data_3RZD
# 
_entry.id   3RZD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RZD         
NDB   NA1115       
RCSB  RCSB065565   
WWPDB D_1000065565 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3S14 . unspecified 
PDB 3S15 . unspecified 
PDB 3S16 . unspecified 
PDB 3S17 . unspecified 
PDB 3RZO . unspecified 
PDB 3S1M . unspecified 
PDB 3S1N . unspecified 
PDB 3S1Q . unspecified 
PDB 3S1R . unspecified 
PDB 3S2D . unspecified 
PDB 3S2H . unspecified 
# 
_pdbx_database_status.entry_id                        3RZD 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-11 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, X.'        1 
'Bushnell, D.A.' 2 
'Silva, D.A.'    3 
'Huang, X.'      4 
'Kornberg, R.D.' 5 
# 
_citation.id                        primary 
_citation.title                     'Initiation complex structure and promoter proofreading.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            333 
_citation.page_first                633 
_citation.page_last                 637 
_citation.year                      2011 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21798951 
_citation.pdbx_database_id_DOI      10.1126/science.1206629 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, X.'        1 
primary 'Bushnell, D.A.' 2 
primary 'Silva, D.A.'    3 
primary 'Huang, X.'      4 
primary 'Kornberg, R.D.' 5 
# 
_cell.entry_id           3RZD 
_cell.length_a           157.538 
_cell.length_b           221.266 
_cell.length_c           192.175 
_cell.angle_alpha        90.000 
_cell.angle_beta         97.440 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RZD 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                                                           
191821.578 1 2.7.7.6 ? ? ?              
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                                                           
138937.297 1 2.7.7.6 ? ? ?              
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                                                           
35330.457  1 ?       ? ? ?              
4  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1'                                            
25117.094  1 ?       ? ? ?              
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2'                                            
17931.834  1 ?       ? ? ?              
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3'                                            
16525.363  1 ?       ? ? ?              
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                                                           
14308.161  1 ?       ? ? ?              
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5'                                            
8290.732   1 ?       ? ? ?              
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'                                                          
13633.493  1 ?       ? ? ?              
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4'                                            
7729.969   1 ?       ? ? ?              
11 polymer     syn 
;RNA (5'-R(*AP*GP*AP*GP*G)-3')
;
1649.072   1 ?       ? ? '5-nt RNA'     
12 polymer     syn 
;DNA (5'-D(*CP*TP*AP*CP*CP*GP*AP*TP*AP*AP*GP*CP*AP*GP*AP*CP*GP*AP*TP*CP*CP*TP*CP*TP*CP*GP*AP*TP*G)-3')
;
8863.724   1 ?       ? ? 'Template DNA' 
13 non-polymer syn 'ZINC ION'                                                                                              65.409 
8 ?       ? ? ?              
14 non-polymer syn 'MAGNESIUM ION'                                                                                         24.305 
1 ?       ? ? ?              
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit 1, RNA polymerase II subunit B1, DNA-directed RNA polymerase III largest subunit, RNA polymerase II subunit B220
;
2  'RNA polymerase II subunit 2, B150, DNA-directed RNA polymerase II 140 kDa polypeptide' 
3  'RNA polymerase II subunit 3, RNA polymerase II subunit B3, B44.5, DNA-directed RNA polymerase II 45 kDa polypeptide' 
4  'RNA polymerases I, II, and III subunit ABC1, ABC27, DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide' 
5  'RNA polymerases I, II, and III subunit ABC2, ABC23, DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide' 
6  
'RNA polymerases I, II, and III subunit ABC3, ABC14.4, ABC14.5, DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide' 
7  
'RNA polymerase II subunit B9, B12.6, DNA-directed RNA polymerase II 14.2 kDa polypeptide, DNA-directed RNA polymerase II subunit 9' 
8  
'RNA polymerases I, II, and III subunit ABC5, ABC10-beta, ABC8, DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide' 
9  'RNA polymerase II subunit B11, B13.6, DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
10 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
5  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
6  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
7  'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
8  'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
9  'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
10 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
11 polyribonucleotide      no no AGAGG AGAGG R ? 
12 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DC)(DC)(DG)(DA)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DA)(DC)(DG)(DA)(DT)(DC)
(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CTACCGATAAGCAGACGATCCTCTCGATG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASP n 
4  3    GLN n 
4  4    GLU n 
4  5    ASN n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ILE n 
4  10   SER n 
4  11   ARG n 
4  12   LEU n 
4  13   TRP n 
4  14   ARG n 
4  15   ALA n 
4  16   PHE n 
4  17   ARG n 
4  18   THR n 
4  19   VAL n 
4  20   LYS n 
4  21   GLU n 
4  22   MET n 
4  23   VAL n 
4  24   LYS n 
4  25   ASP n 
4  26   ARG n 
4  27   GLY n 
4  28   TYR n 
4  29   PHE n 
4  30   ILE n 
4  31   THR n 
4  32   GLN n 
4  33   GLU n 
4  34   GLU n 
4  35   VAL n 
4  36   GLU n 
4  37   LEU n 
4  38   PRO n 
4  39   LEU n 
4  40   GLU n 
4  41   ASP n 
4  42   PHE n 
4  43   LYS n 
4  44   ALA n 
4  45   LYS n 
4  46   TYR n 
4  47   CYS n 
4  48   ASP n 
4  49   SER n 
4  50   MET n 
4  51   GLY n 
4  52   ARG n 
4  53   PRO n 
4  54   GLN n 
4  55   ARG n 
4  56   LYS n 
4  57   MET n 
4  58   MET n 
4  59   SER n 
4  60   PHE n 
4  61   GLN n 
4  62   ALA n 
4  63   ASN n 
4  64   PRO n 
4  65   THR n 
4  66   GLU n 
4  67   GLU n 
4  68   SER n 
4  69   ILE n 
4  70   SER n 
4  71   LYS n 
4  72   PHE n 
4  73   PRO n 
4  74   ASP n 
4  75   MET n 
4  76   GLY n 
4  77   SER n 
4  78   LEU n 
4  79   TRP n 
4  80   VAL n 
4  81   GLU n 
4  82   PHE n 
4  83   CYS n 
4  84   ASP n 
4  85   GLU n 
4  86   PRO n 
4  87   SER n 
4  88   VAL n 
4  89   GLY n 
4  90   VAL n 
4  91   LYS n 
4  92   THR n 
4  93   MET n 
4  94   LYS n 
4  95   THR n 
4  96   PHE n 
4  97   VAL n 
4  98   ILE n 
4  99   HIS n 
4  100  ILE n 
4  101  GLN n 
4  102  GLU n 
4  103  LYS n 
4  104  ASN n 
4  105  PHE n 
4  106  GLN n 
4  107  THR n 
4  108  GLY n 
4  109  ILE n 
4  110  PHE n 
4  111  VAL n 
4  112  TYR n 
4  113  GLN n 
4  114  ASN n 
4  115  ASN n 
4  116  ILE n 
4  117  THR n 
4  118  PRO n 
4  119  SER n 
4  120  ALA n 
4  121  MET n 
4  122  LYS n 
4  123  LEU n 
4  124  VAL n 
4  125  PRO n 
4  126  SER n 
4  127  ILE n 
4  128  PRO n 
4  129  PRO n 
4  130  ALA n 
4  131  THR n 
4  132  ILE n 
4  133  GLU n 
4  134  THR n 
4  135  PHE n 
4  136  ASN n 
4  137  GLU n 
4  138  ALA n 
4  139  ALA n 
4  140  LEU n 
4  141  VAL n 
4  142  VAL n 
4  143  ASN n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  HIS n 
4  148  GLU n 
4  149  LEU n 
4  150  VAL n 
4  151  PRO n 
4  152  LYS n 
4  153  HIS n 
4  154  ILE n 
4  155  ARG n 
4  156  LEU n 
4  157  SER n 
4  158  SER n 
4  159  ASP n 
4  160  GLU n 
4  161  LYS n 
4  162  ARG n 
4  163  GLU n 
4  164  LEU n 
4  165  LEU n 
4  166  LYS n 
4  167  ARG n 
4  168  TYR n 
4  169  ARG n 
4  170  LEU n 
4  171  LYS n 
4  172  GLU n 
4  173  SER n 
4  174  GLN n 
4  175  LEU n 
4  176  PRO n 
4  177  ARG n 
4  178  ILE n 
4  179  GLN n 
4  180  ARG n 
4  181  ALA n 
4  182  ASP n 
4  183  PRO n 
4  184  VAL n 
4  185  ALA n 
4  186  LEU n 
4  187  TYR n 
4  188  LEU n 
4  189  GLY n 
4  190  LEU n 
4  191  LYS n 
4  192  ARG n 
4  193  GLY n 
4  194  GLU n 
4  195  VAL n 
4  196  VAL n 
4  197  LYS n 
4  198  ILE n 
4  199  ILE n 
4  200  ARG n 
4  201  LYS n 
4  202  SER n 
4  203  GLU n 
4  204  THR n 
4  205  SER n 
4  206  GLY n 
4  207  ARG n 
4  208  TYR n 
4  209  ALA n 
4  210  SER n 
4  211  TYR n 
4  212  ARG n 
4  213  ILE n 
4  214  CYS n 
4  215  MET n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    TYR n 
5  5    GLU n 
5  6    GLU n 
5  7    ALA n 
5  8    PHE n 
5  9    ASN n 
5  10   ASP n 
5  11   GLY n 
5  12   ASN n 
5  13   GLU n 
5  14   ASN n 
5  15   PHE n 
5  16   GLU n 
5  17   ASP n 
5  18   PHE n 
5  19   ASP n 
5  20   VAL n 
5  21   GLU n 
5  22   HIS n 
5  23   PHE n 
5  24   SER n 
5  25   ASP n 
5  26   GLU n 
5  27   GLU n 
5  28   THR n 
5  29   TYR n 
5  30   GLU n 
5  31   GLU n 
5  32   LYS n 
5  33   PRO n 
5  34   GLN n 
5  35   PHE n 
5  36   LYS n 
5  37   ASP n 
5  38   GLY n 
5  39   GLU n 
5  40   THR n 
5  41   THR n 
5  42   ASP n 
5  43   ALA n 
5  44   ASN n 
5  45   GLY n 
5  46   LYS n 
5  47   THR n 
5  48   ILE n 
5  49   VAL n 
5  50   THR n 
5  51   GLY n 
5  52   GLY n 
5  53   ASN n 
5  54   GLY n 
5  55   PRO n 
5  56   GLU n 
5  57   ASP n 
5  58   PHE n 
5  59   GLN n 
5  60   GLN n 
5  61   HIS n 
5  62   GLU n 
5  63   GLN n 
5  64   ILE n 
5  65   ARG n 
5  66   ARG n 
5  67   LYS n 
5  68   THR n 
5  69   LEU n 
5  70   LYS n 
5  71   GLU n 
5  72   LYS n 
5  73   ALA n 
5  74   ILE n 
5  75   PRO n 
5  76   LYS n 
5  77   ASP n 
5  78   GLN n 
5  79   ARG n 
5  80   ALA n 
5  81   THR n 
5  82   THR n 
5  83   PRO n 
5  84   TYR n 
5  85   MET n 
5  86   THR n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ARG n 
5  91   ALA n 
5  92   ARG n 
5  93   ILE n 
5  94   LEU n 
5  95   GLY n 
5  96   THR n 
5  97   ARG n 
5  98   ALA n 
5  99   LEU n 
5  100  GLN n 
5  101  ILE n 
5  102  SER n 
5  103  MET n 
5  104  ASN n 
5  105  ALA n 
5  106  PRO n 
5  107  VAL n 
5  108  PHE n 
5  109  VAL n 
5  110  ASP n 
5  111  LEU n 
5  112  GLU n 
5  113  GLY n 
5  114  GLU n 
5  115  THR n 
5  116  ASP n 
5  117  PRO n 
5  118  LEU n 
5  119  ARG n 
5  120  ILE n 
5  121  ALA n 
5  122  MET n 
5  123  LYS n 
5  124  GLU n 
5  125  LEU n 
5  126  ALA n 
5  127  GLU n 
5  128  LYS n 
5  129  LYS n 
5  130  ILE n 
5  131  PRO n 
5  132  LEU n 
5  133  VAL n 
5  134  ILE n 
5  135  ARG n 
5  136  ARG n 
5  137  TYR n 
5  138  LEU n 
5  139  PRO n 
5  140  ASP n 
5  141  GLY n 
5  142  SER n 
5  143  PHE n 
5  144  GLU n 
5  145  ASP n 
5  146  TRP n 
5  147  SER n 
5  148  VAL n 
5  149  GLU n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  VAL n 
5  154  ASP n 
5  155  LEU n 
6  1    MET n 
6  2    SER n 
6  3    ASN n 
6  4    THR n 
6  5    LEU n 
6  6    PHE n 
6  7    ASP n 
6  8    ASP n 
6  9    ILE n 
6  10   PHE n 
6  11   GLN n 
6  12   VAL n 
6  13   SER n 
6  14   GLU n 
6  15   VAL n 
6  16   ASP n 
6  17   PRO n 
6  18   GLY n 
6  19   ARG n 
6  20   TYR n 
6  21   ASN n 
6  22   LYS n 
6  23   VAL n 
6  24   CYS n 
6  25   ARG n 
6  26   ILE n 
6  27   GLU n 
6  28   ALA n 
6  29   ALA n 
6  30   SER n 
6  31   THR n 
6  32   THR n 
6  33   GLN n 
6  34   ASP n 
6  35   GLN n 
6  36   CYS n 
6  37   LYS n 
6  38   LEU n 
6  39   THR n 
6  40   LEU n 
6  41   ASP n 
6  42   ILE n 
6  43   ASN n 
6  44   VAL n 
6  45   GLU n 
6  46   LEU n 
6  47   PHE n 
6  48   PRO n 
6  49   VAL n 
6  50   ALA n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   SER n 
6  55   LEU n 
6  56   THR n 
6  57   VAL n 
6  58   THR n 
6  59   ILE n 
6  60   ALA n 
6  61   SER n 
6  62   SER n 
6  63   LEU n 
6  64   ASN n 
6  65   LEU n 
6  66   GLU n 
6  67   ASP n 
6  68   THR n 
6  69   PRO n 
6  70   ALA n 
6  71   ASN n 
6  72   ASP n 
6  73   SER n 
6  74   SER n 
6  75   ALA n 
6  76   THR n 
6  77   ARG n 
6  78   SER n 
6  79   TRP n 
6  80   ARG n 
6  81   PRO n 
6  82   PRO n 
6  83   GLN n 
6  84   ALA n 
6  85   GLY n 
6  86   ASP n 
6  87   ARG n 
6  88   SER n 
6  89   LEU n 
6  90   ALA n 
6  91   ASP n 
6  92   ASP n 
6  93   TYR n 
6  94   ASP n 
6  95   TYR n 
6  96   VAL n 
6  97   MET n 
6  98   TYR n 
6  99   GLY n 
6  100  THR n 
6  101  ALA n 
6  102  TYR n 
6  103  LYS n 
6  104  PHE n 
6  105  GLU n 
6  106  GLU n 
6  107  VAL n 
6  108  SER n 
6  109  LYS n 
6  110  ASP n 
6  111  LEU n 
6  112  ILE n 
6  113  ALA n 
6  114  VAL n 
6  115  TYR n 
6  116  TYR n 
6  117  SER n 
6  118  PHE n 
6  119  GLY n 
6  120  GLY n 
6  121  LEU n 
6  122  LEU n 
6  123  MET n 
6  124  ARG n 
6  125  LEU n 
6  126  GLU n 
6  127  GLY n 
6  128  ASN n 
6  129  TYR n 
6  130  ARG n 
6  131  ASN n 
6  132  LEU n 
6  133  ASN n 
6  134  ASN n 
6  135  LEU n 
6  136  LYS n 
6  137  GLN n 
6  138  GLU n 
6  139  ASN n 
6  140  ALA n 
6  141  TYR n 
6  142  LEU n 
6  143  LEU n 
6  144  ILE n 
6  145  ARG n 
6  146  ARG n 
7  1    MET n 
7  2    THR n 
7  3    THR n 
7  4    PHE n 
7  5    ARG n 
7  6    PHE n 
7  7    CYS n 
7  8    ARG n 
7  9    ASP n 
7  10   CYS n 
7  11   ASN n 
7  12   ASN n 
7  13   MET n 
7  14   LEU n 
7  15   TYR n 
7  16   PRO n 
7  17   ARG n 
7  18   GLU n 
7  19   ASP n 
7  20   LYS n 
7  21   GLU n 
7  22   ASN n 
7  23   ASN n 
7  24   ARG n 
7  25   LEU n 
7  26   LEU n 
7  27   PHE n 
7  28   GLU n 
7  29   CYS n 
7  30   ARG n 
7  31   THR n 
7  32   CYS n 
7  33   SER n 
7  34   TYR n 
7  35   VAL n 
7  36   GLU n 
7  37   GLU n 
7  38   ALA n 
7  39   GLY n 
7  40   SER n 
7  41   PRO n 
7  42   LEU n 
7  43   VAL n 
7  44   TYR n 
7  45   ARG n 
7  46   HIS n 
7  47   GLU n 
7  48   LEU n 
7  49   ILE n 
7  50   THR n 
7  51   ASN n 
7  52   ILE n 
7  53   GLY n 
7  54   GLU n 
7  55   THR n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   VAL n 
7  60   GLN n 
7  61   ASP n 
7  62   ILE n 
7  63   GLY n 
7  64   SER n 
7  65   ASP n 
7  66   PRO n 
7  67   THR n 
7  68   LEU n 
7  69   PRO n 
7  70   ARG n 
7  71   SER n 
7  72   ASP n 
7  73   ARG n 
7  74   GLU n 
7  75   CYS n 
7  76   PRO n 
7  77   LYS n 
7  78   CYS n 
7  79   HIS n 
7  80   SER n 
7  81   ARG n 
7  82   GLU n 
7  83   ASN n 
7  84   VAL n 
7  85   PHE n 
7  86   PHE n 
7  87   GLN n 
7  88   SER n 
7  89   GLN n 
7  90   GLN n 
7  91   ARG n 
7  92   ARG n 
7  93   LYS n 
7  94   ASP n 
7  95   THR n 
7  96   SER n 
7  97   MET n 
7  98   VAL n 
7  99   LEU n 
7  100  PHE n 
7  101  PHE n 
7  102  VAL n 
7  103  CYS n 
7  104  LEU n 
7  105  SER n 
7  106  CYS n 
7  107  SER n 
7  108  HIS n 
7  109  ILE n 
7  110  PHE n 
7  111  THR n 
7  112  SER n 
7  113  ASP n 
7  114  GLN n 
7  115  LYS n 
7  116  ASN n 
7  117  LYS n 
7  118  ARG n 
7  119  THR n 
7  120  GLN n 
7  121  PHE n 
7  122  SER n 
8  1    MET n 
8  2    ILE n 
8  3    VAL n 
8  4    PRO n 
8  5    VAL n 
8  6    ARG n 
8  7    CYS n 
8  8    PHE n 
8  9    SER n 
8  10   CYS n 
8  11   GLY n 
8  12   LYS n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   ASP n 
8  17   LYS n 
8  18   TRP n 
8  19   GLU n 
8  20   SER n 
8  21   TYR n 
8  22   LEU n 
8  23   ASN n 
8  24   LEU n 
8  25   LEU n 
8  26   GLN n 
8  27   GLU n 
8  28   ASP n 
8  29   GLU n 
8  30   LEU n 
8  31   ASP n 
8  32   GLU n 
8  33   GLY n 
8  34   THR n 
8  35   ALA n 
8  36   LEU n 
8  37   SER n 
8  38   ARG n 
8  39   LEU n 
8  40   GLY n 
8  41   LEU n 
8  42   LYS n 
8  43   ARG n 
8  44   TYR n 
8  45   CYS n 
8  46   CYS n 
8  47   ARG n 
8  48   ARG n 
8  49   MET n 
8  50   ILE n 
8  51   LEU n 
8  52   THR n 
8  53   HIS n 
8  54   VAL n 
8  55   ASP n 
8  56   LEU n 
8  57   ILE n 
8  58   GLU n 
8  59   LYS n 
8  60   PHE n 
8  61   LEU n 
8  62   ARG n 
8  63   TYR n 
8  64   ASN n 
8  65   PRO n 
8  66   LEU n 
8  67   GLU n 
8  68   LYS n 
8  69   ARG n 
8  70   ASP n 
9  1    MET n 
9  2    ASN n 
9  3    ALA n 
9  4    PRO n 
9  5    ASP n 
9  6    ARG n 
9  7    PHE n 
9  8    GLU n 
9  9    LEU n 
9  10   PHE n 
9  11   LEU n 
9  12   LEU n 
9  13   GLY n 
9  14   GLU n 
9  15   GLY n 
9  16   GLU n 
9  17   SER n 
9  18   LYS n 
9  19   LEU n 
9  20   LYS n 
9  21   ILE n 
9  22   ASP n 
9  23   PRO n 
9  24   ASP n 
9  25   THR n 
9  26   LYS n 
9  27   ALA n 
9  28   PRO n 
9  29   ASN n 
9  30   ALA n 
9  31   VAL n 
9  32   VAL n 
9  33   ILE n 
9  34   THR n 
9  35   PHE n 
9  36   GLU n 
9  37   LYS n 
9  38   GLU n 
9  39   ASP n 
9  40   HIS n 
9  41   THR n 
9  42   LEU n 
9  43   GLY n 
9  44   ASN n 
9  45   LEU n 
9  46   ILE n 
9  47   ARG n 
9  48   ALA n 
9  49   GLU n 
9  50   LEU n 
9  51   LEU n 
9  52   ASN n 
9  53   ASP n 
9  54   ARG n 
9  55   LYS n 
9  56   VAL n 
9  57   LEU n 
9  58   PHE n 
9  59   ALA n 
9  60   ALA n 
9  61   TYR n 
9  62   LYS n 
9  63   VAL n 
9  64   GLU n 
9  65   HIS n 
9  66   PRO n 
9  67   PHE n 
9  68   PHE n 
9  69   ALA n 
9  70   ARG n 
9  71   PHE n 
9  72   LYS n 
9  73   LEU n 
9  74   ARG n 
9  75   ILE n 
9  76   GLN n 
9  77   THR n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TYR n 
9  82   ASP n 
9  83   PRO n 
9  84   LYS n 
9  85   ASP n 
9  86   ALA n 
9  87   LEU n 
9  88   LYS n 
9  89   ASN n 
9  90   ALA n 
9  91   CYS n 
9  92   ASN n 
9  93   SER n 
9  94   ILE n 
9  95   ILE n 
9  96   ASN n 
9  97   LYS n 
9  98   LEU n 
9  99   GLY n 
9  100  ALA n 
9  101  LEU n 
9  102  LYS n 
9  103  THR n 
9  104  ASN n 
9  105  PHE n 
9  106  GLU n 
9  107  THR n 
9  108  GLU n 
9  109  TRP n 
9  110  ASN n 
9  111  LEU n 
9  112  GLN n 
9  113  THR n 
9  114  LEU n 
9  115  ALA n 
9  116  ALA n 
9  117  ASP n 
9  118  ASP n 
9  119  ALA n 
9  120  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ARG n 
10 4    GLU n 
10 5    GLY n 
10 6    PHE n 
10 7    GLN n 
10 8    ILE n 
10 9    PRO n 
10 10   THR n 
10 11   ASN n 
10 12   LEU n 
10 13   ASP n 
10 14   ALA n 
10 15   ALA n 
10 16   ALA n 
10 17   ALA n 
10 18   GLY n 
10 19   THR n 
10 20   SER n 
10 21   GLN n 
10 22   ALA n 
10 23   ARG n 
10 24   THR n 
10 25   ALA n 
10 26   THR n 
10 27   LEU n 
10 28   LYS n 
10 29   TYR n 
10 30   ILE n 
10 31   CYS n 
10 32   ALA n 
10 33   GLU n 
10 34   CYS n 
10 35   SER n 
10 36   SER n 
10 37   LYS n 
10 38   LEU n 
10 39   SER n 
10 40   LEU n 
10 41   SER n 
10 42   ARG n 
10 43   THR n 
10 44   ASP n 
10 45   ALA n 
10 46   VAL n 
10 47   ARG n 
10 48   CYS n 
10 49   LYS n 
10 50   ASP n 
10 51   CYS n 
10 52   GLY n 
10 53   HIS n 
10 54   ARG n 
10 55   ILE n 
10 56   LEU n 
10 57   LEU n 
10 58   LYS n 
10 59   ALA n 
10 60   ARG n 
10 61   THR n 
10 62   LYS n 
10 63   ARG n 
10 64   LEU n 
10 65   VAL n 
10 66   GLN n 
10 67   PHE n 
10 68   GLU n 
10 69   ALA n 
10 70   ARG n 
11 1    A   n 
11 2    G   n 
11 3    A   n 
11 4    G   n 
11 5    G   n 
12 1    DC  n 
12 2    DT  n 
12 3    DA  n 
12 4    DC  n 
12 5    DC  n 
12 6    DG  n 
12 7    DA  n 
12 8    DT  n 
12 9    DA  n 
12 10   DA  n 
12 11   DG  n 
12 12   DC  n 
12 13   DA  n 
12 14   DG  n 
12 15   DA  n 
12 16   DC  n 
12 17   DG  n 
12 18   DA  n 
12 19   DT  n 
12 20   DC  n 
12 21   DC  n 
12 22   DT  n 
12 23   DC  n 
12 24   DT  n 
12 25   DC  n 
12 26   DG  n 
12 27   DA  n 
12 28   DT  n 
12 29   DG  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 ? 
2  UNP RPB2_YEAST  P08518 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 ? 
3  UNP RPB3_YEAST  P16370 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 ? 
4  UNP RPAB1_YEAST P20434 4  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 ? 
5  UNP RPAB2_YEAST P20435 5  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 ? 
6  UNP RPAB3_YEAST P20436 6  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 ? 
7  UNP RPB9_YEAST  P27999 7  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 ? 
8  UNP RPAB5_YEAST P22139 8  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 ? 
9  UNP RPB11_YEAST P38902 9  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 ? 
10 UNP RPAB4_YEAST P40422 10 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 ? 
11 PDB 3RZD        3RZD   11 AGAGG ? ? 
12 PDB 3RZD        3RZD   12 CTACCGATAAGCAGACGATCCTCTCGATG ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3RZD A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  3RZD B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  3RZD C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  3RZD E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  3RZD F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  3RZD H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  3RZD I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  3RZD J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  3RZD K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 3RZD L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 3RZD R 1 ? 5    ? 3RZD   6 ? 10   ? 6 10   
12 12 3RZD T 1 ? 29   ? 3RZD   1 ? 29   ? 1 29   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3RZD 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.46 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   64.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'390mM (NH4)2HPO4/NaH2PO4, pH 6.0, 50mM dioxane, 9-11% PEG 6,000, 15mM DTT, vapor diffusion, temperature 293K, VAPOR DIFFUSION' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   2010-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double crystal cryo-cooled' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
# 
_reflns.entry_id                     3RZD 
_reflns.d_resolution_high            3.300 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   97374 
_reflns.pdbx_Rmerge_I_obs            0.173 
_reflns.pdbx_netI_over_sigmaI        5.300 
_reflns.pdbx_chi_squared             1.121 
_reflns.pdbx_redundancy              3.800 
_reflns.percent_possible_obs         99.400 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.300 3.360  ? ? ? 0.769 ? ? 1.071 3.800 ? 4848 99.200 1  1 
3.360 3.420  ? ? ? 0.668 ? ? 1.095 3.800 ? 4824 99.300 2  1 
3.420 3.480  ? ? ? 0.595 ? ? 1.088 3.800 ? 4918 99.400 3  1 
3.480 3.550  ? ? ? 0.521 ? ? 1.130 3.800 ? 4810 99.300 4  1 
3.550 3.630  ? ? ? 0.486 ? ? 1.134 3.900 ? 4852 99.300 5  1 
3.630 3.720  ? ? ? 0.389 ? ? 1.175 3.900 ? 4832 99.300 6  1 
3.720 3.810  ? ? ? 0.344 ? ? 1.165 3.900 ? 4869 99.300 7  1 
3.810 3.910  ? ? ? 0.302 ? ? 1.132 3.900 ? 4862 99.400 8  1 
3.910 4.030  ? ? ? 0.251 ? ? 1.109 3.900 ? 4847 99.400 9  1 
4.030 4.160  ? ? ? 0.210 ? ? 1.106 3.900 ? 4878 99.400 10 1 
4.160 4.310  ? ? ? 0.176 ? ? 1.140 3.900 ? 4852 99.500 11 1 
4.310 4.480  ? ? ? 0.152 ? ? 1.156 3.900 ? 4873 99.500 12 1 
4.480 4.680  ? ? ? 0.142 ? ? 1.170 3.800 ? 4887 99.400 13 1 
4.680 4.930  ? ? ? 0.132 ? ? 1.170 3.900 ? 4868 99.400 14 1 
4.930 5.240  ? ? ? 0.131 ? ? 1.159 3.900 ? 4876 99.400 15 1 
5.240 5.640  ? ? ? 0.133 ? ? 1.137 3.900 ? 4888 99.500 16 1 
5.640 6.210  ? ? ? 0.122 ? ? 1.085 3.900 ? 4870 99.500 17 1 
6.210 7.100  ? ? ? 0.105 ? ? 1.132 3.800 ? 4899 99.400 18 1 
7.100 8.940  ? ? ? 0.070 ? ? 1.059 3.800 ? 4892 99.400 19 1 
8.940 50.000 ? ? ? 0.060 ? ? 0.998 3.700 ? 4929 98.700 20 1 
# 
_refine.entry_id                                 3RZD 
_refine.ls_d_res_high                            3.300 
_refine.ls_d_res_low                             45.1400 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_number_reflns_obs                     97341 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1897 
_refine.ls_R_factor_R_work                       0.1875 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2304 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.9800 
_refine.ls_number_reflns_R_free                  4848 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               95.0929 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -34.9796 
_refine.aniso_B[2][2]                            11.1185 
_refine.aniso_B[3][3]                            23.8612 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            20.7697 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8892 
_refine.correlation_coeff_Fo_to_Fc_free          0.8489 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                274.580 
_refine.B_iso_min                                32.880 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3RZD 
_refine_analyze.Luzzati_coordinate_error_obs    0.674 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28292 
_refine_hist.pdbx_number_atoms_nucleic_acid   269 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28570 
_refine_hist.d_res_high                       3.300 
_refine_hist.d_res_low                        45.1400 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        10524 ?      ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           767   ?      ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              4130  ?      ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      29113 ?      ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     1     ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 3840  ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        32    ?      ? 1.000  HARMONIC     'X-RAY DIFFRACTION' 
t_utility_angle           45    ?      ? 1.000  HARMONIC     'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      33238 ?      ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  29113 0.008  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               39367 1.140  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?     2.260  ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?     22.910 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       3.2900 
_refine_ls_shell.d_res_low                        3.3800 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.number_reflns_R_work             6153 
_refine_ls_shell.R_factor_all                     0.2361 
_refine_ls_shell.R_factor_R_work                  0.2342 
_refine_ls_shell.R_factor_R_free                  0.2668 
_refine_ls_shell.percent_reflns_R_free            5.4800 
_refine_ls_shell.number_reflns_R_free             357 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6510 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RZD 
_struct.title                     'RNA Polymerase II Initiation Complex with a 5-nt RNA' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase II subunit RPB1 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB2 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/RNA/DNA
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RZD 
_struct_keywords.text            'RNA polymerase II, initiation complex, TRANSCRIPTION-RNA-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/RNA/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 13 ? 
O N N 14 ? 
P N N 13 ? 
Q N N 13 ? 
R N N 13 ? 
S N N 13 ? 
T N N 13 ? 
U N N 13 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'biological unit is the same as asym.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? CYS A 103  ? PHE A 95   CYS A 103  1 ? 9  
HELX_P HELX_P3   3   ASN A 119  ? ALA A 127  ? ASN A 119  ALA A 127  1 ? 9  
HELX_P HELX_P4   4   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   5   SER A 203  ? LYS A 212  ? SER A 203  LYS A 212  1 ? 10 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? MET A 234  ? ARG A 230  MET A 234  5 ? 5  
HELX_P HELX_P8   8   ASP A 260  ? THR A 278  ? ASP A 260  THR A 278  1 ? 19 
HELX_P HELX_P9   9   PRO A 285  ? ALA A 288  ? PRO A 285  ALA A 288  5 ? 4  
HELX_P HELX_P10  10  ILE A 289  ? ALA A 301  ? ILE A 289  ALA A 301  1 ? 13 
HELX_P HELX_P11  11  LYS A 323  ? LYS A 330  ? LYS A 323  LYS A 330  1 ? 8  
HELX_P HELX_P12  12  ARG A 335  ? LEU A 340  ? ARG A 335  LEU A 340  1 ? 6  
HELX_P HELX_P13  13  LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P14  14  ASN A 384  ? ARG A 393  ? ASN A 384  ARG A 393  1 ? 10 
HELX_P HELX_P15  15  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P16  16  SER A 494  ? LEU A 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P17  17  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P18  18  VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P19  19  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P20  20  GLY A 574  ? VAL A 580  ? GLY A 574  VAL A 580  1 ? 7  
HELX_P HELX_P21  21  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P22  22  GLY A 628  ? LYS A 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P23  23  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P24  24  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P25  25  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P26  26  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P27  27  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P28  28  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P29  29  SER A 793  ? LYS A 797  ? SER A 793  LYS A 797  5 ? 5  
HELX_P HELX_P30  30  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P31  31  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P32  32  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P33  33  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P34  34  ASP A 909  ? LEU A 913  ? ASP A 909  LEU A 913  5 ? 5  
HELX_P HELX_P35  35  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P36  36  ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P37  37  THR A 982  ? ASN A 996  ? THR A 982  ASN A 996  1 ? 15 
HELX_P HELX_P38  38  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P39  39  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P40  40  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P41  41  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P42  42  SER A 1096 ? VAL A 1107 ? SER A 1096 VAL A 1107 1 ? 12 
HELX_P HELX_P43  43  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  44  ASP A 1166 ? LEU A 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P45  45  ASP A 1198 ? ASP A 1206 ? ASP A 1198 ASP A 1206 1 ? 9  
HELX_P HELX_P46  46  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P47  47  ASP A 1257 ? ASN A 1270 ? ASP A 1257 ASN A 1270 1 ? 14 
HELX_P HELX_P48  48  ASN A 1312 ? VAL A 1319 ? ASN A 1312 VAL A 1319 1 ? 8  
HELX_P HELX_P49  49  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P50  50  GLY A 1340 ? GLY A 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P51  51  ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P52  52  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P53  53  GLU A 1404 ? ALA A 1416 ? GLU A 1404 ALA A 1416 1 ? 13 
HELX_P HELX_P54  54  GLY A 1423 ? LEU A 1430 ? GLY A 1423 LEU A 1430 1 ? 8  
HELX_P HELX_P55  55  ILE A 1436 ? GLY A 1439 ? ILE A 1436 GLY A 1439 5 ? 4  
HELX_P HELX_P56  56  ASP B 29   ? GLU B 40   ? ASP B 29   GLU B 40   1 ? 12 
HELX_P HELX_P57  57  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P58  58  TYR B 57   ? CYS B 64   ? TYR B 57   CYS B 64   1 ? 8  
HELX_P HELX_P59  59  TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P60  60  CYS B 179  ? GLU B 183  ? CYS B 179  GLU B 183  5 ? 5  
HELX_P HELX_P61  61  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P62  62  ILE B 282  ? ALA B 288  ? ILE B 282  ALA B 288  1 ? 7  
HELX_P HELX_P63  63  PRO B 293  ? CYS B 302  ? PRO B 293  CYS B 302  1 ? 10 
HELX_P HELX_P64  64  ASP B 307  ? GLY B 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P65  65  ASP B 326  ? ILE B 334  ? ASP B 326  ILE B 334  1 ? 9  
HELX_P HELX_P66  66  GLU B 346  ? GLU B 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P67  67  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P68  68  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P69  69  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P70  70  ALA B 450  ? THR B 463  ? ALA B 450  THR B 463  1 ? 14 
HELX_P HELX_P71  71  MET B 473  ? GLY B 478  ? MET B 473  GLY B 478  5 ? 6  
HELX_P HELX_P72  72  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P73  73  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P74  74  PRO B 551  ? TRP B 561  ? PRO B 551  TRP B 561  1 ? 11 
HELX_P HELX_P75  75  GLU B 567  ? TYR B 569  ? GLU B 567  TYR B 569  5 ? 3  
HELX_P HELX_P76  76  VAL B 570  ? SER B 574  ? VAL B 570  SER B 574  5 ? 5  
HELX_P HELX_P77  77  ASN B 592  ? LYS B 606  ? ASN B 592  LYS B 606  1 ? 15 
HELX_P HELX_P78  78  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P79  79  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P80  80  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P81  81  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P82  82  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P83  83  PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P84  84  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P85  85  ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P86  86  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P87  87  PRO B 1014 ? ILE B 1017 ? PRO B 1014 ILE B 1017 5 ? 4  
HELX_P HELX_P88  88  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P89  89  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P90  90  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P91  91  GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P92  92  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P93  93  ALA B 1143 ? LEU B 1151 ? ALA B 1143 LEU B 1151 1 ? 9  
HELX_P HELX_P94  94  TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P95  95  ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P96  96  ALA C 59   ? LEU C 69   ? ALA C 59   LEU C 69   1 ? 11 
HELX_P HELX_P97  97  ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P98  98  LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P99  99  HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P100 100 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P101 101 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P102 102 PRO C 239  ? ASP C 268  ? PRO C 239  ASP C 268  1 ? 30 
HELX_P HELX_P103 103 GLU D 4    ? GLY D 27   ? GLU E 4    GLY E 27   1 ? 24 
HELX_P HELX_P104 104 THR D 31   ? GLU D 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P105 105 PRO D 38   ? CYS D 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P106 106 THR D 65   ? SER D 70   ? THR E 65   SER E 70   1 ? 6  
HELX_P HELX_P107 107 GLY D 89   ? LYS D 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P108 108 THR D 117  ? LYS D 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P109 109 GLU D 137  ? VAL D 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P110 110 ASN D 143  ? HIS D 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P111 111 SER D 157  ? TYR D 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P112 112 LYS D 171  ? LEU D 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P113 113 ASP D 182  ? GLY D 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P114 114 THR E 86   ? MET E 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P115 115 ASP E 116  ? GLU E 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P116 116 ASP G 61   ? ASP G 65   ? ASP I 61   ASP I 65   5 ? 5  
HELX_P HELX_P117 117 LYS H 17   ? GLU H 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P118 118 ASP H 31   ? LEU H 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P119 119 ARG H 43   ? THR H 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P120 120 LEU H 56   ? LEU H 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P121 121 ASP I 5    ? PHE I 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P122 122 ASP I 39   ? ASP I 53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P123 123 ASP I 82   ? ASN I 110  ? ASP K 82   ASN K 110  1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? K G   5    "O3'" ? ? ? 1_555 O MG .  MG ? ? R G   10   A MG 2001 1_555 ? ? ? ? ? ? ?              1.935 ? 
metalc2  metalc ? ? A ASP 481  OD1   ? ? ? 1_555 O MG .  MG ? ? A ASP 481  A MG 2001 1_555 ? ? ? ? ? ? ?              2.169 ? 
metalc3  metalc ? ? A HIS 80   NE2   ? ? ? 1_555 N ZN .  ZN ? ? A HIS 80   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.217 ? 
metalc4  metalc ? ? C CYS 92   SG    ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 92   C ZN 319  1_555 ? ? ? ? ? ? ?              2.255 ? 
metalc5  metalc ? ? G CYS 78   SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 78   I ZN 204  1_555 ? ? ? ? ? ? ?              2.265 ? 
metalc6  metalc ? ? G CYS 106  SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 106  I ZN 204  1_555 ? ? ? ? ? ? ?              2.286 ? 
metalc7  metalc ? ? J CYS 51   SG    ? ? ? 1_555 U ZN .  ZN ? ? L CYS 51   L ZN 105  1_555 ? ? ? ? ? ? ?              2.297 ? 
metalc8  metalc ? ? J CYS 34   SG    ? ? ? 1_555 U ZN .  ZN ? ? L CYS 34   L ZN 105  1_555 ? ? ? ? ? ? ?              2.303 ? 
metalc9  metalc ? ? H CYS 10   SG    ? ? ? 1_555 T ZN .  ZN ? ? J CYS 10   J ZN 101  1_555 ? ? ? ? ? ? ?              2.311 ? 
metalc10 metalc ? ? G CYS 32   SG    ? ? ? 1_555 R ZN .  ZN ? ? I CYS 32   I ZN 203  1_555 ? ? ? ? ? ? ?              2.324 ? 
metalc11 metalc ? ? A CYS 107  SG    ? ? ? 1_555 M ZN .  ZN ? ? A CYS 107  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.326 ? 
metalc12 metalc ? ? G CYS 7    SG    ? ? ? 1_555 R ZN .  ZN ? ? I CYS 7    I ZN 203  1_555 ? ? ? ? ? ? ?              2.327 ? 
metalc13 metalc ? ? G CYS 10   SG    ? ? ? 1_555 R ZN .  ZN ? ? I CYS 10   I ZN 203  1_555 ? ? ? ? ? ? ?              2.334 ? 
metalc14 metalc ? ? J CYS 48   SG    ? ? ? 1_555 U ZN .  ZN ? ? L CYS 48   L ZN 105  1_555 ? ? ? ? ? ? ?              2.337 ? 
metalc15 metalc ? ? B CYS 1185 SG    ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1185 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.338 ? 
metalc16 metalc ? ? B CYS 1166 SG    ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1166 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.345 ? 
metalc17 metalc ? ? B CYS 1163 SG    ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1163 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.347 ? 
metalc18 metalc ? ? H CYS 7    SG    ? ? ? 1_555 T ZN .  ZN ? ? J CYS 7    J ZN 101  1_555 ? ? ? ? ? ? ?              2.349 ? 
metalc19 metalc ? ? C CYS 95   SG    ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 95   C ZN 319  1_555 ? ? ? ? ? ? ?              2.349 ? 
metalc20 metalc ? ? G CYS 75   SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 75   I ZN 204  1_555 ? ? ? ? ? ? ?              2.352 ? 
metalc21 metalc ? ? J CYS 31   SG    ? ? ? 1_555 U ZN .  ZN ? ? L CYS 31   L ZN 105  1_555 ? ? ? ? ? ? ?              2.353 ? 
metalc22 metalc ? ? C CYS 86   SG    ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 86   C ZN 319  1_555 ? ? ? ? ? ? ?              2.354 ? 
metalc23 metalc ? ? H CYS 45   SG    ? ? ? 1_555 T ZN .  ZN ? ? J CYS 45   J ZN 101  1_555 ? ? ? ? ? ? ?              2.354 ? 
metalc24 metalc ? ? G CYS 29   SG    ? ? ? 1_555 R ZN .  ZN ? ? I CYS 29   I ZN 203  1_555 ? ? ? ? ? ? ?              2.355 ? 
metalc25 metalc ? ? A CYS 167  SG    ? ? ? 1_555 M ZN .  ZN ? ? A CYS 167  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.369 ? 
metalc26 metalc ? ? A CYS 110  SG    ? ? ? 1_555 M ZN .  ZN ? ? A CYS 110  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.373 ? 
metalc27 metalc ? ? A CYS 77   SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 77   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.374 ? 
metalc28 metalc ? ? G CYS 103  SG    ? ? ? 1_555 S ZN .  ZN ? ? I CYS 103  I ZN 204  1_555 ? ? ? ? ? ? ?              2.380 ? 
metalc29 metalc ? ? H CYS 46   SG    ? ? ? 1_555 T ZN .  ZN ? ? J CYS 46   J ZN 101  1_555 ? ? ? ? ? ? ?              2.385 ? 
metalc30 metalc ? ? A CYS 148  SG    ? ? ? 1_555 M ZN .  ZN ? ? A CYS 148  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.386 ? 
metalc31 metalc ? ? C CYS 88   SG    ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 88   C ZN 319  1_555 ? ? ? ? ? ? ?              2.408 ? 
metalc32 metalc ? ? A CYS 67   SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 67   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.412 ? 
metalc33 metalc ? ? A CYS 70   SG    ? ? ? 1_555 N ZN .  ZN ? ? A CYS 70   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.435 ? 
metalc34 metalc ? ? B CYS 1182 SG    ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1182 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.446 ? 
metalc35 metalc ? ? A ASP 483  OD2   ? ? ? 1_555 O MG .  MG ? ? A ASP 483  A MG 2001 1_555 ? ? ? ? ? ? ?              2.499 ? 
metalc36 metalc ? ? A ASP 485  OD1   ? ? ? 1_555 O MG .  MG ? ? A ASP 485  A MG 2001 1_555 ? ? ? ? ? ? ?              2.574 ? 
hydrog1  hydrog ? ? K G   2    N1    ? ? ? 1_555 L DT 22 O4 ? ? R G   7    T DT 22   1_555 ? ? ? ? ? ? 'G-DT MISPAIR' ?     ? 
hydrog2  hydrog ? ? K G   2    N1    ? ? ? 1_555 L DC 23 N3 ? ? R G   7    T DC 23   1_555 ? ? ? ? ? ? 'G-DC PAIR'    ?     ? 
hydrog3  hydrog ? ? K G   4    N1    ? ? ? 1_555 L DC 20 N3 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog4  hydrog ? ? K G   4    N2    ? ? ? 1_555 L DC 20 O2 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog5  hydrog ? ? K G   4    O6    ? ? ? 1_555 L DC 20 N4 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog6  hydrog ? ? K G   5    N2    ? ? ? 1_555 L DT 19 O2 ? ? R G   10   T DT 19   1_555 ? ? ? ? ? ? 'G-DT MISPAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 116  A . ? ASP 116  A GLU 117  A ? GLU 117  A 1 1.68  
2  ARG 320  A . ? ARG 320  A PRO 321  A ? PRO 321  A 1 0.08  
3  GLN 447  A . ? GLN 447  A PRO 448  A ? PRO 448  A 1 0.11  
4  GLY 1123 A . ? GLY 1123 A HIS 1124 A ? HIS 1124 A 1 3.54  
5  ILE 140  B . ? ILE 140  B ASP 141  B ? ASP 141  B 1 0.35  
6  LYS 345  B . ? LYS 345  B GLU 346  B ? GLU 346  B 1 -0.33 
7  GLY 647  B . ? GLY 647  B HIS 648  B ? HIS 648  B 1 24.06 
8  HIS 887  B . ? HIS 887  B GLY 888  B ? GLY 888  B 1 -3.28 
9  PRO 128  D . ? PRO 128  E PRO 129  D ? PRO 129  E 1 0.65  
10 GLU 71   E . ? GLU 71   F LYS 72   E ? LYS 72   F 1 0.35  
11 SER 2    F . ? SER 2    H ASN 3    F ? ASN 3    H 1 0.74  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 8 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 3 ? 
J  ? 3 ? 
K  ? 2 ? 
L  ? 2 ? 
M  ? 3 ? 
N  ? 2 ? 
O  ? 4 ? 
P  ? 2 ? 
Q  ? 5 ? 
R  ? 2 ? 
S  ? 3 ? 
T  ? 3 ? 
U  ? 2 ? 
V  ? 2 ? 
W  ? 4 ? 
X  ? 5 ? 
Y  ? 3 ? 
Z  ? 4 ? 
AA ? 5 ? 
AB ? 5 ? 
AC ? 7 ? 
AD ? 2 ? 
AE ? 9 ? 
AF ? 3 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 4 ? 
AJ ? 5 ? 
AK ? 2 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 9 ? 
AO ? 9 ? 
AP ? 3 ? 
AQ ? 3 ? 
AR ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? parallel      
F  6 7 ? anti-parallel 
F  7 8 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? parallel      
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AC 6 7 ? anti-parallel 
AD 1 2 ? parallel      
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? parallel      
AE 6 7 ? anti-parallel 
AE 7 8 ? parallel      
AE 8 9 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? parallel      
AL 3 4 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AN 5 6 ? anti-parallel 
AN 6 7 ? anti-parallel 
AN 7 8 ? anti-parallel 
AN 8 9 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AO 6 7 ? anti-parallel 
AO 7 8 ? anti-parallel 
AO 8 9 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
A  2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
A  3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
B  1 GLY A 82   ? VAL A 90   ? GLY A 82   VAL A 90   
B  2 LEU A 236  ? VAL A 241  ? LEU A 236  VAL A 241  
C  1 ASP A 151  ? VAL A 152  ? ASP A 151  VAL A 152  
C  2 VAL A 162  ? SER A 163  ? VAL A 162  SER A 163  
D  1 THR A 173  ? ASP A 177  ? THR A 173  ASP A 177  
D  2 LYS A 180  ? SER A 184  ? LYS A 180  SER A 184  
E  1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
E  2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
F  1 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
F  2 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
F  3 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
F  4 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
F  5 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
F  6 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
F  7 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
F  8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
G  1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
G  2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
G  3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
G  4 ARG A 412  ? ILE A 413  ? ARG A 412  ILE A 413  
H  1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
H  2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
I  1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
I  2 PRO A 570  ? SER A 573  ? PRO A 570  SER A 573  
I  3 ILE A 565  ? ILE A 566  ? ILE A 565  ILE A 566  
J  1 LEU A 588  ? GLN A 589  ? LEU A 588  GLN A 589  
J  2 LEU A 606  ? ILE A 607  ? LEU A 606  ILE A 607  
J  3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
K  1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
K  2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
L  1 SER A 769  ? VAL A 770  ? SER A 769  VAL A 770  
L  2 LYS A 773  ? ARG A 774  ? LYS A 773  ARG A 774  
M  1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
M  2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
M  3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
N  1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
N  2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
O  1 ARG A 1281 ? TYR A 1287 ? ARG A 1281 TYR A 1287 
O  2 GLU A 1303 ? ASP A 1309 ? GLU A 1303 ASP A 1309 
O  3 SER A 1115 ? TYR A 1119 ? SER A 1115 TYR A 1119 
O  4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
P  1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
P  2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
Q  1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
Q  2 LEU A 1236 ? VAL A 1242 ? LEU A 1236 VAL A 1242 
Q  3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
Q  4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
Q  5 LEU G 42   ? ARG G 45   ? LEU I 42   ARG I 45   
R  1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
R  2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
S  1 PHE A 1441 ? MET A 1444 ? PHE A 1441 MET A 1444 
S  2 VAL E 133  ? TYR E 137  ? VAL F 133  TYR F 137  
S  3 PHE E 143  ? SER E 147  ? PHE F 143  SER F 147  
T  1 ILE B 90   ? VAL B 97   ? ILE B 90   VAL B 97   
T  2 SER B 125  ? LYS B 134  ? SER B 125  LYS B 134  
T  3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
U  1 MET B 101  ? VAL B 102  ? MET B 101  VAL B 102  
U  2 HIS B 110  ? ALA B 111  ? HIS B 110  ALA B 111  
V  1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
V  2 SER B 208  ? LYS B 210  ? SER B 208  LYS B 210  
W  1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
W  2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
W  3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
W  4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
X  1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
X  2 ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
X  3 SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
X  4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
X  5 ASP B 279  ? PRO B 281  ? ASP B 279  PRO B 281  
Y  1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
Y  2 VAL B 633  ? ASP B 642  ? VAL B 633  ASP B 642  
Y  3 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
Z  1 LYS B 649  ? LEU B 651  ? LYS B 649  LEU B 651  
Z  2 VAL B 633  ? ASP B 642  ? VAL B 633  ASP B 642  
Z  3 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
Z  4 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
AA 1 GLU B 564  ? PRO B 565  ? GLU B 564  PRO B 565  
AA 2 VAL B 585  ? HIS B 590  ? VAL B 585  HIS B 590  
AA 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
AA 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
AA 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
AB 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
AB 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AB 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
AB 4 ASN B 946  ? THR B 956  ? ASN B 946  THR B 956  
AB 5 ARG B 904  ? SER B 906  ? ARG B 904  SER B 906  
AC 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
AC 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AC 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
AC 4 ASN B 946  ? THR B 956  ? ASN B 946  THR B 956  
AC 5 LEU J 56   ? LEU J 57   ? LEU L 56   LEU L 57   
AC 6 TYR J 29   ? CYS J 31   ? TYR L 29   CYS L 31   
AC 7 LYS J 37   ? LEU J 38   ? LYS L 37   LEU L 38   
AD 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
AD 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
AE 1 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
AE 2 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
AE 3 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
AE 4 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
AE 5 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
AE 6 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
AE 7 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
AE 8 GLN B 821  ? ILE B 827  ? GLN B 821  ILE B 827  
AE 9 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
AF 1 THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
AF 2 LYS B 914  ? PRO B 917  ? LYS B 914  PRO B 917  
AF 3 LYS B 934  ? ASP B 936  ? LYS B 934  ASP B 936  
AG 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
AG 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
AH 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
AH 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
AI 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
AI 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
AI 3 PHE C 228  ? GLU C 233  ? PHE C 228  GLU C 233  
AI 4 ILE C 176  ? TYR C 180  ? ILE C 176  TYR C 180  
AJ 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AJ 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
AJ 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
AJ 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
AJ 5 GLN J 66   ? PHE J 67   ? GLN L 66   PHE L 67   
AK 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
AK 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
AL 1 PHE D 60   ? ALA D 62   ? PHE E 60   ALA E 62   
AL 2 SER D 77   ? PHE D 82   ? SER E 77   PHE E 82   
AL 3 PHE D 105  ? TYR D 112  ? PHE E 105  TYR E 112  
AL 4 THR D 131  ? ASN D 136  ? THR E 131  ASN E 136  
AM 1 LYS D 152  ? ARG D 155  ? LYS E 152  ARG E 155  
AM 2 VAL D 195  ? SER D 202  ? VAL E 195  SER E 202  
AM 3 GLY D 206  ? CYS D 214  ? GLY E 206  CYS E 214  
AM 4 ARG D 177  ? ILE D 178  ? ARG E 177  ILE E 178  
AN 1 TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
AN 2 TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
AN 3 SER F 54   ? ALA F 60   ? SER H 54   ALA H 60   
AN 4 THR F 4    ? ASP F 16   ? THR H 4    ASP H 16   
AN 5 VAL F 23   ? SER F 30   ? VAL H 23   SER H 30   
AN 6 LYS F 37   ? ASN F 43   ? LYS H 37   ASN H 43   
AN 7 LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
AN 8 LEU F 111  ? PHE F 118  ? LEU H 111  PHE H 118  
AN 9 THR F 100  ? LYS F 103  ? THR H 100  LYS H 103  
AO 1 TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
AO 2 TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
AO 3 SER F 54   ? ALA F 60   ? SER H 54   ALA H 60   
AO 4 THR F 4    ? ASP F 16   ? THR H 4    ASP H 16   
AO 5 VAL F 23   ? SER F 30   ? VAL H 23   SER H 30   
AO 6 LYS F 37   ? ASN F 43   ? LYS H 37   ASN H 43   
AO 7 LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
AO 8 LEU F 111  ? PHE F 118  ? LEU H 111  PHE H 118  
AO 9 GLU F 106  ? SER F 108  ? GLU H 106  SER H 108  
AP 1 TYR G 15   ? GLU G 18   ? TYR I 15   GLU I 18   
AP 2 LEU G 25   ? GLU G 28   ? LEU I 25   GLU I 28   
AP 3 VAL G 35   ? GLU G 37   ? VAL I 35   GLU I 37   
AQ 1 ASN G 83   ? GLN G 87   ? ASN I 83   GLN I 87   
AQ 2 LEU G 99   ? CYS G 103  ? LEU I 99   CYS I 103  
AQ 3 ILE G 109  ? THR G 111  ? ILE I 109  THR I 111  
AR 1 ILE I 21   ? PRO I 23   ? ILE K 21   PRO K 23   
AR 2 ALA I 30   ? GLU I 36   ? ALA K 30   GLU K 36   
AR 3 ARG I 70   ? THR I 77   ? ARG K 70   THR K 77   
AR 4 VAL I 56   ? LYS I 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A 1419 ? O ASP A 1419 N VAL A 17   ? N VAL A 17   
A  2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
B  1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
C  1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
D  1 2 N ASP A 177  ? N ASP A 177  O LYS A 180  ? O LYS A 180  
E  1 2 N LYS A 343  ? N LYS A 343  O PHE B 1130 ? O PHE B 1130 
F  1 2 O ARG B 1106 ? O ARG B 1106 N SER A 348  ? N SER A 348  
F  2 3 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
F  3 4 O ASN A 488  ? O ASN A 488  N ASN A 445  ? N ASN A 445  
F  4 5 N VAL A 442  ? N VAL A 442  O HIS A 458  ? O HIS A 458  
F  5 6 O LYS A 461  ? O LYS A 461  N VAL A 366  ? N VAL A 366  
F  6 7 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
F  7 8 O PHE A 468  ? O PHE A 468  N SER A 354  ? N SER A 354  
G  1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
G  2 3 O LYS A 431  ? O LYS A 431  N ILE A 406  ? N ILE A 406  
G  3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
H  1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
I  1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
I  2 3 O LEU A 571  ? O LEU A 571  N ILE A 565  ? N ILE A 565  
J  1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
J  2 3 N LEU A 606  ? N LEU A 606  O ILE A 613  ? O ILE A 613  
K  1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
L  1 2 N VAL A 770  ? N VAL A 770  O LYS A 773  ? O LYS A 773  
M  1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
M  2 3 N THR A 856  ? N THR A 856  O ILE A 864  ? O ILE A 864  
N  1 2 N GLU A 879  ? N GLU A 879  O LEU A 956  ? O LEU A 956  
O  1 2 N MET A 1285 ? N MET A 1285 O VAL A 1305 ? O VAL A 1305 
O  2 3 O LEU A 1306 ? O LEU A 1306 N VAL A 1118 ? N VAL A 1118 
O  3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
P  1 2 N THR A 1141 ? N THR A 1141 O ARG A 1274 ? O ARG A 1274 
Q  1 2 N PHE A 1225 ? N PHE A 1225 O ARG A 1241 ? O ARG A 1241 
Q  2 3 O CYS A 1240 ? O CYS A 1240 N LEU A 1193 ? N LEU A 1193 
Q  3 4 O ARG A 1194 ? O ARG A 1194 N GLU A 1151 ? N GLU A 1151 
Q  4 5 N ILE A 1152 ? N ILE A 1152 O VAL G 43   ? O VAL I 43   
R  1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
S  1 2 N MET A 1444 ? N MET A 1444 O VAL E 133  ? O VAL F 133  
S  2 3 N ILE E 134  ? N ILE F 134  O TRP E 146  ? O TRP F 146  
T  1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
T  2 3 N LEU B 128  ? N LEU B 128  O ILE B 167  ? O ILE B 167  
U  1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
V  1 2 N PHE B 203  ? N PHE B 203  O LYS B 210  ? O LYS B 210  
W  1 2 O ASP B 407  ? O ASP B 407  N GLN B 215  ? N GLN B 215  
W  2 3 N ALA B 214  ? N ALA B 214  O ASN B 499  ? O ASN B 499  
W  3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
X  1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
X  2 3 N ALA B 238  ? N ALA B 238  O VAL B 256  ? O VAL B 256  
X  3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
X  4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
Y  1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
Y  2 3 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
Z  1 2 O GLU B 650  ? O GLU B 650  N GLU B 641  ? N GLU B 641  
Z  2 3 N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
Z  3 4 O HIS B 740  ? O HIS B 740  N ALA B 704  ? N ALA B 704  
AA 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
AA 2 3 O GLY B 588  ? O GLY B 588  N VAL B 580  ? N VAL B 580  
AA 3 4 N ARG B 579  ? N ARG B 579  O LEU B 624  ? O LEU B 624  
AA 4 5 O GLU B 623  ? O GLU B 623  N ASP B 618  ? N ASP B 618  
AB 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AB 2 3 N TYR B 859  ? N TYR B 859  O VAL B 966  ? O VAL B 966  
AB 3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AB 4 5 O GLY B 947  ? O GLY B 947  N VAL B 905  ? N VAL B 905  
AC 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AC 2 3 N TYR B 859  ? N TYR B 859  O VAL B 966  ? O VAL B 966  
AC 3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AC 4 5 N VAL B 954  ? N VAL B 954  O LEU J 56   ? O LEU L 56   
AC 5 6 O LEU J 57   ? O LEU L 57   N ILE J 30   ? N ILE L 30   
AC 6 7 N TYR J 29   ? N TYR L 29   O LEU J 38   ? O LEU L 38   
AD 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
AE 1 2 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
AE 2 3 N MET B 1072 ? N MET B 1072 O LEU B 1081 ? O LEU B 1081 
AE 3 4 O GLN B 1093 ? O GLN B 1093 N ALA B 981  ? N ALA B 981  
AE 4 5 N PHE B 980  ? N PHE B 980  O GLY B 988  ? O GLY B 988  
AE 5 6 O GLY B 991  ? O GLY B 991  N MET B 839  ? N MET B 839  
AE 6 7 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
AE 7 8 O LEU B 1010 ? O LEU B 1010 N ALA B 826  ? N ALA B 826  
AE 8 9 N GLN B 821  ? N GLN B 821  O TYR B 1092 ? O TYR B 1092 
AF 1 2 N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
AF 2 3 N THR B 916  ? N THR B 916  O ARG B 935  ? O ARG B 935  
AG 1 2 N ILE B 912  ? N ILE B 912  O THR B 939  ? O THR B 939  
AH 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
AI 1 2 N GLU C 12   ? N GLU C 12   O ASP C 19   ? O ASP C 19   
AI 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
AI 3 4 O TYR C 229  ? O TYR C 229  N GLU C 179  ? N GLU C 179  
AJ 1 2 O VAL C 119  ? O VAL C 119  N THR C 100  ? N THR C 100  
AJ 2 3 N LEU C 99   ? N LEU C 99   O CYS C 157  ? O CYS C 157  
AJ 3 4 O VAL C 158  ? O VAL C 158  N ASP C 47   ? N ASP C 47   
AJ 4 5 N VAL C 49   ? N VAL C 49   O PHE J 67   ? O PHE L 67   
AK 1 2 N VAL C 113  ? N VAL C 113  O CYS C 145  ? O CYS C 145  
AL 1 2 N ALA D 62   ? N ALA E 62   O LEU D 78   ? O LEU E 78   
AL 2 3 N GLU D 81   ? N GLU E 81   O ILE D 109  ? O ILE E 109  
AL 3 4 N GLY D 108  ? N GLY E 108  O GLU D 133  ? O GLU E 133  
AM 1 2 N ILE D 154  ? N ILE E 154  O LYS D 197  ? O LYS E 197  
AM 2 3 N ILE D 198  ? N ILE E 198  O SER D 210  ? O SER E 210  
AM 3 4 O ILE D 213  ? O ILE E 213  N ILE D 178  ? N ILE E 178  
AN 1 2 N MET F 97   ? N MET H 97   O LEU F 142  ? O LEU H 142  
AN 2 3 O LEU F 143  ? O LEU H 143  N THR F 58   ? N THR H 58   
AN 3 4 O LEU F 55   ? O LEU H 55   N PHE F 10   ? N PHE H 10   
AN 4 5 N SER F 13   ? N SER H 13   O GLU F 27   ? O GLU H 27   
AN 5 6 N ILE F 26   ? N ILE H 26   O LEU F 40   ? O LEU H 40   
AN 6 7 N THR F 39   ? N THR H 39   O ARG F 124  ? O ARG H 124  
AN 7 8 O LEU F 121  ? O LEU H 121  N PHE F 118  ? N PHE H 118  
AN 8 9 O TYR F 115  ? O TYR H 115  N TYR F 102  ? N TYR H 102  
AO 1 2 N MET F 97   ? N MET H 97   O LEU F 142  ? O LEU H 142  
AO 2 3 O LEU F 143  ? O LEU H 143  N THR F 58   ? N THR H 58   
AO 3 4 O LEU F 55   ? O LEU H 55   N PHE F 10   ? N PHE H 10   
AO 4 5 N SER F 13   ? N SER H 13   O GLU F 27   ? O GLU H 27   
AO 5 6 N ILE F 26   ? N ILE H 26   O LEU F 40   ? O LEU H 40   
AO 6 7 N THR F 39   ? N THR H 39   O ARG F 124  ? O ARG H 124  
AO 7 8 O LEU F 121  ? O LEU H 121  N PHE F 118  ? N PHE H 118  
AO 8 9 O LEU F 111  ? O LEU H 111  N VAL F 107  ? N VAL H 107  
AP 1 2 N ARG G 17   ? N ARG I 17   O LEU G 26   ? O LEU I 26   
AP 2 3 N PHE G 27   ? N PHE I 27   O GLU G 36   ? O GLU I 36   
AQ 1 2 N PHE G 86   ? N PHE I 86   O PHE G 100  ? O PHE I 100  
AQ 2 3 N PHE G 101  ? N PHE I 101  O PHE G 110  ? O PHE I 110  
AR 1 2 N ASP I 22   ? N ASP K 22   O VAL I 32   ? O VAL K 32   
AR 2 3 N PHE I 35   ? N PHE K 35   O PHE I 71   ? O PHE K 71   
AR 3 4 O GLN I 76   ? O GLN K 76   N LEU I 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1734' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 1735' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 2001' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 1307' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 319'  
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN I 203'  
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 204'  
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 101'  
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 105'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
10 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
11 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
12 AC3 4 G   K 5    ? G   R 10   . ? 1_555 ? 
13 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
14 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
15 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
16 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
17 AC5 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
18 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
19 AC5 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
20 AC5 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
21 AC6 5 CYS G 7    ? CYS I 7    . ? 1_555 ? 
22 AC6 5 CYS G 10   ? CYS I 10   . ? 1_555 ? 
23 AC6 5 CYS G 29   ? CYS I 29   . ? 1_555 ? 
24 AC6 5 THR G 31   ? THR I 31   . ? 1_555 ? 
25 AC6 5 CYS G 32   ? CYS I 32   . ? 1_555 ? 
26 AC7 4 CYS G 75   ? CYS I 75   . ? 1_555 ? 
27 AC7 4 CYS G 78   ? CYS I 78   . ? 1_555 ? 
28 AC7 4 CYS G 103  ? CYS I 103  . ? 1_555 ? 
29 AC7 4 CYS G 106  ? CYS I 106  . ? 1_555 ? 
30 AC8 4 CYS H 7    ? CYS J 7    . ? 1_555 ? 
31 AC8 4 CYS H 10   ? CYS J 10   . ? 1_555 ? 
32 AC8 4 CYS H 45   ? CYS J 45   . ? 1_555 ? 
33 AC8 4 CYS H 46   ? CYS J 46   . ? 1_555 ? 
34 AC9 4 CYS J 31   ? CYS L 31   . ? 1_555 ? 
35 AC9 4 CYS J 34   ? CYS L 34   . ? 1_555 ? 
36 AC9 4 CYS J 48   ? CYS L 48   . ? 1_555 ? 
37 AC9 4 CYS J 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    3RZD 
_atom_sites.fract_transf_matrix[1][1]   0.006348 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000829 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004519 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005248 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 31.575  -49.060  14.804  1.00 102.38 ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 31.574  -47.603  14.837  1.00 102.32 ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 32.845  -46.985  14.289  1.00 106.33 ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 32.812  -46.289  13.268  1.00 107.07 ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 33.973  -47.235  14.971  1.00 101.68 ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 35.290  -46.725  14.590  1.00 102.22 ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 35.970  -47.644  13.576  1.00 107.70 ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 35.599  -48.815  13.459  1.00 106.60 ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 36.177  -46.546  15.833  1.00 102.62 ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 35.825  -45.323  16.664  1.00 109.36 ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 36.434  -45.386  18.037  1.00 119.49 ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 37.544  -44.908  18.270  1.00 114.41 ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 35.713  -45.968  18.980  1.00 108.51 ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 36.971  -47.102  12.850  1.00 106.69 ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 37.773  -47.794  11.831  1.00 108.45 ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 38.574  -48.964  12.432  1.00 113.02 ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 38.920  -48.914  13.614  1.00 111.58 ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 38.756  -46.804  11.192  1.00 111.31 ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 38.167  -45.873  10.148  1.00 128.10 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 39.265  -45.085  9.472   1.00 146.76 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 39.883  -45.536  8.501   1.00 141.81 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 39.558  -43.900  9.989   1.00 138.80 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 38.892  -50.000  11.616  1.00 111.24 ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 39.674  -51.157  12.077  1.00 111.29 ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 41.153  -50.810  12.328  1.00 116.05 ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 41.853  -50.383  11.407  1.00 117.05 ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 39.541  -52.379  11.124  1.00 113.52 ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 40.667  -53.388  11.273  1.00 116.13 ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 41.720  -53.427  10.362  1.00 119.86 ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 40.722  -54.247  12.368  1.00 116.07 ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 42.795  -54.300  10.533  1.00 121.27 ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 41.787  -55.131  12.544  1.00 117.91 ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 42.820  -55.156  11.621  1.00 126.30 ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 43.867  -56.028  11.790  1.00 127.50 ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 41.638  -51.066  13.555  1.00 111.60 ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 43.042  -50.847  13.895  1.00 112.00 ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 43.773  -52.189  14.009  1.00 115.68 ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 43.277  -53.114  14.662  1.00 114.38 ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 43.179  -50.034  15.178  1.00 114.26 ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 44.540  -49.735  15.443  1.00 123.21 ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 44.946  -52.290  13.355  1.00 112.90 ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 45.788  -53.488  13.345  1.00 113.26 ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 46.542  -53.718  14.668  1.00 115.44 ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 47.056  -54.819  14.881  1.00 115.51 ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 46.753  -53.454  12.165  1.00 119.12 ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 47.592  -52.312  12.216  1.00 128.97 ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 46.590  -52.690  15.556  1.00 110.21 ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 47.226  -52.729  16.882  1.00 109.17 ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 46.580  -53.817  17.770  1.00 112.18 ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 45.370  -54.031  17.660  1.00 110.71 ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 47.109  -51.368  17.554  1.00 108.70 ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 47.343  -54.549  18.621  1.00 109.19 ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 46.714  -55.608  19.429  1.00 108.13 ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 45.822  -55.058  20.530  1.00 110.79 ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 46.217  -54.129  21.241  1.00 110.32 ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 47.903  -56.395  19.999  1.00 111.07 ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 49.120  -55.861  19.312  1.00 117.16 ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 48.792  -54.476  18.881  1.00 112.07 ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 44.606  -55.612  20.649  1.00 106.37 ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 43.657  -55.198  21.678  1.00 104.54 ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 43.977  -55.914  22.976  1.00 109.49 ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 44.201  -57.129  22.976  1.00 109.91 ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 42.204  -55.474  21.251  1.00 103.36 ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 41.107  -54.825  22.098  1.00 105.81 ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 40.978  -53.343  21.792  1.00 105.54 ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 39.778  -55.511  21.877  1.00 106.70 ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 44.021  -55.155  24.079  1.00 106.21 ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 44.312  -55.683  25.410  1.00 106.35 ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 43.709  -54.802  26.497  1.00 109.09 ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 43.614  -53.585  26.320  1.00 108.21 ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 45.825  -55.837  25.611  1.00 108.95 ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 46.205  -57.109  26.350  1.00 122.40 ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 47.149  -57.965  25.525  1.00 135.24 ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 48.551  -57.745  25.887  1.00 144.42 ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 49.347  -56.852  25.307  1.00 156.94 ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 48.889  -56.079  24.332  1.00 142.33 ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 50.607  -56.725  25.701  1.00 143.40 ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 43.290  -55.423  27.616  1.00 105.13 ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 42.690  -54.727  28.760  1.00 103.61 ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 43.751  -54.181  29.706  1.00 107.46 ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 44.762  -54.849  29.953  1.00 108.13 ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 41.673  -55.613  29.486  1.00 110.34 ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 42.161  -56.956  29.546  1.00 110.76 ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 40.309  -55.585  28.828  1.00 108.59 ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 43.516  -52.959  30.229  1.00 102.73 ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 44.422  -52.280  31.161  1.00 102.75 ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 44.469  -53.003  32.523  1.00 106.69 ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 43.427  -53.391  33.060  1.00 105.40 ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 44.192  -50.739  31.233  1.00 105.75 ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 42.835  -50.388  31.818  1.00 104.25 ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 45.311  -50.030  31.989  1.00 106.26 ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 45.691  -53.236  33.031  1.00 104.33 ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 45.938  -53.963  34.276  1.00 104.57 ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 46.499  -53.076  35.391  1.00 109.24 ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 46.306  -53.387  36.568  1.00 109.11 ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 46.873  -55.166  34.021  1.00 108.26 ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 46.466  -56.084  32.858  1.00 119.35 ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 45.306  -57.013  33.198  1.00 127.30 ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 44.828  -57.787  31.996  1.00 135.96 ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 43.691  -58.681  32.340  1.00 143.86 ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 47.210  -51.993  35.030  1.00 106.24 ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 47.820  -51.077  35.995  1.00 106.70 ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 47.669  -49.619  35.575  1.00 110.96 ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 47.680  -49.314  34.379  1.00 110.34 ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 49.321  -51.385  36.159  1.00 109.79 ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 49.660  -52.654  36.928  1.00 121.17 ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 51.136  -53.011  36.994  1.00 142.34 ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 51.930  -52.462  36.195  1.00 132.68 ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 51.496  -53.864  37.837  1.00 138.40 ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 47.556  -48.715  36.564  1.00 108.18 ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 47.494  -47.269  36.337  1.00 108.11 ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 48.621  -46.629  37.165  1.00 114.40 ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 48.438  -46.320  38.350  1.00 113.81 ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 46.097  -46.608  36.554  1.00 110.60 ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 46.128  -45.129  36.168  1.00 110.18 ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 45.006  -47.326  35.764  1.00 109.56 ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 49.807  -46.497  36.536  1.00 113.06 ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 51.017  -45.937  37.141  1.00 114.34 ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 50.973  -44.413  37.153  1.00 119.13 ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 51.195  -43.769  36.125  1.00 118.54 ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 52.288  -46.477  36.441  1.00 116.99 ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 53.624  -45.920  36.956  1.00 128.64 ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 53.886  -46.223  38.410  1.00 144.09 ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 53.631  -45.400  39.296  1.00 138.95 ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 54.414  -47.405  38.686  1.00 135.11 ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 50.685  -43.841  38.325  1.00 116.88 ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 50.627  -42.394  38.492  1.00 117.22 ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 52.026  -41.789  38.563  1.00 123.54 ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 53.008  -42.516  38.726  1.00 124.10 ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 49.762  -42.017  39.704  1.00 118.49 ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 48.286  -42.191  39.439  1.00 118.93 ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 47.645  -43.388  39.739  1.00 121.73 ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 47.542  -41.169  38.861  1.00 120.40 ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 46.282  -43.555  39.478  1.00 121.43 ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 46.179  -41.337  38.600  1.00 122.10 ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 45.558  -42.528  38.912  1.00 119.74 ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 52.103  -40.477  38.377  1.00 120.96 ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 53.360  -39.743  38.398  1.00 122.36 ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 53.219  -38.296  37.982  1.00 126.81 ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 52.112  -37.748  37.966  1.00 125.42 ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 54.354  -37.671  37.648  1.00 124.95 ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 54.409  -36.274  37.229  1.00 125.16 ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 55.103  -36.101  35.883  1.00 129.92 ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 55.955  -36.913  35.507  1.00 130.13 ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 55.087  -35.415  38.308  1.00 126.12 ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 54.225  -35.057  39.516  1.00 130.31 ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 55.068  -34.952  40.777  1.00 131.51 ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 53.441  -33.773  39.274  1.00 132.33 ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 54.724  -35.040  35.155  1.00 126.71 ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 55.288  -34.726  33.850  1.00 127.63 ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 56.600  -33.971  33.968  1.00 133.40 ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 56.649  -32.891  34.563  1.00 133.42 ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 54.293  -33.935  32.986  1.00 128.86 ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 53.621  -34.732  31.893  1.00 130.01 ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 52.238  -34.746  31.773  1.00 132.08 ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 54.372  -35.463  30.979  1.00 133.07 ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 51.616  -35.484  30.763  1.00 132.62 ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 53.750  -36.207  29.975  1.00 135.58 ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 52.376  -36.208  29.871  1.00 132.49 ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 57.668  -34.549  33.402  1.00 130.85 ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 58.992  -33.937  33.376  1.00 131.94 ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 58.964  -32.829  32.310  1.00 135.38 ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 58.322  -33.040  31.280  1.00 134.55 ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 60.040  -34.983  33.010  1.00 136.88 ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 61.352  -34.450  33.069  1.00 148.50 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 59.624  -31.652  32.503  1.00 132.14 ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 59.599  -30.616  31.445  1.00 132.15 ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 60.154  -31.130  30.116  1.00 135.84 ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 59.667  -30.731  29.056  1.00 135.24 ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 60.455  -29.484  32.019  1.00 135.01 ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 61.266  -30.109  33.097  1.00 140.03 ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 60.435  -31.219  33.659  1.00 134.29 ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 61.139  -32.059  30.193  1.00 132.53 ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 61.779  -32.745  29.067  1.00 133.07 ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 60.752  -33.650  28.370  1.00 135.20 ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 60.760  -33.751  27.143  1.00 135.34 ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 62.982  -33.584  29.551  1.00 135.54 ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 64.148  -32.775  30.104  1.00 145.98 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 64.125  -32.494  31.596  1.00 159.87 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 64.054  -33.461  32.389  1.00 149.64 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 64.240  -31.306  31.974  1.00 151.46 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 59.861  -34.287  29.162  1.00 129.75 ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 58.786  -35.162  28.686  1.00 128.06 ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 57.653  -34.336  28.061  1.00 130.53 ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 57.082  -34.777  27.066  1.00 129.69 ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 58.251  -36.034  29.835  1.00 128.10 ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 57.505  -37.276  29.376  1.00 136.34 ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 56.852  -38.116  30.459  1.00 149.37 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 57.368  -38.145  31.600  1.00 144.82 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 55.842  -38.787  30.147  1.00 135.87 ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 57.331  -33.151  28.643  1.00 126.67 ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 56.284  -32.228  28.163  1.00 125.96 ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 56.613  -31.752  26.736  1.00 131.96 ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 55.739  -31.775  25.863  1.00 131.38 ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 56.036  -31.033  29.138  1.00 129.29 ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 55.015  -30.045  28.574  1.00 128.62 ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 55.589  -31.519  30.511  1.00 127.90 ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 57.878  -31.348  26.508  1.00 130.32 ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 58.369  -30.881  25.210  1.00 131.74 ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 58.440  -32.015  24.174  1.00 136.46 ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 58.075  -31.795  23.018  1.00 136.50 ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 59.726  -30.167  25.359  1.00 133.46 ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 59.619  -28.796  26.027  1.00 142.65 ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 60.956  -28.086  26.133  1.00 151.92 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 60.809  -26.742  26.696  1.00 158.98 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 60.961  -26.439  27.983  1.00 172.24 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 61.274  -27.382  28.863  1.00 159.48 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 60.801  -25.189  28.399  1.00 158.13 ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 58.879  -33.226  24.596  1.00 133.29 ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 59.005  -34.423  23.747  1.00 133.81 ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 57.658  -34.900  23.185  1.00 136.68 ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 57.563  -35.224  21.998  1.00 136.67 ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 59.673  -35.548  24.525  1.00 134.64 ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 56.627  -34.934  24.050  1.00 131.90 ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 55.257  -35.338  23.737  1.00 130.36 ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 54.581  -34.317  22.803  1.00 134.86 ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 53.770  -34.707  21.956  1.00 134.31 ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 54.494  -35.613  25.079  1.00 131.60 ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 54.462  -37.118  25.420  1.00 131.53 ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 53.091  -34.985  25.164  1.00 130.86 ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 55.746  -37.715  26.031  1.00 139.82 ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 54.953  -33.025  22.938  1.00 132.06 ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 54.412  -31.909  22.163  1.00 132.28 ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 54.574  -32.032  20.655  1.00 138.35 ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 55.529  -32.640  20.170  1.00 138.57 ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 54.991  -30.584  22.641  1.00 135.58 ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 54.433  -29.507  21.906  1.00 142.43 ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 53.614  -31.437  19.929  1.00 136.45 ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 53.529  -31.378  18.464  1.00 138.37 ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 53.260  -29.930  18.003  1.00 144.89 ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 53.358  -29.633  16.812  1.00 145.76 ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 52.482  -32.372  17.870  1.00 141.44 ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 52.913  -33.825  18.048  1.00 140.97 ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 51.084  -32.140  18.439  1.00 139.49 ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 52.912  -29.044  18.956  1.00 142.34 ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 52.582  -27.644  18.701  1.00 143.72 ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 53.621  -26.666  19.232  1.00 149.98 ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 54.268  -26.934  20.246  1.00 148.71 ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 51.221  -27.321  19.290  1.00 143.09 ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 53.745  -25.513  18.553  1.00 149.56 ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 54.671  -24.433  18.897  1.00 151.22 ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 54.190  -23.679  20.144  1.00 155.51 ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 54.944  -23.574  21.113  1.00 154.77 ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 54.842  -23.455  17.712  1.00 155.81 ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 55.323  -24.096  16.414  1.00 171.10 ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 55.220  -23.123  15.247  1.00 183.54 ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 54.443  -23.680  14.075  1.00 196.20 ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 52.971  -23.631  14.297  1.00 203.84 ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 52.925  -23.177  20.116  1.00 152.83 ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 52.255  -22.388  21.167  1.00 152.35 ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 53.037  -21.087  21.434  1.00 158.74 ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 53.874  -21.031  22.341  1.00 158.22 ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 51.885  -23.201  22.456  1.00 153.48 ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 51.288  -24.608  22.148  1.00 152.74 ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 51.017  -22.390  23.434  1.00 153.47 ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 49.806  -24.684  21.652  1.00 159.88 ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 52.794  -20.063  20.597  1.00 157.61 ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 53.486  -18.773  20.684  1.00 159.44 ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 52.541  -17.570  20.717  1.00 165.02 ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 52.924  -16.522  21.243  1.00 165.42 ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 54.481  -18.608  19.519  1.00 161.52 ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 55.660  -19.583  19.520  1.00 170.66 ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 56.538  -19.416  18.292  1.00 181.28 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 55.820  -19.725  17.051  1.00 190.22 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 56.249  -19.408  15.833  1.00 206.05 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 57.401  -18.767  15.671  1.00 196.62 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 55.526  -19.723  14.767  1.00 190.80 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 51.331  -17.700  20.135  1.00 162.10 ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 50.368  -16.598  20.047  1.00 163.03 ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 49.136  -16.761  20.955  1.00 166.54 ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 48.571  -17.855  21.007  1.00 164.66 ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 49.964  -16.340  18.584  1.00 166.29 ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 51.136  -16.224  17.634  1.00 169.61 ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 51.502  -17.290  16.823  1.00 172.66 ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 51.891  -15.058  17.573  1.00 173.52 ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 52.596  -17.190  15.958  1.00 175.38 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 52.985  -14.959  16.709  1.00 178.10 ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 53.329  -16.025  15.907  1.00 176.21 ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 48.700  -15.690  21.674  1.00 164.23 ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 47.527  -15.823  22.557  1.00 162.81 ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 46.172  -15.628  21.868  1.00 167.86 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 45.139  -15.709  22.533  1.00 166.44 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 47.777  -14.771  23.643  1.00 164.86 ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 48.731  -13.788  23.040  1.00 171.33 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 49.256  -14.323  21.736  1.00 167.66 ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 46.168  -15.377  20.545  1.00 166.59 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 44.940  -15.186  19.767  1.00 167.29 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 44.272  -16.523  19.403  1.00 170.08 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 44.929  -17.568  19.429  1.00 168.49 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 45.205  -14.325  18.521  1.00 171.12 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 45.147  -12.825  18.777  1.00 182.35 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 46.374  -12.153  19.369  1.00 198.30 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 46.252  -10.979  19.786  1.00 189.89 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 47.460  -12.778  19.392  1.00 189.48 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 42.964  -16.482  19.073  1.00 167.08 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 42.153  -17.654  18.729  1.00 165.80 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 42.540  -18.283  17.376  1.00 170.82 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 43.451  -19.112  17.332  1.00 169.63 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 40.642  -17.355  18.895  1.00 173.57 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 40.433  -16.515  20.032  1.00 173.08 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 39.801  -18.622  19.028  1.00 170.33 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 41.849  -17.892  16.287  1.00 169.35 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 42.065  -18.430  14.940  1.00 170.43 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 42.223  -17.368  13.848  1.00 177.55 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 42.898  -17.631  12.851  1.00 178.22 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 40.987  -19.471  14.552  1.00 171.79 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 39.648  -19.312  15.267  1.00 174.63 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 38.812  -17.740  14.946  1.00 181.10 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 37.457  -17.865  16.095  1.00 176.24 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 41.610  -16.180  14.029  1.00 175.71 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 41.695  -15.083  13.060  1.00 178.40 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 43.009  -14.313  13.220  1.00 183.89 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 43.287  -13.767  14.292  1.00 182.94 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 40.477  -14.144  13.167  1.00 181.05 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 40.335  -13.186  11.999  1.00 191.61 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 40.804  -12.035  12.116  1.00 193.23 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 39.744  -13.584  10.974  1.00 197.15 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 43.820  -14.295  12.147  1.00 182.39 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 45.119  -13.615  12.074  1.00 183.78 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 45.025  -12.383  11.159  1.00 190.85 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 45.501  -12.425  10.018  1.00 192.57 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 46.260  -14.573  11.627  1.00 184.91 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 45.859  -15.825  10.849  1.00 194.22 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 45.069  -15.631  9.569   1.00 216.59 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 43.834  -15.835  9.606   1.00 206.50 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 45.681  -15.299  8.529   1.00 214.90 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 44.395  -11.289  11.669  1.00 187.76 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 44.144  -10.019  10.957  1.00 190.32 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 43.400  -10.355  9.646   1.00 194.48 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 43.973  -10.266  8.554   1.00 196.38 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 45.437  -9.166   10.827  1.00 201.47 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 46.177  -9.217   12.051  1.00 198.71 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 45.150  -7.712   10.461  1.00 202.87 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 42.133  -10.822  9.797   1.00 188.76 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 41.220  -11.339  8.759   1.00 189.01 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 41.600  -12.806  8.440   1.00 190.10 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 42.403  -13.376  9.183   1.00 187.69 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 41.140  -10.434  7.505   1.00 193.80 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 40.431  -9.109   7.760   1.00 203.66 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 40.634  -8.139   6.630   1.00 218.34 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 41.619  -7.397   6.587   1.00 215.85 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 39.698  -8.117   5.694   1.00 212.80 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 40.999  -13.427  7.390   1.00 186.52 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 41.221  -14.821  6.946   1.00 184.71 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 40.681  -15.862  7.945   1.00 184.70 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 40.845  -15.707  9.157   1.00 182.36 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 42.686  -15.079  6.494   1.00 192.31 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 43.196  -13.932  5.812   1.00 195.12 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 42.830  -16.311  5.603   1.00 189.93 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 40.042  -16.930  7.429   1.00 179.74 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 39.486  -17.995  8.264   1.00 176.33 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 40.480  -19.142  8.514   1.00 177.44 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 40.172  -20.319  8.295   1.00 175.77 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 38.109  -18.455  7.737   1.00 177.01 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 37.158  -19.052  8.796   1.00 186.97 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 36.970  -18.244  10.086  1.00 196.20 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 36.705  -16.820  9.854   1.00 208.48 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 37.477  -15.832  10.298  1.00 222.13 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 38.563  -16.097  11.014  1.00 207.49 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 37.167  -14.570  10.033  1.00 211.25 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 41.681  -18.775  8.998   1.00 173.26 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 42.762  -19.709  9.301   1.00 171.38 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 42.680  -20.231  10.748  1.00 171.78 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 41.570  -20.441  11.247  1.00 170.06 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 44.113  -19.068  9.010   1.00 173.70 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 43.843  -20.488  11.401  1.00 166.85 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 43.920  -21.044  12.759  1.00 163.87 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 45.011  -20.407  13.646  1.00 166.70 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 44.875  -20.432  14.872  1.00 164.55 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 44.130  -22.576  12.708  1.00 164.99 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 43.228  -23.362  11.738  1.00 180.81 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 41.908  -23.828  12.351  1.00 188.55 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 41.202  -24.789  11.426  1.00 196.71 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 40.294  -25.705  12.161  1.00 202.02 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 46.088  -19.850  13.026  1.00 164.61 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 47.290  -19.236  13.643  1.00 164.62 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 48.194  -20.314  14.256  1.00 166.13 ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 47.724  -21.117  15.062  1.00 163.92 ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 47.054  -18.048  14.644  1.00 167.74 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 45.871  -17.143  14.242  1.00 169.37 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 48.344  -17.228  14.849  1.00 169.62 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 45.266  -16.322  15.371  1.00 176.24 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 49.483  -20.285  13.913  1.00 162.82 ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 50.475  -21.228  14.425  1.00 161.26 ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 50.882  -21.016  15.875  1.00 162.93 ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 52.049  -21.214  16.223  1.00 162.80 ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 49.918  -20.633  16.713  1.00 157.49 ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 50.101  -20.385  18.139  1.00 155.67 ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 49.119  -21.166  18.987  1.00 156.28 ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 49.399  -22.312  19.346  1.00 154.76 ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 47.953  -20.561  19.299  1.00 151.30 ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 46.907  -21.205  20.103  1.00 148.55 ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 45.882  -21.910  19.219  1.00 151.36 ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 45.531  -21.391  18.158  1.00 152.26 ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 46.216  -20.190  21.030  1.00 148.24 ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 45.530  -20.746  22.281  1.00 150.56 ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 46.531  -20.989  23.403  1.00 149.90 ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 44.470  -19.794  22.774  1.00 152.74 ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 45.405  -23.087  19.685  1.00 145.72 ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 44.430  -24.009  19.079  1.00 144.72 ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 44.543  -24.318  17.576  1.00 149.66 ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 44.334  -23.434  16.744  1.00 150.88 ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 42.975  -23.767  19.554  1.00 144.29 ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 42.192  -22.579  19.009  1.00 167.44 ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 40.991  -22.450  19.267  1.00 158.24 ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 42.815  -21.677  18.263  1.00 163.42 ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 44.891  -25.592  17.252  1.00 145.46 ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 45.058  -26.214  15.920  1.00 146.38 ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 46.480  -26.492  15.387  1.00 151.30 ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 46.626  -27.585  14.840  1.00 150.39 ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 44.126  -25.660  14.817  1.00 149.66 ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 44.291  -26.316  13.452  1.00 161.59 ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 43.495  -27.225  13.130  1.00 161.68 ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 45.226  -25.929  12.714  1.00 168.81 ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 47.505  -25.583  15.458  1.00 149.66 ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 48.828  -25.888  14.860  1.00 150.90 ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 49.347  -27.321  15.002  1.00 153.94 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 50.157  -27.626  15.884  1.00 153.19 ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 49.767  -24.828  15.470  1.00 153.38 ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 48.939  -24.072  16.468  1.00 156.77 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 47.520  -24.228  16.034  1.00 151.83 ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 48.860  -28.197  14.091  1.00 149.98 ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 49.136  -29.633  13.993  1.00 148.72 ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 48.726  -30.414  15.267  1.00 149.43 ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 49.414  -31.366  15.648  1.00 148.49 ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 50.595  -29.919  13.551  1.00 149.97 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 50.999  -29.241  12.237  1.00 159.68 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 52.291  -28.443  12.354  1.00 165.70 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 52.242  -27.448  13.430  1.00 167.31 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 53.062  -27.432  14.475  1.00 176.07 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 54.027  -28.337  14.584  1.00 162.30 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 52.932  -26.506  15.413  1.00 159.62 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 47.590  -30.033  15.905  1.00 144.17 ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 47.122  -30.703  17.129  1.00 141.69 ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 45.614  -31.053  17.236  1.00 143.13 ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 45.178  -31.598  18.256  1.00 140.78 ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 47.708  -30.061  18.419  1.00 141.29 ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 47.029  -28.824  19.029  1.00 145.73 ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 47.250  -28.771  20.528  1.00 144.77 ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 47.565  -27.553  18.433  1.00 149.96 ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 44.856  -30.779  16.174  1.00 139.98 ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 43.427  -31.068  16.118  1.00 138.61 ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 42.626  -30.096  15.277  1.00 143.11 ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 42.677  -28.884  15.509  1.00 143.34 ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 41.862  -30.628  14.302  1.00 139.62 ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 41.027  -29.836  13.395  1.00 140.51 ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 39.699  -29.451  14.045  1.00 142.56 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 39.061  -30.286  14.689  1.00 140.35 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 40.789  -30.586  12.088  1.00 145.10 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 40.127  -29.772  11.134  1.00 155.48 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 39.290  -28.185  13.868  1.00 139.88 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 38.054  -27.637  14.432  1.00 138.98 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 37.112  -27.018  13.387  1.00 145.13 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 36.760  -25.839  13.476  1.00 145.64 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 38.296  -26.744  15.683  1.00 141.18 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 39.555  -25.857  15.546  1.00 142.45 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 38.353  -27.595  16.938  1.00 139.82 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 39.277  -24.408  15.239  1.00 149.92 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 36.697  -27.840  12.398  1.00 142.61 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 35.790  -27.471  11.300  1.00 144.26 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 35.211  -28.734  10.618  1.00 148.34 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 34.597  -28.636  9.549   1.00 149.36 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 36.523  -26.564  10.278  1.00 148.45 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 35.655  -25.938  9.197   1.00 160.31 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 34.544  -25.459  9.525   1.00 160.67 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 36.089  -25.920  8.026   1.00 168.04 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 35.373  -29.912  11.270  1.00 143.49 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 34.949  -31.231  10.776  1.00 142.96 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 35.656  -31.560  9.445   1.00 149.14 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 35.017  -31.857  8.427   1.00 149.39 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 33.408  -31.378  10.712  1.00 142.71 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 32.753  -31.709  12.052  1.00 150.00 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 32.341  -30.477  12.845  1.00 159.70 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 31.081  -29.904  12.366  1.00 169.32 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 30.980  -28.771  11.676  1.00 183.97 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 32.065  -28.065  11.381  1.00 170.91 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 29.792  -28.331  11.284  1.00 171.12 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 37.001  -31.446  9.473   1.00 146.81 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 37.905  -31.704  8.350   1.00 148.42 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 38.893  -32.799  8.741   1.00 152.20 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 39.523  -32.709  9.801   1.00 150.41 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 38.683  -30.433  7.953   1.00 149.16 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 37.859  -29.183  7.750   1.00 164.15 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 36.664  -29.221  7.430   1.00 158.52 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 38.503  -28.037  7.902   1.00 153.03 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 39.054  -33.818  7.867   1.00 150.17 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 39.985  -34.943  8.057   1.00 149.55 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 41.427  -34.429  8.078   1.00 154.84 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 42.344  -35.157  8.455   1.00 153.97 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 39.801  -36.004  6.951   1.00 150.38 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 38.485  -36.792  6.971   1.00 153.83 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 37.922  -36.947  5.576   1.00 155.61 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 38.662  -38.148  7.626   1.00 154.48 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 41.600  -33.146  7.717   1.00 153.39 ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 42.861  -32.416  7.684   1.00 154.87 ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 43.334  -32.131  9.131   1.00 158.01 ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 43.321  -30.982  9.588   1.00 158.31 ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 42.704  -31.112  6.863   1.00 159.36 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 42.135  -31.300  5.454   1.00 172.54 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 43.201  -31.133  4.386   1.00 183.46 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 42.614  -31.183  2.998   1.00 194.40 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 43.647  -30.937  1.960   1.00 205.04 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 43.728  -33.194  9.854   1.00 152.75 ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 44.218  -33.086  11.222  1.00 150.98 ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 45.670  -33.535  11.285  1.00 155.19 ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 45.948  -34.726  11.136  1.00 154.68 ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 43.339  -33.873  12.191  1.00 149.06 ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 44.015  -34.002  13.870  1.00 151.32 ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 46.593  -32.564  11.469  1.00 152.28 ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 48.051  -32.724  11.604  1.00 152.69 ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 48.754  -33.725  10.662  1.00 159.02 ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 49.856  -34.188  10.978  1.00 159.05 ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 48.427  -32.975  13.077  1.00 151.81 ? 68   GLN A CB    1 
ATOM   514   C  CG    . GLN A 1  68   ? 48.152  -34.364  13.625  1.00 151.36 ? 68   GLN A CG    1 
ATOM   515   C  CD    . GLN A 1  68   ? 49.428  -35.012  14.077  1.00 160.01 ? 68   GLN A CD    1 
ATOM   516   O  OE1   . GLN A 1  68   ? 49.933  -34.753  15.173  1.00 153.33 ? 68   GLN A OE1   1 
ATOM   517   N  NE2   . GLN A 1  68   ? 49.994  -35.851  13.228  1.00 149.10 ? 68   GLN A NE2   1 
ATOM   518   N  N     . THR A 1  69   ? 48.128  -34.036  9.500   1.00 157.09 ? 69   THR A N     1 
ATOM   519   C  CA    . THR A 1  69   ? 48.561  -35.030  8.498   1.00 158.28 ? 69   THR A CA    1 
ATOM   520   C  C     . THR A 1  69   ? 48.163  -36.465  8.964   1.00 160.36 ? 69   THR A C     1 
ATOM   521   O  O     . THR A 1  69   ? 48.130  -37.385  8.140   1.00 160.61 ? 69   THR A O     1 
ATOM   522   C  CB    . THR A 1  69   ? 50.046  -34.844  8.041   1.00 168.91 ? 69   THR A CB    1 
ATOM   523   O  OG1   . THR A 1  69   ? 50.380  -33.453  7.998   1.00 169.37 ? 69   THR A OG1   1 
ATOM   524   C  CG2   . THR A 1  69   ? 50.336  -35.475  6.685   1.00 169.97 ? 69   THR A CG2   1 
ATOM   525   N  N     . CYS A 1  70   ? 47.794  -36.629  10.274  1.00 154.31 ? 70   CYS A N     1 
ATOM   526   C  CA    . CYS A 1  70   ? 47.368  -37.897  10.891  1.00 151.98 ? 70   CYS A CA    1 
ATOM   527   C  C     . CYS A 1  70   ? 46.023  -38.437  10.366  1.00 154.34 ? 70   CYS A C     1 
ATOM   528   O  O     . CYS A 1  70   ? 45.646  -39.564  10.702  1.00 152.84 ? 70   CYS A O     1 
ATOM   529   C  CB    . CYS A 1  70   ? 47.418  -37.836  12.422  1.00 150.25 ? 70   CYS A CB    1 
ATOM   530   S  SG    . CYS A 1  70   ? 45.854  -37.384  13.236  1.00 152.05 ? 70   CYS A SG    1 
ATOM   531   N  N     . GLN A 1  71   ? 45.335  -37.646  9.508   1.00 151.03 ? 71   GLN A N     1 
ATOM   532   C  CA    . GLN A 1  71   ? 44.035  -37.949  8.896   1.00 150.41 ? 71   GLN A CA    1 
ATOM   533   C  C     . GLN A 1  71   ? 42.978  -38.089  10.004  1.00 151.06 ? 71   GLN A C     1 
ATOM   534   O  O     . GLN A 1  71   ? 42.880  -37.201  10.856  1.00 149.77 ? 71   GLN A O     1 
ATOM   535   C  CB    . GLN A 1  71   ? 44.089  -39.193  7.965   1.00 152.69 ? 71   GLN A CB    1 
ATOM   536   C  CG    . GLN A 1  71   ? 45.204  -39.188  6.912   1.00 172.72 ? 71   GLN A CG    1 
ATOM   537   C  CD    . GLN A 1  71   ? 46.248  -40.260  7.150   1.00 192.33 ? 71   GLN A CD    1 
ATOM   538   O  OE1   . GLN A 1  71   ? 45.943  -41.428  7.433   1.00 186.94 ? 71   GLN A OE1   1 
ATOM   539   N  NE2   . GLN A 1  71   ? 47.512  -39.895  6.992   1.00 185.29 ? 71   GLN A NE2   1 
ATOM   540   N  N     . GLU A 1  72   ? 42.217  -39.207  10.001  1.00 145.92 ? 72   GLU A N     1 
ATOM   541   C  CA    . GLU A 1  72   ? 41.188  -39.595  10.973  1.00 143.24 ? 72   GLU A CA    1 
ATOM   542   C  C     . GLU A 1  72   ? 40.003  -38.636  11.108  1.00 145.63 ? 72   GLU A C     1 
ATOM   543   O  O     . GLU A 1  72   ? 38.859  -39.052  10.909  1.00 144.49 ? 72   GLU A O     1 
ATOM   544   C  CB    . GLU A 1  72   ? 41.796  -39.949  12.351  1.00 143.18 ? 72   GLU A CB    1 
ATOM   545   C  CG    . GLU A 1  72   ? 42.958  -40.934  12.320  1.00 153.96 ? 72   GLU A CG    1 
ATOM   546   C  CD    . GLU A 1  72   ? 42.740  -42.217  11.543  1.00 175.07 ? 72   GLU A CD    1 
ATOM   547   O  OE1   . GLU A 1  72   ? 43.348  -42.362  10.458  1.00 171.16 ? 72   GLU A OE1   1 
ATOM   548   O  OE2   . GLU A 1  72   ? 41.949  -43.070  12.007  1.00 168.61 ? 72   GLU A OE2   1 
ATOM   549   N  N     . GLY A 1  73   ? 40.283  -37.387  11.481  1.00 141.80 ? 73   GLY A N     1 
ATOM   550   C  CA    . GLY A 1  73   ? 39.276  -36.354  11.690  1.00 141.05 ? 73   GLY A CA    1 
ATOM   551   C  C     . GLY A 1  73   ? 38.507  -36.554  12.979  1.00 142.01 ? 73   GLY A C     1 
ATOM   552   O  O     . GLY A 1  73   ? 38.776  -37.504  13.721  1.00 140.37 ? 73   GLY A O     1 
ATOM   553   N  N     . MET A 1  74   ? 37.531  -35.664  13.248  1.00 137.70 ? 74   MET A N     1 
ATOM   554   C  CA    . MET A 1  74   ? 36.683  -35.710  14.449  1.00 135.46 ? 74   MET A CA    1 
ATOM   555   C  C     . MET A 1  74   ? 35.881  -37.014  14.537  1.00 138.28 ? 74   MET A C     1 
ATOM   556   O  O     . MET A 1  74   ? 35.609  -37.638  13.504  1.00 138.59 ? 74   MET A O     1 
ATOM   557   C  CB    . MET A 1  74   ? 35.765  -34.481  14.523  1.00 137.98 ? 74   MET A CB    1 
ATOM   558   C  CG    . MET A 1  74   ? 36.496  -33.214  14.908  1.00 141.92 ? 74   MET A CG    1 
ATOM   559   S  SD    . MET A 1  74   ? 35.573  -31.713  14.516  1.00 147.08 ? 74   MET A SD    1 
ATOM   560   C  CE    . MET A 1  74   ? 34.407  -31.686  15.870  1.00 142.09 ? 74   MET A CE    1 
ATOM   561   N  N     . ASN A 1  75   ? 35.542  -37.439  15.779  1.00 133.09 ? 75   ASN A N     1 
ATOM   562   C  CA    . ASN A 1  75   ? 34.828  -38.688  16.102  1.00 131.65 ? 75   ASN A CA    1 
ATOM   563   C  C     . ASN A 1  75   ? 35.700  -39.928  15.785  1.00 134.89 ? 75   ASN A C     1 
ATOM   564   O  O     . ASN A 1  75   ? 35.174  -41.003  15.474  1.00 133.81 ? 75   ASN A O     1 
ATOM   565   C  CB    . ASN A 1  75   ? 33.424  -38.749  15.442  1.00 133.10 ? 75   ASN A CB    1 
ATOM   566   C  CG    . ASN A 1  75   ? 32.346  -39.407  16.274  1.00 154.31 ? 75   ASN A CG    1 
ATOM   567   O  OD1   . ASN A 1  75   ? 32.536  -40.467  16.886  1.00 147.61 ? 75   ASN A OD1   1 
ATOM   568   N  ND2   . ASN A 1  75   ? 31.162  -38.810  16.273  1.00 145.90 ? 75   ASN A ND2   1 
ATOM   569   N  N     . GLU A 1  76   ? 37.045  -39.757  15.883  1.00 131.63 ? 76   GLU A N     1 
ATOM   570   C  CA    . GLU A 1  76   ? 38.076  -40.772  15.621  1.00 131.52 ? 76   GLU A CA    1 
ATOM   571   C  C     . GLU A 1  76   ? 39.443  -40.343  16.181  1.00 135.19 ? 76   GLU A C     1 
ATOM   572   O  O     . GLU A 1  76   ? 40.162  -41.180  16.731  1.00 134.15 ? 76   GLU A O     1 
ATOM   573   C  CB    . GLU A 1  76   ? 38.166  -41.089  14.107  1.00 134.33 ? 76   GLU A CB    1 
ATOM   574   C  CG    . GLU A 1  76   ? 39.149  -42.180  13.705  1.00 144.86 ? 76   GLU A CG    1 
ATOM   575   C  CD    . GLU A 1  76   ? 39.043  -43.509  14.427  1.00 160.81 ? 76   GLU A CD    1 
ATOM   576   O  OE1   . GLU A 1  76   ? 38.080  -44.262  14.157  1.00 155.98 ? 76   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A 1  76   ? 39.945  -43.809  15.241  1.00 149.69 ? 76   GLU A OE2   1 
ATOM   578   N  N     . CYS A 1  77   ? 39.797  -39.049  16.038  1.00 132.69 ? 77   CYS A N     1 
ATOM   579   C  CA    . CYS A 1  77   ? 41.069  -38.497  16.514  1.00 133.09 ? 77   CYS A CA    1 
ATOM   580   C  C     . CYS A 1  77   ? 41.044  -38.171  18.012  1.00 135.32 ? 77   CYS A C     1 
ATOM   581   O  O     . CYS A 1  77   ? 40.122  -37.487  18.463  1.00 134.42 ? 77   CYS A O     1 
ATOM   582   C  CB    . CYS A 1  77   ? 41.489  -37.285  15.687  1.00 135.13 ? 77   CYS A CB    1 
ATOM   583   S  SG    . CYS A 1  77   ? 43.051  -36.534  16.214  1.00 139.84 ? 77   CYS A SG    1 
ATOM   584   N  N     . PRO A 1  78   ? 42.066  -38.599  18.791  1.00 131.22 ? 78   PRO A N     1 
ATOM   585   C  CA    . PRO A 1  78   ? 42.058  -38.301  20.232  1.00 129.86 ? 78   PRO A CA    1 
ATOM   586   C  C     . PRO A 1  78   ? 42.439  -36.869  20.611  1.00 134.03 ? 78   PRO A C     1 
ATOM   587   O  O     . PRO A 1  78   ? 42.101  -36.424  21.707  1.00 132.91 ? 78   PRO A O     1 
ATOM   588   C  CB    . PRO A 1  78   ? 43.052  -39.317  20.817  1.00 131.46 ? 78   PRO A CB    1 
ATOM   589   C  CG    . PRO A 1  78   ? 43.461  -40.212  19.675  1.00 136.86 ? 78   PRO A CG    1 
ATOM   590   C  CD    . PRO A 1  78   ? 43.232  -39.427  18.434  1.00 133.49 ? 78   PRO A CD    1 
ATOM   591   N  N     . GLY A 1  79   ? 43.140  -36.167  19.727  1.00 131.65 ? 79   GLY A N     1 
ATOM   592   C  CA    . GLY A 1  79   ? 43.613  -34.816  20.002  1.00 131.99 ? 79   GLY A CA    1 
ATOM   593   C  C     . GLY A 1  79   ? 44.980  -34.895  20.644  1.00 135.94 ? 79   GLY A C     1 
ATOM   594   O  O     . GLY A 1  79   ? 45.135  -35.506  21.706  1.00 134.51 ? 79   GLY A O     1 
ATOM   595   N  N     . HIS A 1  80   ? 45.979  -34.285  19.996  1.00 133.83 ? 80   HIS A N     1 
ATOM   596   C  CA    . HIS A 1  80   ? 47.393  -34.318  20.383  1.00 134.14 ? 80   HIS A CA    1 
ATOM   597   C  C     . HIS A 1  80   ? 47.826  -33.113  21.225  1.00 138.99 ? 80   HIS A C     1 
ATOM   598   O  O     . HIS A 1  80   ? 47.345  -32.005  21.013  1.00 138.81 ? 80   HIS A O     1 
ATOM   599   C  CB    . HIS A 1  80   ? 48.270  -34.508  19.132  1.00 136.22 ? 80   HIS A CB    1 
ATOM   600   C  CG    . HIS A 1  80   ? 47.512  -35.089  17.978  1.00 139.52 ? 80   HIS A CG    1 
ATOM   601   N  ND1   . HIS A 1  80   ? 46.754  -34.287  17.144  1.00 141.80 ? 80   HIS A ND1   1 
ATOM   602   C  CD2   . HIS A 1  80   ? 47.344  -36.380  17.609  1.00 140.60 ? 80   HIS A CD2   1 
ATOM   603   C  CE1   . HIS A 1  80   ? 46.173  -35.107  16.287  1.00 141.12 ? 80   HIS A CE1   1 
ATOM   604   N  NE2   . HIS A 1  80   ? 46.501  -36.374  16.518  1.00 140.79 ? 80   HIS A NE2   1 
ATOM   605   N  N     . PHE A 1  81   ? 48.723  -33.345  22.192  1.00 136.19 ? 81   PHE A N     1 
ATOM   606   C  CA    . PHE A 1  81   ? 49.202  -32.336  23.136  1.00 136.56 ? 81   PHE A CA    1 
ATOM   607   C  C     . PHE A 1  81   ? 50.252  -31.369  22.610  1.00 142.17 ? 81   PHE A C     1 
ATOM   608   O  O     . PHE A 1  81   ? 51.007  -31.703  21.699  1.00 142.79 ? 81   PHE A O     1 
ATOM   609   C  CB    . PHE A 1  81   ? 49.713  -33.015  24.413  1.00 137.86 ? 81   PHE A CB    1 
ATOM   610   C  CG    . PHE A 1  81   ? 48.712  -33.019  25.540  1.00 138.29 ? 81   PHE A CG    1 
ATOM   611   C  CD1   . PHE A 1  81   ? 47.757  -34.023  25.640  1.00 140.46 ? 81   PHE A CD1   1 
ATOM   612   C  CD2   . PHE A 1  81   ? 48.728  -32.023  26.507  1.00 140.58 ? 81   PHE A CD2   1 
ATOM   613   C  CE1   . PHE A 1  81   ? 46.833  -34.026  26.686  1.00 140.24 ? 81   PHE A CE1   1 
ATOM   614   C  CE2   . PHE A 1  81   ? 47.806  -32.029  27.555  1.00 142.28 ? 81   PHE A CE2   1 
ATOM   615   C  CZ    . PHE A 1  81   ? 46.860  -33.026  27.632  1.00 139.30 ? 81   PHE A CZ    1 
ATOM   616   N  N     . GLY A 1  82   ? 50.301  -30.193  23.232  1.00 139.16 ? 82   GLY A N     1 
ATOM   617   C  CA    . GLY A 1  82   ? 51.269  -29.139  22.952  1.00 140.56 ? 82   GLY A CA    1 
ATOM   618   C  C     . GLY A 1  82   ? 52.144  -28.853  24.160  1.00 144.46 ? 82   GLY A C     1 
ATOM   619   O  O     . GLY A 1  82   ? 52.184  -29.654  25.102  1.00 142.89 ? 82   GLY A O     1 
ATOM   620   N  N     . HIS A 1  83   ? 52.857  -27.706  24.144  1.00 142.26 ? 83   HIS A N     1 
ATOM   621   C  CA    . HIS A 1  83   ? 53.734  -27.277  25.242  1.00 142.13 ? 83   HIS A CA    1 
ATOM   622   C  C     . HIS A 1  83   ? 53.841  -25.755  25.337  1.00 145.53 ? 83   HIS A C     1 
ATOM   623   O  O     . HIS A 1  83   ? 53.798  -25.069  24.316  1.00 145.76 ? 83   HIS A O     1 
ATOM   624   C  CB    . HIS A 1  83   ? 55.134  -27.919  25.130  1.00 144.09 ? 83   HIS A CB    1 
ATOM   625   C  CG    . HIS A 1  83   ? 56.074  -27.196  24.214  1.00 149.59 ? 83   HIS A CG    1 
ATOM   626   N  ND1   . HIS A 1  83   ? 57.092  -26.403  24.708  1.00 152.54 ? 83   HIS A ND1   1 
ATOM   627   C  CD2   . HIS A 1  83   ? 56.088  -27.129  22.863  1.00 152.59 ? 83   HIS A CD2   1 
ATOM   628   C  CE1   . HIS A 1  83   ? 57.706  -25.903  23.648  1.00 153.69 ? 83   HIS A CE1   1 
ATOM   629   N  NE2   . HIS A 1  83   ? 57.136  -26.312  22.515  1.00 154.14 ? 83   HIS A NE2   1 
ATOM   630   N  N     . ILE A 1  84   ? 54.015  -25.235  26.561  1.00 141.35 ? 84   ILE A N     1 
ATOM   631   C  CA    . ILE A 1  84   ? 54.168  -23.800  26.790  1.00 141.95 ? 84   ILE A CA    1 
ATOM   632   C  C     . ILE A 1  84   ? 55.408  -23.467  27.642  1.00 145.95 ? 84   ILE A C     1 
ATOM   633   O  O     . ILE A 1  84   ? 55.474  -23.814  28.824  1.00 144.55 ? 84   ILE A O     1 
ATOM   634   C  CB    . ILE A 1  84   ? 52.837  -23.092  27.194  1.00 144.41 ? 84   ILE A CB    1 
ATOM   635   C  CG1   . ILE A 1  84   ? 52.902  -21.563  26.978  1.00 146.21 ? 84   ILE A CG1   1 
ATOM   636   C  CG2   . ILE A 1  84   ? 52.341  -23.479  28.597  1.00 143.78 ? 84   ILE A CG2   1 
ATOM   637   C  CD1   . ILE A 1  84   ? 51.532  -20.855  26.872  1.00 153.41 ? 84   ILE A CD1   1 
ATOM   638   N  N     . ASP A 1  85   ? 56.416  -22.849  27.002  1.00 143.87 ? 85   ASP A N     1 
ATOM   639   C  CA    . ASP A 1  85   ? 57.679  -22.474  27.639  1.00 144.37 ? 85   ASP A CA    1 
ATOM   640   C  C     . ASP A 1  85   ? 57.508  -21.225  28.487  1.00 148.31 ? 85   ASP A C     1 
ATOM   641   O  O     . ASP A 1  85   ? 57.025  -20.200  27.999  1.00 148.42 ? 85   ASP A O     1 
ATOM   642   C  CB    . ASP A 1  85   ? 58.791  -22.263  26.591  1.00 147.76 ? 85   ASP A CB    1 
ATOM   643   C  CG    . ASP A 1  85   ? 59.095  -23.462  25.712  1.00 155.29 ? 85   ASP A CG    1 
ATOM   644   O  OD1   . ASP A 1  85   ? 59.122  -24.594  26.239  1.00 154.03 ? 85   ASP A OD1   1 
ATOM   645   O  OD2   . ASP A 1  85   ? 59.352  -23.262  24.507  1.00 162.18 ? 85   ASP A OD2   1 
ATOM   646   N  N     . LEU A 1  86   ? 57.899  -21.316  29.760  1.00 144.46 ? 86   LEU A N     1 
ATOM   647   C  CA    . LEU A 1  86   ? 57.818  -20.196  30.692  1.00 144.64 ? 86   LEU A CA    1 
ATOM   648   C  C     . LEU A 1  86   ? 59.216  -19.650  30.965  1.00 150.30 ? 86   LEU A C     1 
ATOM   649   O  O     . LEU A 1  86   ? 60.159  -20.433  31.107  1.00 150.32 ? 86   LEU A O     1 
ATOM   650   C  CB    . LEU A 1  86   ? 57.125  -20.613  31.999  1.00 143.28 ? 86   LEU A CB    1 
ATOM   651   C  CG    . LEU A 1  86   ? 55.647  -20.990  31.887  1.00 146.53 ? 86   LEU A CG    1 
ATOM   652   C  CD1   . LEU A 1  86   ? 55.336  -22.220  32.712  1.00 145.23 ? 86   LEU A CD1   1 
ATOM   653   C  CD2   . LEU A 1  86   ? 54.752  -19.832  32.284  1.00 149.01 ? 86   LEU A CD2   1 
ATOM   654   N  N     . ALA A 1  87   ? 59.349  -18.306  31.010  1.00 147.89 ? 87   ALA A N     1 
ATOM   655   C  CA    . ALA A 1  87   ? 60.619  -17.605  31.252  1.00 149.18 ? 87   ALA A CA    1 
ATOM   656   C  C     . ALA A 1  87   ? 61.174  -17.875  32.658  1.00 152.30 ? 87   ALA A C     1 
ATOM   657   O  O     . ALA A 1  87   ? 62.379  -18.097  32.808  1.00 152.79 ? 87   ALA A O     1 
ATOM   658   C  CB    . ALA A 1  87   ? 60.447  -16.109  31.026  1.00 151.04 ? 87   ALA A CB    1 
ATOM   659   N  N     . LYS A 1  88   ? 60.288  -17.877  33.674  1.00 147.25 ? 88   LYS A N     1 
ATOM   660   C  CA    . LYS A 1  88   ? 60.626  -18.134  35.075  1.00 146.50 ? 88   LYS A CA    1 
ATOM   661   C  C     . LYS A 1  88   ? 59.687  -19.218  35.638  1.00 147.66 ? 88   LYS A C     1 
ATOM   662   O  O     . LYS A 1  88   ? 58.484  -19.162  35.361  1.00 146.11 ? 88   LYS A O     1 
ATOM   663   C  CB    . LYS A 1  88   ? 60.525  -16.836  35.901  1.00 149.74 ? 88   LYS A CB    1 
ATOM   664   C  CG    . LYS A 1  88   ? 61.395  -16.819  37.156  1.00 163.07 ? 88   LYS A CG    1 
ATOM   665   C  CD    . LYS A 1  88   ? 61.404  -15.451  37.828  1.00 172.17 ? 88   LYS A CD    1 
ATOM   666   C  CE    . LYS A 1  88   ? 62.207  -15.432  39.108  1.00 180.23 ? 88   LYS A CE    1 
ATOM   667   N  NZ    . LYS A 1  88   ? 61.473  -16.067  40.235  1.00 185.67 ? 88   LYS A NZ    1 
ATOM   668   N  N     . PRO A 1  89   ? 60.202  -20.209  36.414  1.00 143.28 ? 89   PRO A N     1 
ATOM   669   C  CA    . PRO A 1  89   ? 59.316  -21.257  36.953  1.00 141.31 ? 89   PRO A CA    1 
ATOM   670   C  C     . PRO A 1  89   ? 58.257  -20.742  37.926  1.00 143.68 ? 89   PRO A C     1 
ATOM   671   O  O     . PRO A 1  89   ? 58.484  -19.751  38.622  1.00 143.83 ? 89   PRO A O     1 
ATOM   672   C  CB    . PRO A 1  89   ? 60.284  -22.223  37.649  1.00 143.32 ? 89   PRO A CB    1 
ATOM   673   C  CG    . PRO A 1  89   ? 61.626  -21.908  37.090  1.00 149.38 ? 89   PRO A CG    1 
ATOM   674   C  CD    . PRO A 1  89   ? 61.601  -20.445  36.819  1.00 145.82 ? 89   PRO A CD    1 
ATOM   675   N  N     . VAL A 1  90   ? 57.092  -21.414  37.945  1.00 138.41 ? 90   VAL A N     1 
ATOM   676   C  CA    . VAL A 1  90   ? 55.953  -21.100  38.815  1.00 137.25 ? 90   VAL A CA    1 
ATOM   677   C  C     . VAL A 1  90   ? 55.457  -22.335  39.569  1.00 139.41 ? 90   VAL A C     1 
ATOM   678   O  O     . VAL A 1  90   ? 55.629  -23.457  39.092  1.00 138.14 ? 90   VAL A O     1 
ATOM   679   C  CB    . VAL A 1  90   ? 54.799  -20.314  38.131  1.00 140.97 ? 90   VAL A CB    1 
ATOM   680   C  CG1   . VAL A 1  90   ? 55.107  -18.823  38.067  1.00 142.06 ? 90   VAL A CG1   1 
ATOM   681   C  CG2   . VAL A 1  90   ? 54.457  -20.874  36.752  1.00 140.46 ? 90   VAL A CG2   1 
ATOM   682   N  N     . PHE A 1  91   ? 54.852  -22.120  40.752  1.00 135.61 ? 91   PHE A N     1 
ATOM   683   C  CA    . PHE A 1  91   ? 54.306  -23.173  41.613  1.00 134.36 ? 91   PHE A CA    1 
ATOM   684   C  C     . PHE A 1  91   ? 53.070  -23.863  40.994  1.00 135.66 ? 91   PHE A C     1 
ATOM   685   O  O     . PHE A 1  91   ? 52.513  -23.380  40.005  1.00 134.95 ? 91   PHE A O     1 
ATOM   686   C  CB    . PHE A 1  91   ? 53.925  -22.589  42.992  1.00 136.62 ? 91   PHE A CB    1 
ATOM   687   C  CG    . PHE A 1  91   ? 55.046  -22.073  43.866  1.00 139.68 ? 91   PHE A CG    1 
ATOM   688   C  CD1   . PHE A 1  91   ? 55.869  -22.952  44.562  1.00 143.21 ? 91   PHE A CD1   1 
ATOM   689   C  CD2   . PHE A 1  91   ? 55.218  -20.710  44.071  1.00 143.00 ? 91   PHE A CD2   1 
ATOM   690   C  CE1   . PHE A 1  91   ? 56.884  -22.473  45.397  1.00 145.46 ? 91   PHE A CE1   1 
ATOM   691   C  CE2   . PHE A 1  91   ? 56.233  -20.231  44.906  1.00 147.11 ? 91   PHE A CE2   1 
ATOM   692   C  CZ    . PHE A 1  91   ? 57.058  -21.116  45.564  1.00 145.47 ? 91   PHE A CZ    1 
ATOM   693   N  N     . HIS A 1  92   ? 52.643  -24.985  41.607  1.00 130.38 ? 92   HIS A N     1 
ATOM   694   C  CA    . HIS A 1  92   ? 51.455  -25.761  41.246  1.00 128.35 ? 92   HIS A CA    1 
ATOM   695   C  C     . HIS A 1  92   ? 50.482  -25.673  42.433  1.00 131.07 ? 92   HIS A C     1 
ATOM   696   O  O     . HIS A 1  92   ? 50.880  -25.965  43.565  1.00 131.17 ? 92   HIS A O     1 
ATOM   697   C  CB    . HIS A 1  92   ? 51.840  -27.224  40.974  1.00 128.41 ? 92   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1  92   ? 50.727  -28.071  40.442  1.00 130.39 ? 92   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1  92   ? 50.839  -28.721  39.230  1.00 131.80 ? 92   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1  92   ? 49.529  -28.379  40.994  1.00 131.08 ? 92   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1  92   ? 49.709  -29.390  39.077  1.00 130.08 ? 92   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1  92   ? 48.891  -29.214  40.113  1.00 129.98 ? 92   HIS A NE2   1 
ATOM   703   N  N     . VAL A 1  93   ? 49.218  -25.276  42.174  1.00 126.19 ? 93   VAL A N     1 
ATOM   704   C  CA    . VAL A 1  93   ? 48.152  -25.093  43.180  1.00 125.39 ? 93   VAL A CA    1 
ATOM   705   C  C     . VAL A 1  93   ? 48.036  -26.173  44.253  1.00 128.60 ? 93   VAL A C     1 
ATOM   706   O  O     . VAL A 1  93   ? 47.860  -25.846  45.428  1.00 128.50 ? 93   VAL A O     1 
ATOM   707   C  CB    . VAL A 1  93   ? 46.763  -24.749  42.596  1.00 128.46 ? 93   VAL A CB    1 
ATOM   708   C  CG1   . VAL A 1  93   ? 46.335  -23.340  42.986  1.00 128.90 ? 93   VAL A CG1   1 
ATOM   709   C  CG2   . VAL A 1  93   ? 46.710  -24.958  41.087  1.00 127.92 ? 93   VAL A CG2   1 
ATOM   710   N  N     . GLY A 1  94   ? 48.108  -27.434  43.839  1.00 124.28 ? 94   GLY A N     1 
ATOM   711   C  CA    . GLY A 1  94   ? 48.010  -28.572  44.744  1.00 123.67 ? 94   GLY A CA    1 
ATOM   712   C  C     . GLY A 1  94   ? 49.316  -28.925  45.425  1.00 127.83 ? 94   GLY A C     1 
ATOM   713   O  O     . GLY A 1  94   ? 49.331  -29.233  46.622  1.00 127.39 ? 94   GLY A O     1 
ATOM   714   N  N     . PHE A 1  95   ? 50.420  -28.879  44.659  1.00 124.73 ? 95   PHE A N     1 
ATOM   715   C  CA    . PHE A 1  95   ? 51.756  -29.224  45.138  1.00 125.55 ? 95   PHE A CA    1 
ATOM   716   C  C     . PHE A 1  95   ? 52.441  -28.189  46.035  1.00 131.42 ? 95   PHE A C     1 
ATOM   717   O  O     . PHE A 1  95   ? 53.347  -28.565  46.783  1.00 131.89 ? 95   PHE A O     1 
ATOM   718   C  CB    . PHE A 1  95   ? 52.656  -29.693  43.986  1.00 127.44 ? 95   PHE A CB    1 
ATOM   719   C  CG    . PHE A 1  95   ? 52.168  -30.972  43.347  1.00 128.01 ? 95   PHE A CG    1 
ATOM   720   C  CD1   . PHE A 1  95   ? 51.432  -30.942  42.171  1.00 130.48 ? 95   PHE A CD1   1 
ATOM   721   C  CD2   . PHE A 1  95   ? 52.419  -32.204  43.937  1.00 130.06 ? 95   PHE A CD2   1 
ATOM   722   C  CE1   . PHE A 1  95   ? 50.969  -32.123  41.585  1.00 130.61 ? 95   PHE A CE1   1 
ATOM   723   C  CE2   . PHE A 1  95   ? 51.953  -33.384  43.352  1.00 132.12 ? 95   PHE A CE2   1 
ATOM   724   C  CZ    . PHE A 1  95   ? 51.230  -33.336  42.181  1.00 129.54 ? 95   PHE A CZ    1 
ATOM   725   N  N     . ILE A 1  96   ? 51.986  -26.910  46.001  1.00 128.44 ? 96   ILE A N     1 
ATOM   726   C  CA    . ILE A 1  96   ? 52.524  -25.805  46.816  1.00 129.40 ? 96   ILE A CA    1 
ATOM   727   C  C     . ILE A 1  96   ? 52.509  -26.109  48.328  1.00 133.46 ? 96   ILE A C     1 
ATOM   728   O  O     . ILE A 1  96   ? 53.435  -25.711  49.037  1.00 134.00 ? 96   ILE A O     1 
ATOM   729   C  CB    . ILE A 1  96   ? 51.894  -24.429  46.430  1.00 132.71 ? 96   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1  96   ? 52.848  -23.221  46.670  1.00 134.63 ? 96   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1  96   ? 50.451  -24.227  46.933  1.00 132.79 ? 96   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1  96   ? 52.944  -22.589  48.121  1.00 143.88 ? 96   ILE A CD1   1 
ATOM   733   N  N     . ALA A 1  97   ? 51.482  -26.852  48.798  1.00 129.22 ? 97   ALA A N     1 
ATOM   734   C  CA    . ALA A 1  97   ? 51.333  -27.280  50.188  1.00 129.39 ? 97   ALA A CA    1 
ATOM   735   C  C     . ALA A 1  97   ? 52.423  -28.299  50.548  1.00 133.41 ? 97   ALA A C     1 
ATOM   736   O  O     . ALA A 1  97   ? 52.999  -28.212  51.636  1.00 133.74 ? 97   ALA A O     1 
ATOM   737   C  CB    . ALA A 1  97   ? 49.954  -27.886  50.399  1.00 129.18 ? 97   ALA A CB    1 
ATOM   738   N  N     . LYS A 1  98   ? 52.720  -29.243  49.621  1.00 129.45 ? 98   LYS A N     1 
ATOM   739   C  CA    . LYS A 1  98   ? 53.758  -30.260  49.808  1.00 129.86 ? 98   LYS A CA    1 
ATOM   740   C  C     . LYS A 1  98   ? 55.150  -29.665  49.626  1.00 135.59 ? 98   LYS A C     1 
ATOM   741   O  O     . LYS A 1  98   ? 56.076  -30.121  50.296  1.00 136.40 ? 98   LYS A O     1 
ATOM   742   C  CB    . LYS A 1  98   ? 53.547  -31.486  48.905  1.00 131.01 ? 98   LYS A CB    1 
ATOM   743   C  CG    . LYS A 1  98   ? 54.138  -32.767  49.498  1.00 139.72 ? 98   LYS A CG    1 
ATOM   744   C  CD    . LYS A 1  98   ? 53.744  -34.016  48.718  1.00 144.42 ? 98   LYS A CD    1 
ATOM   745   C  CE    . LYS A 1  98   ? 54.137  -35.296  49.422  1.00 149.44 ? 98   LYS A CE    1 
ATOM   746   N  NZ    . LYS A 1  98   ? 53.233  -35.615  50.561  1.00 154.50 ? 98   LYS A NZ    1 
ATOM   747   N  N     . ILE A 1  99   ? 55.294  -28.635  48.745  1.00 132.30 ? 99   ILE A N     1 
ATOM   748   C  CA    . ILE A 1  99   ? 56.551  -27.906  48.507  1.00 133.42 ? 99   ILE A CA    1 
ATOM   749   C  C     . ILE A 1  99   ? 57.079  -27.432  49.873  1.00 138.56 ? 99   ILE A C     1 
ATOM   750   O  O     . ILE A 1  99   ? 58.211  -27.756  50.232  1.00 139.25 ? 99   ILE A O     1 
ATOM   751   C  CB    . ILE A 1  99   ? 56.347  -26.727  47.493  1.00 136.39 ? 99   ILE A CB    1 
ATOM   752   C  CG1   . ILE A 1  99   ? 56.184  -27.223  46.030  1.00 136.12 ? 99   ILE A CG1   1 
ATOM   753   C  CG2   . ILE A 1  99   ? 57.433  -25.634  47.613  1.00 138.55 ? 99   ILE A CG2   1 
ATOM   754   C  CD1   . ILE A 1  99   ? 57.479  -27.651  45.255  1.00 144.87 ? 99   ILE A CD1   1 
ATOM   755   N  N     . LYS A 1  100  ? 56.204  -26.751  50.656  1.00 134.86 ? 100  LYS A N     1 
ATOM   756   C  CA    . LYS A 1  100  ? 56.440  -26.238  52.008  1.00 135.67 ? 100  LYS A CA    1 
ATOM   757   C  C     . LYS A 1  100  ? 56.951  -27.357  52.923  1.00 140.47 ? 100  LYS A C     1 
ATOM   758   O  O     . LYS A 1  100  ? 57.925  -27.148  53.647  1.00 141.46 ? 100  LYS A O     1 
ATOM   759   C  CB    . LYS A 1  100  ? 55.137  -25.628  52.565  1.00 137.41 ? 100  LYS A CB    1 
ATOM   760   C  CG    . LYS A 1  100  ? 55.294  -24.828  53.854  1.00 149.32 ? 100  LYS A CG    1 
ATOM   761   C  CD    . LYS A 1  100  ? 54.358  -25.341  54.937  1.00 156.34 ? 100  LYS A CD    1 
ATOM   762   C  CE    . LYS A 1  100  ? 54.408  -24.484  56.175  1.00 164.75 ? 100  LYS A CE    1 
ATOM   763   N  NZ    . LYS A 1  100  ? 53.679  -25.110  57.306  1.00 172.63 ? 100  LYS A NZ    1 
ATOM   764   N  N     . LYS A 1  101  ? 56.314  -28.547  52.857  1.00 136.41 ? 101  LYS A N     1 
ATOM   765   C  CA    . LYS A 1  101  ? 56.691  -29.718  53.650  1.00 136.99 ? 101  LYS A CA    1 
ATOM   766   C  C     . LYS A 1  101  ? 58.070  -30.265  53.259  1.00 143.60 ? 101  LYS A C     1 
ATOM   767   O  O     . LYS A 1  101  ? 58.838  -30.643  54.146  1.00 144.66 ? 101  LYS A O     1 
ATOM   768   C  CB    . LYS A 1  101  ? 55.602  -30.803  53.615  1.00 137.32 ? 101  LYS A CB    1 
ATOM   769   C  CG    . LYS A 1  101  ? 54.368  -30.438  54.436  1.00 139.50 ? 101  LYS A CG    1 
ATOM   770   C  CD    . LYS A 1  101  ? 53.613  -31.662  54.922  1.00 142.02 ? 101  LYS A CD    1 
ATOM   771   C  CE    . LYS A 1  101  ? 52.488  -31.279  55.851  1.00 144.68 ? 101  LYS A CE    1 
ATOM   772   N  NZ    . LYS A 1  101  ? 51.767  -32.469  56.374  1.00 149.06 ? 101  LYS A NZ    1 
ATOM   773   N  N     . VAL A 1  102  ? 58.403  -30.262  51.948  1.00 140.81 ? 102  VAL A N     1 
ATOM   774   C  CA    . VAL A 1  102  ? 59.712  -30.718  51.454  1.00 142.25 ? 102  VAL A CA    1 
ATOM   775   C  C     . VAL A 1  102  ? 60.785  -29.676  51.832  1.00 149.17 ? 102  VAL A C     1 
ATOM   776   O  O     . VAL A 1  102  ? 61.884  -30.056  52.243  1.00 150.31 ? 102  VAL A O     1 
ATOM   777   C  CB    . VAL A 1  102  ? 59.720  -31.072  49.934  1.00 145.33 ? 102  VAL A CB    1 
ATOM   778   C  CG1   . VAL A 1  102  ? 61.071  -31.642  49.500  1.00 146.33 ? 102  VAL A CG1   1 
ATOM   779   C  CG2   . VAL A 1  102  ? 58.606  -32.055  49.581  1.00 143.76 ? 102  VAL A CG2   1 
ATOM   780   N  N     . CYS A 1  103  ? 60.433  -28.371  51.759  1.00 146.64 ? 103  CYS A N     1 
ATOM   781   C  CA    . CYS A 1  103  ? 61.305  -27.236  52.099  1.00 148.39 ? 103  CYS A CA    1 
ATOM   782   C  C     . CYS A 1  103  ? 61.781  -27.222  53.568  1.00 154.77 ? 103  CYS A C     1 
ATOM   783   O  O     . CYS A 1  103  ? 62.709  -26.482  53.896  1.00 155.78 ? 103  CYS A O     1 
ATOM   784   C  CB    . CYS A 1  103  ? 60.644  -25.913  51.717  1.00 148.18 ? 103  CYS A CB    1 
ATOM   785   S  SG    . CYS A 1  103  ? 60.534  -25.617  49.931  1.00 151.23 ? 103  CYS A SG    1 
ATOM   786   N  N     . GLU A 1  104  ? 61.154  -28.037  54.437  1.00 151.94 ? 104  GLU A N     1 
ATOM   787   C  CA    . GLU A 1  104  ? 61.477  -28.139  55.864  1.00 153.55 ? 104  GLU A CA    1 
ATOM   788   C  C     . GLU A 1  104  ? 62.257  -29.422  56.207  1.00 159.78 ? 104  GLU A C     1 
ATOM   789   O  O     . GLU A 1  104  ? 62.775  -29.539  57.320  1.00 160.61 ? 104  GLU A O     1 
ATOM   790   C  CB    . GLU A 1  104  ? 60.190  -28.049  56.708  1.00 154.18 ? 104  GLU A CB    1 
ATOM   791   C  CG    . GLU A 1  104  ? 59.483  -26.703  56.613  1.00 162.53 ? 104  GLU A CG    1 
ATOM   792   C  CD    . GLU A 1  104  ? 57.984  -26.696  56.847  1.00 174.18 ? 104  GLU A CD    1 
ATOM   793   O  OE1   . GLU A 1  104  ? 57.338  -27.755  56.676  1.00 159.79 ? 104  GLU A OE1   1 
ATOM   794   O  OE2   . GLU A 1  104  ? 57.444  -25.608  57.152  1.00 166.51 ? 104  GLU A OE2   1 
ATOM   795   N  N     . CYS A 1  105  ? 62.341  -30.371  55.250  1.00 157.01 ? 105  CYS A N     1 
ATOM   796   C  CA    . CYS A 1  105  ? 63.009  -31.670  55.409  1.00 158.32 ? 105  CYS A CA    1 
ATOM   797   C  C     . CYS A 1  105  ? 64.475  -31.703  54.961  1.00 164.51 ? 105  CYS A C     1 
ATOM   798   O  O     . CYS A 1  105  ? 65.272  -32.420  55.567  1.00 165.73 ? 105  CYS A O     1 
ATOM   799   C  CB    . CYS A 1  105  ? 62.202  -32.778  54.733  1.00 157.24 ? 105  CYS A CB    1 
ATOM   800   S  SG    . CYS A 1  105  ? 60.601  -33.123  55.510  1.00 159.92 ? 105  CYS A SG    1 
ATOM   801   N  N     . VAL A 1  106  ? 64.818  -30.972  53.883  1.00 161.13 ? 106  VAL A N     1 
ATOM   802   C  CA    . VAL A 1  106  ? 66.165  -30.945  53.294  1.00 162.47 ? 106  VAL A CA    1 
ATOM   803   C  C     . VAL A 1  106  ? 66.812  -29.550  53.428  1.00 167.28 ? 106  VAL A C     1 
ATOM   804   O  O     . VAL A 1  106  ? 66.101  -28.542  53.440  1.00 165.91 ? 106  VAL A O     1 
ATOM   805   C  CB    . VAL A 1  106  ? 66.108  -31.462  51.819  1.00 165.56 ? 106  VAL A CB    1 
ATOM   806   C  CG1   . VAL A 1  106  ? 67.415  -31.237  51.062  1.00 166.74 ? 106  VAL A CG1   1 
ATOM   807   C  CG2   . VAL A 1  106  ? 65.711  -32.936  51.766  1.00 164.91 ? 106  VAL A CG2   1 
ATOM   808   N  N     . CYS A 1  107  ? 68.161  -29.507  53.539  1.00 165.82 ? 107  CYS A N     1 
ATOM   809   C  CA    . CYS A 1  107  ? 68.954  -28.276  53.631  1.00 166.90 ? 107  CYS A CA    1 
ATOM   810   C  C     . CYS A 1  107  ? 68.899  -27.474  52.321  1.00 170.01 ? 107  CYS A C     1 
ATOM   811   O  O     . CYS A 1  107  ? 68.752  -28.059  51.244  1.00 168.75 ? 107  CYS A O     1 
ATOM   812   C  CB    . CYS A 1  107  ? 70.392  -28.585  54.040  1.00 169.52 ? 107  CYS A CB    1 
ATOM   813   S  SG    . CYS A 1  107  ? 71.479  -27.134  54.114  1.00 174.98 ? 107  CYS A SG    1 
ATOM   814   N  N     . MET A 1  108  ? 69.036  -26.137  52.426  1.00 166.89 ? 108  MET A N     1 
ATOM   815   C  CA    . MET A 1  108  ? 68.996  -25.201  51.294  1.00 166.13 ? 108  MET A CA    1 
ATOM   816   C  C     . MET A 1  108  ? 70.392  -24.930  50.678  1.00 171.61 ? 108  MET A C     1 
ATOM   817   O  O     . MET A 1  108  ? 70.580  -23.910  50.007  1.00 171.18 ? 108  MET A O     1 
ATOM   818   C  CB    . MET A 1  108  ? 68.304  -23.878  51.702  1.00 167.89 ? 108  MET A CB    1 
ATOM   819   C  CG    . MET A 1  108  ? 66.926  -24.045  52.336  1.00 170.09 ? 108  MET A CG    1 
ATOM   820   S  SD    . MET A 1  108  ? 65.676  -24.805  51.271  1.00 172.02 ? 108  MET A SD    1 
ATOM   821   C  CE    . MET A 1  108  ? 64.208  -24.120  51.977  1.00 167.42 ? 108  MET A CE    1 
ATOM   822   N  N     . HIS A 1  109  ? 71.364  -25.846  50.896  1.00 169.59 ? 109  HIS A N     1 
ATOM   823   C  CA    . HIS A 1  109  ? 72.729  -25.713  50.377  1.00 171.17 ? 109  HIS A CA    1 
ATOM   824   C  C     . HIS A 1  109  ? 73.330  -27.023  49.846  1.00 175.48 ? 109  HIS A C     1 
ATOM   825   O  O     . HIS A 1  109  ? 73.632  -27.101  48.653  1.00 175.09 ? 109  HIS A O     1 
ATOM   826   C  CB    . HIS A 1  109  ? 73.657  -25.044  51.408  1.00 173.83 ? 109  HIS A CB    1 
ATOM   827   C  CG    . HIS A 1  109  ? 73.418  -23.576  51.568  1.00 177.03 ? 109  HIS A CG    1 
ATOM   828   N  ND1   . HIS A 1  109  ? 74.062  -22.650  50.768  1.00 179.45 ? 109  HIS A ND1   1 
ATOM   829   C  CD2   . HIS A 1  109  ? 72.604  -22.921  52.428  1.00 178.05 ? 109  HIS A CD2   1 
ATOM   830   C  CE1   . HIS A 1  109  ? 73.624  -21.467  51.165  1.00 178.59 ? 109  HIS A CE1   1 
ATOM   831   N  NE2   . HIS A 1  109  ? 72.745  -21.580  52.162  1.00 178.12 ? 109  HIS A NE2   1 
ATOM   832   N  N     . CYS A 1  110  ? 73.510  -28.039  50.720  1.00 172.49 ? 110  CYS A N     1 
ATOM   833   C  CA    . CYS A 1  110  ? 74.103  -29.333  50.356  1.00 173.02 ? 110  CYS A CA    1 
ATOM   834   C  C     . CYS A 1  110  ? 73.201  -30.241  49.504  1.00 174.88 ? 110  CYS A C     1 
ATOM   835   O  O     . CYS A 1  110  ? 73.646  -30.737  48.466  1.00 174.68 ? 110  CYS A O     1 
ATOM   836   C  CB    . CYS A 1  110  ? 74.662  -30.059  51.579  1.00 174.83 ? 110  CYS A CB    1 
ATOM   837   S  SG    . CYS A 1  110  ? 73.465  -30.307  52.918  1.00 177.45 ? 110  CYS A SG    1 
ATOM   838   N  N     . GLY A 1  111  ? 71.957  -30.441  49.943  1.00 169.51 ? 111  GLY A N     1 
ATOM   839   C  CA    . GLY A 1  111  ? 70.982  -31.280  49.251  1.00 167.37 ? 111  GLY A CA    1 
ATOM   840   C  C     . GLY A 1  111  ? 70.615  -32.556  49.985  1.00 170.55 ? 111  GLY A C     1 
ATOM   841   O  O     . GLY A 1  111  ? 69.658  -33.236  49.606  1.00 168.43 ? 111  GLY A O     1 
ATOM   842   N  N     . LYS A 1  112  ? 71.378  -32.894  51.037  1.00 168.63 ? 112  LYS A N     1 
ATOM   843   C  CA    . LYS A 1  112  ? 71.167  -34.079  51.872  1.00 168.59 ? 112  LYS A CA    1 
ATOM   844   C  C     . LYS A 1  112  ? 70.002  -33.824  52.844  1.00 171.08 ? 112  LYS A C     1 
ATOM   845   O  O     . LYS A 1  112  ? 69.692  -32.664  53.136  1.00 170.15 ? 112  LYS A O     1 
ATOM   846   C  CB    . LYS A 1  112  ? 72.459  -34.390  52.657  1.00 173.30 ? 112  LYS A CB    1 
ATOM   847   C  CG    . LYS A 1  112  ? 72.580  -35.826  53.155  1.00 183.20 ? 112  LYS A CG    1 
ATOM   848   C  CD    . LYS A 1  112  ? 73.585  -35.925  54.287  1.00 193.44 ? 112  LYS A CD    1 
ATOM   849   C  CE    . LYS A 1  112  ? 73.625  -37.303  54.893  1.00 203.71 ? 112  LYS A CE    1 
ATOM   850   N  NZ    . LYS A 1  112  ? 74.553  -37.362  56.053  1.00 214.26 ? 112  LYS A NZ    1 
ATOM   851   N  N     . LEU A 1  113  ? 69.360  -34.908  53.341  1.00 167.00 ? 113  LEU A N     1 
ATOM   852   C  CA    . LEU A 1  113  ? 68.279  -34.834  54.330  1.00 165.68 ? 113  LEU A CA    1 
ATOM   853   C  C     . LEU A 1  113  ? 68.865  -34.335  55.658  1.00 170.44 ? 113  LEU A C     1 
ATOM   854   O  O     . LEU A 1  113  ? 69.941  -34.792  56.058  1.00 171.96 ? 113  LEU A O     1 
ATOM   855   C  CB    . LEU A 1  113  ? 67.616  -36.212  54.531  1.00 165.26 ? 113  LEU A CB    1 
ATOM   856   C  CG    . LEU A 1  113  ? 66.249  -36.445  53.873  1.00 167.57 ? 113  LEU A CG    1 
ATOM   857   C  CD1   . LEU A 1  113  ? 65.890  -37.917  53.888  1.00 167.66 ? 113  LEU A CD1   1 
ATOM   858   C  CD2   . LEU A 1  113  ? 65.145  -35.660  54.574  1.00 168.60 ? 113  LEU A CD2   1 
ATOM   859   N  N     . LEU A 1  114  ? 68.174  -33.381  56.315  1.00 165.74 ? 114  LEU A N     1 
ATOM   860   C  CA    . LEU A 1  114  ? 68.604  -32.758  57.573  1.00 166.89 ? 114  LEU A CA    1 
ATOM   861   C  C     . LEU A 1  114  ? 68.930  -33.755  58.690  1.00 172.30 ? 114  LEU A C     1 
ATOM   862   O  O     . LEU A 1  114  ? 70.055  -33.743  59.195  1.00 174.06 ? 114  LEU A O     1 
ATOM   863   C  CB    . LEU A 1  114  ? 67.609  -31.682  58.049  1.00 165.69 ? 114  LEU A CB    1 
ATOM   864   C  CG    . LEU A 1  114  ? 67.450  -30.436  57.166  1.00 169.13 ? 114  LEU A CG    1 
ATOM   865   C  CD1   . LEU A 1  114  ? 66.172  -29.707  57.498  1.00 167.83 ? 114  LEU A CD1   1 
ATOM   866   C  CD2   . LEU A 1  114  ? 68.635  -29.489  57.300  1.00 173.05 ? 114  LEU A CD2   1 
ATOM   867   N  N     . LEU A 1  115  ? 67.972  -34.628  59.050  1.00 167.85 ? 115  LEU A N     1 
ATOM   868   C  CA    . LEU A 1  115  ? 68.179  -35.642  60.083  1.00 169.23 ? 115  LEU A CA    1 
ATOM   869   C  C     . LEU A 1  115  ? 68.502  -37.001  59.458  1.00 173.61 ? 115  LEU A C     1 
ATOM   870   O  O     . LEU A 1  115  ? 67.604  -37.775  59.115  1.00 171.89 ? 115  LEU A O     1 
ATOM   871   C  CB    . LEU A 1  115  ? 66.994  -35.712  61.058  1.00 168.57 ? 115  LEU A CB    1 
ATOM   872   C  CG    . LEU A 1  115  ? 66.994  -34.664  62.166  1.00 174.19 ? 115  LEU A CG    1 
ATOM   873   C  CD1   . LEU A 1  115  ? 65.604  -34.123  62.398  1.00 172.64 ? 115  LEU A CD1   1 
ATOM   874   C  CD2   . LEU A 1  115  ? 67.586  -35.219  63.457  1.00 178.81 ? 115  LEU A CD2   1 
ATOM   875   N  N     . ASP A 1  116  ? 69.808  -37.257  59.281  1.00 172.12 ? 116  ASP A N     1 
ATOM   876   C  CA    . ASP A 1  116  ? 70.361  -38.470  58.680  1.00 172.79 ? 116  ASP A CA    1 
ATOM   877   C  C     . ASP A 1  116  ? 71.607  -38.924  59.470  1.00 178.88 ? 116  ASP A C     1 
ATOM   878   O  O     . ASP A 1  116  ? 72.346  -38.068  59.954  1.00 179.66 ? 116  ASP A O     1 
ATOM   879   C  CB    . ASP A 1  116  ? 70.723  -38.198  57.206  1.00 173.99 ? 116  ASP A CB    1 
ATOM   880   C  CG    . ASP A 1  116  ? 70.243  -39.250  56.222  1.00 184.14 ? 116  ASP A CG    1 
ATOM   881   O  OD1   . ASP A 1  116  ? 69.025  -39.547  56.212  1.00 183.08 ? 116  ASP A OD1   1 
ATOM   882   O  OD2   . ASP A 1  116  ? 71.074  -39.742  55.429  1.00 191.09 ? 116  ASP A OD2   1 
ATOM   883   N  N     . GLU A 1  117  ? 71.854  -40.244  59.633  1.00 176.20 ? 117  GLU A N     1 
ATOM   884   C  CA    . GLU A 1  117  ? 71.075  -41.372  59.106  1.00 174.61 ? 117  GLU A CA    1 
ATOM   885   C  C     . GLU A 1  117  ? 70.827  -42.410  60.208  1.00 179.14 ? 117  GLU A C     1 
ATOM   886   O  O     . GLU A 1  117  ? 69.705  -42.902  60.344  1.00 176.73 ? 117  GLU A O     1 
ATOM   887   C  CB    . GLU A 1  117  ? 71.825  -42.006  57.917  1.00 176.50 ? 117  GLU A CB    1 
ATOM   888   C  CG    . GLU A 1  117  ? 70.960  -42.835  56.980  1.00 184.94 ? 117  GLU A CG    1 
ATOM   889   C  CD    . GLU A 1  117  ? 71.652  -43.321  55.719  1.00 203.83 ? 117  GLU A CD    1 
ATOM   890   O  OE1   . GLU A 1  117  ? 72.776  -43.867  55.818  1.00 199.99 ? 117  GLU A OE1   1 
ATOM   891   O  OE2   . GLU A 1  117  ? 71.053  -43.182  54.628  1.00 193.07 ? 117  GLU A OE2   1 
ATOM   892   N  N     . HIS A 1  118  ? 71.874  -42.719  61.001  1.00 177.54 ? 118  HIS A N     1 
ATOM   893   C  CA    . HIS A 1  118  ? 71.843  -43.691  62.098  1.00 179.05 ? 118  HIS A CA    1 
ATOM   894   C  C     . HIS A 1  118  ? 71.197  -43.186  63.408  1.00 181.90 ? 118  HIS A C     1 
ATOM   895   O  O     . HIS A 1  118  ? 71.265  -43.878  64.429  1.00 182.84 ? 118  HIS A O     1 
ATOM   896   C  CB    . HIS A 1  118  ? 73.233  -44.327  62.324  1.00 183.25 ? 118  HIS A CB    1 
ATOM   897   C  CG    . HIS A 1  118  ? 74.360  -43.345  62.453  1.00 188.14 ? 118  HIS A CG    1 
ATOM   898   N  ND1   . HIS A 1  118  ? 75.007  -42.839  61.338  1.00 189.47 ? 118  HIS A ND1   1 
ATOM   899   C  CD2   . HIS A 1  118  ? 74.944  -42.838  63.564  1.00 191.53 ? 118  HIS A CD2   1 
ATOM   900   C  CE1   . HIS A 1  118  ? 75.945  -42.029  61.804  1.00 190.27 ? 118  HIS A CE1   1 
ATOM   901   N  NE2   . HIS A 1  118  ? 75.946  -41.997  63.137  1.00 191.97 ? 118  HIS A NE2   1 
ATOM   902   N  N     . ASN A 1  119  ? 70.540  -42.001  63.362  1.00 175.02 ? 119  ASN A N     1 
ATOM   903   C  CA    . ASN A 1  119  ? 69.823  -41.375  64.481  1.00 173.81 ? 119  ASN A CA    1 
ATOM   904   C  C     . ASN A 1  119  ? 68.641  -42.286  64.855  1.00 176.24 ? 119  ASN A C     1 
ATOM   905   O  O     . ASN A 1  119  ? 67.838  -42.611  63.979  1.00 173.95 ? 119  ASN A O     1 
ATOM   906   C  CB    . ASN A 1  119  ? 69.326  -39.979  64.058  1.00 170.94 ? 119  ASN A CB    1 
ATOM   907   C  CG    . ASN A 1  119  ? 68.785  -39.114  65.171  1.00 185.49 ? 119  ASN A CG    1 
ATOM   908   O  OD1   . ASN A 1  119  ? 67.731  -39.382  65.754  1.00 175.61 ? 119  ASN A OD1   1 
ATOM   909   N  ND2   . ASN A 1  119  ? 69.454  -38.004  65.433  1.00 177.51 ? 119  ASN A ND2   1 
ATOM   910   N  N     . GLU A 1  120  ? 68.564  -42.732  66.133  1.00 173.97 ? 120  GLU A N     1 
ATOM   911   C  CA    . GLU A 1  120  ? 67.516  -43.645  66.620  1.00 172.78 ? 120  GLU A CA    1 
ATOM   912   C  C     . GLU A 1  120  ? 66.057  -43.177  66.493  1.00 172.94 ? 120  GLU A C     1 
ATOM   913   O  O     . GLU A 1  120  ? 65.163  -44.022  66.414  1.00 171.46 ? 120  GLU A O     1 
ATOM   914   C  CB    . GLU A 1  120  ? 67.835  -44.229  68.004  1.00 176.89 ? 120  GLU A CB    1 
ATOM   915   C  CG    . GLU A 1  120  ? 68.486  -45.599  67.921  1.00 188.50 ? 120  GLU A CG    1 
ATOM   916   C  CD    . GLU A 1  120  ? 68.496  -46.387  69.215  1.00 208.40 ? 120  GLU A CD    1 
ATOM   917   O  OE1   . GLU A 1  120  ? 69.458  -46.231  70.002  1.00 202.80 ? 120  GLU A OE1   1 
ATOM   918   O  OE2   . GLU A 1  120  ? 67.552  -47.181  69.432  1.00 201.52 ? 120  GLU A OE2   1 
ATOM   919   N  N     . LEU A 1  121  ? 65.820  -41.847  66.436  1.00 167.55 ? 121  LEU A N     1 
ATOM   920   C  CA    . LEU A 1  121  ? 64.484  -41.266  66.242  1.00 164.41 ? 121  LEU A CA    1 
ATOM   921   C  C     . LEU A 1  121  ? 64.046  -41.475  64.789  1.00 164.62 ? 121  LEU A C     1 
ATOM   922   O  O     . LEU A 1  121  ? 62.852  -41.579  64.511  1.00 161.88 ? 121  LEU A O     1 
ATOM   923   C  CB    . LEU A 1  121  ? 64.487  -39.765  66.569  1.00 164.19 ? 121  LEU A CB    1 
ATOM   924   C  CG    . LEU A 1  121  ? 64.417  -39.384  68.042  1.00 170.69 ? 121  LEU A CG    1 
ATOM   925   C  CD1   . LEU A 1  121  ? 65.223  -38.132  68.314  1.00 171.95 ? 121  LEU A CD1   1 
ATOM   926   C  CD2   . LEU A 1  121  ? 62.976  -39.198  68.494  1.00 171.75 ? 121  LEU A CD2   1 
ATOM   927   N  N     . MET A 1  122  ? 65.030  -41.532  63.873  1.00 160.94 ? 122  MET A N     1 
ATOM   928   C  CA    . MET A 1  122  ? 64.852  -41.744  62.442  1.00 158.66 ? 122  MET A CA    1 
ATOM   929   C  C     . MET A 1  122  ? 65.072  -43.197  62.044  1.00 162.48 ? 122  MET A C     1 
ATOM   930   O  O     . MET A 1  122  ? 64.510  -43.628  61.045  1.00 160.17 ? 122  MET A O     1 
ATOM   931   C  CB    . MET A 1  122  ? 65.774  -40.809  61.649  1.00 161.01 ? 122  MET A CB    1 
ATOM   932   C  CG    . MET A 1  122  ? 65.053  -39.620  61.031  1.00 162.43 ? 122  MET A CG    1 
ATOM   933   S  SD    . MET A 1  122  ? 63.864  -38.770  62.113  1.00 165.77 ? 122  MET A SD    1 
ATOM   934   C  CE    . MET A 1  122  ? 64.961  -37.976  63.266  1.00 164.98 ? 122  MET A CE    1 
ATOM   935   N  N     . ARG A 1  123  ? 65.872  -43.955  62.823  1.00 161.35 ? 123  ARG A N     1 
ATOM   936   C  CA    . ARG A 1  123  ? 66.150  -45.374  62.580  1.00 162.09 ? 123  ARG A CA    1 
ATOM   937   C  C     . ARG A 1  123  ? 64.855  -46.191  62.604  1.00 164.12 ? 123  ARG A C     1 
ATOM   938   O  O     . ARG A 1  123  ? 64.639  -47.019  61.719  1.00 163.07 ? 123  ARG A O     1 
ATOM   939   C  CB    . ARG A 1  123  ? 67.153  -45.923  63.604  1.00 165.40 ? 123  ARG A CB    1 
ATOM   940   C  CG    . ARG A 1  123  ? 68.605  -45.846  63.150  1.00 176.56 ? 123  ARG A CG    1 
ATOM   941   C  CD    . ARG A 1  123  ? 69.513  -46.740  63.977  1.00 187.50 ? 123  ARG A CD    1 
ATOM   942   N  NE    . ARG A 1  123  ? 69.331  -48.160  63.663  1.00 196.99 ? 123  ARG A NE    1 
ATOM   943   C  CZ    . ARG A 1  123  ? 68.658  -49.022  64.421  1.00 211.33 ? 123  ARG A CZ    1 
ATOM   944   N  NH1   . ARG A 1  123  ? 68.096  -48.621  65.556  1.00 200.42 ? 123  ARG A NH1   1 
ATOM   945   N  NH2   . ARG A 1  123  ? 68.543  -50.290  64.052  1.00 198.93 ? 123  ARG A NH2   1 
ATOM   946   N  N     . GLN A 1  124  ? 63.982  -45.917  63.593  1.00 159.68 ? 124  GLN A N     1 
ATOM   947   C  CA    . GLN A 1  124  ? 62.678  -46.564  63.748  1.00 157.85 ? 124  GLN A CA    1 
ATOM   948   C  C     . GLN A 1  124  ? 61.641  -45.921  62.808  1.00 157.72 ? 124  GLN A C     1 
ATOM   949   O  O     . GLN A 1  124  ? 60.633  -46.557  62.489  1.00 155.84 ? 124  GLN A O     1 
ATOM   950   C  CB    . GLN A 1  124  ? 62.205  -46.489  65.214  1.00 160.45 ? 124  GLN A CB    1 
ATOM   951   C  CG    . GLN A 1  124  ? 62.993  -47.386  66.177  1.00 178.86 ? 124  GLN A CG    1 
ATOM   952   C  CD    . GLN A 1  124  ? 63.620  -46.639  67.340  1.00 198.42 ? 124  GLN A CD    1 
ATOM   953   O  OE1   . GLN A 1  124  ? 62.986  -45.814  68.011  1.00 193.64 ? 124  GLN A OE1   1 
ATOM   954   N  NE2   . GLN A 1  124  ? 64.876  -46.946  67.633  1.00 192.34 ? 124  GLN A NE2   1 
ATOM   955   N  N     . ALA A 1  125  ? 61.900  -44.672  62.356  1.00 152.61 ? 125  ALA A N     1 
ATOM   956   C  CA    . ALA A 1  125  ? 61.009  -43.909  61.478  1.00 149.43 ? 125  ALA A CA    1 
ATOM   957   C  C     . ALA A 1  125  ? 61.224  -44.141  59.978  1.00 151.29 ? 125  ALA A C     1 
ATOM   958   O  O     . ALA A 1  125  ? 60.245  -44.331  59.261  1.00 148.93 ? 125  ALA A O     1 
ATOM   959   C  CB    . ALA A 1  125  ? 61.092  -42.426  61.803  1.00 149.90 ? 125  ALA A CB    1 
ATOM   960   N  N     . LEU A 1  126  ? 62.483  -44.103  59.498  1.00 148.44 ? 126  LEU A N     1 
ATOM   961   C  CA    . LEU A 1  126  ? 62.821  -44.297  58.079  1.00 147.01 ? 126  LEU A CA    1 
ATOM   962   C  C     . LEU A 1  126  ? 62.594  -45.739  57.627  1.00 149.63 ? 126  LEU A C     1 
ATOM   963   O  O     . LEU A 1  126  ? 62.240  -45.967  56.470  1.00 147.30 ? 126  LEU A O     1 
ATOM   964   C  CB    . LEU A 1  126  ? 64.271  -43.866  57.774  1.00 148.69 ? 126  LEU A CB    1 
ATOM   965   C  CG    . LEU A 1  126  ? 64.612  -42.371  57.910  1.00 153.27 ? 126  LEU A CG    1 
ATOM   966   C  CD1   . LEU A 1  126  ? 66.096  -42.171  58.167  1.00 155.62 ? 126  LEU A CD1   1 
ATOM   967   C  CD2   . LEU A 1  126  ? 64.175  -41.581  56.681  1.00 153.75 ? 126  LEU A CD2   1 
ATOM   968   N  N     . ALA A 1  127  ? 62.781  -46.703  58.547  1.00 147.68 ? 127  ALA A N     1 
ATOM   969   C  CA    . ALA A 1  127  ? 62.594  -48.133  58.296  1.00 147.76 ? 127  ALA A CA    1 
ATOM   970   C  C     . ALA A 1  127  ? 61.117  -48.524  58.122  1.00 149.10 ? 127  ALA A C     1 
ATOM   971   O  O     . ALA A 1  127  ? 60.836  -49.661  57.733  1.00 148.46 ? 127  ALA A O     1 
ATOM   972   C  CB    . ALA A 1  127  ? 63.232  -48.949  59.412  1.00 151.19 ? 127  ALA A CB    1 
ATOM   973   N  N     . ILE A 1  128  ? 60.178  -47.590  58.398  1.00 143.94 ? 128  ILE A N     1 
ATOM   974   C  CA    . ILE A 1  128  ? 58.745  -47.843  58.249  1.00 141.76 ? 128  ILE A CA    1 
ATOM   975   C  C     . ILE A 1  128  ? 58.321  -47.930  56.776  1.00 143.68 ? 128  ILE A C     1 
ATOM   976   O  O     . ILE A 1  128  ? 58.905  -47.269  55.913  1.00 142.73 ? 128  ILE A O     1 
ATOM   977   C  CB    . ILE A 1  128  ? 57.852  -46.908  59.122  1.00 143.94 ? 128  ILE A CB    1 
ATOM   978   C  CG1   . ILE A 1  128  ? 56.626  -47.674  59.667  1.00 143.81 ? 128  ILE A CG1   1 
ATOM   979   C  CG2   . ILE A 1  128  ? 57.439  -45.617  58.384  1.00 142.57 ? 128  ILE A CG2   1 
ATOM   980   C  CD1   . ILE A 1  128  ? 56.110  -47.212  61.027  1.00 152.11 ? 128  ILE A CD1   1 
ATOM   981   N  N     . LYS A 1  129  ? 57.313  -48.762  56.504  1.00 139.08 ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A 1  129  ? 56.751  -48.981  55.172  1.00 137.00 ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A 1  129  ? 55.839  -47.794  54.787  1.00 138.57 ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A 1  129  ? 55.667  -46.875  55.593  1.00 138.36 ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A 1  129  ? 55.974  -50.314  55.153  1.00 139.35 ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A 1  129  ? 56.808  -51.539  55.538  1.00 153.05 ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A 1  129  ? 56.061  -52.452  56.510  1.00 161.67 ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A 1  129  ? 56.550  -52.332  57.935  1.00 171.69 ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A 1  129  ? 57.814  -53.084  58.155  1.00 181.30 ? 129  LYS A NZ    1 
ATOM   990   N  N     . ASP A 1  130  ? 55.268  -47.816  53.556  1.00 132.96 ? 130  ASP A N     1 
ATOM   991   C  CA    . ASP A 1  130  ? 54.353  -46.808  52.994  1.00 130.64 ? 130  ASP A CA    1 
ATOM   992   C  C     . ASP A 1  130  ? 54.996  -45.440  52.743  1.00 133.66 ? 130  ASP A C     1 
ATOM   993   O  O     . ASP A 1  130  ? 55.623  -44.869  53.634  1.00 134.17 ? 130  ASP A O     1 
ATOM   994   C  CB    . ASP A 1  130  ? 53.046  -46.688  53.809  1.00 131.86 ? 130  ASP A CB    1 
ATOM   995   C  CG    . ASP A 1  130  ? 51.830  -46.311  52.988  1.00 141.76 ? 130  ASP A CG    1 
ATOM   996   O  OD1   . ASP A 1  130  ? 51.725  -45.130  52.587  1.00 141.69 ? 130  ASP A OD1   1 
ATOM   997   O  OD2   . ASP A 1  130  ? 50.953  -47.180  52.795  1.00 147.56 ? 130  ASP A OD2   1 
ATOM   998   N  N     . SER A 1  131  ? 54.815  -44.917  51.518  1.00 128.71 ? 131  SER A N     1 
ATOM   999   C  CA    . SER A 1  131  ? 55.346  -43.632  51.050  1.00 128.05 ? 131  SER A CA    1 
ATOM   1000  C  C     . SER A 1  131  ? 54.840  -42.428  51.866  1.00 130.80 ? 131  SER A C     1 
ATOM   1001  O  O     . SER A 1  131  ? 55.656  -41.687  52.420  1.00 131.38 ? 131  SER A O     1 
ATOM   1002  C  CB    . SER A 1  131  ? 55.043  -43.440  49.565  1.00 129.89 ? 131  SER A CB    1 
ATOM   1003  O  OG    . SER A 1  131  ? 55.559  -44.500  48.777  1.00 138.27 ? 131  SER A OG    1 
ATOM   1004  N  N     . LYS A 1  132  ? 53.501  -42.248  51.943  1.00 125.14 ? 132  LYS A N     1 
ATOM   1005  C  CA    . LYS A 1  132  ? 52.848  -41.145  52.658  1.00 123.96 ? 132  LYS A CA    1 
ATOM   1006  C  C     . LYS A 1  132  ? 52.997  -41.233  54.186  1.00 127.66 ? 132  LYS A C     1 
ATOM   1007  O  O     . LYS A 1  132  ? 52.973  -40.198  54.855  1.00 127.08 ? 132  LYS A O     1 
ATOM   1008  C  CB    . LYS A 1  132  ? 51.370  -41.026  52.240  1.00 124.48 ? 132  LYS A CB    1 
ATOM   1009  C  CG    . LYS A 1  132  ? 50.820  -39.607  52.338  1.00 133.99 ? 132  LYS A CG    1 
ATOM   1010  C  CD    . LYS A 1  132  ? 49.326  -39.559  52.063  1.00 139.04 ? 132  LYS A CD    1 
ATOM   1011  C  CE    . LYS A 1  132  ? 48.635  -38.529  52.923  1.00 144.80 ? 132  LYS A CE    1 
ATOM   1012  N  NZ    . LYS A 1  132  ? 47.180  -38.453  52.634  1.00 147.93 ? 132  LYS A NZ    1 
ATOM   1013  N  N     . LYS A 1  133  ? 53.154  -42.456  54.732  1.00 124.54 ? 133  LYS A N     1 
ATOM   1014  C  CA    . LYS A 1  133  ? 53.329  -42.674  56.170  1.00 125.78 ? 133  LYS A CA    1 
ATOM   1015  C  C     . LYS A 1  133  ? 54.764  -42.385  56.627  1.00 131.73 ? 133  LYS A C     1 
ATOM   1016  O  O     . LYS A 1  133  ? 54.969  -42.007  57.782  1.00 132.62 ? 133  LYS A O     1 
ATOM   1017  C  CB    . LYS A 1  133  ? 52.863  -44.079  56.589  1.00 128.41 ? 133  LYS A CB    1 
ATOM   1018  C  CG    . LYS A 1  133  ? 51.364  -44.158  56.895  1.00 138.85 ? 133  LYS A CG    1 
ATOM   1019  C  CD    . LYS A 1  133  ? 50.518  -44.442  55.654  1.00 145.30 ? 133  LYS A CD    1 
ATOM   1020  C  CE    . LYS A 1  133  ? 49.124  -43.876  55.745  1.00 151.76 ? 133  LYS A CE    1 
ATOM   1021  N  NZ    . LYS A 1  133  ? 48.358  -44.085  54.488  1.00 156.00 ? 133  LYS A NZ    1 
ATOM   1022  N  N     . ARG A 1  134  ? 55.749  -42.543  55.713  1.00 128.46 ? 134  ARG A N     1 
ATOM   1023  C  CA    . ARG A 1  134  ? 57.168  -42.256  55.952  1.00 129.67 ? 134  ARG A CA    1 
ATOM   1024  C  C     . ARG A 1  134  ? 57.351  -40.744  55.994  1.00 133.52 ? 134  ARG A C     1 
ATOM   1025  O  O     . ARG A 1  134  ? 57.845  -40.221  56.990  1.00 134.25 ? 134  ARG A O     1 
ATOM   1026  C  CB    . ARG A 1  134  ? 58.037  -42.835  54.823  1.00 128.79 ? 134  ARG A CB    1 
ATOM   1027  C  CG    . ARG A 1  134  ? 58.866  -44.039  55.220  1.00 135.74 ? 134  ARG A CG    1 
ATOM   1028  C  CD    . ARG A 1  134  ? 59.665  -44.561  54.043  1.00 139.70 ? 134  ARG A CD    1 
ATOM   1029  N  NE    . ARG A 1  134  ? 58.805  -45.111  52.994  1.00 143.17 ? 134  ARG A NE    1 
ATOM   1030  C  CZ    . ARG A 1  134  ? 59.189  -45.328  51.740  1.00 154.91 ? 134  ARG A CZ    1 
ATOM   1031  N  NH1   . ARG A 1  134  ? 60.428  -45.039  51.358  1.00 142.36 ? 134  ARG A NH1   1 
ATOM   1032  N  NH2   . ARG A 1  134  ? 58.337  -45.830  50.856  1.00 139.07 ? 134  ARG A NH2   1 
ATOM   1033  N  N     . PHE A 1  135  ? 56.911  -40.046  54.917  1.00 129.04 ? 135  PHE A N     1 
ATOM   1034  C  CA    . PHE A 1  135  ? 56.973  -38.593  54.730  1.00 128.71 ? 135  PHE A CA    1 
ATOM   1035  C  C     . PHE A 1  135  ? 56.275  -37.820  55.857  1.00 132.67 ? 135  PHE A C     1 
ATOM   1036  O  O     . PHE A 1  135  ? 56.686  -36.700  56.166  1.00 132.55 ? 135  PHE A O     1 
ATOM   1037  C  CB    . PHE A 1  135  ? 56.409  -38.201  53.348  1.00 128.95 ? 135  PHE A CB    1 
ATOM   1038  C  CG    . PHE A 1  135  ? 56.566  -36.742  52.984  1.00 130.55 ? 135  PHE A CG    1 
ATOM   1039  C  CD1   . PHE A 1  135  ? 57.763  -36.261  52.468  1.00 134.73 ? 135  PHE A CD1   1 
ATOM   1040  C  CD2   . PHE A 1  135  ? 55.514  -35.848  53.155  1.00 132.04 ? 135  PHE A CD2   1 
ATOM   1041  C  CE1   . PHE A 1  135  ? 57.911  -34.909  52.143  1.00 135.63 ? 135  PHE A CE1   1 
ATOM   1042  C  CE2   . PHE A 1  135  ? 55.664  -34.495  52.832  1.00 134.88 ? 135  PHE A CE2   1 
ATOM   1043  C  CZ    . PHE A 1  135  ? 56.860  -34.035  52.326  1.00 133.79 ? 135  PHE A CZ    1 
ATOM   1044  N  N     . ALA A 1  136  ? 55.228  -38.416  56.463  1.00 129.21 ? 136  ALA A N     1 
ATOM   1045  C  CA    . ALA A 1  136  ? 54.490  -37.828  57.581  1.00 129.56 ? 136  ALA A CA    1 
ATOM   1046  C  C     . ALA A 1  136  ? 55.369  -37.833  58.838  1.00 136.42 ? 136  ALA A C     1 
ATOM   1047  O  O     . ALA A 1  136  ? 55.441  -36.821  59.538  1.00 136.75 ? 136  ALA A O     1 
ATOM   1048  C  CB    . ALA A 1  136  ? 53.205  -38.606  57.830  1.00 129.41 ? 136  ALA A CB    1 
ATOM   1049  N  N     . ALA A 1  137  ? 56.068  -38.959  59.091  1.00 134.55 ? 137  ALA A N     1 
ATOM   1050  C  CA    . ALA A 1  137  ? 56.968  -39.136  60.227  1.00 136.77 ? 137  ALA A CA    1 
ATOM   1051  C  C     . ALA A 1  137  ? 58.235  -38.279  60.094  1.00 142.40 ? 137  ALA A C     1 
ATOM   1052  O  O     . ALA A 1  137  ? 58.665  -37.684  61.084  1.00 143.49 ? 137  ALA A O     1 
ATOM   1053  C  CB    . ALA A 1  137  ? 57.333  -40.603  60.379  1.00 138.49 ? 137  ALA A CB    1 
ATOM   1054  N  N     . ILE A 1  138  ? 58.817  -38.207  58.873  1.00 138.96 ? 138  ILE A N     1 
ATOM   1055  C  CA    . ILE A 1  138  ? 60.027  -37.429  58.565  1.00 140.11 ? 138  ILE A CA    1 
ATOM   1056  C  C     . ILE A 1  138  ? 59.792  -35.937  58.830  1.00 144.94 ? 138  ILE A C     1 
ATOM   1057  O  O     . ILE A 1  138  ? 60.541  -35.333  59.598  1.00 146.02 ? 138  ILE A O     1 
ATOM   1058  C  CB    . ILE A 1  138  ? 60.561  -37.717  57.122  1.00 142.51 ? 138  ILE A CB    1 
ATOM   1059  C  CG1   . ILE A 1  138  ? 61.058  -39.177  56.987  1.00 143.88 ? 138  ILE A CG1   1 
ATOM   1060  C  CG2   . ILE A 1  138  ? 61.668  -36.725  56.710  1.00 143.86 ? 138  ILE A CG2   1 
ATOM   1061  C  CD1   . ILE A 1  138  ? 60.934  -39.782  55.573  1.00 150.48 ? 138  ILE A CD1   1 
ATOM   1062  N  N     . TRP A 1  139  ? 58.738  -35.365  58.216  1.00 140.77 ? 139  TRP A N     1 
ATOM   1063  C  CA    . TRP A 1  139  ? 58.356  -33.959  58.348  1.00 140.70 ? 139  TRP A CA    1 
ATOM   1064  C  C     . TRP A 1  139  ? 58.127  -33.532  59.804  1.00 146.54 ? 139  TRP A C     1 
ATOM   1065  O  O     . TRP A 1  139  ? 58.602  -32.465  60.189  1.00 146.82 ? 139  TRP A O     1 
ATOM   1066  C  CB    . TRP A 1  139  ? 57.143  -33.642  57.457  1.00 137.43 ? 139  TRP A CB    1 
ATOM   1067  C  CG    . TRP A 1  139  ? 56.563  -32.275  57.659  1.00 138.06 ? 139  TRP A CG    1 
ATOM   1068  C  CD1   . TRP A 1  139  ? 56.978  -31.113  57.080  1.00 140.90 ? 139  TRP A CD1   1 
ATOM   1069  C  CD2   . TRP A 1  139  ? 55.454  -31.932  58.502  1.00 137.75 ? 139  TRP A CD2   1 
ATOM   1070  N  NE1   . TRP A 1  139  ? 56.197  -30.065  57.509  1.00 140.17 ? 139  TRP A NE1   1 
ATOM   1071  C  CE2   . TRP A 1  139  ? 55.255  -30.539  58.386  1.00 141.54 ? 139  TRP A CE2   1 
ATOM   1072  C  CE3   . TRP A 1  139  ? 54.615  -32.668  59.359  1.00 139.07 ? 139  TRP A CE3   1 
ATOM   1073  C  CZ2   . TRP A 1  139  ? 54.243  -29.866  59.084  1.00 140.81 ? 139  TRP A CZ2   1 
ATOM   1074  C  CZ3   . TRP A 1  139  ? 53.614  -32.002  60.049  1.00 140.51 ? 139  TRP A CZ3   1 
ATOM   1075  C  CH2   . TRP A 1  139  ? 53.432  -30.619  59.907  1.00 141.04 ? 139  TRP A CH2   1 
ATOM   1076  N  N     . THR A 1  140  ? 57.433  -34.370  60.608  1.00 143.97 ? 140  THR A N     1 
ATOM   1077  C  CA    . THR A 1  140  ? 57.133  -34.118  62.026  1.00 145.32 ? 140  THR A CA    1 
ATOM   1078  C  C     . THR A 1  140  ? 58.416  -33.881  62.847  1.00 152.39 ? 140  THR A C     1 
ATOM   1079  O  O     . THR A 1  140  ? 58.434  -33.002  63.712  1.00 153.07 ? 140  THR A O     1 
ATOM   1080  C  CB    . THR A 1  140  ? 56.227  -35.238  62.588  1.00 152.74 ? 140  THR A CB    1 
ATOM   1081  O  OG1   . THR A 1  140  ? 55.083  -35.380  61.745  1.00 150.18 ? 140  THR A OG1   1 
ATOM   1082  C  CG2   . THR A 1  140  ? 55.756  -34.968  64.015  1.00 152.41 ? 140  THR A CG2   1 
ATOM   1083  N  N     . LEU A 1  141  ? 59.489  -34.635  62.542  1.00 150.47 ? 141  LEU A N     1 
ATOM   1084  C  CA    . LEU A 1  141  ? 60.783  -34.531  63.223  1.00 152.82 ? 141  LEU A CA    1 
ATOM   1085  C  C     . LEU A 1  141  ? 61.750  -33.508  62.593  1.00 157.85 ? 141  LEU A C     1 
ATOM   1086  O  O     . LEU A 1  141  ? 62.584  -32.953  63.312  1.00 159.09 ? 141  LEU A O     1 
ATOM   1087  C  CB    . LEU A 1  141  ? 61.442  -35.915  63.343  1.00 154.07 ? 141  LEU A CB    1 
ATOM   1088  C  CG    . LEU A 1  141  ? 60.818  -36.852  64.382  1.00 159.62 ? 141  LEU A CG    1 
ATOM   1089  C  CD1   . LEU A 1  141  ? 60.583  -38.234  63.808  1.00 159.29 ? 141  LEU A CD1   1 
ATOM   1090  C  CD2   . LEU A 1  141  ? 61.669  -36.933  65.634  1.00 164.84 ? 141  LEU A CD2   1 
ATOM   1091  N  N     . CYS A 1  142  ? 61.633  -33.252  61.268  1.00 153.54 ? 142  CYS A N     1 
ATOM   1092  C  CA    . CYS A 1  142  ? 62.492  -32.314  60.524  1.00 153.72 ? 142  CYS A CA    1 
ATOM   1093  C  C     . CYS A 1  142  ? 62.032  -30.842  60.526  1.00 156.72 ? 142  CYS A C     1 
ATOM   1094  O  O     . CYS A 1  142  ? 62.845  -29.962  60.229  1.00 156.64 ? 142  CYS A O     1 
ATOM   1095  C  CB    . CYS A 1  142  ? 62.759  -32.817  59.107  1.00 153.17 ? 142  CYS A CB    1 
ATOM   1096  S  SG    . CYS A 1  142  ? 63.874  -34.244  59.019  1.00 158.48 ? 142  CYS A SG    1 
ATOM   1097  N  N     . LYS A 1  143  ? 60.744  -30.576  60.846  1.00 152.37 ? 143  LYS A N     1 
ATOM   1098  C  CA    . LYS A 1  143  ? 60.177  -29.217  60.883  1.00 151.72 ? 143  LYS A CA    1 
ATOM   1099  C  C     . LYS A 1  143  ? 60.774  -28.323  61.982  1.00 158.20 ? 143  LYS A C     1 
ATOM   1100  O  O     . LYS A 1  143  ? 61.020  -27.141  61.731  1.00 157.87 ? 143  LYS A O     1 
ATOM   1101  C  CB    . LYS A 1  143  ? 58.630  -29.224  60.928  1.00 152.27 ? 143  LYS A CB    1 
ATOM   1102  C  CG    . LYS A 1  143  ? 57.999  -29.928  62.138  1.00 162.24 ? 143  LYS A CG    1 
ATOM   1103  C  CD    . LYS A 1  143  ? 57.045  -29.019  62.911  1.00 169.68 ? 143  LYS A CD    1 
ATOM   1104  C  CE    . LYS A 1  143  ? 55.592  -29.187  62.528  1.00 174.49 ? 143  LYS A CE    1 
ATOM   1105  N  NZ    . LYS A 1  143  ? 55.007  -30.443  63.073  1.00 179.91 ? 143  LYS A NZ    1 
ATOM   1106  N  N     . THR A 1  144  ? 61.010  -28.893  63.186  1.00 156.77 ? 144  THR A N     1 
ATOM   1107  C  CA    . THR A 1  144  ? 61.566  -28.201  64.357  1.00 158.70 ? 144  THR A CA    1 
ATOM   1108  C  C     . THR A 1  144  ? 63.036  -27.821  64.137  1.00 164.56 ? 144  THR A C     1 
ATOM   1109  O  O     . THR A 1  144  ? 63.443  -26.732  64.545  1.00 164.75 ? 144  THR A O     1 
ATOM   1110  C  CB    . THR A 1  144  ? 61.354  -29.040  65.632  1.00 167.27 ? 144  THR A CB    1 
ATOM   1111  O  OG1   . THR A 1  144  ? 60.048  -29.619  65.611  1.00 164.97 ? 144  THR A OG1   1 
ATOM   1112  C  CG2   . THR A 1  144  ? 61.535  -28.226  66.913  1.00 167.53 ? 144  THR A CG2   1 
ATOM   1113  N  N     . LYS A 1  145  ? 63.818  -28.715  63.490  1.00 162.31 ? 145  LYS A N     1 
ATOM   1114  C  CA    . LYS A 1  145  ? 65.235  -28.507  63.191  1.00 164.01 ? 145  LYS A CA    1 
ATOM   1115  C  C     . LYS A 1  145  ? 65.474  -27.300  62.285  1.00 169.17 ? 145  LYS A C     1 
ATOM   1116  O  O     . LYS A 1  145  ? 64.984  -27.252  61.155  1.00 167.20 ? 145  LYS A O     1 
ATOM   1117  C  CB    . LYS A 1  145  ? 65.890  -29.784  62.631  1.00 166.45 ? 145  LYS A CB    1 
ATOM   1118  C  CG    . LYS A 1  145  ? 66.571  -30.653  63.687  1.00 179.19 ? 145  LYS A CG    1 
ATOM   1119  C  CD    . LYS A 1  145  ? 67.967  -30.140  64.067  1.00 189.35 ? 145  LYS A CD    1 
ATOM   1120  C  CE    . LYS A 1  145  ? 68.002  -29.562  65.461  1.00 198.50 ? 145  LYS A CE    1 
ATOM   1121  N  NZ    . LYS A 1  145  ? 69.164  -28.659  65.657  1.00 206.49 ? 145  LYS A NZ    1 
ATOM   1122  N  N     . MET A 1  146  ? 66.207  -26.315  62.817  1.00 168.51 ? 146  MET A N     1 
ATOM   1123  C  CA    . MET A 1  146  ? 66.534  -25.044  62.168  1.00 168.86 ? 146  MET A CA    1 
ATOM   1124  C  C     . MET A 1  146  ? 67.952  -25.028  61.587  1.00 174.77 ? 146  MET A C     1 
ATOM   1125  O  O     . MET A 1  146  ? 68.229  -24.216  60.707  1.00 173.97 ? 146  MET A O     1 
ATOM   1126  C  CB    . MET A 1  146  ? 66.345  -23.852  63.138  1.00 172.31 ? 146  MET A CB    1 
ATOM   1127  C  CG    . MET A 1  146  ? 65.680  -24.204  64.470  1.00 177.00 ? 146  MET A CG    1 
ATOM   1128  S  SD    . MET A 1  146  ? 66.711  -25.241  65.548  1.00 183.83 ? 146  MET A SD    1 
ATOM   1129  C  CE    . MET A 1  146  ? 65.588  -25.525  66.893  1.00 180.97 ? 146  MET A CE    1 
ATOM   1130  N  N     . VAL A 1  147  ? 68.848  -25.906  62.084  1.00 173.57 ? 147  VAL A N     1 
ATOM   1131  C  CA    . VAL A 1  147  ? 70.239  -25.988  61.619  1.00 175.16 ? 147  VAL A CA    1 
ATOM   1132  C  C     . VAL A 1  147  ? 70.599  -27.329  60.976  1.00 180.10 ? 147  VAL A C     1 
ATOM   1133  O  O     . VAL A 1  147  ? 70.115  -28.376  61.412  1.00 179.51 ? 147  VAL A O     1 
ATOM   1134  C  CB    . VAL A 1  147  ? 71.291  -25.524  62.660  1.00 181.53 ? 147  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A 1  147  ? 71.293  -24.006  62.799  1.00 181.56 ? 147  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A 1  147  ? 71.091  -26.205  64.014  1.00 182.49 ? 147  VAL A CG2   1 
ATOM   1137  N  N     . CYS A 1  148  ? 71.454  -27.279  59.937  1.00 177.76 ? 148  CYS A N     1 
ATOM   1138  C  CA    . CYS A 1  148  ? 71.924  -28.428  59.155  1.00 177.96 ? 148  CYS A CA    1 
ATOM   1139  C  C     . CYS A 1  148  ? 72.896  -29.337  59.937  1.00 184.03 ? 148  CYS A C     1 
ATOM   1140  O  O     . CYS A 1  148  ? 72.964  -30.535  59.647  1.00 183.59 ? 148  CYS A O     1 
ATOM   1141  C  CB    . CYS A 1  148  ? 72.525  -27.949  57.834  1.00 178.17 ? 148  CYS A CB    1 
ATOM   1142  S  SG    . CYS A 1  148  ? 72.993  -29.271  56.683  1.00 182.03 ? 148  CYS A SG    1 
ATOM   1143  N  N     . GLU A 1  149  ? 73.622  -28.767  60.937  1.00 182.70 ? 149  GLU A N     1 
ATOM   1144  C  CA    . GLU A 1  149  ? 74.617  -29.416  61.815  1.00 185.20 ? 149  GLU A CA    1 
ATOM   1145  C  C     . GLU A 1  149  ? 75.923  -29.801  61.118  1.00 190.78 ? 149  GLU A C     1 
ATOM   1146  O  O     . GLU A 1  149  ? 75.903  -30.265  59.977  1.00 189.53 ? 149  GLU A O     1 
ATOM   1147  C  CB    . GLU A 1  149  ? 74.044  -30.609  62.607  1.00 186.75 ? 149  GLU A CB    1 
ATOM   1148  C  CG    . GLU A 1  149  ? 73.589  -30.264  64.016  1.00 197.54 ? 149  GLU A CG    1 
ATOM   1149  C  CD    . GLU A 1  149  ? 72.115  -29.954  64.207  1.00 217.19 ? 149  GLU A CD    1 
ATOM   1150  O  OE1   . GLU A 1  149  ? 71.291  -30.354  63.351  1.00 207.89 ? 149  GLU A OE1   1 
ATOM   1151  O  OE2   . GLU A 1  149  ? 71.778  -29.346  65.248  1.00 213.17 ? 149  GLU A OE2   1 
ATOM   1152  N  N     . THR A 1  150  ? 77.057  -29.622  61.820  1.00 190.34 ? 150  THR A N     1 
ATOM   1153  C  CA    . THR A 1  150  ? 78.389  -29.952  61.308  1.00 192.27 ? 150  THR A CA    1 
ATOM   1154  C  C     . THR A 1  150  ? 78.690  -31.440  61.548  1.00 197.37 ? 150  THR A C     1 
ATOM   1155  O  O     . THR A 1  150  ? 78.991  -32.162  60.595  1.00 197.20 ? 150  THR A O     1 
ATOM   1156  C  CB    . THR A 1  150  ? 79.453  -29.002  61.903  1.00 202.76 ? 150  THR A CB    1 
ATOM   1157  O  OG1   . THR A 1  150  ? 79.022  -27.647  61.756  1.00 200.64 ? 150  THR A OG1   1 
ATOM   1158  C  CG2   . THR A 1  150  ? 80.825  -29.171  61.258  1.00 203.48 ? 150  THR A CG2   1 
ATOM   1159  N  N     . ASP A 1  151  ? 78.595  -31.888  62.817  1.00 194.50 ? 151  ASP A N     1 
ATOM   1160  C  CA    . ASP A 1  151  ? 78.863  -33.266  63.232  1.00 195.90 ? 151  ASP A CA    1 
ATOM   1161  C  C     . ASP A 1  151  ? 77.711  -33.888  64.033  1.00 198.27 ? 151  ASP A C     1 
ATOM   1162  O  O     . ASP A 1  151  ? 76.782  -33.185  64.439  1.00 196.19 ? 151  ASP A O     1 
ATOM   1163  C  CB    . ASP A 1  151  ? 80.185  -33.338  64.025  1.00 201.53 ? 151  ASP A CB    1 
ATOM   1164  C  CG    . ASP A 1  151  ? 81.452  -33.472  63.191  1.00 213.97 ? 151  ASP A CG    1 
ATOM   1165  O  OD1   . ASP A 1  151  ? 82.481  -33.914  63.746  1.00 216.75 ? 151  ASP A OD1   1 
ATOM   1166  O  OD2   . ASP A 1  151  ? 81.418  -33.126  61.987  1.00 217.79 ? 151  ASP A OD2   1 
ATOM   1167  N  N     . VAL A 1  152  ? 77.785  -35.217  64.250  1.00 195.78 ? 152  VAL A N     1 
ATOM   1168  C  CA    . VAL A 1  152  ? 76.796  -36.026  64.978  1.00 195.04 ? 152  VAL A CA    1 
ATOM   1169  C  C     . VAL A 1  152  ? 77.435  -36.800  66.171  1.00 202.21 ? 152  VAL A C     1 
ATOM   1170  O  O     . VAL A 1  152  ? 78.655  -36.972  66.165  1.00 203.93 ? 152  VAL A O     1 
ATOM   1171  C  CB    . VAL A 1  152  ? 75.976  -36.948  64.024  1.00 196.42 ? 152  VAL A CB    1 
ATOM   1172  C  CG1   . VAL A 1  152  ? 74.967  -36.146  63.208  1.00 193.27 ? 152  VAL A CG1   1 
ATOM   1173  C  CG2   . VAL A 1  152  ? 76.879  -37.783  63.115  1.00 196.96 ? 152  VAL A CG2   1 
ATOM   1174  N  N     . PRO A 1  153  ? 76.663  -37.266  67.198  1.00 197.99 ? 153  PRO A N     1 
ATOM   1175  C  CA    . PRO A 1  153  ? 77.296  -37.975  68.332  1.00 200.70 ? 153  PRO A CA    1 
ATOM   1176  C  C     . PRO A 1  153  ? 77.934  -39.332  68.008  1.00 206.75 ? 153  PRO A C     1 
ATOM   1177  O  O     . PRO A 1  153  ? 77.629  -39.933  66.977  1.00 204.45 ? 153  PRO A O     1 
ATOM   1178  C  CB    . PRO A 1  153  ? 76.151  -38.120  69.341  1.00 201.68 ? 153  PRO A CB    1 
ATOM   1179  C  CG    . PRO A 1  153  ? 74.921  -38.111  68.514  1.00 202.88 ? 153  PRO A CG    1 
ATOM   1180  C  CD    . PRO A 1  153  ? 75.205  -37.133  67.411  1.00 196.92 ? 153  PRO A CD    1 
ATOM   1181  N  N     . SER A 1  154  ? 78.820  -39.806  68.915  1.00 204.78 ? 154  SER A N     1 
ATOM   1182  C  CA    . SER A 1  154  ? 79.557  -41.074  68.826  1.00 224.39 ? 154  SER A CA    1 
ATOM   1183  C  C     . SER A 1  154  ? 78.619  -42.282  68.872  1.00 240.30 ? 154  SER A C     1 
ATOM   1184  O  O     . SER A 1  154  ? 78.975  -43.358  68.393  1.00 213.42 ? 154  SER A O     1 
ATOM   1185  C  CB    . SER A 1  154  ? 80.587  -41.165  69.950  1.00 227.72 ? 154  SER A CB    1 
ATOM   1186  O  OG    . SER A 1  154  ? 81.328  -42.373  69.898  1.00 234.52 ? 154  SER A OG    1 
ATOM   1187  N  N     . LEU A 1  161  ? 82.590  -36.535  68.273  1.00 214.34 ? 161  LEU A N     1 
ATOM   1188  C  CA    . LEU A 1  161  ? 82.527  -35.876  66.972  1.00 213.74 ? 161  LEU A CA    1 
ATOM   1189  C  C     . LEU A 1  161  ? 82.578  -36.899  65.836  1.00 217.48 ? 161  LEU A C     1 
ATOM   1190  O  O     . LEU A 1  161  ? 83.577  -37.607  65.688  1.00 218.20 ? 161  LEU A O     1 
ATOM   1191  C  CB    . LEU A 1  161  ? 83.668  -34.847  66.819  1.00 214.33 ? 161  LEU A CB    1 
ATOM   1192  C  CG    . LEU A 1  161  ? 83.570  -33.567  67.650  1.00 216.90 ? 161  LEU A CG    1 
ATOM   1193  C  CD1   . LEU A 1  161  ? 84.946  -33.083  68.064  1.00 218.28 ? 161  LEU A CD1   1 
ATOM   1194  C  CD2   . LEU A 1  161  ? 82.834  -32.473  66.894  1.00 217.33 ? 161  LEU A CD2   1 
ATOM   1195  N  N     . VAL A 1  162  ? 81.490  -36.987  65.050  1.00 214.64 ? 162  VAL A N     1 
ATOM   1196  C  CA    . VAL A 1  162  ? 81.380  -37.893  63.900  1.00 215.06 ? 162  VAL A CA    1 
ATOM   1197  C  C     . VAL A 1  162  ? 81.172  -37.049  62.632  1.00 217.58 ? 162  VAL A C     1 
ATOM   1198  O  O     . VAL A 1  162  ? 80.112  -36.436  62.459  1.00 215.63 ? 162  VAL A O     1 
ATOM   1199  C  CB    . VAL A 1  162  ? 80.304  -39.005  64.087  1.00 217.40 ? 162  VAL A CB    1 
ATOM   1200  C  CG1   . VAL A 1  162  ? 80.164  -39.869  62.835  1.00 217.39 ? 162  VAL A CG1   1 
ATOM   1201  C  CG2   . VAL A 1  162  ? 80.610  -39.876  65.304  1.00 218.09 ? 162  VAL A CG2   1 
ATOM   1202  N  N     . SER A 1  163  ? 82.208  -37.000  61.771  1.00 216.71 ? 163  SER A N     1 
ATOM   1203  C  CA    . SER A 1  163  ? 82.227  -36.227  60.527  1.00 215.05 ? 163  SER A CA    1 
ATOM   1204  C  C     . SER A 1  163  ? 81.213  -36.726  59.502  1.00 215.48 ? 163  SER A C     1 
ATOM   1205  O  O     . SER A 1  163  ? 81.335  -37.842  58.991  1.00 215.36 ? 163  SER A O     1 
ATOM   1206  C  CB    . SER A 1  163  ? 83.634  -36.192  59.935  1.00 219.62 ? 163  SER A CB    1 
ATOM   1207  O  OG    . SER A 1  163  ? 84.558  -35.594  60.830  1.00 225.19 ? 163  SER A OG    1 
ATOM   1208  N  N     . ARG A 1  164  ? 80.197  -35.891  59.227  1.00 209.28 ? 164  ARG A N     1 
ATOM   1209  C  CA    . ARG A 1  164  ? 79.120  -36.171  58.273  1.00 206.50 ? 164  ARG A CA    1 
ATOM   1210  C  C     . ARG A 1  164  ? 78.927  -35.024  57.270  1.00 209.38 ? 164  ARG A C     1 
ATOM   1211  O  O     . ARG A 1  164  ? 79.426  -33.917  57.494  1.00 210.67 ? 164  ARG A O     1 
ATOM   1212  C  CB    . ARG A 1  164  ? 77.798  -36.534  58.998  1.00 205.02 ? 164  ARG A CB    1 
ATOM   1213  C  CG    . ARG A 1  164  ? 77.221  -35.463  59.942  1.00 215.03 ? 164  ARG A CG    1 
ATOM   1214  C  CD    . ARG A 1  164  ? 76.148  -34.592  59.299  1.00 219.70 ? 164  ARG A CD    1 
ATOM   1215  N  NE    . ARG A 1  164  ? 74.941  -35.345  58.950  1.00 224.41 ? 164  ARG A NE    1 
ATOM   1216  C  CZ    . ARG A 1  164  ? 73.882  -34.828  58.333  1.00 231.67 ? 164  ARG A CZ    1 
ATOM   1217  N  NH1   . ARG A 1  164  ? 73.866  -33.545  57.990  1.00 220.84 ? 164  ARG A NH1   1 
ATOM   1218  N  NH2   . ARG A 1  164  ? 72.832  -35.587  58.057  1.00 217.81 ? 164  ARG A NH2   1 
ATOM   1219  N  N     . GLY A 1  165  ? 78.194  -35.302  56.192  1.00 203.12 ? 165  GLY A N     1 
ATOM   1220  C  CA    . GLY A 1  165  ? 77.887  -34.330  55.150  1.00 200.91 ? 165  GLY A CA    1 
ATOM   1221  C  C     . GLY A 1  165  ? 76.871  -33.307  55.611  1.00 202.41 ? 165  GLY A C     1 
ATOM   1222  O  O     . GLY A 1  165  ? 75.682  -33.428  55.302  1.00 200.31 ? 165  GLY A O     1 
ATOM   1223  N  N     . GLY A 1  166  ? 77.347  -32.316  56.365  1.00 199.33 ? 166  GLY A N     1 
ATOM   1224  C  CA    . GLY A 1  166  ? 76.525  -31.245  56.914  1.00 197.73 ? 166  GLY A CA    1 
ATOM   1225  C  C     . GLY A 1  166  ? 77.219  -29.899  56.952  1.00 202.58 ? 166  GLY A C     1 
ATOM   1226  O  O     . GLY A 1  166  ? 78.306  -29.772  57.523  1.00 204.41 ? 166  GLY A O     1 
ATOM   1227  N  N     . CYS A 1  167  ? 76.578  -28.884  56.343  1.00 197.13 ? 167  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1  167  ? 77.074  -27.510  56.256  1.00 197.28 ? 167  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1  167  ? 76.419  -26.595  57.295  1.00 200.14 ? 167  CYS A C     1 
ATOM   1230  O  O     . CYS A 1  167  ? 75.202  -26.421  57.289  1.00 197.55 ? 167  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1  167  ? 76.921  -26.961  54.838  1.00 196.28 ? 167  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1  167  ? 75.267  -27.175  54.123  1.00 197.00 ? 167  CYS A SG    1 
ATOM   1233  N  N     . GLY A 1  168  ? 77.242  -26.024  58.171  1.00 198.35 ? 168  GLY A N     1 
ATOM   1234  C  CA    . GLY A 1  168  ? 76.804  -25.132  59.240  1.00 198.10 ? 168  GLY A CA    1 
ATOM   1235  C  C     . GLY A 1  168  ? 76.114  -23.866  58.770  1.00 200.29 ? 168  GLY A C     1 
ATOM   1236  O  O     . GLY A 1  168  ? 76.765  -22.833  58.592  1.00 200.88 ? 168  GLY A O     1 
ATOM   1237  N  N     . ASN A 1  169  ? 74.784  -23.946  58.563  1.00 194.37 ? 169  ASN A N     1 
ATOM   1238  C  CA    . ASN A 1  169  ? 73.942  -22.823  58.140  1.00 192.55 ? 169  ASN A CA    1 
ATOM   1239  C  C     . ASN A 1  169  ? 72.525  -22.962  58.693  1.00 195.13 ? 169  ASN A C     1 
ATOM   1240  O  O     . ASN A 1  169  ? 71.987  -24.071  58.740  1.00 193.90 ? 169  ASN A O     1 
ATOM   1241  C  CB    . ASN A 1  169  ? 73.920  -22.682  56.617  1.00 190.76 ? 169  ASN A CB    1 
ATOM   1242  C  CG    . ASN A 1  169  ? 73.365  -21.359  56.145  1.00 204.39 ? 169  ASN A CG    1 
ATOM   1243  O  OD1   . ASN A 1  169  ? 73.989  -20.303  56.296  1.00 197.24 ? 169  ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A 1  169  ? 72.176  -21.389  55.565  1.00 192.95 ? 169  ASN A ND2   1 
ATOM   1245  N  N     . THR A 1  170  ? 71.926  -21.830  59.107  1.00 191.44 ? 170  THR A N     1 
ATOM   1246  C  CA    . THR A 1  170  ? 70.576  -21.775  59.675  1.00 189.88 ? 170  THR A CA    1 
ATOM   1247  C  C     . THR A 1  170  ? 69.500  -21.696  58.582  1.00 191.79 ? 170  THR A C     1 
ATOM   1248  O  O     . THR A 1  170  ? 69.601  -20.882  57.661  1.00 190.92 ? 170  THR A O     1 
ATOM   1249  C  CB    . THR A 1  170  ? 70.468  -20.648  60.724  1.00 196.75 ? 170  THR A CB    1 
ATOM   1250  O  OG1   . THR A 1  170  ? 71.617  -20.676  61.571  1.00 197.40 ? 170  THR A OG1   1 
ATOM   1251  C  CG2   . THR A 1  170  ? 69.207  -20.753  61.580  1.00 193.82 ? 170  THR A CG2   1 
ATOM   1252  N  N     . GLN A 1  171  ? 68.475  -22.558  58.702  1.00 187.10 ? 171  GLN A N     1 
ATOM   1253  C  CA    . GLN A 1  171  ? 67.326  -22.657  57.802  1.00 184.71 ? 171  GLN A CA    1 
ATOM   1254  C  C     . GLN A 1  171  ? 66.113  -21.943  58.424  1.00 187.58 ? 171  GLN A C     1 
ATOM   1255  O  O     . GLN A 1  171  ? 65.942  -22.006  59.647  1.00 187.84 ? 171  GLN A O     1 
ATOM   1256  C  CB    . GLN A 1  171  ? 66.991  -24.130  57.533  1.00 185.18 ? 171  GLN A CB    1 
ATOM   1257  C  CG    . GLN A 1  171  ? 66.872  -24.456  56.056  1.00 202.24 ? 171  GLN A CG    1 
ATOM   1258  C  CD    . GLN A 1  171  ? 65.952  -25.623  55.820  1.00 223.43 ? 171  GLN A CD    1 
ATOM   1259  O  OE1   . GLN A 1  171  ? 64.725  -25.492  55.834  1.00 217.56 ? 171  GLN A OE1   1 
ATOM   1260  N  NE2   . GLN A 1  171  ? 66.526  -26.792  55.595  1.00 217.83 ? 171  GLN A NE2   1 
ATOM   1261  N  N     . PRO A 1  172  ? 65.253  -21.264  57.624  1.00 182.71 ? 172  PRO A N     1 
ATOM   1262  C  CA    . PRO A 1  172  ? 64.110  -20.556  58.220  1.00 181.92 ? 172  PRO A CA    1 
ATOM   1263  C  C     . PRO A 1  172  ? 62.916  -21.454  58.543  1.00 183.87 ? 172  PRO A C     1 
ATOM   1264  O  O     . PRO A 1  172  ? 62.840  -22.589  58.066  1.00 182.44 ? 172  PRO A O     1 
ATOM   1265  C  CB    . PRO A 1  172  ? 63.741  -19.546  57.132  1.00 182.91 ? 172  PRO A CB    1 
ATOM   1266  C  CG    . PRO A 1  172  ? 64.030  -20.279  55.868  1.00 186.45 ? 172  PRO A CG    1 
ATOM   1267  C  CD    . PRO A 1  172  ? 65.290  -21.067  56.157  1.00 183.26 ? 172  PRO A CD    1 
ATOM   1268  N  N     . THR A 1  173  ? 61.972  -20.920  59.334  1.00 179.97 ? 173  THR A N     1 
ATOM   1269  C  CA    . THR A 1  173  ? 60.721  -21.590  59.675  1.00 178.43 ? 173  THR A CA    1 
ATOM   1270  C  C     . THR A 1  173  ? 59.745  -21.128  58.580  1.00 180.21 ? 173  THR A C     1 
ATOM   1271  O  O     . THR A 1  173  ? 59.051  -20.119  58.741  1.00 179.83 ? 173  THR A O     1 
ATOM   1272  C  CB    . THR A 1  173  ? 60.302  -21.265  61.127  1.00 186.97 ? 173  THR A CB    1 
ATOM   1273  O  OG1   . THR A 1  173  ? 61.424  -21.438  61.995  1.00 187.76 ? 173  THR A OG1   1 
ATOM   1274  C  CG2   . THR A 1  173  ? 59.147  -22.131  61.612  1.00 184.82 ? 173  THR A CG2   1 
ATOM   1275  N  N     . ILE A 1  174  ? 59.784  -21.827  57.425  1.00 175.12 ? 174  ILE A N     1 
ATOM   1276  C  CA    . ILE A 1  174  ? 59.004  -21.543  56.211  1.00 173.11 ? 174  ILE A CA    1 
ATOM   1277  C  C     . ILE A 1  174  ? 57.491  -21.491  56.452  1.00 174.95 ? 174  ILE A C     1 
ATOM   1278  O  O     . ILE A 1  174  ? 56.928  -22.408  57.050  1.00 174.15 ? 174  ILE A O     1 
ATOM   1279  C  CB    . ILE A 1  174  ? 59.428  -22.468  55.024  1.00 175.41 ? 174  ILE A CB    1 
ATOM   1280  C  CG1   . ILE A 1  174  ? 60.881  -22.185  54.591  1.00 177.07 ? 174  ILE A CG1   1 
ATOM   1281  C  CG2   . ILE A 1  174  ? 58.492  -22.353  53.816  1.00 174.43 ? 174  ILE A CG2   1 
ATOM   1282  C  CD1   . ILE A 1  174  ? 61.836  -23.296  54.885  1.00 185.95 ? 174  ILE A CD1   1 
ATOM   1283  N  N     . ARG A 1  175  ? 56.854  -20.398  55.988  1.00 170.39 ? 175  ARG A N     1 
ATOM   1284  C  CA    . ARG A 1  175  ? 55.418  -20.147  56.100  1.00 169.01 ? 175  ARG A CA    1 
ATOM   1285  C  C     . ARG A 1  175  ? 54.859  -19.667  54.753  1.00 170.96 ? 175  ARG A C     1 
ATOM   1286  O  O     . ARG A 1  175  ? 55.513  -18.885  54.060  1.00 170.90 ? 175  ARG A O     1 
ATOM   1287  C  CB    . ARG A 1  175  ? 55.148  -19.106  57.197  1.00 170.43 ? 175  ARG A CB    1 
ATOM   1288  C  CG    . ARG A 1  175  ? 53.703  -19.071  57.684  1.00 180.15 ? 175  ARG A CG    1 
ATOM   1289  C  CD    . ARG A 1  175  ? 53.361  -17.754  58.355  1.00 191.34 ? 175  ARG A CD    1 
ATOM   1290  N  NE    . ARG A 1  175  ? 53.034  -16.708  57.383  1.00 199.35 ? 175  ARG A NE    1 
ATOM   1291  C  CZ    . ARG A 1  175  ? 53.867  -15.745  57.000  1.00 214.06 ? 175  ARG A CZ    1 
ATOM   1292  N  NH1   . ARG A 1  175  ? 55.092  -15.676  57.506  1.00 202.94 ? 175  ARG A NH1   1 
ATOM   1293  N  NH2   . ARG A 1  175  ? 53.479  -14.838  56.113  1.00 199.96 ? 175  ARG A NH2   1 
ATOM   1294  N  N     . LYS A 1  176  ? 53.651  -20.138  54.389  1.00 165.63 ? 176  LYS A N     1 
ATOM   1295  C  CA    . LYS A 1  176  ? 52.976  -19.776  53.139  1.00 164.08 ? 176  LYS A CA    1 
ATOM   1296  C  C     . LYS A 1  176  ? 52.276  -18.424  53.275  1.00 167.41 ? 176  LYS A C     1 
ATOM   1297  O  O     . LYS A 1  176  ? 51.535  -18.204  54.236  1.00 167.29 ? 176  LYS A O     1 
ATOM   1298  C  CB    . LYS A 1  176  ? 51.979  -20.875  52.723  1.00 165.09 ? 176  LYS A CB    1 
ATOM   1299  C  CG    . LYS A 1  176  ? 51.417  -20.724  51.310  1.00 178.17 ? 176  LYS A CG    1 
ATOM   1300  C  CD    . LYS A 1  176  ? 50.367  -21.789  51.021  1.00 186.37 ? 176  LYS A CD    1 
ATOM   1301  C  CE    . LYS A 1  176  ? 49.638  -21.548  49.723  1.00 194.61 ? 176  LYS A CE    1 
ATOM   1302  N  NZ    . LYS A 1  176  ? 48.603  -22.585  49.473  1.00 201.12 ? 176  LYS A NZ    1 
ATOM   1303  N  N     . ASP A 1  177  ? 52.514  -17.524  52.306  1.00 163.47 ? 177  ASP A N     1 
ATOM   1304  C  CA    . ASP A 1  177  ? 51.918  -16.189  52.274  1.00 163.67 ? 177  ASP A CA    1 
ATOM   1305  C  C     . ASP A 1  177  ? 51.186  -15.970  50.946  1.00 165.05 ? 177  ASP A C     1 
ATOM   1306  O  O     . ASP A 1  177  ? 51.783  -15.512  49.966  1.00 164.80 ? 177  ASP A O     1 
ATOM   1307  C  CB    . ASP A 1  177  ? 52.983  -15.103  52.543  1.00 167.27 ? 177  ASP A CB    1 
ATOM   1308  C  CG    . ASP A 1  177  ? 52.440  -13.691  52.681  1.00 178.77 ? 177  ASP A CG    1 
ATOM   1309  O  OD1   . ASP A 1  177  ? 51.526  -13.482  53.513  1.00 179.51 ? 177  ASP A OD1   1 
ATOM   1310  O  OD2   . ASP A 1  177  ? 52.963  -12.786  51.996  1.00 185.45 ? 177  ASP A OD2   1 
ATOM   1311  N  N     . GLY A 1  178  ? 49.904  -16.333  50.933  1.00 159.38 ? 178  GLY A N     1 
ATOM   1312  C  CA    . GLY A 1  178  ? 49.034  -16.219  49.769  1.00 157.73 ? 178  GLY A CA    1 
ATOM   1313  C  C     . GLY A 1  178  ? 49.366  -17.226  48.689  1.00 158.50 ? 178  GLY A C     1 
ATOM   1314  O  O     . GLY A 1  178  ? 48.917  -18.373  48.748  1.00 156.87 ? 178  GLY A O     1 
ATOM   1315  N  N     . LEU A 1  179  ? 50.166  -16.799  47.699  1.00 154.05 ? 179  LEU A N     1 
ATOM   1316  C  CA    . LEU A 1  179  ? 50.588  -17.628  46.568  1.00 152.42 ? 179  LEU A CA    1 
ATOM   1317  C  C     . LEU A 1  179  ? 52.105  -17.892  46.558  1.00 155.90 ? 179  LEU A C     1 
ATOM   1318  O  O     . LEU A 1  179  ? 52.563  -18.786  45.842  1.00 154.79 ? 179  LEU A O     1 
ATOM   1319  C  CB    . LEU A 1  179  ? 50.123  -17.001  45.229  1.00 152.34 ? 179  LEU A CB    1 
ATOM   1320  C  CG    . LEU A 1  179  ? 48.645  -17.174  44.771  1.00 155.97 ? 179  LEU A CG    1 
ATOM   1321  C  CD1   . LEU A 1  179  ? 48.227  -18.637  44.668  1.00 154.53 ? 179  LEU A CD1   1 
ATOM   1322  C  CD2   . LEU A 1  179  ? 47.662  -16.331  45.590  1.00 158.84 ? 179  LEU A CD2   1 
ATOM   1323  N  N     . LYS A 1  180  ? 52.875  -17.119  47.358  1.00 153.02 ? 180  LYS A N     1 
ATOM   1324  C  CA    . LYS A 1  180  ? 54.335  -17.232  47.489  1.00 153.19 ? 180  LYS A CA    1 
ATOM   1325  C  C     . LYS A 1  180  ? 54.749  -17.656  48.908  1.00 157.24 ? 180  LYS A C     1 
ATOM   1326  O  O     . LYS A 1  180  ? 53.953  -17.539  49.843  1.00 156.62 ? 180  LYS A O     1 
ATOM   1327  C  CB    . LYS A 1  180  ? 55.024  -15.917  47.082  1.00 156.48 ? 180  LYS A CB    1 
ATOM   1328  C  CG    . LYS A 1  180  ? 55.136  -15.729  45.575  1.00 165.22 ? 180  LYS A CG    1 
ATOM   1329  C  CD    . LYS A 1  180  ? 55.682  -14.355  45.215  1.00 173.63 ? 180  LYS A CD    1 
ATOM   1330  C  CE    . LYS A 1  180  ? 55.815  -14.168  43.723  1.00 180.46 ? 180  LYS A CE    1 
ATOM   1331  N  NZ    . LYS A 1  180  ? 56.269  -12.794  43.373  1.00 187.44 ? 180  LYS A NZ    1 
ATOM   1332  N  N     . LEU A 1  181  ? 55.991  -18.156  49.062  1.00 154.27 ? 181  LEU A N     1 
ATOM   1333  C  CA    . LEU A 1  181  ? 56.521  -18.620  50.349  1.00 154.59 ? 181  LEU A CA    1 
ATOM   1334  C  C     . LEU A 1  181  ? 57.510  -17.644  50.997  1.00 160.83 ? 181  LEU A C     1 
ATOM   1335  O  O     . LEU A 1  181  ? 58.259  -16.959  50.295  1.00 161.25 ? 181  LEU A O     1 
ATOM   1336  C  CB    . LEU A 1  181  ? 57.166  -20.008  50.205  1.00 153.96 ? 181  LEU A CB    1 
ATOM   1337  C  CG    . LEU A 1  181  ? 56.225  -21.172  49.917  1.00 156.73 ? 181  LEU A CG    1 
ATOM   1338  C  CD1   . LEU A 1  181  ? 56.916  -22.221  49.095  1.00 156.34 ? 181  LEU A CD1   1 
ATOM   1339  C  CD2   . LEU A 1  181  ? 55.686  -21.781  51.200  1.00 158.76 ? 181  LEU A CD2   1 
ATOM   1340  N  N     . VAL A 1  182  ? 57.508  -17.595  52.344  1.00 158.33 ? 182  VAL A N     1 
ATOM   1341  C  CA    . VAL A 1  182  ? 58.389  -16.754  53.174  1.00 159.87 ? 182  VAL A CA    1 
ATOM   1342  C  C     . VAL A 1  182  ? 58.997  -17.585  54.344  1.00 164.50 ? 182  VAL A C     1 
ATOM   1343  O  O     . VAL A 1  182  ? 59.118  -18.806  54.213  1.00 163.46 ? 182  VAL A O     1 
ATOM   1344  C  CB    . VAL A 1  182  ? 57.728  -15.413  53.628  1.00 164.48 ? 182  VAL A CB    1 
ATOM   1345  C  CG1   . VAL A 1  182  ? 57.649  -14.409  52.481  1.00 164.32 ? 182  VAL A CG1   1 
ATOM   1346  C  CG2   . VAL A 1  182  ? 56.354  -15.632  54.261  1.00 163.59 ? 182  VAL A CG2   1 
ATOM   1347  N  N     . GLY A 1  183  ? 59.381  -16.926  55.444  1.00 162.37 ? 183  GLY A N     1 
ATOM   1348  C  CA    . GLY A 1  183  ? 59.955  -17.577  56.619  1.00 162.94 ? 183  GLY A CA    1 
ATOM   1349  C  C     . GLY A 1  183  ? 61.000  -16.742  57.332  1.00 168.19 ? 183  GLY A C     1 
ATOM   1350  O  O     . GLY A 1  183  ? 61.920  -16.226  56.692  1.00 168.52 ? 183  GLY A O     1 
ATOM   1351  N  N     . SER A 1  184  ? 60.870  -16.611  58.667  1.00 165.14 ? 184  SER A N     1 
ATOM   1352  C  CA    . SER A 1  184  ? 61.786  -15.831  59.504  1.00 166.51 ? 184  SER A CA    1 
ATOM   1353  C  C     . SER A 1  184  ? 63.115  -16.541  59.754  1.00 170.43 ? 184  SER A C     1 
ATOM   1354  O  O     . SER A 1  184  ? 63.135  -17.739  60.039  1.00 169.51 ? 184  SER A O     1 
ATOM   1355  C  CB    . SER A 1  184  ? 61.127  -15.458  60.828  1.00 170.92 ? 184  SER A CB    1 
ATOM   1356  O  OG    . SER A 1  184  ? 60.055  -14.550  60.632  1.00 179.22 ? 184  SER A OG    1 
ATOM   1357  N  N     . TRP A 1  185  ? 64.220  -15.785  59.659  1.00 168.03 ? 185  TRP A N     1 
ATOM   1358  C  CA    . TRP A 1  185  ? 65.585  -16.274  59.873  1.00 168.89 ? 185  TRP A CA    1 
ATOM   1359  C  C     . TRP A 1  185  ? 66.134  -15.880  61.260  1.00 173.07 ? 185  TRP A C     1 
ATOM   1360  O  O     . TRP A 1  185  ? 65.652  -14.915  61.862  1.00 173.00 ? 185  TRP A O     1 
ATOM   1361  C  CB    . TRP A 1  185  ? 66.513  -15.770  58.756  1.00 168.16 ? 185  TRP A CB    1 
ATOM   1362  C  CG    . TRP A 1  185  ? 66.684  -16.719  57.603  1.00 168.08 ? 185  TRP A CG    1 
ATOM   1363  C  CD1   . TRP A 1  185  ? 67.588  -17.736  57.509  1.00 171.51 ? 185  TRP A CD1   1 
ATOM   1364  C  CD2   . TRP A 1  185  ? 65.992  -16.679  56.347  1.00 166.34 ? 185  TRP A CD2   1 
ATOM   1365  N  NE1   . TRP A 1  185  ? 67.483  -18.352  56.284  1.00 169.77 ? 185  TRP A NE1   1 
ATOM   1366  C  CE2   . TRP A 1  185  ? 66.518  -17.717  55.546  1.00 169.86 ? 185  TRP A CE2   1 
ATOM   1367  C  CE3   . TRP A 1  185  ? 64.974  -15.868  55.820  1.00 166.65 ? 185  TRP A CE3   1 
ATOM   1368  C  CZ2   . TRP A 1  185  ? 66.059  -17.967  54.245  1.00 167.75 ? 185  TRP A CZ2   1 
ATOM   1369  C  CZ3   . TRP A 1  185  ? 64.502  -16.132  54.541  1.00 166.75 ? 185  TRP A CZ3   1 
ATOM   1370  C  CH2   . TRP A 1  185  ? 65.041  -17.171  53.769  1.00 166.93 ? 185  TRP A CH2   1 
ATOM   1371  N  N     . LYS A 1  186  ? 67.154  -16.634  61.747  1.00 169.70 ? 186  LYS A N     1 
ATOM   1372  C  CA    . LYS A 1  186  ? 67.841  -16.482  63.041  1.00 185.33 ? 186  LYS A CA    1 
ATOM   1373  C  C     . LYS A 1  186  ? 66.894  -16.688  64.224  1.00 200.82 ? 186  LYS A C     1 
ATOM   1374  O  O     . LYS A 1  186  ? 67.245  -17.382  65.176  1.00 157.96 ? 186  LYS A O     1 
ATOM   1375  C  CB    . LYS A 1  186  ? 68.605  -15.143  63.148  1.00 188.98 ? 186  LYS A CB    1 
ATOM   1376  C  CG    . LYS A 1  186  ? 69.581  -15.062  64.320  1.00 199.53 ? 186  LYS A CG    1 
ATOM   1377  C  CD    . LYS A 1  186  ? 70.102  -13.645  64.520  1.00 206.94 ? 186  LYS A CD    1 
ATOM   1378  C  CE    . LYS A 1  186  ? 70.930  -13.494  65.774  1.00 213.02 ? 186  LYS A CE    1 
ATOM   1379  N  NZ    . LYS A 1  186  ? 72.295  -14.060  65.618  1.00 219.80 ? 186  LYS A NZ    1 
ATOM   1380  N  N     . LEU A 1  199  ? 62.630  -13.568  56.966  1.00 161.44 ? 199  LEU A N     1 
ATOM   1381  C  CA    . LEU A 1  199  ? 62.932  -12.186  56.600  1.00 162.31 ? 199  LEU A CA    1 
ATOM   1382  C  C     . LEU A 1  199  ? 62.828  -11.951  55.082  1.00 166.00 ? 199  LEU A C     1 
ATOM   1383  O  O     . LEU A 1  199  ? 62.193  -10.983  54.659  1.00 165.47 ? 199  LEU A O     1 
ATOM   1384  C  CB    . LEU A 1  199  ? 64.324  -11.771  57.127  1.00 164.10 ? 199  LEU A CB    1 
ATOM   1385  C  CG    . LEU A 1  199  ? 64.476  -11.636  58.647  1.00 169.89 ? 199  LEU A CG    1 
ATOM   1386  C  CD1   . LEU A 1  199  ? 65.863  -12.042  59.092  1.00 171.30 ? 199  LEU A CD1   1 
ATOM   1387  C  CD2   . LEU A 1  199  ? 64.171  -10.221  59.115  1.00 173.17 ? 199  LEU A CD2   1 
ATOM   1388  N  N     . ARG A 1  200  ? 63.444  -12.842  54.273  1.00 162.58 ? 200  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  200  ? 63.480  -12.780  52.805  1.00 161.88 ? 200  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  200  ? 62.372  -13.629  52.166  1.00 164.16 ? 200  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  200  ? 62.062  -14.716  52.663  1.00 163.01 ? 200  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  200  ? 64.868  -13.232  52.297  1.00 163.07 ? 200  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  200  ? 65.139  -12.981  50.811  1.00 174.20 ? 200  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  200  ? 66.468  -13.562  50.352  1.00 186.34 ? 200  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  200  ? 66.453  -15.027  50.301  1.00 194.56 ? 200  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  200  ? 67.168  -15.816  51.099  1.00 209.63 ? 200  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  200  ? 67.977  -15.293  52.013  1.00 198.34 ? 200  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  200  ? 67.089  -17.135  50.980  1.00 195.69 ? 200  ARG A NH2   1 
ATOM   1399  N  N     . VAL A 1  201  ? 61.797  -13.134  51.050  1.00 160.27 ? 201  VAL A N     1 
ATOM   1400  C  CA    . VAL A 1  201  ? 60.746  -13.813  50.282  1.00 158.46 ? 201  VAL A CA    1 
ATOM   1401  C  C     . VAL A 1  201  ? 61.399  -14.919  49.432  1.00 161.79 ? 201  VAL A C     1 
ATOM   1402  O  O     . VAL A 1  201  ? 62.320  -14.634  48.660  1.00 162.21 ? 201  VAL A O     1 
ATOM   1403  C  CB    . VAL A 1  201  ? 59.908  -12.825  49.413  1.00 162.17 ? 201  VAL A CB    1 
ATOM   1404  C  CG1   . VAL A 1  201  ? 58.725  -13.532  48.752  1.00 160.23 ? 201  VAL A CG1   1 
ATOM   1405  C  CG2   . VAL A 1  201  ? 59.425  -11.627  50.231  1.00 162.96 ? 201  VAL A CG2   1 
ATOM   1406  N  N     . LEU A 1  202  ? 60.928  -16.174  49.589  1.00 156.90 ? 202  LEU A N     1 
ATOM   1407  C  CA    . LEU A 1  202  ? 61.446  -17.334  48.855  1.00 155.98 ? 202  LEU A CA    1 
ATOM   1408  C  C     . LEU A 1  202  ? 60.923  -17.397  47.418  1.00 158.50 ? 202  LEU A C     1 
ATOM   1409  O  O     . LEU A 1  202  ? 59.739  -17.669  47.190  1.00 156.76 ? 202  LEU A O     1 
ATOM   1410  C  CB    . LEU A 1  202  ? 61.177  -18.647  49.610  1.00 155.22 ? 202  LEU A CB    1 
ATOM   1411  C  CG    . LEU A 1  202  ? 62.207  -19.028  50.667  1.00 161.01 ? 202  LEU A CG    1 
ATOM   1412  C  CD1   . LEU A 1  202  ? 61.779  -18.564  52.051  1.00 161.68 ? 202  LEU A CD1   1 
ATOM   1413  C  CD2   . LEU A 1  202  ? 62.437  -20.522  50.676  1.00 162.82 ? 202  LEU A CD2   1 
ATOM   1414  N  N     . SER A 1  203  ? 61.818  -17.127  46.452  1.00 155.50 ? 203  SER A N     1 
ATOM   1415  C  CA    . SER A 1  203  ? 61.517  -17.125  45.021  1.00 154.66 ? 203  SER A CA    1 
ATOM   1416  C  C     . SER A 1  203  ? 61.276  -18.539  44.485  1.00 156.98 ? 203  SER A C     1 
ATOM   1417  O  O     . SER A 1  203  ? 61.806  -19.505  45.036  1.00 156.40 ? 203  SER A O     1 
ATOM   1418  C  CB    . SER A 1  203  ? 62.640  -16.442  44.245  1.00 159.60 ? 203  SER A CB    1 
ATOM   1419  O  OG    . SER A 1  203  ? 62.350  -16.348  42.860  1.00 168.02 ? 203  SER A OG    1 
ATOM   1420  N  N     . THR A 1  204  ? 60.470  -18.650  43.408  1.00 152.43 ? 204  THR A N     1 
ATOM   1421  C  CA    . THR A 1  204  ? 60.146  -19.926  42.758  1.00 150.89 ? 204  THR A CA    1 
ATOM   1422  C  C     . THR A 1  204  ? 61.354  -20.476  41.995  1.00 154.48 ? 204  THR A C     1 
ATOM   1423  O  O     . THR A 1  204  ? 61.519  -21.694  41.915  1.00 153.41 ? 204  THR A O     1 
ATOM   1424  C  CB    . THR A 1  204  ? 58.898  -19.815  41.871  1.00 158.74 ? 204  THR A CB    1 
ATOM   1425  O  OG1   . THR A 1  204  ? 58.022  -18.794  42.357  1.00 158.80 ? 204  THR A OG1   1 
ATOM   1426  C  CG2   . THR A 1  204  ? 58.148  -21.132  41.772  1.00 156.15 ? 204  THR A CG2   1 
ATOM   1427  N  N     . GLU A 1  205  ? 62.199  -19.576  41.449  1.00 151.62 ? 205  GLU A N     1 
ATOM   1428  C  CA    . GLU A 1  205  ? 63.431  -19.924  40.736  1.00 152.04 ? 205  GLU A CA    1 
ATOM   1429  C  C     . GLU A 1  205  ? 64.521  -20.318  41.751  1.00 155.37 ? 205  GLU A C     1 
ATOM   1430  O  O     . GLU A 1  205  ? 65.431  -21.077  41.410  1.00 155.50 ? 205  GLU A O     1 
ATOM   1431  C  CB    . GLU A 1  205  ? 63.890  -18.756  39.847  1.00 154.62 ? 205  GLU A CB    1 
ATOM   1432  C  CG    . GLU A 1  205  ? 64.685  -19.183  38.622  1.00 165.57 ? 205  GLU A CG    1 
ATOM   1433  C  CD    . GLU A 1  205  ? 64.789  -18.140  37.524  1.00 184.71 ? 205  GLU A CD    1 
ATOM   1434  O  OE1   . GLU A 1  205  ? 65.375  -17.063  37.776  1.00 180.37 ? 205  GLU A OE1   1 
ATOM   1435  O  OE2   . GLU A 1  205  ? 64.308  -18.413  36.399  1.00 174.79 ? 205  GLU A OE2   1 
ATOM   1436  N  N     . GLU A 1  206  ? 64.405  -19.809  43.002  1.00 151.01 ? 206  GLU A N     1 
ATOM   1437  C  CA    . GLU A 1  206  ? 65.305  -20.099  44.120  1.00 151.28 ? 206  GLU A CA    1 
ATOM   1438  C  C     . GLU A 1  206  ? 65.038  -21.528  44.612  1.00 153.52 ? 206  GLU A C     1 
ATOM   1439  O  O     . GLU A 1  206  ? 65.984  -22.303  44.754  1.00 153.85 ? 206  GLU A O     1 
ATOM   1440  C  CB    . GLU A 1  206  ? 65.098  -19.075  45.257  1.00 153.03 ? 206  GLU A CB    1 
ATOM   1441  C  CG    . GLU A 1  206  ? 66.103  -19.163  46.394  1.00 164.29 ? 206  GLU A CG    1 
ATOM   1442  C  CD    . GLU A 1  206  ? 65.748  -18.352  47.625  1.00 183.15 ? 206  GLU A CD    1 
ATOM   1443  O  OE1   . GLU A 1  206  ? 66.452  -17.355  47.902  1.00 176.52 ? 206  GLU A OE1   1 
ATOM   1444  O  OE2   . GLU A 1  206  ? 64.776  -18.720  48.323  1.00 176.19 ? 206  GLU A OE2   1 
ATOM   1445  N  N     . ILE A 1  207  ? 63.747  -21.873  44.846  1.00 148.02 ? 207  ILE A N     1 
ATOM   1446  C  CA    . ILE A 1  207  ? 63.278  -23.191  45.308  1.00 146.60 ? 207  ILE A CA    1 
ATOM   1447  C  C     . ILE A 1  207  ? 63.587  -24.290  44.263  1.00 149.39 ? 207  ILE A C     1 
ATOM   1448  O  O     . ILE A 1  207  ? 63.976  -25.398  44.639  1.00 148.83 ? 207  ILE A O     1 
ATOM   1449  C  CB    . ILE A 1  207  ? 61.783  -23.120  45.774  1.00 148.25 ? 207  ILE A CB    1 
ATOM   1450  C  CG1   . ILE A 1  207  ? 61.646  -22.226  47.037  1.00 149.38 ? 207  ILE A CG1   1 
ATOM   1451  C  CG2   . ILE A 1  207  ? 61.179  -24.510  46.037  1.00 147.62 ? 207  ILE A CG2   1 
ATOM   1452  C  CD1   . ILE A 1  207  ? 60.278  -21.556  47.257  1.00 155.79 ? 207  ILE A CD1   1 
ATOM   1453  N  N     . LEU A 1  208  ? 63.470  -23.949  42.961  1.00 145.56 ? 208  LEU A N     1 
ATOM   1454  C  CA    . LEU A 1  208  ? 63.774  -24.818  41.817  1.00 145.27 ? 208  LEU A CA    1 
ATOM   1455  C  C     . LEU A 1  208  ? 65.258  -25.240  41.853  1.00 151.23 ? 208  LEU A C     1 
ATOM   1456  O  O     . LEU A 1  208  ? 65.552  -26.426  41.691  1.00 150.80 ? 208  LEU A O     1 
ATOM   1457  C  CB    . LEU A 1  208  ? 63.358  -24.094  40.494  1.00 144.94 ? 208  LEU A CB    1 
ATOM   1458  C  CG    . LEU A 1  208  ? 64.042  -24.317  39.106  1.00 150.23 ? 208  LEU A CG    1 
ATOM   1459  C  CD1   . LEU A 1  208  ? 65.284  -23.451  38.908  1.00 152.11 ? 208  LEU A CD1   1 
ATOM   1460  C  CD2   . LEU A 1  208  ? 64.194  -25.786  38.709  1.00 152.23 ? 208  LEU A CD2   1 
ATOM   1461  N  N     . ASN A 1  209  ? 66.170  -24.277  42.124  1.00 149.53 ? 209  ASN A N     1 
ATOM   1462  C  CA    . ASN A 1  209  ? 67.623  -24.480  42.211  1.00 151.19 ? 209  ASN A CA    1 
ATOM   1463  C  C     . ASN A 1  209  ? 68.008  -25.470  43.319  1.00 155.12 ? 209  ASN A C     1 
ATOM   1464  O  O     . ASN A 1  209  ? 69.020  -26.164  43.197  1.00 155.77 ? 209  ASN A O     1 
ATOM   1465  C  CB    . ASN A 1  209  ? 68.337  -23.135  42.409  1.00 154.09 ? 209  ASN A CB    1 
ATOM   1466  C  CG    . ASN A 1  209  ? 69.823  -23.131  42.111  1.00 181.16 ? 209  ASN A CG    1 
ATOM   1467  O  OD1   . ASN A 1  209  ? 70.341  -23.921  41.310  1.00 176.70 ? 209  ASN A OD1   1 
ATOM   1468  N  ND2   . ASN A 1  209  ? 70.537  -22.187  42.711  1.00 173.91 ? 209  ASN A ND2   1 
ATOM   1469  N  N     . ILE A 1  210  ? 67.188  -25.540  44.383  1.00 150.78 ? 210  ILE A N     1 
ATOM   1470  C  CA    . ILE A 1  210  ? 67.370  -26.444  45.521  1.00 151.01 ? 210  ILE A CA    1 
ATOM   1471  C  C     . ILE A 1  210  ? 66.818  -27.822  45.151  1.00 153.96 ? 210  ILE A C     1 
ATOM   1472  O  O     . ILE A 1  210  ? 67.532  -28.821  45.251  1.00 154.16 ? 210  ILE A O     1 
ATOM   1473  C  CB    . ILE A 1  210  ? 66.694  -25.871  46.813  1.00 153.78 ? 210  ILE A CB    1 
ATOM   1474  C  CG1   . ILE A 1  210  ? 67.117  -24.406  47.139  1.00 155.39 ? 210  ILE A CG1   1 
ATOM   1475  C  CG2   . ILE A 1  210  ? 66.839  -26.806  48.026  1.00 154.75 ? 210  ILE A CG2   1 
ATOM   1476  C  CD1   . ILE A 1  210  ? 68.666  -24.087  47.296  1.00 165.70 ? 210  ILE A CD1   1 
ATOM   1477  N  N     . PHE A 1  211  ? 65.546  -27.857  44.714  1.00 149.21 ? 211  PHE A N     1 
ATOM   1478  C  CA    . PHE A 1  211  ? 64.802  -29.060  44.346  1.00 148.00 ? 211  PHE A CA    1 
ATOM   1479  C  C     . PHE A 1  211  ? 65.400  -29.866  43.197  1.00 152.51 ? 211  PHE A C     1 
ATOM   1480  O  O     . PHE A 1  211  ? 65.304  -31.096  43.216  1.00 151.83 ? 211  PHE A O     1 
ATOM   1481  C  CB    . PHE A 1  211  ? 63.321  -28.733  44.109  1.00 148.02 ? 211  PHE A CB    1 
ATOM   1482  C  CG    . PHE A 1  211  ? 62.471  -28.669  45.360  1.00 148.95 ? 211  PHE A CG    1 
ATOM   1483  C  CD1   . PHE A 1  211  ? 62.803  -27.815  46.407  1.00 152.84 ? 211  PHE A CD1   1 
ATOM   1484  C  CD2   . PHE A 1  211  ? 61.309  -29.425  45.470  1.00 149.83 ? 211  PHE A CD2   1 
ATOM   1485  C  CE1   . PHE A 1  211  ? 62.013  -27.752  47.555  1.00 153.29 ? 211  PHE A CE1   1 
ATOM   1486  C  CE2   . PHE A 1  211  ? 60.512  -29.349  46.616  1.00 152.12 ? 211  PHE A CE2   1 
ATOM   1487  C  CZ    . PHE A 1  211  ? 60.864  -28.504  47.646  1.00 151.07 ? 211  PHE A CZ    1 
ATOM   1488  N  N     . LYS A 1  212  ? 66.043  -29.192  42.219  1.00 149.87 ? 212  LYS A N     1 
ATOM   1489  C  CA    . LYS A 1  212  ? 66.675  -29.879  41.086  1.00 150.22 ? 212  LYS A CA    1 
ATOM   1490  C  C     . LYS A 1  212  ? 68.066  -30.445  41.445  1.00 155.91 ? 212  LYS A C     1 
ATOM   1491  O  O     . LYS A 1  212  ? 68.774  -30.954  40.571  1.00 156.50 ? 212  LYS A O     1 
ATOM   1492  C  CB    . LYS A 1  212  ? 66.684  -29.005  39.814  1.00 152.40 ? 212  LYS A CB    1 
ATOM   1493  C  CG    . LYS A 1  212  ? 66.326  -29.791  38.553  1.00 161.28 ? 212  LYS A CG    1 
ATOM   1494  C  CD    . LYS A 1  212  ? 65.944  -28.892  37.379  1.00 167.72 ? 212  LYS A CD    1 
ATOM   1495  C  CE    . LYS A 1  212  ? 65.588  -29.668  36.129  1.00 173.30 ? 212  LYS A CE    1 
ATOM   1496  N  NZ    . LYS A 1  212  ? 64.263  -30.340  36.232  1.00 177.35 ? 212  LYS A NZ    1 
ATOM   1497  N  N     . HIS A 1  213  ? 68.429  -30.393  42.744  1.00 152.92 ? 213  HIS A N     1 
ATOM   1498  C  CA    . HIS A 1  213  ? 69.694  -30.907  43.257  1.00 154.69 ? 213  HIS A CA    1 
ATOM   1499  C  C     . HIS A 1  213  ? 69.564  -31.424  44.703  1.00 158.59 ? 213  HIS A C     1 
ATOM   1500  O  O     . HIS A 1  213  ? 70.327  -31.008  45.583  1.00 159.47 ? 213  HIS A O     1 
ATOM   1501  C  CB    . HIS A 1  213  ? 70.813  -29.860  43.104  1.00 157.11 ? 213  HIS A CB    1 
ATOM   1502  C  CG    . HIS A 1  213  ? 72.124  -30.450  42.692  1.00 162.47 ? 213  HIS A CG    1 
ATOM   1503  N  ND1   . HIS A 1  213  ? 73.091  -30.781  43.624  1.00 165.89 ? 213  HIS A ND1   1 
ATOM   1504  C  CD2   . HIS A 1  213  ? 72.581  -30.764  41.458  1.00 164.79 ? 213  HIS A CD2   1 
ATOM   1505  C  CE1   . HIS A 1  213  ? 74.103  -31.276  42.930  1.00 166.89 ? 213  HIS A CE1   1 
ATOM   1506  N  NE2   . HIS A 1  213  ? 73.841  -31.286  41.623  1.00 166.65 ? 213  HIS A NE2   1 
ATOM   1507  N  N     . ILE A 1  214  ? 68.600  -32.345  44.941  1.00 153.72 ? 214  ILE A N     1 
ATOM   1508  C  CA    . ILE A 1  214  ? 68.388  -32.948  46.265  1.00 153.61 ? 214  ILE A CA    1 
ATOM   1509  C  C     . ILE A 1  214  ? 69.396  -34.109  46.474  1.00 159.98 ? 214  ILE A C     1 
ATOM   1510  O  O     . ILE A 1  214  ? 70.588  -33.833  46.636  1.00 161.77 ? 214  ILE A O     1 
ATOM   1511  C  CB    . ILE A 1  214  ? 66.884  -33.287  46.578  1.00 154.39 ? 214  ILE A CB    1 
ATOM   1512  C  CG1   . ILE A 1  214  ? 65.937  -32.075  46.340  1.00 153.19 ? 214  ILE A CG1   1 
ATOM   1513  C  CG2   . ILE A 1  214  ? 66.686  -33.881  47.992  1.00 155.21 ? 214  ILE A CG2   1 
ATOM   1514  C  CD1   . ILE A 1  214  ? 65.958  -30.899  47.402  1.00 159.97 ? 214  ILE A CD1   1 
ATOM   1515  N  N     . SER A 1  215  ? 68.935  -35.382  46.449  1.00 156.08 ? 215  SER A N     1 
ATOM   1516  C  CA    . SER A 1  215  ? 69.759  -36.581  46.641  1.00 157.54 ? 215  SER A CA    1 
ATOM   1517  C  C     . SER A 1  215  ? 69.076  -37.786  46.007  1.00 160.80 ? 215  SER A C     1 
ATOM   1518  O  O     . SER A 1  215  ? 67.852  -37.862  46.017  1.00 158.40 ? 215  SER A O     1 
ATOM   1519  C  CB    . SER A 1  215  ? 70.009  -36.834  48.125  1.00 161.66 ? 215  SER A CB    1 
ATOM   1520  O  OG    . SER A 1  215  ? 70.878  -37.935  48.337  1.00 170.66 ? 215  SER A OG    1 
ATOM   1521  N  N     . VAL A 1  216  ? 69.872  -38.721  45.460  1.00 159.06 ? 216  VAL A N     1 
ATOM   1522  C  CA    . VAL A 1  216  ? 69.409  -39.930  44.762  1.00 158.32 ? 216  VAL A CA    1 
ATOM   1523  C  C     . VAL A 1  216  ? 68.695  -40.937  45.697  1.00 161.68 ? 216  VAL A C     1 
ATOM   1524  O  O     . VAL A 1  216  ? 67.623  -41.433  45.342  1.00 159.42 ? 216  VAL A O     1 
ATOM   1525  C  CB    . VAL A 1  216  ? 70.547  -40.589  43.921  1.00 164.01 ? 216  VAL A CB    1 
ATOM   1526  C  CG1   . VAL A 1  216  ? 70.001  -41.667  42.987  1.00 163.06 ? 216  VAL A CG1   1 
ATOM   1527  C  CG2   . VAL A 1  216  ? 71.331  -39.546  43.122  1.00 164.55 ? 216  VAL A CG2   1 
ATOM   1528  N  N     . LYS A 1  217  ? 69.293  -41.234  46.874  1.00 159.88 ? 217  LYS A N     1 
ATOM   1529  C  CA    . LYS A 1  217  ? 68.766  -42.193  47.858  1.00 159.63 ? 217  LYS A CA    1 
ATOM   1530  C  C     . LYS A 1  217  ? 67.796  -41.577  48.879  1.00 161.88 ? 217  LYS A C     1 
ATOM   1531  O  O     . LYS A 1  217  ? 66.805  -42.225  49.226  1.00 160.31 ? 217  LYS A O     1 
ATOM   1532  C  CB    . LYS A 1  217  ? 69.914  -42.938  48.562  1.00 164.82 ? 217  LYS A CB    1 
ATOM   1533  C  CG    . LYS A 1  217  ? 69.507  -44.283  49.159  1.00 178.61 ? 217  LYS A CG    1 
ATOM   1534  C  CD    . LYS A 1  217  ? 69.523  -44.259  50.686  1.00 188.43 ? 217  LYS A CD    1 
ATOM   1535  C  CE    . LYS A 1  217  ? 70.740  -44.933  51.278  1.00 200.70 ? 217  LYS A CE    1 
ATOM   1536  N  NZ    . LYS A 1  217  ? 71.974  -44.121  51.109  1.00 211.26 ? 217  LYS A NZ    1 
ATOM   1537  N  N     . ASP A 1  218  ? 68.081  -40.339  49.360  1.00 158.33 ? 218  ASP A N     1 
ATOM   1538  C  CA    . ASP A 1  218  ? 67.242  -39.595  50.318  1.00 156.79 ? 218  ASP A CA    1 
ATOM   1539  C  C     . ASP A 1  218  ? 65.879  -39.259  49.698  1.00 157.28 ? 218  ASP A C     1 
ATOM   1540  O  O     . ASP A 1  218  ? 64.905  -39.025  50.412  1.00 155.75 ? 218  ASP A O     1 
ATOM   1541  C  CB    . ASP A 1  218  ? 67.945  -38.302  50.774  1.00 159.47 ? 218  ASP A CB    1 
ATOM   1542  C  CG    . ASP A 1  218  ? 69.166  -38.511  51.648  1.00 170.64 ? 218  ASP A CG    1 
ATOM   1543  O  OD1   . ASP A 1  218  ? 69.006  -39.002  52.786  1.00 171.59 ? 218  ASP A OD1   1 
ATOM   1544  O  OD2   . ASP A 1  218  ? 70.273  -38.122  51.221  1.00 177.37 ? 218  ASP A OD2   1 
ATOM   1545  N  N     . PHE A 1  219  ? 65.844  -39.250  48.358  1.00 152.47 ? 219  PHE A N     1 
ATOM   1546  C  CA    . PHE A 1  219  ? 64.723  -39.017  47.455  1.00 149.95 ? 219  PHE A CA    1 
ATOM   1547  C  C     . PHE A 1  219  ? 63.579  -39.997  47.742  1.00 151.05 ? 219  PHE A C     1 
ATOM   1548  O  O     . PHE A 1  219  ? 62.494  -39.584  48.154  1.00 148.89 ? 219  PHE A O     1 
ATOM   1549  C  CB    . PHE A 1  219  ? 65.252  -39.261  46.033  1.00 152.25 ? 219  PHE A CB    1 
ATOM   1550  C  CG    . PHE A 1  219  ? 64.361  -38.946  44.866  1.00 152.38 ? 219  PHE A CG    1 
ATOM   1551  C  CD1   . PHE A 1  219  ? 63.289  -39.768  44.548  1.00 154.46 ? 219  PHE A CD1   1 
ATOM   1552  C  CD2   . PHE A 1  219  ? 64.665  -37.899  44.007  1.00 154.81 ? 219  PHE A CD2   1 
ATOM   1553  C  CE1   . PHE A 1  219  ? 62.482  -39.493  43.451  1.00 154.10 ? 219  PHE A CE1   1 
ATOM   1554  C  CE2   . PHE A 1  219  ? 63.870  -37.640  42.892  1.00 156.47 ? 219  PHE A CE2   1 
ATOM   1555  C  CZ    . PHE A 1  219  ? 62.781  -38.438  42.626  1.00 153.26 ? 219  PHE A CZ    1 
ATOM   1556  N  N     . THR A 1  220  ? 63.838  -41.297  47.494  1.00 147.51 ? 220  THR A N     1 
ATOM   1557  C  CA    . THR A 1  220  ? 62.914  -42.422  47.652  1.00 146.15 ? 220  THR A CA    1 
ATOM   1558  C  C     . THR A 1  220  ? 62.484  -42.637  49.101  1.00 149.69 ? 220  THR A C     1 
ATOM   1559  O  O     . THR A 1  220  ? 61.420  -43.212  49.341  1.00 148.33 ? 220  THR A O     1 
ATOM   1560  C  CB    . THR A 1  220  ? 63.512  -43.693  47.033  1.00 154.66 ? 220  THR A CB    1 
ATOM   1561  O  OG1   . THR A 1  220  ? 64.792  -43.941  47.619  1.00 156.72 ? 220  THR A OG1   1 
ATOM   1562  C  CG2   . THR A 1  220  ? 63.636  -43.608  45.513  1.00 152.35 ? 220  THR A CG2   1 
ATOM   1563  N  N     . SER A 1  221  ? 63.307  -42.168  50.060  1.00 147.11 ? 221  SER A N     1 
ATOM   1564  C  CA    . SER A 1  221  ? 63.057  -42.252  51.500  1.00 147.19 ? 221  SER A CA    1 
ATOM   1565  C  C     . SER A 1  221  ? 61.845  -41.400  51.900  1.00 148.90 ? 221  SER A C     1 
ATOM   1566  O  O     . SER A 1  221  ? 61.115  -41.772  52.821  1.00 148.05 ? 221  SER A O     1 
ATOM   1567  C  CB    . SER A 1  221  ? 64.291  -41.809  52.278  1.00 152.38 ? 221  SER A CB    1 
ATOM   1568  O  OG    . SER A 1  221  ? 65.440  -42.535  51.873  1.00 161.58 ? 221  SER A OG    1 
ATOM   1569  N  N     . LEU A 1  222  ? 61.624  -40.273  51.190  1.00 144.22 ? 222  LEU A N     1 
ATOM   1570  C  CA    . LEU A 1  222  ? 60.505  -39.360  51.438  1.00 142.46 ? 222  LEU A CA    1 
ATOM   1571  C  C     . LEU A 1  222  ? 59.293  -39.503  50.477  1.00 144.44 ? 222  LEU A C     1 
ATOM   1572  O  O     . LEU A 1  222  ? 58.561  -38.536  50.247  1.00 142.66 ? 222  LEU A O     1 
ATOM   1573  C  CB    . LEU A 1  222  ? 60.965  -37.897  51.643  1.00 142.79 ? 222  LEU A CB    1 
ATOM   1574  C  CG    . LEU A 1  222  ? 62.010  -37.336  50.684  1.00 147.97 ? 222  LEU A CG    1 
ATOM   1575  C  CD1   . LEU A 1  222  ? 61.361  -36.618  49.523  1.00 146.53 ? 222  LEU A CD1   1 
ATOM   1576  C  CD2   . LEU A 1  222  ? 62.943  -36.395  51.405  1.00 151.70 ? 222  LEU A CD2   1 
ATOM   1577  N  N     . GLY A 1  223  ? 59.087  -40.722  49.962  1.00 140.85 ? 223  GLY A N     1 
ATOM   1578  C  CA    . GLY A 1  223  ? 57.949  -41.081  49.117  1.00 138.85 ? 223  GLY A CA    1 
ATOM   1579  C  C     . GLY A 1  223  ? 58.096  -41.079  47.605  1.00 141.81 ? 223  GLY A C     1 
ATOM   1580  O  O     . GLY A 1  223  ? 57.557  -41.970  46.938  1.00 140.70 ? 223  GLY A O     1 
ATOM   1581  N  N     . PHE A 1  224  ? 58.772  -40.053  47.049  1.00 138.19 ? 224  PHE A N     1 
ATOM   1582  C  CA    . PHE A 1  224  ? 58.960  -39.838  45.605  1.00 137.17 ? 224  PHE A CA    1 
ATOM   1583  C  C     . PHE A 1  224  ? 59.611  -40.993  44.833  1.00 141.03 ? 224  PHE A C     1 
ATOM   1584  O  O     . PHE A 1  224  ? 60.512  -41.654  45.353  1.00 142.12 ? 224  PHE A O     1 
ATOM   1585  C  CB    . PHE A 1  224  ? 59.696  -38.515  45.347  1.00 139.41 ? 224  PHE A CB    1 
ATOM   1586  C  CG    . PHE A 1  224  ? 58.883  -37.275  45.630  1.00 139.79 ? 224  PHE A CG    1 
ATOM   1587  C  CD1   . PHE A 1  224  ? 58.870  -36.706  46.898  1.00 143.07 ? 224  PHE A CD1   1 
ATOM   1588  C  CD2   . PHE A 1  224  ? 58.144  -36.665  44.623  1.00 140.67 ? 224  PHE A CD2   1 
ATOM   1589  C  CE1   . PHE A 1  224  ? 58.126  -35.552  47.156  1.00 143.15 ? 224  PHE A CE1   1 
ATOM   1590  C  CE2   . PHE A 1  224  ? 57.395  -35.514  44.884  1.00 142.66 ? 224  PHE A CE2   1 
ATOM   1591  C  CZ    . PHE A 1  224  ? 57.389  -34.968  46.150  1.00 141.12 ? 224  PHE A CZ    1 
ATOM   1592  N  N     . ASN A 1  225  ? 59.149  -41.223  43.584  1.00 136.08 ? 225  ASN A N     1 
ATOM   1593  C  CA    . ASN A 1  225  ? 59.643  -42.280  42.695  1.00 136.27 ? 225  ASN A CA    1 
ATOM   1594  C  C     . ASN A 1  225  ? 60.593  -41.715  41.638  1.00 140.22 ? 225  ASN A C     1 
ATOM   1595  O  O     . ASN A 1  225  ? 60.191  -40.886  40.817  1.00 138.77 ? 225  ASN A O     1 
ATOM   1596  C  CB    . ASN A 1  225  ? 58.478  -43.026  42.034  1.00 135.44 ? 225  ASN A CB    1 
ATOM   1597  C  CG    . ASN A 1  225  ? 58.818  -44.407  41.524  1.00 157.58 ? 225  ASN A CG    1 
ATOM   1598  O  OD1   . ASN A 1  225  ? 58.429  -45.418  42.116  1.00 152.91 ? 225  ASN A OD1   1 
ATOM   1599  N  ND2   . ASN A 1  225  ? 59.513  -44.488  40.395  1.00 148.25 ? 225  ASN A ND2   1 
ATOM   1600  N  N     . GLU A 1  226  ? 61.855  -42.192  41.660  1.00 137.96 ? 226  GLU A N     1 
ATOM   1601  C  CA    . GLU A 1  226  ? 62.963  -41.800  40.779  1.00 138.50 ? 226  GLU A CA    1 
ATOM   1602  C  C     . GLU A 1  226  ? 62.584  -41.707  39.297  1.00 140.85 ? 226  GLU A C     1 
ATOM   1603  O  O     . GLU A 1  226  ? 62.924  -40.723  38.640  1.00 140.48 ? 226  GLU A O     1 
ATOM   1604  C  CB    . GLU A 1  226  ? 64.151  -42.757  40.979  1.00 141.80 ? 226  GLU A CB    1 
ATOM   1605  C  CG    . GLU A 1  226  ? 65.469  -42.251  40.414  1.00 152.26 ? 226  GLU A CG    1 
ATOM   1606  C  CD    . GLU A 1  226  ? 66.452  -43.314  39.957  1.00 170.48 ? 226  GLU A CD    1 
ATOM   1607  O  OE1   . GLU A 1  226  ? 66.318  -44.487  40.377  1.00 163.45 ? 226  GLU A OE1   1 
ATOM   1608  O  OE2   . GLU A 1  226  ? 67.369  -42.966  39.180  1.00 163.39 ? 226  GLU A OE2   1 
ATOM   1609  N  N     . VAL A 1  227  ? 61.865  -42.718  38.791  1.00 136.27 ? 227  VAL A N     1 
ATOM   1610  C  CA    . VAL A 1  227  ? 61.459  -42.824  37.391  1.00 135.48 ? 227  VAL A CA    1 
ATOM   1611  C  C     . VAL A 1  227  ? 60.210  -41.996  37.049  1.00 137.82 ? 227  VAL A C     1 
ATOM   1612  O  O     . VAL A 1  227  ? 60.223  -41.266  36.055  1.00 136.96 ? 227  VAL A O     1 
ATOM   1613  C  CB    . VAL A 1  227  ? 61.300  -44.309  36.946  1.00 139.54 ? 227  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1  227  ? 61.323  -44.439  35.424  1.00 139.37 ? 227  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1  227  ? 62.366  -45.207  37.573  1.00 141.27 ? 227  VAL A CG2   1 
ATOM   1616  N  N     . PHE A 1  228  ? 59.136  -42.125  37.854  1.00 133.61 ? 228  PHE A N     1 
ATOM   1617  C  CA    . PHE A 1  228  ? 57.833  -41.507  37.585  1.00 131.73 ? 228  PHE A CA    1 
ATOM   1618  C  C     . PHE A 1  228  ? 57.513  -40.136  38.187  1.00 136.15 ? 228  PHE A C     1 
ATOM   1619  O  O     . PHE A 1  228  ? 56.943  -39.304  37.478  1.00 134.76 ? 228  PHE A O     1 
ATOM   1620  C  CB    . PHE A 1  228  ? 56.692  -42.518  37.793  1.00 132.08 ? 228  PHE A CB    1 
ATOM   1621  C  CG    . PHE A 1  228  ? 56.938  -43.845  37.108  1.00 133.99 ? 228  PHE A CG    1 
ATOM   1622  C  CD1   . PHE A 1  228  ? 57.446  -44.928  37.815  1.00 137.99 ? 228  PHE A CD1   1 
ATOM   1623  C  CD2   . PHE A 1  228  ? 56.702  -43.998  35.746  1.00 135.78 ? 228  PHE A CD2   1 
ATOM   1624  C  CE1   . PHE A 1  228  ? 57.703  -46.145  37.175  1.00 139.58 ? 228  PHE A CE1   1 
ATOM   1625  C  CE2   . PHE A 1  228  ? 56.953  -45.217  35.108  1.00 139.22 ? 228  PHE A CE2   1 
ATOM   1626  C  CZ    . PHE A 1  228  ? 57.452  -46.282  35.827  1.00 138.28 ? 228  PHE A CZ    1 
ATOM   1627  N  N     . SER A 1  229  ? 57.842  -39.898  39.474  1.00 134.25 ? 229  SER A N     1 
ATOM   1628  C  CA    . SER A 1  229  ? 57.545  -38.613  40.121  1.00 134.18 ? 229  SER A CA    1 
ATOM   1629  C  C     . SER A 1  229  ? 58.696  -38.045  40.959  1.00 140.76 ? 229  SER A C     1 
ATOM   1630  O  O     . SER A 1  229  ? 59.062  -38.618  41.991  1.00 141.20 ? 229  SER A O     1 
ATOM   1631  C  CB    . SER A 1  229  ? 56.264  -38.699  40.943  1.00 136.44 ? 229  SER A CB    1 
ATOM   1632  O  OG    . SER A 1  229  ? 56.451  -39.458  42.126  1.00 145.91 ? 229  SER A OG    1 
ATOM   1633  N  N     . ARG A 1  230  ? 59.236  -36.895  40.525  1.00 138.37 ? 230  ARG A N     1 
ATOM   1634  C  CA    . ARG A 1  230  ? 60.345  -36.205  41.191  1.00 139.62 ? 230  ARG A CA    1 
ATOM   1635  C  C     . ARG A 1  230  ? 59.891  -34.883  41.847  1.00 142.71 ? 230  ARG A C     1 
ATOM   1636  O  O     . ARG A 1  230  ? 59.013  -34.214  41.292  1.00 141.43 ? 230  ARG A O     1 
ATOM   1637  C  CB    . ARG A 1  230  ? 61.503  -35.950  40.206  1.00 141.48 ? 230  ARG A CB    1 
ATOM   1638  C  CG    . ARG A 1  230  ? 62.097  -37.209  39.575  1.00 153.05 ? 230  ARG A CG    1 
ATOM   1639  C  CD    . ARG A 1  230  ? 63.532  -37.001  39.133  1.00 164.93 ? 230  ARG A CD    1 
ATOM   1640  N  NE    . ARG A 1  230  ? 63.961  -38.019  38.173  1.00 172.60 ? 230  ARG A NE    1 
ATOM   1641  C  CZ    . ARG A 1  230  ? 65.146  -38.033  37.572  1.00 186.26 ? 230  ARG A CZ    1 
ATOM   1642  N  NH1   . ARG A 1  230  ? 66.042  -37.088  37.831  1.00 173.98 ? 230  ARG A NH1   1 
ATOM   1643  N  NH2   . ARG A 1  230  ? 65.446  -38.993  36.707  1.00 172.40 ? 230  ARG A NH2   1 
ATOM   1644  N  N     . PRO A 1  231  ? 60.475  -34.468  43.005  1.00 139.64 ? 231  PRO A N     1 
ATOM   1645  C  CA    . PRO A 1  231  ? 60.056  -33.196  43.626  1.00 139.09 ? 231  PRO A CA    1 
ATOM   1646  C  C     . PRO A 1  231  ? 60.453  -31.980  42.799  1.00 143.26 ? 231  PRO A C     1 
ATOM   1647  O  O     . PRO A 1  231  ? 59.817  -30.933  42.905  1.00 142.08 ? 231  PRO A O     1 
ATOM   1648  C  CB    . PRO A 1  231  ? 60.765  -33.200  44.987  1.00 142.01 ? 231  PRO A CB    1 
ATOM   1649  C  CG    . PRO A 1  231  ? 61.290  -34.580  45.168  1.00 147.11 ? 231  PRO A CG    1 
ATOM   1650  C  CD    . PRO A 1  231  ? 61.531  -35.115  43.803  1.00 142.58 ? 231  PRO A CD    1 
ATOM   1651  N  N     . GLU A 1  232  ? 61.493  -32.136  41.958  1.00 141.24 ? 232  GLU A N     1 
ATOM   1652  C  CA    . GLU A 1  232  ? 61.993  -31.108  41.043  1.00 141.92 ? 232  GLU A CA    1 
ATOM   1653  C  C     . GLU A 1  232  ? 60.952  -30.775  39.953  1.00 144.96 ? 232  GLU A C     1 
ATOM   1654  O  O     . GLU A 1  232  ? 60.990  -29.685  39.378  1.00 145.01 ? 232  GLU A O     1 
ATOM   1655  C  CB    . GLU A 1  232  ? 63.347  -31.531  40.426  1.00 144.86 ? 232  GLU A CB    1 
ATOM   1656  C  CG    . GLU A 1  232  ? 63.315  -32.818  39.614  1.00 154.94 ? 232  GLU A CG    1 
ATOM   1657  C  CD    . GLU A 1  232  ? 64.665  -33.413  39.268  1.00 174.77 ? 232  GLU A CD    1 
ATOM   1658  O  OE1   . GLU A 1  232  ? 65.206  -34.182  40.096  1.00 166.49 ? 232  GLU A OE1   1 
ATOM   1659  O  OE2   . GLU A 1  232  ? 65.162  -33.144  38.151  1.00 168.56 ? 232  GLU A OE2   1 
ATOM   1660  N  N     . TRP A 1  233  ? 60.020  -31.713  39.690  1.00 140.17 ? 233  TRP A N     1 
ATOM   1661  C  CA    . TRP A 1  233  ? 58.968  -31.558  38.690  1.00 138.80 ? 233  TRP A CA    1 
ATOM   1662  C  C     . TRP A 1  233  ? 57.688  -30.927  39.252  1.00 140.57 ? 233  TRP A C     1 
ATOM   1663  O  O     . TRP A 1  233  ? 56.831  -30.521  38.462  1.00 139.40 ? 233  TRP A O     1 
ATOM   1664  C  CB    . TRP A 1  233  ? 58.682  -32.893  37.974  1.00 137.25 ? 233  TRP A CB    1 
ATOM   1665  C  CG    . TRP A 1  233  ? 59.873  -33.539  37.314  1.00 139.68 ? 233  TRP A CG    1 
ATOM   1666  C  CD1   . TRP A 1  233  ? 60.989  -32.917  36.831  1.00 144.05 ? 233  TRP A CD1   1 
ATOM   1667  C  CD2   . TRP A 1  233  ? 60.027  -34.932  37.010  1.00 139.69 ? 233  TRP A CD2   1 
ATOM   1668  N  NE1   . TRP A 1  233  ? 61.849  -33.842  36.287  1.00 144.61 ? 233  TRP A NE1   1 
ATOM   1669  C  CE2   . TRP A 1  233  ? 61.282  -35.087  36.379  1.00 145.27 ? 233  TRP A CE2   1 
ATOM   1670  C  CE3   . TRP A 1  233  ? 59.231  -36.071  37.224  1.00 140.00 ? 233  TRP A CE3   1 
ATOM   1671  C  CZ2   . TRP A 1  233  ? 61.757  -36.335  35.955  1.00 145.30 ? 233  TRP A CZ2   1 
ATOM   1672  C  CZ3   . TRP A 1  233  ? 59.701  -37.306  36.801  1.00 142.14 ? 233  TRP A CZ3   1 
ATOM   1673  C  CH2   . TRP A 1  233  ? 60.946  -37.429  36.169  1.00 144.44 ? 233  TRP A CH2   1 
ATOM   1674  N  N     . MET A 1  234  ? 57.572  -30.807  40.605  1.00 136.38 ? 234  MET A N     1 
ATOM   1675  C  CA    . MET A 1  234  ? 56.421  -30.194  41.294  1.00 135.02 ? 234  MET A CA    1 
ATOM   1676  C  C     . MET A 1  234  ? 56.215  -28.732  40.877  1.00 139.04 ? 234  MET A C     1 
ATOM   1677  O  O     . MET A 1  234  ? 55.082  -28.244  40.879  1.00 137.63 ? 234  MET A O     1 
ATOM   1678  C  CB    . MET A 1  234  ? 56.559  -30.285  42.819  1.00 137.58 ? 234  MET A CB    1 
ATOM   1679  C  CG    . MET A 1  234  ? 56.258  -31.652  43.386  1.00 140.64 ? 234  MET A CG    1 
ATOM   1680  S  SD    . MET A 1  234  ? 55.816  -31.589  45.143  1.00 144.83 ? 234  MET A SD    1 
ATOM   1681  C  CE    . MET A 1  234  ? 57.424  -31.346  45.892  1.00 143.43 ? 234  MET A CE    1 
ATOM   1682  N  N     . ILE A 1  235  ? 57.318  -28.041  40.529  1.00 136.85 ? 235  ILE A N     1 
ATOM   1683  C  CA    . ILE A 1  235  ? 57.306  -26.664  40.033  1.00 137.07 ? 235  ILE A CA    1 
ATOM   1684  C  C     . ILE A 1  235  ? 57.136  -26.701  38.519  1.00 140.47 ? 235  ILE A C     1 
ATOM   1685  O  O     . ILE A 1  235  ? 57.684  -27.588  37.857  1.00 139.95 ? 235  ILE A O     1 
ATOM   1686  C  CB    . ILE A 1  235  ? 58.536  -25.824  40.486  1.00 141.73 ? 235  ILE A CB    1 
ATOM   1687  C  CG1   . ILE A 1  235  ? 59.879  -26.571  40.298  1.00 143.33 ? 235  ILE A CG1   1 
ATOM   1688  C  CG2   . ILE A 1  235  ? 58.369  -25.326  41.919  1.00 142.36 ? 235  ILE A CG2   1 
ATOM   1689  C  CD1   . ILE A 1  235  ? 60.586  -26.277  38.989  1.00 152.60 ? 235  ILE A CD1   1 
ATOM   1690  N  N     . LEU A 1  236  ? 56.364  -25.754  37.978  1.00 137.04 ? 236  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1  236  ? 56.064  -25.693  36.550  1.00 136.95 ? 236  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1  236  ? 56.997  -24.784  35.750  1.00 142.86 ? 236  LEU A C     1 
ATOM   1693  O  O     . LEU A 1  236  ? 57.013  -23.566  35.947  1.00 143.01 ? 236  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1  236  ? 54.588  -25.328  36.316  1.00 135.89 ? 236  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1  236  ? 53.565  -26.372  36.758  1.00 138.93 ? 236  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1  236  ? 52.425  -25.727  37.508  1.00 138.31 ? 236  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1  236  ? 53.055  -27.178  35.577  1.00 140.83 ? 236  LEU A CD2   1 
ATOM   1698  N  N     . THR A 1  237  ? 57.774  -25.401  34.846  1.00 140.50 ? 237  THR A N     1 
ATOM   1699  C  CA    . THR A 1  237  ? 58.718  -24.742  33.932  1.00 141.97 ? 237  THR A CA    1 
ATOM   1700  C  C     . THR A 1  237  ? 58.122  -24.778  32.520  1.00 146.48 ? 237  THR A C     1 
ATOM   1701  O  O     . THR A 1  237  ? 58.233  -23.806  31.768  1.00 147.15 ? 237  THR A O     1 
ATOM   1702  C  CB    . THR A 1  237  ? 60.091  -25.427  33.981  1.00 149.86 ? 237  THR A CB    1 
ATOM   1703  O  OG1   . THR A 1  237  ? 59.919  -26.831  33.794  1.00 147.58 ? 237  THR A OG1   1 
ATOM   1704  C  CG2   . THR A 1  237  ? 60.833  -25.165  35.283  1.00 149.31 ? 237  THR A CG2   1 
ATOM   1705  N  N     . CYS A 1  238  ? 57.487  -25.913  32.175  1.00 142.12 ? 238  CYS A N     1 
ATOM   1706  C  CA    . CYS A 1  238  ? 56.797  -26.132  30.912  1.00 141.58 ? 238  CYS A CA    1 
ATOM   1707  C  C     . CYS A 1  238  ? 55.500  -26.887  31.192  1.00 143.91 ? 238  CYS A C     1 
ATOM   1708  O  O     . CYS A 1  238  ? 55.528  -28.009  31.709  1.00 142.90 ? 238  CYS A O     1 
ATOM   1709  C  CB    . CYS A 1  238  ? 57.680  -26.866  29.908  1.00 142.67 ? 238  CYS A CB    1 
ATOM   1710  S  SG    . CYS A 1  238  ? 57.018  -26.878  28.222  1.00 146.69 ? 238  CYS A SG    1 
ATOM   1711  N  N     . LEU A 1  239  ? 54.364  -26.234  30.905  1.00 139.70 ? 239  LEU A N     1 
ATOM   1712  C  CA    . LEU A 1  239  ? 53.018  -26.763  31.115  1.00 137.87 ? 239  LEU A CA    1 
ATOM   1713  C  C     . LEU A 1  239  ? 52.473  -27.406  29.818  1.00 140.44 ? 239  LEU A C     1 
ATOM   1714  O  O     . LEU A 1  239  ? 52.628  -26.812  28.746  1.00 141.09 ? 239  LEU A O     1 
ATOM   1715  C  CB    . LEU A 1  239  ? 52.096  -25.621  31.613  1.00 137.79 ? 239  LEU A CB    1 
ATOM   1716  C  CG    . LEU A 1  239  ? 50.579  -25.861  31.642  1.00 141.54 ? 239  LEU A CG    1 
ATOM   1717  C  CD1   . LEU A 1  239  ? 50.127  -26.386  32.997  1.00 140.81 ? 239  LEU A CD1   1 
ATOM   1718  C  CD2   . LEU A 1  239  ? 49.823  -24.594  31.295  1.00 144.16 ? 239  LEU A CD2   1 
ATOM   1719  N  N     . PRO A 1  240  ? 51.829  -28.602  29.884  1.00 134.53 ? 240  PRO A N     1 
ATOM   1720  C  CA    . PRO A 1  240  ? 51.280  -29.205  28.659  1.00 133.51 ? 240  PRO A CA    1 
ATOM   1721  C  C     . PRO A 1  240  ? 49.988  -28.507  28.234  1.00 134.65 ? 240  PRO A C     1 
ATOM   1722  O  O     . PRO A 1  240  ? 49.127  -28.236  29.079  1.00 132.90 ? 240  PRO A O     1 
ATOM   1723  C  CB    . PRO A 1  240  ? 51.044  -30.674  29.051  1.00 134.31 ? 240  PRO A CB    1 
ATOM   1724  C  CG    . PRO A 1  240  ? 51.591  -30.825  30.453  1.00 138.78 ? 240  PRO A CG    1 
ATOM   1725  C  CD    . PRO A 1  240  ? 51.558  -29.461  31.052  1.00 134.82 ? 240  PRO A CD    1 
ATOM   1726  N  N     . VAL A 1  241  ? 49.874  -28.185  26.930  1.00 130.72 ? 241  VAL A N     1 
ATOM   1727  C  CA    . VAL A 1  241  ? 48.707  -27.499  26.367  1.00 129.88 ? 241  VAL A CA    1 
ATOM   1728  C  C     . VAL A 1  241  ? 47.647  -28.524  25.904  1.00 131.21 ? 241  VAL A C     1 
ATOM   1729  O  O     . VAL A 1  241  ? 47.888  -29.251  24.931  1.00 130.91 ? 241  VAL A O     1 
ATOM   1730  C  CB    . VAL A 1  241  ? 49.064  -26.448  25.272  1.00 135.27 ? 241  VAL A CB    1 
ATOM   1731  C  CG1   . VAL A 1  241  ? 47.823  -25.689  24.806  1.00 135.08 ? 241  VAL A CG1   1 
ATOM   1732  C  CG2   . VAL A 1  241  ? 50.125  -25.468  25.767  1.00 136.13 ? 241  VAL A CG2   1 
ATOM   1733  N  N     . PRO A 1  242  ? 46.475  -28.592  26.598  1.00 125.41 ? 242  PRO A N     1 
ATOM   1734  C  CA    . PRO A 1  242  ? 45.433  -29.554  26.198  1.00 123.66 ? 242  PRO A CA    1 
ATOM   1735  C  C     . PRO A 1  242  ? 44.883  -29.318  24.788  1.00 126.63 ? 242  PRO A C     1 
ATOM   1736  O  O     . PRO A 1  242  ? 44.639  -28.170  24.403  1.00 127.12 ? 242  PRO A O     1 
ATOM   1737  C  CB    . PRO A 1  242  ? 44.357  -29.389  27.276  1.00 124.36 ? 242  PRO A CB    1 
ATOM   1738  C  CG    . PRO A 1  242  ? 44.573  -28.032  27.828  1.00 129.64 ? 242  PRO A CG    1 
ATOM   1739  C  CD    . PRO A 1  242  ? 46.051  -27.814  27.780  1.00 126.32 ? 242  PRO A CD    1 
ATOM   1740  N  N     . PRO A 1  243  ? 44.696  -30.405  24.005  1.00 121.49 ? 243  PRO A N     1 
ATOM   1741  C  CA    . PRO A 1  243  ? 44.194  -30.255  22.625  1.00 121.46 ? 243  PRO A CA    1 
ATOM   1742  C  C     . PRO A 1  243  ? 42.750  -29.736  22.508  1.00 123.01 ? 243  PRO A C     1 
ATOM   1743  O  O     . PRO A 1  243  ? 42.065  -29.655  23.530  1.00 121.31 ? 243  PRO A O     1 
ATOM   1744  C  CB    . PRO A 1  243  ? 44.320  -31.678  22.065  1.00 122.95 ? 243  PRO A CB    1 
ATOM   1745  C  CG    . PRO A 1  243  ? 44.242  -32.560  23.249  1.00 126.25 ? 243  PRO A CG    1 
ATOM   1746  C  CD    . PRO A 1  243  ? 44.966  -31.822  24.325  1.00 121.96 ? 243  PRO A CD    1 
ATOM   1747  N  N     . PRO A 1  244  ? 42.239  -29.426  21.283  1.00 119.51 ? 244  PRO A N     1 
ATOM   1748  C  CA    . PRO A 1  244  ? 40.842  -28.966  21.164  1.00 118.85 ? 244  PRO A CA    1 
ATOM   1749  C  C     . PRO A 1  244  ? 39.738  -29.866  21.759  1.00 119.94 ? 244  PRO A C     1 
ATOM   1750  O  O     . PRO A 1  244  ? 38.839  -29.275  22.348  1.00 118.94 ? 244  PRO A O     1 
ATOM   1751  C  CB    . PRO A 1  244  ? 40.670  -28.730  19.662  1.00 122.07 ? 244  PRO A CB    1 
ATOM   1752  C  CG    . PRO A 1  244  ? 42.051  -28.508  19.153  1.00 127.70 ? 244  PRO A CG    1 
ATOM   1753  C  CD    . PRO A 1  244  ? 42.898  -29.436  19.958  1.00 122.29 ? 244  PRO A CD    1 
ATOM   1754  N  N     . PRO A 1  245  ? 39.751  -31.233  21.703  1.00 115.12 ? 245  PRO A N     1 
ATOM   1755  C  CA    . PRO A 1  245  ? 38.655  -32.000  22.335  1.00 113.67 ? 245  PRO A CA    1 
ATOM   1756  C  C     . PRO A 1  245  ? 38.381  -31.688  23.815  1.00 117.37 ? 245  PRO A C     1 
ATOM   1757  O  O     . PRO A 1  245  ? 37.223  -31.738  24.238  1.00 116.34 ? 245  PRO A O     1 
ATOM   1758  C  CB    . PRO A 1  245  ? 39.095  -33.456  22.154  1.00 114.69 ? 245  PRO A CB    1 
ATOM   1759  C  CG    . PRO A 1  245  ? 39.967  -33.442  20.974  1.00 120.18 ? 245  PRO A CG    1 
ATOM   1760  C  CD    . PRO A 1  245  ? 40.710  -32.150  21.049  1.00 116.77 ? 245  PRO A CD    1 
ATOM   1761  N  N     . VAL A 1  246  ? 39.440  -31.366  24.590  1.00 114.34 ? 246  VAL A N     1 
ATOM   1762  C  CA    . VAL A 1  246  ? 39.377  -31.033  26.021  1.00 113.62 ? 246  VAL A CA    1 
ATOM   1763  C  C     . VAL A 1  246  ? 38.710  -29.667  26.216  1.00 119.09 ? 246  VAL A C     1 
ATOM   1764  O  O     . VAL A 1  246  ? 37.879  -29.504  27.110  1.00 117.85 ? 246  VAL A O     1 
ATOM   1765  C  CB    . VAL A 1  246  ? 40.785  -31.087  26.678  1.00 117.47 ? 246  VAL A CB    1 
ATOM   1766  C  CG1   . VAL A 1  246  ? 40.714  -30.841  28.184  1.00 116.58 ? 246  VAL A CG1   1 
ATOM   1767  C  CG2   . VAL A 1  246  ? 41.478  -32.414  26.388  1.00 116.96 ? 246  VAL A CG2   1 
ATOM   1768  N  N     . ARG A 1  247  ? 39.074  -28.699  25.374  1.00 118.33 ? 247  ARG A N     1 
ATOM   1769  C  CA    . ARG A 1  247  ? 38.546  -27.339  25.418  1.00 119.99 ? 247  ARG A CA    1 
ATOM   1770  C  C     . ARG A 1  247  ? 37.927  -26.976  24.051  1.00 127.61 ? 247  ARG A C     1 
ATOM   1771  O  O     . ARG A 1  247  ? 38.557  -26.278  23.251  1.00 128.34 ? 247  ARG A O     1 
ATOM   1772  C  CB    . ARG A 1  247  ? 39.640  -26.348  25.865  1.00 121.06 ? 247  ARG A CB    1 
ATOM   1773  C  CG    . ARG A 1  247  ? 41.036  -26.696  25.351  1.00 130.72 ? 247  ARG A CG    1 
ATOM   1774  C  CD    . ARG A 1  247  ? 42.003  -25.544  25.471  1.00 138.61 ? 247  ARG A CD    1 
ATOM   1775  N  NE    . ARG A 1  247  ? 43.168  -25.749  24.611  1.00 144.99 ? 247  ARG A NE    1 
ATOM   1776  C  CZ    . ARG A 1  247  ? 43.254  -25.323  23.355  1.00 158.85 ? 247  ARG A CZ    1 
ATOM   1777  N  NH1   . ARG A 1  247  ? 42.250  -24.651  22.804  1.00 146.86 ? 247  ARG A NH1   1 
ATOM   1778  N  NH2   . ARG A 1  247  ? 44.346  -25.560  22.642  1.00 145.25 ? 247  ARG A NH2   1 
ATOM   1779  N  N     . PRO A 1  248  ? 36.718  -27.496  23.727  1.00 126.21 ? 248  PRO A N     1 
ATOM   1780  C  CA    . PRO A 1  248  ? 36.129  -27.209  22.410  1.00 128.18 ? 248  PRO A CA    1 
ATOM   1781  C  C     . PRO A 1  248  ? 35.439  -25.849  22.309  1.00 136.44 ? 248  PRO A C     1 
ATOM   1782  O  O     . PRO A 1  248  ? 35.458  -25.071  23.267  1.00 136.00 ? 248  PRO A O     1 
ATOM   1783  C  CB    . PRO A 1  248  ? 35.158  -28.382  22.185  1.00 128.79 ? 248  PRO A CB    1 
ATOM   1784  C  CG    . PRO A 1  248  ? 35.151  -29.182  23.470  1.00 131.25 ? 248  PRO A CG    1 
ATOM   1785  C  CD    . PRO A 1  248  ? 35.826  -28.365  24.517  1.00 126.68 ? 248  PRO A CD    1 
ATOM   1786  N  N     . SER A 1  249  ? 34.846  -25.558  21.131  1.00 136.65 ? 249  SER A N     1 
ATOM   1787  C  CA    . SER A 1  249  ? 34.138  -24.310  20.854  1.00 139.08 ? 249  SER A CA    1 
ATOM   1788  C  C     . SER A 1  249  ? 32.613  -24.525  20.793  1.00 146.23 ? 249  SER A C     1 
ATOM   1789  O  O     . SER A 1  249  ? 31.987  -24.643  21.850  1.00 144.64 ? 249  SER A O     1 
ATOM   1790  C  CB    . SER A 1  249  ? 34.681  -23.653  19.587  1.00 144.17 ? 249  SER A CB    1 
ATOM   1791  O  OG    . SER A 1  249  ? 34.620  -24.544  18.485  1.00 152.46 ? 249  SER A OG    1 
ATOM   1792  N  N     . ILE A 1  250  ? 32.029  -24.604  19.566  1.00 146.79 ? 250  ILE A N     1 
ATOM   1793  C  CA    . ILE A 1  250  ? 30.590  -24.779  19.277  1.00 147.96 ? 250  ILE A CA    1 
ATOM   1794  C  C     . ILE A 1  250  ? 29.740  -23.658  19.928  1.00 155.19 ? 250  ILE A C     1 
ATOM   1795  O  O     . ILE A 1  250  ? 29.284  -23.782  21.074  1.00 153.91 ? 250  ILE A O     1 
ATOM   1796  C  CB    . ILE A 1  250  ? 30.059  -26.254  19.429  1.00 149.23 ? 250  ILE A CB    1 
ATOM   1797  C  CG1   . ILE A 1  250  ? 30.772  -27.221  18.442  1.00 149.39 ? 250  ILE A CG1   1 
ATOM   1798  C  CG2   . ILE A 1  250  ? 28.536  -26.348  19.221  1.00 149.94 ? 250  ILE A CG2   1 
ATOM   1799  C  CD1   . ILE A 1  250  ? 32.093  -27.869  18.930  1.00 154.19 ? 250  ILE A CD1   1 
ATOM   1800  N  N     . SER A 1  251  ? 29.601  -22.536  19.190  1.00 155.14 ? 251  SER A N     1 
ATOM   1801  C  CA    . SER A 1  251  ? 28.904  -21.327  19.626  1.00 156.70 ? 251  SER A CA    1 
ATOM   1802  C  C     . SER A 1  251  ? 27.386  -21.462  19.785  1.00 161.69 ? 251  SER A C     1 
ATOM   1803  O  O     . SER A 1  251  ? 26.749  -22.312  19.154  1.00 160.71 ? 251  SER A O     1 
ATOM   1804  C  CB    . SER A 1  251  ? 29.264  -20.138  18.736  1.00 162.43 ? 251  SER A CB    1 
ATOM   1805  O  OG    . SER A 1  251  ? 28.898  -20.346  17.382  1.00 171.65 ? 251  SER A OG    1 
ATOM   1806  N  N     . PHE A 1  252  ? 26.827  -20.606  20.658  1.00 159.71 ? 252  PHE A N     1 
ATOM   1807  C  CA    . PHE A 1  252  ? 25.404  -20.471  20.979  1.00 160.23 ? 252  PHE A CA    1 
ATOM   1808  C  C     . PHE A 1  252  ? 24.644  -19.907  19.767  1.00 165.96 ? 252  PHE A C     1 
ATOM   1809  O  O     . PHE A 1  252  ? 23.501  -20.302  19.521  1.00 165.50 ? 252  PHE A O     1 
ATOM   1810  C  CB    . PHE A 1  252  ? 25.213  -19.562  22.218  1.00 162.54 ? 252  PHE A CB    1 
ATOM   1811  C  CG    . PHE A 1  252  ? 26.413  -18.722  22.612  1.00 164.63 ? 252  PHE A CG    1 
ATOM   1812  C  CD1   . PHE A 1  252  ? 26.651  -17.491  22.010  1.00 170.02 ? 252  PHE A CD1   1 
ATOM   1813  C  CD2   . PHE A 1  252  ? 27.306  -19.166  23.581  1.00 165.17 ? 252  PHE A CD2   1 
ATOM   1814  C  CE1   . PHE A 1  252  ? 27.767  -16.724  22.363  1.00 171.35 ? 252  PHE A CE1   1 
ATOM   1815  C  CE2   . PHE A 1  252  ? 28.420  -18.397  23.935  1.00 168.43 ? 252  PHE A CE2   1 
ATOM   1816  C  CZ    . PHE A 1  252  ? 28.641  -17.180  23.326  1.00 168.62 ? 252  PHE A CZ    1 
ATOM   1817  N  N     . ASN A 1  253  ? 25.300  -18.996  19.007  1.00 164.22 ? 253  ASN A N     1 
ATOM   1818  C  CA    . ASN A 1  253  ? 24.776  -18.359  17.794  1.00 166.22 ? 253  ASN A CA    1 
ATOM   1819  C  C     . ASN A 1  253  ? 25.282  -19.077  16.516  1.00 169.91 ? 253  ASN A C     1 
ATOM   1820  O  O     . ASN A 1  253  ? 25.249  -20.309  16.483  1.00 167.76 ? 253  ASN A O     1 
ATOM   1821  C  CB    . ASN A 1  253  ? 25.052  -16.839  17.795  1.00 168.48 ? 253  ASN A CB    1 
ATOM   1822  C  CG    . ASN A 1  253  ? 26.492  -16.455  18.038  1.00 186.94 ? 253  ASN A CG    1 
ATOM   1823  O  OD1   . ASN A 1  253  ? 27.383  -16.736  17.230  1.00 181.32 ? 253  ASN A OD1   1 
ATOM   1824  N  ND2   . ASN A 1  253  ? 26.743  -15.780  19.148  1.00 176.81 ? 253  ASN A ND2   1 
ATOM   1825  N  N     . GLU A 1  254  ? 25.728  -18.334  15.473  1.00 168.41 ? 254  GLU A N     1 
ATOM   1826  C  CA    . GLU A 1  254  ? 26.195  -18.936  14.215  1.00 168.48 ? 254  GLU A CA    1 
ATOM   1827  C  C     . GLU A 1  254  ? 27.597  -18.506  13.737  1.00 172.65 ? 254  GLU A C     1 
ATOM   1828  O  O     . GLU A 1  254  ? 28.266  -19.306  13.076  1.00 171.97 ? 254  GLU A O     1 
ATOM   1829  C  CB    . GLU A 1  254  ? 25.159  -18.763  13.079  1.00 171.84 ? 254  GLU A CB    1 
ATOM   1830  C  CG    . GLU A 1  254  ? 23.780  -19.367  13.329  1.00 180.74 ? 254  GLU A CG    1 
ATOM   1831  C  CD    . GLU A 1  254  ? 23.707  -20.849  13.652  1.00 195.34 ? 254  GLU A CD    1 
ATOM   1832  O  OE1   . GLU A 1  254  ? 23.046  -21.199  14.656  1.00 185.76 ? 254  GLU A OE1   1 
ATOM   1833  O  OE2   . GLU A 1  254  ? 24.291  -21.660  12.898  1.00 187.88 ? 254  GLU A OE2   1 
ATOM   1834  N  N     . SER A 1  255  ? 28.036  -17.258  14.038  1.00 169.71 ? 255  SER A N     1 
ATOM   1835  C  CA    . SER A 1  255  ? 29.345  -16.751  13.593  1.00 169.99 ? 255  SER A CA    1 
ATOM   1836  C  C     . SER A 1  255  ? 30.277  -16.158  14.668  1.00 171.70 ? 255  SER A C     1 
ATOM   1837  O  O     . SER A 1  255  ? 31.492  -16.132  14.451  1.00 171.23 ? 255  SER A O     1 
ATOM   1838  C  CB    . SER A 1  255  ? 29.190  -15.797  12.411  1.00 176.83 ? 255  SER A CB    1 
ATOM   1839  O  OG    . SER A 1  255  ? 29.096  -16.511  11.189  1.00 186.14 ? 255  SER A OG    1 
ATOM   1840  N  N     . GLN A 1  256  ? 29.726  -15.689  15.811  1.00 166.67 ? 256  GLN A N     1 
ATOM   1841  C  CA    . GLN A 1  256  ? 30.509  -15.109  16.916  1.00 165.35 ? 256  GLN A CA    1 
ATOM   1842  C  C     . GLN A 1  256  ? 31.343  -16.186  17.641  1.00 165.58 ? 256  GLN A C     1 
ATOM   1843  O  O     . GLN A 1  256  ? 31.017  -17.373  17.549  1.00 163.71 ? 256  GLN A O     1 
ATOM   1844  C  CB    . GLN A 1  256  ? 29.591  -14.348  17.897  1.00 166.91 ? 256  GLN A CB    1 
ATOM   1845  C  CG    . GLN A 1  256  ? 30.281  -13.272  18.747  1.00 178.28 ? 256  GLN A CG    1 
ATOM   1846  C  CD    . GLN A 1  256  ? 30.637  -12.022  17.976  1.00 195.05 ? 256  GLN A CD    1 
ATOM   1847  O  OE1   . GLN A 1  256  ? 29.774  -11.313  17.446  1.00 191.90 ? 256  GLN A OE1   1 
ATOM   1848  N  NE2   . GLN A 1  256  ? 31.920  -11.703  17.933  1.00 184.71 ? 256  GLN A NE2   1 
ATOM   1849  N  N     . ARG A 1  257  ? 32.425  -15.760  18.337  1.00 160.76 ? 257  ARG A N     1 
ATOM   1850  C  CA    . ARG A 1  257  ? 33.385  -16.596  19.080  1.00 157.93 ? 257  ARG A CA    1 
ATOM   1851  C  C     . ARG A 1  257  ? 32.750  -17.508  20.163  1.00 158.09 ? 257  ARG A C     1 
ATOM   1852  O  O     . ARG A 1  257  ? 32.274  -18.598  19.833  1.00 156.74 ? 257  ARG A O     1 
ATOM   1853  C  CB    . ARG A 1  257  ? 34.542  -15.739  19.654  1.00 158.44 ? 257  ARG A CB    1 
ATOM   1854  C  CG    . ARG A 1  257  ? 35.493  -15.147  18.611  1.00 170.04 ? 257  ARG A CG    1 
ATOM   1855  C  CD    . ARG A 1  257  ? 35.130  -13.725  18.203  1.00 181.53 ? 257  ARG A CD    1 
ATOM   1856  N  NE    . ARG A 1  257  ? 35.425  -12.746  19.252  1.00 188.91 ? 257  ARG A NE    1 
ATOM   1857  C  CZ    . ARG A 1  257  ? 35.321  -11.429  19.102  1.00 204.11 ? 257  ARG A CZ    1 
ATOM   1858  N  NH1   . ARG A 1  257  ? 34.935  -10.913  17.941  1.00 193.07 ? 257  ARG A NH1   1 
ATOM   1859  N  NH2   . ARG A 1  257  ? 35.611  -10.616  20.109  1.00 190.35 ? 257  ARG A NH2   1 
ATOM   1860  N  N     . GLY A 1  258  ? 32.770  -17.063  21.424  1.00 152.49 ? 258  GLY A N     1 
ATOM   1861  C  CA    . GLY A 1  258  ? 32.225  -17.797  22.563  1.00 149.66 ? 258  GLY A CA    1 
ATOM   1862  C  C     . GLY A 1  258  ? 32.937  -19.104  22.852  1.00 149.33 ? 258  GLY A C     1 
ATOM   1863  O  O     . GLY A 1  258  ? 32.290  -20.150  22.951  1.00 147.53 ? 258  GLY A O     1 
ATOM   1864  N  N     . GLU A 1  259  ? 34.276  -19.049  22.991  1.00 144.03 ? 259  GLU A N     1 
ATOM   1865  C  CA    . GLU A 1  259  ? 35.131  -20.213  23.263  1.00 141.34 ? 259  GLU A CA    1 
ATOM   1866  C  C     . GLU A 1  259  ? 34.981  -20.716  24.711  1.00 141.45 ? 259  GLU A C     1 
ATOM   1867  O  O     . GLU A 1  259  ? 34.249  -20.120  25.506  1.00 141.16 ? 259  GLU A O     1 
ATOM   1868  C  CB    . GLU A 1  259  ? 36.610  -19.888  22.952  1.00 143.34 ? 259  GLU A CB    1 
ATOM   1869  C  CG    . GLU A 1  259  ? 36.911  -19.565  21.494  1.00 155.81 ? 259  GLU A CG    1 
ATOM   1870  C  CD    . GLU A 1  259  ? 36.956  -20.729  20.521  1.00 175.86 ? 259  GLU A CD    1 
ATOM   1871  O  OE1   . GLU A 1  259  ? 36.463  -20.562  19.381  1.00 170.23 ? 259  GLU A OE1   1 
ATOM   1872  O  OE2   . GLU A 1  259  ? 37.512  -21.793  20.879  1.00 167.79 ? 259  GLU A OE2   1 
ATOM   1873  N  N     . ASP A 1  260  ? 35.671  -21.822  25.044  1.00 134.86 ? 260  ASP A N     1 
ATOM   1874  C  CA    . ASP A 1  260  ? 35.669  -22.424  26.378  1.00 132.42 ? 260  ASP A CA    1 
ATOM   1875  C  C     . ASP A 1  260  ? 36.471  -21.546  27.345  1.00 134.85 ? 260  ASP A C     1 
ATOM   1876  O  O     . ASP A 1  260  ? 37.386  -20.848  26.907  1.00 135.49 ? 260  ASP A O     1 
ATOM   1877  C  CB    . ASP A 1  260  ? 36.301  -23.826  26.309  1.00 132.95 ? 260  ASP A CB    1 
ATOM   1878  C  CG    . ASP A 1  260  ? 35.869  -24.805  27.387  1.00 142.23 ? 260  ASP A CG    1 
ATOM   1879  O  OD1   . ASP A 1  260  ? 35.826  -26.020  27.100  1.00 141.75 ? 260  ASP A OD1   1 
ATOM   1880  O  OD2   . ASP A 1  260  ? 35.606  -24.362  28.529  1.00 148.65 ? 260  ASP A OD2   1 
ATOM   1881  N  N     . ASP A 1  261  ? 36.146  -21.598  28.659  1.00 129.29 ? 261  ASP A N     1 
ATOM   1882  C  CA    . ASP A 1  261  ? 36.857  -20.844  29.706  1.00 128.69 ? 261  ASP A CA    1 
ATOM   1883  C  C     . ASP A 1  261  ? 38.324  -21.281  29.804  1.00 129.91 ? 261  ASP A C     1 
ATOM   1884  O  O     . ASP A 1  261  ? 39.193  -20.447  30.061  1.00 130.08 ? 261  ASP A O     1 
ATOM   1885  C  CB    . ASP A 1  261  ? 36.165  -20.989  31.075  1.00 129.86 ? 261  ASP A CB    1 
ATOM   1886  C  CG    . ASP A 1  261  ? 35.053  -19.995  31.363  1.00 142.04 ? 261  ASP A CG    1 
ATOM   1887  O  OD1   . ASP A 1  261  ? 35.219  -18.796  31.026  1.00 144.60 ? 261  ASP A OD1   1 
ATOM   1888  O  OD2   . ASP A 1  261  ? 34.053  -20.395  31.997  1.00 146.89 ? 261  ASP A OD2   1 
ATOM   1889  N  N     . LEU A 1  262  ? 38.590  -22.587  29.570  1.00 123.90 ? 262  LEU A N     1 
ATOM   1890  C  CA    . LEU A 1  262  ? 39.922  -23.198  29.562  1.00 122.75 ? 262  LEU A CA    1 
ATOM   1891  C  C     . LEU A 1  262  ? 40.755  -22.626  28.408  1.00 127.32 ? 262  LEU A C     1 
ATOM   1892  O  O     . LEU A 1  262  ? 41.959  -22.419  28.571  1.00 127.07 ? 262  LEU A O     1 
ATOM   1893  C  CB    . LEU A 1  262  ? 39.801  -24.725  29.431  1.00 121.29 ? 262  LEU A CB    1 
ATOM   1894  C  CG    . LEU A 1  262  ? 40.717  -25.555  30.326  1.00 124.75 ? 262  LEU A CG    1 
ATOM   1895  C  CD1   . LEU A 1  262  ? 40.053  -25.861  31.650  1.00 123.89 ? 262  LEU A CD1   1 
ATOM   1896  C  CD2   . LEU A 1  262  ? 41.085  -26.859  29.658  1.00 126.24 ? 262  LEU A CD2   1 
ATOM   1897  N  N     . THR A 1  263  ? 40.101  -22.348  27.254  1.00 124.49 ? 263  THR A N     1 
ATOM   1898  C  CA    . THR A 1  263  ? 40.718  -21.744  26.069  1.00 125.69 ? 263  THR A CA    1 
ATOM   1899  C  C     . THR A 1  263  ? 41.033  -20.272  26.385  1.00 131.07 ? 263  THR A C     1 
ATOM   1900  O  O     . THR A 1  263  ? 42.128  -19.805  26.067  1.00 131.48 ? 263  THR A O     1 
ATOM   1901  C  CB    . THR A 1  263  ? 39.805  -21.894  24.832  1.00 133.29 ? 263  THR A CB    1 
ATOM   1902  O  OG1   . THR A 1  263  ? 39.277  -23.217  24.778  1.00 131.83 ? 263  THR A OG1   1 
ATOM   1903  C  CG2   . THR A 1  263  ? 40.521  -21.580  23.525  1.00 132.79 ? 263  THR A CG2   1 
ATOM   1904  N  N     . PHE A 1  264  ? 40.083  -19.560  27.035  1.00 128.07 ? 264  PHE A N     1 
ATOM   1905  C  CA    . PHE A 1  264  ? 40.234  -18.158  27.431  1.00 129.38 ? 264  PHE A CA    1 
ATOM   1906  C  C     . PHE A 1  264  ? 41.304  -17.955  28.498  1.00 133.50 ? 264  PHE A C     1 
ATOM   1907  O  O     . PHE A 1  264  ? 41.938  -16.901  28.517  1.00 134.26 ? 264  PHE A O     1 
ATOM   1908  C  CB    . PHE A 1  264  ? 38.895  -17.544  27.875  1.00 131.58 ? 264  PHE A CB    1 
ATOM   1909  C  CG    . PHE A 1  264  ? 37.982  -17.145  26.739  1.00 134.47 ? 264  PHE A CG    1 
ATOM   1910  C  CD1   . PHE A 1  264  ? 36.723  -17.716  26.605  1.00 137.21 ? 264  PHE A CD1   1 
ATOM   1911  C  CD2   . PHE A 1  264  ? 38.378  -16.194  25.805  1.00 138.65 ? 264  PHE A CD2   1 
ATOM   1912  C  CE1   . PHE A 1  264  ? 35.879  -17.348  25.552  1.00 139.36 ? 264  PHE A CE1   1 
ATOM   1913  C  CE2   . PHE A 1  264  ? 37.536  -15.833  24.748  1.00 142.75 ? 264  PHE A CE2   1 
ATOM   1914  C  CZ    . PHE A 1  264  ? 36.292  -16.414  24.628  1.00 140.24 ? 264  PHE A CZ    1 
ATOM   1915  N  N     . LYS A 1  265  ? 41.513  -18.955  29.374  1.00 129.22 ? 265  LYS A N     1 
ATOM   1916  C  CA    . LYS A 1  265  ? 42.528  -18.886  30.424  1.00 129.13 ? 265  LYS A CA    1 
ATOM   1917  C  C     . LYS A 1  265  ? 43.925  -19.198  29.886  1.00 134.38 ? 265  LYS A C     1 
ATOM   1918  O  O     . LYS A 1  265  ? 44.891  -18.586  30.341  1.00 134.60 ? 265  LYS A O     1 
ATOM   1919  C  CB    . LYS A 1  265  ? 42.169  -19.778  31.624  1.00 129.93 ? 265  LYS A CB    1 
ATOM   1920  C  CG    . LYS A 1  265  ? 42.933  -19.434  32.904  1.00 142.46 ? 265  LYS A CG    1 
ATOM   1921  C  CD    . LYS A 1  265  ? 42.447  -18.153  33.571  1.00 152.57 ? 265  LYS A CD    1 
ATOM   1922  C  CE    . LYS A 1  265  ? 43.569  -17.442  34.278  1.00 161.63 ? 265  LYS A CE    1 
ATOM   1923  N  NZ    . LYS A 1  265  ? 43.083  -16.220  34.961  1.00 169.99 ? 265  LYS A NZ    1 
ATOM   1924  N  N     . LEU A 1  266  ? 44.036  -20.130  28.910  1.00 131.41 ? 266  LEU A N     1 
ATOM   1925  C  CA    . LEU A 1  266  ? 45.317  -20.470  28.276  1.00 132.09 ? 266  LEU A CA    1 
ATOM   1926  C  C     . LEU A 1  266  ? 45.820  -19.301  27.422  1.00 138.28 ? 266  LEU A C     1 
ATOM   1927  O  O     . LEU A 1  266  ? 47.030  -19.117  27.276  1.00 138.52 ? 266  LEU A O     1 
ATOM   1928  C  CB    . LEU A 1  266  ? 45.226  -21.758  27.443  1.00 131.48 ? 266  LEU A CB    1 
ATOM   1929  C  CG    . LEU A 1  266  ? 45.383  -23.078  28.203  1.00 134.68 ? 266  LEU A CG    1 
ATOM   1930  C  CD1   . LEU A 1  266  ? 44.946  -24.235  27.350  1.00 134.29 ? 266  LEU A CD1   1 
ATOM   1931  C  CD2   . LEU A 1  266  ? 46.825  -23.307  28.652  1.00 137.26 ? 266  LEU A CD2   1 
ATOM   1932  N  N     . ALA A 1  267  ? 44.879  -18.504  26.882  1.00 135.98 ? 267  ALA A N     1 
ATOM   1933  C  CA    . ALA A 1  267  ? 45.152  -17.295  26.114  1.00 137.69 ? 267  ALA A CA    1 
ATOM   1934  C  C     . ALA A 1  267  ? 45.568  -16.198  27.100  1.00 142.25 ? 267  ALA A C     1 
ATOM   1935  O  O     . ALA A 1  267  ? 46.427  -15.381  26.774  1.00 143.38 ? 267  ALA A O     1 
ATOM   1936  C  CB    . ALA A 1  267  ? 43.904  -16.870  25.358  1.00 139.08 ? 267  ALA A CB    1 
ATOM   1937  N  N     . ASP A 1  268  ? 44.969  -16.207  28.315  1.00 137.79 ? 268  ASP A N     1 
ATOM   1938  C  CA    . ASP A 1  268  ? 45.237  -15.262  29.401  1.00 138.16 ? 268  ASP A CA    1 
ATOM   1939  C  C     . ASP A 1  268  ? 46.626  -15.476  30.008  1.00 141.35 ? 268  ASP A C     1 
ATOM   1940  O  O     . ASP A 1  268  ? 47.314  -14.495  30.298  1.00 141.92 ? 268  ASP A O     1 
ATOM   1941  C  CB    . ASP A 1  268  ? 44.144  -15.354  30.484  1.00 139.21 ? 268  ASP A CB    1 
ATOM   1942  C  CG    . ASP A 1  268  ? 43.455  -14.045  30.825  1.00 151.52 ? 268  ASP A CG    1 
ATOM   1943  O  OD1   . ASP A 1  268  ? 43.202  -13.242  29.896  1.00 153.57 ? 268  ASP A OD1   1 
ATOM   1944  O  OD2   . ASP A 1  268  ? 43.100  -13.854  32.007  1.00 157.40 ? 268  ASP A OD2   1 
ATOM   1945  N  N     . ILE A 1  269  ? 47.043  -16.751  30.187  1.00 136.46 ? 269  ILE A N     1 
ATOM   1946  C  CA    . ILE A 1  269  ? 48.367  -17.088  30.727  1.00 136.17 ? 269  ILE A CA    1 
ATOM   1947  C  C     . ILE A 1  269  ? 49.473  -16.787  29.705  1.00 141.67 ? 269  ILE A C     1 
ATOM   1948  O  O     . ILE A 1  269  ? 50.582  -16.417  30.101  1.00 142.04 ? 269  ILE A O     1 
ATOM   1949  C  CB    . ILE A 1  269  ? 48.471  -18.517  31.351  1.00 137.54 ? 269  ILE A CB    1 
ATOM   1950  C  CG1   . ILE A 1  269  ? 48.413  -19.646  30.297  1.00 137.34 ? 269  ILE A CG1   1 
ATOM   1951  C  CG2   . ILE A 1  269  ? 47.437  -18.727  32.454  1.00 137.05 ? 269  ILE A CG2   1 
ATOM   1952  C  CD1   . ILE A 1  269  ? 49.251  -20.880  30.633  1.00 143.07 ? 269  ILE A CD1   1 
ATOM   1953  N  N     . LEU A 1  270  ? 49.152  -16.927  28.393  1.00 138.65 ? 270  LEU A N     1 
ATOM   1954  C  CA    . LEU A 1  270  ? 50.051  -16.665  27.264  1.00 139.82 ? 270  LEU A CA    1 
ATOM   1955  C  C     . LEU A 1  270  ? 50.353  -15.165  27.151  1.00 144.95 ? 270  LEU A C     1 
ATOM   1956  O  O     . LEU A 1  270  ? 51.498  -14.802  26.876  1.00 145.73 ? 270  LEU A O     1 
ATOM   1957  C  CB    . LEU A 1  270  ? 49.443  -17.196  25.953  1.00 140.03 ? 270  LEU A CB    1 
ATOM   1958  C  CG    . LEU A 1  270  ? 50.408  -17.834  24.949  1.00 145.49 ? 270  LEU A CG    1 
ATOM   1959  C  CD1   . LEU A 1  270  ? 49.706  -18.876  24.112  1.00 144.97 ? 270  LEU A CD1   1 
ATOM   1960  C  CD2   . LEU A 1  270  ? 51.039  -16.799  24.042  1.00 150.18 ? 270  LEU A CD2   1 
ATOM   1961  N  N     . LYS A 1  271  ? 49.332  -14.300  27.386  1.00 141.27 ? 271  LYS A N     1 
ATOM   1962  C  CA    . LYS A 1  271  ? 49.447  -12.833  27.380  1.00 142.54 ? 271  LYS A CA    1 
ATOM   1963  C  C     . LYS A 1  271  ? 50.403  -12.380  28.490  1.00 146.17 ? 271  LYS A C     1 
ATOM   1964  O  O     . LYS A 1  271  ? 51.162  -11.430  28.302  1.00 147.08 ? 271  LYS A O     1 
ATOM   1965  C  CB    . LYS A 1  271  ? 48.072  -12.173  27.588  1.00 144.91 ? 271  LYS A CB    1 
ATOM   1966  C  CG    . LYS A 1  271  ? 47.203  -12.096  26.334  1.00 155.48 ? 271  LYS A CG    1 
ATOM   1967  C  CD    . LYS A 1  271  ? 45.902  -11.322  26.584  1.00 162.43 ? 271  LYS A CD    1 
ATOM   1968  C  CE    . LYS A 1  271  ? 44.767  -12.191  27.079  1.00 167.21 ? 271  LYS A CE    1 
ATOM   1969  N  NZ    . LYS A 1  271  ? 43.570  -11.387  27.438  1.00 174.04 ? 271  LYS A NZ    1 
ATOM   1970  N  N     . ALA A 1  272  ? 50.359  -13.081  29.639  1.00 141.13 ? 272  ALA A N     1 
ATOM   1971  C  CA    . ALA A 1  272  ? 51.200  -12.844  30.803  1.00 140.99 ? 272  ALA A CA    1 
ATOM   1972  C  C     . ALA A 1  272  ? 52.638  -13.311  30.552  1.00 145.30 ? 272  ALA A C     1 
ATOM   1973  O  O     . ALA A 1  272  ? 53.570  -12.602  30.931  1.00 146.29 ? 272  ALA A O     1 
ATOM   1974  C  CB    . ALA A 1  272  ? 50.619  -13.556  32.015  1.00 140.10 ? 272  ALA A CB    1 
ATOM   1975  N  N     . ASN A 1  273  ? 52.819  -14.490  29.905  1.00 140.75 ? 273  ASN A N     1 
ATOM   1976  C  CA    . ASN A 1  273  ? 54.132  -15.075  29.602  1.00 140.80 ? 273  ASN A CA    1 
ATOM   1977  C  C     . ASN A 1  273  ? 54.962  -14.259  28.608  1.00 147.29 ? 273  ASN A C     1 
ATOM   1978  O  O     . ASN A 1  273  ? 56.152  -14.051  28.848  1.00 147.73 ? 273  ASN A O     1 
ATOM   1979  C  CB    . ASN A 1  273  ? 54.003  -16.532  29.151  1.00 138.17 ? 273  ASN A CB    1 
ATOM   1980  C  CG    . ASN A 1  273  ? 55.323  -17.258  29.055  1.00 150.28 ? 273  ASN A CG    1 
ATOM   1981  O  OD1   . ASN A 1  273  ? 55.993  -17.520  30.059  1.00 140.38 ? 273  ASN A OD1   1 
ATOM   1982  N  ND2   . ASN A 1  273  ? 55.726  -17.600  27.842  1.00 141.20 ? 273  ASN A ND2   1 
ATOM   1983  N  N     . ILE A 1  274  ? 54.343  -13.804  27.501  1.00 145.03 ? 274  ILE A N     1 
ATOM   1984  C  CA    . ILE A 1  274  ? 55.022  -13.004  26.476  1.00 146.99 ? 274  ILE A CA    1 
ATOM   1985  C  C     . ILE A 1  274  ? 55.331  -11.586  26.999  1.00 152.56 ? 274  ILE A C     1 
ATOM   1986  O  O     . ILE A 1  274  ? 56.397  -11.055  26.684  1.00 153.64 ? 274  ILE A O     1 
ATOM   1987  C  CB    . ILE A 1  274  ? 54.281  -13.034  25.096  1.00 150.68 ? 274  ILE A CB    1 
ATOM   1988  C  CG1   . ILE A 1  274  ? 53.885  -14.476  24.647  1.00 149.59 ? 274  ILE A CG1   1 
ATOM   1989  C  CG2   . ILE A 1  274  ? 55.048  -12.290  23.987  1.00 153.71 ? 274  ILE A CG2   1 
ATOM   1990  C  CD1   . ILE A 1  274  ? 55.021  -15.573  24.506  1.00 155.86 ? 274  ILE A CD1   1 
ATOM   1991  N  N     . SER A 1  275  ? 54.431  -11.003  27.832  1.00 148.98 ? 275  SER A N     1 
ATOM   1992  C  CA    . SER A 1  275  ? 54.619  -9.669   28.425  1.00 150.21 ? 275  SER A CA    1 
ATOM   1993  C  C     . SER A 1  275  ? 55.824  -9.613   29.365  1.00 154.53 ? 275  SER A C     1 
ATOM   1994  O  O     . SER A 1  275  ? 56.531  -8.607   29.375  1.00 155.67 ? 275  SER A O     1 
ATOM   1995  C  CB    . SER A 1  275  ? 53.360  -9.196   29.145  1.00 153.07 ? 275  SER A CB    1 
ATOM   1996  O  OG    . SER A 1  275  ? 53.058  -10.007  30.268  1.00 159.55 ? 275  SER A OG    1 
ATOM   1997  N  N     . LEU A 1  276  ? 56.069  -10.697  30.130  1.00 149.98 ? 276  LEU A N     1 
ATOM   1998  C  CA    . LEU A 1  276  ? 57.210  -10.808  31.044  1.00 150.27 ? 276  LEU A CA    1 
ATOM   1999  C  C     . LEU A 1  276  ? 58.525  -10.960  30.277  1.00 156.72 ? 276  LEU A C     1 
ATOM   2000  O  O     . LEU A 1  276  ? 59.571  -10.531  30.766  1.00 157.29 ? 276  LEU A O     1 
ATOM   2001  C  CB    . LEU A 1  276  ? 57.021  -11.979  32.012  1.00 148.40 ? 276  LEU A CB    1 
ATOM   2002  C  CG    . LEU A 1  276  ? 56.400  -11.622  33.353  1.00 152.46 ? 276  LEU A CG    1 
ATOM   2003  C  CD1   . LEU A 1  276  ? 55.395  -12.658  33.777  1.00 150.78 ? 276  LEU A CD1   1 
ATOM   2004  C  CD2   . LEU A 1  276  ? 57.459  -11.452  34.424  1.00 155.15 ? 276  LEU A CD2   1 
ATOM   2005  N  N     . GLU A 1  277  ? 58.463  -11.567  29.075  1.00 154.39 ? 277  GLU A N     1 
ATOM   2006  C  CA    . GLU A 1  277  ? 59.608  -11.760  28.179  1.00 155.96 ? 277  GLU A CA    1 
ATOM   2007  C  C     . GLU A 1  277  ? 59.992  -10.417  27.539  1.00 162.79 ? 277  GLU A C     1 
ATOM   2008  O  O     . GLU A 1  277  ? 61.180  -10.102  27.444  1.00 163.62 ? 277  GLU A O     1 
ATOM   2009  C  CB    . GLU A 1  277  ? 59.277  -12.798  27.091  1.00 156.82 ? 277  GLU A CB    1 
ATOM   2010  C  CG    . GLU A 1  277  ? 59.239  -14.235  27.590  1.00 164.38 ? 277  GLU A CG    1 
ATOM   2011  C  CD    . GLU A 1  277  ? 58.443  -15.220  26.752  1.00 177.61 ? 277  GLU A CD    1 
ATOM   2012  O  OE1   . GLU A 1  277  ? 58.171  -14.929  25.564  1.00 168.45 ? 277  GLU A OE1   1 
ATOM   2013  O  OE2   . GLU A 1  277  ? 58.106  -16.301  27.285  1.00 167.26 ? 277  GLU A OE2   1 
ATOM   2014  N  N     . THR A 1  278  ? 58.972  -9.611   27.147  1.00 160.37 ? 278  THR A N     1 
ATOM   2015  C  CA    . THR A 1  278  ? 59.109  -8.278   26.540  1.00 162.48 ? 278  THR A CA    1 
ATOM   2016  C  C     . THR A 1  278  ? 59.415  -7.212   27.627  1.00 167.73 ? 278  THR A C     1 
ATOM   2017  O  O     . THR A 1  278  ? 59.240  -6.010   27.411  1.00 168.71 ? 278  THR A O     1 
ATOM   2018  C  CB    . THR A 1  278  ? 57.888  -7.971   25.638  1.00 170.05 ? 278  THR A CB    1 
ATOM   2019  O  OG1   . THR A 1  278  ? 57.441  -9.177   25.014  1.00 167.90 ? 278  THR A OG1   1 
ATOM   2020  C  CG2   . THR A 1  278  ? 58.195  -6.944   24.554  1.00 171.18 ? 278  THR A CG2   1 
ATOM   2021  N  N     . LEU A 1  279  ? 59.888  -7.678   28.792  1.00 164.18 ? 279  LEU A N     1 
ATOM   2022  C  CA    . LEU A 1  279  ? 60.299  -6.870   29.936  1.00 165.02 ? 279  LEU A CA    1 
ATOM   2023  C  C     . LEU A 1  279  ? 61.670  -7.356   30.459  1.00 169.92 ? 279  LEU A C     1 
ATOM   2024  O  O     . LEU A 1  279  ? 62.068  -7.032   31.582  1.00 169.67 ? 279  LEU A O     1 
ATOM   2025  C  CB    . LEU A 1  279  ? 59.222  -6.875   31.041  1.00 163.67 ? 279  LEU A CB    1 
ATOM   2026  C  CG    . LEU A 1  279  ? 58.013  -5.946   30.846  1.00 168.83 ? 279  LEU A CG    1 
ATOM   2027  C  CD1   . LEU A 1  279  ? 56.914  -6.280   31.830  1.00 167.35 ? 279  LEU A CD1   1 
ATOM   2028  C  CD2   . LEU A 1  279  ? 58.393  -4.477   30.998  1.00 173.27 ? 279  LEU A CD2   1 
ATOM   2029  N  N     . GLU A 1  280  ? 62.393  -8.117   29.611  1.00 167.10 ? 280  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1  280  ? 63.725  -8.665   29.872  1.00 167.48 ? 280  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1  280  ? 64.620  -8.389   28.660  1.00 174.32 ? 280  GLU A C     1 
ATOM   2032  O  O     . GLU A 1  280  ? 65.674  -7.769   28.806  1.00 175.39 ? 280  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1  280  ? 63.654  -10.176  30.160  1.00 166.93 ? 280  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1  280  ? 63.017  -10.531  31.492  1.00 174.54 ? 280  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1  280  ? 62.972  -12.018  31.777  1.00 190.51 ? 280  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1  280  ? 62.188  -12.730  31.107  1.00 182.40 ? 280  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1  280  ? 63.718  -12.473  32.673  1.00 182.53 ? 280  GLU A OE2   1 
ATOM   2038  N  N     . HIS A 1  281  ? 64.177  -8.829   27.462  1.00 171.89 ? 281  HIS A N     1 
ATOM   2039  C  CA    . HIS A 1  281  ? 64.872  -8.641   26.182  1.00 174.05 ? 281  HIS A CA    1 
ATOM   2040  C  C     . HIS A 1  281  ? 64.516  -7.273   25.582  1.00 180.10 ? 281  HIS A C     1 
ATOM   2041  O  O     . HIS A 1  281  ? 65.197  -6.807   24.665  1.00 181.61 ? 281  HIS A O     1 
ATOM   2042  C  CB    . HIS A 1  281  ? 64.490  -9.753   25.184  1.00 174.32 ? 281  HIS A CB    1 
ATOM   2043  C  CG    . HIS A 1  281  ? 64.485  -11.135  25.763  1.00 176.02 ? 281  HIS A CG    1 
ATOM   2044  N  ND1   . HIS A 1  281  ? 63.338  -11.680  26.319  1.00 175.80 ? 281  HIS A ND1   1 
ATOM   2045  C  CD2   . HIS A 1  281  ? 65.483  -12.045  25.840  1.00 177.91 ? 281  HIS A CD2   1 
ATOM   2046  C  CE1   . HIS A 1  281  ? 63.676  -12.894  26.720  1.00 174.06 ? 281  HIS A CE1   1 
ATOM   2047  N  NE2   . HIS A 1  281  ? 64.956  -13.160  26.453  1.00 175.63 ? 281  HIS A NE2   1 
ATOM   2048  N  N     . ASN A 1  282  ? 63.441  -6.643   26.100  1.00 176.43 ? 282  ASN A N     1 
ATOM   2049  C  CA    . ASN A 1  282  ? 62.931  -5.348   25.652  1.00 177.89 ? 282  ASN A CA    1 
ATOM   2050  C  C     . ASN A 1  282  ? 62.690  -4.400   26.854  1.00 182.10 ? 282  ASN A C     1 
ATOM   2051  O  O     . ASN A 1  282  ? 61.545  -4.074   27.189  1.00 180.89 ? 282  ASN A O     1 
ATOM   2052  C  CB    . ASN A 1  282  ? 61.669  -5.559   24.791  1.00 177.61 ? 282  ASN A CB    1 
ATOM   2053  C  CG    . ASN A 1  282  ? 61.221  -4.363   23.986  1.00 199.86 ? 282  ASN A CG    1 
ATOM   2054  O  OD1   . ASN A 1  282  ? 60.151  -3.795   24.226  1.00 193.60 ? 282  ASN A OD1   1 
ATOM   2055  N  ND2   . ASN A 1  282  ? 61.991  -3.994   22.970  1.00 193.70 ? 282  ASN A ND2   1 
ATOM   2056  N  N     . GLY A 1  283  ? 63.790  -3.991   27.492  1.00 179.77 ? 283  GLY A N     1 
ATOM   2057  C  CA    . GLY A 1  283  ? 63.802  -3.084   28.637  1.00 179.96 ? 283  GLY A CA    1 
ATOM   2058  C  C     . GLY A 1  283  ? 63.385  -3.717   29.948  1.00 181.89 ? 283  GLY A C     1 
ATOM   2059  O  O     . GLY A 1  283  ? 62.275  -4.244   30.048  1.00 179.73 ? 283  GLY A O     1 
ATOM   2060  N  N     . ALA A 1  284  ? 64.261  -3.646   30.974  1.00 178.83 ? 284  ALA A N     1 
ATOM   2061  C  CA    . ALA A 1  284  ? 64.002  -4.215   32.301  1.00 177.08 ? 284  ALA A CA    1 
ATOM   2062  C  C     . ALA A 1  284  ? 63.792  -3.142   33.403  1.00 181.92 ? 284  ALA A C     1 
ATOM   2063  O  O     . ALA A 1  284  ? 64.768  -2.693   34.015  1.00 182.64 ? 284  ALA A O     1 
ATOM   2064  C  CB    . ALA A 1  284  ? 65.113  -5.185   32.686  1.00 177.41 ? 284  ALA A CB    1 
ATOM   2065  N  N     . PRO A 1  285  ? 62.525  -2.734   33.690  1.00 177.99 ? 285  PRO A N     1 
ATOM   2066  C  CA    . PRO A 1  285  ? 62.296  -1.709   34.727  1.00 178.36 ? 285  PRO A CA    1 
ATOM   2067  C  C     . PRO A 1  285  ? 62.350  -2.228   36.171  1.00 180.17 ? 285  PRO A C     1 
ATOM   2068  O  O     . PRO A 1  285  ? 61.350  -2.202   36.895  1.00 178.61 ? 285  PRO A O     1 
ATOM   2069  C  CB    . PRO A 1  285  ? 60.934  -1.096   34.345  1.00 180.28 ? 285  PRO A CB    1 
ATOM   2070  C  CG    . PRO A 1  285  ? 60.418  -1.905   33.180  1.00 183.95 ? 285  PRO A CG    1 
ATOM   2071  C  CD    . PRO A 1  285  ? 61.255  -3.136   33.062  1.00 178.47 ? 285  PRO A CD    1 
ATOM   2072  N  N     . HIS A 1  286  ? 63.551  -2.680   36.582  1.00 176.62 ? 286  HIS A N     1 
ATOM   2073  C  CA    . HIS A 1  286  ? 63.912  -3.182   37.912  1.00 175.55 ? 286  HIS A CA    1 
ATOM   2074  C  C     . HIS A 1  286  ? 62.926  -4.149   38.599  1.00 176.60 ? 286  HIS A C     1 
ATOM   2075  O  O     . HIS A 1  286  ? 62.627  -5.198   38.029  1.00 174.83 ? 286  HIS A O     1 
ATOM   2076  C  CB    . HIS A 1  286  ? 64.408  -2.045   38.825  1.00 177.93 ? 286  HIS A CB    1 
ATOM   2077  C  CG    . HIS A 1  286  ? 65.691  -1.431   38.357  1.00 183.29 ? 286  HIS A CG    1 
ATOM   2078  N  ND1   . HIS A 1  286  ? 66.913  -1.844   38.858  1.00 185.46 ? 286  HIS A ND1   1 
ATOM   2079  C  CD2   . HIS A 1  286  ? 65.902  -0.473   37.425  1.00 186.72 ? 286  HIS A CD2   1 
ATOM   2080  C  CE1   . HIS A 1  286  ? 67.823  -1.118   38.228  1.00 186.74 ? 286  HIS A CE1   1 
ATOM   2081  N  NE2   . HIS A 1  286  ? 67.262  -0.280   37.355  1.00 187.90 ? 286  HIS A NE2   1 
ATOM   2082  N  N     . HIS A 1  287  ? 62.442  -3.810   39.814  1.00 172.46 ? 287  HIS A N     1 
ATOM   2083  C  CA    . HIS A 1  287  ? 61.542  -4.664   40.591  1.00 170.22 ? 287  HIS A CA    1 
ATOM   2084  C  C     . HIS A 1  287  ? 60.037  -4.522   40.335  1.00 172.14 ? 287  HIS A C     1 
ATOM   2085  O  O     . HIS A 1  287  ? 59.240  -5.172   41.016  1.00 170.27 ? 287  HIS A O     1 
ATOM   2086  C  CB    . HIS A 1  287  ? 61.904  -4.657   42.084  1.00 171.17 ? 287  HIS A CB    1 
ATOM   2087  C  CG    . HIS A 1  287  ? 63.033  -5.582   42.419  1.00 174.39 ? 287  HIS A CG    1 
ATOM   2088  N  ND1   . HIS A 1  287  ? 62.899  -6.956   42.303  1.00 174.58 ? 287  HIS A ND1   1 
ATOM   2089  C  CD2   . HIS A 1  287  ? 64.280  -5.301   42.863  1.00 177.48 ? 287  HIS A CD2   1 
ATOM   2090  C  CE1   . HIS A 1  287  ? 64.063  -7.462   42.675  1.00 174.43 ? 287  HIS A CE1   1 
ATOM   2091  N  NE2   . HIS A 1  287  ? 64.925  -6.506   43.022  1.00 176.48 ? 287  HIS A NE2   1 
ATOM   2092  N  N     . ALA A 1  288  ? 59.649  -3.735   39.312  1.00 168.75 ? 288  ALA A N     1 
ATOM   2093  C  CA    . ALA A 1  288  ? 58.248  -3.575   38.910  1.00 167.59 ? 288  ALA A CA    1 
ATOM   2094  C  C     . ALA A 1  288  ? 57.759  -4.871   38.235  1.00 168.57 ? 288  ALA A C     1 
ATOM   2095  O  O     . ALA A 1  288  ? 56.554  -5.077   38.083  1.00 167.32 ? 288  ALA A O     1 
ATOM   2096  C  CB    . ALA A 1  288  ? 58.107  -2.396   37.958  1.00 170.08 ? 288  ALA A CB    1 
ATOM   2097  N  N     . ILE A 1  289  ? 58.717  -5.753   37.874  1.00 163.81 ? 289  ILE A N     1 
ATOM   2098  C  CA    . ILE A 1  289  ? 58.532  -7.064   37.244  1.00 161.72 ? 289  ILE A CA    1 
ATOM   2099  C  C     . ILE A 1  289  ? 57.869  -8.055   38.221  1.00 162.99 ? 289  ILE A C     1 
ATOM   2100  O  O     . ILE A 1  289  ? 57.180  -8.978   37.777  1.00 161.22 ? 289  ILE A O     1 
ATOM   2101  C  CB    . ILE A 1  289  ? 59.894  -7.569   36.655  1.00 165.24 ? 289  ILE A CB    1 
ATOM   2102  C  CG1   . ILE A 1  289  ? 60.559  -6.516   35.722  1.00 167.63 ? 289  ILE A CG1   1 
ATOM   2103  C  CG2   . ILE A 1  289  ? 59.797  -8.939   35.967  1.00 164.54 ? 289  ILE A CG2   1 
ATOM   2104  C  CD1   . ILE A 1  289  ? 59.685  -5.950   34.560  1.00 174.93 ? 289  ILE A CD1   1 
ATOM   2105  N  N     . GLU A 1  290  ? 58.041  -7.829   39.546  1.00 158.87 ? 290  GLU A N     1 
ATOM   2106  C  CA    . GLU A 1  290  ? 57.453  -8.633   40.625  1.00 156.86 ? 290  GLU A CA    1 
ATOM   2107  C  C     . GLU A 1  290  ? 55.916  -8.628   40.581  1.00 158.33 ? 290  GLU A C     1 
ATOM   2108  O  O     . GLU A 1  290  ? 55.289  -9.601   41.005  1.00 156.35 ? 290  GLU A O     1 
ATOM   2109  C  CB    . GLU A 1  290  ? 57.952  -8.146   41.995  1.00 159.01 ? 290  GLU A CB    1 
ATOM   2110  C  CG    . GLU A 1  290  ? 58.752  -9.184   42.762  1.00 169.32 ? 290  GLU A CG    1 
ATOM   2111  C  CD    . GLU A 1  290  ? 60.198  -9.334   42.331  1.00 190.81 ? 290  GLU A CD    1 
ATOM   2112  O  OE1   . GLU A 1  290  ? 60.448  -9.984   41.290  1.00 184.22 ? 290  GLU A OE1   1 
ATOM   2113  O  OE2   . GLU A 1  290  ? 61.084  -8.825   43.052  1.00 186.04 ? 290  GLU A OE2   1 
ATOM   2114  N  N     . GLU A 1  291  ? 55.325  -7.536   40.050  1.00 154.66 ? 291  GLU A N     1 
ATOM   2115  C  CA    . GLU A 1  291  ? 53.882  -7.349   39.874  1.00 153.42 ? 291  GLU A CA    1 
ATOM   2116  C  C     . GLU A 1  291  ? 53.355  -8.240   38.743  1.00 154.95 ? 291  GLU A C     1 
ATOM   2117  O  O     . GLU A 1  291  ? 52.170  -8.575   38.733  1.00 153.38 ? 291  GLU A O     1 
ATOM   2118  C  CB    . GLU A 1  291  ? 53.563  -5.875   39.582  1.00 156.50 ? 291  GLU A CB    1 
ATOM   2119  C  CG    . GLU A 1  291  ? 53.748  -4.963   40.783  1.00 168.22 ? 291  GLU A CG    1 
ATOM   2120  C  CD    . GLU A 1  291  ? 54.378  -3.621   40.470  1.00 191.46 ? 291  GLU A CD    1 
ATOM   2121  O  OE1   . GLU A 1  291  ? 53.748  -2.822   39.739  1.00 189.86 ? 291  GLU A OE1   1 
ATOM   2122  O  OE2   . GLU A 1  291  ? 55.493  -3.357   40.975  1.00 184.98 ? 291  GLU A OE2   1 
ATOM   2123  N  N     . ALA A 1  292  ? 54.240  -8.612   37.794  1.00 151.07 ? 292  ALA A N     1 
ATOM   2124  C  CA    . ALA A 1  292  ? 53.938  -9.475   36.652  1.00 149.68 ? 292  ALA A CA    1 
ATOM   2125  C  C     . ALA A 1  292  ? 54.301  -10.939  36.942  1.00 151.46 ? 292  ALA A C     1 
ATOM   2126  O  O     . ALA A 1  292  ? 53.574  -11.835  36.506  1.00 149.97 ? 292  ALA A O     1 
ATOM   2127  C  CB    . ALA A 1  292  ? 54.671  -8.981   35.417  1.00 151.71 ? 292  ALA A CB    1 
ATOM   2128  N  N     . GLU A 1  293  ? 55.414  -11.176  37.685  1.00 147.51 ? 293  GLU A N     1 
ATOM   2129  C  CA    . GLU A 1  293  ? 55.898  -12.504  38.096  1.00 145.75 ? 293  GLU A CA    1 
ATOM   2130  C  C     . GLU A 1  293  ? 54.861  -13.211  38.971  1.00 146.61 ? 293  GLU A C     1 
ATOM   2131  O  O     . GLU A 1  293  ? 54.583  -14.392  38.759  1.00 144.73 ? 293  GLU A O     1 
ATOM   2132  C  CB    . GLU A 1  293  ? 57.223  -12.387  38.868  1.00 148.05 ? 293  GLU A CB    1 
ATOM   2133  C  CG    . GLU A 1  293  ? 58.455  -12.219  37.997  1.00 160.01 ? 293  GLU A CG    1 
ATOM   2134  C  CD    . GLU A 1  293  ? 59.754  -12.062  38.764  1.00 181.02 ? 293  GLU A CD    1 
ATOM   2135  O  OE1   . GLU A 1  293  ? 60.036  -12.904  39.648  1.00 172.33 ? 293  GLU A OE1   1 
ATOM   2136  O  OE2   . GLU A 1  293  ? 60.501  -11.103  38.468  1.00 177.92 ? 293  GLU A OE2   1 
ATOM   2137  N  N     . SER A 1  294  ? 54.291  -12.476  39.949  1.00 142.58 ? 294  SER A N     1 
ATOM   2138  C  CA    . SER A 1  294  ? 53.258  -12.962  40.864  1.00 140.82 ? 294  SER A CA    1 
ATOM   2139  C  C     . SER A 1  294  ? 51.903  -13.094  40.158  1.00 142.36 ? 294  SER A C     1 
ATOM   2140  O  O     . SER A 1  294  ? 51.069  -13.889  40.597  1.00 140.73 ? 294  SER A O     1 
ATOM   2141  C  CB    . SER A 1  294  ? 53.143  -12.050  42.081  1.00 145.42 ? 294  SER A CB    1 
ATOM   2142  O  OG    . SER A 1  294  ? 52.920  -10.701  41.707  1.00 155.93 ? 294  SER A OG    1 
ATOM   2143  N  N     . LEU A 1  295  ? 51.684  -12.317  39.070  1.00 138.41 ? 295  LEU A N     1 
ATOM   2144  C  CA    . LEU A 1  295  ? 50.449  -12.369  38.280  1.00 137.12 ? 295  LEU A CA    1 
ATOM   2145  C  C     . LEU A 1  295  ? 50.491  -13.486  37.228  1.00 138.37 ? 295  LEU A C     1 
ATOM   2146  O  O     . LEU A 1  295  ? 49.444  -13.874  36.708  1.00 137.04 ? 295  LEU A O     1 
ATOM   2147  C  CB    . LEU A 1  295  ? 50.086  -11.006  37.668  1.00 138.65 ? 295  LEU A CB    1 
ATOM   2148  C  CG    . LEU A 1  295  ? 48.584  -10.704  37.554  1.00 143.15 ? 295  LEU A CG    1 
ATOM   2149  C  CD1   . LEU A 1  295  ? 47.965  -10.382  38.919  1.00 143.25 ? 295  LEU A CD1   1 
ATOM   2150  C  CD2   . LEU A 1  295  ? 48.339  -9.556   36.604  1.00 147.15 ? 295  LEU A CD2   1 
ATOM   2151  N  N     . LEU A 1  296  ? 51.697  -14.024  36.943  1.00 133.82 ? 296  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  296  ? 51.881  -15.175  36.061  1.00 132.23 ? 296  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  296  ? 51.504  -16.401  36.901  1.00 134.41 ? 296  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  296  ? 50.912  -17.346  36.378  1.00 132.92 ? 296  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  296  ? 53.336  -15.281  35.581  1.00 132.90 ? 296  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  296  ? 53.634  -16.399  34.578  1.00 136.77 ? 296  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  296  ? 53.428  -15.932  33.156  1.00 137.65 ? 296  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  296  ? 55.037  -16.919  34.750  1.00 139.48 ? 296  LEU A CD2   1 
ATOM   2159  N  N     . GLN A 1  297  ? 51.832  -16.357  38.218  1.00 130.76 ? 297  GLN A N     1 
ATOM   2160  C  CA    . GLN A 1  297  ? 51.498  -17.380  39.209  1.00 129.18 ? 297  GLN A CA    1 
ATOM   2161  C  C     . GLN A 1  297  ? 49.971  -17.384  39.381  1.00 132.21 ? 297  GLN A C     1 
ATOM   2162  O  O     . GLN A 1  297  ? 49.352  -18.426  39.164  1.00 130.73 ? 297  GLN A O     1 
ATOM   2163  C  CB    . GLN A 1  297  ? 52.225  -17.106  40.543  1.00 131.00 ? 297  GLN A CB    1 
ATOM   2164  C  CG    . GLN A 1  297  ? 52.092  -18.216  41.589  1.00 143.95 ? 297  GLN A CG    1 
ATOM   2165  C  CD    . GLN A 1  297  ? 52.879  -19.448  41.224  1.00 160.29 ? 297  GLN A CD    1 
ATOM   2166  O  OE1   . GLN A 1  297  ? 54.104  -19.494  41.362  1.00 156.39 ? 297  GLN A OE1   1 
ATOM   2167  N  NE2   . GLN A 1  297  ? 52.190  -20.467  40.737  1.00 149.46 ? 297  GLN A NE2   1 
ATOM   2168  N  N     . PHE A 1  298  ? 49.356  -16.207  39.683  1.00 129.29 ? 298  PHE A N     1 
ATOM   2169  C  CA    . PHE A 1  298  ? 47.898  -16.074  39.788  1.00 128.51 ? 298  PHE A CA    1 
ATOM   2170  C  C     . PHE A 1  298  ? 47.322  -15.968  38.368  1.00 131.20 ? 298  PHE A C     1 
ATOM   2171  O  O     . PHE A 1  298  ? 46.896  -14.898  37.933  1.00 131.84 ? 298  PHE A O     1 
ATOM   2172  C  CB    . PHE A 1  298  ? 47.474  -14.884  40.687  1.00 131.57 ? 298  PHE A CB    1 
ATOM   2173  C  CG    . PHE A 1  298  ? 45.975  -14.749  40.880  1.00 133.17 ? 298  PHE A CG    1 
ATOM   2174  C  CD1   . PHE A 1  298  ? 45.305  -15.520  41.823  1.00 135.75 ? 298  PHE A CD1   1 
ATOM   2175  C  CD2   . PHE A 1  298  ? 45.236  -13.845  40.122  1.00 136.25 ? 298  PHE A CD2   1 
ATOM   2176  C  CE1   . PHE A 1  298  ? 43.920  -15.404  41.990  1.00 136.62 ? 298  PHE A CE1   1 
ATOM   2177  C  CE2   . PHE A 1  298  ? 43.852  -13.739  40.280  1.00 139.06 ? 298  PHE A CE2   1 
ATOM   2178  C  CZ    . PHE A 1  298  ? 43.204  -14.513  41.219  1.00 136.37 ? 298  PHE A CZ    1 
ATOM   2179  N  N     . HIS A 1  299  ? 47.388  -17.087  37.633  1.00 125.87 ? 299  HIS A N     1 
ATOM   2180  C  CA    . HIS A 1  299  ? 46.922  -17.275  36.260  1.00 125.16 ? 299  HIS A CA    1 
ATOM   2181  C  C     . HIS A 1  299  ? 47.089  -18.749  35.931  1.00 126.60 ? 299  HIS A C     1 
ATOM   2182  O  O     . HIS A 1  299  ? 46.092  -19.416  35.673  1.00 125.51 ? 299  HIS A O     1 
ATOM   2183  C  CB    . HIS A 1  299  ? 47.672  -16.372  35.254  1.00 127.38 ? 299  HIS A CB    1 
ATOM   2184  C  CG    . HIS A 1  299  ? 46.826  -15.296  34.634  1.00 131.78 ? 299  HIS A CG    1 
ATOM   2185  N  ND1   . HIS A 1  299  ? 47.010  -14.905  33.318  1.00 134.47 ? 299  HIS A ND1   1 
ATOM   2186  C  CD2   . HIS A 1  299  ? 45.826  -14.555  35.170  1.00 133.82 ? 299  HIS A CD2   1 
ATOM   2187  C  CE1   . HIS A 1  299  ? 46.126  -13.943  33.103  1.00 134.72 ? 299  HIS A CE1   1 
ATOM   2188  N  NE2   . HIS A 1  299  ? 45.386  -13.706  34.185  1.00 134.73 ? 299  HIS A NE2   1 
ATOM   2189  N  N     . VAL A 1  300  ? 48.340  -19.264  35.992  1.00 122.09 ? 300  VAL A N     1 
ATOM   2190  C  CA    . VAL A 1  300  ? 48.697  -20.668  35.736  1.00 120.45 ? 300  VAL A CA    1 
ATOM   2191  C  C     . VAL A 1  300  ? 48.051  -21.554  36.815  1.00 122.43 ? 300  VAL A C     1 
ATOM   2192  O  O     . VAL A 1  300  ? 47.522  -22.626  36.509  1.00 120.52 ? 300  VAL A O     1 
ATOM   2193  C  CB    . VAL A 1  300  ? 50.243  -20.852  35.643  1.00 124.81 ? 300  VAL A CB    1 
ATOM   2194  C  CG1   . VAL A 1  300  ? 50.639  -22.326  35.571  1.00 123.72 ? 300  VAL A CG1   1 
ATOM   2195  C  CG2   . VAL A 1  300  ? 50.817  -20.095  34.450  1.00 125.84 ? 300  VAL A CG2   1 
ATOM   2196  N  N     . ALA A 1  301  ? 48.064  -21.074  38.066  1.00 119.43 ? 301  ALA A N     1 
ATOM   2197  C  CA    . ALA A 1  301  ? 47.464  -21.764  39.200  1.00 118.51 ? 301  ALA A CA    1 
ATOM   2198  C  C     . ALA A 1  301  ? 45.944  -21.710  39.087  1.00 122.06 ? 301  ALA A C     1 
ATOM   2199  O  O     . ALA A 1  301  ? 45.307  -22.762  39.113  1.00 120.73 ? 301  ALA A O     1 
ATOM   2200  C  CB    . ALA A 1  301  ? 47.927  -21.137  40.506  1.00 119.94 ? 301  ALA A CB    1 
ATOM   2201  N  N     . THR A 1  302  ? 45.371  -20.502  38.879  1.00 119.45 ? 302  THR A N     1 
ATOM   2202  C  CA    . THR A 1  302  ? 43.923  -20.305  38.747  1.00 119.14 ? 302  THR A CA    1 
ATOM   2203  C  C     . THR A 1  302  ? 43.288  -20.967  37.488  1.00 122.50 ? 302  THR A C     1 
ATOM   2204  O  O     . THR A 1  302  ? 42.060  -21.038  37.380  1.00 121.69 ? 302  THR A O     1 
ATOM   2205  C  CB    . THR A 1  302  ? 43.515  -18.863  39.102  1.00 128.69 ? 302  THR A CB    1 
ATOM   2206  O  OG1   . THR A 1  302  ? 42.128  -18.823  39.436  1.00 129.43 ? 302  THR A OG1   1 
ATOM   2207  C  CG2   . THR A 1  302  ? 43.833  -17.866  38.010  1.00 128.00 ? 302  THR A CG2   1 
ATOM   2208  N  N     . TYR A 1  303  ? 44.139  -21.488  36.575  1.00 118.89 ? 303  TYR A N     1 
ATOM   2209  C  CA    . TYR A 1  303  ? 43.771  -22.229  35.363  1.00 118.01 ? 303  TYR A CA    1 
ATOM   2210  C  C     . TYR A 1  303  ? 43.444  -23.669  35.753  1.00 121.06 ? 303  TYR A C     1 
ATOM   2211  O  O     . TYR A 1  303  ? 42.685  -24.344  35.056  1.00 119.89 ? 303  TYR A O     1 
ATOM   2212  C  CB    . TYR A 1  303  ? 44.933  -22.163  34.344  1.00 119.52 ? 303  TYR A CB    1 
ATOM   2213  C  CG    . TYR A 1  303  ? 45.164  -23.376  33.464  1.00 119.99 ? 303  TYR A CG    1 
ATOM   2214  C  CD1   . TYR A 1  303  ? 44.390  -23.596  32.328  1.00 121.69 ? 303  TYR A CD1   1 
ATOM   2215  C  CD2   . TYR A 1  303  ? 46.234  -24.236  33.698  1.00 120.31 ? 303  TYR A CD2   1 
ATOM   2216  C  CE1   . TYR A 1  303  ? 44.630  -24.682  31.486  1.00 121.72 ? 303  TYR A CE1   1 
ATOM   2217  C  CE2   . TYR A 1  303  ? 46.486  -25.324  32.863  1.00 120.69 ? 303  TYR A CE2   1 
ATOM   2218  C  CZ    . TYR A 1  303  ? 45.686  -25.539  31.753  1.00 127.22 ? 303  TYR A CZ    1 
ATOM   2219  O  OH    . TYR A 1  303  ? 45.931  -26.611  30.928  1.00 126.83 ? 303  TYR A OH    1 
ATOM   2220  N  N     . MET A 1  304  ? 44.020  -24.127  36.873  1.00 117.93 ? 304  MET A N     1 
ATOM   2221  C  CA    . MET A 1  304  ? 43.827  -25.473  37.391  1.00 117.01 ? 304  MET A CA    1 
ATOM   2222  C  C     . MET A 1  304  ? 42.817  -25.506  38.543  1.00 121.50 ? 304  MET A C     1 
ATOM   2223  O  O     . MET A 1  304  ? 41.854  -26.265  38.463  1.00 120.08 ? 304  MET A O     1 
ATOM   2224  C  CB    . MET A 1  304  ? 45.173  -26.108  37.792  1.00 119.41 ? 304  MET A CB    1 
ATOM   2225  C  CG    . MET A 1  304  ? 46.124  -26.310  36.618  1.00 123.41 ? 304  MET A CG    1 
ATOM   2226  S  SD    . MET A 1  304  ? 47.590  -27.310  36.968  1.00 127.70 ? 304  MET A SD    1 
ATOM   2227  C  CE    . MET A 1  304  ? 48.566  -26.137  37.906  1.00 125.64 ? 304  MET A CE    1 
ATOM   2228  N  N     . ASP A 1  305  ? 43.011  -24.666  39.585  1.00 119.87 ? 305  ASP A N     1 
ATOM   2229  C  CA    . ASP A 1  305  ? 42.154  -24.613  40.777  1.00 120.12 ? 305  ASP A CA    1 
ATOM   2230  C  C     . ASP A 1  305  ? 41.717  -23.197  41.156  1.00 126.40 ? 305  ASP A C     1 
ATOM   2231  O  O     . ASP A 1  305  ? 42.518  -22.266  41.114  1.00 126.84 ? 305  ASP A O     1 
ATOM   2232  C  CB    . ASP A 1  305  ? 42.860  -25.324  41.960  1.00 121.99 ? 305  ASP A CB    1 
ATOM   2233  C  CG    . ASP A 1  305  ? 42.466  -24.915  43.376  1.00 134.09 ? 305  ASP A CG    1 
ATOM   2234  O  OD1   . ASP A 1  305  ? 41.270  -25.014  43.712  1.00 134.30 ? 305  ASP A OD1   1 
ATOM   2235  O  OD2   . ASP A 1  305  ? 43.372  -24.582  44.172  1.00 141.57 ? 305  ASP A OD2   1 
ATOM   2236  N  N     . ASN A 1  306  ? 40.446  -23.060  41.561  1.00 124.40 ? 306  ASN A N     1 
ATOM   2237  C  CA    . ASN A 1  306  ? 39.833  -21.813  42.029  1.00 126.11 ? 306  ASN A CA    1 
ATOM   2238  C  C     . ASN A 1  306  ? 39.156  -22.082  43.391  1.00 131.95 ? 306  ASN A C     1 
ATOM   2239  O  O     . ASN A 1  306  ? 39.069  -23.246  43.792  1.00 130.70 ? 306  ASN A O     1 
ATOM   2240  C  CB    . ASN A 1  306  ? 38.830  -21.283  40.997  1.00 126.93 ? 306  ASN A CB    1 
ATOM   2241  C  CG    . ASN A 1  306  ? 38.840  -19.781  40.860  1.00 146.78 ? 306  ASN A CG    1 
ATOM   2242  O  OD1   . ASN A 1  306  ? 38.342  -19.041  41.717  1.00 142.57 ? 306  ASN A OD1   1 
ATOM   2243  N  ND2   . ASN A 1  306  ? 39.395  -19.300  39.761  1.00 136.21 ? 306  ASN A ND2   1 
ATOM   2244  N  N     . ASP A 1  307  ? 38.687  -21.020  44.103  1.00 130.96 ? 307  ASP A N     1 
ATOM   2245  C  CA    . ASP A 1  307  ? 38.053  -21.109  45.436  1.00 131.62 ? 307  ASP A CA    1 
ATOM   2246  C  C     . ASP A 1  307  ? 39.121  -21.568  46.462  1.00 136.59 ? 307  ASP A C     1 
ATOM   2247  O  O     . ASP A 1  307  ? 39.111  -22.718  46.913  1.00 135.61 ? 307  ASP A O     1 
ATOM   2248  C  CB    . ASP A 1  307  ? 36.780  -22.009  45.409  1.00 132.64 ? 307  ASP A CB    1 
ATOM   2249  C  CG    . ASP A 1  307  ? 35.931  -22.032  46.671  1.00 143.15 ? 307  ASP A CG    1 
ATOM   2250  O  OD1   . ASP A 1  307  ? 34.863  -21.381  46.679  1.00 144.00 ? 307  ASP A OD1   1 
ATOM   2251  O  OD2   . ASP A 1  307  ? 36.274  -22.789  47.605  1.00 149.07 ? 307  ASP A OD2   1 
ATOM   2252  N  N     . ILE A 1  308  ? 40.094  -20.669  46.756  1.00 134.51 ? 308  ILE A N     1 
ATOM   2253  C  CA    . ILE A 1  308  ? 41.215  -20.935  47.674  1.00 134.66 ? 308  ILE A CA    1 
ATOM   2254  C  C     . ILE A 1  308  ? 41.197  -19.978  48.890  1.00 140.68 ? 308  ILE A C     1 
ATOM   2255  O  O     . ILE A 1  308  ? 40.549  -20.284  49.893  1.00 140.38 ? 308  ILE A O     1 
ATOM   2256  C  CB    . ILE A 1  308  ? 42.606  -20.975  46.949  1.00 137.48 ? 308  ILE A CB    1 
ATOM   2257  C  CG1   . ILE A 1  308  ? 42.533  -21.610  45.542  1.00 136.63 ? 308  ILE A CG1   1 
ATOM   2258  C  CG2   . ILE A 1  308  ? 43.664  -21.672  47.813  1.00 138.17 ? 308  ILE A CG2   1 
ATOM   2259  C  CD1   . ILE A 1  308  ? 43.135  -20.768  44.452  1.00 142.33 ? 308  ILE A CD1   1 
ATOM   2260  N  N     . ALA A 1  309  ? 41.918  -18.834  48.793  1.00 138.78 ? 309  ALA A N     1 
ATOM   2261  C  CA    . ALA A 1  309  ? 42.049  -17.789  49.818  1.00 140.18 ? 309  ALA A CA    1 
ATOM   2262  C  C     . ALA A 1  309  ? 42.608  -16.489  49.215  1.00 145.65 ? 309  ALA A C     1 
ATOM   2263  O  O     . ALA A 1  309  ? 42.421  -15.415  49.793  1.00 146.31 ? 309  ALA A O     1 
ATOM   2264  C  CB    . ALA A 1  309  ? 42.956  -18.268  50.946  1.00 141.14 ? 309  ALA A CB    1 
ATOM   2265  N  N     . GLY A 1  310  ? 43.282  -16.610  48.067  1.00 142.39 ? 310  GLY A N     1 
ATOM   2266  C  CA    . GLY A 1  310  ? 43.903  -15.502  47.348  1.00 143.35 ? 310  GLY A CA    1 
ATOM   2267  C  C     . GLY A 1  310  ? 43.042  -14.858  46.279  1.00 148.03 ? 310  GLY A C     1 
ATOM   2268  O  O     . GLY A 1  310  ? 43.533  -14.582  45.180  1.00 147.40 ? 310  GLY A O     1 
ATOM   2269  N  N     . GLN A 1  311  ? 41.749  -14.609  46.605  1.00 145.70 ? 311  GLN A N     1 
ATOM   2270  C  CA    . GLN A 1  311  ? 40.725  -13.945  45.776  1.00 146.38 ? 311  GLN A CA    1 
ATOM   2271  C  C     . GLN A 1  311  ? 40.225  -14.691  44.514  1.00 150.11 ? 311  GLN A C     1 
ATOM   2272  O  O     . GLN A 1  311  ? 41.012  -15.408  43.891  1.00 148.76 ? 311  GLN A O     1 
ATOM   2273  C  CB    . GLN A 1  311  ? 41.075  -12.464  45.511  1.00 149.35 ? 311  GLN A CB    1 
ATOM   2274  C  CG    . GLN A 1  311  ? 40.587  -11.501  46.608  1.00 165.05 ? 311  GLN A CG    1 
ATOM   2275  C  CD    . GLN A 1  311  ? 41.115  -11.784  48.004  1.00 180.78 ? 311  GLN A CD    1 
ATOM   2276  O  OE1   . GLN A 1  311  ? 42.324  -11.904  48.238  1.00 175.60 ? 311  GLN A OE1   1 
ATOM   2277  N  NE2   . GLN A 1  311  ? 40.211  -11.890  48.966  1.00 171.33 ? 311  GLN A NE2   1 
ATOM   2278  N  N     . PRO A 1  312  ? 38.926  -14.538  44.117  1.00 147.55 ? 312  PRO A N     1 
ATOM   2279  C  CA    . PRO A 1  312  ? 38.418  -15.279  42.942  1.00 146.43 ? 312  PRO A CA    1 
ATOM   2280  C  C     . PRO A 1  312  ? 38.918  -14.794  41.576  1.00 150.98 ? 312  PRO A C     1 
ATOM   2281  O  O     . PRO A 1  312  ? 39.843  -13.985  41.506  1.00 151.35 ? 312  PRO A O     1 
ATOM   2282  C  CB    . PRO A 1  312  ? 36.896  -15.152  43.080  1.00 148.39 ? 312  PRO A CB    1 
ATOM   2283  C  CG    . PRO A 1  312  ? 36.698  -13.863  43.782  1.00 154.54 ? 312  PRO A CG    1 
ATOM   2284  C  CD    . PRO A 1  312  ? 37.846  -13.748  44.751  1.00 150.38 ? 312  PRO A CD    1 
ATOM   2285  N  N     . GLN A 1  313  ? 38.305  -15.305  40.490  1.00 147.47 ? 313  GLN A N     1 
ATOM   2286  C  CA    . GLN A 1  313  ? 38.660  -14.955  39.115  1.00 148.03 ? 313  GLN A CA    1 
ATOM   2287  C  C     . GLN A 1  313  ? 37.573  -14.133  38.405  1.00 153.86 ? 313  GLN A C     1 
ATOM   2288  O  O     . GLN A 1  313  ? 36.395  -14.218  38.756  1.00 153.47 ? 313  GLN A O     1 
ATOM   2289  C  CB    . GLN A 1  313  ? 39.039  -16.221  38.318  1.00 147.94 ? 313  GLN A CB    1 
ATOM   2290  C  CG    . GLN A 1  313  ? 39.674  -15.992  36.932  1.00 165.01 ? 313  GLN A CG    1 
ATOM   2291  C  CD    . GLN A 1  313  ? 40.782  -14.962  36.872  1.00 187.04 ? 313  GLN A CD    1 
ATOM   2292  O  OE1   . GLN A 1  313  ? 40.736  -14.020  36.073  1.00 183.38 ? 313  GLN A OE1   1 
ATOM   2293  N  NE2   . GLN A 1  313  ? 41.816  -15.125  37.686  1.00 180.47 ? 313  GLN A NE2   1 
ATOM   2294  N  N     . ALA A 1  314  ? 37.990  -13.326  37.415  1.00 152.20 ? 314  ALA A N     1 
ATOM   2295  C  CA    . ALA A 1  314  ? 37.132  -12.463  36.606  1.00 153.62 ? 314  ALA A CA    1 
ATOM   2296  C  C     . ALA A 1  314  ? 36.221  -13.249  35.644  1.00 156.75 ? 314  ALA A C     1 
ATOM   2297  O  O     . ALA A 1  314  ? 36.407  -14.453  35.442  1.00 154.52 ? 314  ALA A O     1 
ATOM   2298  C  CB    . ALA A 1  314  ? 37.985  -11.460  35.836  1.00 155.80 ? 314  ALA A CB    1 
ATOM   2299  N  N     . LEU A 1  315  ? 35.231  -12.547  35.066  1.00 154.79 ? 315  LEU A N     1 
ATOM   2300  C  CA    . LEU A 1  315  ? 34.252  -13.087  34.123  1.00 154.36 ? 315  LEU A CA    1 
ATOM   2301  C  C     . LEU A 1  315  ? 34.839  -13.517  32.780  1.00 158.72 ? 315  LEU A C     1 
ATOM   2302  O  O     . LEU A 1  315  ? 34.454  -14.571  32.265  1.00 157.30 ? 315  LEU A O     1 
ATOM   2303  C  CB    . LEU A 1  315  ? 33.059  -12.124  33.934  1.00 155.94 ? 315  LEU A CB    1 
ATOM   2304  C  CG    . LEU A 1  315  ? 33.369  -10.649  33.675  1.00 162.56 ? 315  LEU A CG    1 
ATOM   2305  C  CD1   . LEU A 1  315  ? 33.080  -10.278  32.248  1.00 163.77 ? 315  LEU A CD1   1 
ATOM   2306  C  CD2   . LEU A 1  315  ? 32.570  -9.763   34.595  1.00 166.06 ? 315  LEU A CD2   1 
ATOM   2307  N  N     . GLN A 1  316  ? 35.785  -12.712  32.233  1.00 156.65 ? 316  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1  316  ? 36.449  -12.894  30.933  1.00 156.63 ? 316  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1  316  ? 35.397  -12.801  29.811  1.00 160.95 ? 316  GLN A C     1 
ATOM   2310  O  O     . GLN A 1  316  ? 35.018  -13.814  29.213  1.00 159.39 ? 316  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1  316  ? 37.307  -14.188  30.882  1.00 156.16 ? 316  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1  316  ? 38.272  -14.278  29.696  1.00 171.28 ? 316  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1  316  ? 39.433  -13.321  29.804  1.00 191.61 ? 316  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1  316  ? 40.311  -13.463  30.661  1.00 186.07 ? 316  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1  316  ? 39.471  -12.332  28.924  1.00 186.09 ? 316  GLN A NE2   1 
ATOM   2316  N  N     . LYS A 1  317  ? 34.870  -11.567  29.604  1.00 159.23 ? 317  LYS A N     1 
ATOM   2317  C  CA    . LYS A 1  317  ? 33.833  -11.178  28.627  1.00 160.22 ? 317  LYS A CA    1 
ATOM   2318  C  C     . LYS A 1  317  ? 32.417  -11.773  28.867  1.00 163.32 ? 317  LYS A C     1 
ATOM   2319  O  O     . LYS A 1  317  ? 31.455  -11.304  28.247  1.00 164.19 ? 317  LYS A O     1 
ATOM   2320  C  CB    . LYS A 1  317  ? 34.299  -11.377  27.162  1.00 162.90 ? 317  LYS A CB    1 
ATOM   2321  C  CG    . LYS A 1  317  ? 35.508  -10.539  26.757  1.00 172.68 ? 317  LYS A CG    1 
ATOM   2322  C  CD    . LYS A 1  317  ? 36.011  -10.923  25.369  1.00 179.05 ? 317  LYS A CD    1 
ATOM   2323  C  CE    . LYS A 1  317  ? 37.346  -10.301  25.035  1.00 186.96 ? 317  LYS A CE    1 
ATOM   2324  N  NZ    . LYS A 1  317  ? 38.469  -10.956  25.758  1.00 191.64 ? 317  LYS A NZ    1 
ATOM   2325  N  N     . SER A 1  318  ? 32.288  -12.777  29.772  1.00 157.71 ? 318  SER A N     1 
ATOM   2326  C  CA    . SER A 1  318  ? 31.026  -13.468  30.070  1.00 156.47 ? 318  SER A CA    1 
ATOM   2327  C  C     . SER A 1  318  ? 30.573  -13.384  31.551  1.00 158.70 ? 318  SER A C     1 
ATOM   2328  O  O     . SER A 1  318  ? 30.347  -12.281  32.053  1.00 159.59 ? 318  SER A O     1 
ATOM   2329  C  CB    . SER A 1  318  ? 31.080  -14.912  29.570  1.00 158.44 ? 318  SER A CB    1 
ATOM   2330  O  OG    . SER A 1  318  ? 32.112  -15.649  30.208  1.00 165.92 ? 318  SER A OG    1 
ATOM   2331  N  N     . GLY A 1  319  ? 30.411  -14.543  32.203  1.00 152.60 ? 319  GLY A N     1 
ATOM   2332  C  CA    . GLY A 1  319  ? 29.970  -14.675  33.590  1.00 151.38 ? 319  GLY A CA    1 
ATOM   2333  C  C     . GLY A 1  319  ? 31.060  -15.145  34.532  1.00 152.17 ? 319  GLY A C     1 
ATOM   2334  O  O     . GLY A 1  319  ? 31.747  -16.133  34.254  1.00 150.41 ? 319  GLY A O     1 
ATOM   2335  N  N     . ARG A 1  320  ? 31.209  -14.436  35.661  1.00 147.62 ? 320  ARG A N     1 
ATOM   2336  C  CA    . ARG A 1  320  ? 32.225  -14.684  36.684  1.00 145.70 ? 320  ARG A CA    1 
ATOM   2337  C  C     . ARG A 1  320  ? 31.943  -15.886  37.594  1.00 145.82 ? 320  ARG A C     1 
ATOM   2338  O  O     . ARG A 1  320  ? 30.816  -16.027  38.067  1.00 145.53 ? 320  ARG A O     1 
ATOM   2339  C  CB    . ARG A 1  320  ? 32.516  -13.403  37.502  1.00 147.41 ? 320  ARG A CB    1 
ATOM   2340  C  CG    . ARG A 1  320  ? 31.300  -12.749  38.174  1.00 158.05 ? 320  ARG A CG    1 
ATOM   2341  C  CD    . ARG A 1  320  ? 30.891  -11.449  37.504  1.00 168.35 ? 320  ARG A CD    1 
ATOM   2342  N  NE    . ARG A 1  320  ? 29.979  -11.657  36.376  1.00 175.40 ? 320  ARG A NE    1 
ATOM   2343  C  CZ    . ARG A 1  320  ? 28.664  -11.462  36.424  1.00 188.11 ? 320  ARG A CZ    1 
ATOM   2344  N  NH1   . ARG A 1  320  ? 28.087  -11.047  37.545  1.00 173.77 ? 320  ARG A NH1   1 
ATOM   2345  N  NH2   . ARG A 1  320  ? 27.917  -11.675  35.349  1.00 174.69 ? 320  ARG A NH2   1 
ATOM   2346  N  N     . PRO A 1  321  ? 32.935  -16.763  37.878  1.00 139.31 ? 321  PRO A N     1 
ATOM   2347  C  CA    . PRO A 1  321  ? 34.339  -16.765  37.436  1.00 138.35 ? 321  PRO A CA    1 
ATOM   2348  C  C     . PRO A 1  321  ? 34.569  -17.770  36.299  1.00 139.41 ? 321  PRO A C     1 
ATOM   2349  O  O     . PRO A 1  321  ? 33.626  -18.096  35.575  1.00 138.89 ? 321  PRO A O     1 
ATOM   2350  C  CB    . PRO A 1  321  ? 35.066  -17.199  38.720  1.00 139.50 ? 321  PRO A CB    1 
ATOM   2351  C  CG    . PRO A 1  321  ? 34.040  -18.070  39.486  1.00 143.19 ? 321  PRO A CG    1 
ATOM   2352  C  CD    . PRO A 1  321  ? 32.698  -17.890  38.797  1.00 139.25 ? 321  PRO A CD    1 
ATOM   2353  N  N     . VAL A 1  322  ? 35.813  -18.271  36.153  1.00 133.89 ? 322  VAL A N     1 
ATOM   2354  C  CA    . VAL A 1  322  ? 36.151  -19.325  35.189  1.00 131.89 ? 322  VAL A CA    1 
ATOM   2355  C  C     . VAL A 1  322  ? 36.151  -20.642  35.974  1.00 132.07 ? 322  VAL A C     1 
ATOM   2356  O  O     . VAL A 1  322  ? 36.531  -20.638  37.149  1.00 131.64 ? 322  VAL A O     1 
ATOM   2357  C  CB    . VAL A 1  322  ? 37.453  -19.090  34.369  1.00 136.26 ? 322  VAL A CB    1 
ATOM   2358  C  CG1   . VAL A 1  322  ? 37.350  -17.830  33.510  1.00 137.79 ? 322  VAL A CG1   1 
ATOM   2359  C  CG2   . VAL A 1  322  ? 38.701  -19.059  35.251  1.00 135.86 ? 322  VAL A CG2   1 
ATOM   2360  N  N     . LYS A 1  323  ? 35.683  -21.745  35.365  1.00 125.78 ? 323  LYS A N     1 
ATOM   2361  C  CA    . LYS A 1  323  ? 35.587  -23.016  36.088  1.00 123.40 ? 323  LYS A CA    1 
ATOM   2362  C  C     . LYS A 1  323  ? 36.904  -23.674  36.536  1.00 124.27 ? 323  LYS A C     1 
ATOM   2363  O  O     . LYS A 1  323  ? 37.016  -24.037  37.711  1.00 123.83 ? 323  LYS A O     1 
ATOM   2364  C  CB    . LYS A 1  323  ? 34.566  -24.001  35.462  1.00 125.05 ? 323  LYS A CB    1 
ATOM   2365  C  CG    . LYS A 1  323  ? 35.076  -24.883  34.324  1.00 139.28 ? 323  LYS A CG    1 
ATOM   2366  C  CD    . LYS A 1  323  ? 35.040  -24.182  32.971  1.00 151.82 ? 323  LYS A CD    1 
ATOM   2367  C  CE    . LYS A 1  323  ? 36.218  -24.563  32.110  1.00 162.31 ? 323  LYS A CE    1 
ATOM   2368  N  NZ    . LYS A 1  323  ? 37.453  -23.848  32.526  1.00 171.31 ? 323  LYS A NZ    1 
ATOM   2369  N  N     . SER A 1  324  ? 37.899  -23.791  35.621  1.00 118.16 ? 324  SER A N     1 
ATOM   2370  C  CA    . SER A 1  324  ? 39.212  -24.437  35.818  1.00 116.23 ? 324  SER A CA    1 
ATOM   2371  C  C     . SER A 1  324  ? 39.112  -25.973  35.901  1.00 115.18 ? 324  SER A C     1 
ATOM   2372  O  O     . SER A 1  324  ? 38.072  -26.506  36.294  1.00 114.14 ? 324  SER A O     1 
ATOM   2373  C  CB    . SER A 1  324  ? 39.992  -23.838  36.994  1.00 120.27 ? 324  SER A CB    1 
ATOM   2374  O  OG    . SER A 1  324  ? 39.566  -24.330  38.255  1.00 127.78 ? 324  SER A OG    1 
ATOM   2375  N  N     . ILE A 1  325  ? 40.196  -26.673  35.519  1.00 108.58 ? 325  ILE A N     1 
ATOM   2376  C  CA    . ILE A 1  325  ? 40.298  -28.141  35.474  1.00 105.99 ? 325  ILE A CA    1 
ATOM   2377  C  C     . ILE A 1  325  ? 39.833  -28.872  36.756  1.00 106.67 ? 325  ILE A C     1 
ATOM   2378  O  O     . ILE A 1  325  ? 39.309  -29.983  36.646  1.00 105.48 ? 325  ILE A O     1 
ATOM   2379  C  CB    . ILE A 1  325  ? 41.681  -28.638  34.951  1.00 109.01 ? 325  ILE A CB    1 
ATOM   2380  C  CG1   . ILE A 1  325  ? 42.343  -27.619  34.002  1.00 110.30 ? 325  ILE A CG1   1 
ATOM   2381  C  CG2   . ILE A 1  325  ? 41.559  -30.011  34.278  1.00 108.89 ? 325  ILE A CG2   1 
ATOM   2382  C  CD1   . ILE A 1  325  ? 43.826  -27.631  33.997  1.00 117.07 ? 325  ILE A CD1   1 
ATOM   2383  N  N     . ARG A 1  326  ? 39.991  -28.247  37.953  1.00 101.44 ? 326  ARG A N     1 
ATOM   2384  C  CA    . ARG A 1  326  ? 39.561  -28.846  39.223  1.00 99.59  ? 326  ARG A CA    1 
ATOM   2385  C  C     . ARG A 1  326  ? 38.054  -29.059  39.243  1.00 100.51 ? 326  ARG A C     1 
ATOM   2386  O  O     . ARG A 1  326  ? 37.615  -30.194  39.424  1.00 99.47  ? 326  ARG A O     1 
ATOM   2387  C  CB    . ARG A 1  326  ? 40.001  -28.020  40.450  1.00 100.14 ? 326  ARG A CB    1 
ATOM   2388  C  CG    . ARG A 1  326  ? 39.493  -28.620  41.760  1.00 108.31 ? 326  ARG A CG    1 
ATOM   2389  C  CD    . ARG A 1  326  ? 39.805  -27.824  43.006  1.00 114.85 ? 326  ARG A CD    1 
ATOM   2390  N  NE    . ARG A 1  326  ? 39.395  -28.563  44.202  1.00 120.55 ? 326  ARG A NE    1 
ATOM   2391  C  CZ    . ARG A 1  326  ? 39.560  -28.138  45.449  1.00 135.68 ? 326  ARG A CZ    1 
ATOM   2392  N  NH1   . ARG A 1  326  ? 40.124  -26.961  45.689  1.00 124.70 ? 326  ARG A NH1   1 
ATOM   2393  N  NH2   . ARG A 1  326  ? 39.157  -28.886  46.469  1.00 122.24 ? 326  ARG A NH2   1 
ATOM   2394  N  N     . ALA A 1  327  ? 37.273  -27.974  39.042  1.00 95.62  ? 327  ALA A N     1 
ATOM   2395  C  CA    . ALA A 1  327  ? 35.809  -27.993  39.040  1.00 94.52  ? 327  ALA A CA    1 
ATOM   2396  C  C     . ALA A 1  327  ? 35.232  -29.011  38.067  1.00 96.42  ? 327  ALA A C     1 
ATOM   2397  O  O     . ALA A 1  327  ? 34.184  -29.596  38.351  1.00 95.64  ? 327  ALA A O     1 
ATOM   2398  C  CB    . ALA A 1  327  ? 35.268  -26.612  38.726  1.00 96.25  ? 327  ALA A CB    1 
ATOM   2399  N  N     . ARG A 1  328  ? 35.938  -29.242  36.938  1.00 92.00  ? 328  ARG A N     1 
ATOM   2400  C  CA    . ARG A 1  328  ? 35.573  -30.181  35.874  1.00 90.66  ? 328  ARG A CA    1 
ATOM   2401  C  C     . ARG A 1  328  ? 35.482  -31.625  36.357  1.00 93.17  ? 328  ARG A C     1 
ATOM   2402  O  O     . ARG A 1  328  ? 34.667  -32.386  35.834  1.00 92.50  ? 328  ARG A O     1 
ATOM   2403  C  CB    . ARG A 1  328  ? 36.566  -30.088  34.710  1.00 89.89  ? 328  ARG A CB    1 
ATOM   2404  C  CG    . ARG A 1  328  ? 36.405  -28.832  33.876  1.00 97.68  ? 328  ARG A CG    1 
ATOM   2405  C  CD    . ARG A 1  328  ? 37.336  -28.847  32.687  1.00 101.86 ? 328  ARG A CD    1 
ATOM   2406  N  NE    . ARG A 1  328  ? 36.924  -27.885  31.669  1.00 104.65 ? 328  ARG A NE    1 
ATOM   2407  C  CZ    . ARG A 1  328  ? 37.026  -28.088  30.362  1.00 116.73 ? 328  ARG A CZ    1 
ATOM   2408  N  NH1   . ARG A 1  328  ? 37.525  -29.226  29.896  1.00 100.65 ? 328  ARG A NH1   1 
ATOM   2409  N  NH2   . ARG A 1  328  ? 36.626  -27.157  29.509  1.00 106.32 ? 328  ARG A NH2   1 
ATOM   2410  N  N     . LEU A 1  329  ? 36.308  -31.995  37.353  1.00 88.69  ? 329  LEU A N     1 
ATOM   2411  C  CA    . LEU A 1  329  ? 36.347  -33.350  37.907  1.00 87.33  ? 329  LEU A CA    1 
ATOM   2412  C  C     . LEU A 1  329  ? 35.730  -33.451  39.308  1.00 91.38  ? 329  LEU A C     1 
ATOM   2413  O  O     . LEU A 1  329  ? 35.577  -34.563  39.817  1.00 90.51  ? 329  LEU A O     1 
ATOM   2414  C  CB    . LEU A 1  329  ? 37.791  -33.908  37.912  1.00 87.23  ? 329  LEU A CB    1 
ATOM   2415  C  CG    . LEU A 1  329  ? 38.804  -33.348  36.902  1.00 91.91  ? 329  LEU A CG    1 
ATOM   2416  C  CD1   . LEU A 1  329  ? 40.207  -33.727  37.291  1.00 92.34  ? 329  LEU A CD1   1 
ATOM   2417  C  CD2   . LEU A 1  329  ? 38.515  -33.818  35.489  1.00 93.61  ? 329  LEU A CD2   1 
ATOM   2418  N  N     . LYS A 1  330  ? 35.366  -32.297  39.917  1.00 88.97  ? 330  LYS A N     1 
ATOM   2419  C  CA    . LYS A 1  330  ? 34.801  -32.167  41.269  1.00 89.18  ? 330  LYS A CA    1 
ATOM   2420  C  C     . LYS A 1  330  ? 33.544  -32.979  41.541  1.00 93.28  ? 330  LYS A C     1 
ATOM   2421  O  O     . LYS A 1  330  ? 32.659  -33.061  40.689  1.00 92.15  ? 330  LYS A O     1 
ATOM   2422  C  CB    . LYS A 1  330  ? 34.573  -30.695  41.636  1.00 92.48  ? 330  LYS A CB    1 
ATOM   2423  C  CG    . LYS A 1  330  ? 35.557  -30.171  42.677  1.00 104.07 ? 330  LYS A CG    1 
ATOM   2424  C  CD    . LYS A 1  330  ? 34.897  -29.949  44.034  1.00 111.31 ? 330  LYS A CD    1 
ATOM   2425  C  CE    . LYS A 1  330  ? 35.817  -29.242  44.998  1.00 119.01 ? 330  LYS A CE    1 
ATOM   2426  N  NZ    . LYS A 1  330  ? 35.158  -28.988  46.307  1.00 126.32 ? 330  LYS A NZ    1 
ATOM   2427  N  N     . GLY A 1  331  ? 33.486  -33.536  42.753  1.00 91.00  ? 331  GLY A N     1 
ATOM   2428  C  CA    . GLY A 1  331  ? 32.402  -34.368  43.272  1.00 90.94  ? 331  GLY A CA    1 
ATOM   2429  C  C     . GLY A 1  331  ? 30.993  -33.904  42.961  1.00 95.12  ? 331  GLY A C     1 
ATOM   2430  O  O     . GLY A 1  331  ? 30.689  -32.711  43.069  1.00 95.63  ? 331  GLY A O     1 
ATOM   2431  N  N     . LYS A 1  332  ? 30.128  -34.869  42.579  1.00 90.71  ? 332  LYS A N     1 
ATOM   2432  C  CA    . LYS A 1  332  ? 28.728  -34.718  42.173  1.00 90.43  ? 332  LYS A CA    1 
ATOM   2433  C  C     . LYS A 1  332  ? 28.621  -33.931  40.873  1.00 94.79  ? 332  LYS A C     1 
ATOM   2434  O  O     . LYS A 1  332  ? 29.029  -32.769  40.804  1.00 95.49  ? 332  LYS A O     1 
ATOM   2435  C  CB    . LYS A 1  332  ? 27.827  -34.160  43.299  1.00 93.33  ? 332  LYS A CB    1 
ATOM   2436  C  CG    . LYS A 1  332  ? 26.327  -34.228  43.008  1.00 101.55 ? 332  LYS A CG    1 
ATOM   2437  C  CD    . LYS A 1  332  ? 25.775  -35.651  43.042  1.00 107.50 ? 332  LYS A CD    1 
ATOM   2438  C  CE    . LYS A 1  332  ? 24.291  -35.664  43.282  1.00 116.47 ? 332  LYS A CE    1 
ATOM   2439  N  NZ    . LYS A 1  332  ? 23.955  -35.335  44.695  1.00 125.69 ? 332  LYS A NZ    1 
ATOM   2440  N  N     . GLU A 1  333  ? 28.111  -34.592  39.829  1.00 90.61  ? 333  GLU A N     1 
ATOM   2441  C  CA    . GLU A 1  333  ? 27.951  -34.051  38.476  1.00 90.83  ? 333  GLU A CA    1 
ATOM   2442  C  C     . GLU A 1  333  ? 29.229  -33.516  37.771  1.00 94.96  ? 333  GLU A C     1 
ATOM   2443  O  O     . GLU A 1  333  ? 29.125  -32.865  36.726  1.00 95.54  ? 333  GLU A O     1 
ATOM   2444  C  CB    . GLU A 1  333  ? 26.701  -33.145  38.321  1.00 93.05  ? 333  GLU A CB    1 
ATOM   2445  C  CG    . GLU A 1  333  ? 26.797  -31.735  38.881  1.00 104.75 ? 333  GLU A CG    1 
ATOM   2446  C  CD    . GLU A 1  333  ? 25.601  -30.861  38.561  1.00 130.60 ? 333  GLU A CD    1 
ATOM   2447  O  OE1   . GLU A 1  333  ? 24.472  -31.223  38.967  1.00 125.73 ? 333  GLU A OE1   1 
ATOM   2448  O  OE2   . GLU A 1  333  ? 25.793  -29.808  37.911  1.00 127.98 ? 333  GLU A OE2   1 
ATOM   2449  N  N     . GLY A 1  334  ? 30.406  -33.850  38.314  1.00 90.40  ? 334  GLY A N     1 
ATOM   2450  C  CA    . GLY A 1  334  ? 31.696  -33.470  37.746  1.00 89.93  ? 334  GLY A CA    1 
ATOM   2451  C  C     . GLY A 1  334  ? 32.093  -34.411  36.629  1.00 92.46  ? 334  GLY A C     1 
ATOM   2452  O  O     . GLY A 1  334  ? 31.297  -34.647  35.714  1.00 92.46  ? 334  GLY A O     1 
ATOM   2453  N  N     . ARG A 1  335  ? 33.317  -34.960  36.680  1.00 87.42  ? 335  ARG A N     1 
ATOM   2454  C  CA    . ARG A 1  335  ? 33.745  -35.912  35.655  1.00 86.05  ? 335  ARG A CA    1 
ATOM   2455  C  C     . ARG A 1  335  ? 33.632  -37.328  36.195  1.00 88.95  ? 335  ARG A C     1 
ATOM   2456  O  O     . ARG A 1  335  ? 32.921  -38.144  35.613  1.00 88.14  ? 335  ARG A O     1 
ATOM   2457  C  CB    . ARG A 1  335  ? 35.160  -35.622  35.121  1.00 84.73  ? 335  ARG A CB    1 
ATOM   2458  C  CG    . ARG A 1  335  ? 35.408  -36.231  33.741  1.00 90.20  ? 335  ARG A CG    1 
ATOM   2459  C  CD    . ARG A 1  335  ? 35.481  -35.194  32.631  1.00 97.95  ? 335  ARG A CD    1 
ATOM   2460  N  NE    . ARG A 1  335  ? 34.313  -34.310  32.588  1.00 102.51 ? 335  ARG A NE    1 
ATOM   2461  C  CZ    . ARG A 1  335  ? 34.287  -33.126  31.982  1.00 111.38 ? 335  ARG A CZ    1 
ATOM   2462  N  NH1   . ARG A 1  335  ? 35.365  -32.668  31.357  1.00 94.46  ? 335  ARG A NH1   1 
ATOM   2463  N  NH2   . ARG A 1  335  ? 33.186  -32.386  32.005  1.00 96.08  ? 335  ARG A NH2   1 
ATOM   2464  N  N     . ILE A 1  336  ? 34.307  -37.610  37.321  1.00 85.07  ? 336  ILE A N     1 
ATOM   2465  C  CA    . ILE A 1  336  ? 34.314  -38.928  37.958  1.00 83.96  ? 336  ILE A CA    1 
ATOM   2466  C  C     . ILE A 1  336  ? 32.900  -39.350  38.383  1.00 85.25  ? 336  ILE A C     1 
ATOM   2467  O  O     . ILE A 1  336  ? 32.399  -40.385  37.938  1.00 83.62  ? 336  ILE A O     1 
ATOM   2468  C  CB    . ILE A 1  336  ? 35.330  -38.948  39.135  1.00 87.61  ? 336  ILE A CB    1 
ATOM   2469  C  CG1   . ILE A 1  336  ? 36.782  -38.621  38.666  1.00 88.64  ? 336  ILE A CG1   1 
ATOM   2470  C  CG2   . ILE A 1  336  ? 35.245  -40.250  39.951  1.00 88.05  ? 336  ILE A CG2   1 
ATOM   2471  C  CD1   . ILE A 1  336  ? 37.588  -39.772  37.972  1.00 97.29  ? 336  ILE A CD1   1 
ATOM   2472  N  N     . ARG A 1  337  ? 32.264  -38.518  39.212  1.00 81.01  ? 337  ARG A N     1 
ATOM   2473  C  CA    . ARG A 1  337  ? 30.936  -38.742  39.763  1.00 79.98  ? 337  ARG A CA    1 
ATOM   2474  C  C     . ARG A 1  337  ? 29.772  -38.734  38.753  1.00 82.15  ? 337  ARG A C     1 
ATOM   2475  O  O     . ARG A 1  337  ? 28.894  -39.596  38.848  1.00 81.21  ? 337  ARG A O     1 
ATOM   2476  C  CB    . ARG A 1  337  ? 30.683  -37.733  40.882  1.00 80.05  ? 337  ARG A CB    1 
ATOM   2477  C  CG    . ARG A 1  337  ? 31.112  -38.215  42.250  1.00 86.11  ? 337  ARG A CG    1 
ATOM   2478  C  CD    . ARG A 1  337  ? 29.900  -38.277  43.145  1.00 91.25  ? 337  ARG A CD    1 
ATOM   2479  N  NE    . ARG A 1  337  ? 30.192  -37.868  44.515  1.00 98.01  ? 337  ARG A NE    1 
ATOM   2480  C  CZ    . ARG A 1  337  ? 29.265  -37.572  45.420  1.00 110.80 ? 337  ARG A CZ    1 
ATOM   2481  N  NH1   . ARG A 1  337  ? 27.975  -37.636  45.106  1.00 90.35  ? 337  ARG A NH1   1 
ATOM   2482  N  NH2   . ARG A 1  337  ? 29.620  -37.216  46.648  1.00 101.79 ? 337  ARG A NH2   1 
ATOM   2483  N  N     . GLY A 1  338  ? 29.767  -37.766  37.828  1.00 77.77  ? 338  GLY A N     1 
ATOM   2484  C  CA    . GLY A 1  338  ? 28.691  -37.581  36.852  1.00 76.86  ? 338  GLY A CA    1 
ATOM   2485  C  C     . GLY A 1  338  ? 28.854  -38.137  35.446  1.00 78.22  ? 338  GLY A C     1 
ATOM   2486  O  O     . GLY A 1  338  ? 27.884  -38.140  34.681  1.00 77.05  ? 338  GLY A O     1 
ATOM   2487  N  N     . ASN A 1  339  ? 30.066  -38.605  35.085  1.00 73.80  ? 339  ASN A N     1 
ATOM   2488  C  CA    . ASN A 1  339  ? 30.351  -39.153  33.754  1.00 73.00  ? 339  ASN A CA    1 
ATOM   2489  C  C     . ASN A 1  339  ? 31.058  -40.513  33.803  1.00 76.82  ? 339  ASN A C     1 
ATOM   2490  O  O     . ASN A 1  339  ? 31.165  -41.173  32.765  1.00 76.42  ? 339  ASN A O     1 
ATOM   2491  C  CB    . ASN A 1  339  ? 31.169  -38.159  32.918  1.00 71.67  ? 339  ASN A CB    1 
ATOM   2492  C  CG    . ASN A 1  339  ? 30.482  -36.848  32.648  1.00 88.49  ? 339  ASN A CG    1 
ATOM   2493  O  OD1   . ASN A 1  339  ? 29.400  -36.794  32.056  1.00 84.11  ? 339  ASN A OD1   1 
ATOM   2494  N  ND2   . ASN A 1  339  ? 31.123  -35.755  33.036  1.00 77.74  ? 339  ASN A ND2   1 
ATOM   2495  N  N     . LEU A 1  340  ? 31.548  -40.934  34.989  1.00 73.42  ? 340  LEU A N     1 
ATOM   2496  C  CA    . LEU A 1  340  ? 32.251  -42.215  35.114  1.00 72.98  ? 340  LEU A CA    1 
ATOM   2497  C  C     . LEU A 1  340  ? 31.590  -43.255  36.022  1.00 74.73  ? 340  LEU A C     1 
ATOM   2498  O  O     . LEU A 1  340  ? 31.457  -44.410  35.612  1.00 73.77  ? 340  LEU A O     1 
ATOM   2499  C  CB    . LEU A 1  340  ? 33.755  -42.033  35.390  1.00 73.66  ? 340  LEU A CB    1 
ATOM   2500  C  CG    . LEU A 1  340  ? 34.579  -41.446  34.221  1.00 78.88  ? 340  LEU A CG    1 
ATOM   2501  C  CD1   . LEU A 1  340  ? 35.900  -40.879  34.707  1.00 79.59  ? 340  LEU A CD1   1 
ATOM   2502  C  CD2   . LEU A 1  340  ? 34.809  -42.477  33.117  1.00 80.98  ? 340  LEU A CD2   1 
ATOM   2503  N  N     . MET A 1  341  ? 31.141  -42.853  37.219  1.00 70.53  ? 341  MET A N     1 
ATOM   2504  C  CA    . MET A 1  341  ? 30.436  -43.770  38.130  1.00 69.98  ? 341  MET A CA    1 
ATOM   2505  C  C     . MET A 1  341  ? 29.000  -43.983  37.650  1.00 71.13  ? 341  MET A C     1 
ATOM   2506  O  O     . MET A 1  341  ? 28.412  -45.036  37.883  1.00 70.16  ? 341  MET A O     1 
ATOM   2507  C  CB    . MET A 1  341  ? 30.442  -43.252  39.580  1.00 73.06  ? 341  MET A CB    1 
ATOM   2508  C  CG    . MET A 1  341  ? 31.832  -43.030  40.165  1.00 77.63  ? 341  MET A CG    1 
ATOM   2509  S  SD    . MET A 1  341  ? 33.049  -44.331  39.817  1.00 82.25  ? 341  MET A SD    1 
ATOM   2510  C  CE    . MET A 1  341  ? 32.542  -45.545  40.949  1.00 79.06  ? 341  MET A CE    1 
ATOM   2511  N  N     . GLY A 1  342  ? 28.469  -42.964  36.987  1.00 66.42  ? 342  GLY A N     1 
ATOM   2512  C  CA    . GLY A 1  342  ? 27.139  -42.926  36.398  1.00 65.40  ? 342  GLY A CA    1 
ATOM   2513  C  C     . GLY A 1  342  ? 27.103  -41.991  35.204  1.00 67.70  ? 342  GLY A C     1 
ATOM   2514  O  O     . GLY A 1  342  ? 27.912  -41.060  35.127  1.00 67.50  ? 342  GLY A O     1 
ATOM   2515  N  N     . LYS A 1  343  ? 26.179  -42.242  34.250  1.00 62.36  ? 343  LYS A N     1 
ATOM   2516  C  CA    . LYS A 1  343  ? 26.010  -41.431  33.034  1.00 61.43  ? 343  LYS A CA    1 
ATOM   2517  C  C     . LYS A 1  343  ? 24.687  -41.691  32.331  1.00 63.92  ? 343  LYS A C     1 
ATOM   2518  O  O     . LYS A 1  343  ? 24.022  -42.682  32.627  1.00 62.58  ? 343  LYS A O     1 
ATOM   2519  C  CB    . LYS A 1  343  ? 27.187  -41.613  32.056  1.00 63.10  ? 343  LYS A CB    1 
ATOM   2520  C  CG    . LYS A 1  343  ? 27.532  -43.053  31.725  1.00 66.89  ? 343  LYS A CG    1 
ATOM   2521  C  CD    . LYS A 1  343  ? 28.894  -43.105  31.094  1.00 74.47  ? 343  LYS A CD    1 
ATOM   2522  C  CE    . LYS A 1  343  ? 29.416  -44.504  31.054  1.00 82.65  ? 343  LYS A CE    1 
ATOM   2523  N  NZ    . LYS A 1  343  ? 30.810  -44.557  30.550  1.00 92.30  ? 343  LYS A NZ    1 
ATOM   2524  N  N     . ARG A 1  344  ? 24.315  -40.800  31.389  1.00 60.85  ? 344  ARG A N     1 
ATOM   2525  C  CA    . ARG A 1  344  ? 23.084  -40.917  30.593  1.00 60.63  ? 344  ARG A CA    1 
ATOM   2526  C  C     . ARG A 1  344  ? 23.279  -41.997  29.532  1.00 63.77  ? 344  ARG A C     1 
ATOM   2527  O  O     . ARG A 1  344  ? 24.395  -42.161  29.037  1.00 63.42  ? 344  ARG A O     1 
ATOM   2528  C  CB    . ARG A 1  344  ? 22.655  -39.558  30.019  1.00 60.71  ? 344  ARG A CB    1 
ATOM   2529  C  CG    . ARG A 1  344  ? 22.409  -38.546  31.136  1.00 66.67  ? 344  ARG A CG    1 
ATOM   2530  C  CD    . ARG A 1  344  ? 21.666  -37.294  30.735  1.00 75.22  ? 344  ARG A CD    1 
ATOM   2531  N  NE    . ARG A 1  344  ? 21.161  -36.613  31.928  1.00 86.49  ? 344  ARG A NE    1 
ATOM   2532  C  CZ    . ARG A 1  344  ? 19.959  -36.816  32.462  1.00 100.97 ? 344  ARG A CZ    1 
ATOM   2533  N  NH1   . ARG A 1  344  ? 19.103  -37.656  31.892  1.00 89.88  ? 344  ARG A NH1   1 
ATOM   2534  N  NH2   . ARG A 1  344  ? 19.597  -36.166  33.561  1.00 84.78  ? 344  ARG A NH2   1 
ATOM   2535  N  N     . VAL A 1  345  ? 22.239  -42.817  29.278  1.00 59.48  ? 345  VAL A N     1 
ATOM   2536  C  CA    . VAL A 1  345  ? 22.355  -43.983  28.387  1.00 58.51  ? 345  VAL A CA    1 
ATOM   2537  C  C     . VAL A 1  345  ? 21.281  -44.117  27.306  1.00 62.40  ? 345  VAL A C     1 
ATOM   2538  O  O     . VAL A 1  345  ? 20.145  -43.680  27.500  1.00 62.71  ? 345  VAL A O     1 
ATOM   2539  C  CB    . VAL A 1  345  ? 22.504  -45.323  29.187  1.00 61.12  ? 345  VAL A CB    1 
ATOM   2540  C  CG1   . VAL A 1  345  ? 23.789  -45.358  30.009  1.00 60.43  ? 345  VAL A CG1   1 
ATOM   2541  C  CG2   . VAL A 1  345  ? 21.285  -45.613  30.066  1.00 60.62  ? 345  VAL A CG2   1 
ATOM   2542  N  N     . ASP A 1  346  ? 21.637  -44.794  26.192  1.00 58.37  ? 346  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1  346  ? 20.723  -45.133  25.093  1.00 58.36  ? 346  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1  346  ? 19.941  -46.375  25.558  1.00 60.04  ? 346  ASP A C     1 
ATOM   2545  O  O     . ASP A 1  346  ? 20.386  -47.049  26.495  1.00 59.92  ? 346  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1  346  ? 21.503  -45.481  23.805  1.00 60.71  ? 346  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1  346  ? 22.488  -44.436  23.314  1.00 74.39  ? 346  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1  346  ? 22.092  -43.254  23.196  1.00 76.24  ? 346  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1  346  ? 23.637  -44.814  22.976  1.00 80.62  ? 346  ASP A OD2   1 
ATOM   2550  N  N     . PHE A 1  347  ? 18.807  -46.693  24.894  1.00 63.73  ? 347  PHE A N     1 
ATOM   2551  C  CA    . PHE A 1  347  ? 17.935  -47.834  25.219  1.00 61.19  ? 347  PHE A CA    1 
ATOM   2552  C  C     . PHE A 1  347  ? 17.350  -47.705  26.632  1.00 61.28  ? 347  PHE A C     1 
ATOM   2553  O  O     . PHE A 1  347  ? 17.365  -48.650  27.424  1.00 60.89  ? 347  PHE A O     1 
ATOM   2554  C  CB    . PHE A 1  347  ? 18.613  -49.194  24.938  1.00 63.71  ? 347  PHE A CB    1 
ATOM   2555  C  CG    . PHE A 1  347  ? 19.209  -49.283  23.557  1.00 66.41  ? 347  PHE A CG    1 
ATOM   2556  C  CD1   . PHE A 1  347  ? 20.562  -49.051  23.350  1.00 71.02  ? 347  PHE A CD1   1 
ATOM   2557  C  CD2   . PHE A 1  347  ? 18.410  -49.567  22.454  1.00 68.73  ? 347  PHE A CD2   1 
ATOM   2558  C  CE1   . PHE A 1  347  ? 21.110  -49.112  22.064  1.00 73.51  ? 347  PHE A CE1   1 
ATOM   2559  C  CE2   . PHE A 1  347  ? 18.954  -49.613  21.167  1.00 72.89  ? 347  PHE A CE2   1 
ATOM   2560  C  CZ    . PHE A 1  347  ? 20.303  -49.392  20.981  1.00 72.42  ? 347  PHE A CZ    1 
ATOM   2561  N  N     . SER A 1  348  ? 16.848  -46.497  26.937  1.00 55.11  ? 348  SER A N     1 
ATOM   2562  C  CA    . SER A 1  348  ? 16.241  -46.142  28.216  1.00 53.00  ? 348  SER A CA    1 
ATOM   2563  C  C     . SER A 1  348  ? 14.893  -45.451  27.999  1.00 53.76  ? 348  SER A C     1 
ATOM   2564  O  O     . SER A 1  348  ? 14.752  -44.664  27.062  1.00 54.01  ? 348  SER A O     1 
ATOM   2565  C  CB    . SER A 1  348  ? 17.181  -45.260  29.030  1.00 56.82  ? 348  SER A CB    1 
ATOM   2566  O  OG    . SER A 1  348  ? 17.559  -44.096  28.312  1.00 66.53  ? 348  SER A OG    1 
ATOM   2567  N  N     . ALA A 1  349  ? 13.903  -45.762  28.851  1.00 47.23  ? 349  ALA A N     1 
ATOM   2568  C  CA    . ALA A 1  349  ? 12.551  -45.209  28.768  1.00 45.64  ? 349  ALA A CA    1 
ATOM   2569  C  C     . ALA A 1  349  ? 12.006  -44.884  30.141  1.00 48.44  ? 349  ALA A C     1 
ATOM   2570  O  O     . ALA A 1  349  ? 12.208  -45.665  31.070  1.00 49.11  ? 349  ALA A O     1 
ATOM   2571  C  CB    . ALA A 1  349  ? 11.630  -46.198  28.081  1.00 46.22  ? 349  ALA A CB    1 
ATOM   2572  N  N     . ARG A 1  350  ? 11.307  -43.749  30.278  1.00 43.08  ? 350  ARG A N     1 
ATOM   2573  C  CA    . ARG A 1  350  ? 10.730  -43.341  31.560  1.00 41.85  ? 350  ARG A CA    1 
ATOM   2574  C  C     . ARG A 1  350  ? 9.301   -42.897  31.391  1.00 45.42  ? 350  ARG A C     1 
ATOM   2575  O  O     . ARG A 1  350  ? 9.010   -42.138  30.466  1.00 45.49  ? 350  ARG A O     1 
ATOM   2576  C  CB    . ARG A 1  350  ? 11.553  -42.223  32.202  1.00 41.32  ? 350  ARG A CB    1 
ATOM   2577  C  CG    . ARG A 1  350  ? 11.142  -41.857  33.621  1.00 46.48  ? 350  ARG A CG    1 
ATOM   2578  C  CD    . ARG A 1  350  ? 11.782  -40.552  34.007  1.00 49.95  ? 350  ARG A CD    1 
ATOM   2579  N  NE    . ARG A 1  350  ? 11.249  -40.005  35.249  1.00 57.15  ? 350  ARG A NE    1 
ATOM   2580  C  CZ    . ARG A 1  350  ? 11.758  -40.247  36.449  1.00 76.97  ? 350  ARG A CZ    1 
ATOM   2581  N  NH1   . ARG A 1  350  ? 12.797  -41.065  36.586  1.00 65.70  ? 350  ARG A NH1   1 
ATOM   2582  N  NH2   . ARG A 1  350  ? 11.225  -39.686  37.527  1.00 68.81  ? 350  ARG A NH2   1 
ATOM   2583  N  N     . THR A 1  351  ? 8.413   -43.341  32.312  1.00 41.36  ? 351  THR A N     1 
ATOM   2584  C  CA    . THR A 1  351  ? 6.984   -43.025  32.299  1.00 40.47  ? 351  THR A CA    1 
ATOM   2585  C  C     . THR A 1  351  ? 6.328   -43.225  33.650  1.00 43.27  ? 351  THR A C     1 
ATOM   2586  O  O     . THR A 1  351  ? 6.840   -43.991  34.469  1.00 43.02  ? 351  THR A O     1 
ATOM   2587  C  CB    . THR A 1  351  ? 6.316   -43.824  31.172  1.00 50.49  ? 351  THR A CB    1 
ATOM   2588  O  OG1   . THR A 1  351  ? 6.389   -43.038  29.993  1.00 57.02  ? 351  THR A OG1   1 
ATOM   2589  C  CG2   . THR A 1  351  ? 4.889   -44.192  31.443  1.00 45.79  ? 351  THR A CG2   1 
ATOM   2590  N  N     . VAL A 1  352  ? 5.168   -42.546  33.852  1.00 38.70  ? 352  VAL A N     1 
ATOM   2591  C  CA    . VAL A 1  352  ? 4.277   -42.629  35.015  1.00 37.29  ? 352  VAL A CA    1 
ATOM   2592  C  C     . VAL A 1  352  ? 3.840   -44.091  35.211  1.00 44.09  ? 352  VAL A C     1 
ATOM   2593  O  O     . VAL A 1  352  ? 3.512   -44.771  34.246  1.00 44.63  ? 352  VAL A O     1 
ATOM   2594  C  CB    . VAL A 1  352  ? 3.074   -41.668  34.840  1.00 39.11  ? 352  VAL A CB    1 
ATOM   2595  C  CG1   . VAL A 1  352  ? 1.886   -42.047  35.719  1.00 38.19  ? 352  VAL A CG1   1 
ATOM   2596  C  CG2   . VAL A 1  352  ? 3.489   -40.226  35.084  1.00 38.71  ? 352  VAL A CG2   1 
ATOM   2597  N  N     . ILE A 1  353  ? 3.877   -44.578  36.445  1.00 42.22  ? 353  ILE A N     1 
ATOM   2598  C  CA    . ILE A 1  353  ? 3.506   -45.958  36.736  1.00 42.87  ? 353  ILE A CA    1 
ATOM   2599  C  C     . ILE A 1  353  ? 2.053   -46.125  37.172  1.00 48.05  ? 353  ILE A C     1 
ATOM   2600  O  O     . ILE A 1  353  ? 1.475   -45.207  37.762  1.00 47.70  ? 353  ILE A O     1 
ATOM   2601  C  CB    . ILE A 1  353  ? 4.542   -46.675  37.638  1.00 46.36  ? 353  ILE A CB    1 
ATOM   2602  C  CG1   . ILE A 1  353  ? 4.952   -45.816  38.860  1.00 46.54  ? 353  ILE A CG1   1 
ATOM   2603  C  CG2   . ILE A 1  353  ? 5.761   -47.029  36.810  1.00 47.75  ? 353  ILE A CG2   1 
ATOM   2604  C  CD1   . ILE A 1  353  ? 4.544   -46.345  40.167  1.00 53.53  ? 353  ILE A CD1   1 
ATOM   2605  N  N     . SER A 1  354  ? 1.448   -47.276  36.820  1.00 45.92  ? 354  SER A N     1 
ATOM   2606  C  CA    . SER A 1  354  ? 0.062   -47.615  37.154  1.00 46.27  ? 354  SER A CA    1 
ATOM   2607  C  C     . SER A 1  354  ? -0.108  -49.103  37.487  1.00 50.97  ? 354  SER A C     1 
ATOM   2608  O  O     . SER A 1  354  ? 0.575   -49.946  36.900  1.00 51.48  ? 354  SER A O     1 
ATOM   2609  C  CB    . SER A 1  354  ? -0.894  -47.171  36.051  1.00 50.25  ? 354  SER A CB    1 
ATOM   2610  O  OG    . SER A 1  354  ? -1.398  -45.879  36.353  1.00 58.46  ? 354  SER A OG    1 
ATOM   2611  N  N     . GLY A 1  355  ? -0.996  -49.399  38.439  1.00 46.80  ? 355  GLY A N     1 
ATOM   2612  C  CA    . GLY A 1  355  ? -1.258  -50.761  38.897  1.00 46.96  ? 355  GLY A CA    1 
ATOM   2613  C  C     . GLY A 1  355  ? -2.092  -51.614  37.961  1.00 50.44  ? 355  GLY A C     1 
ATOM   2614  O  O     . GLY A 1  355  ? -3.043  -51.114  37.347  1.00 50.68  ? 355  GLY A O     1 
ATOM   2615  N  N     . ASP A 1  356  ? -1.755  -52.918  37.863  1.00 45.11  ? 356  ASP A N     1 
ATOM   2616  C  CA    . ASP A 1  356  ? -2.491  -53.844  37.009  1.00 44.54  ? 356  ASP A CA    1 
ATOM   2617  C  C     . ASP A 1  356  ? -2.737  -55.211  37.656  1.00 48.28  ? 356  ASP A C     1 
ATOM   2618  O  O     . ASP A 1  356  ? -1.863  -56.081  37.583  1.00 48.07  ? 356  ASP A O     1 
ATOM   2619  C  CB    . ASP A 1  356  ? -1.823  -53.999  35.640  1.00 46.21  ? 356  ASP A CB    1 
ATOM   2620  C  CG    . ASP A 1  356  ? -2.816  -54.333  34.551  1.00 52.96  ? 356  ASP A CG    1 
ATOM   2621  O  OD1   . ASP A 1  356  ? -3.486  -55.377  34.658  1.00 53.94  ? 356  ASP A OD1   1 
ATOM   2622  O  OD2   . ASP A 1  356  ? -2.939  -53.541  33.605  1.00 57.60  ? 356  ASP A OD2   1 
ATOM   2623  N  N     . PRO A 1  357  ? -3.950  -55.459  38.212  1.00 44.70  ? 357  PRO A N     1 
ATOM   2624  C  CA    . PRO A 1  357  ? -4.214  -56.767  38.844  1.00 45.74  ? 357  PRO A CA    1 
ATOM   2625  C  C     . PRO A 1  357  ? -4.277  -57.974  37.885  1.00 51.31  ? 357  PRO A C     1 
ATOM   2626  O  O     . PRO A 1  357  ? -4.424  -59.127  38.330  1.00 52.08  ? 357  PRO A O     1 
ATOM   2627  C  CB    . PRO A 1  357  ? -5.532  -56.535  39.598  1.00 47.34  ? 357  PRO A CB    1 
ATOM   2628  C  CG    . PRO A 1  357  ? -6.183  -55.398  38.907  1.00 50.42  ? 357  PRO A CG    1 
ATOM   2629  C  CD    . PRO A 1  357  ? -5.088  -54.534  38.390  1.00 45.39  ? 357  PRO A CD    1 
ATOM   2630  N  N     . ASN A 1  358  ? -4.135  -57.712  36.575  1.00 47.28  ? 358  ASN A N     1 
ATOM   2631  C  CA    . ASN A 1  358  ? -4.175  -58.731  35.534  1.00 47.70  ? 358  ASN A CA    1 
ATOM   2632  C  C     . ASN A 1  358  ? -2.829  -58.991  34.841  1.00 52.97  ? 358  ASN A C     1 
ATOM   2633  O  O     . ASN A 1  358  ? -2.759  -59.752  33.875  1.00 53.24  ? 358  ASN A O     1 
ATOM   2634  C  CB    . ASN A 1  358  ? -5.306  -58.444  34.565  1.00 45.57  ? 358  ASN A CB    1 
ATOM   2635  C  CG    . ASN A 1  358  ? -6.640  -58.772  35.172  1.00 61.42  ? 358  ASN A CG    1 
ATOM   2636  O  OD1   . ASN A 1  358  ? -6.973  -59.939  35.395  1.00 59.70  ? 358  ASN A OD1   1 
ATOM   2637  N  ND2   . ASN A 1  358  ? -7.425  -57.754  35.474  1.00 49.44  ? 358  ASN A ND2   1 
ATOM   2638  N  N     . LEU A 1  359  ? -1.759  -58.398  35.375  1.00 49.92  ? 359  LEU A N     1 
ATOM   2639  C  CA    . LEU A 1  359  ? -0.393  -58.583  34.906  1.00 50.27  ? 359  LEU A CA    1 
ATOM   2640  C  C     . LEU A 1  359  ? 0.303   -59.536  35.880  1.00 57.51  ? 359  LEU A C     1 
ATOM   2641  O  O     . LEU A 1  359  ? -0.003  -59.514  37.084  1.00 57.02  ? 359  LEU A O     1 
ATOM   2642  C  CB    . LEU A 1  359  ? 0.318   -57.233  34.901  1.00 49.35  ? 359  LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1  359  ? 0.813   -56.739  33.559  1.00 54.13  ? 359  LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1  359  ? -0.331  -56.277  32.678  1.00 54.43  ? 359  LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1  359  ? 1.770   -55.597  33.743  1.00 56.03  ? 359  LEU A CD2   1 
ATOM   2646  N  N     . GLU A 1  360  ? 1.216   -60.390  35.368  1.00 56.31  ? 360  GLU A N     1 
ATOM   2647  C  CA    . GLU A 1  360  ? 1.950   -61.337  36.218  1.00 57.32  ? 360  GLU A CA    1 
ATOM   2648  C  C     . GLU A 1  360  ? 3.005   -60.601  37.049  1.00 61.35  ? 360  GLU A C     1 
ATOM   2649  O  O     . GLU A 1  360  ? 3.461   -59.539  36.613  1.00 61.28  ? 360  GLU A O     1 
ATOM   2650  C  CB    . GLU A 1  360  ? 2.564   -62.492  35.401  1.00 59.82  ? 360  GLU A CB    1 
ATOM   2651  C  CG    . GLU A 1  360  ? 1.570   -63.578  35.002  1.00 72.95  ? 360  GLU A CG    1 
ATOM   2652  C  CD    . GLU A 1  360  ? 0.835   -64.303  36.121  1.00 102.72 ? 360  GLU A CD    1 
ATOM   2653  O  OE1   . GLU A 1  360  ? -0.360  -64.624  35.925  1.00 98.83  ? 360  GLU A OE1   1 
ATOM   2654  O  OE2   . GLU A 1  360  ? 1.440   -64.538  37.195  1.00 102.53 ? 360  GLU A OE2   1 
ATOM   2655  N  N     . LEU A 1  361  ? 3.362   -61.136  38.254  1.00 57.10  ? 361  LEU A N     1 
ATOM   2656  C  CA    . LEU A 1  361  ? 4.343   -60.536  39.182  1.00 55.93  ? 361  LEU A CA    1 
ATOM   2657  C  C     . LEU A 1  361  ? 5.584   -59.996  38.460  1.00 58.46  ? 361  LEU A C     1 
ATOM   2658  O  O     . LEU A 1  361  ? 5.878   -58.797  38.561  1.00 57.96  ? 361  LEU A O     1 
ATOM   2659  C  CB    . LEU A 1  361  ? 4.745   -61.541  40.288  1.00 56.61  ? 361  LEU A CB    1 
ATOM   2660  C  CG    . LEU A 1  361  ? 5.637   -61.023  41.436  1.00 60.51  ? 361  LEU A CG    1 
ATOM   2661  C  CD1   . LEU A 1  361  ? 4.812   -60.403  42.550  1.00 59.77  ? 361  LEU A CD1   1 
ATOM   2662  C  CD2   . LEU A 1  361  ? 6.452   -62.143  42.028  1.00 63.08  ? 361  LEU A CD2   1 
ATOM   2663  N  N     . ASP A 1  362  ? 6.244   -60.875  37.668  1.00 53.72  ? 362  ASP A N     1 
ATOM   2664  C  CA    . ASP A 1  362  ? 7.451   -60.594  36.892  1.00 52.65  ? 362  ASP A CA    1 
ATOM   2665  C  C     . ASP A 1  362  ? 7.229   -59.842  35.571  1.00 53.65  ? 362  ASP A C     1 
ATOM   2666  O  O     . ASP A 1  362  ? 8.200   -59.503  34.900  1.00 54.00  ? 362  ASP A O     1 
ATOM   2667  C  CB    . ASP A 1  362  ? 8.270   -61.880  36.688  1.00 55.75  ? 362  ASP A CB    1 
ATOM   2668  C  CG    . ASP A 1  362  ? 7.584   -62.975  35.891  1.00 67.60  ? 362  ASP A CG    1 
ATOM   2669  O  OD1   . ASP A 1  362  ? 8.298   -63.750  35.214  1.00 69.79  ? 362  ASP A OD1   1 
ATOM   2670  O  OD2   . ASP A 1  362  ? 6.332   -63.075  35.963  1.00 71.48  ? 362  ASP A OD2   1 
ATOM   2671  N  N     . GLN A 1  363  ? 5.979   -59.554  35.205  1.00 47.23  ? 363  GLN A N     1 
ATOM   2672  C  CA    . GLN A 1  363  ? 5.712   -58.803  33.984  1.00 45.73  ? 363  GLN A CA    1 
ATOM   2673  C  C     . GLN A 1  363  ? 5.741   -57.288  34.236  1.00 48.63  ? 363  GLN A C     1 
ATOM   2674  O  O     . GLN A 1  363  ? 5.638   -56.836  35.387  1.00 47.90  ? 363  GLN A O     1 
ATOM   2675  C  CB    . GLN A 1  363  ? 4.369   -59.207  33.377  1.00 46.63  ? 363  GLN A CB    1 
ATOM   2676  C  CG    . GLN A 1  363  ? 4.388   -60.554  32.692  1.00 57.56  ? 363  GLN A CG    1 
ATOM   2677  C  CD    . GLN A 1  363  ? 3.106   -60.809  31.946  1.00 76.19  ? 363  GLN A CD    1 
ATOM   2678  O  OE1   . GLN A 1  363  ? 2.015   -60.905  32.525  1.00 67.33  ? 363  GLN A OE1   1 
ATOM   2679  N  NE2   . GLN A 1  363  ? 3.215   -60.930  30.632  1.00 75.80  ? 363  GLN A NE2   1 
ATOM   2680  N  N     . VAL A 1  364  ? 5.901   -56.516  33.139  1.00 44.37  ? 364  VAL A N     1 
ATOM   2681  C  CA    . VAL A 1  364  ? 5.881   -55.048  33.071  1.00 42.62  ? 364  VAL A CA    1 
ATOM   2682  C  C     . VAL A 1  364  ? 5.060   -54.627  31.841  1.00 46.60  ? 364  VAL A C     1 
ATOM   2683  O  O     . VAL A 1  364  ? 5.226   -55.184  30.746  1.00 47.21  ? 364  VAL A O     1 
ATOM   2684  C  CB    . VAL A 1  364  ? 7.276   -54.342  33.170  1.00 45.52  ? 364  VAL A CB    1 
ATOM   2685  C  CG1   . VAL A 1  364  ? 8.160   -54.605  31.951  1.00 45.84  ? 364  VAL A CG1   1 
ATOM   2686  C  CG2   . VAL A 1  364  ? 7.126   -52.844  33.411  1.00 44.29  ? 364  VAL A CG2   1 
ATOM   2687  N  N     . GLY A 1  365  ? 4.149   -53.692  32.060  1.00 41.85  ? 365  GLY A N     1 
ATOM   2688  C  CA    . GLY A 1  365  ? 3.285   -53.155  31.022  1.00 41.27  ? 365  GLY A CA    1 
ATOM   2689  C  C     . GLY A 1  365  ? 3.984   -52.035  30.296  1.00 44.51  ? 365  GLY A C     1 
ATOM   2690  O  O     . GLY A 1  365  ? 4.092   -50.932  30.823  1.00 43.51  ? 365  GLY A O     1 
ATOM   2691  N  N     . VAL A 1  366  ? 4.493   -52.315  29.104  1.00 41.95  ? 366  VAL A N     1 
ATOM   2692  C  CA    . VAL A 1  366  ? 5.220   -51.321  28.326  1.00 41.99  ? 366  VAL A CA    1 
ATOM   2693  C  C     . VAL A 1  366  ? 4.309   -50.703  27.232  1.00 46.24  ? 366  VAL A C     1 
ATOM   2694  O  O     . VAL A 1  366  ? 3.871   -51.438  26.339  1.00 45.78  ? 366  VAL A O     1 
ATOM   2695  C  CB    . VAL A 1  366  ? 6.560   -51.913  27.797  1.00 46.40  ? 366  VAL A CB    1 
ATOM   2696  C  CG1   . VAL A 1  366  ? 7.205   -51.025  26.730  1.00 46.39  ? 366  VAL A CG1   1 
ATOM   2697  C  CG2   . VAL A 1  366  ? 7.529   -52.177  28.948  1.00 45.98  ? 366  VAL A CG2   1 
ATOM   2698  N  N     . PRO A 1  367  ? 4.003   -49.367  27.305  1.00 42.70  ? 367  PRO A N     1 
ATOM   2699  C  CA    . PRO A 1  367  ? 3.146   -48.742  26.271  1.00 42.24  ? 367  PRO A CA    1 
ATOM   2700  C  C     . PRO A 1  367  ? 3.704   -48.865  24.863  1.00 46.25  ? 367  PRO A C     1 
ATOM   2701  O  O     . PRO A 1  367  ? 4.899   -48.641  24.649  1.00 45.58  ? 367  PRO A O     1 
ATOM   2702  C  CB    . PRO A 1  367  ? 3.048   -47.274  26.697  1.00 43.47  ? 367  PRO A CB    1 
ATOM   2703  C  CG    . PRO A 1  367  ? 4.116   -47.068  27.677  1.00 48.15  ? 367  PRO A CG    1 
ATOM   2704  C  CD    . PRO A 1  367  ? 4.422   -48.379  28.322  1.00 43.85  ? 367  PRO A CD    1 
ATOM   2705  N  N     . LYS A 1  368  ? 2.823   -49.243  23.914  1.00 43.35  ? 368  LYS A N     1 
ATOM   2706  C  CA    . LYS A 1  368  ? 3.093   -49.455  22.486  1.00 43.85  ? 368  LYS A CA    1 
ATOM   2707  C  C     . LYS A 1  368  ? 4.154   -48.518  21.877  1.00 46.38  ? 368  LYS A C     1 
ATOM   2708  O  O     . LYS A 1  368  ? 5.102   -49.013  21.265  1.00 46.38  ? 368  LYS A O     1 
ATOM   2709  C  CB    . LYS A 1  368  ? 1.781   -49.418  21.680  1.00 46.76  ? 368  LYS A CB    1 
ATOM   2710  C  CG    . LYS A 1  368  ? 1.712   -50.433  20.542  1.00 61.00  ? 368  LYS A CG    1 
ATOM   2711  C  CD    . LYS A 1  368  ? 0.650   -51.503  20.810  1.00 72.94  ? 368  LYS A CD    1 
ATOM   2712  C  CE    . LYS A 1  368  ? -0.006  -52.003  19.540  1.00 86.52  ? 368  LYS A CE    1 
ATOM   2713  N  NZ    . LYS A 1  368  ? -0.934  -53.144  19.792  1.00 94.67  ? 368  LYS A NZ    1 
ATOM   2714  N  N     . SER A 1  369  ? 4.021   -47.185  22.079  1.00 41.66  ? 369  SER A N     1 
ATOM   2715  C  CA    . SER A 1  369  ? 4.977   -46.200  21.557  1.00 41.88  ? 369  SER A CA    1 
ATOM   2716  C  C     . SER A 1  369  ? 6.398   -46.441  22.053  1.00 47.30  ? 369  SER A C     1 
ATOM   2717  O  O     . SER A 1  369  ? 7.318   -46.461  21.236  1.00 48.32  ? 369  SER A O     1 
ATOM   2718  C  CB    . SER A 1  369  ? 4.528   -44.768  21.844  1.00 44.25  ? 369  SER A CB    1 
ATOM   2719  O  OG    . SER A 1  369  ? 4.391   -44.502  23.229  1.00 50.91  ? 369  SER A OG    1 
ATOM   2720  N  N     . ILE A 1  370  ? 6.565   -46.676  23.378  1.00 43.29  ? 370  ILE A N     1 
ATOM   2721  C  CA    . ILE A 1  370  ? 7.845   -46.961  24.032  1.00 42.88  ? 370  ILE A CA    1 
ATOM   2722  C  C     . ILE A 1  370  ? 8.467   -48.219  23.439  1.00 47.30  ? 370  ILE A C     1 
ATOM   2723  O  O     . ILE A 1  370  ? 9.668   -48.223  23.161  1.00 47.11  ? 370  ILE A O     1 
ATOM   2724  C  CB    . ILE A 1  370  ? 7.676   -47.026  25.572  1.00 45.18  ? 370  ILE A CB    1 
ATOM   2725  C  CG1   . ILE A 1  370  ? 7.564   -45.603  26.159  1.00 45.23  ? 370  ILE A CG1   1 
ATOM   2726  C  CG2   . ILE A 1  370  ? 8.794   -47.831  26.245  1.00 46.02  ? 370  ILE A CG2   1 
ATOM   2727  C  CD1   . ILE A 1  370  ? 7.439   -45.494  27.705  1.00 52.58  ? 370  ILE A CD1   1 
ATOM   2728  N  N     . ALA A 1  371  ? 7.638   -49.268  23.209  1.00 44.56  ? 371  ALA A N     1 
ATOM   2729  C  CA    . ALA A 1  371  ? 8.056   -50.546  22.612  1.00 45.07  ? 371  ALA A CA    1 
ATOM   2730  C  C     . ALA A 1  371  ? 8.538   -50.313  21.187  1.00 50.11  ? 371  ALA A C     1 
ATOM   2731  O  O     . ALA A 1  371  ? 9.524   -50.912  20.758  1.00 50.67  ? 371  ALA A O     1 
ATOM   2732  C  CB    . ALA A 1  371  ? 6.900   -51.538  22.618  1.00 45.35  ? 371  ALA A CB    1 
ATOM   2733  N  N     . LYS A 1  372  ? 7.872   -49.388  20.484  1.00 46.75  ? 372  LYS A N     1 
ATOM   2734  C  CA    . LYS A 1  372  ? 8.187   -49.006  19.116  1.00 47.51  ? 372  LYS A CA    1 
ATOM   2735  C  C     . LYS A 1  372  ? 9.427   -48.090  19.011  1.00 52.57  ? 372  LYS A C     1 
ATOM   2736  O  O     . LYS A 1  372  ? 9.888   -47.818  17.898  1.00 54.00  ? 372  LYS A O     1 
ATOM   2737  C  CB    . LYS A 1  372  ? 6.960   -48.372  18.441  1.00 49.37  ? 372  LYS A CB    1 
ATOM   2738  C  CG    . LYS A 1  372  ? 5.897   -49.376  18.001  1.00 58.56  ? 372  LYS A CG    1 
ATOM   2739  C  CD    . LYS A 1  372  ? 5.158   -48.908  16.747  1.00 72.12  ? 372  LYS A CD    1 
ATOM   2740  C  CE    . LYS A 1  372  ? 4.329   -47.647  16.922  1.00 89.86  ? 372  LYS A CE    1 
ATOM   2741  N  NZ    . LYS A 1  372  ? 3.066   -47.899  17.664  1.00 104.17 ? 372  LYS A NZ    1 
ATOM   2742  N  N     . THR A 1  373  ? 9.964   -47.619  20.154  1.00 48.02  ? 373  THR A N     1 
ATOM   2743  C  CA    . THR A 1  373  ? 11.156  -46.768  20.194  1.00 48.15  ? 373  THR A CA    1 
ATOM   2744  C  C     . THR A 1  373  ? 12.387  -47.620  20.496  1.00 53.86  ? 373  THR A C     1 
ATOM   2745  O  O     . THR A 1  373  ? 13.357  -47.571  19.739  1.00 54.74  ? 373  THR A O     1 
ATOM   2746  C  CB    . THR A 1  373  ? 10.976  -45.608  21.182  1.00 52.11  ? 373  THR A CB    1 
ATOM   2747  O  OG1   . THR A 1  373  ? 9.830   -44.854  20.803  1.00 52.29  ? 373  THR A OG1   1 
ATOM   2748  C  CG2   . THR A 1  373  ? 12.186  -44.691  21.235  1.00 50.06  ? 373  THR A CG2   1 
ATOM   2749  N  N     . LEU A 1  374  ? 12.343  -48.398  21.592  1.00 50.75  ? 374  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1  374  ? 13.443  -49.264  22.019  1.00 51.75  ? 374  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1  374  ? 13.543  -50.512  21.144  1.00 58.56  ? 374  LEU A C     1 
ATOM   2752  O  O     . LEU A 1  374  ? 12.521  -51.115  20.791  1.00 58.42  ? 374  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1  374  ? 13.312  -49.657  23.497  1.00 51.00  ? 374  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1  374  ? 12.838  -48.576  24.468  1.00 54.88  ? 374  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1  374  ? 12.222  -49.199  25.696  1.00 54.53  ? 374  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1  374  ? 13.960  -47.608  24.841  1.00 57.21  ? 374  LEU A CD2   1 
ATOM   2757  N  N     . THR A 1  375  ? 14.783  -50.887  20.781  1.00 56.62  ? 375  THR A N     1 
ATOM   2758  C  CA    . THR A 1  375  ? 15.064  -52.044  19.929  1.00 57.30  ? 375  THR A CA    1 
ATOM   2759  C  C     . THR A 1  375  ? 16.084  -52.996  20.541  1.00 62.16  ? 375  THR A C     1 
ATOM   2760  O  O     . THR A 1  375  ? 16.757  -52.651  21.514  1.00 62.14  ? 375  THR A O     1 
ATOM   2761  C  CB    . THR A 1  375  ? 15.539  -51.602  18.544  1.00 64.87  ? 375  THR A CB    1 
ATOM   2762  O  OG1   . THR A 1  375  ? 16.693  -50.769  18.680  1.00 64.89  ? 375  THR A OG1   1 
ATOM   2763  C  CG2   . THR A 1  375  ? 14.446  -50.931  17.732  1.00 62.11  ? 375  THR A CG2   1 
ATOM   2764  N  N     . TYR A 1  376  ? 16.177  -54.204  19.976  1.00 59.10  ? 376  TYR A N     1 
ATOM   2765  C  CA    . TYR A 1  376  ? 17.146  -55.210  20.377  1.00 59.64  ? 376  TYR A CA    1 
ATOM   2766  C  C     . TYR A 1  376  ? 17.878  -55.713  19.121  1.00 64.89  ? 376  TYR A C     1 
ATOM   2767  O  O     . TYR A 1  376  ? 17.219  -56.180  18.188  1.00 63.87  ? 376  TYR A O     1 
ATOM   2768  C  CB    . TYR A 1  376  ? 16.494  -56.366  21.175  1.00 60.18  ? 376  TYR A CB    1 
ATOM   2769  C  CG    . TYR A 1  376  ? 17.441  -57.519  21.448  1.00 62.55  ? 376  TYR A CG    1 
ATOM   2770  C  CD1   . TYR A 1  376  ? 18.343  -57.472  22.506  1.00 64.62  ? 376  TYR A CD1   1 
ATOM   2771  C  CD2   . TYR A 1  376  ? 17.466  -58.639  20.621  1.00 64.07  ? 376  TYR A CD2   1 
ATOM   2772  C  CE1   . TYR A 1  376  ? 19.250  -58.506  22.732  1.00 66.67  ? 376  TYR A CE1   1 
ATOM   2773  C  CE2   . TYR A 1  376  ? 18.367  -59.680  20.837  1.00 65.90  ? 376  TYR A CE2   1 
ATOM   2774  C  CZ    . TYR A 1  376  ? 19.257  -59.610  21.895  1.00 72.18  ? 376  TYR A CZ    1 
ATOM   2775  O  OH    . TYR A 1  376  ? 20.136  -60.641  22.122  1.00 72.73  ? 376  TYR A OH    1 
ATOM   2776  N  N     . PRO A 1  377  ? 19.233  -55.632  19.084  1.00 63.65  ? 377  PRO A N     1 
ATOM   2777  C  CA    . PRO A 1  377  ? 19.975  -56.139  17.922  1.00 65.33  ? 377  PRO A CA    1 
ATOM   2778  C  C     . PRO A 1  377  ? 19.951  -57.663  17.901  1.00 70.34  ? 377  PRO A C     1 
ATOM   2779  O  O     . PRO A 1  377  ? 20.570  -58.313  18.752  1.00 70.71  ? 377  PRO A O     1 
ATOM   2780  C  CB    . PRO A 1  377  ? 21.397  -55.584  18.129  1.00 68.12  ? 377  PRO A CB    1 
ATOM   2781  C  CG    . PRO A 1  377  ? 21.300  -54.630  19.279  1.00 71.61  ? 377  PRO A CG    1 
ATOM   2782  C  CD    . PRO A 1  377  ? 20.163  -55.118  20.102  1.00 65.72  ? 377  PRO A CD    1 
ATOM   2783  N  N     . GLU A 1  378  ? 19.171  -58.219  16.955  1.00 66.48  ? 378  GLU A N     1 
ATOM   2784  C  CA    . GLU A 1  378  ? 18.970  -59.649  16.754  1.00 66.45  ? 378  GLU A CA    1 
ATOM   2785  C  C     . GLU A 1  378  ? 19.630  -60.064  15.442  1.00 71.97  ? 378  GLU A C     1 
ATOM   2786  O  O     . GLU A 1  378  ? 19.275  -59.543  14.382  1.00 71.26  ? 378  GLU A O     1 
ATOM   2787  C  CB    . GLU A 1  378  ? 17.461  -59.977  16.770  1.00 66.44  ? 378  GLU A CB    1 
ATOM   2788  C  CG    . GLU A 1  378  ? 17.127  -61.425  16.456  1.00 76.67  ? 378  GLU A CG    1 
ATOM   2789  C  CD    . GLU A 1  378  ? 16.283  -62.142  17.488  1.00 97.15  ? 378  GLU A CD    1 
ATOM   2790  O  OE1   . GLU A 1  378  ? 16.795  -63.100  18.110  1.00 97.43  ? 378  GLU A OE1   1 
ATOM   2791  O  OE2   . GLU A 1  378  ? 15.104  -61.764  17.662  1.00 91.06  ? 378  GLU A OE2   1 
ATOM   2792  N  N     . VAL A 1  379  ? 20.601  -60.990  15.521  1.00 70.37  ? 379  VAL A N     1 
ATOM   2793  C  CA    . VAL A 1  379  ? 21.334  -61.504  14.357  1.00 72.21  ? 379  VAL A CA    1 
ATOM   2794  C  C     . VAL A 1  379  ? 20.482  -62.545  13.630  1.00 77.11  ? 379  VAL A C     1 
ATOM   2795  O  O     . VAL A 1  379  ? 19.849  -63.374  14.283  1.00 76.27  ? 379  VAL A O     1 
ATOM   2796  C  CB    . VAL A 1  379  ? 22.728  -62.063  14.750  1.00 77.73  ? 379  VAL A CB    1 
ATOM   2797  C  CG1   . VAL A 1  379  ? 23.540  -62.482  13.524  1.00 79.24  ? 379  VAL A CG1   1 
ATOM   2798  C  CG2   . VAL A 1  379  ? 23.508  -61.050  15.580  1.00 77.47  ? 379  VAL A CG2   1 
ATOM   2799  N  N     . VAL A 1  380  ? 20.475  -62.503  12.281  1.00 75.35  ? 380  VAL A N     1 
ATOM   2800  C  CA    . VAL A 1  380  ? 19.709  -63.434  11.445  1.00 75.89  ? 380  VAL A CA    1 
ATOM   2801  C  C     . VAL A 1  380  ? 20.317  -64.848  11.384  1.00 82.69  ? 380  VAL A C     1 
ATOM   2802  O  O     . VAL A 1  380  ? 21.405  -65.052  10.834  1.00 84.03  ? 380  VAL A O     1 
ATOM   2803  C  CB    . VAL A 1  380  ? 19.329  -62.901  10.038  1.00 79.84  ? 380  VAL A CB    1 
ATOM   2804  C  CG1   . VAL A 1  380  ? 18.032  -63.542  9.562   1.00 79.14  ? 380  VAL A CG1   1 
ATOM   2805  C  CG2   . VAL A 1  380  ? 19.200  -61.381  10.016  1.00 78.65  ? 380  VAL A CG2   1 
ATOM   2806  N  N     . THR A 1  381  ? 19.586  -65.818  11.954  1.00 79.39  ? 381  THR A N     1 
ATOM   2807  C  CA    . THR A 1  381  ? 19.922  -67.244  11.999  1.00 80.59  ? 381  THR A CA    1 
ATOM   2808  C  C     . THR A 1  381  ? 18.759  -67.984  11.324  1.00 85.03  ? 381  THR A C     1 
ATOM   2809  O  O     . THR A 1  381  ? 17.672  -67.405  11.243  1.00 82.94  ? 381  THR A O     1 
ATOM   2810  C  CB    . THR A 1  381  ? 20.082  -67.723  13.462  1.00 87.81  ? 381  THR A CB    1 
ATOM   2811  O  OG1   . THR A 1  381  ? 18.829  -67.653  14.141  1.00 86.08  ? 381  THR A OG1   1 
ATOM   2812  C  CG2   . THR A 1  381  ? 21.145  -66.957  14.233  1.00 86.18  ? 381  THR A CG2   1 
ATOM   2813  N  N     . PRO A 1  382  ? 18.898  -69.255  10.875  1.00 84.05  ? 382  PRO A N     1 
ATOM   2814  C  CA    . PRO A 1  382  ? 17.735  -69.929  10.268  1.00 84.20  ? 382  PRO A CA    1 
ATOM   2815  C  C     . PRO A 1  382  ? 16.564  -70.130  11.243  1.00 87.88  ? 382  PRO A C     1 
ATOM   2816  O  O     . PRO A 1  382  ? 15.444  -70.385  10.798  1.00 87.75  ? 382  PRO A O     1 
ATOM   2817  C  CB    . PRO A 1  382  ? 18.311  -71.250  9.745   1.00 87.79  ? 382  PRO A CB    1 
ATOM   2818  C  CG    . PRO A 1  382  ? 19.796  -71.061  9.734   1.00 93.19  ? 382  PRO A CG    1 
ATOM   2819  C  CD    . PRO A 1  382  ? 20.083  -70.134  10.866  1.00 87.41  ? 382  PRO A CD    1 
ATOM   2820  N  N     . TYR A 1  383  ? 16.809  -69.970  12.562  1.00 83.47  ? 383  TYR A N     1 
ATOM   2821  C  CA    . TYR A 1  383  ? 15.772  -70.099  13.581  1.00 82.19  ? 383  TYR A CA    1 
ATOM   2822  C  C     . TYR A 1  383  ? 14.810  -68.904  13.550  1.00 85.10  ? 383  TYR A C     1 
ATOM   2823  O  O     . TYR A 1  383  ? 13.609  -69.095  13.734  1.00 84.76  ? 383  TYR A O     1 
ATOM   2824  C  CB    . TYR A 1  383  ? 16.370  -70.236  14.995  1.00 83.40  ? 383  TYR A CB    1 
ATOM   2825  C  CG    . TYR A 1  383  ? 17.601  -71.105  15.109  1.00 87.32  ? 383  TYR A CG    1 
ATOM   2826  C  CD1   . TYR A 1  383  ? 18.823  -70.566  15.496  1.00 89.92  ? 383  TYR A CD1   1 
ATOM   2827  C  CD2   . TYR A 1  383  ? 17.534  -72.477  14.886  1.00 89.54  ? 383  TYR A CD2   1 
ATOM   2828  C  CE1   . TYR A 1  383  ? 19.960  -71.362  15.618  1.00 92.98  ? 383  TYR A CE1   1 
ATOM   2829  C  CE2   . TYR A 1  383  ? 18.665  -73.284  14.998  1.00 92.36  ? 383  TYR A CE2   1 
ATOM   2830  C  CZ    . TYR A 1  383  ? 19.877  -72.722  15.365  1.00 101.71 ? 383  TYR A CZ    1 
ATOM   2831  O  OH    . TYR A 1  383  ? 20.999  -73.507  15.481  1.00 106.04 ? 383  TYR A OH    1 
ATOM   2832  N  N     . ASN A 1  384  ? 15.330  -67.680  13.328  1.00 80.50  ? 384  ASN A N     1 
ATOM   2833  C  CA    . ASN A 1  384  ? 14.525  -66.452  13.321  1.00 78.32  ? 384  ASN A CA    1 
ATOM   2834  C  C     . ASN A 1  384  ? 14.252  -65.828  11.940  1.00 83.25  ? 384  ASN A C     1 
ATOM   2835  O  O     . ASN A 1  384  ? 13.380  -64.958  11.834  1.00 81.38  ? 384  ASN A O     1 
ATOM   2836  C  CB    . ASN A 1  384  ? 15.124  -65.413  14.277  1.00 74.13  ? 384  ASN A CB    1 
ATOM   2837  C  CG    . ASN A 1  384  ? 16.569  -65.038  14.026  1.00 80.77  ? 384  ASN A CG    1 
ATOM   2838  O  OD1   . ASN A 1  384  ? 17.073  -65.054  12.901  1.00 70.36  ? 384  ASN A OD1   1 
ATOM   2839  N  ND2   . ASN A 1  384  ? 17.253  -64.616  15.073  1.00 71.45  ? 384  ASN A ND2   1 
ATOM   2840  N  N     . ILE A 1  385  ? 15.005  -66.258  10.900  1.00 82.06  ? 385  ILE A N     1 
ATOM   2841  C  CA    . ILE A 1  385  ? 14.938  -65.760  9.515   1.00 82.40  ? 385  ILE A CA    1 
ATOM   2842  C  C     . ILE A 1  385  ? 13.563  -65.261  9.023   1.00 85.08  ? 385  ILE A C     1 
ATOM   2843  O  O     . ILE A 1  385  ? 13.465  -64.114  8.586   1.00 83.98  ? 385  ILE A O     1 
ATOM   2844  C  CB    . ILE A 1  385  ? 15.699  -66.665  8.499   1.00 87.31  ? 385  ILE A CB    1 
ATOM   2845  C  CG1   . ILE A 1  385  ? 15.855  -65.982  7.126   1.00 87.96  ? 385  ILE A CG1   1 
ATOM   2846  C  CG2   . ILE A 1  385  ? 15.079  -68.063  8.375   1.00 88.89  ? 385  ILE A CG2   1 
ATOM   2847  C  CD1   . ILE A 1  385  ? 17.258  -65.721  6.716   1.00 94.43  ? 385  ILE A CD1   1 
ATOM   2848  N  N     . ASP A 1  386  ? 12.514  -66.106  9.141   1.00 81.11  ? 386  ASP A N     1 
ATOM   2849  C  CA    . ASP A 1  386  ? 11.140  -65.798  8.728   1.00 79.55  ? 386  ASP A CA    1 
ATOM   2850  C  C     . ASP A 1  386  ? 10.508  -64.705  9.592   1.00 79.09  ? 386  ASP A C     1 
ATOM   2851  O  O     . ASP A 1  386  ? 9.882   -63.793  9.046   1.00 77.86  ? 386  ASP A O     1 
ATOM   2852  C  CB    . ASP A 1  386  ? 10.257  -67.060  8.739   1.00 82.00  ? 386  ASP A CB    1 
ATOM   2853  C  CG    . ASP A 1  386  ? 10.737  -68.172  7.833   1.00 94.24  ? 386  ASP A CG    1 
ATOM   2854  O  OD1   . ASP A 1  386  ? 11.263  -69.176  8.358   1.00 96.01  ? 386  ASP A OD1   1 
ATOM   2855  O  OD2   . ASP A 1  386  ? 10.559  -68.051  6.598   1.00 99.83  ? 386  ASP A OD2   1 
ATOM   2856  N  N     . ARG A 1  387  ? 10.660  -64.806  10.933  1.00 73.11  ? 387  ARG A N     1 
ATOM   2857  C  CA    . ARG A 1  387  ? 10.120  -63.827  11.876  1.00 70.73  ? 387  ARG A CA    1 
ATOM   2858  C  C     . ARG A 1  387  ? 10.776  -62.471  11.633  1.00 73.09  ? 387  ARG A C     1 
ATOM   2859  O  O     . ARG A 1  387  ? 10.066  -61.481  11.463  1.00 71.70  ? 387  ARG A O     1 
ATOM   2860  C  CB    . ARG A 1  387  ? 10.303  -64.296  13.331  1.00 70.49  ? 387  ARG A CB    1 
ATOM   2861  C  CG    . ARG A 1  387  ? 9.897   -63.266  14.397  1.00 78.62  ? 387  ARG A CG    1 
ATOM   2862  C  CD    . ARG A 1  387  ? 10.028  -63.783  15.829  1.00 85.35  ? 387  ARG A CD    1 
ATOM   2863  N  NE    . ARG A 1  387  ? 11.388  -64.218  16.171  1.00 86.87  ? 387  ARG A NE    1 
ATOM   2864  C  CZ    . ARG A 1  387  ? 12.342  -63.419  16.639  1.00 95.69  ? 387  ARG A CZ    1 
ATOM   2865  N  NH1   . ARG A 1  387  ? 12.107  -62.126  16.819  1.00 83.35  ? 387  ARG A NH1   1 
ATOM   2866  N  NH2   . ARG A 1  387  ? 13.541  -63.907  16.926  1.00 77.67  ? 387  ARG A NH2   1 
ATOM   2867  N  N     . LEU A 1  388  ? 12.119  -62.443  11.556  1.00 69.70  ? 388  LEU A N     1 
ATOM   2868  C  CA    . LEU A 1  388  ? 12.873  -61.216  11.306  1.00 68.96  ? 388  LEU A CA    1 
ATOM   2869  C  C     . LEU A 1  388  ? 12.498  -60.557  9.978   1.00 71.24  ? 388  LEU A C     1 
ATOM   2870  O  O     . LEU A 1  388  ? 12.232  -59.358  9.956   1.00 69.50  ? 388  LEU A O     1 
ATOM   2871  C  CB    . LEU A 1  388  ? 14.392  -61.447  11.403  1.00 70.14  ? 388  LEU A CB    1 
ATOM   2872  C  CG    . LEU A 1  388  ? 14.986  -61.641  12.803  1.00 74.40  ? 388  LEU A CG    1 
ATOM   2873  C  CD1   . LEU A 1  388  ? 16.483  -61.721  12.724  1.00 76.22  ? 388  LEU A CD1   1 
ATOM   2874  C  CD2   . LEU A 1  388  ? 14.624  -60.496  13.745  1.00 74.66  ? 388  LEU A CD2   1 
ATOM   2875  N  N     . THR A 1  389  ? 12.411  -61.346  8.895   1.00 68.18  ? 389  THR A N     1 
ATOM   2876  C  CA    . THR A 1  389  ? 12.038  -60.830  7.579   1.00 68.02  ? 389  THR A CA    1 
ATOM   2877  C  C     . THR A 1  389  ? 10.604  -60.261  7.537   1.00 70.38  ? 389  THR A C     1 
ATOM   2878  O  O     . THR A 1  389  ? 10.345  -59.331  6.775   1.00 69.75  ? 389  THR A O     1 
ATOM   2879  C  CB    . THR A 1  389  ? 12.463  -61.800  6.465   1.00 74.34  ? 389  THR A CB    1 
ATOM   2880  O  OG1   . THR A 1  389  ? 12.827  -61.066  5.295   1.00 74.17  ? 389  THR A OG1   1 
ATOM   2881  C  CG2   . THR A 1  389  ? 11.423  -62.871  6.166   1.00 71.55  ? 389  THR A CG2   1 
ATOM   2882  N  N     . GLN A 1  390  ? 9.699   -60.790  8.388   1.00 65.83  ? 390  GLN A N     1 
ATOM   2883  C  CA    . GLN A 1  390  ? 8.314   -60.325  8.494   1.00 64.36  ? 390  GLN A CA    1 
ATOM   2884  C  C     . GLN A 1  390  ? 8.276   -58.986  9.225   1.00 66.32  ? 390  GLN A C     1 
ATOM   2885  O  O     . GLN A 1  390  ? 7.627   -58.051  8.759   1.00 65.21  ? 390  GLN A O     1 
ATOM   2886  C  CB    . GLN A 1  390  ? 7.433   -61.382  9.190   1.00 65.48  ? 390  GLN A CB    1 
ATOM   2887  C  CG    . GLN A 1  390  ? 5.986   -60.950  9.483   1.00 84.38  ? 390  GLN A CG    1 
ATOM   2888  C  CD    . GLN A 1  390  ? 5.148   -60.650  8.258   1.00 108.98 ? 390  GLN A CD    1 
ATOM   2889  O  OE1   . GLN A 1  390  ? 5.009   -61.471  7.342   1.00 107.34 ? 390  GLN A OE1   1 
ATOM   2890  N  NE2   . GLN A 1  390  ? 4.521   -59.481  8.247   1.00 100.88 ? 390  GLN A NE2   1 
ATOM   2891  N  N     . LEU A 1  391  ? 8.991   -58.897  10.356  1.00 62.63  ? 391  LEU A N     1 
ATOM   2892  C  CA    . LEU A 1  391  ? 9.121   -57.697  11.186  1.00 61.51  ? 391  LEU A CA    1 
ATOM   2893  C  C     . LEU A 1  391  ? 9.844   -56.615  10.374  1.00 67.46  ? 391  LEU A C     1 
ATOM   2894  O  O     . LEU A 1  391  ? 9.514   -55.435  10.482  1.00 66.51  ? 391  LEU A O     1 
ATOM   2895  C  CB    . LEU A 1  391  ? 9.920   -58.036  12.463  1.00 61.00  ? 391  LEU A CB    1 
ATOM   2896  C  CG    . LEU A 1  391  ? 9.179   -58.533  13.725  1.00 63.86  ? 391  LEU A CG    1 
ATOM   2897  C  CD1   . LEU A 1  391  ? 8.137   -59.624  13.427  1.00 63.92  ? 391  LEU A CD1   1 
ATOM   2898  C  CD2   . LEU A 1  391  ? 10.167  -59.045  14.758  1.00 65.48  ? 391  LEU A CD2   1 
ATOM   2899  N  N     . VAL A 1  392  ? 10.799  -57.034  9.519   1.00 66.46  ? 392  VAL A N     1 
ATOM   2900  C  CA    . VAL A 1  392  ? 11.546  -56.151  8.625   1.00 67.56  ? 392  VAL A CA    1 
ATOM   2901  C  C     . VAL A 1  392  ? 10.588  -55.525  7.581   1.00 72.51  ? 392  VAL A C     1 
ATOM   2902  O  O     . VAL A 1  392  ? 10.763  -54.365  7.196   1.00 72.09  ? 392  VAL A O     1 
ATOM   2903  C  CB    . VAL A 1  392  ? 12.793  -56.881  8.039   1.00 72.93  ? 392  VAL A CB    1 
ATOM   2904  C  CG1   . VAL A 1  392  ? 12.721  -57.098  6.526   1.00 74.05  ? 392  VAL A CG1   1 
ATOM   2905  C  CG2   . VAL A 1  392  ? 14.081  -56.186  8.442   1.00 72.85  ? 392  VAL A CG2   1 
ATOM   2906  N  N     . ARG A 1  393  ? 9.543   -56.282  7.186   1.00 69.73  ? 393  ARG A N     1 
ATOM   2907  C  CA    . ARG A 1  393  ? 8.527   -55.819  6.246   1.00 69.83  ? 393  ARG A CA    1 
ATOM   2908  C  C     . ARG A 1  393  ? 7.305   -55.248  6.973   1.00 72.37  ? 393  ARG A C     1 
ATOM   2909  O  O     . ARG A 1  393  ? 6.386   -54.734  6.333   1.00 71.70  ? 393  ARG A O     1 
ATOM   2910  C  CB    . ARG A 1  393  ? 8.185   -56.896  5.196   1.00 72.11  ? 393  ARG A CB    1 
ATOM   2911  C  CG    . ARG A 1  393  ? 9.250   -56.981  4.083   1.00 86.67  ? 393  ARG A CG    1 
ATOM   2912  C  CD    . ARG A 1  393  ? 8.852   -57.865  2.916   1.00 100.50 ? 393  ARG A CD    1 
ATOM   2913  N  NE    . ARG A 1  393  ? 8.832   -59.283  3.284   1.00 113.17 ? 393  ARG A NE    1 
ATOM   2914  C  CZ    . ARG A 1  393  ? 8.537   -60.276  2.450   1.00 128.21 ? 393  ARG A CZ    1 
ATOM   2915  N  NH1   . ARG A 1  393  ? 8.239   -60.021  1.180   1.00 118.06 ? 393  ARG A NH1   1 
ATOM   2916  N  NH2   . ARG A 1  393  ? 8.541   -61.532  2.877   1.00 110.84 ? 393  ARG A NH2   1 
ATOM   2917  N  N     . ASN A 1  394  ? 7.328   -55.289  8.318   1.00 68.44  ? 394  ASN A N     1 
ATOM   2918  C  CA    . ASN A 1  394  ? 6.277   -54.723  9.164   1.00 67.13  ? 394  ASN A CA    1 
ATOM   2919  C  C     . ASN A 1  394  ? 6.530   -53.236  9.359   1.00 70.53  ? 394  ASN A C     1 
ATOM   2920  O  O     . ASN A 1  394  ? 5.585   -52.473  9.545   1.00 69.79  ? 394  ASN A O     1 
ATOM   2921  C  CB    . ASN A 1  394  ? 6.200   -55.434  10.501  1.00 67.46  ? 394  ASN A CB    1 
ATOM   2922  C  CG    . ASN A 1  394  ? 4.996   -56.312  10.652  1.00 92.48  ? 394  ASN A CG    1 
ATOM   2923  O  OD1   . ASN A 1  394  ? 4.828   -57.317  9.951   1.00 87.97  ? 394  ASN A OD1   1 
ATOM   2924  N  ND2   . ASN A 1  394  ? 4.142   -55.960  11.594  1.00 85.04  ? 394  ASN A ND2   1 
ATOM   2925  N  N     . GLY A 1  395  ? 7.797   -52.839  9.298   1.00 67.27  ? 395  GLY A N     1 
ATOM   2926  C  CA    . GLY A 1  395  ? 8.191   -51.442  9.387   1.00 67.16  ? 395  GLY A CA    1 
ATOM   2927  C  C     . GLY A 1  395  ? 8.326   -50.871  10.780  1.00 71.00  ? 395  GLY A C     1 
ATOM   2928  O  O     . GLY A 1  395  ? 7.998   -51.541  11.762  1.00 70.30  ? 395  GLY A O     1 
ATOM   2929  N  N     . PRO A 1  396  ? 8.804   -49.610  10.885  1.00 68.13  ? 396  PRO A N     1 
ATOM   2930  C  CA    . PRO A 1  396  ? 9.000   -49.003  12.210  1.00 67.65  ? 396  PRO A CA    1 
ATOM   2931  C  C     . PRO A 1  396  ? 7.761   -48.366  12.845  1.00 72.59  ? 396  PRO A C     1 
ATOM   2932  O  O     . PRO A 1  396  ? 7.836   -47.891  13.989  1.00 71.29  ? 396  PRO A O     1 
ATOM   2933  C  CB    . PRO A 1  396  ? 10.123  -47.990  11.971  1.00 69.77  ? 396  PRO A CB    1 
ATOM   2934  C  CG    . PRO A 1  396  ? 10.118  -47.727  10.509  1.00 74.82  ? 396  PRO A CG    1 
ATOM   2935  C  CD    . PRO A 1  396  ? 9.233   -48.696  9.810   1.00 70.34  ? 396  PRO A CD    1 
ATOM   2936  N  N     . ASN A 1  397  ? 6.624   -48.370  12.125  1.00 70.56  ? 397  ASN A N     1 
ATOM   2937  C  CA    . ASN A 1  397  ? 5.384   -47.782  12.617  1.00 70.32  ? 397  ASN A CA    1 
ATOM   2938  C  C     . ASN A 1  397  ? 4.330   -48.796  13.059  1.00 74.35  ? 397  ASN A C     1 
ATOM   2939  O  O     . ASN A 1  397  ? 3.452   -48.445  13.850  1.00 73.68  ? 397  ASN A O     1 
ATOM   2940  C  CB    . ASN A 1  397  ? 4.841   -46.760  11.634  1.00 75.04  ? 397  ASN A CB    1 
ATOM   2941  C  CG    . ASN A 1  397  ? 5.660   -45.494  11.620  1.00 110.50 ? 397  ASN A CG    1 
ATOM   2942  O  OD1   . ASN A 1  397  ? 6.691   -45.395  10.943  1.00 106.34 ? 397  ASN A OD1   1 
ATOM   2943  N  ND2   . ASN A 1  397  ? 5.239   -44.511  12.406  1.00 105.97 ? 397  ASN A ND2   1 
ATOM   2944  N  N     . GLU A 1  398  ? 4.413   -50.041  12.563  1.00 71.40  ? 398  GLU A N     1 
ATOM   2945  C  CA    . GLU A 1  398  ? 3.517   -51.127  12.969  1.00 71.29  ? 398  GLU A CA    1 
ATOM   2946  C  C     . GLU A 1  398  ? 4.273   -51.849  14.081  1.00 75.09  ? 398  GLU A C     1 
ATOM   2947  O  O     . GLU A 1  398  ? 5.456   -52.163  13.875  1.00 74.77  ? 398  GLU A O     1 
ATOM   2948  C  CB    . GLU A 1  398  ? 3.233   -52.065  11.787  1.00 73.76  ? 398  GLU A CB    1 
ATOM   2949  C  CG    . GLU A 1  398  ? 1.963   -52.889  11.923  1.00 85.70  ? 398  GLU A CG    1 
ATOM   2950  C  CD    . GLU A 1  398  ? 1.623   -53.768  10.731  1.00 115.59 ? 398  GLU A CD    1 
ATOM   2951  O  OE1   . GLU A 1  398  ? 2.556   -54.298  10.085  1.00 112.84 ? 398  GLU A OE1   1 
ATOM   2952  O  OE2   . GLU A 1  398  ? 0.414   -53.947  10.459  1.00 116.31 ? 398  GLU A OE2   1 
ATOM   2953  N  N     . HIS A 1  399  ? 3.627   -52.071  15.270  1.00 71.41  ? 399  HIS A N     1 
ATOM   2954  C  CA    . HIS A 1  399  ? 4.322   -52.656  16.429  1.00 70.87  ? 399  HIS A CA    1 
ATOM   2955  C  C     . HIS A 1  399  ? 5.227   -53.892  16.234  1.00 74.92  ? 399  HIS A C     1 
ATOM   2956  O  O     . HIS A 1  399  ? 6.436   -53.669  16.345  1.00 77.10  ? 399  HIS A O     1 
ATOM   2957  C  CB    . HIS A 1  399  ? 3.558   -52.715  17.764  1.00 70.49  ? 399  HIS A CB    1 
ATOM   2958  C  CG    . HIS A 1  399  ? 4.347   -53.497  18.778  1.00 73.51  ? 399  HIS A CG    1 
ATOM   2959  N  ND1   . HIS A 1  399  ? 5.623   -53.096  19.163  1.00 75.07  ? 399  HIS A ND1   1 
ATOM   2960  C  CD2   . HIS A 1  399  ? 4.100   -54.716  19.310  1.00 75.13  ? 399  HIS A CD2   1 
ATOM   2961  C  CE1   . HIS A 1  399  ? 6.078   -54.054  19.948  1.00 74.49  ? 399  HIS A CE1   1 
ATOM   2962  N  NE2   . HIS A 1  399  ? 5.197   -55.047  20.072  1.00 74.90  ? 399  HIS A NE2   1 
ATOM   2963  N  N     . PRO A 1  400  ? 4.780   -55.170  16.080  1.00 67.23  ? 400  PRO A N     1 
ATOM   2964  C  CA    . PRO A 1  400  ? 5.772   -56.252  15.952  1.00 66.20  ? 400  PRO A CA    1 
ATOM   2965  C  C     . PRO A 1  400  ? 6.515   -56.126  14.613  1.00 69.35  ? 400  PRO A C     1 
ATOM   2966  O  O     . PRO A 1  400  ? 6.264   -56.850  13.651  1.00 70.48  ? 400  PRO A O     1 
ATOM   2967  C  CB    . PRO A 1  400  ? 4.949   -57.531  16.147  1.00 67.84  ? 400  PRO A CB    1 
ATOM   2968  C  CG    . PRO A 1  400  ? 3.570   -57.062  16.577  1.00 71.80  ? 400  PRO A CG    1 
ATOM   2969  C  CD    . PRO A 1  400  ? 3.409   -55.702  15.982  1.00 67.57  ? 400  PRO A CD    1 
ATOM   2970  N  N     . GLY A 1  401  ? 7.382   -55.116  14.577  1.00 63.93  ? 401  GLY A N     1 
ATOM   2971  C  CA    . GLY A 1  401  ? 8.217   -54.715  13.457  1.00 64.04  ? 401  GLY A CA    1 
ATOM   2972  C  C     . GLY A 1  401  ? 9.621   -54.367  13.899  1.00 67.35  ? 401  GLY A C     1 
ATOM   2973  O  O     . GLY A 1  401  ? 10.025  -54.733  15.002  1.00 66.74  ? 401  GLY A O     1 
ATOM   2974  N  N     . ALA A 1  402  ? 10.372  -53.643  13.054  1.00 64.36  ? 402  ALA A N     1 
ATOM   2975  C  CA    . ALA A 1  402  ? 11.763  -53.265  13.324  1.00 64.50  ? 402  ALA A CA    1 
ATOM   2976  C  C     . ALA A 1  402  ? 12.127  -51.858  12.832  1.00 68.48  ? 402  ALA A C     1 
ATOM   2977  O  O     . ALA A 1  402  ? 11.474  -51.327  11.928  1.00 68.30  ? 402  ALA A O     1 
ATOM   2978  C  CB    . ALA A 1  402  ? 12.697  -54.286  12.688  1.00 66.49  ? 402  ALA A CB    1 
ATOM   2979  N  N     . LYS A 1  403  ? 13.189  -51.267  13.423  1.00 64.82  ? 403  LYS A N     1 
ATOM   2980  C  CA    . LYS A 1  403  ? 13.733  -49.966  13.030  1.00 64.86  ? 403  LYS A CA    1 
ATOM   2981  C  C     . LYS A 1  403  ? 14.877  -50.234  12.037  1.00 71.33  ? 403  LYS A C     1 
ATOM   2982  O  O     . LYS A 1  403  ? 14.590  -50.724  10.961  1.00 72.64  ? 403  LYS A O     1 
ATOM   2983  C  CB    . LYS A 1  403  ? 14.169  -49.130  14.249  1.00 66.25  ? 403  LYS A CB    1 
ATOM   2984  C  CG    . LYS A 1  403  ? 13.012  -48.652  15.123  1.00 74.95  ? 403  LYS A CG    1 
ATOM   2985  C  CD    . LYS A 1  403  ? 12.832  -47.150  15.048  1.00 85.81  ? 403  LYS A CD    1 
ATOM   2986  C  CE    . LYS A 1  403  ? 12.652  -46.520  16.407  1.00 96.61  ? 403  LYS A CE    1 
ATOM   2987  N  NZ    . LYS A 1  403  ? 13.951  -46.321  17.108  1.00 105.89 ? 403  LYS A NZ    1 
ATOM   2988  N  N     . TYR A 1  404  ? 16.146  -50.028  12.405  1.00 68.37  ? 404  TYR A N     1 
ATOM   2989  C  CA    . TYR A 1  404  ? 17.302  -50.243  11.522  1.00 69.91  ? 404  TYR A CA    1 
ATOM   2990  C  C     . TYR A 1  404  ? 17.600  -51.710  11.133  1.00 72.11  ? 404  TYR A C     1 
ATOM   2991  O  O     . TYR A 1  404  ? 17.063  -52.630  11.744  1.00 69.59  ? 404  TYR A O     1 
ATOM   2992  C  CB    . TYR A 1  404  ? 18.544  -49.582  12.135  1.00 72.87  ? 404  TYR A CB    1 
ATOM   2993  C  CG    . TYR A 1  404  ? 18.374  -48.103  12.409  1.00 76.07  ? 404  TYR A CG    1 
ATOM   2994  C  CD1   . TYR A 1  404  ? 17.892  -47.651  13.636  1.00 77.13  ? 404  TYR A CD1   1 
ATOM   2995  C  CD2   . TYR A 1  404  ? 18.723  -47.153  11.454  1.00 78.44  ? 404  TYR A CD2   1 
ATOM   2996  C  CE1   . TYR A 1  404  ? 17.736  -46.288  13.896  1.00 78.47  ? 404  TYR A CE1   1 
ATOM   2997  C  CE2   . TYR A 1  404  ? 18.583  -45.787  11.707  1.00 79.50  ? 404  TYR A CE2   1 
ATOM   2998  C  CZ    . TYR A 1  404  ? 18.088  -45.358  12.930  1.00 86.87  ? 404  TYR A CZ    1 
ATOM   2999  O  OH    . TYR A 1  404  ? 17.943  -44.011  13.177  1.00 87.65  ? 404  TYR A OH    1 
ATOM   3000  N  N     . VAL A 1  405  ? 18.436  -51.907  10.076  1.00 70.88  ? 405  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1  405  ? 18.942  -53.199  9.546   1.00 72.29  ? 405  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1  405  ? 20.456  -53.051  9.300   1.00 80.09  ? 405  VAL A C     1 
ATOM   3003  O  O     . VAL A 1  405  ? 20.874  -52.214  8.495   1.00 80.60  ? 405  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1  405  ? 18.220  -53.727  8.269   1.00 75.96  ? 405  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1  405  ? 18.825  -55.046  7.793   1.00 76.60  ? 405  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1  405  ? 16.728  -53.885  8.497   1.00 74.51  ? 405  VAL A CG2   1 
ATOM   3007  N  N     . ILE A 1  406  ? 21.266  -53.858  9.998   1.00 78.64  ? 406  ILE A N     1 
ATOM   3008  C  CA    . ILE A 1  406  ? 22.723  -53.803  9.899   1.00 80.46  ? 406  ILE A CA    1 
ATOM   3009  C  C     . ILE A 1  406  ? 23.246  -54.888  8.988   1.00 87.89  ? 406  ILE A C     1 
ATOM   3010  O  O     . ILE A 1  406  ? 22.987  -56.069  9.206   1.00 86.75  ? 406  ILE A O     1 
ATOM   3011  C  CB    . ILE A 1  406  ? 23.421  -53.763  11.290  1.00 83.00  ? 406  ILE A CB    1 
ATOM   3012  C  CG1   . ILE A 1  406  ? 22.980  -52.529  12.108  1.00 81.63  ? 406  ILE A CG1   1 
ATOM   3013  C  CG2   . ILE A 1  406  ? 24.945  -53.786  11.153  1.00 85.56  ? 406  ILE A CG2   1 
ATOM   3014  C  CD1   . ILE A 1  406  ? 21.911  -52.783  13.118  1.00 85.32  ? 406  ILE A CD1   1 
ATOM   3015  N  N     . ARG A 1  407  ? 23.978  -54.461  7.959   1.00 88.73  ? 407  ARG A N     1 
ATOM   3016  C  CA    . ARG A 1  407  ? 24.590  -55.303  6.937   1.00 91.61  ? 407  ARG A CA    1 
ATOM   3017  C  C     . ARG A 1  407  ? 26.023  -55.616  7.301   1.00 100.67 ? 407  ARG A C     1 
ATOM   3018  O  O     . ARG A 1  407  ? 26.610  -54.956  8.166   1.00 99.34  ? 407  ARG A O     1 
ATOM   3019  C  CB    . ARG A 1  407  ? 24.639  -54.536  5.603   1.00 91.95  ? 407  ARG A CB    1 
ATOM   3020  C  CG    . ARG A 1  407  ? 23.322  -54.373  4.881   1.00 100.08 ? 407  ARG A CG    1 
ATOM   3021  C  CD    . ARG A 1  407  ? 23.533  -53.693  3.544   1.00 113.27 ? 407  ARG A CD    1 
ATOM   3022  N  NE    . ARG A 1  407  ? 24.272  -54.549  2.613   1.00 129.77 ? 407  ARG A NE    1 
ATOM   3023  C  CZ    . ARG A 1  407  ? 24.888  -54.114  1.519   1.00 149.44 ? 407  ARG A CZ    1 
ATOM   3024  N  NH1   . ARG A 1  407  ? 24.864  -52.825  1.203   1.00 139.53 ? 407  ARG A NH1   1 
ATOM   3025  N  NH2   . ARG A 1  407  ? 25.538  -54.964  0.735   1.00 138.17 ? 407  ARG A NH2   1 
ATOM   3026  N  N     . ASP A 1  408  ? 26.617  -56.572  6.555   1.00 102.80 ? 408  ASP A N     1 
ATOM   3027  C  CA    . ASP A 1  408  ? 28.038  -56.903  6.609   1.00 106.41 ? 408  ASP A CA    1 
ATOM   3028  C  C     . ASP A 1  408  ? 28.756  -55.627  6.117   1.00 114.51 ? 408  ASP A C     1 
ATOM   3029  O  O     . ASP A 1  408  ? 28.212  -54.917  5.257   1.00 114.24 ? 408  ASP A O     1 
ATOM   3030  C  CB    . ASP A 1  408  ? 28.370  -58.124  5.712   1.00 110.34 ? 408  ASP A CB    1 
ATOM   3031  C  CG    . ASP A 1  408  ? 27.655  -58.199  4.362   1.00 123.79 ? 408  ASP A CG    1 
ATOM   3032  O  OD1   . ASP A 1  408  ? 26.944  -59.202  4.123   1.00 124.40 ? 408  ASP A OD1   1 
ATOM   3033  O  OD2   . ASP A 1  408  ? 27.853  -57.283  3.526   1.00 130.89 ? 408  ASP A OD2   1 
ATOM   3034  N  N     . SER A 1  409  ? 29.924  -55.303  6.709   1.00 113.58 ? 409  SER A N     1 
ATOM   3035  C  CA    . SER A 1  409  ? 30.723  -54.083  6.476   1.00 114.76 ? 409  SER A CA    1 
ATOM   3036  C  C     . SER A 1  409  ? 30.150  -52.884  7.270   1.00 117.43 ? 409  SER A C     1 
ATOM   3037  O  O     . SER A 1  409  ? 30.560  -51.736  7.067   1.00 117.41 ? 409  SER A O     1 
ATOM   3038  C  CB    . SER A 1  409  ? 30.942  -53.781  4.987   1.00 119.82 ? 409  SER A CB    1 
ATOM   3039  O  OG    . SER A 1  409  ? 29.822  -53.174  4.361   1.00 126.77 ? 409  SER A OG    1 
ATOM   3040  N  N     . GLY A 1  410  ? 29.237  -53.206  8.194   1.00 112.46 ? 410  GLY A N     1 
ATOM   3041  C  CA    . GLY A 1  410  ? 28.585  -52.306  9.141   1.00 110.47 ? 410  GLY A CA    1 
ATOM   3042  C  C     . GLY A 1  410  ? 28.020  -50.996  8.630   1.00 113.28 ? 410  GLY A C     1 
ATOM   3043  O  O     . GLY A 1  410  ? 28.702  -49.967  8.685   1.00 113.84 ? 410  GLY A O     1 
ATOM   3044  N  N     . ASP A 1  411  ? 26.751  -51.020  8.168   1.00 107.24 ? 411  ASP A N     1 
ATOM   3045  C  CA    . ASP A 1  411  ? 26.013  -49.836  7.708   1.00 105.07 ? 411  ASP A CA    1 
ATOM   3046  C  C     . ASP A 1  411  ? 24.507  -50.002  7.914   1.00 102.90 ? 411  ASP A C     1 
ATOM   3047  O  O     . ASP A 1  411  ? 23.927  -50.993  7.464   1.00 102.50 ? 411  ASP A O     1 
ATOM   3048  C  CB    . ASP A 1  411  ? 26.362  -49.443  6.263   1.00 108.56 ? 411  ASP A CB    1 
ATOM   3049  C  CG    . ASP A 1  411  ? 26.723  -47.974  6.136   1.00 120.28 ? 411  ASP A CG    1 
ATOM   3050  O  OD1   . ASP A 1  411  ? 27.880  -47.679  5.769   1.00 123.12 ? 411  ASP A OD1   1 
ATOM   3051  O  OD2   . ASP A 1  411  ? 25.862  -47.118  6.454   1.00 124.33 ? 411  ASP A OD2   1 
ATOM   3052  N  N     . ARG A 1  412  ? 23.886  -49.048  8.628   1.00 94.48  ? 412  ARG A N     1 
ATOM   3053  C  CA    . ARG A 1  412  ? 22.460  -49.094  8.948   1.00 90.85  ? 412  ARG A CA    1 
ATOM   3054  C  C     . ARG A 1  412  ? 21.561  -48.687  7.794   1.00 90.81  ? 412  ARG A C     1 
ATOM   3055  O  O     . ARG A 1  412  ? 21.834  -47.713  7.083   1.00 90.74  ? 412  ARG A O     1 
ATOM   3056  C  CB    . ARG A 1  412  ? 22.133  -48.261  10.199  1.00 89.32  ? 412  ARG A CB    1 
ATOM   3057  C  CG    . ARG A 1  412  ? 22.626  -48.886  11.496  1.00 98.69  ? 412  ARG A CG    1 
ATOM   3058  C  CD    . ARG A 1  412  ? 22.498  -47.948  12.679  1.00 107.11 ? 412  ARG A CD    1 
ATOM   3059  N  NE    . ARG A 1  412  ? 23.104  -48.520  13.884  1.00 118.04 ? 412  ARG A NE    1 
ATOM   3060  C  CZ    . ARG A 1  412  ? 24.162  -48.014  14.513  1.00 133.79 ? 412  ARG A CZ    1 
ATOM   3061  N  NH1   . ARG A 1  412  ? 24.739  -46.902  14.070  1.00 120.93 ? 412  ARG A NH1   1 
ATOM   3062  N  NH2   . ARG A 1  412  ? 24.643  -48.607  15.597  1.00 120.39 ? 412  ARG A NH2   1 
ATOM   3063  N  N     . ILE A 1  413  ? 20.474  -49.447  7.625   1.00 83.53  ? 413  ILE A N     1 
ATOM   3064  C  CA    . ILE A 1  413  ? 19.437  -49.193  6.637   1.00 81.44  ? 413  ILE A CA    1 
ATOM   3065  C  C     . ILE A 1  413  ? 18.248  -48.690  7.457   1.00 81.84  ? 413  ILE A C     1 
ATOM   3066  O  O     . ILE A 1  413  ? 17.640  -49.459  8.209   1.00 79.99  ? 413  ILE A O     1 
ATOM   3067  C  CB    . ILE A 1  413  ? 19.106  -50.456  5.798   1.00 84.41  ? 413  ILE A CB    1 
ATOM   3068  C  CG1   . ILE A 1  413  ? 20.350  -50.994  5.073   1.00 86.27  ? 413  ILE A CG1   1 
ATOM   3069  C  CG2   . ILE A 1  413  ? 17.964  -50.178  4.812   1.00 84.82  ? 413  ILE A CG2   1 
ATOM   3070  C  CD1   . ILE A 1  413  ? 20.242  -52.445  4.699   1.00 93.52  ? 413  ILE A CD1   1 
ATOM   3071  N  N     . ASP A 1  414  ? 17.970  -47.380  7.364   1.00 77.15  ? 414  ASP A N     1 
ATOM   3072  C  CA    . ASP A 1  414  ? 16.884  -46.741  8.103   1.00 74.82  ? 414  ASP A CA    1 
ATOM   3073  C  C     . ASP A 1  414  ? 15.553  -47.140  7.484   1.00 75.19  ? 414  ASP A C     1 
ATOM   3074  O  O     . ASP A 1  414  ? 15.236  -46.721  6.370   1.00 75.20  ? 414  ASP A O     1 
ATOM   3075  C  CB    . ASP A 1  414  ? 17.064  -45.208  8.124   1.00 77.19  ? 414  ASP A CB    1 
ATOM   3076  C  CG    . ASP A 1  414  ? 16.342  -44.490  9.253   1.00 88.43  ? 414  ASP A CG    1 
ATOM   3077  O  OD1   . ASP A 1  414  ? 15.150  -44.789  9.482   1.00 87.96  ? 414  ASP A OD1   1 
ATOM   3078  O  OD2   . ASP A 1  414  ? 16.957  -43.594  9.877   1.00 95.30  ? 414  ASP A OD2   1 
ATOM   3079  N  N     . LEU A 1  415  ? 14.774  -47.954  8.200   1.00 68.69  ? 415  LEU A N     1 
ATOM   3080  C  CA    . LEU A 1  415  ? 13.493  -48.409  7.666   1.00 67.16  ? 415  LEU A CA    1 
ATOM   3081  C  C     . LEU A 1  415  ? 12.380  -47.358  7.622   1.00 69.00  ? 415  LEU A C     1 
ATOM   3082  O  O     . LEU A 1  415  ? 11.345  -47.594  7.002   1.00 67.73  ? 415  LEU A O     1 
ATOM   3083  C  CB    . LEU A 1  415  ? 13.040  -49.746  8.277   1.00 66.32  ? 415  LEU A CB    1 
ATOM   3084  C  CG    . LEU A 1  415  ? 13.953  -50.974  8.063   1.00 71.48  ? 415  LEU A CG    1 
ATOM   3085  C  CD1   . LEU A 1  415  ? 13.209  -52.256  8.368   1.00 71.10  ? 415  LEU A CD1   1 
ATOM   3086  C  CD2   . LEU A 1  415  ? 14.562  -51.018  6.668   1.00 75.12  ? 415  LEU A CD2   1 
ATOM   3087  N  N     . ARG A 1  416  ? 12.609  -46.187  8.233   1.00 65.50  ? 416  ARG A N     1 
ATOM   3088  C  CA    . ARG A 1  416  ? 11.651  -45.083  8.217   1.00 64.90  ? 416  ARG A CA    1 
ATOM   3089  C  C     . ARG A 1  416  ? 11.850  -44.247  6.943   1.00 69.78  ? 416  ARG A C     1 
ATOM   3090  O  O     . ARG A 1  416  ? 10.923  -43.534  6.541   1.00 69.77  ? 416  ARG A O     1 
ATOM   3091  C  CB    . ARG A 1  416  ? 11.792  -44.168  9.457   1.00 65.51  ? 416  ARG A CB    1 
ATOM   3092  C  CG    . ARG A 1  416  ? 12.244  -44.845  10.759  1.00 82.59  ? 416  ARG A CG    1 
ATOM   3093  C  CD    . ARG A 1  416  ? 11.890  -44.058  12.015  1.00 102.29 ? 416  ARG A CD    1 
ATOM   3094  N  NE    . ARG A 1  416  ? 12.367  -42.669  11.994  1.00 117.78 ? 416  ARG A NE    1 
ATOM   3095  C  CZ    . ARG A 1  416  ? 13.526  -42.259  12.502  1.00 134.41 ? 416  ARG A CZ    1 
ATOM   3096  N  NH1   . ARG A 1  416  ? 14.356  -43.126  13.070  1.00 122.36 ? 416  ARG A NH1   1 
ATOM   3097  N  NH2   . ARG A 1  416  ? 13.866  -40.978  12.441  1.00 122.23 ? 416  ARG A NH2   1 
ATOM   3098  N  N     . TYR A 1  417  ? 13.056  -44.329  6.313   1.00 66.00  ? 417  TYR A N     1 
ATOM   3099  C  CA    . TYR A 1  417  ? 13.395  -43.518  5.140   1.00 65.96  ? 417  TYR A CA    1 
ATOM   3100  C  C     . TYR A 1  417  ? 13.854  -44.243  3.884   1.00 68.16  ? 417  TYR A C     1 
ATOM   3101  O  O     . TYR A 1  417  ? 13.571  -43.750  2.796   1.00 68.53  ? 417  TYR A O     1 
ATOM   3102  C  CB    . TYR A 1  417  ? 14.394  -42.405  5.510   1.00 67.89  ? 417  TYR A CB    1 
ATOM   3103  C  CG    . TYR A 1  417  ? 13.931  -41.532  6.655   1.00 69.39  ? 417  TYR A CG    1 
ATOM   3104  C  CD1   . TYR A 1  417  ? 14.378  -41.758  7.954   1.00 70.92  ? 417  TYR A CD1   1 
ATOM   3105  C  CD2   . TYR A 1  417  ? 13.008  -40.509  6.450   1.00 70.09  ? 417  TYR A CD2   1 
ATOM   3106  C  CE1   . TYR A 1  417  ? 13.930  -40.978  9.021   1.00 71.00  ? 417  TYR A CE1   1 
ATOM   3107  C  CE2   . TYR A 1  417  ? 12.551  -39.723  7.509   1.00 70.22  ? 417  TYR A CE2   1 
ATOM   3108  C  CZ    . TYR A 1  417  ? 13.018  -39.960  8.793   1.00 77.97  ? 417  TYR A CZ    1 
ATOM   3109  O  OH    . TYR A 1  417  ? 12.582  -39.190  9.843   1.00 79.27  ? 417  TYR A OH    1 
ATOM   3110  N  N     . SER A 1  418  ? 14.578  -45.369  4.009   1.00 63.19  ? 418  SER A N     1 
ATOM   3111  C  CA    . SER A 1  418  ? 15.131  -46.106  2.861   1.00 63.77  ? 418  SER A CA    1 
ATOM   3112  C  C     . SER A 1  418  ? 14.152  -46.343  1.734   1.00 66.24  ? 418  SER A C     1 
ATOM   3113  O  O     . SER A 1  418  ? 12.987  -46.643  1.986   1.00 65.64  ? 418  SER A O     1 
ATOM   3114  C  CB    . SER A 1  418  ? 15.733  -47.440  3.290   1.00 67.94  ? 418  SER A CB    1 
ATOM   3115  O  OG    . SER A 1  418  ? 16.431  -48.055  2.218   1.00 78.63  ? 418  SER A OG    1 
ATOM   3116  N  N     . LYS A 1  419  ? 14.629  -46.220  0.487   1.00 62.01  ? 419  LYS A N     1 
ATOM   3117  C  CA    . LYS A 1  419  ? 13.807  -46.469  -0.694  1.00 61.04  ? 419  LYS A CA    1 
ATOM   3118  C  C     . LYS A 1  419  ? 13.679  -47.974  -0.895  1.00 67.29  ? 419  LYS A C     1 
ATOM   3119  O  O     . LYS A 1  419  ? 12.798  -48.424  -1.626  1.00 68.02  ? 419  LYS A O     1 
ATOM   3120  C  CB    . LYS A 1  419  ? 14.376  -45.764  -1.942  1.00 62.52  ? 419  LYS A CB    1 
ATOM   3121  C  CG    . LYS A 1  419  ? 15.723  -46.288  -2.427  1.00 52.73  ? 419  LYS A CG    1 
ATOM   3122  C  CD    . LYS A 1  419  ? 16.284  -45.461  -3.559  1.00 53.00  ? 419  LYS A CD    1 
ATOM   3123  C  CE    . LYS A 1  419  ? 17.144  -44.320  -3.079  1.00 58.75  ? 419  LYS A CE    1 
ATOM   3124  N  NZ    . LYS A 1  419  ? 18.591  -44.566  -3.311  1.00 64.04  ? 419  LYS A NZ    1 
ATOM   3125  N  N     . ARG A 1  420  ? 14.563  -48.744  -0.234  1.00 64.69  ? 420  ARG A N     1 
ATOM   3126  C  CA    . ARG A 1  420  ? 14.612  -50.201  -0.291  1.00 65.32  ? 420  ARG A CA    1 
ATOM   3127  C  C     . ARG A 1  420  ? 13.971  -50.831  0.951   1.00 71.32  ? 420  ARG A C     1 
ATOM   3128  O  O     . ARG A 1  420  ? 14.154  -52.032  1.178   1.00 71.61  ? 420  ARG A O     1 
ATOM   3129  C  CB    . ARG A 1  420  ? 16.066  -50.678  -0.448  1.00 64.69  ? 420  ARG A CB    1 
ATOM   3130  C  CG    . ARG A 1  420  ? 16.664  -50.482  -1.838  1.00 69.79  ? 420  ARG A CG    1 
ATOM   3131  C  CD    . ARG A 1  420  ? 16.475  -51.697  -2.722  1.00 74.75  ? 420  ARG A CD    1 
ATOM   3132  N  NE    . ARG A 1  420  ? 17.196  -52.869  -2.222  1.00 79.90  ? 420  ARG A NE    1 
ATOM   3133  C  CZ    . ARG A 1  420  ? 18.293  -53.370  -2.780  1.00 96.09  ? 420  ARG A CZ    1 
ATOM   3134  N  NH1   . ARG A 1  420  ? 18.804  -52.815  -3.868  1.00 91.25  ? 420  ARG A NH1   1 
ATOM   3135  N  NH2   . ARG A 1  420  ? 18.873  -54.445  -2.267  1.00 81.54  ? 420  ARG A NH2   1 
ATOM   3136  N  N     . ALA A 1  421  ? 13.200  -50.030  1.739   1.00 68.54  ? 421  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1  421  ? 12.508  -50.474  2.963   1.00 67.90  ? 421  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1  421  ? 11.442  -51.530  2.671   1.00 74.02  ? 421  ALA A C     1 
ATOM   3139  O  O     . ALA A 1  421  ? 11.127  -52.349  3.542   1.00 73.15  ? 421  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1  421  ? 11.890  -49.291  3.687   1.00 67.43  ? 421  ALA A CB    1 
ATOM   3141  N  N     . GLY A 1  422  ? 10.909  -51.492  1.452   1.00 72.72  ? 422  GLY A N     1 
ATOM   3142  C  CA    . GLY A 1  422  ? 9.938   -52.458  0.966   1.00 73.44  ? 422  GLY A CA    1 
ATOM   3143  C  C     . GLY A 1  422  ? 10.632  -53.736  0.546   1.00 80.52  ? 422  GLY A C     1 
ATOM   3144  O  O     . GLY A 1  422  ? 10.203  -54.825  0.932   1.00 80.32  ? 422  GLY A O     1 
ATOM   3145  N  N     . ASP A 1  423  ? 11.736  -53.588  -0.223  1.00 79.82  ? 423  ASP A N     1 
ATOM   3146  C  CA    . ASP A 1  423  ? 12.601  -54.640  -0.768  1.00 81.86  ? 423  ASP A CA    1 
ATOM   3147  C  C     . ASP A 1  423  ? 13.223  -55.505  0.343   1.00 87.96  ? 423  ASP A C     1 
ATOM   3148  O  O     . ASP A 1  423  ? 12.606  -56.492  0.747   1.00 87.96  ? 423  ASP A O     1 
ATOM   3149  C  CB    . ASP A 1  423  ? 13.685  -53.997  -1.657  1.00 85.24  ? 423  ASP A CB    1 
ATOM   3150  C  CG    . ASP A 1  423  ? 14.588  -54.955  -2.412  1.00 98.77  ? 423  ASP A CG    1 
ATOM   3151  O  OD1   . ASP A 1  423  ? 14.683  -54.823  -3.653  1.00 100.91 ? 423  ASP A OD1   1 
ATOM   3152  O  OD2   . ASP A 1  423  ? 15.262  -55.787  -1.754  1.00 104.51 ? 423  ASP A OD2   1 
ATOM   3153  N  N     . ILE A 1  424  ? 14.441  -55.134  0.817   1.00 85.84  ? 424  ILE A N     1 
ATOM   3154  C  CA    . ILE A 1  424  ? 15.239  -55.778  1.881   1.00 86.00  ? 424  ILE A CA    1 
ATOM   3155  C  C     . ILE A 1  424  ? 15.061  -57.284  2.107   1.00 89.42  ? 424  ILE A C     1 
ATOM   3156  O  O     . ILE A 1  424  ? 14.228  -57.707  2.921   1.00 87.75  ? 424  ILE A O     1 
ATOM   3157  C  CB    . ILE A 1  424  ? 15.304  -54.975  3.213   1.00 88.11  ? 424  ILE A CB    1 
ATOM   3158  C  CG1   . ILE A 1  424  ? 13.918  -54.400  3.599   1.00 87.42  ? 424  ILE A CG1   1 
ATOM   3159  C  CG2   . ILE A 1  424  ? 16.392  -53.896  3.144   1.00 89.44  ? 424  ILE A CG2   1 
ATOM   3160  C  CD1   . ILE A 1  424  ? 13.740  -54.041  5.018   1.00 96.35  ? 424  ILE A CD1   1 
ATOM   3161  N  N     . GLN A 1  425  ? 15.855  -58.085  1.379   1.00 86.97  ? 425  GLN A N     1 
ATOM   3162  C  CA    . GLN A 1  425  ? 15.862  -59.542  1.502   1.00 87.00  ? 425  GLN A CA    1 
ATOM   3163  C  C     . GLN A 1  425  ? 17.082  -59.892  2.351   1.00 89.12  ? 425  GLN A C     1 
ATOM   3164  O  O     . GLN A 1  425  ? 18.226  -59.688  1.926   1.00 90.05  ? 425  GLN A O     1 
ATOM   3165  C  CB    . GLN A 1  425  ? 15.872  -60.231  0.123   1.00 90.22  ? 425  GLN A CB    1 
ATOM   3166  C  CG    . GLN A 1  425  ? 14.644  -59.896  -0.736  1.00 110.94 ? 425  GLN A CG    1 
ATOM   3167  C  CD    . GLN A 1  425  ? 14.534  -60.712  -2.004  1.00 138.63 ? 425  GLN A CD    1 
ATOM   3168  O  OE1   . GLN A 1  425  ? 13.482  -61.290  -2.301  1.00 136.03 ? 425  GLN A OE1   1 
ATOM   3169  N  NE2   . GLN A 1  425  ? 15.591  -60.745  -2.809  1.00 134.14 ? 425  GLN A NE2   1 
ATOM   3170  N  N     . LEU A 1  426  ? 16.822  -60.330  3.590   1.00 82.77  ? 426  LEU A N     1 
ATOM   3171  C  CA    . LEU A 1  426  ? 17.833  -60.609  4.608   1.00 81.83  ? 426  LEU A CA    1 
ATOM   3172  C  C     . LEU A 1  426  ? 18.857  -61.693  4.316   1.00 87.57  ? 426  LEU A C     1 
ATOM   3173  O  O     . LEU A 1  426  ? 18.611  -62.608  3.531   1.00 87.93  ? 426  LEU A O     1 
ATOM   3174  C  CB    . LEU A 1  426  ? 17.193  -60.808  5.992   1.00 79.75  ? 426  LEU A CB    1 
ATOM   3175  C  CG    . LEU A 1  426  ? 16.574  -59.575  6.628   1.00 81.63  ? 426  LEU A CG    1 
ATOM   3176  C  CD1   . LEU A 1  426  ? 15.727  -59.955  7.809   1.00 80.32  ? 426  LEU A CD1   1 
ATOM   3177  C  CD2   . LEU A 1  426  ? 17.633  -58.560  7.021   1.00 82.88  ? 426  LEU A CD2   1 
ATOM   3178  N  N     . GLN A 1  427  ? 20.013  -61.570  4.982   1.00 85.11  ? 427  GLN A N     1 
ATOM   3179  C  CA    . GLN A 1  427  ? 21.149  -62.481  4.920   1.00 87.09  ? 427  GLN A CA    1 
ATOM   3180  C  C     . GLN A 1  427  ? 21.564  -62.887  6.343   1.00 90.59  ? 427  GLN A C     1 
ATOM   3181  O  O     . GLN A 1  427  ? 21.319  -62.134  7.288   1.00 88.72  ? 427  GLN A O     1 
ATOM   3182  C  CB    . GLN A 1  427  ? 22.327  -61.790  4.210   1.00 90.03  ? 427  GLN A CB    1 
ATOM   3183  C  CG    . GLN A 1  427  ? 22.846  -62.532  2.981   1.00 111.50 ? 427  GLN A CG    1 
ATOM   3184  C  CD    . GLN A 1  427  ? 21.888  -62.499  1.814   1.00 133.32 ? 427  GLN A CD    1 
ATOM   3185  O  OE1   . GLN A 1  427  ? 21.300  -61.462  1.475   1.00 127.24 ? 427  GLN A OE1   1 
ATOM   3186  N  NE2   . GLN A 1  427  ? 21.728  -63.640  1.160   1.00 129.11 ? 427  GLN A NE2   1 
ATOM   3187  N  N     . TYR A 1  428  ? 22.190  -64.070  6.499   1.00 88.43  ? 428  TYR A N     1 
ATOM   3188  C  CA    . TYR A 1  428  ? 22.669  -64.529  7.802   1.00 88.08  ? 428  TYR A CA    1 
ATOM   3189  C  C     . TYR A 1  428  ? 23.881  -63.701  8.210   1.00 91.31  ? 428  TYR A C     1 
ATOM   3190  O  O     . TYR A 1  428  ? 24.667  -63.287  7.354   1.00 91.93  ? 428  TYR A O     1 
ATOM   3191  C  CB    . TYR A 1  428  ? 23.050  -66.014  7.776   1.00 91.37  ? 428  TYR A CB    1 
ATOM   3192  C  CG    . TYR A 1  428  ? 21.937  -66.956  7.376   1.00 93.81  ? 428  TYR A CG    1 
ATOM   3193  C  CD1   . TYR A 1  428  ? 21.977  -67.639  6.163   1.00 97.46  ? 428  TYR A CD1   1 
ATOM   3194  C  CD2   . TYR A 1  428  ? 20.872  -67.213  8.234   1.00 93.25  ? 428  TYR A CD2   1 
ATOM   3195  C  CE1   . TYR A 1  428  ? 20.969  -68.533  5.801   1.00 98.46  ? 428  TYR A CE1   1 
ATOM   3196  C  CE2   . TYR A 1  428  ? 19.851  -68.090  7.876   1.00 94.28  ? 428  TYR A CE2   1 
ATOM   3197  C  CZ    . TYR A 1  428  ? 19.911  -68.762  6.665   1.00 103.95 ? 428  TYR A CZ    1 
ATOM   3198  O  OH    . TYR A 1  428  ? 18.909  -69.634  6.313   1.00 105.51 ? 428  TYR A OH    1 
ATOM   3199  N  N     . GLY A 1  429  ? 24.011  -63.456  9.507   1.00 86.46  ? 429  GLY A N     1 
ATOM   3200  C  CA    . GLY A 1  429  ? 25.103  -62.659  10.052  1.00 86.45  ? 429  GLY A CA    1 
ATOM   3201  C  C     . GLY A 1  429  ? 24.771  -61.184  10.124  1.00 88.16  ? 429  GLY A C     1 
ATOM   3202  O  O     . GLY A 1  429  ? 25.518  -60.406  10.722  1.00 88.13  ? 429  GLY A O     1 
ATOM   3203  N  N     . TRP A 1  430  ? 23.649  -60.791  9.506   1.00 82.55  ? 430  TRP A N     1 
ATOM   3204  C  CA    . TRP A 1  430  ? 23.156  -59.420  9.502   1.00 80.81  ? 430  TRP A CA    1 
ATOM   3205  C  C     . TRP A 1  430  ? 22.402  -59.182  10.791  1.00 80.14  ? 430  TRP A C     1 
ATOM   3206  O  O     . TRP A 1  430  ? 21.820  -60.118  11.336  1.00 79.69  ? 430  TRP A O     1 
ATOM   3207  C  CB    . TRP A 1  430  ? 22.189  -59.211  8.330   1.00 79.81  ? 430  TRP A CB    1 
ATOM   3208  C  CG    . TRP A 1  430  ? 22.824  -58.991  6.989   1.00 82.74  ? 430  TRP A CG    1 
ATOM   3209  C  CD1   . TRP A 1  430  ? 24.041  -59.441  6.562   1.00 87.61  ? 430  TRP A CD1   1 
ATOM   3210  C  CD2   . TRP A 1  430  ? 22.223  -58.334  5.868   1.00 82.67  ? 430  TRP A CD2   1 
ATOM   3211  N  NE1   . TRP A 1  430  ? 24.252  -59.066  5.257   1.00 88.33  ? 430  TRP A NE1   1 
ATOM   3212  C  CE2   . TRP A 1  430  ? 23.153  -58.379  4.807   1.00 88.66  ? 430  TRP A CE2   1 
ATOM   3213  C  CE3   . TRP A 1  430  ? 20.988  -57.694  5.661   1.00 82.60  ? 430  TRP A CE3   1 
ATOM   3214  C  CZ2   . TRP A 1  430  ? 22.883  -57.818  3.552   1.00 88.55  ? 430  TRP A CZ2   1 
ATOM   3215  C  CZ3   . TRP A 1  430  ? 20.725  -57.134  4.421   1.00 84.59  ? 430  TRP A CZ3   1 
ATOM   3216  C  CH2   . TRP A 1  430  ? 21.660  -57.207  3.381   1.00 87.12  ? 430  TRP A CH2   1 
ATOM   3217  N  N     . LYS A 1  431  ? 22.392  -57.942  11.276  1.00 72.99  ? 431  LYS A N     1 
ATOM   3218  C  CA    . LYS A 1  431  ? 21.662  -57.621  12.495  1.00 69.66  ? 431  LYS A CA    1 
ATOM   3219  C  C     . LYS A 1  431  ? 20.409  -56.853  12.142  1.00 68.91  ? 431  LYS A C     1 
ATOM   3220  O  O     . LYS A 1  431  ? 20.431  -56.008  11.255  1.00 67.69  ? 431  LYS A O     1 
ATOM   3221  C  CB    . LYS A 1  431  ? 22.532  -56.846  13.502  1.00 71.73  ? 431  LYS A CB    1 
ATOM   3222  C  CG    . LYS A 1  431  ? 23.686  -57.663  14.074  1.00 81.85  ? 431  LYS A CG    1 
ATOM   3223  C  CD    . LYS A 1  431  ? 24.517  -56.869  15.062  1.00 91.90  ? 431  LYS A CD    1 
ATOM   3224  C  CE    . LYS A 1  431  ? 24.293  -57.325  16.483  1.00 103.27 ? 431  LYS A CE    1 
ATOM   3225  N  NZ    . LYS A 1  431  ? 24.880  -56.381  17.473  1.00 109.73 ? 431  LYS A NZ    1 
ATOM   3226  N  N     . VAL A 1  432  ? 19.309  -57.179  12.809  1.00 63.42  ? 432  VAL A N     1 
ATOM   3227  C  CA    . VAL A 1  432  ? 18.026  -56.514  12.615  1.00 61.42  ? 432  VAL A CA    1 
ATOM   3228  C  C     . VAL A 1  432  ? 17.620  -55.920  13.963  1.00 62.43  ? 432  VAL A C     1 
ATOM   3229  O  O     . VAL A 1  432  ? 17.340  -56.666  14.901  1.00 61.74  ? 432  VAL A O     1 
ATOM   3230  C  CB    . VAL A 1  432  ? 16.945  -57.474  12.049  1.00 65.16  ? 432  VAL A CB    1 
ATOM   3231  C  CG1   . VAL A 1  432  ? 15.587  -56.785  11.948  1.00 63.73  ? 432  VAL A CG1   1 
ATOM   3232  C  CG2   . VAL A 1  432  ? 17.360  -58.041  10.699  1.00 66.36  ? 432  VAL A CG2   1 
ATOM   3233  N  N     . GLU A 1  433  ? 17.614  -54.587  14.064  1.00 57.09  ? 433  GLU A N     1 
ATOM   3234  C  CA    . GLU A 1  433  ? 17.224  -53.893  15.284  1.00 55.16  ? 433  GLU A CA    1 
ATOM   3235  C  C     . GLU A 1  433  ? 15.699  -53.930  15.414  1.00 57.60  ? 433  GLU A C     1 
ATOM   3236  O  O     . GLU A 1  433  ? 15.005  -52.981  15.049  1.00 56.70  ? 433  GLU A O     1 
ATOM   3237  C  CB    . GLU A 1  433  ? 17.779  -52.460  15.307  1.00 56.54  ? 433  GLU A CB    1 
ATOM   3238  C  CG    . GLU A 1  433  ? 19.272  -52.400  15.563  1.00 68.40  ? 433  GLU A CG    1 
ATOM   3239  C  CD    . GLU A 1  433  ? 19.760  -51.080  16.120  1.00 84.73  ? 433  GLU A CD    1 
ATOM   3240  O  OE1   . GLU A 1  433  ? 19.665  -50.893  17.354  1.00 77.79  ? 433  GLU A OE1   1 
ATOM   3241  O  OE2   . GLU A 1  433  ? 20.240  -50.236  15.329  1.00 74.51  ? 433  GLU A OE2   1 
ATOM   3242  N  N     . ARG A 1  434  ? 15.185  -55.062  15.896  1.00 53.90  ? 434  ARG A N     1 
ATOM   3243  C  CA    . ARG A 1  434  ? 13.756  -55.296  16.071  1.00 52.94  ? 434  ARG A CA    1 
ATOM   3244  C  C     . ARG A 1  434  ? 13.202  -54.617  17.304  1.00 57.58  ? 434  ARG A C     1 
ATOM   3245  O  O     . ARG A 1  434  ? 13.896  -54.535  18.317  1.00 57.27  ? 434  ARG A O     1 
ATOM   3246  C  CB    . ARG A 1  434  ? 13.443  -56.797  16.109  1.00 52.49  ? 434  ARG A CB    1 
ATOM   3247  C  CG    . ARG A 1  434  ? 14.368  -57.606  17.012  1.00 62.05  ? 434  ARG A CG    1 
ATOM   3248  C  CD    . ARG A 1  434  ? 13.658  -58.810  17.561  1.00 66.83  ? 434  ARG A CD    1 
ATOM   3249  N  NE    . ARG A 1  434  ? 12.991  -58.491  18.815  1.00 67.33  ? 434  ARG A NE    1 
ATOM   3250  C  CZ    . ARG A 1  434  ? 13.353  -58.974  19.994  1.00 76.30  ? 434  ARG A CZ    1 
ATOM   3251  N  NH1   . ARG A 1  434  ? 14.367  -59.827  20.087  1.00 61.90  ? 434  ARG A NH1   1 
ATOM   3252  N  NH2   . ARG A 1  434  ? 12.695  -58.626  21.087  1.00 60.17  ? 434  ARG A NH2   1 
ATOM   3253  N  N     . HIS A 1  435  ? 11.923  -54.183  17.237  1.00 54.47  ? 435  HIS A N     1 
ATOM   3254  C  CA    . HIS A 1  435  ? 11.202  -53.546  18.340  1.00 53.27  ? 435  HIS A CA    1 
ATOM   3255  C  C     . HIS A 1  435  ? 11.190  -54.451  19.554  1.00 57.16  ? 435  HIS A C     1 
ATOM   3256  O  O     . HIS A 1  435  ? 11.287  -55.676  19.429  1.00 57.25  ? 435  HIS A O     1 
ATOM   3257  C  CB    . HIS A 1  435  ? 9.732   -53.251  17.958  1.00 53.40  ? 435  HIS A CB    1 
ATOM   3258  C  CG    . HIS A 1  435  ? 9.530   -52.108  17.013  1.00 56.95  ? 435  HIS A CG    1 
ATOM   3259  N  ND1   . HIS A 1  435  ? 8.607   -52.181  15.988  1.00 58.94  ? 435  HIS A ND1   1 
ATOM   3260  C  CD2   . HIS A 1  435  ? 10.129  -50.896  16.971  1.00 58.97  ? 435  HIS A CD2   1 
ATOM   3261  C  CE1   . HIS A 1  435  ? 8.671   -51.021  15.357  1.00 58.60  ? 435  HIS A CE1   1 
ATOM   3262  N  NE2   . HIS A 1  435  ? 9.573   -50.213  15.914  1.00 58.93  ? 435  HIS A NE2   1 
ATOM   3263  N  N     . ILE A 1  436  ? 11.047  -53.843  20.725  1.00 53.66  ? 436  ILE A N     1 
ATOM   3264  C  CA    . ILE A 1  436  ? 10.937  -54.554  21.988  1.00 53.59  ? 436  ILE A CA    1 
ATOM   3265  C  C     . ILE A 1  436  ? 9.599   -55.334  21.975  1.00 58.35  ? 436  ILE A C     1 
ATOM   3266  O  O     . ILE A 1  436  ? 8.568   -54.760  21.614  1.00 57.95  ? 436  ILE A O     1 
ATOM   3267  C  CB    . ILE A 1  436  ? 11.172  -53.522  23.153  1.00 55.74  ? 436  ILE A CB    1 
ATOM   3268  C  CG1   . ILE A 1  436  ? 12.501  -53.782  23.853  1.00 56.78  ? 436  ILE A CG1   1 
ATOM   3269  C  CG2   . ILE A 1  436  ? 10.032  -53.364  24.162  1.00 55.02  ? 436  ILE A CG2   1 
ATOM   3270  C  CD1   . ILE A 1  436  ? 13.688  -53.731  22.955  1.00 66.32  ? 436  ILE A CD1   1 
ATOM   3271  N  N     . MET A 1  437  ? 9.641   -56.658  22.210  1.00 55.27  ? 437  MET A N     1 
ATOM   3272  C  CA    . MET A 1  437  ? 8.415   -57.463  22.195  1.00 55.06  ? 437  MET A CA    1 
ATOM   3273  C  C     . MET A 1  437  ? 8.175   -58.356  23.408  1.00 58.62  ? 437  MET A C     1 
ATOM   3274  O  O     . MET A 1  437  ? 9.065   -58.501  24.240  1.00 58.81  ? 437  MET A O     1 
ATOM   3275  C  CB    . MET A 1  437  ? 8.159   -58.158  20.855  1.00 58.47  ? 437  MET A CB    1 
ATOM   3276  C  CG    . MET A 1  437  ? 9.334   -58.898  20.291  1.00 63.77  ? 437  MET A CG    1 
ATOM   3277  S  SD    . MET A 1  437  ? 9.111   -59.012  18.496  1.00 69.50  ? 437  MET A SD    1 
ATOM   3278  C  CE    . MET A 1  437  ? 9.270   -60.766  18.265  1.00 67.59  ? 437  MET A CE    1 
ATOM   3279  N  N     . ASP A 1  438  ? 6.950   -58.904  23.537  1.00 54.03  ? 438  ASP A N     1 
ATOM   3280  C  CA    . ASP A 1  438  ? 6.508   -59.743  24.652  1.00 53.05  ? 438  ASP A CA    1 
ATOM   3281  C  C     . ASP A 1  438  ? 7.528   -60.749  25.153  1.00 57.86  ? 438  ASP A C     1 
ATOM   3282  O  O     . ASP A 1  438  ? 8.195   -61.408  24.364  1.00 58.37  ? 438  ASP A O     1 
ATOM   3283  C  CB    . ASP A 1  438  ? 5.163   -60.419  24.343  1.00 54.56  ? 438  ASP A CB    1 
ATOM   3284  C  CG    . ASP A 1  438  ? 3.940   -59.526  24.501  1.00 63.02  ? 438  ASP A CG    1 
ATOM   3285  O  OD1   . ASP A 1  438  ? 4.103   -58.282  24.518  1.00 63.31  ? 438  ASP A OD1   1 
ATOM   3286  O  OD2   . ASP A 1  438  ? 2.820   -60.069  24.593  1.00 67.82  ? 438  ASP A OD2   1 
ATOM   3287  N  N     . ASN A 1  439  ? 7.672   -60.814  26.480  1.00 54.91  ? 439  ASN A N     1 
ATOM   3288  C  CA    . ASN A 1  439  ? 8.564   -61.704  27.219  1.00 55.59  ? 439  ASN A CA    1 
ATOM   3289  C  C     . ASN A 1  439  ? 10.079  -61.473  27.065  1.00 61.13  ? 439  ASN A C     1 
ATOM   3290  O  O     . ASN A 1  439  ? 10.875  -62.384  27.305  1.00 62.13  ? 439  ASN A O     1 
ATOM   3291  C  CB    . ASN A 1  439  ? 8.114   -63.168  27.127  1.00 55.42  ? 439  ASN A CB    1 
ATOM   3292  C  CG    . ASN A 1  439  ? 6.704   -63.384  27.642  1.00 80.06  ? 439  ASN A CG    1 
ATOM   3293  O  OD1   . ASN A 1  439  ? 6.143   -62.577  28.408  1.00 72.44  ? 439  ASN A OD1   1 
ATOM   3294  N  ND2   . ASN A 1  439  ? 6.090   -64.475  27.218  1.00 74.70  ? 439  ASN A ND2   1 
ATOM   3295  N  N     . ASP A 1  440  ? 10.474  -60.227  26.738  1.00 57.19  ? 440  ASP A N     1 
ATOM   3296  C  CA    . ASP A 1  440  ? 11.877  -59.828  26.641  1.00 57.46  ? 440  ASP A CA    1 
ATOM   3297  C  C     . ASP A 1  440  ? 12.361  -59.419  28.028  1.00 61.28  ? 440  ASP A C     1 
ATOM   3298  O  O     . ASP A 1  440  ? 11.611  -58.771  28.765  1.00 60.64  ? 440  ASP A O     1 
ATOM   3299  C  CB    . ASP A 1  440  ? 12.050  -58.626  25.701  1.00 59.12  ? 440  ASP A CB    1 
ATOM   3300  C  CG    . ASP A 1  440  ? 12.175  -58.940  24.224  1.00 72.78  ? 440  ASP A CG    1 
ATOM   3301  O  OD1   . ASP A 1  440  ? 12.568  -60.083  23.884  1.00 74.54  ? 440  ASP A OD1   1 
ATOM   3302  O  OD2   . ASP A 1  440  ? 11.916  -58.032  23.406  1.00 79.97  ? 440  ASP A OD2   1 
ATOM   3303  N  N     . PRO A 1  441  ? 13.610  -59.738  28.414  1.00 58.00  ? 441  PRO A N     1 
ATOM   3304  C  CA    . PRO A 1  441  ? 14.088  -59.300  29.735  1.00 57.05  ? 441  PRO A CA    1 
ATOM   3305  C  C     . PRO A 1  441  ? 14.417  -57.809  29.705  1.00 59.39  ? 441  PRO A C     1 
ATOM   3306  O  O     . PRO A 1  441  ? 15.086  -57.361  28.780  1.00 60.00  ? 441  PRO A O     1 
ATOM   3307  C  CB    . PRO A 1  441  ? 15.346  -60.153  29.967  1.00 60.14  ? 441  PRO A CB    1 
ATOM   3308  C  CG    . PRO A 1  441  ? 15.416  -61.119  28.805  1.00 65.80  ? 441  PRO A CG    1 
ATOM   3309  C  CD    . PRO A 1  441  ? 14.650  -60.493  27.694  1.00 60.81  ? 441  PRO A CD    1 
ATOM   3310  N  N     . VAL A 1  442  ? 13.891  -57.038  30.664  1.00 53.73  ? 442  VAL A N     1 
ATOM   3311  C  CA    . VAL A 1  442  ? 14.140  -55.595  30.782  1.00 52.76  ? 442  VAL A CA    1 
ATOM   3312  C  C     . VAL A 1  442  ? 14.352  -55.205  32.247  1.00 56.06  ? 442  VAL A C     1 
ATOM   3313  O  O     . VAL A 1  442  ? 13.643  -55.697  33.126  1.00 55.21  ? 442  VAL A O     1 
ATOM   3314  C  CB    . VAL A 1  442  ? 13.089  -54.671  30.091  1.00 55.67  ? 442  VAL A CB    1 
ATOM   3315  C  CG1   . VAL A 1  442  ? 13.211  -54.698  28.573  1.00 56.01  ? 442  VAL A CG1   1 
ATOM   3316  C  CG2   . VAL A 1  442  ? 11.664  -54.983  30.540  1.00 54.68  ? 442  VAL A CG2   1 
ATOM   3317  N  N     . LEU A 1  443  ? 15.301  -54.302  32.503  1.00 52.30  ? 443  LEU A N     1 
ATOM   3318  C  CA    . LEU A 1  443  ? 15.587  -53.828  33.849  1.00 51.38  ? 443  LEU A CA    1 
ATOM   3319  C  C     . LEU A 1  443  ? 14.633  -52.683  34.223  1.00 52.62  ? 443  LEU A C     1 
ATOM   3320  O  O     . LEU A 1  443  ? 14.653  -51.624  33.595  1.00 51.42  ? 443  LEU A O     1 
ATOM   3321  C  CB    . LEU A 1  443  ? 17.054  -53.366  33.944  1.00 52.59  ? 443  LEU A CB    1 
ATOM   3322  C  CG    . LEU A 1  443  ? 17.883  -53.751  35.183  1.00 58.36  ? 443  LEU A CG    1 
ATOM   3323  C  CD1   . LEU A 1  443  ? 18.934  -52.726  35.435  1.00 58.83  ? 443  LEU A CD1   1 
ATOM   3324  C  CD2   . LEU A 1  443  ? 17.045  -53.846  36.446  1.00 60.77  ? 443  LEU A CD2   1 
ATOM   3325  N  N     . PHE A 1  444  ? 13.797  -52.903  35.249  1.00 48.46  ? 444  PHE A N     1 
ATOM   3326  C  CA    . PHE A 1  444  ? 12.843  -51.904  35.748  1.00 46.80  ? 444  PHE A CA    1 
ATOM   3327  C  C     . PHE A 1  444  ? 13.399  -51.273  37.019  1.00 49.86  ? 444  PHE A C     1 
ATOM   3328  O  O     . PHE A 1  444  ? 13.858  -52.000  37.903  1.00 50.33  ? 444  PHE A O     1 
ATOM   3329  C  CB    . PHE A 1  444  ? 11.473  -52.541  35.998  1.00 47.71  ? 444  PHE A CB    1 
ATOM   3330  C  CG    . PHE A 1  444  ? 10.303  -51.609  35.832  1.00 47.99  ? 444  PHE A CG    1 
ATOM   3331  C  CD1   . PHE A 1  444  ? 10.236  -50.736  34.753  1.00 50.71  ? 444  PHE A CD1   1 
ATOM   3332  C  CD2   . PHE A 1  444  ? 9.233   -51.651  36.712  1.00 49.48  ? 444  PHE A CD2   1 
ATOM   3333  C  CE1   . PHE A 1  444  ? 9.145   -49.882  34.592  1.00 51.00  ? 444  PHE A CE1   1 
ATOM   3334  C  CE2   . PHE A 1  444  ? 8.136   -50.809  36.541  1.00 51.64  ? 444  PHE A CE2   1 
ATOM   3335  C  CZ    . PHE A 1  444  ? 8.103   -49.922  35.486  1.00 49.54  ? 444  PHE A CZ    1 
ATOM   3336  N  N     . ASN A 1  445  ? 13.388  -49.928  37.094  1.00 44.59  ? 445  ASN A N     1 
ATOM   3337  C  CA    . ASN A 1  445  ? 13.991  -49.175  38.191  1.00 43.85  ? 445  ASN A CA    1 
ATOM   3338  C  C     . ASN A 1  445  ? 13.114  -48.070  38.737  1.00 47.02  ? 445  ASN A C     1 
ATOM   3339  O  O     . ASN A 1  445  ? 12.474  -47.360  37.971  1.00 47.20  ? 445  ASN A O     1 
ATOM   3340  C  CB    . ASN A 1  445  ? 15.337  -48.589  37.704  1.00 45.26  ? 445  ASN A CB    1 
ATOM   3341  C  CG    . ASN A 1  445  ? 16.091  -47.651  38.635  1.00 72.01  ? 445  ASN A CG    1 
ATOM   3342  O  OD1   . ASN A 1  445  ? 16.577  -46.593  38.214  1.00 68.64  ? 445  ASN A OD1   1 
ATOM   3343  N  ND2   . ASN A 1  445  ? 16.276  -48.037  39.892  1.00 63.47  ? 445  ASN A ND2   1 
ATOM   3344  N  N     . ARG A 1  446  ? 13.146  -47.888  40.060  1.00 42.84  ? 446  ARG A N     1 
ATOM   3345  C  CA    . ARG A 1  446  ? 12.459  -46.820  40.778  1.00 41.83  ? 446  ARG A CA    1 
ATOM   3346  C  C     . ARG A 1  446  ? 13.497  -46.153  41.673  1.00 46.86  ? 446  ARG A C     1 
ATOM   3347  O  O     . ARG A 1  446  ? 14.076  -46.818  42.543  1.00 46.56  ? 446  ARG A O     1 
ATOM   3348  C  CB    . ARG A 1  446  ? 11.300  -47.376  41.627  1.00 40.66  ? 446  ARG A CB    1 
ATOM   3349  C  CG    . ARG A 1  446  ? 10.211  -46.355  41.968  1.00 44.23  ? 446  ARG A CG    1 
ATOM   3350  C  CD    . ARG A 1  446  ? 10.482  -45.652  43.270  1.00 48.16  ? 446  ARG A CD    1 
ATOM   3351  N  NE    . ARG A 1  446  ? 9.330   -44.893  43.735  1.00 56.91  ? 446  ARG A NE    1 
ATOM   3352  C  CZ    . ARG A 1  446  ? 9.372   -44.046  44.756  1.00 76.95  ? 446  ARG A CZ    1 
ATOM   3353  N  NH1   . ARG A 1  446  ? 10.510  -43.842  45.412  1.00 66.03  ? 446  ARG A NH1   1 
ATOM   3354  N  NH2   . ARG A 1  446  ? 8.279   -43.393  45.129  1.00 66.03  ? 446  ARG A NH2   1 
ATOM   3355  N  N     . GLN A 1  447  ? 13.730  -44.846  41.460  1.00 44.31  ? 447  GLN A N     1 
ATOM   3356  C  CA    . GLN A 1  447  ? 14.702  -44.073  42.238  1.00 45.26  ? 447  GLN A CA    1 
ATOM   3357  C  C     . GLN A 1  447  ? 14.104  -43.429  43.505  1.00 49.30  ? 447  GLN A C     1 
ATOM   3358  O  O     . GLN A 1  447  ? 12.944  -43.012  43.472  1.00 48.15  ? 447  GLN A O     1 
ATOM   3359  C  CB    . GLN A 1  447  ? 15.389  -43.020  41.372  1.00 47.35  ? 447  GLN A CB    1 
ATOM   3360  C  CG    . GLN A 1  447  ? 16.263  -43.608  40.282  1.00 65.45  ? 447  GLN A CG    1 
ATOM   3361  C  CD    . GLN A 1  447  ? 16.229  -42.747  39.053  1.00 90.08  ? 447  GLN A CD    1 
ATOM   3362  O  OE1   . GLN A 1  447  ? 15.232  -42.069  38.754  1.00 85.06  ? 447  GLN A OE1   1 
ATOM   3363  N  NE2   . GLN A 1  447  ? 17.313  -42.780  38.295  1.00 87.24  ? 447  GLN A NE2   1 
ATOM   3364  N  N     . PRO A 1  448  ? 14.848  -43.324  44.635  1.00 46.67  ? 448  PRO A N     1 
ATOM   3365  C  CA    . PRO A 1  448  ? 16.239  -43.754  44.870  1.00 47.32  ? 448  PRO A CA    1 
ATOM   3366  C  C     . PRO A 1  448  ? 16.432  -45.270  44.922  1.00 50.89  ? 448  PRO A C     1 
ATOM   3367  O  O     . PRO A 1  448  ? 15.637  -46.011  45.522  1.00 49.35  ? 448  PRO A O     1 
ATOM   3368  C  CB    . PRO A 1  448  ? 16.597  -43.059  46.185  1.00 49.25  ? 448  PRO A CB    1 
ATOM   3369  C  CG    . PRO A 1  448  ? 15.294  -42.972  46.913  1.00 53.09  ? 448  PRO A CG    1 
ATOM   3370  C  CD    . PRO A 1  448  ? 14.272  -42.703  45.843  1.00 48.01  ? 448  PRO A CD    1 
ATOM   3371  N  N     . SER A 1  449  ? 17.511  -45.711  44.261  1.00 47.95  ? 449  SER A N     1 
ATOM   3372  C  CA    . SER A 1  449  ? 17.919  -47.102  44.117  1.00 47.88  ? 449  SER A CA    1 
ATOM   3373  C  C     . SER A 1  449  ? 18.744  -47.565  45.330  1.00 53.83  ? 449  SER A C     1 
ATOM   3374  O  O     . SER A 1  449  ? 19.944  -47.853  45.213  1.00 55.46  ? 449  SER A O     1 
ATOM   3375  C  CB    . SER A 1  449  ? 18.682  -47.270  42.809  1.00 50.40  ? 449  SER A CB    1 
ATOM   3376  O  OG    . SER A 1  449  ? 18.013  -46.589  41.760  1.00 56.26  ? 449  SER A OG    1 
ATOM   3377  N  N     . LEU A 1  450  ? 18.081  -47.631  46.504  1.00 49.69  ? 450  LEU A N     1 
ATOM   3378  C  CA    . LEU A 1  450  ? 18.667  -48.021  47.796  1.00 50.29  ? 450  LEU A CA    1 
ATOM   3379  C  C     . LEU A 1  450  ? 18.778  -49.557  48.003  1.00 55.96  ? 450  LEU A C     1 
ATOM   3380  O  O     . LEU A 1  450  ? 19.273  -50.019  49.037  1.00 55.64  ? 450  LEU A O     1 
ATOM   3381  C  CB    . LEU A 1  450  ? 17.808  -47.428  48.925  1.00 49.50  ? 450  LEU A CB    1 
ATOM   3382  C  CG    . LEU A 1  450  ? 17.615  -45.920  48.961  1.00 53.85  ? 450  LEU A CG    1 
ATOM   3383  C  CD1   . LEU A 1  450  ? 16.274  -45.574  49.573  1.00 53.08  ? 450  LEU A CD1   1 
ATOM   3384  C  CD2   . LEU A 1  450  ? 18.730  -45.243  49.734  1.00 57.18  ? 450  LEU A CD2   1 
ATOM   3385  N  N     . HIS A 1  451  ? 18.325  -50.331  47.012  1.00 53.88  ? 451  HIS A N     1 
ATOM   3386  C  CA    . HIS A 1  451  ? 18.246  -51.783  47.041  1.00 54.64  ? 451  HIS A CA    1 
ATOM   3387  C  C     . HIS A 1  451  ? 18.699  -52.436  45.760  1.00 57.50  ? 451  HIS A C     1 
ATOM   3388  O  O     . HIS A 1  451  ? 18.661  -51.815  44.692  1.00 56.00  ? 451  HIS A O     1 
ATOM   3389  C  CB    . HIS A 1  451  ? 16.759  -52.144  47.115  1.00 55.28  ? 451  HIS A CB    1 
ATOM   3390  C  CG    . HIS A 1  451  ? 16.225  -52.419  48.464  1.00 58.87  ? 451  HIS A CG    1 
ATOM   3391  N  ND1   . HIS A 1  451  ? 14.870  -52.570  48.665  1.00 60.14  ? 451  HIS A ND1   1 
ATOM   3392  C  CD2   . HIS A 1  451  ? 16.875  -52.589  49.637  1.00 61.85  ? 451  HIS A CD2   1 
ATOM   3393  C  CE1   . HIS A 1  451  ? 14.730  -52.808  49.956  1.00 60.31  ? 451  HIS A CE1   1 
ATOM   3394  N  NE2   . HIS A 1  451  ? 15.914  -52.843  50.580  1.00 61.47  ? 451  HIS A NE2   1 
ATOM   3395  N  N     . LYS A 1  452  ? 18.943  -53.760  45.841  1.00 53.94  ? 452  LYS A N     1 
ATOM   3396  C  CA    . LYS A 1  452  ? 19.160  -54.562  44.649  1.00 53.69  ? 452  LYS A CA    1 
ATOM   3397  C  C     . LYS A 1  452  ? 17.751  -54.812  44.077  1.00 55.24  ? 452  LYS A C     1 
ATOM   3398  O  O     . LYS A 1  452  ? 17.579  -54.834  42.865  1.00 53.94  ? 452  LYS A O     1 
ATOM   3399  C  CB    . LYS A 1  452  ? 19.958  -55.853  44.934  1.00 57.04  ? 452  LYS A CB    1 
ATOM   3400  C  CG    . LYS A 1  452  ? 19.418  -56.766  46.024  1.00 68.03  ? 452  LYS A CG    1 
ATOM   3401  C  CD    . LYS A 1  452  ? 20.501  -57.717  46.550  1.00 77.99  ? 452  LYS A CD    1 
ATOM   3402  C  CE    . LYS A 1  452  ? 20.573  -59.053  45.845  1.00 85.22  ? 452  LYS A CE    1 
ATOM   3403  N  NZ    . LYS A 1  452  ? 21.282  -58.960  44.546  1.00 96.18  ? 452  LYS A NZ    1 
ATOM   3404  N  N     . MET A 1  453  ? 16.731  -54.843  44.973  1.00 51.27  ? 453  MET A N     1 
ATOM   3405  C  CA    . MET A 1  453  ? 15.302  -54.988  44.661  1.00 50.49  ? 453  MET A CA    1 
ATOM   3406  C  C     . MET A 1  453  ? 14.688  -53.707  44.073  1.00 53.49  ? 453  MET A C     1 
ATOM   3407  O  O     . MET A 1  453  ? 13.524  -53.716  43.660  1.00 52.62  ? 453  MET A O     1 
ATOM   3408  C  CB    . MET A 1  453  ? 14.508  -55.434  45.892  1.00 52.71  ? 453  MET A CB    1 
ATOM   3409  C  CG    . MET A 1  453  ? 14.948  -56.762  46.442  1.00 57.92  ? 453  MET A CG    1 
ATOM   3410  S  SD    . MET A 1  453  ? 16.083  -56.535  47.825  1.00 63.23  ? 453  MET A SD    1 
ATOM   3411  C  CE    . MET A 1  453  ? 14.912  -56.128  49.131  1.00 58.94  ? 453  MET A CE    1 
ATOM   3412  N  N     . SER A 1  454  ? 15.465  -52.609  44.028  1.00 49.63  ? 454  SER A N     1 
ATOM   3413  C  CA    . SER A 1  454  ? 15.041  -51.349  43.420  1.00 48.35  ? 454  SER A CA    1 
ATOM   3414  C  C     . SER A 1  454  ? 15.278  -51.408  41.894  1.00 51.81  ? 454  SER A C     1 
ATOM   3415  O  O     . SER A 1  454  ? 14.827  -50.532  41.161  1.00 50.50  ? 454  SER A O     1 
ATOM   3416  C  CB    . SER A 1  454  ? 15.800  -50.181  44.038  1.00 51.17  ? 454  SER A CB    1 
ATOM   3417  O  OG    . SER A 1  454  ? 15.183  -49.773  45.245  1.00 58.53  ? 454  SER A OG    1 
ATOM   3418  N  N     . MET A 1  455  ? 15.995  -52.447  41.440  1.00 49.34  ? 455  MET A N     1 
ATOM   3419  C  CA    . MET A 1  455  ? 16.334  -52.720  40.053  1.00 50.03  ? 455  MET A CA    1 
ATOM   3420  C  C     . MET A 1  455  ? 16.103  -54.207  39.791  1.00 55.21  ? 455  MET A C     1 
ATOM   3421  O  O     . MET A 1  455  ? 16.922  -55.039  40.196  1.00 55.88  ? 455  MET A O     1 
ATOM   3422  C  CB    . MET A 1  455  ? 17.798  -52.361  39.788  1.00 53.52  ? 455  MET A CB    1 
ATOM   3423  C  CG    . MET A 1  455  ? 18.024  -50.914  39.533  1.00 57.31  ? 455  MET A CG    1 
ATOM   3424  S  SD    . MET A 1  455  ? 19.501  -50.715  38.524  1.00 63.56  ? 455  MET A SD    1 
ATOM   3425  C  CE    . MET A 1  455  ? 18.886  -49.600  37.276  1.00 59.73  ? 455  MET A CE    1 
ATOM   3426  N  N     . MET A 1  456  ? 14.980  -54.553  39.137  1.00 51.11  ? 456  MET A N     1 
ATOM   3427  C  CA    . MET A 1  456  ? 14.671  -55.958  38.853  1.00 51.24  ? 456  MET A CA    1 
ATOM   3428  C  C     . MET A 1  456  ? 14.337  -56.185  37.397  1.00 54.18  ? 456  MET A C     1 
ATOM   3429  O  O     . MET A 1  456  ? 13.737  -55.315  36.761  1.00 53.45  ? 456  MET A O     1 
ATOM   3430  C  CB    . MET A 1  456  ? 13.520  -56.475  39.731  1.00 53.00  ? 456  MET A CB    1 
ATOM   3431  C  CG    . MET A 1  456  ? 13.891  -56.724  41.176  1.00 56.45  ? 456  MET A CG    1 
ATOM   3432  S  SD    . MET A 1  456  ? 12.437  -56.494  42.227  1.00 59.24  ? 456  MET A SD    1 
ATOM   3433  C  CE    . MET A 1  456  ? 11.889  -58.091  42.349  1.00 56.48  ? 456  MET A CE    1 
ATOM   3434  N  N     . ALA A 1  457  ? 14.699  -57.373  36.880  1.00 50.24  ? 457  ALA A N     1 
ATOM   3435  C  CA    . ALA A 1  457  ? 14.421  -57.767  35.505  1.00 49.60  ? 457  ALA A CA    1 
ATOM   3436  C  C     . ALA A 1  457  ? 12.973  -58.242  35.362  1.00 51.80  ? 457  ALA A C     1 
ATOM   3437  O  O     . ALA A 1  457  ? 12.522  -59.106  36.109  1.00 50.90  ? 457  ALA A O     1 
ATOM   3438  C  CB    . ALA A 1  457  ? 15.387  -58.849  35.058  1.00 51.49  ? 457  ALA A CB    1 
ATOM   3439  N  N     . HIS A 1  458  ? 12.247  -57.651  34.412  1.00 48.06  ? 458  HIS A N     1 
ATOM   3440  C  CA    . HIS A 1  458  ? 10.854  -57.972  34.132  1.00 47.76  ? 458  HIS A CA    1 
ATOM   3441  C  C     . HIS A 1  458  ? 10.645  -58.515  32.720  1.00 52.50  ? 458  HIS A C     1 
ATOM   3442  O  O     . HIS A 1  458  ? 11.362  -58.136  31.789  1.00 52.63  ? 458  HIS A O     1 
ATOM   3443  C  CB    . HIS A 1  458  ? 9.989   -56.720  34.291  1.00 47.63  ? 458  HIS A CB    1 
ATOM   3444  C  CG    . HIS A 1  458  ? 9.710   -56.320  35.702  1.00 50.51  ? 458  HIS A CG    1 
ATOM   3445  N  ND1   . HIS A 1  458  ? 8.454   -56.481  36.259  1.00 51.75  ? 458  HIS A ND1   1 
ATOM   3446  C  CD2   . HIS A 1  458  ? 10.523  -55.734  36.610  1.00 52.20  ? 458  HIS A CD2   1 
ATOM   3447  C  CE1   . HIS A 1  458  ? 8.546   -56.001  37.487  1.00 50.88  ? 458  HIS A CE1   1 
ATOM   3448  N  NE2   . HIS A 1  458  ? 9.772   -55.534  37.740  1.00 51.41  ? 458  HIS A NE2   1 
ATOM   3449  N  N     . ARG A 1  459  ? 9.621   -59.367  32.555  1.00 48.96  ? 459  ARG A N     1 
ATOM   3450  C  CA    . ARG A 1  459  ? 9.226   -59.911  31.259  1.00 49.28  ? 459  ARG A CA    1 
ATOM   3451  C  C     . ARG A 1  459  ? 8.362   -58.841  30.604  1.00 53.72  ? 459  ARG A C     1 
ATOM   3452  O  O     . ARG A 1  459  ? 7.520   -58.245  31.281  1.00 53.45  ? 459  ARG A O     1 
ATOM   3453  C  CB    . ARG A 1  459  ? 8.396   -61.183  31.453  1.00 48.41  ? 459  ARG A CB    1 
ATOM   3454  C  CG    . ARG A 1  459  ? 9.171   -62.486  31.329  1.00 53.72  ? 459  ARG A CG    1 
ATOM   3455  C  CD    . ARG A 1  459  ? 8.394   -63.643  31.936  1.00 58.20  ? 459  ARG A CD    1 
ATOM   3456  N  NE    . ARG A 1  459  ? 7.066   -63.814  31.334  1.00 64.42  ? 459  ARG A NE    1 
ATOM   3457  C  CZ    . ARG A 1  459  ? 5.916   -63.798  32.005  1.00 71.71  ? 459  ARG A CZ    1 
ATOM   3458  N  NH1   . ARG A 1  459  ? 5.908   -63.630  33.320  1.00 47.51  ? 459  ARG A NH1   1 
ATOM   3459  N  NH2   . ARG A 1  459  ? 4.766   -63.963  31.366  1.00 61.79  ? 459  ARG A NH2   1 
ATOM   3460  N  N     . VAL A 1  460  ? 8.574   -58.576  29.311  1.00 50.04  ? 460  VAL A N     1 
ATOM   3461  C  CA    . VAL A 1  460  ? 7.801   -57.562  28.594  1.00 49.17  ? 460  VAL A CA    1 
ATOM   3462  C  C     . VAL A 1  460  ? 6.361   -58.056  28.324  1.00 53.12  ? 460  VAL A C     1 
ATOM   3463  O  O     . VAL A 1  460  ? 6.103   -59.266  28.225  1.00 52.79  ? 460  VAL A O     1 
ATOM   3464  C  CB    . VAL A 1  460  ? 8.549   -57.062  27.306  1.00 53.45  ? 460  VAL A CB    1 
ATOM   3465  C  CG1   . VAL A 1  460  ? 7.643   -56.280  26.351  1.00 52.68  ? 460  VAL A CG1   1 
ATOM   3466  C  CG2   . VAL A 1  460  ? 9.766   -56.225  27.665  1.00 53.25  ? 460  VAL A CG2   1 
ATOM   3467  N  N     . LYS A 1  461  ? 5.431   -57.091  28.300  1.00 49.17  ? 461  LYS A N     1 
ATOM   3468  C  CA    . LYS A 1  461  ? 4.028   -57.209  27.928  1.00 48.85  ? 461  LYS A CA    1 
ATOM   3469  C  C     . LYS A 1  461  ? 3.657   -55.852  27.342  1.00 53.99  ? 461  LYS A C     1 
ATOM   3470  O  O     . LYS A 1  461  ? 3.486   -54.873  28.078  1.00 53.37  ? 461  LYS A O     1 
ATOM   3471  C  CB    . LYS A 1  461  ? 3.111   -57.611  29.103  1.00 50.18  ? 461  LYS A CB    1 
ATOM   3472  C  CG    . LYS A 1  461  ? 1.608   -57.624  28.763  1.00 55.08  ? 461  LYS A CG    1 
ATOM   3473  C  CD    . LYS A 1  461  ? 1.216   -58.706  27.748  1.00 64.14  ? 461  LYS A CD    1 
ATOM   3474  C  CE    . LYS A 1  461  ? -0.197  -58.556  27.231  1.00 75.22  ? 461  LYS A CE    1 
ATOM   3475  N  NZ    . LYS A 1  461  ? -1.217  -59.001  28.220  1.00 85.33  ? 461  LYS A NZ    1 
ATOM   3476  N  N     . VAL A 1  462  ? 3.628   -55.778  26.004  1.00 51.08  ? 462  VAL A N     1 
ATOM   3477  C  CA    . VAL A 1  462  ? 3.298   -54.545  25.294  1.00 50.02  ? 462  VAL A CA    1 
ATOM   3478  C  C     . VAL A 1  462  ? 1.791   -54.309  25.424  1.00 53.37  ? 462  VAL A C     1 
ATOM   3479  O  O     . VAL A 1  462  ? 1.005   -55.221  25.164  1.00 53.28  ? 462  VAL A O     1 
ATOM   3480  C  CB    . VAL A 1  462  ? 3.819   -54.553  23.833  1.00 53.94  ? 462  VAL A CB    1 
ATOM   3481  C  CG1   . VAL A 1  462  ? 3.491   -53.243  23.114  1.00 53.37  ? 462  VAL A CG1   1 
ATOM   3482  C  CG2   . VAL A 1  462  ? 5.323   -54.819  23.798  1.00 54.05  ? 462  VAL A CG2   1 
ATOM   3483  N  N     . ILE A 1  463  ? 1.404   -53.112  25.899  1.00 49.42  ? 463  ILE A N     1 
ATOM   3484  C  CA    . ILE A 1  463  ? 0.004   -52.743  26.137  1.00 48.90  ? 463  ILE A CA    1 
ATOM   3485  C  C     . ILE A 1  463  ? -0.383  -51.364  25.578  1.00 52.13  ? 463  ILE A C     1 
ATOM   3486  O  O     . ILE A 1  463  ? 0.500   -50.525  25.386  1.00 50.90  ? 463  ILE A O     1 
ATOM   3487  C  CB    . ILE A 1  463  ? -0.360  -52.865  27.651  1.00 51.61  ? 463  ILE A CB    1 
ATOM   3488  C  CG1   . ILE A 1  463  ? 0.742   -52.296  28.581  1.00 51.45  ? 463  ILE A CG1   1 
ATOM   3489  C  CG2   . ILE A 1  463  ? -0.765  -54.297  28.025  1.00 52.90  ? 463  ILE A CG2   1 
ATOM   3490  C  CD1   . ILE A 1  463  ? 0.541   -50.840  29.051  1.00 57.50  ? 463  ILE A CD1   1 
ATOM   3491  N  N     . PRO A 1  464  ? -1.696  -51.080  25.356  1.00 49.58  ? 464  PRO A N     1 
ATOM   3492  C  CA    . PRO A 1  464  ? -2.082  -49.730  24.913  1.00 49.99  ? 464  PRO A CA    1 
ATOM   3493  C  C     . PRO A 1  464  ? -2.029  -48.777  26.110  1.00 55.96  ? 464  PRO A C     1 
ATOM   3494  O  O     . PRO A 1  464  ? -1.815  -49.254  27.222  1.00 56.80  ? 464  PRO A O     1 
ATOM   3495  C  CB    . PRO A 1  464  ? -3.515  -49.930  24.426  1.00 51.79  ? 464  PRO A CB    1 
ATOM   3496  C  CG    . PRO A 1  464  ? -4.046  -51.024  25.278  1.00 55.63  ? 464  PRO A CG    1 
ATOM   3497  C  CD    . PRO A 1  464  ? -2.887  -51.942  25.535  1.00 51.22  ? 464  PRO A CD    1 
ATOM   3498  N  N     . TYR A 1  465  ? -2.253  -47.460  25.909  1.00 53.03  ? 465  TYR A N     1 
ATOM   3499  C  CA    . TYR A 1  465  ? -2.225  -46.426  26.969  1.00 52.81  ? 465  TYR A CA    1 
ATOM   3500  C  C     . TYR A 1  465  ? -0.805  -46.096  27.436  1.00 55.06  ? 465  TYR A C     1 
ATOM   3501  O  O     . TYR A 1  465  ? 0.060   -46.971  27.482  1.00 54.66  ? 465  TYR A O     1 
ATOM   3502  C  CB    . TYR A 1  465  ? -3.189  -46.709  28.141  1.00 54.39  ? 465  TYR A CB    1 
ATOM   3503  C  CG    . TYR A 1  465  ? -4.618  -46.934  27.703  1.00 57.40  ? 465  TYR A CG    1 
ATOM   3504  C  CD1   . TYR A 1  465  ? -5.133  -48.218  27.573  1.00 59.82  ? 465  TYR A CD1   1 
ATOM   3505  C  CD2   . TYR A 1  465  ? -5.450  -45.863  27.397  1.00 58.92  ? 465  TYR A CD2   1 
ATOM   3506  C  CE1   . TYR A 1  465  ? -6.443  -48.432  27.150  1.00 61.96  ? 465  TYR A CE1   1 
ATOM   3507  C  CE2   . TYR A 1  465  ? -6.760  -46.064  26.967  1.00 60.71  ? 465  TYR A CE2   1 
ATOM   3508  C  CZ    . TYR A 1  465  ? -7.259  -47.351  26.862  1.00 69.71  ? 465  TYR A CZ    1 
ATOM   3509  O  OH    . TYR A 1  465  ? -8.549  -47.554  26.438  1.00 72.94  ? 465  TYR A OH    1 
ATOM   3510  N  N     . SER A 1  466  ? -0.575  -44.819  27.759  1.00 50.07  ? 466  SER A N     1 
ATOM   3511  C  CA    . SER A 1  466  ? 0.735   -44.251  28.076  1.00 49.24  ? 466  SER A CA    1 
ATOM   3512  C  C     . SER A 1  466  ? 1.534   -44.665  29.342  1.00 52.17  ? 466  SER A C     1 
ATOM   3513  O  O     . SER A 1  466  ? 2.744   -44.445  29.359  1.00 51.59  ? 466  SER A O     1 
ATOM   3514  C  CB    . SER A 1  466  ? 0.714   -42.742  27.876  1.00 52.00  ? 466  SER A CB    1 
ATOM   3515  O  OG    . SER A 1  466  ? 0.588   -42.439  26.495  1.00 59.05  ? 466  SER A OG    1 
ATOM   3516  N  N     . THR A 1  467  ? 0.901   -45.289  30.361  1.00 47.66  ? 467  THR A N     1 
ATOM   3517  C  CA    . THR A 1  467  ? 1.592   -45.698  31.600  1.00 45.95  ? 467  THR A CA    1 
ATOM   3518  C  C     . THR A 1  467  ? 2.367   -47.014  31.530  1.00 49.68  ? 467  THR A C     1 
ATOM   3519  O  O     . THR A 1  467  ? 2.054   -47.881  30.707  1.00 49.83  ? 467  THR A O     1 
ATOM   3520  C  CB    . THR A 1  467  ? 0.645   -45.727  32.822  1.00 44.98  ? 467  THR A CB    1 
ATOM   3521  O  OG1   . THR A 1  467  ? -0.445  -46.627  32.621  1.00 44.13  ? 467  THR A OG1   1 
ATOM   3522  C  CG2   . THR A 1  467  ? 0.154   -44.377  33.208  1.00 39.79  ? 467  THR A CG2   1 
ATOM   3523  N  N     . PHE A 1  468  ? 3.360   -47.162  32.441  1.00 45.45  ? 468  PHE A N     1 
ATOM   3524  C  CA    . PHE A 1  468  ? 4.139   -48.377  32.671  1.00 45.44  ? 468  PHE A CA    1 
ATOM   3525  C  C     . PHE A 1  468  ? 3.312   -49.161  33.688  1.00 49.87  ? 468  PHE A C     1 
ATOM   3526  O  O     . PHE A 1  468  ? 2.976   -48.625  34.750  1.00 50.03  ? 468  PHE A O     1 
ATOM   3527  C  CB    . PHE A 1  468  ? 5.520   -48.065  33.274  1.00 47.16  ? 468  PHE A CB    1 
ATOM   3528  C  CG    . PHE A 1  468  ? 6.706   -47.968  32.344  1.00 49.11  ? 468  PHE A CG    1 
ATOM   3529  C  CD1   . PHE A 1  468  ? 7.664   -46.977  32.517  1.00 52.16  ? 468  PHE A CD1   1 
ATOM   3530  C  CD2   . PHE A 1  468  ? 6.904   -48.907  31.339  1.00 51.69  ? 468  PHE A CD2   1 
ATOM   3531  C  CE1   . PHE A 1  468  ? 8.784   -46.910  31.687  1.00 53.63  ? 468  PHE A CE1   1 
ATOM   3532  C  CE2   . PHE A 1  468  ? 8.022   -48.837  30.506  1.00 55.16  ? 468  PHE A CE2   1 
ATOM   3533  C  CZ    . PHE A 1  468  ? 8.957   -47.842  30.690  1.00 53.34  ? 468  PHE A CZ    1 
ATOM   3534  N  N     . ARG A 1  469  ? 2.925   -50.393  33.357  1.00 46.31  ? 469  ARG A N     1 
ATOM   3535  C  CA    . ARG A 1  469  ? 2.063   -51.166  34.254  1.00 45.60  ? 469  ARG A CA    1 
ATOM   3536  C  C     . ARG A 1  469  ? 2.777   -52.262  35.007  1.00 50.20  ? 469  ARG A C     1 
ATOM   3537  O  O     . ARG A 1  469  ? 3.589   -52.984  34.435  1.00 50.35  ? 469  ARG A O     1 
ATOM   3538  C  CB    . ARG A 1  469  ? 0.806   -51.669  33.536  1.00 43.58  ? 469  ARG A CB    1 
ATOM   3539  C  CG    . ARG A 1  469  ? 0.072   -50.543  32.843  1.00 47.22  ? 469  ARG A CG    1 
ATOM   3540  C  CD    . ARG A 1  469  ? -1.307  -50.925  32.415  1.00 50.75  ? 469  ARG A CD    1 
ATOM   3541  N  NE    . ARG A 1  469  ? -2.253  -49.883  32.793  1.00 55.63  ? 469  ARG A NE    1 
ATOM   3542  C  CZ    . ARG A 1  469  ? -3.037  -49.939  33.861  1.00 71.04  ? 469  ARG A CZ    1 
ATOM   3543  N  NH1   . ARG A 1  469  ? -3.009  -50.996  34.659  1.00 62.21  ? 469  ARG A NH1   1 
ATOM   3544  N  NH2   . ARG A 1  469  ? -3.865  -48.945  34.132  1.00 60.29  ? 469  ARG A NH2   1 
ATOM   3545  N  N     . LEU A 1  470  ? 2.501   -52.365  36.303  1.00 46.80  ? 470  LEU A N     1 
ATOM   3546  C  CA    . LEU A 1  470  ? 3.146   -53.371  37.139  1.00 47.27  ? 470  LEU A CA    1 
ATOM   3547  C  C     . LEU A 1  470  ? 2.190   -54.014  38.116  1.00 50.62  ? 470  LEU A C     1 
ATOM   3548  O  O     . LEU A 1  470  ? 1.126   -53.448  38.392  1.00 49.27  ? 470  LEU A O     1 
ATOM   3549  C  CB    . LEU A 1  470  ? 4.392   -52.806  37.860  1.00 47.39  ? 470  LEU A CB    1 
ATOM   3550  C  CG    . LEU A 1  470  ? 4.199   -51.550  38.694  1.00 51.56  ? 470  LEU A CG    1 
ATOM   3551  C  CD1   . LEU A 1  470  ? 4.564   -51.790  40.135  1.00 51.63  ? 470  LEU A CD1   1 
ATOM   3552  C  CD2   . LEU A 1  470  ? 4.989   -50.429  38.132  1.00 53.72  ? 470  LEU A CD2   1 
ATOM   3553  N  N     . ASN A 1  471  ? 2.576   -55.207  38.636  1.00 47.91  ? 471  ASN A N     1 
ATOM   3554  C  CA    . ASN A 1  471  ? 1.791   -55.946  39.620  1.00 47.85  ? 471  ASN A CA    1 
ATOM   3555  C  C     . ASN A 1  471  ? 1.958   -55.320  40.996  1.00 51.18  ? 471  ASN A C     1 
ATOM   3556  O  O     . ASN A 1  471  ? 3.079   -55.006  41.391  1.00 50.75  ? 471  ASN A O     1 
ATOM   3557  C  CB    . ASN A 1  471  ? 2.166   -57.423  39.644  1.00 48.82  ? 471  ASN A CB    1 
ATOM   3558  C  CG    . ASN A 1  471  ? 1.169   -58.249  40.410  1.00 68.96  ? 471  ASN A CG    1 
ATOM   3559  O  OD1   . ASN A 1  471  ? -0.035  -57.947  40.447  1.00 65.01  ? 471  ASN A OD1   1 
ATOM   3560  N  ND2   . ASN A 1  471  ? 1.651   -59.284  41.068  1.00 58.57  ? 471  ASN A ND2   1 
ATOM   3561  N  N     . LEU A 1  472  ? 0.852   -55.129  41.721  1.00 47.98  ? 472  LEU A N     1 
ATOM   3562  C  CA    . LEU A 1  472  ? 0.858   -54.478  43.041  1.00 48.20  ? 472  LEU A CA    1 
ATOM   3563  C  C     . LEU A 1  472  ? 1.769   -55.124  44.073  1.00 54.51  ? 472  LEU A C     1 
ATOM   3564  O  O     . LEU A 1  472  ? 2.277   -54.421  44.943  1.00 54.04  ? 472  LEU A O     1 
ATOM   3565  C  CB    . LEU A 1  472  ? -0.550  -54.343  43.619  1.00 48.14  ? 472  LEU A CB    1 
ATOM   3566  C  CG    . LEU A 1  472  ? -1.586  -53.856  42.657  1.00 52.88  ? 472  LEU A CG    1 
ATOM   3567  C  CD1   . LEU A 1  472  ? -2.674  -54.909  42.458  1.00 54.43  ? 472  LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A 1  472  ? -2.088  -52.515  43.060  1.00 52.92  ? 472  LEU A CD2   1 
ATOM   3569  N  N     . SER A 1  473  ? 1.965   -56.455  43.999  1.00 52.80  ? 473  SER A N     1 
ATOM   3570  C  CA    . SER A 1  473  ? 2.827   -57.152  44.952  1.00 53.22  ? 473  SER A CA    1 
ATOM   3571  C  C     . SER A 1  473  ? 4.315   -56.792  44.795  1.00 56.78  ? 473  SER A C     1 
ATOM   3572  O  O     . SER A 1  473  ? 5.059   -56.896  45.775  1.00 57.39  ? 473  SER A O     1 
ATOM   3573  C  CB    . SER A 1  473  ? 2.563   -58.652  44.952  1.00 57.51  ? 473  SER A CB    1 
ATOM   3574  O  OG    . SER A 1  473  ? 1.301   -58.923  45.543  1.00 65.54  ? 473  SER A OG    1 
ATOM   3575  N  N     . VAL A 1  474  ? 4.717   -56.274  43.601  1.00 51.18  ? 474  VAL A N     1 
ATOM   3576  C  CA    . VAL A 1  474  ? 6.075   -55.805  43.317  1.00 50.17  ? 474  VAL A CA    1 
ATOM   3577  C  C     . VAL A 1  474  ? 6.247   -54.297  43.696  1.00 53.60  ? 474  VAL A C     1 
ATOM   3578  O  O     . VAL A 1  474  ? 7.328   -53.727  43.539  1.00 54.02  ? 474  VAL A O     1 
ATOM   3579  C  CB    . VAL A 1  474  ? 6.566   -56.215  41.889  1.00 53.76  ? 474  VAL A CB    1 
ATOM   3580  C  CG1   . VAL A 1  474  ? 6.213   -55.191  40.812  1.00 52.60  ? 474  VAL A CG1   1 
ATOM   3581  C  CG2   . VAL A 1  474  ? 8.057   -56.518  41.883  1.00 54.30  ? 474  VAL A CG2   1 
ATOM   3582  N  N     . THR A 1  475  ? 5.182   -53.681  44.249  1.00 48.77  ? 475  THR A N     1 
ATOM   3583  C  CA    . THR A 1  475  ? 5.145   -52.281  44.680  1.00 47.71  ? 475  THR A CA    1 
ATOM   3584  C  C     . THR A 1  475  ? 6.170   -51.975  45.787  1.00 53.12  ? 475  THR A C     1 
ATOM   3585  O  O     . THR A 1  475  ? 6.955   -51.033  45.661  1.00 52.30  ? 475  THR A O     1 
ATOM   3586  C  CB    . THR A 1  475  ? 3.678   -51.875  44.978  1.00 52.26  ? 475  THR A CB    1 
ATOM   3587  O  OG1   . THR A 1  475  ? 3.294   -50.783  44.155  1.00 52.56  ? 475  THR A OG1   1 
ATOM   3588  C  CG2   . THR A 1  475  ? 3.371   -51.600  46.466  1.00 49.13  ? 475  THR A CG2   1 
ATOM   3589  N  N     . SER A 1  476  ? 6.161   -52.805  46.851  1.00 51.45  ? 476  SER A N     1 
ATOM   3590  C  CA    . SER A 1  476  ? 6.986   -52.723  48.061  1.00 51.46  ? 476  SER A CA    1 
ATOM   3591  C  C     . SER A 1  476  ? 8.510   -52.712  47.836  1.00 54.33  ? 476  SER A C     1 
ATOM   3592  O  O     . SER A 1  476  ? 9.128   -51.770  48.334  1.00 53.85  ? 476  SER A O     1 
ATOM   3593  C  CB    . SER A 1  476  ? 6.570   -53.776  49.091  1.00 56.20  ? 476  SER A CB    1 
ATOM   3594  O  OG    . SER A 1  476  ? 5.458   -54.558  48.674  1.00 66.06  ? 476  SER A OG    1 
ATOM   3595  N  N     . PRO A 1  477  ? 9.149   -53.678  47.101  1.00 50.38  ? 477  PRO A N     1 
ATOM   3596  C  CA    . PRO A 1  477  ? 10.615  -53.612  46.918  1.00 50.50  ? 477  PRO A CA    1 
ATOM   3597  C  C     . PRO A 1  477  ? 11.111  -52.350  46.213  1.00 54.13  ? 477  PRO A C     1 
ATOM   3598  O  O     . PRO A 1  477  ? 12.188  -51.852  46.546  1.00 54.40  ? 477  PRO A O     1 
ATOM   3599  C  CB    . PRO A 1  477  ? 10.939  -54.886  46.131  1.00 52.96  ? 477  PRO A CB    1 
ATOM   3600  C  CG    . PRO A 1  477  ? 9.678   -55.266  45.478  1.00 57.20  ? 477  PRO A CG    1 
ATOM   3601  C  CD    . PRO A 1  477  ? 8.598   -54.875  46.433  1.00 52.20  ? 477  PRO A CD    1 
ATOM   3602  N  N     . TYR A 1  478  ? 10.308  -51.826  45.265  1.00 49.91  ? 478  TYR A N     1 
ATOM   3603  C  CA    . TYR A 1  478  ? 10.569  -50.593  44.516  1.00 48.84  ? 478  TYR A CA    1 
ATOM   3604  C  C     . TYR A 1  478  ? 10.181  -49.374  45.359  1.00 51.88  ? 478  TYR A C     1 
ATOM   3605  O  O     . TYR A 1  478  ? 10.713  -48.284  45.127  1.00 50.99  ? 478  TYR A O     1 
ATOM   3606  C  CB    . TYR A 1  478  ? 9.760   -50.577  43.199  1.00 49.15  ? 478  TYR A CB    1 
ATOM   3607  C  CG    . TYR A 1  478  ? 10.266  -51.521  42.128  1.00 50.77  ? 478  TYR A CG    1 
ATOM   3608  C  CD1   . TYR A 1  478  ? 9.429   -52.477  41.562  1.00 52.50  ? 478  TYR A CD1   1 
ATOM   3609  C  CD2   . TYR A 1  478  ? 11.573  -51.432  41.650  1.00 52.01  ? 478  TYR A CD2   1 
ATOM   3610  C  CE1   . TYR A 1  478  ? 9.888   -53.345  40.571  1.00 53.77  ? 478  TYR A CE1   1 
ATOM   3611  C  CE2   . TYR A 1  478  ? 12.041  -52.289  40.655  1.00 53.36  ? 478  TYR A CE2   1 
ATOM   3612  C  CZ    . TYR A 1  478  ? 11.194  -53.242  40.114  1.00 59.54  ? 478  TYR A CZ    1 
ATOM   3613  O  OH    . TYR A 1  478  ? 11.650  -54.079  39.125  1.00 58.57  ? 478  TYR A OH    1 
ATOM   3614  N  N     . ASN A 1  479  ? 9.260   -49.576  46.345  1.00 48.32  ? 479  ASN A N     1 
ATOM   3615  C  CA    . ASN A 1  479  ? 8.685   -48.567  47.249  1.00 48.02  ? 479  ASN A CA    1 
ATOM   3616  C  C     . ASN A 1  479  ? 7.895   -47.532  46.442  1.00 51.87  ? 479  ASN A C     1 
ATOM   3617  O  O     . ASN A 1  479  ? 7.993   -46.316  46.655  1.00 51.19  ? 479  ASN A O     1 
ATOM   3618  C  CB    . ASN A 1  479  ? 9.732   -47.938  48.200  1.00 50.44  ? 479  ASN A CB    1 
ATOM   3619  C  CG    . ASN A 1  479  ? 9.172   -47.042  49.291  1.00 71.96  ? 479  ASN A CG    1 
ATOM   3620  O  OD1   . ASN A 1  479  ? 7.970   -47.032  49.600  1.00 63.39  ? 479  ASN A OD1   1 
ATOM   3621  N  ND2   . ASN A 1  479  ? 10.043  -46.249  49.889  1.00 66.53  ? 479  ASN A ND2   1 
ATOM   3622  N  N     . ALA A 1  480  ? 7.101   -48.049  45.500  1.00 48.31  ? 480  ALA A N     1 
ATOM   3623  C  CA    . ALA A 1  480  ? 6.277   -47.245  44.621  1.00 47.40  ? 480  ALA A CA    1 
ATOM   3624  C  C     . ALA A 1  480  ? 4.820   -47.226  45.069  1.00 52.51  ? 480  ALA A C     1 
ATOM   3625  O  O     . ALA A 1  480  ? 4.404   -48.008  45.928  1.00 52.24  ? 480  ALA A O     1 
ATOM   3626  C  CB    . ALA A 1  480  ? 6.386   -47.770  43.203  1.00 48.05  ? 480  ALA A CB    1 
ATOM   3627  N  N     . ASP A 1  481  ? 4.078   -46.260  44.524  1.00 50.27  ? 481  ASP A N     1 
ATOM   3628  C  CA    . ASP A 1  481  ? 2.642   -46.028  44.648  1.00 50.22  ? 481  ASP A CA    1 
ATOM   3629  C  C     . ASP A 1  481  ? 2.209   -45.269  43.402  1.00 53.72  ? 481  ASP A C     1 
ATOM   3630  O  O     . ASP A 1  481  ? 3.024   -44.600  42.759  1.00 52.80  ? 481  ASP A O     1 
ATOM   3631  C  CB    . ASP A 1  481  ? 2.211   -45.375  45.984  1.00 52.22  ? 481  ASP A CB    1 
ATOM   3632  C  CG    . ASP A 1  481  ? 2.683   -43.962  46.282  1.00 66.55  ? 481  ASP A CG    1 
ATOM   3633  O  OD1   . ASP A 1  481  ? 3.757   -43.565  45.765  1.00 68.07  ? 481  ASP A OD1   1 
ATOM   3634  O  OD2   . ASP A 1  481  ? 2.031   -43.285  47.109  1.00 73.60  ? 481  ASP A OD2   1 
ATOM   3635  N  N     . PHE A 1  482  ? 0.965   -45.457  42.998  1.00 50.48  ? 482  PHE A N     1 
ATOM   3636  C  CA    . PHE A 1  482  ? 0.463   -44.896  41.753  1.00 50.14  ? 482  PHE A CA    1 
ATOM   3637  C  C     . PHE A 1  482  ? -0.184  -43.488  41.881  1.00 53.03  ? 482  PHE A C     1 
ATOM   3638  O  O     . PHE A 1  482  ? -1.248  -43.231  41.315  1.00 52.96  ? 482  PHE A O     1 
ATOM   3639  C  CB    . PHE A 1  482  ? -0.400  -45.963  41.030  1.00 52.09  ? 482  PHE A CB    1 
ATOM   3640  C  CG    . PHE A 1  482  ? 0.153   -47.375  41.147  1.00 53.73  ? 482  PHE A CG    1 
ATOM   3641  C  CD1   . PHE A 1  482  ? -0.472  -48.320  41.948  1.00 56.72  ? 482  PHE A CD1   1 
ATOM   3642  C  CD2   . PHE A 1  482  ? 1.322   -47.743  40.488  1.00 56.05  ? 482  PHE A CD2   1 
ATOM   3643  C  CE1   . PHE A 1  482  ? 0.058   -49.611  42.083  1.00 57.96  ? 482  PHE A CE1   1 
ATOM   3644  C  CE2   . PHE A 1  482  ? 1.843   -49.037  40.610  1.00 58.99  ? 482  PHE A CE2   1 
ATOM   3645  C  CZ    . PHE A 1  482  ? 1.209   -49.961  41.409  1.00 57.19  ? 482  PHE A CZ    1 
ATOM   3646  N  N     . ASP A 1  483  ? 0.495   -42.569  42.604  1.00 48.47  ? 483  ASP A N     1 
ATOM   3647  C  CA    . ASP A 1  483  ? 0.032   -41.192  42.808  1.00 47.70  ? 483  ASP A CA    1 
ATOM   3648  C  C     . ASP A 1  483  ? 0.818   -40.143  42.013  1.00 49.52  ? 483  ASP A C     1 
ATOM   3649  O  O     . ASP A 1  483  ? 0.822   -38.968  42.386  1.00 48.00  ? 483  ASP A O     1 
ATOM   3650  C  CB    . ASP A 1  483  ? -0.042  -40.835  44.310  1.00 49.82  ? 483  ASP A CB    1 
ATOM   3651  C  CG    . ASP A 1  483  ? 1.264   -40.623  45.069  1.00 62.65  ? 483  ASP A CG    1 
ATOM   3652  O  OD1   . ASP A 1  483  ? 1.205   -40.444  46.308  1.00 64.05  ? 483  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP A 1  483  ? 2.341   -40.607  44.424  1.00 67.89  ? 483  ASP A OD2   1 
ATOM   3654  N  N     . GLY A 1  484  ? 1.489   -40.584  40.949  1.00 46.17  ? 484  GLY A N     1 
ATOM   3655  C  CA    . GLY A 1  484  ? 2.285   -39.715  40.092  1.00 46.17  ? 484  GLY A CA    1 
ATOM   3656  C  C     . GLY A 1  484  ? 3.731   -40.119  39.883  1.00 50.45  ? 484  GLY A C     1 
ATOM   3657  O  O     . GLY A 1  484  ? 4.452   -39.438  39.145  1.00 51.05  ? 484  GLY A O     1 
ATOM   3658  N  N     . ASP A 1  485  ? 4.165   -41.225  40.527  1.00 46.34  ? 485  ASP A N     1 
ATOM   3659  C  CA    . ASP A 1  485  ? 5.530   -41.774  40.451  1.00 45.75  ? 485  ASP A CA    1 
ATOM   3660  C  C     . ASP A 1  485  ? 5.865   -42.160  39.021  1.00 46.83  ? 485  ASP A C     1 
ATOM   3661  O  O     . ASP A 1  485  ? 4.965   -42.513  38.262  1.00 45.20  ? 485  ASP A O     1 
ATOM   3662  C  CB    . ASP A 1  485  ? 5.668   -43.036  41.336  1.00 47.96  ? 485  ASP A CB    1 
ATOM   3663  C  CG    . ASP A 1  485  ? 5.532   -42.865  42.842  1.00 60.92  ? 485  ASP A CG    1 
ATOM   3664  O  OD1   . ASP A 1  485  ? 4.695   -42.037  43.279  1.00 61.85  ? 485  ASP A OD1   1 
ATOM   3665  O  OD2   . ASP A 1  485  ? 6.167   -43.644  43.583  1.00 67.21  ? 485  ASP A OD2   1 
ATOM   3666  N  N     . GLU A 1  486  ? 7.159   -42.100  38.667  1.00 43.20  ? 486  GLU A N     1 
ATOM   3667  C  CA    . GLU A 1  486  ? 7.688   -42.480  37.351  1.00 43.14  ? 486  GLU A CA    1 
ATOM   3668  C  C     . GLU A 1  486  ? 8.790   -43.523  37.531  1.00 46.37  ? 486  GLU A C     1 
ATOM   3669  O  O     . GLU A 1  486  ? 9.472   -43.522  38.558  1.00 45.64  ? 486  GLU A O     1 
ATOM   3670  C  CB    . GLU A 1  486  ? 8.252   -41.270  36.595  1.00 44.83  ? 486  GLU A CB    1 
ATOM   3671  C  CG    . GLU A 1  486  ? 7.226   -40.239  36.180  1.00 56.87  ? 486  GLU A CG    1 
ATOM   3672  C  CD    . GLU A 1  486  ? 7.864   -39.080  35.445  1.00 86.99  ? 486  GLU A CD    1 
ATOM   3673  O  OE1   . GLU A 1  486  ? 8.295   -38.114  36.115  1.00 78.11  ? 486  GLU A OE1   1 
ATOM   3674  O  OE2   . GLU A 1  486  ? 7.988   -39.168  34.202  1.00 87.73  ? 486  GLU A OE2   1 
ATOM   3675  N  N     . MET A 1  487  ? 8.974   -44.403  36.538  1.00 43.04  ? 487  MET A N     1 
ATOM   3676  C  CA    . MET A 1  487  ? 10.002  -45.443  36.603  1.00 43.25  ? 487  MET A CA    1 
ATOM   3677  C  C     . MET A 1  487  ? 10.789  -45.602  35.316  1.00 49.14  ? 487  MET A C     1 
ATOM   3678  O  O     . MET A 1  487  ? 10.235  -45.435  34.228  1.00 48.86  ? 487  MET A O     1 
ATOM   3679  C  CB    . MET A 1  487  ? 9.403   -46.781  37.031  1.00 45.07  ? 487  MET A CB    1 
ATOM   3680  C  CG    . MET A 1  487  ? 9.131   -46.854  38.507  1.00 47.50  ? 487  MET A CG    1 
ATOM   3681  S  SD    . MET A 1  487  ? 9.117   -48.547  39.095  1.00 51.12  ? 487  MET A SD    1 
ATOM   3682  C  CE    . MET A 1  487  ? 7.547   -48.586  39.774  1.00 46.96  ? 487  MET A CE    1 
ATOM   3683  N  N     . ASN A 1  488  ? 12.082  -45.930  35.445  1.00 47.35  ? 488  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  488  ? 12.985  -46.123  34.312  1.00 48.63  ? 488  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  488  ? 13.006  -47.578  33.855  1.00 53.19  ? 488  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  488  ? 12.803  -48.501  34.655  1.00 52.53  ? 488  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  488  ? 14.412  -45.666  34.653  1.00 53.19  ? 488  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  488  ? 14.567  -44.223  35.085  1.00 88.19  ? 488  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  488  ? 13.619  -43.423  35.088  1.00 84.13  ? 488  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  488  ? 15.787  -43.862  35.470  1.00 82.28  ? 488  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  489  ? 13.264  -47.771  32.558  1.00 50.33  ? 489  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  489  ? 13.367  -49.074  31.920  1.00 50.59  ? 489  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  489  ? 14.633  -49.087  31.063  1.00 55.83  ? 489  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  489  ? 14.837  -48.185  30.250  1.00 55.66  ? 489  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  489  ? 12.119  -49.370  31.071  1.00 50.10  ? 489  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  489  ? 11.979  -50.810  30.596  1.00 55.12  ? 489  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  489  ? 10.690  -51.412  31.076  1.00 54.97  ? 489  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  489  ? 12.096  -50.904  29.101  1.00 56.99  ? 489  LEU A CD2   1 
ATOM   3699  N  N     . HIS A 1  490  ? 15.495  -50.088  31.274  1.00 53.23  ? 490  HIS A N     1 
ATOM   3700  C  CA    . HIS A 1  490  ? 16.746  -50.252  30.537  1.00 54.10  ? 490  HIS A CA    1 
ATOM   3701  C  C     . HIS A 1  490  ? 16.667  -51.528  29.732  1.00 57.62  ? 490  HIS A C     1 
ATOM   3702  O  O     . HIS A 1  490  ? 16.114  -52.523  30.204  1.00 56.43  ? 490  HIS A O     1 
ATOM   3703  C  CB    . HIS A 1  490  ? 17.951  -50.241  31.484  1.00 55.74  ? 490  HIS A CB    1 
ATOM   3704  C  CG    . HIS A 1  490  ? 18.042  -48.974  32.279  1.00 59.05  ? 490  HIS A CG    1 
ATOM   3705  N  ND1   . HIS A 1  490  ? 18.827  -47.915  31.860  1.00 61.63  ? 490  HIS A ND1   1 
ATOM   3706  C  CD2   . HIS A 1  490  ? 17.397  -48.618  33.418  1.00 60.09  ? 490  HIS A CD2   1 
ATOM   3707  C  CE1   . HIS A 1  490  ? 18.656  -46.962  32.765  1.00 60.50  ? 490  HIS A CE1   1 
ATOM   3708  N  NE2   . HIS A 1  490  ? 17.804  -47.338  33.722  1.00 59.86  ? 490  HIS A NE2   1 
ATOM   3709  N  N     . VAL A 1  491  ? 17.152  -51.480  28.486  1.00 55.18  ? 491  VAL A N     1 
ATOM   3710  C  CA    . VAL A 1  491  ? 17.081  -52.619  27.572  1.00 55.35  ? 491  VAL A CA    1 
ATOM   3711  C  C     . VAL A 1  491  ? 18.452  -53.271  27.286  1.00 62.20  ? 491  VAL A C     1 
ATOM   3712  O  O     . VAL A 1  491  ? 19.351  -52.609  26.756  1.00 62.60  ? 491  VAL A O     1 
ATOM   3713  C  CB    . VAL A 1  491  ? 16.303  -52.284  26.274  1.00 57.80  ? 491  VAL A CB    1 
ATOM   3714  C  CG1   . VAL A 1  491  ? 16.186  -53.510  25.387  1.00 58.24  ? 491  VAL A CG1   1 
ATOM   3715  C  CG2   . VAL A 1  491  ? 14.922  -51.720  26.580  1.00 55.96  ? 491  VAL A CG2   1 
ATOM   3716  N  N     . PRO A 1  492  ? 18.604  -54.585  27.579  1.00 60.21  ? 492  PRO A N     1 
ATOM   3717  C  CA    . PRO A 1  492  ? 19.867  -55.274  27.250  1.00 61.81  ? 492  PRO A CA    1 
ATOM   3718  C  C     . PRO A 1  492  ? 20.058  -55.370  25.734  1.00 65.82  ? 492  PRO A C     1 
ATOM   3719  O  O     . PRO A 1  492  ? 19.087  -55.558  24.996  1.00 64.92  ? 492  PRO A O     1 
ATOM   3720  C  CB    . PRO A 1  492  ? 19.684  -56.661  27.876  1.00 64.08  ? 492  PRO A CB    1 
ATOM   3721  C  CG    . PRO A 1  492  ? 18.212  -56.867  27.905  1.00 67.52  ? 492  PRO A CG    1 
ATOM   3722  C  CD    . PRO A 1  492  ? 17.629  -55.512  28.187  1.00 61.54  ? 492  PRO A CD    1 
ATOM   3723  N  N     . GLN A 1  493  ? 21.298  -55.225  25.272  1.00 62.96  ? 493  GLN A N     1 
ATOM   3724  C  CA    . GLN A 1  493  ? 21.593  -55.247  23.843  1.00 63.61  ? 493  GLN A CA    1 
ATOM   3725  C  C     . GLN A 1  493  ? 22.336  -56.493  23.378  1.00 69.66  ? 493  GLN A C     1 
ATOM   3726  O  O     . GLN A 1  493  ? 22.340  -56.784  22.182  1.00 69.31  ? 493  GLN A O     1 
ATOM   3727  C  CB    . GLN A 1  493  ? 22.324  -53.959  23.435  1.00 65.25  ? 493  GLN A CB    1 
ATOM   3728  C  CG    . GLN A 1  493  ? 21.562  -52.678  23.795  1.00 69.09  ? 493  GLN A CG    1 
ATOM   3729  C  CD    . GLN A 1  493  ? 20.252  -52.581  23.055  1.00 79.91  ? 493  GLN A CD    1 
ATOM   3730  O  OE1   . GLN A 1  493  ? 20.215  -52.508  21.819  1.00 75.89  ? 493  GLN A OE1   1 
ATOM   3731  N  NE2   . GLN A 1  493  ? 19.149  -52.604  23.795  1.00 62.96  ? 493  GLN A NE2   1 
ATOM   3732  N  N     . SER A 1  494  ? 22.953  -57.228  24.324  1.00 68.67  ? 494  SER A N     1 
ATOM   3733  C  CA    . SER A 1  494  ? 23.716  -58.459  24.082  1.00 70.71  ? 494  SER A CA    1 
ATOM   3734  C  C     . SER A 1  494  ? 22.977  -59.687  24.630  1.00 74.27  ? 494  SER A C     1 
ATOM   3735  O  O     . SER A 1  494  ? 22.189  -59.556  25.568  1.00 72.42  ? 494  SER A O     1 
ATOM   3736  C  CB    . SER A 1  494  ? 25.108  -58.351  24.707  1.00 76.07  ? 494  SER A CB    1 
ATOM   3737  O  OG    . SER A 1  494  ? 25.894  -59.514  24.502  1.00 88.24  ? 494  SER A OG    1 
ATOM   3738  N  N     . GLU A 1  495  ? 23.241  -60.876  24.046  1.00 72.35  ? 495  GLU A N     1 
ATOM   3739  C  CA    . GLU A 1  495  ? 22.635  -62.142  24.476  1.00 72.34  ? 495  GLU A CA    1 
ATOM   3740  C  C     . GLU A 1  495  ? 23.046  -62.502  25.907  1.00 76.25  ? 495  GLU A C     1 
ATOM   3741  O  O     . GLU A 1  495  ? 22.208  -62.951  26.693  1.00 75.00  ? 495  GLU A O     1 
ATOM   3742  C  CB    . GLU A 1  495  ? 22.974  -63.293  23.507  1.00 75.22  ? 495  GLU A CB    1 
ATOM   3743  C  CG    . GLU A 1  495  ? 21.913  -63.560  22.445  1.00 84.11  ? 495  GLU A CG    1 
ATOM   3744  C  CD    . GLU A 1  495  ? 20.603  -64.206  22.871  1.00 103.58 ? 495  GLU A CD    1 
ATOM   3745  O  OE1   . GLU A 1  495  ? 19.710  -64.332  22.002  1.00 91.27  ? 495  GLU A OE1   1 
ATOM   3746  O  OE2   . GLU A 1  495  ? 20.464  -64.592  24.056  1.00 99.67  ? 495  GLU A OE2   1 
ATOM   3747  N  N     . GLU A 1  496  ? 24.330  -62.284  26.243  1.00 73.74  ? 496  GLU A N     1 
ATOM   3748  C  CA    . GLU A 1  496  ? 24.866  -62.563  27.575  1.00 73.86  ? 496  GLU A CA    1 
ATOM   3749  C  C     . GLU A 1  496  ? 24.365  -61.577  28.607  1.00 75.78  ? 496  GLU A C     1 
ATOM   3750  O  O     . GLU A 1  496  ? 24.272  -61.925  29.782  1.00 75.70  ? 496  GLU A O     1 
ATOM   3751  C  CB    . GLU A 1  496  ? 26.404  -62.665  27.575  1.00 77.14  ? 496  GLU A CB    1 
ATOM   3752  C  CG    . GLU A 1  496  ? 27.147  -61.469  27.000  1.00 88.82  ? 496  GLU A CG    1 
ATOM   3753  C  CD    . GLU A 1  496  ? 28.182  -61.825  25.951  1.00 114.63 ? 496  GLU A CD    1 
ATOM   3754  O  OE1   . GLU A 1  496  ? 28.137  -61.220  24.856  1.00 114.04 ? 496  GLU A OE1   1 
ATOM   3755  O  OE2   . GLU A 1  496  ? 29.034  -62.704  26.218  1.00 108.22 ? 496  GLU A OE2   1 
ATOM   3756  N  N     . THR A 1  497  ? 24.031  -60.358  28.157  1.00 70.59  ? 497  THR A N     1 
ATOM   3757  C  CA    . THR A 1  497  ? 23.513  -59.271  28.981  1.00 68.58  ? 497  THR A CA    1 
ATOM   3758  C  C     . THR A 1  497  ? 22.092  -59.591  29.446  1.00 69.62  ? 497  THR A C     1 
ATOM   3759  O  O     . THR A 1  497  ? 21.793  -59.423  30.629  1.00 67.95  ? 497  THR A O     1 
ATOM   3760  C  CB    . THR A 1  497  ? 23.639  -57.957  28.223  1.00 79.08  ? 497  THR A CB    1 
ATOM   3761  O  OG1   . THR A 1  497  ? 25.015  -57.750  27.914  1.00 83.00  ? 497  THR A OG1   1 
ATOM   3762  C  CG2   . THR A 1  497  ? 23.142  -56.790  29.012  1.00 77.08  ? 497  THR A CG2   1 
ATOM   3763  N  N     . ARG A 1  498  ? 21.228  -60.074  28.529  1.00 65.35  ? 498  ARG A N     1 
ATOM   3764  C  CA    . ARG A 1  498  ? 19.863  -60.473  28.887  1.00 63.36  ? 498  ARG A CA    1 
ATOM   3765  C  C     . ARG A 1  498  ? 19.850  -61.723  29.782  1.00 66.44  ? 498  ARG A C     1 
ATOM   3766  O  O     . ARG A 1  498  ? 18.989  -61.829  30.661  1.00 65.30  ? 498  ARG A O     1 
ATOM   3767  C  CB    . ARG A 1  498  ? 18.905  -60.573  27.680  1.00 61.36  ? 498  ARG A CB    1 
ATOM   3768  C  CG    . ARG A 1  498  ? 19.482  -61.138  26.390  1.00 66.68  ? 498  ARG A CG    1 
ATOM   3769  C  CD    . ARG A 1  498  ? 18.418  -61.745  25.491  1.00 67.90  ? 498  ARG A CD    1 
ATOM   3770  N  NE    . ARG A 1  498  ? 17.457  -60.756  24.995  1.00 63.88  ? 498  ARG A NE    1 
ATOM   3771  C  CZ    . ARG A 1  498  ? 16.221  -61.044  24.594  1.00 68.14  ? 498  ARG A CZ    1 
ATOM   3772  N  NH1   . ARG A 1  498  ? 15.769  -62.292  24.651  1.00 48.06  ? 498  ARG A NH1   1 
ATOM   3773  N  NH2   . ARG A 1  498  ? 15.419  -60.083  24.155  1.00 52.59  ? 498  ARG A NH2   1 
ATOM   3774  N  N     . ALA A 1  499  ? 20.857  -62.614  29.613  1.00 63.17  ? 499  ALA A N     1 
ATOM   3775  C  CA    . ALA A 1  499  ? 21.054  -63.819  30.429  1.00 63.29  ? 499  ALA A CA    1 
ATOM   3776  C  C     . ALA A 1  499  ? 21.326  -63.430  31.891  1.00 65.91  ? 499  ALA A C     1 
ATOM   3777  O  O     . ALA A 1  499  ? 20.850  -64.104  32.809  1.00 65.64  ? 499  ALA A O     1 
ATOM   3778  C  CB    . ALA A 1  499  ? 22.213  -64.643  29.887  1.00 65.77  ? 499  ALA A CB    1 
ATOM   3779  N  N     . GLU A 1  500  ? 22.065  -62.321  32.100  1.00 60.85  ? 500  GLU A N     1 
ATOM   3780  C  CA    . GLU A 1  500  ? 22.388  -61.801  33.426  1.00 59.63  ? 500  GLU A CA    1 
ATOM   3781  C  C     . GLU A 1  500  ? 21.132  -61.296  34.102  1.00 62.95  ? 500  GLU A C     1 
ATOM   3782  O  O     . GLU A 1  500  ? 21.022  -61.390  35.320  1.00 63.13  ? 500  GLU A O     1 
ATOM   3783  C  CB    . GLU A 1  500  ? 23.394  -60.655  33.337  1.00 60.79  ? 500  GLU A CB    1 
ATOM   3784  C  CG    . GLU A 1  500  ? 24.815  -61.080  33.037  1.00 68.37  ? 500  GLU A CG    1 
ATOM   3785  C  CD    . GLU A 1  500  ? 25.848  -60.015  33.343  1.00 82.22  ? 500  GLU A CD    1 
ATOM   3786  O  OE1   . GLU A 1  500  ? 25.494  -58.815  33.364  1.00 67.44  ? 500  GLU A OE1   1 
ATOM   3787  O  OE2   . GLU A 1  500  ? 27.017  -60.385  33.578  1.00 78.73  ? 500  GLU A OE2   1 
ATOM   3788  N  N     . LEU A 1  501  ? 20.191  -60.745  33.315  1.00 58.11  ? 501  LEU A N     1 
ATOM   3789  C  CA    . LEU A 1  501  ? 18.931  -60.233  33.834  1.00 55.92  ? 501  LEU A CA    1 
ATOM   3790  C  C     . LEU A 1  501  ? 18.003  -61.387  34.184  1.00 57.90  ? 501  LEU A C     1 
ATOM   3791  O  O     . LEU A 1  501  ? 17.461  -61.418  35.289  1.00 56.43  ? 501  LEU A O     1 
ATOM   3792  C  CB    . LEU A 1  501  ? 18.261  -59.290  32.816  1.00 55.30  ? 501  LEU A CB    1 
ATOM   3793  C  CG    . LEU A 1  501  ? 18.891  -57.909  32.587  1.00 60.11  ? 501  LEU A CG    1 
ATOM   3794  C  CD1   . LEU A 1  501  ? 18.069  -57.111  31.610  1.00 59.45  ? 501  LEU A CD1   1 
ATOM   3795  C  CD2   . LEU A 1  501  ? 18.987  -57.111  33.877  1.00 62.54  ? 501  LEU A CD2   1 
ATOM   3796  N  N     . SER A 1  502  ? 17.850  -62.353  33.259  1.00 54.29  ? 502  SER A N     1 
ATOM   3797  C  CA    . SER A 1  502  ? 16.969  -63.507  33.435  1.00 54.14  ? 502  SER A CA    1 
ATOM   3798  C  C     . SER A 1  502  ? 17.418  -64.511  34.498  1.00 59.52  ? 502  SER A C     1 
ATOM   3799  O  O     . SER A 1  502  ? 16.575  -65.069  35.210  1.00 58.83  ? 502  SER A O     1 
ATOM   3800  C  CB    . SER A 1  502  ? 16.724  -64.210  32.104  1.00 57.80  ? 502  SER A CB    1 
ATOM   3801  O  OG    . SER A 1  502  ? 17.929  -64.551  31.438  1.00 67.58  ? 502  SER A OG    1 
ATOM   3802  N  N     . GLN A 1  503  ? 18.729  -64.755  34.603  1.00 57.33  ? 503  GLN A N     1 
ATOM   3803  C  CA    . GLN A 1  503  ? 19.221  -65.750  35.551  1.00 58.26  ? 503  GLN A CA    1 
ATOM   3804  C  C     . GLN A 1  503  ? 19.633  -65.198  36.916  1.00 62.26  ? 503  GLN A C     1 
ATOM   3805  O  O     . GLN A 1  503  ? 19.762  -65.976  37.867  1.00 62.59  ? 503  GLN A O     1 
ATOM   3806  C  CB    . GLN A 1  503  ? 20.322  -66.644  34.931  1.00 61.22  ? 503  GLN A CB    1 
ATOM   3807  C  CG    . GLN A 1  503  ? 19.986  -67.280  33.575  1.00 68.79  ? 503  GLN A CG    1 
ATOM   3808  C  CD    . GLN A 1  503  ? 18.628  -67.937  33.508  1.00 86.97  ? 503  GLN A CD    1 
ATOM   3809  O  OE1   . GLN A 1  503  ? 17.672  -67.386  32.950  1.00 83.71  ? 503  GLN A OE1   1 
ATOM   3810  N  NE2   . GLN A 1  503  ? 18.513  -69.132  34.056  1.00 76.95  ? 503  GLN A NE2   1 
ATOM   3811  N  N     . LEU A 1  504  ? 19.831  -63.873  37.025  1.00 57.68  ? 504  LEU A N     1 
ATOM   3812  C  CA    . LEU A 1  504  ? 20.253  -63.276  38.291  1.00 57.06  ? 504  LEU A CA    1 
ATOM   3813  C  C     . LEU A 1  504  ? 19.302  -62.214  38.818  1.00 61.53  ? 504  LEU A C     1 
ATOM   3814  O  O     . LEU A 1  504  ? 18.964  -62.258  39.997  1.00 61.88  ? 504  LEU A O     1 
ATOM   3815  C  CB    . LEU A 1  504  ? 21.703  -62.729  38.232  1.00 57.59  ? 504  LEU A CB    1 
ATOM   3816  C  CG    . LEU A 1  504  ? 22.820  -63.635  37.660  1.00 63.58  ? 504  LEU A CG    1 
ATOM   3817  C  CD1   . LEU A 1  504  ? 24.058  -62.831  37.320  1.00 64.11  ? 504  LEU A CD1   1 
ATOM   3818  C  CD2   . LEU A 1  504  ? 23.184  -64.765  38.611  1.00 66.71  ? 504  LEU A CD2   1 
ATOM   3819  N  N     . CYS A 1  505  ? 18.856  -61.276  37.962  1.00 57.88  ? 505  CYS A N     1 
ATOM   3820  C  CA    . CYS A 1  505  ? 18.020  -60.135  38.361  1.00 56.57  ? 505  CYS A CA    1 
ATOM   3821  C  C     . CYS A 1  505  ? 16.499  -60.286  38.304  1.00 57.09  ? 505  CYS A C     1 
ATOM   3822  O  O     . CYS A 1  505  ? 15.796  -59.391  38.796  1.00 55.08  ? 505  CYS A O     1 
ATOM   3823  C  CB    . CYS A 1  505  ? 18.483  -58.867  37.654  1.00 57.48  ? 505  CYS A CB    1 
ATOM   3824  S  SG    . CYS A 1  505  ? 20.278  -58.643  37.656  1.00 63.35  ? 505  CYS A SG    1 
ATOM   3825  N  N     . ALA A 1  506  ? 15.987  -61.398  37.715  1.00 52.41  ? 506  ALA A N     1 
ATOM   3826  C  CA    . ALA A 1  506  ? 14.549  -61.666  37.568  1.00 50.29  ? 506  ALA A CA    1 
ATOM   3827  C  C     . ALA A 1  506  ? 13.758  -61.456  38.863  1.00 51.89  ? 506  ALA A C     1 
ATOM   3828  O  O     . ALA A 1  506  ? 14.294  -61.679  39.950  1.00 53.03  ? 506  ALA A O     1 
ATOM   3829  C  CB    . ALA A 1  506  ? 14.329  -63.068  37.040  1.00 51.75  ? 506  ALA A CB    1 
ATOM   3830  N  N     . VAL A 1  507  ? 12.502  -60.992  38.740  1.00 45.02  ? 507  VAL A N     1 
ATOM   3831  C  CA    . VAL A 1  507  ? 11.583  -60.730  39.856  1.00 43.34  ? 507  VAL A CA    1 
ATOM   3832  C  C     . VAL A 1  507  ? 11.339  -61.970  40.748  1.00 46.92  ? 507  VAL A C     1 
ATOM   3833  O  O     . VAL A 1  507  ? 11.440  -61.827  41.975  1.00 46.01  ? 507  VAL A O     1 
ATOM   3834  C  CB    . VAL A 1  507  ? 10.272  -60.020  39.400  1.00 46.13  ? 507  VAL A CB    1 
ATOM   3835  C  CG1   . VAL A 1  507  ? 9.229   -59.934  40.515  1.00 45.06  ? 507  VAL A CG1   1 
ATOM   3836  C  CG2   . VAL A 1  507  ? 10.568  -58.633  38.845  1.00 45.39  ? 507  VAL A CG2   1 
ATOM   3837  N  N     . PRO A 1  508  ? 11.069  -63.189  40.192  1.00 43.72  ? 508  PRO A N     1 
ATOM   3838  C  CA    . PRO A 1  508  ? 10.844  -64.353  41.070  1.00 44.05  ? 508  PRO A CA    1 
ATOM   3839  C  C     . PRO A 1  508  ? 12.031  -64.688  41.960  1.00 47.60  ? 508  PRO A C     1 
ATOM   3840  O  O     . PRO A 1  508  ? 11.848  -65.146  43.087  1.00 47.45  ? 508  PRO A O     1 
ATOM   3841  C  CB    . PRO A 1  508  ? 10.538  -65.491  40.089  1.00 46.73  ? 508  PRO A CB    1 
ATOM   3842  C  CG    . PRO A 1  508  ? 10.098  -64.816  38.847  1.00 50.38  ? 508  PRO A CG    1 
ATOM   3843  C  CD    . PRO A 1  508  ? 10.912  -63.572  38.773  1.00 45.30  ? 508  PRO A CD    1 
ATOM   3844  N  N     . LEU A 1  509  ? 13.242  -64.425  41.457  1.00 44.13  ? 509  LEU A N     1 
ATOM   3845  C  CA    . LEU A 1  509  ? 14.501  -64.672  42.146  1.00 44.75  ? 509  LEU A CA    1 
ATOM   3846  C  C     . LEU A 1  509  ? 14.675  -63.779  43.359  1.00 48.67  ? 509  LEU A C     1 
ATOM   3847  O  O     . LEU A 1  509  ? 15.267  -64.206  44.358  1.00 49.42  ? 509  LEU A O     1 
ATOM   3848  C  CB    . LEU A 1  509  ? 15.681  -64.467  41.187  1.00 45.13  ? 509  LEU A CB    1 
ATOM   3849  C  CG    . LEU A 1  509  ? 15.720  -65.339  39.947  1.00 50.11  ? 509  LEU A CG    1 
ATOM   3850  C  CD1   . LEU A 1  509  ? 16.797  -64.867  39.013  1.00 50.91  ? 509  LEU A CD1   1 
ATOM   3851  C  CD2   . LEU A 1  509  ? 15.930  -66.804  40.303  1.00 53.11  ? 509  LEU A CD2   1 
ATOM   3852  N  N     . GLN A 1  510  ? 14.174  -62.543  43.271  1.00 43.78  ? 510  GLN A N     1 
ATOM   3853  C  CA    . GLN A 1  510  ? 14.330  -61.580  44.351  1.00 43.48  ? 510  GLN A CA    1 
ATOM   3854  C  C     . GLN A 1  510  ? 13.276  -61.673  45.469  1.00 48.74  ? 510  GLN A C     1 
ATOM   3855  O  O     . GLN A 1  510  ? 13.461  -61.016  46.499  1.00 47.91  ? 510  GLN A O     1 
ATOM   3856  C  CB    . GLN A 1  510  ? 14.502  -60.149  43.808  1.00 43.76  ? 510  GLN A CB    1 
ATOM   3857  C  CG    . GLN A 1  510  ? 15.497  -60.014  42.648  1.00 58.04  ? 510  GLN A CG    1 
ATOM   3858  C  CD    . GLN A 1  510  ? 16.938  -60.170  43.066  1.00 78.86  ? 510  GLN A CD    1 
ATOM   3859  O  OE1   . GLN A 1  510  ? 17.517  -59.301  43.717  1.00 76.77  ? 510  GLN A OE1   1 
ATOM   3860  N  NE2   . GLN A 1  510  ? 17.565  -61.262  42.666  1.00 71.29  ? 510  GLN A NE2   1 
ATOM   3861  N  N     . ILE A 1  511  ? 12.214  -62.526  45.297  1.00 46.70  ? 511  ILE A N     1 
ATOM   3862  C  CA    . ILE A 1  511  ? 11.115  -62.734  46.270  1.00 46.61  ? 511  ILE A CA    1 
ATOM   3863  C  C     . ILE A 1  511  ? 11.628  -62.824  47.706  1.00 52.01  ? 511  ILE A C     1 
ATOM   3864  O  O     . ILE A 1  511  ? 11.428  -61.875  48.461  1.00 50.78  ? 511  ILE A O     1 
ATOM   3865  C  CB    . ILE A 1  511  ? 10.073  -63.848  45.894  1.00 50.11  ? 511  ILE A CB    1 
ATOM   3866  C  CG1   . ILE A 1  511  ? 9.390   -63.567  44.524  1.00 49.68  ? 511  ILE A CG1   1 
ATOM   3867  C  CG2   . ILE A 1  511  ? 9.013   -63.996  47.003  1.00 50.47  ? 511  ILE A CG2   1 
ATOM   3868  C  CD1   . ILE A 1  511  ? 8.527   -64.741  43.944  1.00 52.96  ? 511  ILE A CD1   1 
ATOM   3869  N  N     . VAL A 1  512  ? 12.325  -63.929  48.057  1.00 50.73  ? 512  VAL A N     1 
ATOM   3870  C  CA    . VAL A 1  512  ? 12.950  -64.135  49.366  1.00 51.47  ? 512  VAL A CA    1 
ATOM   3871  C  C     . VAL A 1  512  ? 14.267  -63.338  49.321  1.00 57.44  ? 512  VAL A C     1 
ATOM   3872  O  O     . VAL A 1  512  ? 15.146  -63.637  48.504  1.00 58.31  ? 512  VAL A O     1 
ATOM   3873  C  CB    . VAL A 1  512  ? 13.115  -65.647  49.688  1.00 56.48  ? 512  VAL A CB    1 
ATOM   3874  C  CG1   . VAL A 1  512  ? 14.171  -65.893  50.757  1.00 57.26  ? 512  VAL A CG1   1 
ATOM   3875  C  CG2   . VAL A 1  512  ? 11.782  -66.259  50.109  1.00 56.06  ? 512  VAL A CG2   1 
ATOM   3876  N  N     . SER A 1  513  ? 14.353  -62.267  50.131  1.00 54.01  ? 513  SER A N     1 
ATOM   3877  C  CA    . SER A 1  513  ? 15.497  -61.362  50.117  1.00 54.23  ? 513  SER A CA    1 
ATOM   3878  C  C     . SER A 1  513  ? 16.504  -61.537  51.257  1.00 58.85  ? 513  SER A C     1 
ATOM   3879  O  O     . SER A 1  513  ? 16.098  -61.636  52.420  1.00 57.91  ? 513  SER A O     1 
ATOM   3880  C  CB    . SER A 1  513  ? 15.037  -59.911  50.022  1.00 57.49  ? 513  SER A CB    1 
ATOM   3881  O  OG    . SER A 1  513  ? 16.144  -59.023  50.022  1.00 68.34  ? 513  SER A OG    1 
ATOM   3882  N  N     . PRO A 1  514  ? 17.827  -61.474  50.921  1.00 56.43  ? 514  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1  514  ? 18.876  -61.624  51.942  1.00 57.04  ? 514  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1  514  ? 18.998  -60.498  52.973  1.00 59.94  ? 514  PRO A C     1 
ATOM   3885  O  O     . PRO A 1  514  ? 19.735  -60.661  53.944  1.00 59.87  ? 514  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1  514  ? 20.153  -61.735  51.100  1.00 59.71  ? 514  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1  514  ? 19.855  -60.980  49.879  1.00 63.30  ? 514  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1  514  ? 18.435  -61.351  49.578  1.00 58.23  ? 514  PRO A CD    1 
ATOM   3889  N  N     . GLN A 1  515  ? 18.305  -59.367  52.775  1.00 55.80  ? 515  GLN A N     1 
ATOM   3890  C  CA    . GLN A 1  515  ? 18.378  -58.243  53.709  1.00 55.68  ? 515  GLN A CA    1 
ATOM   3891  C  C     . GLN A 1  515  ? 17.853  -58.630  55.097  1.00 61.35  ? 515  GLN A C     1 
ATOM   3892  O  O     . GLN A 1  515  ? 18.547  -58.421  56.094  1.00 61.65  ? 515  GLN A O     1 
ATOM   3893  C  CB    . GLN A 1  515  ? 17.637  -57.015  53.147  1.00 55.71  ? 515  GLN A CB    1 
ATOM   3894  C  CG    . GLN A 1  515  ? 17.624  -55.802  54.075  1.00 71.54  ? 515  GLN A CG    1 
ATOM   3895  C  CD    . GLN A 1  515  ? 16.954  -54.615  53.434  1.00 93.86  ? 515  GLN A CD    1 
ATOM   3896  O  OE1   . GLN A 1  515  ? 17.432  -54.059  52.438  1.00 88.11  ? 515  GLN A OE1   1 
ATOM   3897  N  NE2   . GLN A 1  515  ? 15.847  -54.176  54.016  1.00 88.73  ? 515  GLN A NE2   1 
ATOM   3898  N  N     . SER A 1  516  ? 16.648  -59.222  55.149  1.00 58.21  ? 516  SER A N     1 
ATOM   3899  C  CA    . SER A 1  516  ? 16.012  -59.608  56.403  1.00 58.16  ? 516  SER A CA    1 
ATOM   3900  C  C     . SER A 1  516  ? 15.664  -61.103  56.447  1.00 63.25  ? 516  SER A C     1 
ATOM   3901  O  O     . SER A 1  516  ? 14.857  -61.518  57.286  1.00 63.66  ? 516  SER A O     1 
ATOM   3902  C  CB    . SER A 1  516  ? 14.777  -58.744  56.643  1.00 60.50  ? 516  SER A CB    1 
ATOM   3903  O  OG    . SER A 1  516  ? 15.062  -57.361  56.494  1.00 69.34  ? 516  SER A OG    1 
ATOM   3904  N  N     . ASN A 1  517  ? 16.305  -61.915  55.565  1.00 59.63  ? 517  ASN A N     1 
ATOM   3905  C  CA    . ASN A 1  517  ? 16.118  -63.369  55.398  1.00 59.78  ? 517  ASN A CA    1 
ATOM   3906  C  C     . ASN A 1  517  ? 14.645  -63.819  55.391  1.00 62.68  ? 517  ASN A C     1 
ATOM   3907  O  O     . ASN A 1  517  ? 14.289  -64.895  55.880  1.00 63.30  ? 517  ASN A O     1 
ATOM   3908  C  CB    . ASN A 1  517  ? 17.008  -64.185  56.340  1.00 59.59  ? 517  ASN A CB    1 
ATOM   3909  C  CG    . ASN A 1  517  ? 16.721  -64.006  57.795  1.00 72.21  ? 517  ASN A CG    1 
ATOM   3910  O  OD1   . ASN A 1  517  ? 15.902  -64.716  58.377  1.00 68.60  ? 517  ASN A OD1   1 
ATOM   3911  N  ND2   . ASN A 1  517  ? 17.402  -63.061  58.412  1.00 60.42  ? 517  ASN A ND2   1 
ATOM   3912  N  N     . LYS A 1  518  ? 13.802  -62.964  54.805  1.00 57.44  ? 518  LYS A N     1 
ATOM   3913  C  CA    . LYS A 1  518  ? 12.359  -63.113  54.668  1.00 56.31  ? 518  LYS A CA    1 
ATOM   3914  C  C     . LYS A 1  518  ? 11.954  -62.593  53.268  1.00 59.70  ? 518  LYS A C     1 
ATOM   3915  O  O     . LYS A 1  518  ? 12.730  -61.850  52.649  1.00 58.59  ? 518  LYS A O     1 
ATOM   3916  C  CB    . LYS A 1  518  ? 11.632  -62.313  55.787  1.00 57.43  ? 518  LYS A CB    1 
ATOM   3917  C  CG    . LYS A 1  518  ? 11.787  -60.784  55.685  1.00 62.65  ? 518  LYS A CG    1 
ATOM   3918  C  CD    . LYS A 1  518  ? 10.637  -59.992  56.314  1.00 65.27  ? 518  LYS A CD    1 
ATOM   3919  C  CE    . LYS A 1  518  ? 10.031  -58.927  55.413  1.00 73.20  ? 518  LYS A CE    1 
ATOM   3920  N  NZ    . LYS A 1  518  ? 11.030  -58.047  54.737  1.00 85.78  ? 518  LYS A NZ    1 
ATOM   3921  N  N     . PRO A 1  519  ? 10.747  -62.930  52.757  1.00 56.58  ? 519  PRO A N     1 
ATOM   3922  C  CA    . PRO A 1  519  ? 10.345  -62.392  51.450  1.00 55.69  ? 519  PRO A CA    1 
ATOM   3923  C  C     . PRO A 1  519  ? 10.127  -60.880  51.487  1.00 58.41  ? 519  PRO A C     1 
ATOM   3924  O  O     . PRO A 1  519  ? 9.599   -60.360  52.470  1.00 57.33  ? 519  PRO A O     1 
ATOM   3925  C  CB    . PRO A 1  519  ? 9.053   -63.143  51.138  1.00 57.64  ? 519  PRO A CB    1 
ATOM   3926  C  CG    . PRO A 1  519  ? 8.511   -63.537  52.468  1.00 62.59  ? 519  PRO A CG    1 
ATOM   3927  C  CD    . PRO A 1  519  ? 9.699   -63.806  53.326  1.00 58.82  ? 519  PRO A CD    1 
ATOM   3928  N  N     . CYS A 1  520  ? 10.551  -60.179  50.423  1.00 54.79  ? 520  CYS A N     1 
ATOM   3929  C  CA    . CYS A 1  520  ? 10.406  -58.728  50.304  1.00 53.53  ? 520  CYS A CA    1 
ATOM   3930  C  C     . CYS A 1  520  ? 9.151   -58.296  49.502  1.00 56.49  ? 520  CYS A C     1 
ATOM   3931  O  O     . CYS A 1  520  ? 9.022   -57.121  49.135  1.00 55.20  ? 520  CYS A O     1 
ATOM   3932  C  CB    . CYS A 1  520  ? 11.684  -58.105  49.749  1.00 53.87  ? 520  CYS A CB    1 
ATOM   3933  S  SG    . CYS A 1  520  ? 11.977  -58.447  47.999  1.00 58.03  ? 520  CYS A SG    1 
ATOM   3934  N  N     . MET A 1  521  ? 8.225   -59.250  49.258  1.00 53.05  ? 521  MET A N     1 
ATOM   3935  C  CA    . MET A 1  521  ? 6.964   -59.061  48.527  1.00 51.81  ? 521  MET A CA    1 
ATOM   3936  C  C     . MET A 1  521  ? 5.814   -59.807  49.210  1.00 55.45  ? 521  MET A C     1 
ATOM   3937  O  O     . MET A 1  521  ? 6.051   -60.821  49.873  1.00 56.59  ? 521  MET A O     1 
ATOM   3938  C  CB    . MET A 1  521  ? 7.114   -59.539  47.080  1.00 54.23  ? 521  MET A CB    1 
ATOM   3939  C  CG    . MET A 1  521  ? 7.872   -58.574  46.225  1.00 57.35  ? 521  MET A CG    1 
ATOM   3940  S  SD    . MET A 1  521  ? 8.279   -59.272  44.628  1.00 62.15  ? 521  MET A SD    1 
ATOM   3941  C  CE    . MET A 1  521  ? 9.921   -59.716  44.911  1.00 59.70  ? 521  MET A CE    1 
ATOM   3942  N  N     . GLY A 1  522  ? 4.590   -59.313  49.035  1.00 49.73  ? 522  GLY A N     1 
ATOM   3943  C  CA    . GLY A 1  522  ? 3.412   -59.931  49.632  1.00 48.94  ? 522  GLY A CA    1 
ATOM   3944  C  C     . GLY A 1  522  ? 2.104   -59.361  49.143  1.00 50.70  ? 522  GLY A C     1 
ATOM   3945  O  O     . GLY A 1  522  ? 2.090   -58.363  48.418  1.00 49.66  ? 522  GLY A O     1 
ATOM   3946  N  N     . ILE A 1  523  ? 0.993   -59.996  49.555  1.00 46.79  ? 523  ILE A N     1 
ATOM   3947  C  CA    . ILE A 1  523  ? -0.370  -59.606  49.176  1.00 45.95  ? 523  ILE A CA    1 
ATOM   3948  C  C     . ILE A 1  523  ? -0.783  -58.308  49.890  1.00 50.14  ? 523  ILE A C     1 
ATOM   3949  O  O     . ILE A 1  523  ? -0.751  -58.245  51.121  1.00 49.44  ? 523  ILE A O     1 
ATOM   3950  C  CB    . ILE A 1  523  ? -1.354  -60.816  49.312  1.00 49.13  ? 523  ILE A CB    1 
ATOM   3951  C  CG1   . ILE A 1  523  ? -1.319  -61.709  48.049  1.00 49.27  ? 523  ILE A CG1   1 
ATOM   3952  C  CG2   . ILE A 1  523  ? -2.786  -60.391  49.586  1.00 49.39  ? 523  ILE A CG2   1 
ATOM   3953  C  CD1   . ILE A 1  523  ? -0.194  -62.685  47.935  1.00 52.68  ? 523  ILE A CD1   1 
ATOM   3954  N  N     . VAL A 1  524  ? -1.094  -57.252  49.104  1.00 47.25  ? 524  VAL A N     1 
ATOM   3955  C  CA    . VAL A 1  524  ? -1.421  -55.912  49.633  1.00 46.83  ? 524  VAL A CA    1 
ATOM   3956  C  C     . VAL A 1  524  ? -2.825  -55.373  49.284  1.00 51.34  ? 524  VAL A C     1 
ATOM   3957  O  O     . VAL A 1  524  ? -3.550  -55.981  48.489  1.00 52.86  ? 524  VAL A O     1 
ATOM   3958  C  CB    . VAL A 1  524  ? -0.307  -54.860  49.316  1.00 50.09  ? 524  VAL A CB    1 
ATOM   3959  C  CG1   . VAL A 1  524  ? 1.054   -55.310  49.831  1.00 50.58  ? 524  VAL A CG1   1 
ATOM   3960  C  CG2   . VAL A 1  524  ? -0.235  -54.526  47.827  1.00 49.51  ? 524  VAL A CG2   1 
ATOM   3961  N  N     . GLN A 1  525  ? -3.175  -54.208  49.870  1.00 45.81  ? 525  GLN A N     1 
ATOM   3962  C  CA    . GLN A 1  525  ? -4.407  -53.438  49.651  1.00 44.82  ? 525  GLN A CA    1 
ATOM   3963  C  C     . GLN A 1  525  ? -5.704  -54.259  49.505  1.00 48.43  ? 525  GLN A C     1 
ATOM   3964  O  O     . GLN A 1  525  ? -6.051  -54.987  50.438  1.00 47.78  ? 525  GLN A O     1 
ATOM   3965  C  CB    . GLN A 1  525  ? -4.222  -52.399  48.522  1.00 45.17  ? 525  GLN A CB    1 
ATOM   3966  C  CG    . GLN A 1  525  ? -3.153  -51.339  48.811  1.00 53.24  ? 525  GLN A CG    1 
ATOM   3967  C  CD    . GLN A 1  525  ? -3.631  -49.905  48.741  1.00 73.59  ? 525  GLN A CD    1 
ATOM   3968  O  OE1   . GLN A 1  525  ? -3.006  -49.005  49.304  1.00 70.21  ? 525  GLN A OE1   1 
ATOM   3969  N  NE2   . GLN A 1  525  ? -4.716  -49.633  48.023  1.00 68.78  ? 525  GLN A NE2   1 
ATOM   3970  N  N     . ASP A 1  526  ? -6.415  -54.131  48.352  1.00 45.43  ? 526  ASP A N     1 
ATOM   3971  C  CA    . ASP A 1  526  ? -7.668  -54.838  48.050  1.00 46.49  ? 526  ASP A CA    1 
ATOM   3972  C  C     . ASP A 1  526  ? -7.503  -56.329  48.300  1.00 51.88  ? 526  ASP A C     1 
ATOM   3973  O  O     . ASP A 1  526  ? -8.278  -56.914  49.056  1.00 52.12  ? 526  ASP A O     1 
ATOM   3974  C  CB    . ASP A 1  526  ? -8.111  -54.615  46.580  1.00 48.36  ? 526  ASP A CB    1 
ATOM   3975  C  CG    . ASP A 1  526  ? -8.663  -53.244  46.232  1.00 59.77  ? 526  ASP A CG    1 
ATOM   3976  O  OD1   . ASP A 1  526  ? -8.352  -52.272  46.961  1.00 58.95  ? 526  ASP A OD1   1 
ATOM   3977  O  OD2   . ASP A 1  526  ? -9.360  -53.130  45.190  1.00 68.43  ? 526  ASP A OD2   1 
ATOM   3978  N  N     . THR A 1  527  ? -6.456  -56.922  47.704  1.00 48.66  ? 527  THR A N     1 
ATOM   3979  C  CA    . THR A 1  527  ? -6.142  -58.339  47.820  1.00 49.31  ? 527  THR A CA    1 
ATOM   3980  C  C     . THR A 1  527  ? -5.913  -58.788  49.250  1.00 53.71  ? 527  THR A C     1 
ATOM   3981  O  O     . THR A 1  527  ? -6.304  -59.899  49.590  1.00 54.28  ? 527  THR A O     1 
ATOM   3982  C  CB    . THR A 1  527  ? -5.030  -58.750  46.871  1.00 58.80  ? 527  THR A CB    1 
ATOM   3983  O  OG1   . THR A 1  527  ? -4.678  -57.660  46.006  1.00 59.45  ? 527  THR A OG1   1 
ATOM   3984  C  CG2   . THR A 1  527  ? -5.414  -59.963  46.064  1.00 57.72  ? 527  THR A CG2   1 
ATOM   3985  N  N     . LEU A 1  528  ? -5.299  -57.933  50.093  1.00 49.90  ? 528  LEU A N     1 
ATOM   3986  C  CA    . LEU A 1  528  ? -5.085  -58.257  51.503  1.00 50.15  ? 528  LEU A CA    1 
ATOM   3987  C  C     . LEU A 1  528  ? -6.409  -58.139  52.271  1.00 55.60  ? 528  LEU A C     1 
ATOM   3988  O  O     . LEU A 1  528  ? -6.819  -59.086  52.944  1.00 55.71  ? 528  LEU A O     1 
ATOM   3989  C  CB    . LEU A 1  528  ? -3.969  -57.388  52.117  1.00 49.15  ? 528  LEU A CB    1 
ATOM   3990  C  CG    . LEU A 1  528  ? -3.539  -57.685  53.570  1.00 53.83  ? 528  LEU A CG    1 
ATOM   3991  C  CD1   . LEU A 1  528  ? -3.229  -59.147  53.791  1.00 54.68  ? 528  LEU A CD1   1 
ATOM   3992  C  CD2   . LEU A 1  528  ? -2.305  -56.918  53.921  1.00 56.79  ? 528  LEU A CD2   1 
ATOM   3993  N  N     . CYS A 1  529  ? -7.094  -56.993  52.117  1.00 52.33  ? 529  CYS A N     1 
ATOM   3994  C  CA    . CYS A 1  529  ? -8.391  -56.704  52.725  1.00 52.21  ? 529  CYS A CA    1 
ATOM   3995  C  C     . CYS A 1  529  ? -9.443  -57.767  52.334  1.00 55.05  ? 529  CYS A C     1 
ATOM   3996  O  O     . CYS A 1  529  ? -10.111 -58.324  53.214  1.00 55.57  ? 529  CYS A O     1 
ATOM   3997  C  CB    . CYS A 1  529  ? -8.837  -55.296  52.340  1.00 51.91  ? 529  CYS A CB    1 
ATOM   3998  S  SG    . CYS A 1  529  ? -10.522 -54.877  52.850  1.00 56.50  ? 529  CYS A SG    1 
ATOM   3999  N  N     . GLY A 1  530  ? -9.531  -58.047  51.031  1.00 49.63  ? 530  GLY A N     1 
ATOM   4000  C  CA    . GLY A 1  530  ? -10.466 -58.996  50.439  1.00 49.88  ? 530  GLY A CA    1 
ATOM   4001  C  C     . GLY A 1  530  ? -10.253 -60.435  50.851  1.00 53.89  ? 530  GLY A C     1 
ATOM   4002  O  O     . GLY A 1  530  ? -11.229 -61.174  51.027  1.00 54.01  ? 530  GLY A O     1 
ATOM   4003  N  N     . ILE A 1  531  ? -8.973  -60.846  51.005  1.00 49.83  ? 531  ILE A N     1 
ATOM   4004  C  CA    . ILE A 1  531  ? -8.632  -62.214  51.398  1.00 49.94  ? 531  ILE A CA    1 
ATOM   4005  C  C     . ILE A 1  531  ? -9.172  -62.530  52.794  1.00 54.22  ? 531  ILE A C     1 
ATOM   4006  O  O     . ILE A 1  531  ? -9.836  -63.544  52.936  1.00 54.98  ? 531  ILE A O     1 
ATOM   4007  C  CB    . ILE A 1  531  ? -7.146  -62.610  51.142  1.00 52.20  ? 531  ILE A CB    1 
ATOM   4008  C  CG1   . ILE A 1  531  ? -6.963  -64.132  51.049  1.00 52.94  ? 531  ILE A CG1   1 
ATOM   4009  C  CG2   . ILE A 1  531  ? -6.183  -61.970  52.139  1.00 52.98  ? 531  ILE A CG2   1 
ATOM   4010  C  CD1   . ILE A 1  531  ? -5.612  -64.584  50.540  1.00 54.66  ? 531  ILE A CD1   1 
ATOM   4011  N  N     . ARG A 1  532  ? -9.003  -61.607  53.772  1.00 49.81  ? 532  ARG A N     1 
ATOM   4012  C  CA    . ARG A 1  532  ? -9.518  -61.754  55.139  1.00 50.13  ? 532  ARG A CA    1 
ATOM   4013  C  C     . ARG A 1  532  ? -11.038 -61.972  55.119  1.00 54.38  ? 532  ARG A C     1 
ATOM   4014  O  O     . ARG A 1  532  ? -11.527 -62.908  55.747  1.00 54.97  ? 532  ARG A O     1 
ATOM   4015  C  CB    . ARG A 1  532  ? -9.163  -60.522  55.995  1.00 49.13  ? 532  ARG A CB    1 
ATOM   4016  C  CG    . ARG A 1  532  ? -9.611  -60.638  57.448  1.00 59.65  ? 532  ARG A CG    1 
ATOM   4017  C  CD    . ARG A 1  532  ? -10.056 -59.312  58.028  1.00 69.89  ? 532  ARG A CD    1 
ATOM   4018  N  NE    . ARG A 1  532  ? -11.332 -59.417  58.739  1.00 78.37  ? 532  ARG A NE    1 
ATOM   4019  C  CZ    . ARG A 1  532  ? -12.458 -58.833  58.341  1.00 91.86  ? 532  ARG A CZ    1 
ATOM   4020  N  NH1   . ARG A 1  532  ? -12.475 -58.089  57.241  1.00 81.70  ? 532  ARG A NH1   1 
ATOM   4021  N  NH2   . ARG A 1  532  ? -13.572 -58.977  59.047  1.00 74.74  ? 532  ARG A NH2   1 
ATOM   4022  N  N     . LYS A 1  533  ? -11.761 -61.120  54.367  1.00 50.09  ? 533  LYS A N     1 
ATOM   4023  C  CA    . LYS A 1  533  ? -13.214 -61.133  54.203  1.00 50.37  ? 533  LYS A CA    1 
ATOM   4024  C  C     . LYS A 1  533  ? -13.723 -62.443  53.611  1.00 55.91  ? 533  LYS A C     1 
ATOM   4025  O  O     . LYS A 1  533  ? -14.703 -62.988  54.117  1.00 56.62  ? 533  LYS A O     1 
ATOM   4026  C  CB    . LYS A 1  533  ? -13.661 -59.960  53.317  1.00 51.62  ? 533  LYS A CB    1 
ATOM   4027  C  CG    . LYS A 1  533  ? -13.464 -58.581  53.940  1.00 56.91  ? 533  LYS A CG    1 
ATOM   4028  C  CD    . LYS A 1  533  ? -14.018 -57.461  53.063  1.00 60.97  ? 533  LYS A CD    1 
ATOM   4029  C  CE    . LYS A 1  533  ? -15.511 -57.539  52.787  1.00 71.21  ? 533  LYS A CE    1 
ATOM   4030  N  NZ    . LYS A 1  533  ? -16.340 -57.428  54.017  1.00 78.89  ? 533  LYS A NZ    1 
ATOM   4031  N  N     . LEU A 1  534  ? -13.070 -62.934  52.530  1.00 52.83  ? 534  LEU A N     1 
ATOM   4032  C  CA    . LEU A 1  534  ? -13.430 -64.176  51.820  1.00 53.90  ? 534  LEU A CA    1 
ATOM   4033  C  C     . LEU A 1  534  ? -13.142 -65.409  52.670  1.00 60.30  ? 534  LEU A C     1 
ATOM   4034  O  O     . LEU A 1  534  ? -13.876 -66.394  52.635  1.00 61.34  ? 534  LEU A O     1 
ATOM   4035  C  CB    . LEU A 1  534  ? -12.640 -64.270  50.487  1.00 52.92  ? 534  LEU A CB    1 
ATOM   4036  C  CG    . LEU A 1  534  ? -12.577 -65.641  49.788  1.00 57.71  ? 534  LEU A CG    1 
ATOM   4037  C  CD1   . LEU A 1  534  ? -13.813 -65.897  48.973  1.00 58.61  ? 534  LEU A CD1   1 
ATOM   4038  C  CD2   . LEU A 1  534  ? -11.338 -65.765  48.932  1.00 58.15  ? 534  LEU A CD2   1 
ATOM   4039  N  N     . THR A 1  535  ? -12.047 -65.349  53.403  1.00 57.08  ? 535  THR A N     1 
ATOM   4040  C  CA    . THR A 1  535  ? -11.541 -66.438  54.201  1.00 58.03  ? 535  THR A CA    1 
ATOM   4041  C  C     . THR A 1  535  ? -12.277 -66.644  55.550  1.00 63.37  ? 535  THR A C     1 
ATOM   4042  O  O     . THR A 1  535  ? -11.910 -67.559  56.288  1.00 64.68  ? 535  THR A O     1 
ATOM   4043  C  CB    . THR A 1  535  ? -10.011 -66.316  54.195  1.00 64.77  ? 535  THR A CB    1 
ATOM   4044  O  OG1   . THR A 1  535  ? -9.370  -67.565  53.967  1.00 68.16  ? 535  THR A OG1   1 
ATOM   4045  C  CG2   . THR A 1  535  ? -9.467  -65.560  55.362  1.00 60.32  ? 535  THR A CG2   1 
ATOM   4046  N  N     . LEU A 1  536  ? -13.331 -65.840  55.853  1.00 59.34  ? 536  LEU A N     1 
ATOM   4047  C  CA    . LEU A 1  536  ? -14.102 -65.971  57.103  1.00 60.16  ? 536  LEU A CA    1 
ATOM   4048  C  C     . LEU A 1  536  ? -14.958 -67.252  57.128  1.00 68.78  ? 536  LEU A C     1 
ATOM   4049  O  O     . LEU A 1  536  ? -15.262 -67.810  56.059  1.00 69.31  ? 536  LEU A O     1 
ATOM   4050  C  CB    . LEU A 1  536  ? -14.983 -64.732  57.378  1.00 59.12  ? 536  LEU A CB    1 
ATOM   4051  C  CG    . LEU A 1  536  ? -14.295 -63.359  57.456  1.00 61.71  ? 536  LEU A CG    1 
ATOM   4052  C  CD1   . LEU A 1  536  ? -15.301 -62.255  57.488  1.00 61.39  ? 536  LEU A CD1   1 
ATOM   4053  C  CD2   . LEU A 1  536  ? -13.388 -63.232  58.663  1.00 63.89  ? 536  LEU A CD2   1 
ATOM   4054  N  N     . ARG A 1  537  ? -15.326 -67.731  58.350  1.00 67.37  ? 537  ARG A N     1 
ATOM   4055  C  CA    . ARG A 1  537  ? -16.164 -68.931  58.529  1.00 69.26  ? 537  ARG A CA    1 
ATOM   4056  C  C     . ARG A 1  537  ? -17.585 -68.705  58.008  1.00 74.23  ? 537  ARG A C     1 
ATOM   4057  O  O     . ARG A 1  537  ? -18.192 -69.618  57.450  1.00 74.14  ? 537  ARG A O     1 
ATOM   4058  C  CB    . ARG A 1  537  ? -16.194 -69.380  59.994  1.00 70.12  ? 537  ARG A CB    1 
ATOM   4059  C  CG    . ARG A 1  537  ? -15.136 -70.425  60.311  1.00 79.83  ? 537  ARG A CG    1 
ATOM   4060  C  CD    . ARG A 1  537  ? -15.618 -71.438  61.334  1.00 84.86  ? 537  ARG A CD    1 
ATOM   4061  N  NE    . ARG A 1  537  ? -15.356 -71.008  62.709  1.00 85.60  ? 537  ARG A NE    1 
ATOM   4062  C  CZ    . ARG A 1  537  ? -14.304 -71.387  63.427  1.00 94.58  ? 537  ARG A CZ    1 
ATOM   4063  N  NH1   . ARG A 1  537  ? -13.398 -72.208  62.910  1.00 77.49  ? 537  ARG A NH1   1 
ATOM   4064  N  NH2   . ARG A 1  537  ? -14.148 -70.947  64.668  1.00 83.00  ? 537  ARG A NH2   1 
ATOM   4065  N  N     . ASP A 1  538  ? -18.085 -67.467  58.174  1.00 71.48  ? 538  ASP A N     1 
ATOM   4066  C  CA    . ASP A 1  538  ? -19.388 -66.971  57.733  1.00 72.43  ? 538  ASP A CA    1 
ATOM   4067  C  C     . ASP A 1  538  ? -19.516 -66.964  56.198  1.00 76.93  ? 538  ASP A C     1 
ATOM   4068  O  O     . ASP A 1  538  ? -20.629 -67.078  55.679  1.00 77.83  ? 538  ASP A O     1 
ATOM   4069  C  CB    . ASP A 1  538  ? -19.566 -65.526  58.241  1.00 73.58  ? 538  ASP A CB    1 
ATOM   4070  C  CG    . ASP A 1  538  ? -20.658 -65.301  59.270  1.00 88.48  ? 538  ASP A CG    1 
ATOM   4071  O  OD1   . ASP A 1  538  ? -21.399 -66.261  59.574  1.00 90.99  ? 538  ASP A OD1   1 
ATOM   4072  O  OD2   . ASP A 1  538  ? -20.782 -64.159  59.761  1.00 96.08  ? 538  ASP A OD2   1 
ATOM   4073  N  N     . THR A 1  539  ? -18.382 -66.777  55.484  1.00 72.00  ? 539  THR A N     1 
ATOM   4074  C  CA    . THR A 1  539  ? -18.315 -66.680  54.026  1.00 70.88  ? 539  THR A CA    1 
ATOM   4075  C  C     . THR A 1  539  ? -18.580 -67.999  53.320  1.00 76.72  ? 539  THR A C     1 
ATOM   4076  O  O     . THR A 1  539  ? -17.783 -68.935  53.438  1.00 76.84  ? 539  THR A O     1 
ATOM   4077  C  CB    . THR A 1  539  ? -16.995 -66.039  53.584  1.00 73.71  ? 539  THR A CB    1 
ATOM   4078  O  OG1   . THR A 1  539  ? -16.753 -64.860  54.352  1.00 69.70  ? 539  THR A OG1   1 
ATOM   4079  C  CG2   . THR A 1  539  ? -16.983 -65.698  52.102  1.00 72.34  ? 539  THR A CG2   1 
ATOM   4080  N  N     . PHE A 1  540  ? -19.689 -68.045  52.555  1.00 74.42  ? 540  PHE A N     1 
ATOM   4081  C  CA    . PHE A 1  540  ? -20.111 -69.195  51.754  1.00 75.79  ? 540  PHE A CA    1 
ATOM   4082  C  C     . PHE A 1  540  ? -20.497 -68.763  50.348  1.00 80.02  ? 540  PHE A C     1 
ATOM   4083  O  O     . PHE A 1  540  ? -21.178 -67.747  50.187  1.00 79.46  ? 540  PHE A O     1 
ATOM   4084  C  CB    . PHE A 1  540  ? -21.271 -69.951  52.415  1.00 79.60  ? 540  PHE A CB    1 
ATOM   4085  C  CG    . PHE A 1  540  ? -20.902 -70.654  53.697  1.00 82.14  ? 540  PHE A CG    1 
ATOM   4086  C  CD1   . PHE A 1  540  ? -21.227 -70.101  54.929  1.00 85.47  ? 540  PHE A CD1   1 
ATOM   4087  C  CD2   . PHE A 1  540  ? -20.228 -71.869  53.674  1.00 85.07  ? 540  PHE A CD2   1 
ATOM   4088  C  CE1   . PHE A 1  540  ? -20.877 -70.745  56.118  1.00 87.08  ? 540  PHE A CE1   1 
ATOM   4089  C  CE2   . PHE A 1  540  ? -19.881 -72.514  54.865  1.00 88.78  ? 540  PHE A CE2   1 
ATOM   4090  C  CZ    . PHE A 1  540  ? -20.209 -71.947  56.079  1.00 86.89  ? 540  PHE A CZ    1 
ATOM   4091  N  N     . ILE A 1  541  ? -20.070 -69.539  49.332  1.00 77.20  ? 541  ILE A N     1 
ATOM   4092  C  CA    . ILE A 1  541  ? -20.341 -69.269  47.914  1.00 76.84  ? 541  ILE A CA    1 
ATOM   4093  C  C     . ILE A 1  541  ? -21.153 -70.338  47.181  1.00 82.33  ? 541  ILE A C     1 
ATOM   4094  O  O     . ILE A 1  541  ? -21.014 -71.537  47.440  1.00 82.87  ? 541  ILE A O     1 
ATOM   4095  C  CB    . ILE A 1  541  ? -19.121 -68.753  47.091  1.00 78.34  ? 541  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A 1  541  ? -17.835 -69.608  47.296  1.00 78.46  ? 541  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A 1  541  ? -18.909 -67.240  47.276  1.00 77.76  ? 541  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A 1  541  ? -16.853 -69.189  48.385  1.00 84.07  ? 541  ILE A CD1   1 
ATOM   4099  N  N     . GLU A 1  542  ? -22.005 -69.871  46.262  1.00 79.26  ? 542  GLU A N     1 
ATOM   4100  C  CA    . GLU A 1  542  ? -22.898 -70.672  45.428  1.00 80.83  ? 542  GLU A CA    1 
ATOM   4101  C  C     . GLU A 1  542  ? -22.148 -71.189  44.204  1.00 85.09  ? 542  GLU A C     1 
ATOM   4102  O  O     . GLU A 1  542  ? -21.231 -70.522  43.723  1.00 83.45  ? 542  GLU A O     1 
ATOM   4103  C  CB    . GLU A 1  542  ? -24.073 -69.806  44.941  1.00 82.41  ? 542  GLU A CB    1 
ATOM   4104  C  CG    . GLU A 1  542  ? -24.642 -68.842  45.971  1.00 92.77  ? 542  GLU A CG    1 
ATOM   4105  C  CD    . GLU A 1  542  ? -25.940 -69.276  46.618  1.00 116.50 ? 542  GLU A CD    1 
ATOM   4106  O  OE1   . GLU A 1  542  ? -26.121 -70.496  46.834  1.00 117.03 ? 542  GLU A OE1   1 
ATOM   4107  O  OE2   . GLU A 1  542  ? -26.772 -68.391  46.923  1.00 109.37 ? 542  GLU A OE2   1 
ATOM   4108  N  N     . LEU A 1  543  ? -22.590 -72.339  43.665  1.00 83.46  ? 543  LEU A N     1 
ATOM   4109  C  CA    . LEU A 1  543  ? -22.056 -73.011  42.470  1.00 83.57  ? 543  LEU A CA    1 
ATOM   4110  C  C     . LEU A 1  543  ? -21.674 -72.040  41.320  1.00 86.22  ? 543  LEU A C     1 
ATOM   4111  O  O     . LEU A 1  543  ? -20.550 -72.103  40.818  1.00 84.41  ? 543  LEU A O     1 
ATOM   4112  C  CB    . LEU A 1  543  ? -23.090 -74.072  42.002  1.00 85.52  ? 543  LEU A CB    1 
ATOM   4113  C  CG    . LEU A 1  543  ? -22.754 -75.079  40.875  1.00 90.51  ? 543  LEU A CG    1 
ATOM   4114  C  CD1   . LEU A 1  543  ? -23.068 -74.525  39.501  1.00 90.15  ? 543  LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A 1  543  ? -21.356 -75.673  40.998  1.00 91.98  ? 543  LEU A CD2   1 
ATOM   4116  N  N     . ASP A 1  544  ? -22.612 -71.149  40.930  1.00 83.43  ? 544  ASP A N     1 
ATOM   4117  C  CA    . ASP A 1  544  ? -22.469 -70.134  39.870  1.00 82.41  ? 544  ASP A CA    1 
ATOM   4118  C  C     . ASP A 1  544  ? -21.190 -69.294  39.993  1.00 83.02  ? 544  ASP A C     1 
ATOM   4119  O  O     . ASP A 1  544  ? -20.496 -69.092  38.992  1.00 81.83  ? 544  ASP A O     1 
ATOM   4120  C  CB    . ASP A 1  544  ? -23.711 -69.217  39.818  1.00 85.06  ? 544  ASP A CB    1 
ATOM   4121  C  CG    . ASP A 1  544  ? -24.179 -68.722  41.181  1.00 99.06  ? 544  ASP A CG    1 
ATOM   4122  O  OD1   . ASP A 1  544  ? -23.615 -67.712  41.677  1.00 97.90  ? 544  ASP A OD1   1 
ATOM   4123  O  OD2   . ASP A 1  544  ? -25.094 -69.358  41.763  1.00 107.23 ? 544  ASP A OD2   1 
ATOM   4124  N  N     . GLN A 1  545  ? -20.887 -68.822  41.224  1.00 77.39  ? 545  GLN A N     1 
ATOM   4125  C  CA    . GLN A 1  545  ? -19.713 -68.014  41.553  1.00 74.62  ? 545  GLN A CA    1 
ATOM   4126  C  C     . GLN A 1  545  ? -18.475 -68.897  41.674  1.00 76.23  ? 545  GLN A C     1 
ATOM   4127  O  O     . GLN A 1  545  ? -17.398 -68.488  41.234  1.00 74.65  ? 545  GLN A O     1 
ATOM   4128  C  CB    . GLN A 1  545  ? -19.945 -67.244  42.863  1.00 75.54  ? 545  GLN A CB    1 
ATOM   4129  C  CG    . GLN A 1  545  ? -19.236 -65.886  42.910  1.00 88.87  ? 545  GLN A CG    1 
ATOM   4130  C  CD    . GLN A 1  545  ? -19.472 -65.088  44.182  1.00 104.11 ? 545  GLN A CD    1 
ATOM   4131  O  OE1   . GLN A 1  545  ? -18.656 -64.239  44.565  1.00 96.38  ? 545  GLN A OE1   1 
ATOM   4132  N  NE2   . GLN A 1  545  ? -20.605 -65.303  44.850  1.00 97.04  ? 545  GLN A NE2   1 
ATOM   4133  N  N     . VAL A 1  546  ? -18.634 -70.107  42.273  1.00 72.13  ? 546  VAL A N     1 
ATOM   4134  C  CA    . VAL A 1  546  ? -17.579 -71.109  42.495  1.00 70.95  ? 546  VAL A CA    1 
ATOM   4135  C  C     . VAL A 1  546  ? -16.880 -71.467  41.181  1.00 73.02  ? 546  VAL A C     1 
ATOM   4136  O  O     . VAL A 1  546  ? -15.654 -71.362  41.095  1.00 71.56  ? 546  VAL A O     1 
ATOM   4137  C  CB    . VAL A 1  546  ? -18.113 -72.361  43.239  1.00 75.84  ? 546  VAL A CB    1 
ATOM   4138  C  CG1   . VAL A 1  546  ? -17.056 -73.455  43.328  1.00 76.04  ? 546  VAL A CG1   1 
ATOM   4139  C  CG2   . VAL A 1  546  ? -18.601 -71.997  44.627  1.00 75.73  ? 546  VAL A CG2   1 
ATOM   4140  N  N     . LEU A 1  547  ? -17.668 -71.845  40.154  1.00 68.86  ? 547  LEU A N     1 
ATOM   4141  C  CA    . LEU A 1  547  ? -17.149 -72.207  38.840  1.00 67.77  ? 547  LEU A CA    1 
ATOM   4142  C  C     . LEU A 1  547  ? -16.371 -71.048  38.223  1.00 70.00  ? 547  LEU A C     1 
ATOM   4143  O  O     . LEU A 1  547  ? -15.293 -71.273  37.668  1.00 69.17  ? 547  LEU A O     1 
ATOM   4144  C  CB    . LEU A 1  547  ? -18.275 -72.668  37.893  1.00 68.56  ? 547  LEU A CB    1 
ATOM   4145  C  CG    . LEU A 1  547  ? -19.166 -73.847  38.311  1.00 74.11  ? 547  LEU A CG    1 
ATOM   4146  C  CD1   . LEU A 1  547  ? -20.107 -74.222  37.190  1.00 74.81  ? 547  LEU A CD1   1 
ATOM   4147  C  CD2   . LEU A 1  547  ? -18.352 -75.062  38.712  1.00 77.01  ? 547  LEU A CD2   1 
ATOM   4148  N  N     . ASN A 1  548  ? -16.896 -69.807  38.358  1.00 65.70  ? 548  ASN A N     1 
ATOM   4149  C  CA    . ASN A 1  548  ? -16.267 -68.592  37.828  1.00 63.90  ? 548  ASN A CA    1 
ATOM   4150  C  C     . ASN A 1  548  ? -14.904 -68.353  38.456  1.00 66.97  ? 548  ASN A C     1 
ATOM   4151  O  O     . ASN A 1  548  ? -13.948 -68.054  37.735  1.00 65.98  ? 548  ASN A O     1 
ATOM   4152  C  CB    . ASN A 1  548  ? -17.178 -67.371  38.007  1.00 63.08  ? 548  ASN A CB    1 
ATOM   4153  C  CG    . ASN A 1  548  ? -17.996 -66.993  36.787  1.00 89.26  ? 548  ASN A CG    1 
ATOM   4154  O  OD1   . ASN A 1  548  ? -17.788 -67.483  35.667  1.00 85.95  ? 548  ASN A OD1   1 
ATOM   4155  N  ND2   . ASN A 1  548  ? -18.935 -66.075  36.972  1.00 80.22  ? 548  ASN A ND2   1 
ATOM   4156  N  N     . MET A 1  549  ? -14.814 -68.536  39.793  1.00 63.35  ? 549  MET A N     1 
ATOM   4157  C  CA    . MET A 1  549  ? -13.599 -68.376  40.591  1.00 62.12  ? 549  MET A CA    1 
ATOM   4158  C  C     . MET A 1  549  ? -12.580 -69.462  40.263  1.00 65.15  ? 549  MET A C     1 
ATOM   4159  O  O     . MET A 1  549  ? -11.397 -69.154  40.107  1.00 63.09  ? 549  MET A O     1 
ATOM   4160  C  CB    . MET A 1  549  ? -13.933 -68.353  42.089  1.00 64.99  ? 549  MET A CB    1 
ATOM   4161  C  CG    . MET A 1  549  ? -14.626 -67.076  42.507  1.00 68.54  ? 549  MET A CG    1 
ATOM   4162  S  SD    . MET A 1  549  ? -14.906 -66.852  44.281  1.00 73.68  ? 549  MET A SD    1 
ATOM   4163  C  CE    . MET A 1  549  ? -16.390 -67.777  44.470  1.00 72.29  ? 549  MET A CE    1 
ATOM   4164  N  N     . LEU A 1  550  ? -13.047 -70.722  40.112  1.00 63.26  ? 550  LEU A N     1 
ATOM   4165  C  CA    . LEU A 1  550  ? -12.211 -71.872  39.756  1.00 63.83  ? 550  LEU A CA    1 
ATOM   4166  C  C     . LEU A 1  550  ? -11.551 -71.652  38.398  1.00 68.68  ? 550  LEU A C     1 
ATOM   4167  O  O     . LEU A 1  550  ? -10.363 -71.939  38.245  1.00 67.88  ? 550  LEU A O     1 
ATOM   4168  C  CB    . LEU A 1  550  ? -13.040 -73.170  39.719  1.00 65.39  ? 550  LEU A CB    1 
ATOM   4169  C  CG    . LEU A 1  550  ? -13.469 -73.782  41.043  1.00 70.65  ? 550  LEU A CG    1 
ATOM   4170  C  CD1   . LEU A 1  550  ? -14.531 -74.836  40.829  1.00 72.00  ? 550  LEU A CD1   1 
ATOM   4171  C  CD2   . LEU A 1  550  ? -12.290 -74.375  41.786  1.00 74.31  ? 550  LEU A CD2   1 
ATOM   4172  N  N     . TYR A 1  551  ? -12.320 -71.124  37.421  1.00 66.73  ? 551  TYR A N     1 
ATOM   4173  C  CA    . TYR A 1  551  ? -11.828 -70.850  36.074  1.00 67.09  ? 551  TYR A CA    1 
ATOM   4174  C  C     . TYR A 1  551  ? -10.795 -69.736  36.061  1.00 71.11  ? 551  TYR A C     1 
ATOM   4175  O  O     . TYR A 1  551  ? -9.851  -69.815  35.273  1.00 70.95  ? 551  TYR A O     1 
ATOM   4176  C  CB    . TYR A 1  551  ? -12.978 -70.558  35.096  1.00 69.05  ? 551  TYR A CB    1 
ATOM   4177  C  CG    . TYR A 1  551  ? -12.558 -70.475  33.639  1.00 71.30  ? 551  TYR A CG    1 
ATOM   4178  C  CD1   . TYR A 1  551  ? -11.757 -71.461  33.063  1.00 73.86  ? 551  TYR A CD1   1 
ATOM   4179  C  CD2   . TYR A 1  551  ? -13.003 -69.438  32.821  1.00 71.46  ? 551  TYR A CD2   1 
ATOM   4180  C  CE1   . TYR A 1  551  ? -11.352 -71.378  31.730  1.00 74.10  ? 551  TYR A CE1   1 
ATOM   4181  C  CE2   . TYR A 1  551  ? -12.634 -69.367  31.476  1.00 72.07  ? 551  TYR A CE2   1 
ATOM   4182  C  CZ    . TYR A 1  551  ? -11.806 -70.338  30.937  1.00 78.06  ? 551  TYR A CZ    1 
ATOM   4183  O  OH    . TYR A 1  551  ? -11.425 -70.267  29.622  1.00 75.97  ? 551  TYR A OH    1 
ATOM   4184  N  N     . TRP A 1  552  ? -10.942 -68.727  36.960  1.00 67.05  ? 552  TRP A N     1 
ATOM   4185  C  CA    . TRP A 1  552  ? -10.004 -67.612  37.072  1.00 65.43  ? 552  TRP A CA    1 
ATOM   4186  C  C     . TRP A 1  552  ? -8.579  -68.045  37.355  1.00 69.50  ? 552  TRP A C     1 
ATOM   4187  O  O     . TRP A 1  552  ? -7.661  -67.434  36.812  1.00 68.37  ? 552  TRP A O     1 
ATOM   4188  C  CB    . TRP A 1  552  ? -10.488 -66.542  38.040  1.00 63.50  ? 552  TRP A CB    1 
ATOM   4189  C  CG    . TRP A 1  552  ? -11.139 -65.387  37.339  1.00 64.16  ? 552  TRP A CG    1 
ATOM   4190  C  CD1   . TRP A 1  552  ? -12.471 -65.107  37.291  1.00 67.42  ? 552  TRP A CD1   1 
ATOM   4191  C  CD2   . TRP A 1  552  ? -10.486 -64.379  36.549  1.00 63.25  ? 552  TRP A CD2   1 
ATOM   4192  N  NE1   . TRP A 1  552  ? -12.691 -63.983  36.529  1.00 66.26  ? 552  TRP A NE1   1 
ATOM   4193  C  CE2   . TRP A 1  552  ? -11.489 -63.511  36.067  1.00 66.95  ? 552  TRP A CE2   1 
ATOM   4194  C  CE3   . TRP A 1  552  ? -9.148  -64.123  36.199  1.00 64.11  ? 552  TRP A CE3   1 
ATOM   4195  C  CZ2   . TRP A 1  552  ? -11.200 -62.416  35.242  1.00 65.54  ? 552  TRP A CZ2   1 
ATOM   4196  C  CZ3   . TRP A 1  552  ? -8.862  -63.033  35.389  1.00 64.71  ? 552  TRP A CZ3   1 
ATOM   4197  C  CH2   . TRP A 1  552  ? -9.879  -62.195  34.918  1.00 65.06  ? 552  TRP A CH2   1 
ATOM   4198  N  N     . VAL A 1  553  ? -8.393  -69.141  38.128  1.00 67.52  ? 553  VAL A N     1 
ATOM   4199  C  CA    . VAL A 1  553  ? -7.077  -69.734  38.390  1.00 68.11  ? 553  VAL A CA    1 
ATOM   4200  C  C     . VAL A 1  553  ? -6.605  -70.348  37.049  1.00 74.90  ? 553  VAL A C     1 
ATOM   4201  O  O     . VAL A 1  553  ? -7.270  -71.253  36.519  1.00 75.15  ? 553  VAL A O     1 
ATOM   4202  C  CB    . VAL A 1  553  ? -7.084  -70.801  39.522  1.00 72.92  ? 553  VAL A CB    1 
ATOM   4203  C  CG1   . VAL A 1  553  ? -5.671  -71.291  39.833  1.00 72.93  ? 553  VAL A CG1   1 
ATOM   4204  C  CG2   . VAL A 1  553  ? -7.757  -70.285  40.784  1.00 72.30  ? 553  VAL A CG2   1 
ATOM   4205  N  N     . PRO A 1  554  ? -5.493  -69.842  36.468  1.00 72.94  ? 554  PRO A N     1 
ATOM   4206  C  CA    . PRO A 1  554  ? -5.036  -70.369  35.170  1.00 74.27  ? 554  PRO A CA    1 
ATOM   4207  C  C     . PRO A 1  554  ? -4.454  -71.775  35.249  1.00 82.13  ? 554  PRO A C     1 
ATOM   4208  O  O     . PRO A 1  554  ? -4.530  -72.538  34.288  1.00 83.13  ? 554  PRO A O     1 
ATOM   4209  C  CB    . PRO A 1  554  ? -3.977  -69.349  34.724  1.00 74.80  ? 554  PRO A CB    1 
ATOM   4210  C  CG    . PRO A 1  554  ? -4.116  -68.179  35.662  1.00 77.69  ? 554  PRO A CG    1 
ATOM   4211  C  CD    . PRO A 1  554  ? -4.608  -68.760  36.936  1.00 73.48  ? 554  PRO A CD    1 
ATOM   4212  N  N     . ASP A 1  555  ? -3.886  -72.116  36.395  1.00 80.50  ? 555  ASP A N     1 
ATOM   4213  C  CA    . ASP A 1  555  ? -3.262  -73.410  36.621  1.00 82.67  ? 555  ASP A CA    1 
ATOM   4214  C  C     . ASP A 1  555  ? -4.264  -74.531  36.931  1.00 87.10  ? 555  ASP A C     1 
ATOM   4215  O  O     . ASP A 1  555  ? -3.894  -75.702  36.812  1.00 88.42  ? 555  ASP A O     1 
ATOM   4216  C  CB    . ASP A 1  555  ? -2.206  -73.288  37.739  1.00 85.17  ? 555  ASP A CB    1 
ATOM   4217  C  CG    . ASP A 1  555  ? -1.203  -72.169  37.502  1.00 99.10  ? 555  ASP A CG    1 
ATOM   4218  O  OD1   . ASP A 1  555  ? -0.419  -72.267  36.528  1.00 100.57 ? 555  ASP A OD1   1 
ATOM   4219  O  OD2   . ASP A 1  555  ? -1.224  -71.182  38.269  1.00 105.14 ? 555  ASP A OD2   1 
ATOM   4220  N  N     . TRP A 1  556  ? -5.518  -74.174  37.317  1.00 81.85  ? 556  TRP A N     1 
ATOM   4221  C  CA    . TRP A 1  556  ? -6.603  -75.086  37.720  1.00 82.11  ? 556  TRP A CA    1 
ATOM   4222  C  C     . TRP A 1  556  ? -6.633  -76.470  37.071  1.00 86.72  ? 556  TRP A C     1 
ATOM   4223  O  O     . TRP A 1  556  ? -6.594  -76.576  35.849  1.00 86.46  ? 556  TRP A O     1 
ATOM   4224  C  CB    . TRP A 1  556  ? -7.988  -74.412  37.662  1.00 80.04  ? 556  TRP A CB    1 
ATOM   4225  C  CG    . TRP A 1  556  ? -9.079  -75.232  38.296  1.00 81.97  ? 556  TRP A CG    1 
ATOM   4226  C  CD1   . TRP A 1  556  ? -9.036  -75.851  39.510  1.00 85.70  ? 556  TRP A CD1   1 
ATOM   4227  C  CD2   . TRP A 1  556  ? -10.374 -75.512  37.751  1.00 82.29  ? 556  TRP A CD2   1 
ATOM   4228  N  NE1   . TRP A 1  556  ? -10.207 -76.534  39.737  1.00 86.33  ? 556  TRP A NE1   1 
ATOM   4229  C  CE2   . TRP A 1  556  ? -11.058 -76.318  38.687  1.00 87.46  ? 556  TRP A CE2   1 
ATOM   4230  C  CE3   . TRP A 1  556  ? -11.031 -75.150  36.566  1.00 83.21  ? 556  TRP A CE3   1 
ATOM   4231  C  CZ2   . TRP A 1  556  ? -12.369 -76.757  38.482  1.00 87.74  ? 556  TRP A CZ2   1 
ATOM   4232  C  CZ3   . TRP A 1  556  ? -12.323 -75.599  36.356  1.00 85.67  ? 556  TRP A CZ3   1 
ATOM   4233  C  CH2   . TRP A 1  556  ? -12.975 -76.400  37.303  1.00 87.59  ? 556  TRP A CH2   1 
ATOM   4234  N  N     . ASP A 1  557  ? -6.722  -77.522  37.904  1.00 83.88  ? 557  ASP A N     1 
ATOM   4235  C  CA    . ASP A 1  557  ? -6.763  -78.921  37.480  1.00 85.15  ? 557  ASP A CA    1 
ATOM   4236  C  C     . ASP A 1  557  ? -8.025  -79.319  36.706  1.00 88.27  ? 557  ASP A C     1 
ATOM   4237  O  O     . ASP A 1  557  ? -8.021  -80.347  36.025  1.00 89.46  ? 557  ASP A O     1 
ATOM   4238  C  CB    . ASP A 1  557  ? -6.529  -79.864  38.681  1.00 88.66  ? 557  ASP A CB    1 
ATOM   4239  C  CG    . ASP A 1  557  ? -7.547  -79.816  39.819  1.00 102.37 ? 557  ASP A CG    1 
ATOM   4240  O  OD1   . ASP A 1  557  ? -8.233  -78.779  39.968  1.00 102.09 ? 557  ASP A OD1   1 
ATOM   4241  O  OD2   . ASP A 1  557  ? -7.595  -80.784  40.612  1.00 110.65 ? 557  ASP A OD2   1 
ATOM   4242  N  N     . GLY A 1  558  ? -9.081  -78.513  36.812  1.00 82.64  ? 558  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1  558  ? -10.354 -78.774  36.147  1.00 82.47  ? 558  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1  558  ? -11.298 -79.618  36.982  1.00 85.71  ? 558  GLY A C     1 
ATOM   4245  O  O     . GLY A 1  558  ? -12.431 -79.885  36.569  1.00 86.03  ? 558  GLY A O     1 
ATOM   4246  N  N     . VAL A 1  559  ? -10.837 -80.022  38.177  1.00 80.92  ? 559  VAL A N     1 
ATOM   4247  C  CA    . VAL A 1  559  ? -11.584 -80.845  39.123  1.00 81.38  ? 559  VAL A CA    1 
ATOM   4248  C  C     . VAL A 1  559  ? -12.319 -79.935  40.107  1.00 83.33  ? 559  VAL A C     1 
ATOM   4249  O  O     . VAL A 1  559  ? -11.682 -79.225  40.902  1.00 82.14  ? 559  VAL A O     1 
ATOM   4250  C  CB    . VAL A 1  559  ? -10.659 -81.865  39.838  1.00 86.10  ? 559  VAL A CB    1 
ATOM   4251  C  CG1   . VAL A 1  559  ? -11.444 -82.761  40.788  1.00 87.43  ? 559  VAL A CG1   1 
ATOM   4252  C  CG2   . VAL A 1  559  ? -9.877  -82.703  38.834  1.00 86.86  ? 559  VAL A CG2   1 
ATOM   4253  N  N     . ILE A 1  560  ? -13.666 -79.962  40.042  1.00 78.75  ? 560  ILE A N     1 
ATOM   4254  C  CA    . ILE A 1  560  ? -14.535 -79.175  40.918  1.00 77.17  ? 560  ILE A CA    1 
ATOM   4255  C  C     . ILE A 1  560  ? -14.462 -79.773  42.330  1.00 79.82  ? 560  ILE A C     1 
ATOM   4256  O  O     . ILE A 1  560  ? -14.826 -80.939  42.493  1.00 81.90  ? 560  ILE A O     1 
ATOM   4257  C  CB    . ILE A 1  560  ? -16.004 -79.101  40.390  1.00 81.01  ? 560  ILE A CB    1 
ATOM   4258  C  CG1   . ILE A 1  560  ? -16.075 -78.546  38.945  1.00 80.67  ? 560  ILE A CG1   1 
ATOM   4259  C  CG2   . ILE A 1  560  ? -16.903 -78.292  41.347  1.00 81.25  ? 560  ILE A CG2   1 
ATOM   4260  C  CD1   . ILE A 1  560  ? -17.261 -79.067  38.121  1.00 89.83  ? 560  ILE A CD1   1 
ATOM   4261  N  N     . PRO A 1  561  ? -13.979 -79.023  43.350  1.00 73.08  ? 561  PRO A N     1 
ATOM   4262  C  CA    . PRO A 1  561  ? -13.918 -79.589  44.707  1.00 73.07  ? 561  PRO A CA    1 
ATOM   4263  C  C     . PRO A 1  561  ? -15.294 -79.843  45.308  1.00 77.36  ? 561  PRO A C     1 
ATOM   4264  O  O     . PRO A 1  561  ? -16.244 -79.120  45.007  1.00 75.49  ? 561  PRO A O     1 
ATOM   4265  C  CB    . PRO A 1  561  ? -13.158 -78.529  45.500  1.00 72.99  ? 561  PRO A CB    1 
ATOM   4266  C  CG    . PRO A 1  561  ? -13.395 -77.273  44.779  1.00 76.11  ? 561  PRO A CG    1 
ATOM   4267  C  CD    . PRO A 1  561  ? -13.479 -77.634  43.328  1.00 72.26  ? 561  PRO A CD    1 
ATOM   4268  N  N     . THR A 1  562  ? -15.390 -80.889  46.141  1.00 76.60  ? 562  THR A N     1 
ATOM   4269  C  CA    . THR A 1  562  ? -16.613 -81.282  46.843  1.00 78.41  ? 562  THR A CA    1 
ATOM   4270  C  C     . THR A 1  562  ? -16.960 -80.184  47.861  1.00 82.41  ? 562  THR A C     1 
ATOM   4271  O  O     . THR A 1  562  ? -16.094 -79.822  48.662  1.00 81.05  ? 562  THR A O     1 
ATOM   4272  C  CB    . THR A 1  562  ? -16.417 -82.647  47.490  1.00 88.89  ? 562  THR A CB    1 
ATOM   4273  O  OG1   . THR A 1  562  ? -15.808 -83.510  46.531  1.00 90.80  ? 562  THR A OG1   1 
ATOM   4274  C  CG2   . THR A 1  562  ? -17.724 -83.248  48.001  1.00 89.04  ? 562  THR A CG2   1 
ATOM   4275  N  N     . PRO A 1  563  ? -18.186 -79.603  47.811  1.00 79.77  ? 563  PRO A N     1 
ATOM   4276  C  CA    . PRO A 1  563  ? -18.514 -78.501  48.734  1.00 78.77  ? 563  PRO A CA    1 
ATOM   4277  C  C     . PRO A 1  563  ? -18.492 -78.899  50.196  1.00 85.07  ? 563  PRO A C     1 
ATOM   4278  O  O     . PRO A 1  563  ? -18.757 -80.058  50.522  1.00 86.85  ? 563  PRO A O     1 
ATOM   4279  C  CB    . PRO A 1  563  ? -19.919 -78.073  48.301  1.00 80.74  ? 563  PRO A CB    1 
ATOM   4280  C  CG    . PRO A 1  563  ? -20.480 -79.246  47.596  1.00 86.98  ? 563  PRO A CG    1 
ATOM   4281  C  CD    . PRO A 1  563  ? -19.320 -79.904  46.915  1.00 82.34  ? 563  PRO A CD    1 
ATOM   4282  N  N     . ALA A 1  564  ? -18.179 -77.935  51.073  1.00 81.42  ? 564  ALA A N     1 
ATOM   4283  C  CA    . ALA A 1  564  ? -18.157 -78.167  52.516  1.00 82.61  ? 564  ALA A CA    1 
ATOM   4284  C  C     . ALA A 1  564  ? -19.564 -78.510  52.994  1.00 89.83  ? 564  ALA A C     1 
ATOM   4285  O  O     . ALA A 1  564  ? -19.710 -79.290  53.927  1.00 91.51  ? 564  ALA A O     1 
ATOM   4286  C  CB    . ALA A 1  564  ? -17.645 -76.935  53.246  1.00 81.54  ? 564  ALA A CB    1 
ATOM   4287  N  N     . ILE A 1  565  ? -20.591 -77.960  52.317  1.00 86.52  ? 565  ILE A N     1 
ATOM   4288  C  CA    . ILE A 1  565  ? -22.003 -78.168  52.619  1.00 87.89  ? 565  ILE A CA    1 
ATOM   4289  C  C     . ILE A 1  565  ? -22.721 -78.803  51.415  1.00 93.93  ? 565  ILE A C     1 
ATOM   4290  O  O     . ILE A 1  565  ? -22.555 -78.346  50.286  1.00 92.29  ? 565  ILE A O     1 
ATOM   4291  C  CB    . ILE A 1  565  ? -22.622 -76.827  53.130  1.00 89.63  ? 565  ILE A CB    1 
ATOM   4292  C  CG1   . ILE A 1  565  ? -22.420 -76.675  54.656  1.00 90.14  ? 565  ILE A CG1   1 
ATOM   4293  C  CG2   . ILE A 1  565  ? -24.085 -76.659  52.750  1.00 90.94  ? 565  ILE A CG2   1 
ATOM   4294  C  CD1   . ILE A 1  565  ? -22.428 -75.221  55.203  1.00 94.36  ? 565  ILE A CD1   1 
ATOM   4295  N  N     . ILE A 1  566  ? -23.454 -79.903  51.665  1.00 93.78  ? 566  ILE A N     1 
ATOM   4296  C  CA    . ILE A 1  566  ? -24.243 -80.660  50.680  1.00 95.40  ? 566  ILE A CA    1 
ATOM   4297  C  C     . ILE A 1  566  ? -25.673 -80.886  51.271  1.00 103.32 ? 566  ILE A C     1 
ATOM   4298  O  O     . ILE A 1  566  ? -26.349 -81.863  50.933  1.00 105.35 ? 566  ILE A O     1 
ATOM   4299  C  CB    . ILE A 1  566  ? -23.543 -82.000  50.248  1.00 99.29  ? 566  ILE A CB    1 
ATOM   4300  C  CG1   . ILE A 1  566  ? -21.997 -81.893  50.204  1.00 97.83  ? 566  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE A 1  566  ? -24.094 -82.501  48.904  1.00 101.10 ? 566  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE A 1  566  ? -21.245 -83.206  50.406  1.00 104.88 ? 566  ILE A CD1   1 
ATOM   4303  N  N     . LYS A 1  567  ? -26.120 -79.971  52.168  1.00 99.98  ? 567  LYS A N     1 
ATOM   4304  C  CA    . LYS A 1  567  ? -27.432 -80.007  52.843  1.00 101.45 ? 567  LYS A CA    1 
ATOM   4305  C  C     . LYS A 1  567  ? -28.544 -79.329  51.983  1.00 104.48 ? 567  LYS A C     1 
ATOM   4306  O  O     . LYS A 1  567  ? -28.479 -79.561  50.772  1.00 104.21 ? 567  LYS A O     1 
ATOM   4307  C  CB    . LYS A 1  567  ? -27.329 -79.490  54.285  1.00 104.18 ? 567  LYS A CB    1 
ATOM   4308  C  CG    . LYS A 1  567  ? -26.514 -78.226  54.461  1.00 126.35 ? 567  LYS A CG    1 
ATOM   4309  C  CD    . LYS A 1  567  ? -26.861 -77.503  55.738  1.00 142.21 ? 567  LYS A CD    1 
ATOM   4310  C  CE    . LYS A 1  567  ? -26.001 -76.287  55.921  1.00 155.96 ? 567  LYS A CE    1 
ATOM   4311  N  NZ    . LYS A 1  567  ? -26.418 -75.513  57.114  1.00 166.59 ? 567  LYS A NZ    1 
ATOM   4312  N  N     . PRO A 1  568  ? -29.546 -78.510  52.453  1.00 99.96  ? 568  PRO A N     1 
ATOM   4313  C  CA    . PRO A 1  568  ? -30.523 -77.963  51.494  1.00 99.32  ? 568  PRO A CA    1 
ATOM   4314  C  C     . PRO A 1  568  ? -29.947 -76.914  50.532  1.00 99.08  ? 568  PRO A C     1 
ATOM   4315  O  O     . PRO A 1  568  ? -30.635 -75.946  50.196  1.00 98.73  ? 568  PRO A O     1 
ATOM   4316  C  CB    . PRO A 1  568  ? -31.626 -77.405  52.401  1.00 102.04 ? 568  PRO A CB    1 
ATOM   4317  C  CG    . PRO A 1  568  ? -30.917 -77.007  53.627  1.00 105.60 ? 568  PRO A CG    1 
ATOM   4318  C  CD    . PRO A 1  568  ? -29.896 -78.087  53.828  1.00 101.58 ? 568  PRO A CD    1 
ATOM   4319  N  N     . LYS A 1  569  ? -28.687 -77.132  50.075  1.00 92.31  ? 569  LYS A N     1 
ATOM   4320  C  CA    . LYS A 1  569  ? -27.916 -76.298  49.148  1.00 88.96  ? 569  LYS A CA    1 
ATOM   4321  C  C     . LYS A 1  569  ? -26.460 -76.781  49.082  1.00 91.13  ? 569  LYS A C     1 
ATOM   4322  O  O     . LYS A 1  569  ? -25.851 -76.965  50.134  1.00 90.67  ? 569  LYS A O     1 
ATOM   4323  C  CB    . LYS A 1  569  ? -27.937 -74.820  49.602  1.00 88.72  ? 569  LYS A CB    1 
ATOM   4324  C  CG    . LYS A 1  569  ? -27.293 -73.832  48.656  1.00 91.70  ? 569  LYS A CG    1 
ATOM   4325  C  CD    . LYS A 1  569  ? -27.835 -72.435  48.878  1.00 98.52  ? 569  LYS A CD    1 
ATOM   4326  C  CE    . LYS A 1  569  ? -28.881 -72.089  47.844  1.00 108.55 ? 569  LYS A CE    1 
ATOM   4327  N  NZ    . LYS A 1  569  ? -28.850 -70.650  47.477  1.00 111.97 ? 569  LYS A NZ    1 
ATOM   4328  N  N     . PRO A 1  570  ? -25.856 -76.939  47.882  1.00 86.25  ? 570  PRO A N     1 
ATOM   4329  C  CA    . PRO A 1  570  ? -24.421 -77.258  47.829  1.00 84.73  ? 570  PRO A CA    1 
ATOM   4330  C  C     . PRO A 1  570  ? -23.646 -75.937  47.970  1.00 85.35  ? 570  PRO A C     1 
ATOM   4331  O  O     . PRO A 1  570  ? -23.681 -75.091  47.070  1.00 83.86  ? 570  PRO A O     1 
ATOM   4332  C  CB    . PRO A 1  570  ? -24.241 -77.912  46.452  1.00 86.80  ? 570  PRO A CB    1 
ATOM   4333  C  CG    . PRO A 1  570  ? -25.529 -77.661  45.701  1.00 92.17  ? 570  PRO A CG    1 
ATOM   4334  C  CD    . PRO A 1  570  ? -26.405 -76.765  46.525  1.00 87.79  ? 570  PRO A CD    1 
ATOM   4335  N  N     . LEU A 1  571  ? -23.004 -75.734  49.131  1.00 80.45  ? 571  LEU A N     1 
ATOM   4336  C  CA    . LEU A 1  571  ? -22.292 -74.498  49.450  1.00 77.66  ? 571  LEU A CA    1 
ATOM   4337  C  C     . LEU A 1  571  ? -20.813 -74.688  49.727  1.00 80.96  ? 571  LEU A C     1 
ATOM   4338  O  O     . LEU A 1  571  ? -20.428 -75.581  50.486  1.00 81.77  ? 571  LEU A O     1 
ATOM   4339  C  CB    . LEU A 1  571  ? -22.971 -73.817  50.646  1.00 77.44  ? 571  LEU A CB    1 
ATOM   4340  C  CG    . LEU A 1  571  ? -23.524 -72.410  50.462  1.00 80.58  ? 571  LEU A CG    1 
ATOM   4341  C  CD1   . LEU A 1  571  ? -24.025 -72.161  49.046  1.00 80.70  ? 571  LEU A CD1   1 
ATOM   4342  C  CD2   . LEU A 1  571  ? -24.622 -72.145  51.450  1.00 83.36  ? 571  LEU A CD2   1 
ATOM   4343  N  N     . TRP A 1  572  ? -19.987 -73.827  49.118  1.00 75.61  ? 572  TRP A N     1 
ATOM   4344  C  CA    . TRP A 1  572  ? -18.535 -73.836  49.282  1.00 74.44  ? 572  TRP A CA    1 
ATOM   4345  C  C     . TRP A 1  572  ? -18.101 -72.717  50.218  1.00 77.20  ? 572  TRP A C     1 
ATOM   4346  O  O     . TRP A 1  572  ? -18.681 -71.634  50.174  1.00 76.29  ? 572  TRP A O     1 
ATOM   4347  C  CB    . TRP A 1  572  ? -17.838 -73.636  47.929  1.00 72.09  ? 572  TRP A CB    1 
ATOM   4348  C  CG    . TRP A 1  572  ? -17.793 -74.854  47.057  1.00 74.28  ? 572  TRP A CG    1 
ATOM   4349  C  CD1   . TRP A 1  572  ? -16.729 -75.684  46.867  1.00 77.43  ? 572  TRP A CD1   1 
ATOM   4350  C  CD2   . TRP A 1  572  ? -18.843 -75.345  46.213  1.00 75.30  ? 572  TRP A CD2   1 
ATOM   4351  N  NE1   . TRP A 1  572  ? -17.055 -76.674  45.970  1.00 78.17  ? 572  TRP A NE1   1 
ATOM   4352  C  CE2   . TRP A 1  572  ? -18.346 -76.488  45.548  1.00 80.11  ? 572  TRP A CE2   1 
ATOM   4353  C  CE3   . TRP A 1  572  ? -20.169 -74.942  45.967  1.00 77.06  ? 572  TRP A CE3   1 
ATOM   4354  C  CZ2   . TRP A 1  572  ? -19.121 -77.226  44.646  1.00 80.67  ? 572  TRP A CZ2   1 
ATOM   4355  C  CZ3   . TRP A 1  572  ? -20.934 -75.672  45.072  1.00 79.81  ? 572  TRP A CZ3   1 
ATOM   4356  C  CH2   . TRP A 1  572  ? -20.415 -76.807  44.433  1.00 81.28  ? 572  TRP A CH2   1 
ATOM   4357  N  N     . SER A 1  573  ? -17.068 -72.958  51.040  1.00 73.08  ? 573  SER A N     1 
ATOM   4358  C  CA    . SER A 1  573  ? -16.517 -71.925  51.920  1.00 71.02  ? 573  SER A CA    1 
ATOM   4359  C  C     . SER A 1  573  ? -15.415 -71.185  51.158  1.00 72.14  ? 573  SER A C     1 
ATOM   4360  O  O     . SER A 1  573  ? -14.834 -71.748  50.223  1.00 71.24  ? 573  SER A O     1 
ATOM   4361  C  CB    . SER A 1  573  ? -15.954 -72.541  53.196  1.00 74.90  ? 573  SER A CB    1 
ATOM   4362  O  OG    . SER A 1  573  ? -14.753 -73.259  52.958  1.00 83.22  ? 573  SER A OG    1 
ATOM   4363  N  N     . GLY A 1  574  ? -15.142 -69.942  51.559  1.00 67.23  ? 574  GLY A N     1 
ATOM   4364  C  CA    . GLY A 1  574  ? -14.110 -69.106  50.946  1.00 65.28  ? 574  GLY A CA    1 
ATOM   4365  C  C     . GLY A 1  574  ? -12.738 -69.746  50.997  1.00 68.20  ? 574  GLY A C     1 
ATOM   4366  O  O     . GLY A 1  574  ? -11.973 -69.684  50.026  1.00 67.04  ? 574  GLY A O     1 
ATOM   4367  N  N     . LYS A 1  575  ? -12.458 -70.412  52.137  1.00 64.47  ? 575  LYS A N     1 
ATOM   4368  C  CA    . LYS A 1  575  ? -11.238 -71.163  52.436  1.00 63.82  ? 575  LYS A CA    1 
ATOM   4369  C  C     . LYS A 1  575  ? -10.975 -72.241  51.357  1.00 66.93  ? 575  LYS A C     1 
ATOM   4370  O  O     . LYS A 1  575  ? -9.858  -72.325  50.843  1.00 65.83  ? 575  LYS A O     1 
ATOM   4371  C  CB    . LYS A 1  575  ? -11.341 -71.802  53.840  1.00 66.60  ? 575  LYS A CB    1 
ATOM   4372  C  CG    . LYS A 1  575  ? -11.495 -70.803  54.985  1.00 64.45  ? 575  LYS A CG    1 
ATOM   4373  C  CD    . LYS A 1  575  ? -11.161 -71.447  56.313  1.00 67.35  ? 575  LYS A CD    1 
ATOM   4374  C  CE    . LYS A 1  575  ? -11.757 -70.710  57.488  1.00 69.88  ? 575  LYS A CE    1 
ATOM   4375  N  NZ    . LYS A 1  575  ? -10.931 -69.546  57.895  1.00 69.62  ? 575  LYS A NZ    1 
ATOM   4376  N  N     . GLN A 1  576  ? -12.020 -73.018  50.989  1.00 63.20  ? 576  GLN A N     1 
ATOM   4377  C  CA    . GLN A 1  576  ? -11.961 -74.069  49.970  1.00 63.30  ? 576  GLN A CA    1 
ATOM   4378  C  C     . GLN A 1  576  ? -11.478 -73.543  48.618  1.00 64.31  ? 576  GLN A C     1 
ATOM   4379  O  O     . GLN A 1  576  ? -10.521 -74.072  48.051  1.00 63.26  ? 576  GLN A O     1 
ATOM   4380  C  CB    . GLN A 1  576  ? -13.349 -74.702  49.764  1.00 65.82  ? 576  GLN A CB    1 
ATOM   4381  C  CG    . GLN A 1  576  ? -13.736 -75.796  50.734  1.00 71.42  ? 576  GLN A CG    1 
ATOM   4382  C  CD    . GLN A 1  576  ? -15.105 -76.321  50.381  1.00 82.13  ? 576  GLN A CD    1 
ATOM   4383  O  OE1   . GLN A 1  576  ? -16.128 -75.663  50.583  1.00 73.55  ? 576  GLN A OE1   1 
ATOM   4384  N  NE2   . GLN A 1  576  ? -15.153 -77.507  49.814  1.00 77.07  ? 576  GLN A NE2   1 
ATOM   4385  N  N     . ILE A 1  577  ? -12.160 -72.523  48.093  1.00 59.81  ? 577  ILE A N     1 
ATOM   4386  C  CA    . ILE A 1  577  ? -11.849 -71.991  46.772  1.00 58.94  ? 577  ILE A CA    1 
ATOM   4387  C  C     . ILE A 1  577  ? -10.529 -71.217  46.679  1.00 61.60  ? 577  ILE A C     1 
ATOM   4388  O  O     . ILE A 1  577  ? -9.973  -71.069  45.587  1.00 60.97  ? 577  ILE A O     1 
ATOM   4389  C  CB    . ILE A 1  577  ? -13.064 -71.346  46.048  1.00 61.81  ? 577  ILE A CB    1 
ATOM   4390  C  CG1   . ILE A 1  577  ? -13.566 -70.088  46.766  1.00 61.68  ? 577  ILE A CG1   1 
ATOM   4391  C  CG2   . ILE A 1  577  ? -14.196 -72.361  45.838  1.00 63.50  ? 577  ILE A CG2   1 
ATOM   4392  C  CD1   . ILE A 1  577  ? -12.950 -68.805  46.260  1.00 70.61  ? 577  ILE A CD1   1 
ATOM   4393  N  N     . LEU A 1  578  ? -10.025 -70.736  47.819  1.00 56.87  ? 578  LEU A N     1 
ATOM   4394  C  CA    . LEU A 1  578  ? -8.741  -70.051  47.843  1.00 55.10  ? 578  LEU A CA    1 
ATOM   4395  C  C     . LEU A 1  578  ? -7.626  -71.115  47.906  1.00 60.44  ? 578  LEU A C     1 
ATOM   4396  O  O     . LEU A 1  578  ? -6.549  -70.906  47.347  1.00 59.79  ? 578  LEU A O     1 
ATOM   4397  C  CB    . LEU A 1  578  ? -8.674  -69.071  49.021  1.00 53.98  ? 578  LEU A CB    1 
ATOM   4398  C  CG    . LEU A 1  578  ? -7.328  -68.418  49.307  1.00 57.42  ? 578  LEU A CG    1 
ATOM   4399  C  CD1   . LEU A 1  578  ? -7.022  -67.307  48.315  1.00 56.46  ? 578  LEU A CD1   1 
ATOM   4400  C  CD2   . LEU A 1  578  ? -7.270  -67.924  50.730  1.00 60.00  ? 578  LEU A CD2   1 
ATOM   4401  N  N     . SER A 1  579  ? -7.911  -72.279  48.534  1.00 58.02  ? 579  SER A N     1 
ATOM   4402  C  CA    . SER A 1  579  ? -6.965  -73.395  48.651  1.00 58.54  ? 579  SER A CA    1 
ATOM   4403  C  C     . SER A 1  579  ? -6.588  -73.950  47.271  1.00 62.23  ? 579  SER A C     1 
ATOM   4404  O  O     . SER A 1  579  ? -5.554  -74.614  47.129  1.00 62.77  ? 579  SER A O     1 
ATOM   4405  C  CB    . SER A 1  579  ? -7.547  -74.500  49.523  1.00 63.44  ? 579  SER A CB    1 
ATOM   4406  O  OG    . SER A 1  579  ? -7.901  -74.043  50.817  1.00 71.09  ? 579  SER A OG    1 
ATOM   4407  N  N     . VAL A 1  580  ? -7.430  -73.650  46.255  1.00 57.08  ? 580  VAL A N     1 
ATOM   4408  C  CA    . VAL A 1  580  ? -7.232  -74.017  44.852  1.00 56.62  ? 580  VAL A CA    1 
ATOM   4409  C  C     . VAL A 1  580  ? -5.971  -73.276  44.352  1.00 60.02  ? 580  VAL A C     1 
ATOM   4410  O  O     . VAL A 1  580  ? -5.190  -73.843  43.580  1.00 59.96  ? 580  VAL A O     1 
ATOM   4411  C  CB    . VAL A 1  580  ? -8.490  -73.680  43.998  1.00 59.67  ? 580  VAL A CB    1 
ATOM   4412  C  CG1   . VAL A 1  580  ? -8.314  -74.085  42.536  1.00 59.49  ? 580  VAL A CG1   1 
ATOM   4413  C  CG2   . VAL A 1  580  ? -9.743  -74.320  44.580  1.00 60.57  ? 580  VAL A CG2   1 
ATOM   4414  N  N     . ALA A 1  581  ? -5.760  -72.026  44.832  1.00 55.55  ? 581  ALA A N     1 
ATOM   4415  C  CA    . ALA A 1  581  ? -4.598  -71.215  44.464  1.00 54.51  ? 581  ALA A CA    1 
ATOM   4416  C  C     . ALA A 1  581  ? -3.311  -71.749  45.089  1.00 58.77  ? 581  ALA A C     1 
ATOM   4417  O  O     . ALA A 1  581  ? -2.265  -71.666  44.445  1.00 59.35  ? 581  ALA A O     1 
ATOM   4418  C  CB    . ALA A 1  581  ? -4.811  -69.755  44.837  1.00 53.84  ? 581  ALA A CB    1 
ATOM   4419  N  N     . ILE A 1  582  ? -3.392  -72.319  46.316  1.00 54.28  ? 582  ILE A N     1 
ATOM   4420  C  CA    . ILE A 1  582  ? -2.244  -72.900  47.026  1.00 53.99  ? 582  ILE A CA    1 
ATOM   4421  C  C     . ILE A 1  582  ? -1.864  -74.235  46.366  1.00 59.45  ? 582  ILE A C     1 
ATOM   4422  O  O     . ILE A 1  582  ? -2.724  -75.127  46.282  1.00 60.26  ? 582  ILE A O     1 
ATOM   4423  C  CB    . ILE A 1  582  ? -2.516  -73.071  48.553  1.00 57.07  ? 582  ILE A CB    1 
ATOM   4424  C  CG1   . ILE A 1  582  ? -2.813  -71.733  49.224  1.00 55.78  ? 582  ILE A CG1   1 
ATOM   4425  C  CG2   . ILE A 1  582  ? -1.355  -73.780  49.268  1.00 58.44  ? 582  ILE A CG2   1 
ATOM   4426  C  CD1   . ILE A 1  582  ? -3.891  -71.798  50.215  1.00 62.54  ? 582  ILE A CD1   1 
ATOM   4427  N  N     . PRO A 1  583  ? -0.582  -74.410  45.935  1.00 56.10  ? 583  PRO A N     1 
ATOM   4428  C  CA    . PRO A 1  583  ? -0.180  -75.701  45.341  1.00 58.00  ? 583  PRO A CA    1 
ATOM   4429  C  C     . PRO A 1  583  ? -0.076  -76.841  46.372  1.00 65.43  ? 583  PRO A C     1 
ATOM   4430  O  O     . PRO A 1  583  ? -0.079  -76.596  47.587  1.00 65.20  ? 583  PRO A O     1 
ATOM   4431  C  CB    . PRO A 1  583  ? 1.164   -75.386  44.671  1.00 58.85  ? 583  PRO A CB    1 
ATOM   4432  C  CG    . PRO A 1  583  ? 1.711   -74.247  45.426  1.00 61.18  ? 583  PRO A CG    1 
ATOM   4433  C  CD    . PRO A 1  583  ? 0.556   -73.466  45.991  1.00 55.83  ? 583  PRO A CD    1 
ATOM   4434  N  N     . ASN A 1  584  ? 0.007   -78.087  45.886  1.00 64.16  ? 584  ASN A N     1 
ATOM   4435  C  CA    . ASN A 1  584  ? 0.114   -79.259  46.754  1.00 66.26  ? 584  ASN A CA    1 
ATOM   4436  C  C     . ASN A 1  584  ? 1.500   -79.369  47.417  1.00 70.82  ? 584  ASN A C     1 
ATOM   4437  O  O     . ASN A 1  584  ? 2.485   -78.870  46.875  1.00 70.30  ? 584  ASN A O     1 
ATOM   4438  C  CB    . ASN A 1  584  ? -0.231  -80.532  45.976  1.00 70.25  ? 584  ASN A CB    1 
ATOM   4439  C  CG    . ASN A 1  584  ? -1.550  -80.454  45.251  1.00 96.07  ? 584  ASN A CG    1 
ATOM   4440  O  OD1   . ASN A 1  584  ? -1.599  -80.489  44.020  1.00 90.64  ? 584  ASN A OD1   1 
ATOM   4441  N  ND2   . ASN A 1  584  ? -2.643  -80.301  45.993  1.00 89.51  ? 584  ASN A ND2   1 
ATOM   4442  N  N     . GLY A 1  585  ? 1.549   -80.002  48.586  1.00 67.86  ? 585  GLY A N     1 
ATOM   4443  C  CA    . GLY A 1  585  ? 2.784   -80.191  49.339  1.00 68.07  ? 585  GLY A CA    1 
ATOM   4444  C  C     . GLY A 1  585  ? 3.167   -79.019  50.220  1.00 70.59  ? 585  GLY A C     1 
ATOM   4445  O  O     . GLY A 1  585  ? 4.240   -79.034  50.836  1.00 70.60  ? 585  GLY A O     1 
ATOM   4446  N  N     . ILE A 1  586  ? 2.298   -77.989  50.284  1.00 65.51  ? 586  ILE A N     1 
ATOM   4447  C  CA    . ILE A 1  586  ? 2.530   -76.795  51.101  1.00 63.45  ? 586  ILE A CA    1 
ATOM   4448  C  C     . ILE A 1  586  ? 1.967   -77.021  52.497  1.00 67.61  ? 586  ILE A C     1 
ATOM   4449  O  O     . ILE A 1  586  ? 0.754   -77.152  52.676  1.00 66.53  ? 586  ILE A O     1 
ATOM   4450  C  CB    . ILE A 1  586  ? 2.036   -75.476  50.414  1.00 64.20  ? 586  ILE A CB    1 
ATOM   4451  C  CG1   . ILE A 1  586  ? 2.696   -75.255  49.026  1.00 63.84  ? 586  ILE A CG1   1 
ATOM   4452  C  CG2   . ILE A 1  586  ? 2.196   -74.242  51.319  1.00 62.85  ? 586  ILE A CG2   1 
ATOM   4453  C  CD1   . ILE A 1  586  ? 4.262   -75.186  48.984  1.00 70.17  ? 586  ILE A CD1   1 
ATOM   4454  N  N     . HIS A 1  587  ? 2.864   -77.110  53.474  1.00 65.88  ? 587  HIS A N     1 
ATOM   4455  C  CA    . HIS A 1  587  ? 2.471   -77.335  54.856  1.00 67.37  ? 587  HIS A CA    1 
ATOM   4456  C  C     . HIS A 1  587  ? 2.844   -76.128  55.711  1.00 69.98  ? 587  HIS A C     1 
ATOM   4457  O  O     . HIS A 1  587  ? 4.005   -75.712  55.731  1.00 69.63  ? 587  HIS A O     1 
ATOM   4458  C  CB    . HIS A 1  587  ? 3.038   -78.673  55.401  1.00 70.85  ? 587  HIS A CB    1 
ATOM   4459  C  CG    . HIS A 1  587  ? 2.895   -79.837  54.455  1.00 76.27  ? 587  HIS A CG    1 
ATOM   4460  N  ND1   . HIS A 1  587  ? 1.667   -80.175  53.890  1.00 78.56  ? 587  HIS A ND1   1 
ATOM   4461  C  CD2   . HIS A 1  587  ? 3.834   -80.701  53.998  1.00 79.61  ? 587  HIS A CD2   1 
ATOM   4462  C  CE1   . HIS A 1  587  ? 1.905   -81.214  53.103  1.00 79.29  ? 587  HIS A CE1   1 
ATOM   4463  N  NE2   . HIS A 1  587  ? 3.191   -81.572  53.138  1.00 80.31  ? 587  HIS A NE2   1 
ATOM   4464  N  N     . LEU A 1  588  ? 1.843   -75.530  56.372  1.00 65.52  ? 588  LEU A N     1 
ATOM   4465  C  CA    . LEU A 1  588  ? 2.053   -74.360  57.218  1.00 64.34  ? 588  LEU A CA    1 
ATOM   4466  C  C     . LEU A 1  588  ? 1.227   -74.449  58.497  1.00 69.67  ? 588  LEU A C     1 
ATOM   4467  O  O     . LEU A 1  588  ? 0.046   -74.792  58.451  1.00 69.49  ? 588  LEU A O     1 
ATOM   4468  C  CB    . LEU A 1  588  ? 1.729   -73.079  56.435  1.00 62.51  ? 588  LEU A CB    1 
ATOM   4469  C  CG    . LEU A 1  588  ? 2.271   -71.773  56.995  1.00 65.60  ? 588  LEU A CG    1 
ATOM   4470  C  CD1   . LEU A 1  588  ? 2.826   -70.918  55.901  1.00 64.27  ? 588  LEU A CD1   1 
ATOM   4471  C  CD2   . LEU A 1  588  ? 1.200   -71.014  57.740  1.00 67.79  ? 588  LEU A CD2   1 
ATOM   4472  N  N     . GLN A 1  589  ? 1.859   -74.126  59.630  1.00 67.46  ? 589  GLN A N     1 
ATOM   4473  C  CA    . GLN A 1  589  ? 1.243   -74.151  60.954  1.00 68.84  ? 589  GLN A CA    1 
ATOM   4474  C  C     . GLN A 1  589  ? 1.610   -72.865  61.713  1.00 74.31  ? 589  GLN A C     1 
ATOM   4475  O  O     . GLN A 1  589  ? 2.752   -72.406  61.594  1.00 74.12  ? 589  GLN A O     1 
ATOM   4476  C  CB    . GLN A 1  589  ? 1.741   -75.385  61.717  1.00 72.12  ? 589  GLN A CB    1 
ATOM   4477  C  CG    . GLN A 1  589  ? 0.836   -75.806  62.857  1.00 90.76  ? 589  GLN A CG    1 
ATOM   4478  C  CD    . GLN A 1  589  ? 1.536   -76.764  63.777  1.00 111.52 ? 589  GLN A CD    1 
ATOM   4479  O  OE1   . GLN A 1  589  ? 2.315   -76.364  64.650  1.00 106.67 ? 589  GLN A OE1   1 
ATOM   4480  N  NE2   . GLN A 1  589  ? 1.277   -78.052  63.596  1.00 105.54 ? 589  GLN A NE2   1 
ATOM   4481  N  N     . ARG A 1  590  ? 0.665   -72.278  62.489  1.00 71.48  ? 590  ARG A N     1 
ATOM   4482  C  CA    . ARG A 1  590  ? 1.001   -71.047  63.204  1.00 70.88  ? 590  ARG A CA    1 
ATOM   4483  C  C     . ARG A 1  590  ? 0.821   -70.981  64.712  1.00 79.89  ? 590  ARG A C     1 
ATOM   4484  O  O     . ARG A 1  590  ? 1.813   -71.108  65.443  1.00 81.12  ? 590  ARG A O     1 
ATOM   4485  C  CB    . ARG A 1  590  ? 0.474   -69.793  62.516  1.00 66.58  ? 590  ARG A CB    1 
ATOM   4486  C  CG    . ARG A 1  590  ? 1.578   -68.760  62.291  1.00 66.98  ? 590  ARG A CG    1 
ATOM   4487  C  CD    . ARG A 1  590  ? 1.223   -67.320  62.671  1.00 65.20  ? 590  ARG A CD    1 
ATOM   4488  N  NE    . ARG A 1  590  ? -0.175  -66.943  62.424  1.00 68.82  ? 590  ARG A NE    1 
ATOM   4489  C  CZ    . ARG A 1  590  ? -0.720  -66.745  61.225  1.00 84.50  ? 590  ARG A CZ    1 
ATOM   4490  N  NH1   . ARG A 1  590  ? -0.001  -66.919  60.120  1.00 70.37  ? 590  ARG A NH1   1 
ATOM   4491  N  NH2   . ARG A 1  590  ? -1.999  -66.406  61.120  1.00 73.97  ? 590  ARG A NH2   1 
ATOM   4492  N  N     . PHE A 1  591  ? -0.426  -70.739  65.178  1.00 77.83  ? 591  PHE A N     1 
ATOM   4493  C  CA    . PHE A 1  591  ? -0.801  -70.545  66.588  1.00 78.43  ? 591  PHE A CA    1 
ATOM   4494  C  C     . PHE A 1  591  ? -0.503  -69.109  67.032  1.00 82.10  ? 591  PHE A C     1 
ATOM   4495  O  O     . PHE A 1  591  ? 0.655   -68.686  67.047  1.00 80.44  ? 591  PHE A O     1 
ATOM   4496  C  CB    . PHE A 1  591  ? -0.225  -71.614  67.551  1.00 81.57  ? 591  PHE A CB    1 
ATOM   4497  C  CG    . PHE A 1  591  ? -0.739  -73.009  67.291  1.00 84.56  ? 591  PHE A CG    1 
ATOM   4498  C  CD1   . PHE A 1  591  ? -0.130  -73.829  66.346  1.00 88.45  ? 591  PHE A CD1   1 
ATOM   4499  C  CD2   . PHE A 1  591  ? -1.833  -73.505  67.988  1.00 87.81  ? 591  PHE A CD2   1 
ATOM   4500  C  CE1   . PHE A 1  591  ? -0.620  -75.114  66.088  1.00 91.07  ? 591  PHE A CE1   1 
ATOM   4501  C  CE2   . PHE A 1  591  ? -2.321  -74.792  67.734  1.00 92.57  ? 591  PHE A CE2   1 
ATOM   4502  C  CZ    . PHE A 1  591  ? -1.708  -75.589  66.789  1.00 91.29  ? 591  PHE A CZ    1 
ATOM   4503  N  N     . ASP A 1  592  ? -1.574  -68.349  67.321  1.00 79.98  ? 592  ASP A N     1 
ATOM   4504  C  CA    . ASP A 1  592  ? -1.505  -66.948  67.719  1.00 79.65  ? 592  ASP A CA    1 
ATOM   4505  C  C     . ASP A 1  592  ? -1.783  -66.787  69.211  1.00 86.30  ? 592  ASP A C     1 
ATOM   4506  O  O     . ASP A 1  592  ? -0.840  -66.589  69.981  1.00 86.49  ? 592  ASP A O     1 
ATOM   4507  C  CB    . ASP A 1  592  ? -2.468  -66.079  66.873  1.00 80.56  ? 592  ASP A CB    1 
ATOM   4508  C  CG    . ASP A 1  592  ? -2.204  -66.023  65.374  1.00 88.43  ? 592  ASP A CG    1 
ATOM   4509  O  OD1   . ASP A 1  592  ? -1.053  -66.289  64.959  1.00 89.46  ? 592  ASP A OD1   1 
ATOM   4510  O  OD2   . ASP A 1  592  ? -3.136  -65.660  64.622  1.00 90.88  ? 592  ASP A OD2   1 
ATOM   4511  N  N     . GLU A 1  593  ? -3.060  -66.869  69.624  1.00 84.56  ? 593  GLU A N     1 
ATOM   4512  C  CA    . GLU A 1  593  ? -3.418  -66.723  71.030  1.00 86.04  ? 593  GLU A CA    1 
ATOM   4513  C  C     . GLU A 1  593  ? -4.407  -67.797  71.467  1.00 93.53  ? 593  GLU A C     1 
ATOM   4514  O  O     . GLU A 1  593  ? -3.991  -68.803  72.052  1.00 94.93  ? 593  GLU A O     1 
ATOM   4515  C  CB    . GLU A 1  593  ? -3.920  -65.301  71.332  1.00 86.40  ? 593  GLU A CB    1 
ATOM   4516  C  CG    . GLU A 1  593  ? -3.678  -64.865  72.770  1.00 99.79  ? 593  GLU A CG    1 
ATOM   4517  C  CD    . GLU A 1  593  ? -2.355  -64.177  73.059  1.00 123.30 ? 593  GLU A CD    1 
ATOM   4518  O  OE1   . GLU A 1  593  ? -2.386  -63.070  73.645  1.00 118.88 ? 593  GLU A OE1   1 
ATOM   4519  O  OE2   . GLU A 1  593  ? -1.290  -64.748  72.729  1.00 117.61 ? 593  GLU A OE2   1 
ATOM   4520  N  N     . GLY A 1  594  ? -5.687  -67.605  71.135  1.00 90.66  ? 594  GLY A N     1 
ATOM   4521  C  CA    . GLY A 1  594  ? -6.760  -68.540  71.466  1.00 92.14  ? 594  GLY A CA    1 
ATOM   4522  C  C     . GLY A 1  594  ? -6.727  -69.838  70.681  1.00 96.77  ? 594  GLY A C     1 
ATOM   4523  O  O     . GLY A 1  594  ? -7.614  -70.680  70.848  1.00 98.24  ? 594  GLY A O     1 
ATOM   4524  N  N     . THR A 1  595  ? -5.698  -69.996  69.816  1.00 91.81  ? 595  THR A N     1 
ATOM   4525  C  CA    . THR A 1  595  ? -5.422  -71.145  68.945  1.00 91.77  ? 595  THR A CA    1 
ATOM   4526  C  C     . THR A 1  595  ? -5.262  -72.420  69.749  1.00 95.72  ? 595  THR A C     1 
ATOM   4527  O  O     . THR A 1  595  ? -4.427  -72.469  70.656  1.00 95.68  ? 595  THR A O     1 
ATOM   4528  C  CB    . THR A 1  595  ? -4.203  -70.864  68.083  1.00 97.35  ? 595  THR A CB    1 
ATOM   4529  O  OG1   . THR A 1  595  ? -3.206  -70.197  68.865  1.00 96.80  ? 595  THR A OG1   1 
ATOM   4530  C  CG2   . THR A 1  595  ? -4.543  -70.053  66.874  1.00 92.83  ? 595  THR A CG2   1 
ATOM   4531  N  N     . THR A 1  596  ? -6.097  -73.433  69.442  1.00 91.97  ? 596  THR A N     1 
ATOM   4532  C  CA    . THR A 1  596  ? -6.157  -74.693  70.181  1.00 93.34  ? 596  THR A CA    1 
ATOM   4533  C  C     . THR A 1  596  ? -6.372  -75.917  69.283  1.00 99.00  ? 596  THR A C     1 
ATOM   4534  O  O     . THR A 1  596  ? -6.950  -76.903  69.759  1.00 101.52 ? 596  THR A O     1 
ATOM   4535  C  CB    . THR A 1  596  ? -7.330  -74.623  71.194  1.00 97.84  ? 596  THR A CB    1 
ATOM   4536  O  OG1   . THR A 1  596  ? -8.517  -74.199  70.523  1.00 93.15  ? 596  THR A OG1   1 
ATOM   4537  C  CG2   . THR A 1  596  ? -7.047  -73.727  72.393  1.00 96.11  ? 596  THR A CG2   1 
ATOM   4538  N  N     . LEU A 1  597  ? -5.937  -75.873  67.995  1.00 93.76  ? 597  LEU A N     1 
ATOM   4539  C  CA    . LEU A 1  597  ? -6.166  -76.950  66.998  1.00 94.37  ? 597  LEU A CA    1 
ATOM   4540  C  C     . LEU A 1  597  ? -7.674  -77.092  66.716  1.00 98.78  ? 597  LEU A C     1 
ATOM   4541  O  O     . LEU A 1  597  ? -8.086  -77.843  65.830  1.00 99.08  ? 597  LEU A O     1 
ATOM   4542  C  CB    . LEU A 1  597  ? -5.557  -78.319  67.400  1.00 96.21  ? 597  LEU A CB    1 
ATOM   4543  C  CG    . LEU A 1  597  ? -4.038  -78.447  67.349  1.00 100.58 ? 597  LEU A CG    1 
ATOM   4544  C  CD1   . LEU A 1  597  ? -3.541  -79.400  68.413  1.00 102.72 ? 597  LEU A CD1   1 
ATOM   4545  C  CD2   . LEU A 1  597  ? -3.564  -78.906  65.982  1.00 102.40 ? 597  LEU A CD2   1 
ATOM   4546  N  N     . LEU A 1  598  ? -8.479  -76.347  67.490  1.00 94.93  ? 598  LEU A N     1 
ATOM   4547  C  CA    . LEU A 1  598  ? -9.929  -76.251  67.435  1.00 94.97  ? 598  LEU A CA    1 
ATOM   4548  C  C     . LEU A 1  598  ? -10.339 -74.786  67.204  1.00 96.75  ? 598  LEU A C     1 
ATOM   4549  O  O     . LEU A 1  598  ? -11.532 -74.486  67.260  1.00 96.64  ? 598  LEU A O     1 
ATOM   4550  C  CB    . LEU A 1  598  ? -10.531 -76.751  68.759  1.00 96.60  ? 598  LEU A CB    1 
ATOM   4551  C  CG    . LEU A 1  598  ? -11.545 -77.889  68.705  1.00 103.28 ? 598  LEU A CG    1 
ATOM   4552  C  CD1   . LEU A 1  598  ? -12.337 -77.941  69.988  1.00 104.74 ? 598  LEU A CD1   1 
ATOM   4553  C  CD2   . LEU A 1  598  ? -12.508 -77.758  67.526  1.00 105.36 ? 598  LEU A CD2   1 
ATOM   4554  N  N     . SER A 1  599  ? -9.345  -73.889  66.933  1.00 91.04  ? 599  SER A N     1 
ATOM   4555  C  CA    . SER A 1  599  ? -9.445  -72.439  66.669  1.00 88.53  ? 599  SER A CA    1 
ATOM   4556  C  C     . SER A 1  599  ? -10.852 -71.829  66.815  1.00 91.57  ? 599  SER A C     1 
ATOM   4557  O  O     . SER A 1  599  ? -11.510 -71.572  65.800  1.00 90.81  ? 599  SER A O     1 
ATOM   4558  C  CB    . SER A 1  599  ? -8.847  -72.099  65.309  1.00 90.35  ? 599  SER A CB    1 
ATOM   4559  O  OG    . SER A 1  599  ? -7.768  -71.194  65.453  1.00 97.81  ? 599  SER A OG    1 
ATOM   4560  N  N     . PRO A 1  600  ? -11.349 -71.624  68.064  1.00 87.71  ? 600  PRO A N     1 
ATOM   4561  C  CA    . PRO A 1  600  ? -12.712 -71.082  68.227  1.00 87.13  ? 600  PRO A CA    1 
ATOM   4562  C  C     . PRO A 1  600  ? -12.854 -69.678  67.654  1.00 87.21  ? 600  PRO A C     1 
ATOM   4563  O  O     . PRO A 1  600  ? -13.882 -69.369  67.052  1.00 86.96  ? 600  PRO A O     1 
ATOM   4564  C  CB    . PRO A 1  600  ? -12.940 -71.126  69.741  1.00 90.04  ? 600  PRO A CB    1 
ATOM   4565  C  CG    . PRO A 1  600  ? -11.579 -71.136  70.335  1.00 94.22  ? 600  PRO A CG    1 
ATOM   4566  C  CD    . PRO A 1  600  ? -10.714 -71.884  69.373  1.00 89.75  ? 600  PRO A CD    1 
ATOM   4567  N  N     . LYS A 1  601  ? -11.793 -68.861  67.788  1.00 80.20  ? 601  LYS A N     1 
ATOM   4568  C  CA    . LYS A 1  601  ? -11.751 -67.504  67.271  1.00 77.24  ? 601  LYS A CA    1 
ATOM   4569  C  C     . LYS A 1  601  ? -11.401 -67.480  65.775  1.00 79.25  ? 601  LYS A C     1 
ATOM   4570  O  O     . LYS A 1  601  ? -11.399 -66.399  65.177  1.00 77.70  ? 601  LYS A O     1 
ATOM   4571  C  CB    . LYS A 1  601  ? -10.761 -66.664  68.089  1.00 78.25  ? 601  LYS A CB    1 
ATOM   4572  C  CG    . LYS A 1  601  ? -11.396 -65.991  69.301  1.00 90.88  ? 601  LYS A CG    1 
ATOM   4573  C  CD    . LYS A 1  601  ? -10.520 -64.863  69.881  1.00 99.89  ? 601  LYS A CD    1 
ATOM   4574  C  CE    . LYS A 1  601  ? -10.754 -63.507  69.238  1.00 106.12 ? 601  LYS A CE    1 
ATOM   4575  N  NZ    . LYS A 1  601  ? -9.939  -62.435  69.872  1.00 109.84 ? 601  LYS A NZ    1 
ATOM   4576  N  N     . ASP A 1  602  ? -11.135 -68.674  65.169  1.00 75.56  ? 602  ASP A N     1 
ATOM   4577  C  CA    . ASP A 1  602  ? -10.737 -68.871  63.762  1.00 74.16  ? 602  ASP A CA    1 
ATOM   4578  C  C     . ASP A 1  602  ? -9.443  -68.082  63.483  1.00 75.88  ? 602  ASP A C     1 
ATOM   4579  O  O     . ASP A 1  602  ? -9.343  -67.341  62.503  1.00 74.57  ? 602  ASP A O     1 
ATOM   4580  C  CB    . ASP A 1  602  ? -11.897 -68.535  62.780  1.00 75.36  ? 602  ASP A CB    1 
ATOM   4581  C  CG    . ASP A 1  602  ? -11.753 -68.934  61.309  1.00 80.27  ? 602  ASP A CG    1 
ATOM   4582  O  OD1   . ASP A 1  602  ? -10.999 -69.893  61.018  1.00 80.86  ? 602  ASP A OD1   1 
ATOM   4583  O  OD2   . ASP A 1  602  ? -12.459 -68.338  60.460  1.00 82.10  ? 602  ASP A OD2   1 
ATOM   4584  N  N     . ASN A 1  603  ? -8.471  -68.214  64.403  1.00 72.06  ? 603  ASN A N     1 
ATOM   4585  C  CA    . ASN A 1  603  ? -7.173  -67.550  64.313  1.00 70.63  ? 603  ASN A CA    1 
ATOM   4586  C  C     . ASN A 1  603  ? -6.059  -68.556  64.012  1.00 74.37  ? 603  ASN A C     1 
ATOM   4587  O  O     . ASN A 1  603  ? -6.361  -69.718  63.739  1.00 74.89  ? 603  ASN A O     1 
ATOM   4588  C  CB    . ASN A 1  603  ? -6.889  -66.631  65.535  1.00 71.68  ? 603  ASN A CB    1 
ATOM   4589  C  CG    . ASN A 1  603  ? -6.820  -67.288  66.892  1.00 99.87  ? 603  ASN A CG    1 
ATOM   4590  O  OD1   . ASN A 1  603  ? -7.682  -68.086  67.290  1.00 100.97 ? 603  ASN A OD1   1 
ATOM   4591  N  ND2   . ASN A 1  603  ? -5.825  -66.891  67.671  1.00 89.49  ? 603  ASN A ND2   1 
ATOM   4592  N  N     . GLY A 1  604  ? -4.805  -68.096  64.001  1.00 70.16  ? 604  GLY A N     1 
ATOM   4593  C  CA    . GLY A 1  604  ? -3.648  -68.923  63.672  1.00 70.47  ? 604  GLY A CA    1 
ATOM   4594  C  C     . GLY A 1  604  ? -3.710  -69.382  62.232  1.00 74.28  ? 604  GLY A C     1 
ATOM   4595  O  O     . GLY A 1  604  ? -4.317  -68.697  61.398  1.00 73.86  ? 604  GLY A O     1 
ATOM   4596  N  N     . MET A 1  605  ? -3.105  -70.547  61.928  1.00 70.28  ? 605  MET A N     1 
ATOM   4597  C  CA    . MET A 1  605  ? -3.114  -71.112  60.576  1.00 69.35  ? 605  MET A CA    1 
ATOM   4598  C  C     . MET A 1  605  ? -2.739  -72.580  60.575  1.00 74.73  ? 605  MET A C     1 
ATOM   4599  O  O     . MET A 1  605  ? -1.893  -73.015  61.358  1.00 75.65  ? 605  MET A O     1 
ATOM   4600  C  CB    . MET A 1  605  ? -2.167  -70.339  59.627  1.00 69.99  ? 605  MET A CB    1 
ATOM   4601  C  CG    . MET A 1  605  ? -2.478  -70.536  58.153  1.00 73.05  ? 605  MET A CG    1 
ATOM   4602  S  SD    . MET A 1  605  ? -3.908  -69.581  57.607  1.00 76.04  ? 605  MET A SD    1 
ATOM   4603  C  CE    . MET A 1  605  ? -4.713  -70.755  56.667  1.00 73.80  ? 605  MET A CE    1 
ATOM   4604  N  N     . LEU A 1  606  ? -3.372  -73.333  59.670  1.00 70.87  ? 606  LEU A N     1 
ATOM   4605  C  CA    . LEU A 1  606  ? -3.107  -74.735  59.407  1.00 71.44  ? 606  LEU A CA    1 
ATOM   4606  C  C     . LEU A 1  606  ? -3.442  -75.031  57.956  1.00 73.79  ? 606  LEU A C     1 
ATOM   4607  O  O     . LEU A 1  606  ? -4.596  -74.904  57.539  1.00 72.17  ? 606  LEU A O     1 
ATOM   4608  C  CB    . LEU A 1  606  ? -3.825  -75.688  60.377  1.00 73.07  ? 606  LEU A CB    1 
ATOM   4609  C  CG    . LEU A 1  606  ? -3.467  -77.172  60.234  1.00 79.35  ? 606  LEU A CG    1 
ATOM   4610  C  CD1   . LEU A 1  606  ? -1.997  -77.425  60.521  1.00 79.88  ? 606  LEU A CD1   1 
ATOM   4611  C  CD2   . LEU A 1  606  ? -4.312  -78.020  61.134  1.00 82.96  ? 606  LEU A CD2   1 
ATOM   4612  N  N     . ILE A 1  607  ? -2.395  -75.353  57.182  1.00 70.74  ? 607  ILE A N     1 
ATOM   4613  C  CA    . ILE A 1  607  ? -2.452  -75.693  55.761  1.00 70.75  ? 607  ILE A CA    1 
ATOM   4614  C  C     . ILE A 1  607  ? -1.791  -77.063  55.608  1.00 77.03  ? 607  ILE A C     1 
ATOM   4615  O  O     . ILE A 1  607  ? -0.633  -77.225  55.990  1.00 76.88  ? 607  ILE A O     1 
ATOM   4616  C  CB    . ILE A 1  607  ? -1.755  -74.618  54.865  1.00 72.14  ? 607  ILE A CB    1 
ATOM   4617  C  CG1   . ILE A 1  607  ? -2.172  -73.174  55.254  1.00 71.28  ? 607  ILE A CG1   1 
ATOM   4618  C  CG2   . ILE A 1  607  ? -1.997  -74.904  53.380  1.00 72.68  ? 607  ILE A CG2   1 
ATOM   4619  C  CD1   . ILE A 1  607  ? -1.339  -71.986  54.659  1.00 77.91  ? 607  ILE A CD1   1 
ATOM   4620  N  N     . ILE A 1  608  ? -2.542  -78.052  55.109  1.00 75.73  ? 608  ILE A N     1 
ATOM   4621  C  CA    . ILE A 1  608  ? -2.045  -79.410  54.872  1.00 78.25  ? 608  ILE A CA    1 
ATOM   4622  C  C     . ILE A 1  608  ? -2.319  -79.722  53.400  1.00 85.53  ? 608  ILE A C     1 
ATOM   4623  O  O     . ILE A 1  608  ? -3.486  -79.791  52.994  1.00 85.87  ? 608  ILE A O     1 
ATOM   4624  C  CB    . ILE A 1  608  ? -2.638  -80.446  55.872  1.00 83.08  ? 608  ILE A CB    1 
ATOM   4625  C  CG1   . ILE A 1  608  ? -2.221  -80.111  57.334  1.00 82.92  ? 608  ILE A CG1   1 
ATOM   4626  C  CG2   . ILE A 1  608  ? -2.216  -81.877  55.494  1.00 85.82  ? 608  ILE A CG2   1 
ATOM   4627  C  CD1   . ILE A 1  608  ? -3.193  -80.536  58.417  1.00 87.43  ? 608  ILE A CD1   1 
ATOM   4628  N  N     . ASP A 1  609  ? -1.233  -79.848  52.593  1.00 83.53  ? 609  ASP A N     1 
ATOM   4629  C  CA    . ASP A 1  609  ? -1.251  -80.018  51.130  1.00 83.85  ? 609  ASP A CA    1 
ATOM   4630  C  C     . ASP A 1  609  ? -1.789  -78.698  50.526  1.00 88.04  ? 609  ASP A C     1 
ATOM   4631  O  O     . ASP A 1  609  ? -1.562  -77.625  51.097  1.00 85.60  ? 609  ASP A O     1 
ATOM   4632  C  CB    . ASP A 1  609  ? -2.074  -81.261  50.693  1.00 87.35  ? 609  ASP A CB    1 
ATOM   4633  C  CG    . ASP A 1  609  ? -1.388  -82.238  49.744  1.00 98.94  ? 609  ASP A CG    1 
ATOM   4634  O  OD1   . ASP A 1  609  ? -0.144  -82.183  49.625  1.00 100.02 ? 609  ASP A OD1   1 
ATOM   4635  O  OD2   . ASP A 1  609  ? -2.092  -83.091  49.159  1.00 104.62 ? 609  ASP A OD2   1 
ATOM   4636  N  N     . GLY A 1  610  ? -2.509  -78.778  49.411  1.00 87.06  ? 610  GLY A N     1 
ATOM   4637  C  CA    . GLY A 1  610  ? -3.094  -77.596  48.777  1.00 85.96  ? 610  GLY A CA    1 
ATOM   4638  C  C     . GLY A 1  610  ? -4.479  -77.269  49.310  1.00 89.25  ? 610  GLY A C     1 
ATOM   4639  O  O     . GLY A 1  610  ? -5.380  -76.958  48.517  1.00 89.01  ? 610  GLY A O     1 
ATOM   4640  N  N     . GLN A 1  611  ? -4.658  -77.369  50.672  1.00 83.26  ? 611  GLN A N     1 
ATOM   4641  C  CA    . GLN A 1  611  ? -5.920  -77.146  51.390  1.00 81.40  ? 611  GLN A CA    1 
ATOM   4642  C  C     . GLN A 1  611  ? -5.718  -76.537  52.765  1.00 81.58  ? 611  GLN A C     1 
ATOM   4643  O  O     . GLN A 1  611  ? -4.907  -77.044  53.538  1.00 82.03  ? 611  GLN A O     1 
ATOM   4644  C  CB    . GLN A 1  611  ? -6.723  -78.455  51.508  1.00 84.42  ? 611  GLN A CB    1 
ATOM   4645  C  CG    . GLN A 1  611  ? -7.623  -78.761  50.304  1.00 95.00  ? 611  GLN A CG    1 
ATOM   4646  C  CD    . GLN A 1  611  ? -8.780  -77.796  50.135  1.00 108.99 ? 611  GLN A CD    1 
ATOM   4647  O  OE1   . GLN A 1  611  ? -9.340  -77.266  51.108  1.00 105.94 ? 611  GLN A OE1   1 
ATOM   4648  N  NE2   . GLN A 1  611  ? -9.160  -77.540  48.888  1.00 94.54  ? 611  GLN A NE2   1 
ATOM   4649  N  N     . ILE A 1  612  ? -6.465  -75.462  53.080  1.00 75.07  ? 612  ILE A N     1 
ATOM   4650  C  CA    . ILE A 1  612  ? -6.367  -74.793  54.380  1.00 73.61  ? 612  ILE A CA    1 
ATOM   4651  C  C     . ILE A 1  612  ? -7.379  -75.365  55.347  1.00 78.53  ? 612  ILE A C     1 
ATOM   4652  O  O     . ILE A 1  612  ? -8.581  -75.359  55.072  1.00 78.72  ? 612  ILE A O     1 
ATOM   4653  C  CB    . ILE A 1  612  ? -6.316  -73.239  54.349  1.00 74.65  ? 612  ILE A CB    1 
ATOM   4654  C  CG1   . ILE A 1  612  ? -7.661  -72.592  53.991  1.00 74.77  ? 612  ILE A CG1   1 
ATOM   4655  C  CG2   . ILE A 1  612  ? -5.193  -72.724  53.451  1.00 74.05  ? 612  ILE A CG2   1 
ATOM   4656  C  CD1   . ILE A 1  612  ? -7.801  -71.198  54.489  1.00 82.06  ? 612  ILE A CD1   1 
ATOM   4657  N  N     . ILE A 1  613  ? -6.873  -75.918  56.455  1.00 75.44  ? 613  ILE A N     1 
ATOM   4658  C  CA    . ILE A 1  613  ? -7.655  -76.585  57.494  1.00 76.02  ? 613  ILE A CA    1 
ATOM   4659  C  C     . ILE A 1  613  ? -8.402  -75.592  58.391  1.00 78.64  ? 613  ILE A C     1 
ATOM   4660  O  O     . ILE A 1  613  ? -9.618  -75.731  58.543  1.00 79.06  ? 613  ILE A O     1 
ATOM   4661  C  CB    . ILE A 1  613  ? -6.775  -77.607  58.260  1.00 80.06  ? 613  ILE A CB    1 
ATOM   4662  C  CG1   . ILE A 1  613  ? -6.112  -78.654  57.310  1.00 80.83  ? 613  ILE A CG1   1 
ATOM   4663  C  CG2   . ILE A 1  613  ? -7.515  -78.252  59.417  1.00 82.16  ? 613  ILE A CG2   1 
ATOM   4664  C  CD1   . ILE A 1  613  ? -7.029  -79.643  56.523  1.00 85.97  ? 613  ILE A CD1   1 
ATOM   4665  N  N     . PHE A 1  614  ? -7.688  -74.596  58.971  1.00 73.02  ? 614  PHE A N     1 
ATOM   4666  C  CA    . PHE A 1  614  ? -8.291  -73.547  59.807  1.00 71.72  ? 614  PHE A CA    1 
ATOM   4667  C  C     . PHE A 1  614  ? -7.535  -72.213  59.764  1.00 72.61  ? 614  PHE A C     1 
ATOM   4668  O  O     . PHE A 1  614  ? -6.443  -72.132  59.200  1.00 71.84  ? 614  PHE A O     1 
ATOM   4669  C  CB    . PHE A 1  614  ? -8.519  -74.020  61.261  1.00 74.97  ? 614  PHE A CB    1 
ATOM   4670  C  CG    . PHE A 1  614  ? -7.308  -74.202  62.155  1.00 76.97  ? 614  PHE A CG    1 
ATOM   4671  C  CD1   . PHE A 1  614  ? -6.633  -73.102  62.676  1.00 78.51  ? 614  PHE A CD1   1 
ATOM   4672  C  CD2   . PHE A 1  614  ? -6.916  -75.470  62.571  1.00 81.24  ? 614  PHE A CD2   1 
ATOM   4673  C  CE1   . PHE A 1  614  ? -5.540  -73.268  63.529  1.00 79.84  ? 614  PHE A CE1   1 
ATOM   4674  C  CE2   . PHE A 1  614  ? -5.833  -75.635  63.442  1.00 84.44  ? 614  PHE A CE2   1 
ATOM   4675  C  CZ    . PHE A 1  614  ? -5.147  -74.533  63.907  1.00 81.03  ? 614  PHE A CZ    1 
ATOM   4676  N  N     . GLY A 1  615  ? -8.118  -71.194  60.388  1.00 67.33  ? 615  GLY A N     1 
ATOM   4677  C  CA    . GLY A 1  615  ? -7.512  -69.877  60.514  1.00 65.07  ? 615  GLY A CA    1 
ATOM   4678  C  C     . GLY A 1  615  ? -7.754  -68.949  59.349  1.00 67.12  ? 615  GLY A C     1 
ATOM   4679  O  O     . GLY A 1  615  ? -7.626  -69.351  58.190  1.00 66.86  ? 615  GLY A O     1 
ATOM   4680  N  N     . VAL A 1  616  ? -8.079  -67.686  59.668  1.00 62.28  ? 616  VAL A N     1 
ATOM   4681  C  CA    . VAL A 1  616  ? -8.325  -66.607  58.713  1.00 60.58  ? 616  VAL A CA    1 
ATOM   4682  C  C     . VAL A 1  616  ? -6.989  -66.169  58.073  1.00 65.02  ? 616  VAL A C     1 
ATOM   4683  O  O     . VAL A 1  616  ? -6.010  -65.922  58.785  1.00 64.80  ? 616  VAL A O     1 
ATOM   4684  C  CB    . VAL A 1  616  ? -9.106  -65.439  59.390  1.00 63.04  ? 616  VAL A CB    1 
ATOM   4685  C  CG1   . VAL A 1  616  ? -8.918  -64.112  58.662  1.00 61.25  ? 616  VAL A CG1   1 
ATOM   4686  C  CG2   . VAL A 1  616  ? -10.587 -65.767  59.523  1.00 63.57  ? 616  VAL A CG2   1 
ATOM   4687  N  N     . VAL A 1  617  ? -6.955  -66.106  56.733  1.00 61.71  ? 617  VAL A N     1 
ATOM   4688  C  CA    . VAL A 1  617  ? -5.796  -65.685  55.947  1.00 61.05  ? 617  VAL A CA    1 
ATOM   4689  C  C     . VAL A 1  617  ? -5.733  -64.151  55.880  1.00 62.98  ? 617  VAL A C     1 
ATOM   4690  O  O     . VAL A 1  617  ? -6.519  -63.523  55.164  1.00 61.94  ? 617  VAL A O     1 
ATOM   4691  C  CB    . VAL A 1  617  ? -5.766  -66.318  54.528  1.00 65.63  ? 617  VAL A CB    1 
ATOM   4692  C  CG1   . VAL A 1  617  ? -4.435  -66.042  53.831  1.00 64.76  ? 617  VAL A CG1   1 
ATOM   4693  C  CG2   . VAL A 1  617  ? -6.032  -67.816  54.584  1.00 67.19  ? 617  VAL A CG2   1 
ATOM   4694  N  N     . GLU A 1  618  ? -4.777  -63.569  56.616  1.00 58.51  ? 618  GLU A N     1 
ATOM   4695  C  CA    . GLU A 1  618  ? -4.517  -62.130  56.663  1.00 56.99  ? 618  GLU A CA    1 
ATOM   4696  C  C     . GLU A 1  618  ? -3.000  -61.817  56.450  1.00 60.64  ? 618  GLU A C     1 
ATOM   4697  O  O     . GLU A 1  618  ? -2.303  -62.626  55.827  1.00 61.01  ? 618  GLU A O     1 
ATOM   4698  C  CB    . GLU A 1  618  ? -5.093  -61.503  57.951  1.00 58.17  ? 618  GLU A CB    1 
ATOM   4699  C  CG    . GLU A 1  618  ? -4.857  -62.315  59.211  1.00 69.55  ? 618  GLU A CG    1 
ATOM   4700  C  CD    . GLU A 1  618  ? -3.409  -62.670  59.483  1.00 82.76  ? 618  GLU A CD    1 
ATOM   4701  O  OE1   . GLU A 1  618  ? -2.685  -61.799  60.014  1.00 77.65  ? 618  GLU A OE1   1 
ATOM   4702  O  OE2   . GLU A 1  618  ? -2.977  -63.773  59.072  1.00 67.17  ? 618  GLU A OE2   1 
ATOM   4703  N  N     . LYS A 1  619  ? -2.498  -60.661  56.961  1.00 55.40  ? 619  LYS A N     1 
ATOM   4704  C  CA    . LYS A 1  619  ? -1.111  -60.206  56.796  1.00 54.10  ? 619  LYS A CA    1 
ATOM   4705  C  C     . LYS A 1  619  ? -0.039  -61.192  57.293  1.00 59.47  ? 619  LYS A C     1 
ATOM   4706  O  O     . LYS A 1  619  ? 0.980   -61.350  56.624  1.00 59.68  ? 619  LYS A O     1 
ATOM   4707  C  CB    . LYS A 1  619  ? -0.921  -58.806  57.395  1.00 54.76  ? 619  LYS A CB    1 
ATOM   4708  C  CG    . LYS A 1  619  ? 0.254   -58.021  56.818  1.00 60.04  ? 619  LYS A CG    1 
ATOM   4709  C  CD    . LYS A 1  619  ? 0.391   -56.652  57.495  1.00 66.50  ? 619  LYS A CD    1 
ATOM   4710  C  CE    . LYS A 1  619  ? 1.637   -55.908  57.075  1.00 77.71  ? 619  LYS A CE    1 
ATOM   4711  N  NZ    . LYS A 1  619  ? 1.766   -54.598  57.770  1.00 87.90  ? 619  LYS A NZ    1 
ATOM   4712  N  N     . LYS A 1  620  ? -0.276  -61.868  58.439  1.00 56.43  ? 620  LYS A N     1 
ATOM   4713  C  CA    . LYS A 1  620  ? 0.660   -62.843  59.027  1.00 56.78  ? 620  LYS A CA    1 
ATOM   4714  C  C     . LYS A 1  620  ? 0.935   -64.040  58.118  1.00 61.30  ? 620  LYS A C     1 
ATOM   4715  O  O     . LYS A 1  620  ? 2.009   -64.639  58.207  1.00 62.06  ? 620  LYS A O     1 
ATOM   4716  C  CB    . LYS A 1  620  ? 0.148   -63.357  60.380  1.00 59.53  ? 620  LYS A CB    1 
ATOM   4717  C  CG    . LYS A 1  620  ? 0.749   -62.667  61.588  1.00 70.67  ? 620  LYS A CG    1 
ATOM   4718  C  CD    . LYS A 1  620  ? 0.122   -63.182  62.885  1.00 79.49  ? 620  LYS A CD    1 
ATOM   4719  C  CE    . LYS A 1  620  ? -0.965  -62.286  63.437  1.00 85.12  ? 620  LYS A CE    1 
ATOM   4720  N  NZ    . LYS A 1  620  ? -2.232  -62.397  62.668  1.00 92.04  ? 620  LYS A NZ    1 
ATOM   4721  N  N     . THR A 1  621  ? -0.040  -64.410  57.279  1.00 57.19  ? 621  THR A N     1 
ATOM   4722  C  CA    . THR A 1  621  ? 0.075   -65.561  56.389  1.00 57.80  ? 621  THR A CA    1 
ATOM   4723  C  C     . THR A 1  621  ? 0.520   -65.117  54.994  1.00 62.10  ? 621  THR A C     1 
ATOM   4724  O  O     . THR A 1  621  ? 1.582   -65.510  54.489  1.00 61.84  ? 621  THR A O     1 
ATOM   4725  C  CB    . THR A 1  621  ? -1.292  -66.280  56.311  1.00 60.63  ? 621  THR A CB    1 
ATOM   4726  O  OG1   . THR A 1  621  ? -1.877  -66.380  57.609  1.00 57.61  ? 621  THR A OG1   1 
ATOM   4727  C  CG2   . THR A 1  621  ? -1.209  -67.641  55.637  1.00 59.08  ? 621  THR A CG2   1 
ATOM   4728  N  N     . VAL A 1  622  ? -0.330  -64.291  54.387  1.00 57.94  ? 622  VAL A N     1 
ATOM   4729  C  CA    . VAL A 1  622  ? -0.242  -63.828  53.024  1.00 56.43  ? 622  VAL A CA    1 
ATOM   4730  C  C     . VAL A 1  622  ? 0.563   -62.524  52.800  1.00 59.19  ? 622  VAL A C     1 
ATOM   4731  O  O     . VAL A 1  622  ? 0.779   -62.118  51.653  1.00 58.53  ? 622  VAL A O     1 
ATOM   4732  C  CB    . VAL A 1  622  ? -1.665  -63.885  52.422  1.00 59.62  ? 622  VAL A CB    1 
ATOM   4733  C  CG1   . VAL A 1  622  ? -2.416  -62.568  52.559  1.00 58.18  ? 622  VAL A CG1   1 
ATOM   4734  C  CG2   . VAL A 1  622  ? -1.652  -64.398  50.995  1.00 59.65  ? 622  VAL A CG2   1 
ATOM   4735  N  N     . GLY A 1  623  ? 1.066   -61.930  53.880  1.00 55.04  ? 623  GLY A N     1 
ATOM   4736  C  CA    . GLY A 1  623  ? 1.897   -60.736  53.778  1.00 54.15  ? 623  GLY A CA    1 
ATOM   4737  C  C     . GLY A 1  623  ? 3.327   -61.105  53.443  1.00 59.47  ? 623  GLY A C     1 
ATOM   4738  O  O     . GLY A 1  623  ? 3.573   -62.182  52.894  1.00 60.35  ? 623  GLY A O     1 
ATOM   4739  N  N     . SER A 1  624  ? 4.286   -60.226  53.774  1.00 56.01  ? 624  SER A N     1 
ATOM   4740  C  CA    . SER A 1  624  ? 5.703   -60.499  53.532  1.00 56.59  ? 624  SER A CA    1 
ATOM   4741  C  C     . SER A 1  624  ? 6.370   -60.925  54.847  1.00 62.13  ? 624  SER A C     1 
ATOM   4742  O  O     . SER A 1  624  ? 7.513   -60.565  55.129  1.00 61.82  ? 624  SER A O     1 
ATOM   4743  C  CB    . SER A 1  624  ? 6.390   -59.297  52.888  1.00 60.08  ? 624  SER A CB    1 
ATOM   4744  O  OG    . SER A 1  624  ? 6.297   -58.140  53.702  1.00 70.93  ? 624  SER A OG    1 
ATOM   4745  N  N     . SER A 1  625  ? 5.629   -61.714  55.648  1.00 60.12  ? 625  SER A N     1 
ATOM   4746  C  CA    . SER A 1  625  ? 6.030   -62.260  56.949  1.00 61.01  ? 625  SER A CA    1 
ATOM   4747  C  C     . SER A 1  625  ? 7.183   -63.272  56.848  1.00 66.48  ? 625  SER A C     1 
ATOM   4748  O  O     . SER A 1  625  ? 7.406   -63.839  55.773  1.00 67.07  ? 625  SER A O     1 
ATOM   4749  C  CB    . SER A 1  625  ? 4.828   -62.890  57.647  1.00 64.57  ? 625  SER A CB    1 
ATOM   4750  O  OG    . SER A 1  625  ? 4.026   -63.640  56.749  1.00 72.07  ? 625  SER A OG    1 
ATOM   4751  N  N     . ASN A 1  626  ? 7.904   -63.498  57.971  1.00 63.07  ? 626  ASN A N     1 
ATOM   4752  C  CA    . ASN A 1  626  ? 9.032   -64.427  58.044  1.00 64.21  ? 626  ASN A CA    1 
ATOM   4753  C  C     . ASN A 1  626  ? 8.622   -65.893  57.812  1.00 69.12  ? 626  ASN A C     1 
ATOM   4754  O  O     . ASN A 1  626  ? 9.108   -66.503  56.864  1.00 69.65  ? 626  ASN A O     1 
ATOM   4755  C  CB    . ASN A 1  626  ? 9.814   -64.259  59.348  1.00 67.56  ? 626  ASN A CB    1 
ATOM   4756  C  CG    . ASN A 1  626  ? 11.295  -64.552  59.224  1.00 97.75  ? 626  ASN A CG    1 
ATOM   4757  O  OD1   . ASN A 1  626  ? 11.749  -65.710  59.320  1.00 90.96  ? 626  ASN A OD1   1 
ATOM   4758  N  ND2   . ASN A 1  626  ? 12.087  -63.495  59.043  1.00 90.00  ? 626  ASN A ND2   1 
ATOM   4759  N  N     . GLY A 1  627  ? 7.717   -66.431  58.630  1.00 65.03  ? 627  GLY A N     1 
ATOM   4760  C  CA    . GLY A 1  627  ? 7.275   -67.817  58.475  1.00 65.70  ? 627  GLY A CA    1 
ATOM   4761  C  C     . GLY A 1  627  ? 6.057   -68.014  57.594  1.00 68.12  ? 627  GLY A C     1 
ATOM   4762  O  O     . GLY A 1  627  ? 5.439   -69.082  57.617  1.00 68.45  ? 627  GLY A O     1 
ATOM   4763  N  N     . GLY A 1  628  ? 5.736   -66.988  56.812  1.00 63.02  ? 628  GLY A N     1 
ATOM   4764  C  CA    . GLY A 1  628  ? 4.572   -66.923  55.934  1.00 62.06  ? 628  GLY A CA    1 
ATOM   4765  C  C     . GLY A 1  628  ? 4.483   -67.884  54.767  1.00 64.36  ? 628  GLY A C     1 
ATOM   4766  O  O     . GLY A 1  628  ? 5.430   -68.617  54.465  1.00 64.54  ? 628  GLY A O     1 
ATOM   4767  N  N     . LEU A 1  629  ? 3.311   -67.854  54.097  1.00 58.75  ? 629  LEU A N     1 
ATOM   4768  C  CA    . LEU A 1  629  ? 2.938   -68.663  52.932  1.00 58.16  ? 629  LEU A CA    1 
ATOM   4769  C  C     . LEU A 1  629  ? 3.894   -68.446  51.766  1.00 61.24  ? 629  LEU A C     1 
ATOM   4770  O  O     . LEU A 1  629  ? 4.172   -69.390  51.034  1.00 61.33  ? 629  LEU A O     1 
ATOM   4771  C  CB    . LEU A 1  629  ? 1.494   -68.310  52.508  1.00 57.09  ? 629  LEU A CB    1 
ATOM   4772  C  CG    . LEU A 1  629  ? 0.589   -69.334  51.776  1.00 61.23  ? 629  LEU A CG    1 
ATOM   4773  C  CD1   . LEU A 1  629  ? 0.120   -68.804  50.465  1.00 59.85  ? 629  LEU A CD1   1 
ATOM   4774  C  CD2   . LEU A 1  629  ? 1.196   -70.721  51.652  1.00 64.31  ? 629  LEU A CD2   1 
ATOM   4775  N  N     . ILE A 1  630  ? 4.403   -67.211  51.603  1.00 56.73  ? 630  ILE A N     1 
ATOM   4776  C  CA    . ILE A 1  630  ? 5.319   -66.882  50.516  1.00 55.56  ? 630  ILE A CA    1 
ATOM   4777  C  C     . ILE A 1  630  ? 6.714   -67.473  50.754  1.00 60.41  ? 630  ILE A C     1 
ATOM   4778  O  O     . ILE A 1  630  ? 7.201   -68.188  49.875  1.00 60.93  ? 630  ILE A O     1 
ATOM   4779  C  CB    . ILE A 1  630  ? 5.259   -65.380  50.110  1.00 56.35  ? 630  ILE A CB    1 
ATOM   4780  C  CG1   . ILE A 1  630  ? 3.910   -65.053  49.446  1.00 55.52  ? 630  ILE A CG1   1 
ATOM   4781  C  CG2   . ILE A 1  630  ? 6.388   -64.990  49.177  1.00 56.16  ? 630  ILE A CG2   1 
ATOM   4782  C  CD1   . ILE A 1  630  ? 2.962   -64.360  50.318  1.00 60.21  ? 630  ILE A CD1   1 
ATOM   4783  N  N     . HIS A 1  631  ? 7.312   -67.263  51.954  1.00 57.03  ? 631  HIS A N     1 
ATOM   4784  C  CA    . HIS A 1  631  ? 8.624   -67.835  52.291  1.00 58.34  ? 631  HIS A CA    1 
ATOM   4785  C  C     . HIS A 1  631  ? 8.579   -69.370  52.100  1.00 62.04  ? 631  HIS A C     1 
ATOM   4786  O  O     . HIS A 1  631  ? 9.482   -69.932  51.475  1.00 62.39  ? 631  HIS A O     1 
ATOM   4787  C  CB    . HIS A 1  631  ? 9.043   -67.453  53.736  1.00 60.00  ? 631  HIS A CB    1 
ATOM   4788  C  CG    . HIS A 1  631  ? 10.525  -67.529  54.055  1.00 64.71  ? 631  HIS A CG    1 
ATOM   4789  N  ND1   . HIS A 1  631  ? 11.466  -67.942  53.116  1.00 67.64  ? 631  HIS A ND1   1 
ATOM   4790  C  CD2   . HIS A 1  631  ? 11.175  -67.234  55.208  1.00 66.57  ? 631  HIS A CD2   1 
ATOM   4791  C  CE1   . HIS A 1  631  ? 12.641  -67.886  53.729  1.00 67.48  ? 631  HIS A CE1   1 
ATOM   4792  N  NE2   . HIS A 1  631  ? 12.516  -67.464  54.987  1.00 67.30  ? 631  HIS A NE2   1 
ATOM   4793  N  N     . VAL A 1  632  ? 7.478   -70.020  52.559  1.00 57.61  ? 632  VAL A N     1 
ATOM   4794  C  CA    . VAL A 1  632  ? 7.239   -71.469  52.453  1.00 58.19  ? 632  VAL A CA    1 
ATOM   4795  C  C     . VAL A 1  632  ? 7.179   -71.940  50.985  1.00 61.75  ? 632  VAL A C     1 
ATOM   4796  O  O     . VAL A 1  632  ? 7.916   -72.859  50.622  1.00 62.42  ? 632  VAL A O     1 
ATOM   4797  C  CB    . VAL A 1  632  ? 6.006   -71.919  53.295  1.00 61.91  ? 632  VAL A CB    1 
ATOM   4798  C  CG1   . VAL A 1  632  ? 5.579   -73.345  52.972  1.00 63.02  ? 632  VAL A CG1   1 
ATOM   4799  C  CG2   . VAL A 1  632  ? 6.288   -71.792  54.780  1.00 62.09  ? 632  VAL A CG2   1 
ATOM   4800  N  N     . VAL A 1  633  ? 6.324   -71.298  50.152  1.00 56.63  ? 633  VAL A N     1 
ATOM   4801  C  CA    . VAL A 1  633  ? 6.140   -71.637  48.732  1.00 56.23  ? 633  VAL A CA    1 
ATOM   4802  C  C     . VAL A 1  633  ? 7.432   -71.454  47.904  1.00 60.33  ? 633  VAL A C     1 
ATOM   4803  O  O     . VAL A 1  633  ? 7.756   -72.336  47.098  1.00 61.15  ? 633  VAL A O     1 
ATOM   4804  C  CB    . VAL A 1  633  ? 4.870   -70.991  48.094  1.00 58.56  ? 633  VAL A CB    1 
ATOM   4805  C  CG1   . VAL A 1  633  ? 4.780   -71.272  46.599  1.00 58.35  ? 633  VAL A CG1   1 
ATOM   4806  C  CG2   . VAL A 1  633  ? 3.601   -71.484  48.779  1.00 58.72  ? 633  VAL A CG2   1 
ATOM   4807  N  N     . THR A 1  634  ? 8.189   -70.353  48.142  1.00 55.30  ? 634  THR A N     1 
ATOM   4808  C  CA    . THR A 1  634  ? 9.450   -70.083  47.432  1.00 55.01  ? 634  THR A CA    1 
ATOM   4809  C  C     . THR A 1  634  ? 10.494  -71.151  47.734  1.00 60.88  ? 634  THR A C     1 
ATOM   4810  O  O     . THR A 1  634  ? 11.156  -71.637  46.818  1.00 60.75  ? 634  THR A O     1 
ATOM   4811  C  CB    . THR A 1  634  ? 10.022  -68.713  47.794  1.00 60.48  ? 634  THR A CB    1 
ATOM   4812  O  OG1   . THR A 1  634  ? 8.968   -67.775  47.998  1.00 59.30  ? 634  THR A OG1   1 
ATOM   4813  C  CG2   . THR A 1  634  ? 11.003  -68.200  46.744  1.00 58.85  ? 634  THR A CG2   1 
ATOM   4814  N  N     . ARG A 1  635  ? 10.645  -71.501  49.022  1.00 58.80  ? 635  ARG A N     1 
ATOM   4815  C  CA    . ARG A 1  635  ? 11.614  -72.494  49.460  1.00 60.44  ? 635  ARG A CA    1 
ATOM   4816  C  C     . ARG A 1  635  ? 11.231  -73.919  49.067  1.00 67.34  ? 635  ARG A C     1 
ATOM   4817  O  O     . ARG A 1  635  ? 12.120  -74.710  48.748  1.00 69.07  ? 635  ARG A O     1 
ATOM   4818  C  CB    . ARG A 1  635  ? 11.898  -72.383  50.974  1.00 59.46  ? 635  ARG A CB    1 
ATOM   4819  C  CG    . ARG A 1  635  ? 12.610  -71.099  51.437  1.00 67.25  ? 635  ARG A CG    1 
ATOM   4820  C  CD    . ARG A 1  635  ? 14.062  -70.954  50.986  1.00 77.64  ? 635  ARG A CD    1 
ATOM   4821  N  NE    . ARG A 1  635  ? 14.149  -70.361  49.649  1.00 88.65  ? 635  ARG A NE    1 
ATOM   4822  C  CZ    . ARG A 1  635  ? 15.165  -69.628  49.204  1.00 103.54 ? 635  ARG A CZ    1 
ATOM   4823  N  NH1   . ARG A 1  635  ? 16.205  -69.378  49.988  1.00 93.24  ? 635  ARG A NH1   1 
ATOM   4824  N  NH2   . ARG A 1  635  ? 15.145  -69.133  47.975  1.00 88.88  ? 635  ARG A NH2   1 
ATOM   4825  N  N     . GLU A 1  636  ? 9.929   -74.250  49.074  1.00 64.04  ? 636  GLU A N     1 
ATOM   4826  C  CA    . GLU A 1  636  ? 9.486   -75.606  48.759  1.00 65.69  ? 636  GLU A CA    1 
ATOM   4827  C  C     . GLU A 1  636  ? 9.259   -75.868  47.268  1.00 70.12  ? 636  GLU A C     1 
ATOM   4828  O  O     . GLU A 1  636  ? 9.856   -76.799  46.708  1.00 70.65  ? 636  GLU A O     1 
ATOM   4829  C  CB    . GLU A 1  636  ? 8.253   -75.995  49.599  1.00 67.28  ? 636  GLU A CB    1 
ATOM   4830  C  CG    . GLU A 1  636  ? 8.365   -77.357  50.258  1.00 79.88  ? 636  GLU A CG    1 
ATOM   4831  C  CD    . GLU A 1  636  ? 9.371   -77.407  51.389  1.00 110.63 ? 636  GLU A CD    1 
ATOM   4832  O  OE1   . GLU A 1  636  ? 10.485  -77.939  51.175  1.00 110.61 ? 636  GLU A OE1   1 
ATOM   4833  O  OE2   . GLU A 1  636  ? 9.061   -76.875  52.479  1.00 110.60 ? 636  GLU A OE2   1 
ATOM   4834  N  N     . LYS A 1  637  ? 8.399   -75.052  46.633  1.00 65.65  ? 637  LYS A N     1 
ATOM   4835  C  CA    . LYS A 1  637  ? 8.024   -75.209  45.228  1.00 65.35  ? 637  LYS A CA    1 
ATOM   4836  C  C     . LYS A 1  637  ? 8.922   -74.507  44.199  1.00 68.19  ? 637  LYS A C     1 
ATOM   4837  O  O     . LYS A 1  637  ? 8.999   -74.963  43.060  1.00 67.88  ? 637  LYS A O     1 
ATOM   4838  C  CB    . LYS A 1  637  ? 6.532   -74.914  45.018  1.00 66.90  ? 637  LYS A CB    1 
ATOM   4839  C  CG    . LYS A 1  637  ? 5.621   -75.914  45.731  1.00 78.14  ? 637  LYS A CG    1 
ATOM   4840  C  CD    . LYS A 1  637  ? 4.962   -76.898  44.781  1.00 89.68  ? 637  LYS A CD    1 
ATOM   4841  C  CE    . LYS A 1  637  ? 5.263   -78.330  45.151  1.00 101.57 ? 637  LYS A CE    1 
ATOM   4842  N  NZ    . LYS A 1  637  ? 4.354   -79.276  44.450  1.00 111.68 ? 637  LYS A NZ    1 
ATOM   4843  N  N     . GLY A 1  638  ? 9.613   -73.450  44.615  1.00 64.19  ? 638  GLY A N     1 
ATOM   4844  C  CA    . GLY A 1  638  ? 10.532  -72.712  43.756  1.00 63.98  ? 638  GLY A CA    1 
ATOM   4845  C  C     . GLY A 1  638  ? 10.165  -71.254  43.546  1.00 67.59  ? 638  GLY A C     1 
ATOM   4846  O  O     . GLY A 1  638  ? 9.102   -70.822  43.999  1.00 66.81  ? 638  GLY A O     1 
ATOM   4847  N  N     . PRO A 1  639  ? 11.016  -70.463  42.844  1.00 64.01  ? 639  PRO A N     1 
ATOM   4848  C  CA    . PRO A 1  639  ? 10.684  -69.047  42.606  1.00 62.14  ? 639  PRO A CA    1 
ATOM   4849  C  C     . PRO A 1  639  ? 9.583   -68.836  41.563  1.00 65.36  ? 639  PRO A C     1 
ATOM   4850  O  O     . PRO A 1  639  ? 8.676   -68.034  41.797  1.00 63.76  ? 639  PRO A O     1 
ATOM   4851  C  CB    . PRO A 1  639  ? 12.016  -68.433  42.144  1.00 63.89  ? 639  PRO A CB    1 
ATOM   4852  C  CG    . PRO A 1  639  ? 13.048  -69.503  42.320  1.00 70.10  ? 639  PRO A CG    1 
ATOM   4853  C  CD    . PRO A 1  639  ? 12.320  -70.798  42.245  1.00 66.70  ? 639  PRO A CD    1 
ATOM   4854  N  N     . GLN A 1  640  ? 9.659   -69.551  40.416  1.00 62.68  ? 640  GLN A N     1 
ATOM   4855  C  CA    . GLN A 1  640  ? 8.695   -69.441  39.312  1.00 61.81  ? 640  GLN A CA    1 
ATOM   4856  C  C     . GLN A 1  640  ? 7.291   -69.838  39.744  1.00 63.77  ? 640  GLN A C     1 
ATOM   4857  O  O     . GLN A 1  640  ? 6.325   -69.207  39.313  1.00 62.26  ? 640  GLN A O     1 
ATOM   4858  C  CB    . GLN A 1  640  ? 9.132   -70.265  38.084  1.00 64.65  ? 640  GLN A CB    1 
ATOM   4859  C  CG    . GLN A 1  640  ? 10.565  -70.011  37.593  1.00 88.55  ? 640  GLN A CG    1 
ATOM   4860  C  CD    . GLN A 1  640  ? 10.789  -68.612  37.070  1.00 113.11 ? 640  GLN A CD    1 
ATOM   4861  O  OE1   . GLN A 1  640  ? 11.438  -67.781  37.718  1.00 107.96 ? 640  GLN A OE1   1 
ATOM   4862  N  NE2   . GLN A 1  640  ? 10.276  -68.330  35.877  1.00 108.86 ? 640  GLN A NE2   1 
ATOM   4863  N  N     . VAL A 1  641  ? 7.186   -70.864  40.614  1.00 60.14  ? 641  VAL A N     1 
ATOM   4864  C  CA    . VAL A 1  641  ? 5.915   -71.359  41.151  1.00 59.68  ? 641  VAL A CA    1 
ATOM   4865  C  C     . VAL A 1  641  ? 5.344   -70.330  42.122  1.00 61.55  ? 641  VAL A C     1 
ATOM   4866  O  O     . VAL A 1  641  ? 4.136   -70.081  42.113  1.00 60.57  ? 641  VAL A O     1 
ATOM   4867  C  CB    . VAL A 1  641  ? 6.070   -72.747  41.823  1.00 65.05  ? 641  VAL A CB    1 
ATOM   4868  C  CG1   . VAL A 1  641  ? 4.711   -73.336  42.209  1.00 64.90  ? 641  VAL A CG1   1 
ATOM   4869  C  CG2   . VAL A 1  641  ? 6.831   -73.707  40.917  1.00 66.38  ? 641  VAL A CG2   1 
ATOM   4870  N  N     . CYS A 1  642  ? 6.215   -69.740  42.955  1.00 57.30  ? 642  CYS A N     1 
ATOM   4871  C  CA    . CYS A 1  642  ? 5.815   -68.749  43.937  1.00 56.29  ? 642  CYS A CA    1 
ATOM   4872  C  C     . CYS A 1  642  ? 5.316   -67.476  43.280  1.00 59.51  ? 642  CYS A C     1 
ATOM   4873  O  O     . CYS A 1  642  ? 4.298   -66.936  43.706  1.00 58.40  ? 642  CYS A O     1 
ATOM   4874  C  CB    . CYS A 1  642  ? 6.939   -68.468  44.922  1.00 56.87  ? 642  CYS A CB    1 
ATOM   4875  S  SG    . CYS A 1  642  ? 6.478   -67.329  46.248  1.00 59.88  ? 642  CYS A SG    1 
ATOM   4876  N  N     . ALA A 1  643  ? 6.012   -67.011  42.228  1.00 56.25  ? 643  ALA A N     1 
ATOM   4877  C  CA    . ALA A 1  643  ? 5.629   -65.818  41.477  1.00 54.96  ? 643  ALA A CA    1 
ATOM   4878  C  C     . ALA A 1  643  ? 4.235   -66.021  40.860  1.00 58.89  ? 643  ALA A C     1 
ATOM   4879  O  O     . ALA A 1  643  ? 3.423   -65.087  40.846  1.00 57.88  ? 643  ALA A O     1 
ATOM   4880  C  CB    . ALA A 1  643  ? 6.662   -65.528  40.398  1.00 55.78  ? 643  ALA A CB    1 
ATOM   4881  N  N     . LYS A 1  644  ? 3.948   -67.267  40.408  1.00 56.05  ? 644  LYS A N     1 
ATOM   4882  C  CA    . LYS A 1  644  ? 2.664   -67.671  39.841  1.00 55.75  ? 644  LYS A CA    1 
ATOM   4883  C  C     . LYS A 1  644  ? 1.569   -67.544  40.890  1.00 58.58  ? 644  LYS A C     1 
ATOM   4884  O  O     . LYS A 1  644  ? 0.457   -67.131  40.558  1.00 57.91  ? 644  LYS A O     1 
ATOM   4885  C  CB    . LYS A 1  644  ? 2.726   -69.119  39.329  1.00 59.78  ? 644  LYS A CB    1 
ATOM   4886  C  CG    . LYS A 1  644  ? 2.946   -69.236  37.832  1.00 82.36  ? 644  LYS A CG    1 
ATOM   4887  C  CD    . LYS A 1  644  ? 1.626   -69.309  37.058  1.00 96.51  ? 644  LYS A CD    1 
ATOM   4888  C  CE    . LYS A 1  644  ? 1.831   -69.518  35.575  1.00 111.72 ? 644  LYS A CE    1 
ATOM   4889  N  NZ    . LYS A 1  644  ? 2.263   -70.906  35.255  1.00 125.61 ? 644  LYS A NZ    1 
ATOM   4890  N  N     . LEU A 1  645  ? 1.904   -67.873  42.160  1.00 54.40  ? 645  LEU A N     1 
ATOM   4891  C  CA    . LEU A 1  645  ? 0.998   -67.830  43.308  1.00 53.31  ? 645  LEU A CA    1 
ATOM   4892  C  C     . LEU A 1  645  ? 0.447   -66.428  43.563  1.00 54.45  ? 645  LEU A C     1 
ATOM   4893  O  O     . LEU A 1  645  ? -0.742  -66.299  43.866  1.00 53.97  ? 645  LEU A O     1 
ATOM   4894  C  CB    . LEU A 1  645  ? 1.671   -68.433  44.558  1.00 53.76  ? 645  LEU A CB    1 
ATOM   4895  C  CG    . LEU A 1  645  ? 0.885   -68.439  45.867  1.00 57.92  ? 645  LEU A CG    1 
ATOM   4896  C  CD1   . LEU A 1  645  ? -0.218  -69.489  45.867  1.00 58.46  ? 645  LEU A CD1   1 
ATOM   4897  C  CD2   . LEU A 1  645  ? 1.800   -68.656  47.026  1.00 61.59  ? 645  LEU A CD2   1 
ATOM   4898  N  N     . PHE A 1  646  ? 1.279   -65.384  43.393  1.00 49.13  ? 646  PHE A N     1 
ATOM   4899  C  CA    . PHE A 1  646  ? 0.824   -64.006  43.561  1.00 47.59  ? 646  PHE A CA    1 
ATOM   4900  C  C     . PHE A 1  646  ? -0.341  -63.752  42.611  1.00 52.87  ? 646  PHE A C     1 
ATOM   4901  O  O     . PHE A 1  646  ? -1.412  -63.360  43.073  1.00 53.05  ? 646  PHE A O     1 
ATOM   4902  C  CB    . PHE A 1  646  ? 1.960   -63.001  43.330  1.00 48.42  ? 646  PHE A CB    1 
ATOM   4903  C  CG    . PHE A 1  646  ? 2.934   -62.922  44.477  1.00 50.00  ? 646  PHE A CG    1 
ATOM   4904  C  CD1   . PHE A 1  646  ? 4.113   -63.657  44.460  1.00 53.95  ? 646  PHE A CD1   1 
ATOM   4905  C  CD2   . PHE A 1  646  ? 2.663   -62.132  45.587  1.00 51.64  ? 646  PHE A CD2   1 
ATOM   4906  C  CE1   . PHE A 1  646  ? 5.006   -63.603  45.534  1.00 54.98  ? 646  PHE A CE1   1 
ATOM   4907  C  CE2   . PHE A 1  646  ? 3.565   -62.063  46.654  1.00 54.65  ? 646  PHE A CE2   1 
ATOM   4908  C  CZ    . PHE A 1  646  ? 4.728   -62.803  46.622  1.00 53.50  ? 646  PHE A CZ    1 
ATOM   4909  N  N     . GLY A 1  647  ? -0.154  -64.095  41.332  1.00 49.57  ? 647  GLY A N     1 
ATOM   4910  C  CA    . GLY A 1  647  ? -1.172  -63.978  40.295  1.00 49.18  ? 647  GLY A CA    1 
ATOM   4911  C  C     . GLY A 1  647  ? -2.445  -64.736  40.618  1.00 53.67  ? 647  GLY A C     1 
ATOM   4912  O  O     . GLY A 1  647  ? -3.532  -64.155  40.592  1.00 52.59  ? 647  GLY A O     1 
ATOM   4913  N  N     . ASN A 1  648  ? -2.313  -66.027  40.967  1.00 51.93  ? 648  ASN A N     1 
ATOM   4914  C  CA    . ASN A 1  648  ? -3.440  -66.898  41.319  1.00 52.85  ? 648  ASN A CA    1 
ATOM   4915  C  C     . ASN A 1  648  ? -4.284  -66.324  42.460  1.00 55.38  ? 648  ASN A C     1 
ATOM   4916  O  O     . ASN A 1  648  ? -5.485  -66.123  42.266  1.00 54.80  ? 648  ASN A O     1 
ATOM   4917  C  CB    . ASN A 1  648  ? -2.973  -68.330  41.635  1.00 56.69  ? 648  ASN A CB    1 
ATOM   4918  C  CG    . ASN A 1  648  ? -2.284  -69.058  40.496  1.00 84.22  ? 648  ASN A CG    1 
ATOM   4919  O  OD1   . ASN A 1  648  ? -2.223  -68.597  39.340  1.00 71.58  ? 648  ASN A OD1   1 
ATOM   4920  N  ND2   . ASN A 1  648  ? -1.741  -70.227  40.814  1.00 82.25  ? 648  ASN A ND2   1 
ATOM   4921  N  N     . ILE A 1  649  ? -3.653  -66.007  43.618  1.00 50.96  ? 649  ILE A N     1 
ATOM   4922  C  CA    . ILE A 1  649  ? -4.354  -65.424  44.769  1.00 50.32  ? 649  ILE A CA    1 
ATOM   4923  C  C     . ILE A 1  649  ? -5.064  -64.130  44.322  1.00 53.65  ? 649  ILE A C     1 
ATOM   4924  O  O     . ILE A 1  649  ? -6.282  -64.008  44.495  1.00 53.87  ? 649  ILE A O     1 
ATOM   4925  C  CB    . ILE A 1  649  ? -3.430  -65.208  46.004  1.00 52.72  ? 649  ILE A CB    1 
ATOM   4926  C  CG1   . ILE A 1  649  ? -2.772  -66.523  46.475  1.00 53.51  ? 649  ILE A CG1   1 
ATOM   4927  C  CG2   . ILE A 1  649  ? -4.203  -64.542  47.152  1.00 53.11  ? 649  ILE A CG2   1 
ATOM   4928  C  CD1   . ILE A 1  649  ? -1.588  -66.318  47.436  1.00 55.97  ? 649  ILE A CD1   1 
ATOM   4929  N  N     . GLN A 1  650  ? -4.311  -63.216  43.684  1.00 48.58  ? 650  GLN A N     1 
ATOM   4930  C  CA    . GLN A 1  650  ? -4.822  -61.950  43.160  1.00 47.21  ? 650  GLN A CA    1 
ATOM   4931  C  C     . GLN A 1  650  ? -6.031  -62.115  42.233  1.00 50.69  ? 650  GLN A C     1 
ATOM   4932  O  O     . GLN A 1  650  ? -7.042  -61.455  42.446  1.00 49.75  ? 650  GLN A O     1 
ATOM   4933  C  CB    . GLN A 1  650  ? -3.714  -61.156  42.456  1.00 47.53  ? 650  GLN A CB    1 
ATOM   4934  C  CG    . GLN A 1  650  ? -2.825  -60.368  43.398  1.00 52.46  ? 650  GLN A CG    1 
ATOM   4935  C  CD    . GLN A 1  650  ? -1.811  -59.585  42.617  1.00 74.37  ? 650  GLN A CD    1 
ATOM   4936  O  OE1   . GLN A 1  650  ? -0.712  -60.071  42.342  1.00 68.44  ? 650  GLN A OE1   1 
ATOM   4937  N  NE2   . GLN A 1  650  ? -2.178  -58.373  42.189  1.00 71.53  ? 650  GLN A NE2   1 
ATOM   4938  N  N     . LYS A 1  651  ? -5.944  -63.010  41.239  1.00 47.68  ? 651  LYS A N     1 
ATOM   4939  C  CA    . LYS A 1  651  ? -7.032  -63.228  40.286  1.00 47.95  ? 651  LYS A CA    1 
ATOM   4940  C  C     . LYS A 1  651  ? -8.347  -63.659  40.939  1.00 53.94  ? 651  LYS A C     1 
ATOM   4941  O  O     . LYS A 1  651  ? -9.402  -63.118  40.596  1.00 52.70  ? 651  LYS A O     1 
ATOM   4942  C  CB    . LYS A 1  651  ? -6.597  -64.130  39.117  1.00 50.00  ? 651  LYS A CB    1 
ATOM   4943  C  CG    . LYS A 1  651  ? -5.885  -63.336  38.014  1.00 53.19  ? 651  LYS A CG    1 
ATOM   4944  C  CD    . LYS A 1  651  ? -5.057  -64.186  37.032  1.00 56.83  ? 651  LYS A CD    1 
ATOM   4945  C  CE    . LYS A 1  651  ? -3.551  -64.104  37.223  1.00 59.03  ? 651  LYS A CE    1 
ATOM   4946  N  NZ    . LYS A 1  651  ? -3.017  -62.711  37.117  1.00 62.16  ? 651  LYS A NZ    1 
ATOM   4947  N  N     . VAL A 1  652  ? -8.267  -64.553  41.938  1.00 53.19  ? 652  VAL A N     1 
ATOM   4948  C  CA    . VAL A 1  652  ? -9.431  -65.058  42.680  1.00 54.55  ? 652  VAL A CA    1 
ATOM   4949  C  C     . VAL A 1  652  ? -10.017 -63.964  43.586  1.00 59.87  ? 652  VAL A C     1 
ATOM   4950  O  O     . VAL A 1  652  ? -11.163 -63.536  43.380  1.00 59.99  ? 652  VAL A O     1 
ATOM   4951  C  CB    . VAL A 1  652  ? -9.092  -66.334  43.502  1.00 59.03  ? 652  VAL A CB    1 
ATOM   4952  C  CG1   . VAL A 1  652  ? -10.321 -66.859  44.243  1.00 59.76  ? 652  VAL A CG1   1 
ATOM   4953  C  CG2   . VAL A 1  652  ? -8.502  -67.416  42.620  1.00 59.43  ? 652  VAL A CG2   1 
ATOM   4954  N  N     . VAL A 1  653  ? -9.223  -63.553  44.608  1.00 55.53  ? 653  VAL A N     1 
ATOM   4955  C  CA    . VAL A 1  653  ? -9.570  -62.581  45.643  1.00 54.35  ? 653  VAL A CA    1 
ATOM   4956  C  C     . VAL A 1  653  ? -10.196 -61.310  45.094  1.00 57.25  ? 653  VAL A C     1 
ATOM   4957  O  O     . VAL A 1  653  ? -11.292 -60.954  45.533  1.00 57.35  ? 653  VAL A O     1 
ATOM   4958  C  CB    . VAL A 1  653  ? -8.390  -62.313  46.602  1.00 57.63  ? 653  VAL A CB    1 
ATOM   4959  C  CG1   . VAL A 1  653  ? -8.736  -61.232  47.621  1.00 56.64  ? 653  VAL A CG1   1 
ATOM   4960  C  CG2   . VAL A 1  653  ? -7.955  -63.601  47.302  1.00 58.54  ? 653  VAL A CG2   1 
ATOM   4961  N  N     . ASN A 1  654  ? -9.529  -60.657  44.111  1.00 52.63  ? 654  ASN A N     1 
ATOM   4962  C  CA    . ASN A 1  654  ? -10.019 -59.427  43.479  1.00 51.33  ? 654  ASN A CA    1 
ATOM   4963  C  C     . ASN A 1  654  ? -11.386 -59.636  42.853  1.00 55.78  ? 654  ASN A C     1 
ATOM   4964  O  O     . ASN A 1  654  ? -12.242 -58.765  42.998  1.00 55.03  ? 654  ASN A O     1 
ATOM   4965  C  CB    . ASN A 1  654  ? -9.039  -58.881  42.437  1.00 49.73  ? 654  ASN A CB    1 
ATOM   4966  C  CG    . ASN A 1  654  ? -7.704  -58.416  42.967  1.00 67.11  ? 654  ASN A CG    1 
ATOM   4967  O  OD1   . ASN A 1  654  ? -7.581  -57.867  44.071  1.00 57.31  ? 654  ASN A OD1   1 
ATOM   4968  N  ND2   . ASN A 1  654  ? -6.673  -58.590  42.149  1.00 60.36  ? 654  ASN A ND2   1 
ATOM   4969  N  N     . PHE A 1  655  ? -11.598 -60.807  42.194  1.00 53.41  ? 655  PHE A N     1 
ATOM   4970  C  CA    . PHE A 1  655  ? -12.866 -61.174  41.552  1.00 53.85  ? 655  PHE A CA    1 
ATOM   4971  C  C     . PHE A 1  655  ? -13.984 -61.258  42.582  1.00 57.21  ? 655  PHE A C     1 
ATOM   4972  O  O     . PHE A 1  655  ? -15.041 -60.659  42.381  1.00 56.51  ? 655  PHE A O     1 
ATOM   4973  C  CB    . PHE A 1  655  ? -12.744 -62.497  40.765  1.00 56.43  ? 655  PHE A CB    1 
ATOM   4974  C  CG    . PHE A 1  655  ? -14.054 -63.052  40.248  1.00 58.62  ? 655  PHE A CG    1 
ATOM   4975  C  CD1   . PHE A 1  655  ? -14.508 -62.732  38.977  1.00 61.56  ? 655  PHE A CD1   1 
ATOM   4976  C  CD2   . PHE A 1  655  ? -14.836 -63.885  41.039  1.00 61.34  ? 655  PHE A CD2   1 
ATOM   4977  C  CE1   . PHE A 1  655  ? -15.720 -63.240  38.503  1.00 63.45  ? 655  PHE A CE1   1 
ATOM   4978  C  CE2   . PHE A 1  655  ? -16.058 -64.373  40.574  1.00 65.22  ? 655  PHE A CE2   1 
ATOM   4979  C  CZ    . PHE A 1  655  ? -16.492 -64.048  39.310  1.00 63.45  ? 655  PHE A CZ    1 
ATOM   4980  N  N     . TRP A 1  656  ? -13.757 -62.013  43.669  1.00 54.02  ? 656  TRP A N     1 
ATOM   4981  C  CA    . TRP A 1  656  ? -14.755 -62.157  44.719  1.00 54.93  ? 656  TRP A CA    1 
ATOM   4982  C  C     . TRP A 1  656  ? -15.154 -60.787  45.259  1.00 57.38  ? 656  TRP A C     1 
ATOM   4983  O  O     . TRP A 1  656  ? -16.351 -60.481  45.311  1.00 57.61  ? 656  TRP A O     1 
ATOM   4984  C  CB    . TRP A 1  656  ? -14.246 -63.065  45.844  1.00 54.44  ? 656  TRP A CB    1 
ATOM   4985  C  CG    . TRP A 1  656  ? -15.234 -63.207  46.960  1.00 56.35  ? 656  TRP A CG    1 
ATOM   4986  C  CD1   . TRP A 1  656  ? -16.308 -64.044  47.000  1.00 60.70  ? 656  TRP A CD1   1 
ATOM   4987  C  CD2   . TRP A 1  656  ? -15.283 -62.430  48.161  1.00 55.87  ? 656  TRP A CD2   1 
ATOM   4988  N  NE1   . TRP A 1  656  ? -17.005 -63.863  48.171  1.00 60.80  ? 656  TRP A NE1   1 
ATOM   4989  C  CE2   . TRP A 1  656  ? -16.393 -62.883  48.908  1.00 61.15  ? 656  TRP A CE2   1 
ATOM   4990  C  CE3   . TRP A 1  656  ? -14.486 -61.397  48.689  1.00 56.00  ? 656  TRP A CE3   1 
ATOM   4991  C  CZ2   . TRP A 1  656  ? -16.717 -62.356  50.168  1.00 60.44  ? 656  TRP A CZ2   1 
ATOM   4992  C  CZ3   . TRP A 1  656  ? -14.809 -60.872  49.933  1.00 57.55  ? 656  TRP A CZ3   1 
ATOM   4993  C  CH2   . TRP A 1  656  ? -15.912 -61.352  50.660  1.00 59.37  ? 656  TRP A CH2   1 
ATOM   4994  N  N     . LEU A 1  657  ? -14.131 -59.962  45.614  1.00 51.70  ? 657  LEU A N     1 
ATOM   4995  C  CA    . LEU A 1  657  ? -14.256 -58.602  46.142  1.00 49.96  ? 657  LEU A CA    1 
ATOM   4996  C  C     . LEU A 1  657  ? -14.937 -57.677  45.145  1.00 54.57  ? 657  LEU A C     1 
ATOM   4997  O  O     . LEU A 1  657  ? -15.769 -56.876  45.558  1.00 53.87  ? 657  LEU A O     1 
ATOM   4998  C  CB    . LEU A 1  657  ? -12.890 -58.039  46.598  1.00 48.30  ? 657  LEU A CB    1 
ATOM   4999  C  CG    . LEU A 1  657  ? -12.877 -56.644  47.259  1.00 51.18  ? 657  LEU A CG    1 
ATOM   5000  C  CD1   . LEU A 1  657  ? -13.573 -56.646  48.602  1.00 51.87  ? 657  LEU A CD1   1 
ATOM   5001  C  CD2   . LEU A 1  657  ? -11.479 -56.147  47.438  1.00 51.42  ? 657  LEU A CD2   1 
ATOM   5002  N  N     . LEU A 1  658  ? -14.629 -57.817  43.836  1.00 52.40  ? 658  LEU A N     1 
ATOM   5003  C  CA    . LEU A 1  658  ? -15.258 -57.027  42.765  1.00 52.36  ? 658  LEU A CA    1 
ATOM   5004  C  C     . LEU A 1  658  ? -16.787 -57.167  42.847  1.00 57.49  ? 658  LEU A C     1 
ATOM   5005  O  O     . LEU A 1  658  ? -17.508 -56.179  42.674  1.00 57.01  ? 658  LEU A O     1 
ATOM   5006  C  CB    . LEU A 1  658  ? -14.730 -57.462  41.373  1.00 52.22  ? 658  LEU A CB    1 
ATOM   5007  C  CG    . LEU A 1  658  ? -15.509 -57.009  40.124  1.00 57.41  ? 658  LEU A CG    1 
ATOM   5008  C  CD1   . LEU A 1  658  ? -15.167 -55.582  39.720  1.00 56.13  ? 658  LEU A CD1   1 
ATOM   5009  C  CD2   . LEU A 1  658  ? -15.265 -57.954  38.956  1.00 62.41  ? 658  LEU A CD2   1 
ATOM   5010  N  N     . HIS A 1  659  ? -17.260 -58.383  43.173  1.00 55.28  ? 659  HIS A N     1 
ATOM   5011  C  CA    . HIS A 1  659  ? -18.679 -58.686  43.282  1.00 56.42  ? 659  HIS A CA    1 
ATOM   5012  C  C     . HIS A 1  659  ? -19.244 -58.543  44.684  1.00 61.39  ? 659  HIS A C     1 
ATOM   5013  O  O     . HIS A 1  659  ? -20.460 -58.384  44.832  1.00 62.34  ? 659  HIS A O     1 
ATOM   5014  C  CB    . HIS A 1  659  ? -19.004 -60.042  42.646  1.00 58.16  ? 659  HIS A CB    1 
ATOM   5015  C  CG    . HIS A 1  659  ? -18.615 -60.109  41.204  1.00 60.95  ? 659  HIS A CG    1 
ATOM   5016  N  ND1   . HIS A 1  659  ? -19.154 -59.243  40.272  1.00 62.32  ? 659  HIS A ND1   1 
ATOM   5017  C  CD2   . HIS A 1  659  ? -17.719 -60.912  40.589  1.00 62.65  ? 659  HIS A CD2   1 
ATOM   5018  C  CE1   . HIS A 1  659  ? -18.570 -59.544  39.125  1.00 61.68  ? 659  HIS A CE1   1 
ATOM   5019  N  NE2   . HIS A 1  659  ? -17.706 -60.547  39.265  1.00 62.21  ? 659  HIS A NE2   1 
ATOM   5020  N  N     . ASN A 1  660  ? -18.378 -58.568  45.706  1.00 57.48  ? 660  ASN A N     1 
ATOM   5021  C  CA    . ASN A 1  660  ? -18.816 -58.384  47.088  1.00 57.79  ? 660  ASN A CA    1 
ATOM   5022  C  C     . ASN A 1  660  ? -18.882 -56.892  47.390  1.00 60.00  ? 660  ASN A C     1 
ATOM   5023  O  O     . ASN A 1  660  ? -19.896 -56.389  47.872  1.00 59.77  ? 660  ASN A O     1 
ATOM   5024  C  CB    . ASN A 1  660  ? -17.872 -59.085  48.062  1.00 59.36  ? 660  ASN A CB    1 
ATOM   5025  C  CG    . ASN A 1  660  ? -18.431 -59.164  49.454  1.00 83.44  ? 660  ASN A CG    1 
ATOM   5026  O  OD1   . ASN A 1  660  ? -19.128 -60.118  49.807  1.00 80.69  ? 660  ASN A OD1   1 
ATOM   5027  N  ND2   . ASN A 1  660  ? -18.160 -58.150  50.265  1.00 73.28  ? 660  ASN A ND2   1 
ATOM   5028  N  N     . GLY A 1  661  ? -17.795 -56.206  47.083  1.00 55.56  ? 661  GLY A N     1 
ATOM   5029  C  CA    . GLY A 1  661  ? -17.658 -54.777  47.301  1.00 54.73  ? 661  GLY A CA    1 
ATOM   5030  C  C     . GLY A 1  661  ? -17.028 -54.477  48.639  1.00 57.76  ? 661  GLY A C     1 
ATOM   5031  O  O     . GLY A 1  661  ? -17.022 -55.333  49.530  1.00 58.14  ? 661  GLY A O     1 
ATOM   5032  N  N     . PHE A 1  662  ? -16.468 -53.265  48.764  1.00 52.53  ? 662  PHE A N     1 
ATOM   5033  C  CA    . PHE A 1  662  ? -15.860 -52.727  49.978  1.00 51.49  ? 662  PHE A CA    1 
ATOM   5034  C  C     . PHE A 1  662  ? -15.731 -51.214  49.855  1.00 56.28  ? 662  PHE A C     1 
ATOM   5035  O  O     . PHE A 1  662  ? -15.297 -50.710  48.823  1.00 54.29  ? 662  PHE A O     1 
ATOM   5036  C  CB    . PHE A 1  662  ? -14.529 -53.403  50.340  1.00 52.19  ? 662  PHE A CB    1 
ATOM   5037  C  CG    . PHE A 1  662  ? -14.075 -53.072  51.739  1.00 52.85  ? 662  PHE A CG    1 
ATOM   5038  C  CD1   . PHE A 1  662  ? -14.792 -53.511  52.842  1.00 56.26  ? 662  PHE A CD1   1 
ATOM   5039  C  CD2   . PHE A 1  662  ? -12.947 -52.293  51.954  1.00 53.77  ? 662  PHE A CD2   1 
ATOM   5040  C  CE1   . PHE A 1  662  ? -14.377 -53.191  54.136  1.00 56.80  ? 662  PHE A CE1   1 
ATOM   5041  C  CE2   . PHE A 1  662  ? -12.540 -51.965  53.249  1.00 55.92  ? 662  PHE A CE2   1 
ATOM   5042  C  CZ    . PHE A 1  662  ? -13.251 -52.425  54.330  1.00 54.54  ? 662  PHE A CZ    1 
ATOM   5043  N  N     . SER A 1  663  ? -16.161 -50.501  50.905  1.00 55.22  ? 663  SER A N     1 
ATOM   5044  C  CA    . SER A 1  663  ? -16.221 -49.042  51.002  1.00 55.11  ? 663  SER A CA    1 
ATOM   5045  C  C     . SER A 1  663  ? -15.735 -48.609  52.397  1.00 59.79  ? 663  SER A C     1 
ATOM   5046  O  O     . SER A 1  663  ? -15.262 -49.454  53.152  1.00 59.82  ? 663  SER A O     1 
ATOM   5047  C  CB    . SER A 1  663  ? -17.673 -48.607  50.802  1.00 59.55  ? 663  SER A CB    1 
ATOM   5048  O  OG    . SER A 1  663  ? -17.840 -47.212  50.614  1.00 68.87  ? 663  SER A OG    1 
ATOM   5049  N  N     . THR A 1  664  ? -15.823 -47.294  52.717  1.00 56.63  ? 664  THR A N     1 
ATOM   5050  C  CA    . THR A 1  664  ? -15.521 -46.646  54.008  1.00 56.67  ? 664  THR A CA    1 
ATOM   5051  C  C     . THR A 1  664  ? -16.136 -45.266  53.955  1.00 61.42  ? 664  THR A C     1 
ATOM   5052  O  O     . THR A 1  664  ? -15.810 -44.491  53.053  1.00 61.64  ? 664  THR A O     1 
ATOM   5053  C  CB    . THR A 1  664  ? -14.017 -46.558  54.299  1.00 65.56  ? 664  THR A CB    1 
ATOM   5054  O  OG1   . THR A 1  664  ? -13.510 -47.879  54.417  1.00 70.76  ? 664  THR A OG1   1 
ATOM   5055  C  CG2   . THR A 1  664  ? -13.715 -45.806  55.592  1.00 61.94  ? 664  THR A CG2   1 
ATOM   5056  N  N     . GLY A 1  665  ? -17.023 -44.974  54.897  1.00 57.85  ? 665  GLY A N     1 
ATOM   5057  C  CA    . GLY A 1  665  ? -17.695 -43.682  54.953  1.00 57.50  ? 665  GLY A CA    1 
ATOM   5058  C  C     . GLY A 1  665  ? -17.383 -42.903  56.205  1.00 60.37  ? 665  GLY A C     1 
ATOM   5059  O  O     . GLY A 1  665  ? -16.538 -43.320  57.003  1.00 60.31  ? 665  GLY A O     1 
ATOM   5060  N  N     . ILE A 1  666  ? -18.076 -41.771  56.398  1.00 55.81  ? 666  ILE A N     1 
ATOM   5061  C  CA    . ILE A 1  666  ? -17.927 -40.963  57.610  1.00 54.85  ? 666  ILE A CA    1 
ATOM   5062  C  C     . ILE A 1  666  ? -18.513 -41.732  58.810  1.00 58.76  ? 666  ILE A C     1 
ATOM   5063  O  O     . ILE A 1  666  ? -18.060 -41.547  59.939  1.00 58.54  ? 666  ILE A O     1 
ATOM   5064  C  CB    . ILE A 1  666  ? -18.483 -39.510  57.453  1.00 57.86  ? 666  ILE A CB    1 
ATOM   5065  C  CG1   . ILE A 1  666  ? -18.091 -38.587  58.631  1.00 57.89  ? 666  ILE A CG1   1 
ATOM   5066  C  CG2   . ILE A 1  666  ? -19.995 -39.482  57.213  1.00 59.83  ? 666  ILE A CG2   1 
ATOM   5067  C  CD1   . ILE A 1  666  ? -16.632 -38.454  58.915  1.00 61.69  ? 666  ILE A CD1   1 
ATOM   5068  N  N     . GLY A 1  667  ? -19.456 -42.633  58.520  1.00 55.15  ? 667  GLY A N     1 
ATOM   5069  C  CA    . GLY A 1  667  ? -20.132 -43.482  59.493  1.00 55.55  ? 667  GLY A CA    1 
ATOM   5070  C  C     . GLY A 1  667  ? -19.220 -44.367  60.316  1.00 58.12  ? 667  GLY A C     1 
ATOM   5071  O  O     . GLY A 1  667  ? -19.569 -44.734  61.447  1.00 58.62  ? 667  GLY A O     1 
ATOM   5072  N  N     . ASP A 1  668  ? -18.046 -44.720  59.753  1.00 52.29  ? 668  ASP A N     1 
ATOM   5073  C  CA    . ASP A 1  668  ? -17.078 -45.577  60.432  1.00 51.24  ? 668  ASP A CA    1 
ATOM   5074  C  C     . ASP A 1  668  ? -16.267 -44.871  61.515  1.00 54.53  ? 668  ASP A C     1 
ATOM   5075  O  O     . ASP A 1  668  ? -15.707 -45.542  62.374  1.00 54.67  ? 668  ASP A O     1 
ATOM   5076  C  CB    . ASP A 1  668  ? -16.204 -46.341  59.434  1.00 51.93  ? 668  ASP A CB    1 
ATOM   5077  C  CG    . ASP A 1  668  ? -17.010 -47.221  58.496  1.00 60.95  ? 668  ASP A CG    1 
ATOM   5078  O  OD1   . ASP A 1  668  ? -17.491 -48.286  58.944  1.00 60.66  ? 668  ASP A OD1   1 
ATOM   5079  O  OD2   . ASP A 1  668  ? -17.161 -46.844  57.312  1.00 68.23  ? 668  ASP A OD2   1 
ATOM   5080  N  N     . THR A 1  669  ? -16.236 -43.531  61.509  1.00 50.62  ? 669  THR A N     1 
ATOM   5081  C  CA    . THR A 1  669  ? -15.527 -42.754  62.532  1.00 50.34  ? 669  THR A CA    1 
ATOM   5082  C  C     . THR A 1  669  ? -16.452 -42.408  63.710  1.00 55.45  ? 669  THR A C     1 
ATOM   5083  O  O     . THR A 1  669  ? -15.981 -41.940  64.751  1.00 55.12  ? 669  THR A O     1 
ATOM   5084  C  CB    . THR A 1  669  ? -14.862 -41.508  61.926  1.00 60.29  ? 669  THR A CB    1 
ATOM   5085  O  OG1   . THR A 1  669  ? -15.860 -40.688  61.323  1.00 61.82  ? 669  THR A OG1   1 
ATOM   5086  C  CG2   . THR A 1  669  ? -13.771 -41.850  60.916  1.00 58.26  ? 669  THR A CG2   1 
ATOM   5087  N  N     . ILE A 1  670  ? -17.767 -42.658  63.549  1.00 53.24  ? 670  ILE A N     1 
ATOM   5088  C  CA    . ILE A 1  670  ? -18.785 -42.383  64.568  1.00 53.89  ? 670  ILE A CA    1 
ATOM   5089  C  C     . ILE A 1  670  ? -18.845 -43.490  65.614  1.00 61.04  ? 670  ILE A C     1 
ATOM   5090  O  O     . ILE A 1  670  ? -19.182 -44.628  65.288  1.00 60.64  ? 670  ILE A O     1 
ATOM   5091  C  CB    . ILE A 1  670  ? -20.175 -42.063  63.940  1.00 56.75  ? 670  ILE A CB    1 
ATOM   5092  C  CG1   . ILE A 1  670  ? -20.102 -40.791  63.081  1.00 55.60  ? 670  ILE A CG1   1 
ATOM   5093  C  CG2   . ILE A 1  670  ? -21.262 -41.919  65.013  1.00 58.33  ? 670  ILE A CG2   1 
ATOM   5094  C  CD1   . ILE A 1  670  ? -20.795 -40.865  61.825  1.00 55.23  ? 670  ILE A CD1   1 
ATOM   5095  N  N     . ALA A 1  671  ? -18.515 -43.140  66.873  1.00 60.39  ? 671  ALA A N     1 
ATOM   5096  C  CA    . ALA A 1  671  ? -18.589 -44.042  68.029  1.00 61.90  ? 671  ALA A CA    1 
ATOM   5097  C  C     . ALA A 1  671  ? -19.902 -43.777  68.774  1.00 68.94  ? 671  ALA A C     1 
ATOM   5098  O  O     . ALA A 1  671  ? -20.407 -42.649  68.762  1.00 68.79  ? 671  ALA A O     1 
ATOM   5099  C  CB    . ALA A 1  671  ? -17.406 -43.824  68.958  1.00 62.13  ? 671  ALA A CB    1 
ATOM   5100  N  N     . ASP A 1  672  ? -20.442 -44.820  69.422  1.00 67.96  ? 672  ASP A N     1 
ATOM   5101  C  CA    . ASP A 1  672  ? -21.711 -44.831  70.156  1.00 70.06  ? 672  ASP A CA    1 
ATOM   5102  C  C     . ASP A 1  672  ? -21.947 -43.655  71.097  1.00 74.60  ? 672  ASP A C     1 
ATOM   5103  O  O     . ASP A 1  672  ? -20.993 -43.058  71.603  1.00 73.70  ? 672  ASP A O     1 
ATOM   5104  C  CB    . ASP A 1  672  ? -21.852 -46.151  70.926  1.00 73.54  ? 672  ASP A CB    1 
ATOM   5105  C  CG    . ASP A 1  672  ? -23.263 -46.668  71.107  1.00 94.82  ? 672  ASP A CG    1 
ATOM   5106  O  OD1   . ASP A 1  672  ? -23.487 -47.462  72.049  1.00 97.86  ? 672  ASP A OD1   1 
ATOM   5107  O  OD2   . ASP A 1  672  ? -24.146 -46.289  70.301  1.00 105.46 ? 672  ASP A OD2   1 
ATOM   5108  N  N     . GLY A 1  673  ? -23.226 -43.333  71.300  1.00 72.28  ? 673  GLY A N     1 
ATOM   5109  C  CA    . GLY A 1  673  ? -23.670 -42.285  72.212  1.00 72.82  ? 673  GLY A CA    1 
ATOM   5110  C  C     . GLY A 1  673  ? -23.084 -42.493  73.596  1.00 77.26  ? 673  GLY A C     1 
ATOM   5111  O  O     . GLY A 1  673  ? -22.286 -41.660  74.040  1.00 76.23  ? 673  GLY A O     1 
ATOM   5112  N  N     . PRO A 1  674  ? -23.355 -43.659  74.250  1.00 74.69  ? 674  PRO A N     1 
ATOM   5113  C  CA    . PRO A 1  674  ? -22.760 -43.927  75.569  1.00 74.93  ? 674  PRO A CA    1 
ATOM   5114  C  C     . PRO A 1  674  ? -21.233 -44.022  75.563  1.00 77.99  ? 674  PRO A C     1 
ATOM   5115  O  O     . PRO A 1  674  ? -20.617 -43.740  76.599  1.00 78.34  ? 674  PRO A O     1 
ATOM   5116  C  CB    . PRO A 1  674  ? -23.388 -45.261  75.971  1.00 77.93  ? 674  PRO A CB    1 
ATOM   5117  C  CG    . PRO A 1  674  ? -24.620 -45.356  75.169  1.00 83.13  ? 674  PRO A CG    1 
ATOM   5118  C  CD    . PRO A 1  674  ? -24.266 -44.753  73.867  1.00 77.24  ? 674  PRO A CD    1 
ATOM   5119  N  N     . THR A 1  675  ? -20.627 -44.422  74.412  1.00 72.42  ? 675  THR A N     1 
ATOM   5120  C  CA    . THR A 1  675  ? -19.171 -44.525  74.226  1.00 70.26  ? 675  THR A CA    1 
ATOM   5121  C  C     . THR A 1  675  ? -18.545 -43.130  74.307  1.00 72.40  ? 675  THR A C     1 
ATOM   5122  O  O     . THR A 1  675  ? -17.524 -42.951  74.967  1.00 70.33  ? 675  THR A O     1 
ATOM   5123  C  CB    . THR A 1  675  ? -18.855 -45.285  72.928  1.00 76.13  ? 675  THR A CB    1 
ATOM   5124  O  OG1   . THR A 1  675  ? -19.398 -46.593  73.047  1.00 79.48  ? 675  THR A OG1   1 
ATOM   5125  C  CG2   . THR A 1  675  ? -17.369 -45.395  72.639  1.00 71.86  ? 675  THR A CG2   1 
ATOM   5126  N  N     . MET A 1  676  ? -19.191 -42.143  73.678  1.00 70.31  ? 676  MET A N     1 
ATOM   5127  C  CA    . MET A 1  676  ? -18.736 -40.755  73.690  1.00 70.18  ? 676  MET A CA    1 
ATOM   5128  C  C     . MET A 1  676  ? -18.830 -40.141  75.080  1.00 74.09  ? 676  MET A C     1 
ATOM   5129  O  O     . MET A 1  676  ? -17.937 -39.387  75.471  1.00 72.26  ? 676  MET A O     1 
ATOM   5130  C  CB    . MET A 1  676  ? -19.481 -39.920  72.641  1.00 72.83  ? 676  MET A CB    1 
ATOM   5131  C  CG    . MET A 1  676  ? -19.060 -40.237  71.226  1.00 76.01  ? 676  MET A CG    1 
ATOM   5132  S  SD    . MET A 1  676  ? -17.271 -40.059  70.951  1.00 79.38  ? 676  MET A SD    1 
ATOM   5133  C  CE    . MET A 1  676  ? -17.239 -40.065  69.119  1.00 75.66  ? 676  MET A CE    1 
ATOM   5134  N  N     . ARG A 1  677  ? -19.891 -40.506  75.838  1.00 72.51  ? 677  ARG A N     1 
ATOM   5135  C  CA    . ARG A 1  677  ? -20.111 -40.073  77.220  1.00 73.30  ? 677  ARG A CA    1 
ATOM   5136  C  C     . ARG A 1  677  ? -18.903 -40.518  78.038  1.00 76.90  ? 677  ARG A C     1 
ATOM   5137  O  O     . ARG A 1  677  ? -18.271 -39.684  78.686  1.00 76.12  ? 677  ARG A O     1 
ATOM   5138  C  CB    . ARG A 1  677  ? -21.408 -40.675  77.793  1.00 74.83  ? 677  ARG A CB    1 
ATOM   5139  C  CG    . ARG A 1  677  ? -22.680 -40.089  77.194  1.00 87.69  ? 677  ARG A CG    1 
ATOM   5140  C  CD    . ARG A 1  677  ? -23.884 -40.248  78.106  1.00 101.77 ? 677  ARG A CD    1 
ATOM   5141  N  NE    . ARG A 1  677  ? -24.476 -41.586  78.028  1.00 111.21 ? 677  ARG A NE    1 
ATOM   5142  C  CZ    . ARG A 1  677  ? -24.274 -42.553  78.919  1.00 123.17 ? 677  ARG A CZ    1 
ATOM   5143  N  NH1   . ARG A 1  677  ? -23.488 -42.346  79.969  1.00 111.03 ? 677  ARG A NH1   1 
ATOM   5144  N  NH2   . ARG A 1  677  ? -24.857 -43.735  78.766  1.00 105.91 ? 677  ARG A NH2   1 
ATOM   5145  N  N     . GLU A 1  678  ? -18.532 -41.814  77.914  1.00 73.43  ? 678  GLU A N     1 
ATOM   5146  C  CA    . GLU A 1  678  ? -17.377 -42.439  78.555  1.00 72.84  ? 678  GLU A CA    1 
ATOM   5147  C  C     . GLU A 1  678  ? -16.083 -41.737  78.147  1.00 75.14  ? 678  GLU A C     1 
ATOM   5148  O  O     . GLU A 1  678  ? -15.293 -41.388  79.021  1.00 74.96  ? 678  GLU A O     1 
ATOM   5149  C  CB    . GLU A 1  678  ? -17.306 -43.937  78.212  1.00 74.49  ? 678  GLU A CB    1 
ATOM   5150  C  CG    . GLU A 1  678  ? -18.062 -44.831  79.180  1.00 88.80  ? 678  GLU A CG    1 
ATOM   5151  C  CD    . GLU A 1  678  ? -17.189 -45.807  79.947  1.00 112.94 ? 678  GLU A CD    1 
ATOM   5152  O  OE1   . GLU A 1  678  ? -16.323 -45.353  80.730  1.00 107.63 ? 678  GLU A OE1   1 
ATOM   5153  O  OE2   . GLU A 1  678  ? -17.378 -47.032  79.767  1.00 107.95 ? 678  GLU A OE2   1 
ATOM   5154  N  N     . ILE A 1  679  ? -15.890 -41.490  76.832  1.00 70.33  ? 679  ILE A N     1 
ATOM   5155  C  CA    . ILE A 1  679  ? -14.704 -40.821  76.289  1.00 68.39  ? 679  ILE A CA    1 
ATOM   5156  C  C     . ILE A 1  679  ? -14.541 -39.422  76.880  1.00 72.24  ? 679  ILE A C     1 
ATOM   5157  O  O     . ILE A 1  679  ? -13.462 -39.105  77.387  1.00 71.04  ? 679  ILE A O     1 
ATOM   5158  C  CB    . ILE A 1  679  ? -14.691 -40.840  74.733  1.00 70.23  ? 679  ILE A CB    1 
ATOM   5159  C  CG1   . ILE A 1  679  ? -14.427 -42.271  74.210  1.00 70.07  ? 679  ILE A CG1   1 
ATOM   5160  C  CG2   . ILE A 1  679  ? -13.663 -39.839  74.157  1.00 69.71  ? 679  ILE A CG2   1 
ATOM   5161  C  CD1   . ILE A 1  679  ? -14.921 -42.550  72.806  1.00 74.82  ? 679  ILE A CD1   1 
ATOM   5162  N  N     . THR A 1  680  ? -15.620 -38.612  76.851  1.00 69.88  ? 680  THR A N     1 
ATOM   5163  C  CA    . THR A 1  680  ? -15.621 -37.243  77.377  1.00 70.11  ? 680  THR A CA    1 
ATOM   5164  C  C     . THR A 1  680  ? -15.327 -37.203  78.888  1.00 75.46  ? 680  THR A C     1 
ATOM   5165  O  O     . THR A 1  680  ? -14.569 -36.335  79.326  1.00 74.74  ? 680  THR A O     1 
ATOM   5166  C  CB    . THR A 1  680  ? -16.857 -36.445  76.909  1.00 77.42  ? 680  THR A CB    1 
ATOM   5167  O  OG1   . THR A 1  680  ? -17.137 -36.750  75.541  1.00 75.12  ? 680  THR A OG1   1 
ATOM   5168  C  CG2   . THR A 1  680  ? -16.669 -34.939  77.047  1.00 75.75  ? 680  THR A CG2   1 
ATOM   5169  N  N     . GLU A 1  681  ? -15.872 -38.161  79.668  1.00 73.61  ? 681  GLU A N     1 
ATOM   5170  C  CA    . GLU A 1  681  ? -15.593 -38.220  81.106  1.00 74.39  ? 681  GLU A CA    1 
ATOM   5171  C  C     . GLU A 1  681  ? -14.211 -38.810  81.438  1.00 76.97  ? 681  GLU A C     1 
ATOM   5172  O  O     . GLU A 1  681  ? -13.680 -38.534  82.514  1.00 77.17  ? 681  GLU A O     1 
ATOM   5173  C  CB    . GLU A 1  681  ? -16.759 -38.795  81.949  1.00 77.52  ? 681  GLU A CB    1 
ATOM   5174  C  CG    . GLU A 1  681  ? -17.172 -40.232  81.654  1.00 91.83  ? 681  GLU A CG    1 
ATOM   5175  C  CD    . GLU A 1  681  ? -18.646 -40.561  81.855  1.00 122.18 ? 681  GLU A CD    1 
ATOM   5176  O  OE1   . GLU A 1  681  ? -19.506 -39.744  81.449  1.00 120.44 ? 681  GLU A OE1   1 
ATOM   5177  O  OE2   . GLU A 1  681  ? -18.942 -41.664  82.371  1.00 119.11 ? 681  GLU A OE2   1 
ATOM   5178  N  N     . THR A 1  682  ? -13.612 -39.568  80.491  1.00 71.96  ? 682  THR A N     1 
ATOM   5179  C  CA    . THR A 1  682  ? -12.272 -40.152  80.622  1.00 70.96  ? 682  THR A CA    1 
ATOM   5180  C  C     . THR A 1  682  ? -11.244 -39.023  80.591  1.00 74.37  ? 682  THR A C     1 
ATOM   5181  O  O     . THR A 1  682  ? -10.388 -38.951  81.477  1.00 73.57  ? 682  THR A O     1 
ATOM   5182  C  CB    . THR A 1  682  ? -12.054 -41.245  79.553  1.00 76.63  ? 682  THR A CB    1 
ATOM   5183  O  OG1   . THR A 1  682  ? -12.724 -42.425  79.984  1.00 77.03  ? 682  THR A OG1   1 
ATOM   5184  C  CG2   . THR A 1  682  ? -10.580 -41.566  79.302  1.00 74.11  ? 682  THR A CG2   1 
ATOM   5185  N  N     . ILE A 1  683  ? -11.358 -38.128  79.581  1.00 70.93  ? 683  ILE A N     1 
ATOM   5186  C  CA    . ILE A 1  683  ? -10.495 -36.956  79.406  1.00 70.21  ? 683  ILE A CA    1 
ATOM   5187  C  C     . ILE A 1  683  ? -10.725 -35.981  80.570  1.00 75.46  ? 683  ILE A C     1 
ATOM   5188  O  O     . ILE A 1  683  ? -9.777  -35.326  81.008  1.00 75.38  ? 683  ILE A O     1 
ATOM   5189  C  CB    . ILE A 1  683  ? -10.703 -36.271  78.023  1.00 72.60  ? 683  ILE A CB    1 
ATOM   5190  C  CG1   . ILE A 1  683  ? -10.728 -37.279  76.835  1.00 72.66  ? 683  ILE A CG1   1 
ATOM   5191  C  CG2   . ILE A 1  683  ? -9.713  -35.118  77.793  1.00 72.53  ? 683  ILE A CG2   1 
ATOM   5192  C  CD1   . ILE A 1  683  ? -9.380  -37.984  76.433  1.00 82.84  ? 683  ILE A CD1   1 
ATOM   5193  N  N     . ALA A 1  684  ? -11.978 -35.915  81.087  1.00 72.59  ? 684  ALA A N     1 
ATOM   5194  C  CA    . ALA A 1  684  ? -12.361 -35.059  82.215  1.00 72.79  ? 684  ALA A CA    1 
ATOM   5195  C  C     . ALA A 1  684  ? -11.608 -35.439  83.492  1.00 74.99  ? 684  ALA A C     1 
ATOM   5196  O  O     . ALA A 1  684  ? -11.036 -34.557  84.136  1.00 74.07  ? 684  ALA A O     1 
ATOM   5197  C  CB    . ALA A 1  684  ? -13.865 -35.119  82.445  1.00 74.68  ? 684  ALA A CB    1 
ATOM   5198  N  N     . GLU A 1  685  ? -11.564 -36.747  83.827  1.00 70.94  ? 685  GLU A N     1 
ATOM   5199  C  CA    . GLU A 1  685  ? -10.853 -37.222  85.012  1.00 71.06  ? 685  GLU A CA    1 
ATOM   5200  C  C     . GLU A 1  685  ? -9.334  -37.136  84.856  1.00 72.23  ? 685  GLU A C     1 
ATOM   5201  O  O     . GLU A 1  685  ? -8.631  -37.007  85.858  1.00 72.48  ? 685  GLU A O     1 
ATOM   5202  C  CB    . GLU A 1  685  ? -11.343 -38.602  85.490  1.00 73.59  ? 685  GLU A CB    1 
ATOM   5203  C  CG    . GLU A 1  685  ? -10.939 -39.778  84.618  1.00 88.15  ? 685  GLU A CG    1 
ATOM   5204  C  CD    . GLU A 1  685  ? -10.819 -41.108  85.338  1.00 121.31 ? 685  GLU A CD    1 
ATOM   5205  O  OE1   . GLU A 1  685  ? -11.187 -42.142  84.732  1.00 122.26 ? 685  GLU A OE1   1 
ATOM   5206  O  OE2   . GLU A 1  685  ? -10.331 -41.124  86.493  1.00 118.80 ? 685  GLU A OE2   1 
ATOM   5207  N  N     . ALA A 1  686  ? -8.836  -37.163  83.605  1.00 66.23  ? 686  ALA A N     1 
ATOM   5208  C  CA    . ALA A 1  686  ? -7.414  -37.005  83.314  1.00 64.73  ? 686  ALA A CA    1 
ATOM   5209  C  C     . ALA A 1  686  ? -7.022  -35.560  83.620  1.00 68.31  ? 686  ALA A C     1 
ATOM   5210  O  O     . ALA A 1  686  ? -6.012  -35.336  84.295  1.00 68.41  ? 686  ALA A O     1 
ATOM   5211  C  CB    . ALA A 1  686  ? -7.132  -37.321  81.861  1.00 64.32  ? 686  ALA A CB    1 
ATOM   5212  N  N     . LYS A 1  687  ? -7.862  -34.584  83.181  1.00 63.70  ? 687  LYS A N     1 
ATOM   5213  C  CA    . LYS A 1  687  ? -7.673  -33.145  83.425  1.00 62.84  ? 687  LYS A CA    1 
ATOM   5214  C  C     . LYS A 1  687  ? -7.621  -32.846  84.939  1.00 66.50  ? 687  LYS A C     1 
ATOM   5215  O  O     . LYS A 1  687  ? -6.885  -31.947  85.362  1.00 65.83  ? 687  LYS A O     1 
ATOM   5216  C  CB    . LYS A 1  687  ? -8.777  -32.312  82.740  1.00 64.70  ? 687  LYS A CB    1 
ATOM   5217  C  CG    . LYS A 1  687  ? -8.626  -32.166  81.227  1.00 70.69  ? 687  LYS A CG    1 
ATOM   5218  C  CD    . LYS A 1  687  ? -8.781  -30.706  80.782  1.00 78.29  ? 687  LYS A CD    1 
ATOM   5219  C  CE    . LYS A 1  687  ? -9.544  -30.535  79.487  1.00 82.51  ? 687  LYS A CE    1 
ATOM   5220  N  NZ    . LYS A 1  687  ? -11.017 -30.641  79.687  1.00 89.16  ? 687  LYS A NZ    1 
ATOM   5221  N  N     . LYS A 1  688  ? -8.380  -33.637  85.746  1.00 62.75  ? 688  LYS A N     1 
ATOM   5222  C  CA    . LYS A 1  688  ? -8.429  -33.526  87.207  1.00 62.85  ? 688  LYS A CA    1 
ATOM   5223  C  C     . LYS A 1  688  ? -7.145  -33.995  87.829  1.00 64.50  ? 688  LYS A C     1 
ATOM   5224  O  O     . LYS A 1  688  ? -6.634  -33.300  88.703  1.00 64.12  ? 688  LYS A O     1 
ATOM   5225  C  CB    . LYS A 1  688  ? -9.645  -34.246  87.818  1.00 66.56  ? 688  LYS A CB    1 
ATOM   5226  C  CG    . LYS A 1  688  ? -11.017 -33.717  87.364  1.00 86.58  ? 688  LYS A CG    1 
ATOM   5227  C  CD    . LYS A 1  688  ? -11.298 -32.220  87.676  1.00 98.98  ? 688  LYS A CD    1 
ATOM   5228  C  CE    . LYS A 1  688  ? -10.950 -31.248  86.554  1.00 107.04 ? 688  LYS A CE    1 
ATOM   5229  N  NZ    . LYS A 1  688  ? -11.578 -31.613  85.252  1.00 114.33 ? 688  LYS A NZ    1 
ATOM   5230  N  N     . LYS A 1  689  ? -6.590  -35.139  87.349  1.00 59.68  ? 689  LYS A N     1 
ATOM   5231  C  CA    . LYS A 1  689  ? -5.302  -35.688  87.806  1.00 58.99  ? 689  LYS A CA    1 
ATOM   5232  C  C     . LYS A 1  689  ? -4.207  -34.612  87.649  1.00 60.78  ? 689  LYS A C     1 
ATOM   5233  O  O     . LYS A 1  689  ? -3.450  -34.349  88.594  1.00 60.48  ? 689  LYS A O     1 
ATOM   5234  C  CB    . LYS A 1  689  ? -4.917  -36.952  87.006  1.00 60.62  ? 689  LYS A CB    1 
ATOM   5235  C  CG    . LYS A 1  689  ? -5.539  -38.248  87.513  1.00 73.25  ? 689  LYS A CG    1 
ATOM   5236  C  CD    . LYS A 1  689  ? -5.085  -39.432  86.658  1.00 81.53  ? 689  LYS A CD    1 
ATOM   5237  C  CE    . LYS A 1  689  ? -5.613  -40.769  87.122  1.00 90.90  ? 689  LYS A CE    1 
ATOM   5238  N  NZ    . LYS A 1  689  ? -5.097  -41.886  86.283  1.00 96.91  ? 689  LYS A NZ    1 
ATOM   5239  N  N     . VAL A 1  690  ? -4.185  -33.953  86.468  1.00 54.76  ? 690  VAL A N     1 
ATOM   5240  C  CA    . VAL A 1  690  ? -3.251  -32.881  86.124  1.00 52.84  ? 690  VAL A CA    1 
ATOM   5241  C  C     . VAL A 1  690  ? -3.420  -31.684  87.077  1.00 56.74  ? 690  VAL A C     1 
ATOM   5242  O  O     . VAL A 1  690  ? -2.422  -31.215  87.629  1.00 56.52  ? 690  VAL A O     1 
ATOM   5243  C  CB    . VAL A 1  690  ? -3.358  -32.494  84.625  1.00 54.37  ? 690  VAL A CB    1 
ATOM   5244  C  CG1   . VAL A 1  690  ? -2.412  -31.354  84.275  1.00 53.32  ? 690  VAL A CG1   1 
ATOM   5245  C  CG2   . VAL A 1  690  ? -3.076  -33.699  83.745  1.00 53.33  ? 690  VAL A CG2   1 
ATOM   5246  N  N     . LEU A 1  691  ? -4.681  -31.237  87.303  1.00 52.95  ? 691  LEU A N     1 
ATOM   5247  C  CA    . LEU A 1  691  ? -5.027  -30.105  88.178  1.00 53.25  ? 691  LEU A CA    1 
ATOM   5248  C  C     . LEU A 1  691  ? -4.526  -30.319  89.598  1.00 57.47  ? 691  LEU A C     1 
ATOM   5249  O  O     . LEU A 1  691  ? -3.997  -29.395  90.213  1.00 57.34  ? 691  LEU A O     1 
ATOM   5250  C  CB    . LEU A 1  691  ? -6.549  -29.904  88.210  1.00 53.85  ? 691  LEU A CB    1 
ATOM   5251  C  CG    . LEU A 1  691  ? -7.081  -28.479  88.083  1.00 58.71  ? 691  LEU A CG    1 
ATOM   5252  C  CD1   . LEU A 1  691  ? -8.583  -28.488  87.894  1.00 59.69  ? 691  LEU A CD1   1 
ATOM   5253  C  CD2   . LEU A 1  691  ? -6.746  -27.637  89.290  1.00 61.44  ? 691  LEU A CD2   1 
ATOM   5254  N  N     . ASP A 1  692  ? -4.705  -31.539  90.108  1.00 53.99  ? 692  ASP A N     1 
ATOM   5255  C  CA    . ASP A 1  692  ? -4.301  -31.940  91.439  1.00 54.46  ? 692  ASP A CA    1 
ATOM   5256  C  C     . ASP A 1  692  ? -2.789  -31.946  91.580  1.00 57.45  ? 692  ASP A C     1 
ATOM   5257  O  O     . ASP A 1  692  ? -2.290  -31.449  92.588  1.00 58.40  ? 692  ASP A O     1 
ATOM   5258  C  CB    . ASP A 1  692  ? -4.938  -33.288  91.804  1.00 57.23  ? 692  ASP A CB    1 
ATOM   5259  C  CG    . ASP A 1  692  ? -6.465  -33.265  91.855  1.00 70.56  ? 692  ASP A CG    1 
ATOM   5260  O  OD1   . ASP A 1  692  ? -7.065  -32.205  91.514  1.00 70.83  ? 692  ASP A OD1   1 
ATOM   5261  O  OD2   . ASP A 1  692  ? -7.064  -34.312  92.197  1.00 77.95  ? 692  ASP A OD2   1 
ATOM   5262  N  N     . VAL A 1  693  ? -2.054  -32.441  90.557  1.00 52.27  ? 693  VAL A N     1 
ATOM   5263  C  CA    . VAL A 1  693  ? -0.579  -32.434  90.552  1.00 51.48  ? 693  VAL A CA    1 
ATOM   5264  C  C     . VAL A 1  693  ? -0.090  -30.984  90.519  1.00 54.56  ? 693  VAL A C     1 
ATOM   5265  O  O     . VAL A 1  693  ? 0.826   -30.628  91.267  1.00 54.54  ? 693  VAL A O     1 
ATOM   5266  C  CB    . VAL A 1  693  ? 0.022   -33.307  89.418  1.00 54.35  ? 693  VAL A CB    1 
ATOM   5267  C  CG1   . VAL A 1  693  ? 1.536   -33.126  89.292  1.00 53.37  ? 693  VAL A CG1   1 
ATOM   5268  C  CG2   . VAL A 1  693  ? -0.309  -34.769  89.658  1.00 54.82  ? 693  VAL A CG2   1 
ATOM   5269  N  N     . THR A 1  694  ? -0.756  -30.143  89.695  1.00 49.85  ? 694  THR A N     1 
ATOM   5270  C  CA    . THR A 1  694  ? -0.479  -28.717  89.574  1.00 49.17  ? 694  THR A CA    1 
ATOM   5271  C  C     . THR A 1  694  ? -0.613  -28.089  90.944  1.00 54.28  ? 694  THR A C     1 
ATOM   5272  O  O     . THR A 1  694  ? 0.330   -27.455  91.402  1.00 54.57  ? 694  THR A O     1 
ATOM   5273  C  CB    . THR A 1  694  ? -1.410  -28.073  88.552  1.00 54.16  ? 694  THR A CB    1 
ATOM   5274  O  OG1   . THR A 1  694  ? -1.363  -28.824  87.340  1.00 51.08  ? 694  THR A OG1   1 
ATOM   5275  C  CG2   . THR A 1  694  ? -1.059  -26.622  88.284  1.00 53.49  ? 694  THR A CG2   1 
ATOM   5276  N  N     . LYS A 1  695  ? -1.748  -28.346  91.624  1.00 51.49  ? 695  LYS A N     1 
ATOM   5277  C  CA    . LYS A 1  695  ? -2.061  -27.857  92.967  1.00 52.52  ? 695  LYS A CA    1 
ATOM   5278  C  C     . LYS A 1  695  ? -0.997  -28.281  93.989  1.00 58.11  ? 695  LYS A C     1 
ATOM   5279  O  O     . LYS A 1  695  ? -0.574  -27.464  94.815  1.00 57.47  ? 695  LYS A O     1 
ATOM   5280  C  CB    . LYS A 1  695  ? -3.463  -28.329  93.385  1.00 55.10  ? 695  LYS A CB    1 
ATOM   5281  C  CG    . LYS A 1  695  ? -4.425  -27.201  93.727  1.00 69.84  ? 695  LYS A CG    1 
ATOM   5282  C  CD    . LYS A 1  695  ? -5.204  -26.660  92.522  1.00 80.60  ? 695  LYS A CD    1 
ATOM   5283  C  CE    . LYS A 1  695  ? -4.675  -25.348  91.973  1.00 95.28  ? 695  LYS A CE    1 
ATOM   5284  N  NZ    . LYS A 1  695  ? -4.884  -24.206  92.912  1.00 107.43 ? 695  LYS A NZ    1 
ATOM   5285  N  N     . GLU A 1  696  ? -0.537  -29.543  93.885  1.00 56.48  ? 696  GLU A N     1 
ATOM   5286  C  CA    . GLU A 1  696  ? 0.491   -30.146  94.727  1.00 57.88  ? 696  GLU A CA    1 
ATOM   5287  C  C     . GLU A 1  696  ? 1.831   -29.433  94.506  1.00 62.13  ? 696  GLU A C     1 
ATOM   5288  O  O     . GLU A 1  696  ? 2.494   -29.067  95.483  1.00 62.74  ? 696  GLU A O     1 
ATOM   5289  C  CB    . GLU A 1  696  ? 0.600   -31.651  94.415  1.00 59.50  ? 696  GLU A CB    1 
ATOM   5290  C  CG    . GLU A 1  696  ? 1.535   -32.437  95.326  1.00 78.51  ? 696  GLU A CG    1 
ATOM   5291  C  CD    . GLU A 1  696  ? 1.746   -33.910  95.002  1.00 113.46 ? 696  GLU A CD    1 
ATOM   5292  O  OE1   . GLU A 1  696  ? 1.144   -34.415  94.025  1.00 111.07 ? 696  GLU A OE1   1 
ATOM   5293  O  OE2   . GLU A 1  696  ? 2.529   -34.560  95.733  1.00 113.52 ? 696  GLU A OE2   1 
ATOM   5294  N  N     . ALA A 1  697  ? 2.206   -29.217  93.223  1.00 57.68  ? 697  ALA A N     1 
ATOM   5295  C  CA    . ALA A 1  697  ? 3.444   -28.545  92.819  1.00 57.25  ? 697  ALA A CA    1 
ATOM   5296  C  C     . ALA A 1  697  ? 3.494   -27.118  93.343  1.00 62.45  ? 697  ALA A C     1 
ATOM   5297  O  O     . ALA A 1  697  ? 4.486   -26.735  93.964  1.00 62.23  ? 697  ALA A O     1 
ATOM   5298  C  CB    . ALA A 1  697  ? 3.577   -28.557  91.306  1.00 56.86  ? 697  ALA A CB    1 
ATOM   5299  N  N     . GLN A 1  698  ? 2.392   -26.362  93.148  1.00 60.45  ? 698  GLN A N     1 
ATOM   5300  C  CA    . GLN A 1  698  ? 2.195   -24.975  93.586  1.00 61.67  ? 698  GLN A CA    1 
ATOM   5301  C  C     . GLN A 1  698  ? 2.241   -24.832  95.115  1.00 69.53  ? 698  GLN A C     1 
ATOM   5302  O  O     . GLN A 1  698  ? 2.591   -23.760  95.613  1.00 69.14  ? 698  GLN A O     1 
ATOM   5303  C  CB    . GLN A 1  698  ? 0.871   -24.417  93.036  1.00 62.72  ? 698  GLN A CB    1 
ATOM   5304  C  CG    . GLN A 1  698  ? 0.853   -24.239  91.515  1.00 73.31  ? 698  GLN A CG    1 
ATOM   5305  C  CD    . GLN A 1  698  ? -0.507  -23.909  90.937  1.00 90.32  ? 698  GLN A CD    1 
ATOM   5306  O  OE1   . GLN A 1  698  ? -1.559  -24.061  91.573  1.00 82.71  ? 698  GLN A OE1   1 
ATOM   5307  N  NE2   . GLN A 1  698  ? -0.510  -23.428  89.704  1.00 86.54  ? 698  GLN A NE2   1 
ATOM   5308  N  N     . ALA A 1  699  ? 1.911   -25.919  95.852  1.00 69.36  ? 699  ALA A N     1 
ATOM   5309  C  CA    . ALA A 1  699  ? 1.941   -25.967  97.319  1.00 71.71  ? 699  ALA A CA    1 
ATOM   5310  C  C     . ALA A 1  699  ? 3.331   -26.349  97.860  1.00 78.91  ? 699  ALA A C     1 
ATOM   5311  O  O     . ALA A 1  699  ? 3.536   -26.336  99.078  1.00 79.23  ? 699  ALA A O     1 
ATOM   5312  C  CB    . ALA A 1  699  ? 0.896   -26.947  97.829  1.00 72.80  ? 699  ALA A CB    1 
ATOM   5313  N  N     . ASN A 1  700  ? 4.284   -26.665  96.942  1.00 77.35  ? 700  ASN A N     1 
ATOM   5314  C  CA    . ASN A 1  700  ? 5.668   -27.099  97.202  1.00 78.65  ? 700  ASN A CA    1 
ATOM   5315  C  C     . ASN A 1  700  ? 5.691   -28.446  97.926  1.00 87.06  ? 700  ASN A C     1 
ATOM   5316  O  O     . ASN A 1  700  ? 6.618   -28.736  98.689  1.00 87.73  ? 700  ASN A O     1 
ATOM   5317  C  CB    . ASN A 1  700  ? 6.507   -26.026  97.939  1.00 78.07  ? 700  ASN A CB    1 
ATOM   5318  C  CG    . ASN A 1  700  ? 7.994   -26.056  97.633  1.00 93.50  ? 700  ASN A CG    1 
ATOM   5319  O  OD1   . ASN A 1  700  ? 8.532   -26.998  97.031  1.00 84.74  ? 700  ASN A OD1   1 
ATOM   5320  N  ND2   . ASN A 1  700  ? 8.695   -25.006  98.029  1.00 85.18  ? 700  ASN A ND2   1 
ATOM   5321  N  N     . LEU A 1  701  ? 4.662   -29.273  97.676  1.00 85.88  ? 701  LEU A N     1 
ATOM   5322  C  CA    . LEU A 1  701  ? 4.525   -30.588  98.296  1.00 87.32  ? 701  LEU A CA    1 
ATOM   5323  C  C     . LEU A 1  701  ? 4.981   -31.701  97.353  1.00 94.36  ? 701  LEU A C     1 
ATOM   5324  O  O     . LEU A 1  701  ? 5.147   -32.845  97.788  1.00 95.07  ? 701  LEU A O     1 
ATOM   5325  C  CB    . LEU A 1  701  ? 3.094   -30.817  98.835  1.00 87.59  ? 701  LEU A CB    1 
ATOM   5326  C  CG    . LEU A 1  701  ? 2.542   -29.779  99.841  1.00 92.53  ? 701  LEU A CG    1 
ATOM   5327  C  CD1   . LEU A 1  701  ? 1.088   -30.039  100.147 1.00 92.90  ? 701  LEU A CD1   1 
ATOM   5328  C  CD2   . LEU A 1  701  ? 3.348   -29.742  101.137 1.00 95.20  ? 701  LEU A CD2   1 
ATOM   5329  N  N     . LEU A 1  702  ? 5.231   -31.346  96.072  1.00 91.95  ? 702  LEU A N     1 
ATOM   5330  C  CA    . LEU A 1  702  ? 5.735   -32.236  95.025  1.00 91.96  ? 702  LEU A CA    1 
ATOM   5331  C  C     . LEU A 1  702  ? 7.166   -32.614  95.433  1.00 99.29  ? 702  LEU A C     1 
ATOM   5332  O  O     . LEU A 1  702  ? 8.028   -31.736  95.571  1.00 98.64  ? 702  LEU A O     1 
ATOM   5333  C  CB    . LEU A 1  702  ? 5.724   -31.487  93.667  1.00 90.92  ? 702  LEU A CB    1 
ATOM   5334  C  CG    . LEU A 1  702  ? 5.389   -32.235  92.355  1.00 94.29  ? 702  LEU A CG    1 
ATOM   5335  C  CD1   . LEU A 1  702  ? 6.509   -33.170  91.908  1.00 94.26  ? 702  LEU A CD1   1 
ATOM   5336  C  CD2   . LEU A 1  702  ? 4.007   -32.876  92.374  1.00 96.05  ? 702  LEU A CD2   1 
ATOM   5337  N  N     . THR A 1  703  ? 7.379   -33.914  95.712  1.00 98.95  ? 703  THR A N     1 
ATOM   5338  C  CA    . THR A 1  703  ? 8.650   -34.477  96.188  1.00 100.50 ? 703  THR A CA    1 
ATOM   5339  C  C     . THR A 1  703  ? 9.784   -34.458  95.141  1.00 106.51 ? 703  THR A C     1 
ATOM   5340  O  O     . THR A 1  703  ? 9.538   -34.566  93.928  1.00 104.81 ? 703  THR A O     1 
ATOM   5341  C  CB    . THR A 1  703  ? 8.429   -35.856  96.848  1.00 107.18 ? 703  THR A CB    1 
ATOM   5342  O  OG1   . THR A 1  703  ? 7.145   -35.892  97.479  1.00 106.06 ? 703  THR A OG1   1 
ATOM   5343  C  CG2   . THR A 1  703  ? 9.513   -36.204  97.866  1.00 106.00 ? 703  THR A CG2   1 
ATOM   5344  N  N     . ALA A 1  704  ? 11.035  -34.318  95.643  1.00 105.50 ? 704  ALA A N     1 
ATOM   5345  C  CA    . ALA A 1  704  ? 12.265  -34.273  94.854  1.00 105.53 ? 704  ALA A CA    1 
ATOM   5346  C  C     . ALA A 1  704  ? 12.782  -35.680  94.494  1.00 109.97 ? 704  ALA A C     1 
ATOM   5347  O  O     . ALA A 1  704  ? 13.484  -36.317  95.294  1.00 110.34 ? 704  ALA A O     1 
ATOM   5348  C  CB    . ALA A 1  704  ? 13.333  -33.470  95.594  1.00 107.08 ? 704  ALA A CB    1 
ATOM   5349  N  N     . LYS A 1  705  ? 12.406  -36.166  93.286  1.00 105.46 ? 705  LYS A N     1 
ATOM   5350  C  CA    . LYS A 1  705  ? 12.830  -37.473  92.765  1.00 104.84 ? 705  LYS A CA    1 
ATOM   5351  C  C     . LYS A 1  705  ? 14.238  -37.360  92.173  1.00 107.48 ? 705  LYS A C     1 
ATOM   5352  O  O     . LYS A 1  705  ? 14.496  -36.435  91.391  1.00 106.84 ? 705  LYS A O     1 
ATOM   5353  C  CB    . LYS A 1  705  ? 11.812  -38.064  91.762  1.00 106.37 ? 705  LYS A CB    1 
ATOM   5354  C  CG    . LYS A 1  705  ? 11.257  -37.079  90.721  1.00 117.70 ? 705  LYS A CG    1 
ATOM   5355  C  CD    . LYS A 1  705  ? 10.353  -37.756  89.681  1.00 125.22 ? 705  LYS A CD    1 
ATOM   5356  C  CE    . LYS A 1  705  ? 8.898   -37.856  90.090  1.00 134.32 ? 705  LYS A CE    1 
ATOM   5357  N  NZ    . LYS A 1  705  ? 8.048   -38.372  88.982  1.00 141.17 ? 705  LYS A NZ    1 
ATOM   5358  N  N     . HIS A 1  706  ? 15.155  -38.270  92.589  1.00 103.02 ? 706  HIS A N     1 
ATOM   5359  C  CA    . HIS A 1  706  ? 16.569  -38.282  92.193  1.00 102.24 ? 706  HIS A CA    1 
ATOM   5360  C  C     . HIS A 1  706  ? 16.811  -38.253  90.692  1.00 103.82 ? 706  HIS A C     1 
ATOM   5361  O  O     . HIS A 1  706  ? 16.167  -38.987  89.942  1.00 102.75 ? 706  HIS A O     1 
ATOM   5362  C  CB    . HIS A 1  706  ? 17.328  -39.449  92.839  1.00 103.86 ? 706  HIS A CB    1 
ATOM   5363  C  CG    . HIS A 1  706  ? 18.817  -39.265  92.838  1.00 107.84 ? 706  HIS A CG    1 
ATOM   5364  N  ND1   . HIS A 1  706  ? 19.480  -38.735  93.931  1.00 110.58 ? 706  HIS A ND1   1 
ATOM   5365  C  CD2   . HIS A 1  706  ? 19.723  -39.538  91.871  1.00 109.30 ? 706  HIS A CD2   1 
ATOM   5366  C  CE1   . HIS A 1  706  ? 20.759  -38.706  93.598  1.00 110.40 ? 706  HIS A CE1   1 
ATOM   5367  N  NE2   . HIS A 1  706  ? 20.955  -39.179  92.368  1.00 110.09 ? 706  HIS A NE2   1 
ATOM   5368  N  N     . GLY A 1  707  ? 17.740  -37.394  90.283  1.00 99.46  ? 707  GLY A N     1 
ATOM   5369  C  CA    . GLY A 1  707  ? 18.143  -37.233  88.893  1.00 98.17  ? 707  GLY A CA    1 
ATOM   5370  C  C     . GLY A 1  707  ? 17.331  -36.255  88.070  1.00 100.36 ? 707  GLY A C     1 
ATOM   5371  O  O     . GLY A 1  707  ? 17.663  -36.033  86.901  1.00 99.62  ? 707  GLY A O     1 
ATOM   5372  N  N     . MET A 1  708  ? 16.262  -35.662  88.646  1.00 96.03  ? 708  MET A N     1 
ATOM   5373  C  CA    . MET A 1  708  ? 15.431  -34.706  87.898  1.00 94.63  ? 708  MET A CA    1 
ATOM   5374  C  C     . MET A 1  708  ? 14.840  -33.523  88.681  1.00 95.77  ? 708  MET A C     1 
ATOM   5375  O  O     . MET A 1  708  ? 14.584  -33.633  89.885  1.00 95.55  ? 708  MET A O     1 
ATOM   5376  C  CB    . MET A 1  708  ? 14.393  -35.401  86.984  1.00 96.31  ? 708  MET A CB    1 
ATOM   5377  C  CG    . MET A 1  708  ? 13.450  -36.348  87.698  1.00 100.53 ? 708  MET A CG    1 
ATOM   5378  S  SD    . MET A 1  708  ? 12.179  -36.969  86.571  1.00 104.14 ? 708  MET A SD    1 
ATOM   5379  C  CE    . MET A 1  708  ? 13.054  -38.320  85.803  1.00 100.94 ? 708  MET A CE    1 
ATOM   5380  N  N     . THR A 1  709  ? 14.636  -32.389  87.965  1.00 89.85  ? 709  THR A N     1 
ATOM   5381  C  CA    . THR A 1  709  ? 14.080  -31.123  88.456  1.00 88.98  ? 709  THR A CA    1 
ATOM   5382  C  C     . THR A 1  709  ? 12.653  -31.322  88.964  1.00 91.06  ? 709  THR A C     1 
ATOM   5383  O  O     . THR A 1  709  ? 11.911  -32.141  88.425  1.00 89.73  ? 709  THR A O     1 
ATOM   5384  C  CB    . THR A 1  709  ? 14.141  -30.045  87.333  1.00 96.69  ? 709  THR A CB    1 
ATOM   5385  O  OG1   . THR A 1  709  ? 15.485  -29.885  86.883  1.00 98.30  ? 709  THR A OG1   1 
ATOM   5386  C  CG2   . THR A 1  709  ? 13.586  -28.681  87.753  1.00 94.55  ? 709  THR A CG2   1 
ATOM   5387  N  N     . LEU A 1  710  ? 12.280  -30.548  89.999  1.00 87.64  ? 710  LEU A N     1 
ATOM   5388  C  CA    . LEU A 1  710  ? 10.955  -30.494  90.623  1.00 87.04  ? 710  LEU A CA    1 
ATOM   5389  C  C     . LEU A 1  710  ? 9.894   -30.237  89.540  1.00 87.34  ? 710  LEU A C     1 
ATOM   5390  O  O     . LEU A 1  710  ? 8.823   -30.846  89.573  1.00 86.49  ? 710  LEU A O     1 
ATOM   5391  C  CB    . LEU A 1  710  ? 10.953  -29.347  91.667  1.00 88.21  ? 710  LEU A CB    1 
ATOM   5392  C  CG    . LEU A 1  710  ? 10.391  -29.599  93.087  1.00 94.33  ? 710  LEU A CG    1 
ATOM   5393  C  CD1   . LEU A 1  710  ? 8.878   -29.458  93.137  1.00 94.61  ? 710  LEU A CD1   1 
ATOM   5394  C  CD2   . LEU A 1  710  ? 10.890  -30.907  93.707  1.00 97.21  ? 710  LEU A CD2   1 
ATOM   5395  N  N     . ARG A 1  711  ? 10.234  -29.364  88.559  1.00 81.48  ? 711  ARG A N     1 
ATOM   5396  C  CA    . ARG A 1  711  ? 9.412   -29.002  87.409  1.00 79.36  ? 711  ARG A CA    1 
ATOM   5397  C  C     . ARG A 1  711  ? 9.470   -30.102  86.329  1.00 79.58  ? 711  ARG A C     1 
ATOM   5398  O  O     . ARG A 1  711  ? 8.455   -30.349  85.680  1.00 78.38  ? 711  ARG A O     1 
ATOM   5399  C  CB    . ARG A 1  711  ? 9.837   -27.627  86.853  1.00 79.98  ? 711  ARG A CB    1 
ATOM   5400  C  CG    . ARG A 1  711  ? 8.829   -27.014  85.871  1.00 90.08  ? 711  ARG A CG    1 
ATOM   5401  C  CD    . ARG A 1  711  ? 9.255   -25.652  85.345  1.00 94.76  ? 711  ARG A CD    1 
ATOM   5402  N  NE    . ARG A 1  711  ? 8.577   -24.553  86.035  1.00 94.40  ? 711  ARG A NE    1 
ATOM   5403  C  CZ    . ARG A 1  711  ? 9.094   -23.875  87.054  1.00 103.62 ? 711  ARG A CZ    1 
ATOM   5404  N  NH1   . ARG A 1  711  ? 10.306  -24.169  87.511  1.00 88.33  ? 711  ARG A NH1   1 
ATOM   5405  N  NH2   . ARG A 1  711  ? 8.405   -22.894  87.622  1.00 88.92  ? 711  ARG A NH2   1 
ATOM   5406  N  N     . GLU A 1  712  ? 10.642  -30.770  86.152  1.00 74.37  ? 712  GLU A N     1 
ATOM   5407  C  CA    . GLU A 1  712  ? 10.827  -31.877  85.196  1.00 72.78  ? 712  GLU A CA    1 
ATOM   5408  C  C     . GLU A 1  712  ? 9.936   -33.048  85.591  1.00 75.66  ? 712  GLU A C     1 
ATOM   5409  O  O     . GLU A 1  712  ? 9.414   -33.744  84.718  1.00 74.65  ? 712  GLU A O     1 
ATOM   5410  C  CB    . GLU A 1  712  ? 12.283  -32.357  85.167  1.00 74.31  ? 712  GLU A CB    1 
ATOM   5411  C  CG    . GLU A 1  712  ? 13.134  -31.742  84.074  1.00 82.04  ? 712  GLU A CG    1 
ATOM   5412  C  CD    . GLU A 1  712  ? 14.619  -32.046  84.155  1.00 99.20  ? 712  GLU A CD    1 
ATOM   5413  O  OE1   . GLU A 1  712  ? 15.378  -31.462  83.350  1.00 96.83  ? 712  GLU A OE1   1 
ATOM   5414  O  OE2   . GLU A 1  712  ? 15.030  -32.850  85.024  1.00 87.06  ? 712  GLU A OE2   1 
ATOM   5415  N  N     . SER A 1  713  ? 9.771   -33.255  86.916  1.00 72.09  ? 713  SER A N     1 
ATOM   5416  C  CA    . SER A 1  713  ? 8.920   -34.281  87.517  1.00 71.84  ? 713  SER A CA    1 
ATOM   5417  C  C     . SER A 1  713  ? 7.468   -34.005  87.101  1.00 73.23  ? 713  SER A C     1 
ATOM   5418  O  O     . SER A 1  713  ? 6.815   -34.891  86.545  1.00 72.85  ? 713  SER A O     1 
ATOM   5419  C  CB    . SER A 1  713  ? 9.026   -34.239  89.041  1.00 77.46  ? 713  SER A CB    1 
ATOM   5420  O  OG    . SER A 1  713  ? 10.356  -34.087  89.509  1.00 90.06  ? 713  SER A OG    1 
ATOM   5421  N  N     . PHE A 1  714  ? 6.995   -32.752  87.330  1.00 67.25  ? 714  PHE A N     1 
ATOM   5422  C  CA    . PHE A 1  714  ? 5.653   -32.268  87.011  1.00 65.37  ? 714  PHE A CA    1 
ATOM   5423  C  C     . PHE A 1  714  ? 5.280   -32.544  85.550  1.00 66.65  ? 714  PHE A C     1 
ATOM   5424  O  O     . PHE A 1  714  ? 4.273   -33.199  85.285  1.00 65.60  ? 714  PHE A O     1 
ATOM   5425  C  CB    . PHE A 1  714  ? 5.531   -30.769  87.351  1.00 67.14  ? 714  PHE A CB    1 
ATOM   5426  C  CG    . PHE A 1  714  ? 4.252   -30.122  86.876  1.00 68.34  ? 714  PHE A CG    1 
ATOM   5427  C  CD1   . PHE A 1  714  ? 3.085   -30.219  87.623  1.00 71.68  ? 714  PHE A CD1   1 
ATOM   5428  C  CD2   . PHE A 1  714  ? 4.211   -29.421  85.677  1.00 69.89  ? 714  PHE A CD2   1 
ATOM   5429  C  CE1   . PHE A 1  714  ? 1.901   -29.637  87.175  1.00 72.34  ? 714  PHE A CE1   1 
ATOM   5430  C  CE2   . PHE A 1  714  ? 3.024   -28.842  85.227  1.00 72.39  ? 714  PHE A CE2   1 
ATOM   5431  C  CZ    . PHE A 1  714  ? 1.880   -28.941  85.987  1.00 70.90  ? 714  PHE A CZ    1 
ATOM   5432  N  N     . GLU A 1  715  ? 6.111   -32.058  84.615  1.00 61.96  ? 715  GLU A N     1 
ATOM   5433  C  CA    . GLU A 1  715  ? 5.926   -32.217  83.174  1.00 60.22  ? 715  GLU A CA    1 
ATOM   5434  C  C     . GLU A 1  715  ? 5.843   -33.679  82.745  1.00 63.42  ? 715  GLU A C     1 
ATOM   5435  O  O     . GLU A 1  715  ? 5.006   -34.028  81.907  1.00 61.38  ? 715  GLU A O     1 
ATOM   5436  C  CB    . GLU A 1  715  ? 7.029   -31.474  82.419  1.00 60.94  ? 715  GLU A CB    1 
ATOM   5437  C  CG    . GLU A 1  715  ? 6.689   -30.016  82.184  1.00 68.28  ? 715  GLU A CG    1 
ATOM   5438  C  CD    . GLU A 1  715  ? 5.550   -29.802  81.208  1.00 78.65  ? 715  GLU A CD    1 
ATOM   5439  O  OE1   . GLU A 1  715  ? 5.661   -30.277  80.055  1.00 69.22  ? 715  GLU A OE1   1 
ATOM   5440  O  OE2   . GLU A 1  715  ? 4.543   -29.168  81.600  1.00 65.88  ? 715  GLU A OE2   1 
ATOM   5441  N  N     . ASP A 1  716  ? 6.688   -34.529  83.360  1.00 61.06  ? 716  ASP A N     1 
ATOM   5442  C  CA    . ASP A 1  716  ? 6.758   -35.967  83.126  1.00 61.23  ? 716  ASP A CA    1 
ATOM   5443  C  C     . ASP A 1  716  ? 5.405   -36.611  83.490  1.00 62.31  ? 716  ASP A C     1 
ATOM   5444  O  O     . ASP A 1  716  ? 4.840   -37.339  82.664  1.00 60.83  ? 716  ASP A O     1 
ATOM   5445  C  CB    . ASP A 1  716  ? 7.937   -36.567  83.937  1.00 65.08  ? 716  ASP A CB    1 
ATOM   5446  C  CG    . ASP A 1  716  ? 8.177   -38.069  83.842  1.00 83.61  ? 716  ASP A CG    1 
ATOM   5447  O  OD1   . ASP A 1  716  ? 8.746   -38.643  84.806  1.00 85.67  ? 716  ASP A OD1   1 
ATOM   5448  O  OD2   . ASP A 1  716  ? 7.829   -38.667  82.793  1.00 90.58  ? 716  ASP A OD2   1 
ATOM   5449  N  N     . ASN A 1  717  ? 4.860   -36.269  84.689  1.00 57.54  ? 717  ASN A N     1 
ATOM   5450  C  CA    . ASN A 1  717  ? 3.577   -36.766  85.198  1.00 56.73  ? 717  ASN A CA    1 
ATOM   5451  C  C     . ASN A 1  717  ? 2.428   -36.300  84.322  1.00 59.13  ? 717  ASN A C     1 
ATOM   5452  O  O     . ASN A 1  717  ? 1.642   -37.125  83.859  1.00 58.15  ? 717  ASN A O     1 
ATOM   5453  C  CB    . ASN A 1  717  ? 3.342   -36.322  86.650  1.00 56.78  ? 717  ASN A CB    1 
ATOM   5454  C  CG    . ASN A 1  717  ? 4.371   -36.803  87.647  1.00 85.06  ? 717  ASN A CG    1 
ATOM   5455  O  OD1   . ASN A 1  717  ? 4.899   -37.924  87.566  1.00 80.67  ? 717  ASN A OD1   1 
ATOM   5456  N  ND2   . ASN A 1  717  ? 4.652   -35.968  88.641  1.00 77.88  ? 717  ASN A ND2   1 
ATOM   5457  N  N     . VAL A 1  718  ? 2.359   -34.977  84.068  1.00 55.18  ? 718  VAL A N     1 
ATOM   5458  C  CA    . VAL A 1  718  ? 1.326   -34.329  83.257  1.00 53.91  ? 718  VAL A CA    1 
ATOM   5459  C  C     . VAL A 1  718  ? 1.199   -35.000  81.882  1.00 57.51  ? 718  VAL A C     1 
ATOM   5460  O  O     . VAL A 1  718  ? 0.104   -35.429  81.511  1.00 56.10  ? 718  VAL A O     1 
ATOM   5461  C  CB    . VAL A 1  718  ? 1.531   -32.794  83.195  1.00 56.66  ? 718  VAL A CB    1 
ATOM   5462  C  CG1   . VAL A 1  718  ? 0.584   -32.145  82.194  1.00 55.99  ? 718  VAL A CG1   1 
ATOM   5463  C  CG2   . VAL A 1  718  ? 1.347   -32.169  84.568  1.00 56.97  ? 718  VAL A CG2   1 
ATOM   5464  N  N     . VAL A 1  719  ? 2.334   -35.152  81.178  1.00 55.38  ? 719  VAL A N     1 
ATOM   5465  C  CA    . VAL A 1  719  ? 2.421   -35.791  79.864  1.00 55.59  ? 719  VAL A CA    1 
ATOM   5466  C  C     . VAL A 1  719  ? 1.917   -37.248  79.927  1.00 62.05  ? 719  VAL A C     1 
ATOM   5467  O  O     . VAL A 1  719  ? 1.184   -37.671  79.022  1.00 61.76  ? 719  VAL A O     1 
ATOM   5468  C  CB    . VAL A 1  719  ? 3.850   -35.632  79.275  1.00 59.35  ? 719  VAL A CB    1 
ATOM   5469  C  CG1   . VAL A 1  719  ? 4.236   -36.774  78.341  1.00 59.02  ? 719  VAL A CG1   1 
ATOM   5470  C  CG2   . VAL A 1  719  ? 4.003   -34.293  78.576  1.00 58.72  ? 719  VAL A CG2   1 
ATOM   5471  N  N     . ARG A 1  720  ? 2.267   -37.983  81.020  1.00 59.72  ? 720  ARG A N     1 
ATOM   5472  C  CA    . ARG A 1  720  ? 1.830   -39.363  81.250  1.00 59.92  ? 720  ARG A CA    1 
ATOM   5473  C  C     . ARG A 1  720  ? 0.315   -39.441  81.358  1.00 61.55  ? 720  ARG A C     1 
ATOM   5474  O  O     . ARG A 1  720  ? -0.288  -40.191  80.600  1.00 60.24  ? 720  ARG A O     1 
ATOM   5475  C  CB    . ARG A 1  720  ? 2.504   -39.975  82.489  1.00 64.63  ? 720  ARG A CB    1 
ATOM   5476  C  CG    . ARG A 1  720  ? 3.781   -40.745  82.168  1.00 85.74  ? 720  ARG A CG    1 
ATOM   5477  C  CD    . ARG A 1  720  ? 4.861   -40.578  83.228  1.00 104.68 ? 720  ARG A CD    1 
ATOM   5478  N  NE    . ARG A 1  720  ? 4.652   -41.426  84.403  1.00 118.28 ? 720  ARG A NE    1 
ATOM   5479  C  CZ    . ARG A 1  720  ? 5.420   -41.401  85.490  1.00 137.90 ? 720  ARG A CZ    1 
ATOM   5480  N  NH1   . ARG A 1  720  ? 6.448   -40.562  85.568  1.00 124.87 ? 720  ARG A NH1   1 
ATOM   5481  N  NH2   . ARG A 1  720  ? 5.165   -42.212  86.508  1.00 129.99 ? 720  ARG A NH2   1 
ATOM   5482  N  N     . PHE A 1  721  ? -0.302  -38.611  82.230  1.00 58.24  ? 721  PHE A N     1 
ATOM   5483  C  CA    . PHE A 1  721  ? -1.758  -38.554  82.413  1.00 58.73  ? 721  PHE A CA    1 
ATOM   5484  C  C     . PHE A 1  721  ? -2.483  -38.259  81.107  1.00 64.18  ? 721  PHE A C     1 
ATOM   5485  O  O     . PHE A 1  721  ? -3.566  -38.801  80.870  1.00 65.30  ? 721  PHE A O     1 
ATOM   5486  C  CB    . PHE A 1  721  ? -2.158  -37.450  83.408  1.00 60.79  ? 721  PHE A CB    1 
ATOM   5487  C  CG    . PHE A 1  721  ? -1.590  -37.521  84.798  1.00 62.66  ? 721  PHE A CG    1 
ATOM   5488  C  CD1   . PHE A 1  721  ? -0.931  -36.433  85.348  1.00 65.64  ? 721  PHE A CD1   1 
ATOM   5489  C  CD2   . PHE A 1  721  ? -1.770  -38.653  85.583  1.00 64.97  ? 721  PHE A CD2   1 
ATOM   5490  C  CE1   . PHE A 1  721  ? -0.399  -36.500  86.630  1.00 67.19  ? 721  PHE A CE1   1 
ATOM   5491  C  CE2   . PHE A 1  721  ? -1.258  -38.710  86.874  1.00 68.38  ? 721  PHE A CE2   1 
ATOM   5492  C  CZ    . PHE A 1  721  ? -0.580  -37.633  87.391  1.00 66.69  ? 721  PHE A CZ    1 
ATOM   5493  N  N     . LEU A 1  722  ? -1.906  -37.357  80.293  1.00 59.42  ? 722  LEU A N     1 
ATOM   5494  C  CA    . LEU A 1  722  ? -2.467  -36.917  79.026  1.00 58.17  ? 722  LEU A CA    1 
ATOM   5495  C  C     . LEU A 1  722  ? -2.358  -37.980  77.947  1.00 61.94  ? 722  LEU A C     1 
ATOM   5496  O  O     . LEU A 1  722  ? -3.250  -38.067  77.098  1.00 61.98  ? 722  LEU A O     1 
ATOM   5497  C  CB    . LEU A 1  722  ? -1.813  -35.596  78.595  1.00 57.57  ? 722  LEU A CB    1 
ATOM   5498  C  CG    . LEU A 1  722  ? -2.548  -34.274  78.921  1.00 62.22  ? 722  LEU A CG    1 
ATOM   5499  C  CD1   . LEU A 1  722  ? -3.520  -34.396  80.096  1.00 63.11  ? 722  LEU A CD1   1 
ATOM   5500  C  CD2   . LEU A 1  722  ? -1.566  -33.160  79.168  1.00 64.44  ? 722  LEU A CD2   1 
ATOM   5501  N  N     . ASN A 1  723  ? -1.288  -38.799  77.978  1.00 57.99  ? 723  ASN A N     1 
ATOM   5502  C  CA    . ASN A 1  723  ? -1.117  -39.872  76.996  1.00 57.26  ? 723  ASN A CA    1 
ATOM   5503  C  C     . ASN A 1  723  ? -1.967  -41.070  77.369  1.00 61.85  ? 723  ASN A C     1 
ATOM   5504  O  O     . ASN A 1  723  ? -2.563  -41.687  76.487  1.00 60.59  ? 723  ASN A O     1 
ATOM   5505  C  CB    . ASN A 1  723  ? 0.353   -40.229  76.787  1.00 56.12  ? 723  ASN A CB    1 
ATOM   5506  C  CG    . ASN A 1  723  ? 1.142   -39.142  76.082  1.00 69.91  ? 723  ASN A CG    1 
ATOM   5507  O  OD1   . ASN A 1  723  ? 0.627   -38.376  75.253  1.00 62.37  ? 723  ASN A OD1   1 
ATOM   5508  N  ND2   . ASN A 1  723  ? 2.424   -39.064  76.378  1.00 60.10  ? 723  ASN A ND2   1 
ATOM   5509  N  N     . GLU A 1  724  ? -2.079  -41.350  78.690  1.00 60.36  ? 724  GLU A N     1 
ATOM   5510  C  CA    . GLU A 1  724  ? -2.916  -42.409  79.266  1.00 61.24  ? 724  GLU A CA    1 
ATOM   5511  C  C     . GLU A 1  724  ? -4.374  -42.152  78.873  1.00 66.23  ? 724  GLU A C     1 
ATOM   5512  O  O     . GLU A 1  724  ? -5.070  -43.084  78.474  1.00 66.91  ? 724  GLU A O     1 
ATOM   5513  C  CB    . GLU A 1  724  ? -2.797  -42.431  80.803  1.00 63.44  ? 724  GLU A CB    1 
ATOM   5514  C  CG    . GLU A 1  724  ? -1.623  -43.225  81.352  1.00 75.38  ? 724  GLU A CG    1 
ATOM   5515  C  CD    . GLU A 1  724  ? -1.529  -43.265  82.869  1.00 101.72 ? 724  GLU A CD    1 
ATOM   5516  O  OE1   . GLU A 1  724  ? -0.473  -42.864  83.410  1.00 99.44  ? 724  GLU A OE1   1 
ATOM   5517  O  OE2   . GLU A 1  724  ? -2.508  -43.700  83.518  1.00 98.87  ? 724  GLU A OE2   1 
ATOM   5518  N  N     . ALA A 1  725  ? -4.811  -40.876  78.954  1.00 62.51  ? 725  ALA A N     1 
ATOM   5519  C  CA    . ALA A 1  725  ? -6.157  -40.413  78.620  1.00 62.58  ? 725  ALA A CA    1 
ATOM   5520  C  C     . ALA A 1  725  ? -6.525  -40.732  77.176  1.00 66.21  ? 725  ALA A C     1 
ATOM   5521  O  O     . ALA A 1  725  ? -7.562  -41.357  76.943  1.00 66.64  ? 725  ALA A O     1 
ATOM   5522  C  CB    . ALA A 1  725  ? -6.265  -38.916  78.861  1.00 63.19  ? 725  ALA A CB    1 
ATOM   5523  N  N     . ARG A 1  726  ? -5.671  -40.304  76.215  1.00 61.22  ? 726  ARG A N     1 
ATOM   5524  C  CA    . ARG A 1  726  ? -5.838  -40.490  74.772  1.00 59.94  ? 726  ARG A CA    1 
ATOM   5525  C  C     . ARG A 1  726  ? -6.006  -41.968  74.433  1.00 64.37  ? 726  ARG A C     1 
ATOM   5526  O  O     . ARG A 1  726  ? -6.893  -42.321  73.645  1.00 64.13  ? 726  ARG A O     1 
ATOM   5527  C  CB    . ARG A 1  726  ? -4.628  -39.889  74.023  1.00 57.20  ? 726  ARG A CB    1 
ATOM   5528  C  CG    . ARG A 1  726  ? -4.502  -40.305  72.557  1.00 59.87  ? 726  ARG A CG    1 
ATOM   5529  C  CD    . ARG A 1  726  ? -3.166  -39.911  71.972  1.00 66.21  ? 726  ARG A CD    1 
ATOM   5530  N  NE    . ARG A 1  726  ? -2.068  -40.710  72.514  1.00 74.74  ? 726  ARG A NE    1 
ATOM   5531  C  CZ    . ARG A 1  726  ? -0.802  -40.306  72.563  1.00 91.45  ? 726  ARG A CZ    1 
ATOM   5532  N  NH1   . ARG A 1  726  ? -0.463  -39.102  72.113  1.00 73.80  ? 726  ARG A NH1   1 
ATOM   5533  N  NH2   . ARG A 1  726  ? 0.134   -41.096  73.073  1.00 83.21  ? 726  ARG A NH2   1 
ATOM   5534  N  N     . ASP A 1  727  ? -5.155  -42.820  75.047  1.00 60.75  ? 727  ASP A N     1 
ATOM   5535  C  CA    . ASP A 1  727  ? -5.124  -44.260  74.832  1.00 60.50  ? 727  ASP A CA    1 
ATOM   5536  C  C     . ASP A 1  727  ? -6.350  -44.956  75.396  1.00 64.55  ? 727  ASP A C     1 
ATOM   5537  O  O     . ASP A 1  727  ? -6.955  -45.756  74.688  1.00 63.92  ? 727  ASP A O     1 
ATOM   5538  C  CB    . ASP A 1  727  ? -3.802  -44.861  75.338  1.00 62.53  ? 727  ASP A CB    1 
ATOM   5539  C  CG    . ASP A 1  727  ? -2.546  -44.414  74.583  1.00 74.63  ? 727  ASP A CG    1 
ATOM   5540  O  OD1   . ASP A 1  727  ? -2.680  -43.843  73.468  1.00 74.19  ? 727  ASP A OD1   1 
ATOM   5541  O  OD2   . ASP A 1  727  ? -1.430  -44.663  75.088  1.00 82.35  ? 727  ASP A OD2   1 
ATOM   5542  N  N     . LYS A 1  728  ? -6.757  -44.599  76.632  1.00 62.18  ? 728  LYS A N     1 
ATOM   5543  C  CA    . LYS A 1  728  ? -7.950  -45.131  77.309  1.00 63.09  ? 728  LYS A CA    1 
ATOM   5544  C  C     . LYS A 1  728  ? -9.204  -44.809  76.481  1.00 66.39  ? 728  LYS A C     1 
ATOM   5545  O  O     . LYS A 1  728  ? -10.021 -45.696  76.235  1.00 66.52  ? 728  LYS A O     1 
ATOM   5546  C  CB    . LYS A 1  728  ? -8.064  -44.560  78.739  1.00 66.66  ? 728  LYS A CB    1 
ATOM   5547  C  CG    . LYS A 1  728  ? -9.209  -45.150  79.572  1.00 94.71  ? 728  LYS A CG    1 
ATOM   5548  C  CD    . LYS A 1  728  ? -8.814  -45.400  81.043  1.00 113.07 ? 728  LYS A CD    1 
ATOM   5549  C  CE    . LYS A 1  728  ? -9.090  -44.247  81.994  1.00 128.28 ? 728  LYS A CE    1 
ATOM   5550  N  NZ    . LYS A 1  728  ? -10.492 -44.247  82.497  1.00 137.52 ? 728  LYS A NZ    1 
ATOM   5551  N  N     . ALA A 1  729  ? -9.320  -43.548  76.027  1.00 62.05  ? 729  ALA A N     1 
ATOM   5552  C  CA    . ALA A 1  729  ? -10.424 -43.057  75.210  1.00 61.63  ? 729  ALA A CA    1 
ATOM   5553  C  C     . ALA A 1  729  ? -10.439 -43.759  73.853  1.00 65.73  ? 729  ALA A C     1 
ATOM   5554  O  O     . ALA A 1  729  ? -11.511 -44.131  73.372  1.00 66.50  ? 729  ALA A O     1 
ATOM   5555  C  CB    . ALA A 1  729  ? -10.311 -41.551  75.028  1.00 61.68  ? 729  ALA A CB    1 
ATOM   5556  N  N     . GLY A 1  730  ? -9.256  -43.946  73.262  1.00 60.92  ? 730  GLY A N     1 
ATOM   5557  C  CA    . GLY A 1  730  ? -9.105  -44.624  71.980  1.00 59.79  ? 730  GLY A CA    1 
ATOM   5558  C  C     . GLY A 1  730  ? -9.547  -46.070  72.059  1.00 62.93  ? 730  GLY A C     1 
ATOM   5559  O  O     . GLY A 1  730  ? -10.239 -46.571  71.165  1.00 62.06  ? 730  GLY A O     1 
ATOM   5560  N  N     . ARG A 1  731  ? -9.156  -46.740  73.154  1.00 59.44  ? 731  ARG A N     1 
ATOM   5561  C  CA    . ARG A 1  731  ? -9.521  -48.125  73.402  1.00 59.77  ? 731  ARG A CA    1 
ATOM   5562  C  C     . ARG A 1  731  ? -11.031 -48.217  73.584  1.00 63.41  ? 731  ARG A C     1 
ATOM   5563  O  O     . ARG A 1  731  ? -11.654 -49.021  72.899  1.00 63.58  ? 731  ARG A O     1 
ATOM   5564  C  CB    . ARG A 1  731  ? -8.723  -48.716  74.573  1.00 60.88  ? 731  ARG A CB    1 
ATOM   5565  C  CG    . ARG A 1  731  ? -7.277  -49.026  74.187  1.00 73.35  ? 731  ARG A CG    1 
ATOM   5566  C  CD    . ARG A 1  731  ? -6.534  -49.814  75.249  1.00 92.38  ? 731  ARG A CD    1 
ATOM   5567  N  NE    . ARG A 1  731  ? -5.570  -49.007  76.004  1.00 105.26 ? 731  ARG A NE    1 
ATOM   5568  C  CZ    . ARG A 1  731  ? -4.306  -48.793  75.641  1.00 121.28 ? 731  ARG A CZ    1 
ATOM   5569  N  NH1   . ARG A 1  731  ? -3.841  -49.292  74.499  1.00 108.83 ? 731  ARG A NH1   1 
ATOM   5570  N  NH2   . ARG A 1  731  ? -3.504  -48.067  76.406  1.00 108.36 ? 731  ARG A NH2   1 
ATOM   5571  N  N     . LEU A 1  732  ? -11.627 -47.295  74.379  1.00 59.08  ? 732  LEU A N     1 
ATOM   5572  C  CA    . LEU A 1  732  ? -13.076 -47.180  74.603  1.00 59.08  ? 732  LEU A CA    1 
ATOM   5573  C  C     . LEU A 1  732  ? -13.842 -47.109  73.279  1.00 62.61  ? 732  LEU A C     1 
ATOM   5574  O  O     . LEU A 1  732  ? -14.933 -47.671  73.179  1.00 63.11  ? 732  LEU A O     1 
ATOM   5575  C  CB    . LEU A 1  732  ? -13.393 -45.907  75.403  1.00 58.93  ? 732  LEU A CB    1 
ATOM   5576  C  CG    . LEU A 1  732  ? -13.388 -45.975  76.913  1.00 63.67  ? 732  LEU A CG    1 
ATOM   5577  C  CD1   . LEU A 1  732  ? -13.212 -44.599  77.486  1.00 63.21  ? 732  LEU A CD1   1 
ATOM   5578  C  CD2   . LEU A 1  732  ? -14.683 -46.545  77.431  1.00 67.28  ? 732  LEU A CD2   1 
ATOM   5579  N  N     . ALA A 1  733  ? -13.268 -46.399  72.277  1.00 58.35  ? 733  ALA A N     1 
ATOM   5580  C  CA    . ALA A 1  733  ? -13.836 -46.206  70.938  1.00 57.83  ? 733  ALA A CA    1 
ATOM   5581  C  C     . ALA A 1  733  ? -13.642 -47.452  70.076  1.00 61.06  ? 733  ALA A C     1 
ATOM   5582  O  O     . ALA A 1  733  ? -14.625 -47.997  69.570  1.00 60.40  ? 733  ALA A O     1 
ATOM   5583  C  CB    . ALA A 1  733  ? -13.203 -44.989  70.264  1.00 57.40  ? 733  ALA A CB    1 
ATOM   5584  N  N     . GLU A 1  734  ? -12.380 -47.917  69.941  1.00 57.59  ? 734  GLU A N     1 
ATOM   5585  C  CA    . GLU A 1  734  ? -12.005 -49.095  69.155  1.00 57.79  ? 734  GLU A CA    1 
ATOM   5586  C  C     . GLU A 1  734  ? -12.739 -50.386  69.593  1.00 62.51  ? 734  GLU A C     1 
ATOM   5587  O  O     . GLU A 1  734  ? -13.012 -51.251  68.758  1.00 62.34  ? 734  GLU A O     1 
ATOM   5588  C  CB    . GLU A 1  734  ? -10.461 -49.223  69.047  1.00 58.68  ? 734  GLU A CB    1 
ATOM   5589  C  CG    . GLU A 1  734  ? -9.787  -50.352  69.813  1.00 73.67  ? 734  GLU A CG    1 
ATOM   5590  C  CD    . GLU A 1  734  ? -9.434  -51.555  68.960  1.00 100.43 ? 734  GLU A CD    1 
ATOM   5591  O  OE1   . GLU A 1  734  ? -10.085 -52.613  69.125  1.00 102.03 ? 734  GLU A OE1   1 
ATOM   5592  O  OE2   . GLU A 1  734  ? -8.519  -51.435  68.113  1.00 93.63  ? 734  GLU A OE2   1 
ATOM   5593  N  N     . VAL A 1  735  ? -13.088 -50.478  70.891  1.00 59.67  ? 735  VAL A N     1 
ATOM   5594  C  CA    . VAL A 1  735  ? -13.841 -51.582  71.489  1.00 60.80  ? 735  VAL A CA    1 
ATOM   5595  C  C     . VAL A 1  735  ? -15.296 -51.539  70.986  1.00 66.79  ? 735  VAL A C     1 
ATOM   5596  O  O     . VAL A 1  735  ? -15.868 -52.587  70.659  1.00 67.66  ? 735  VAL A O     1 
ATOM   5597  C  CB    . VAL A 1  735  ? -13.726 -51.530  73.031  1.00 64.87  ? 735  VAL A CB    1 
ATOM   5598  C  CG1   . VAL A 1  735  ? -14.908 -52.201  73.725  1.00 66.12  ? 735  VAL A CG1   1 
ATOM   5599  C  CG2   . VAL A 1  735  ? -12.403 -52.132  73.492  1.00 64.47  ? 735  VAL A CG2   1 
ATOM   5600  N  N     . ASN A 1  736  ? -15.868 -50.317  70.890  1.00 63.12  ? 736  ASN A N     1 
ATOM   5601  C  CA    . ASN A 1  736  ? -17.228 -50.081  70.405  1.00 63.32  ? 736  ASN A CA    1 
ATOM   5602  C  C     . ASN A 1  736  ? -17.374 -50.333  68.898  1.00 65.62  ? 736  ASN A C     1 
ATOM   5603  O  O     . ASN A 1  736  ? -18.491 -50.573  68.432  1.00 66.15  ? 736  ASN A O     1 
ATOM   5604  C  CB    . ASN A 1  736  ? -17.709 -48.680  70.771  1.00 64.03  ? 736  ASN A CB    1 
ATOM   5605  C  CG    . ASN A 1  736  ? -19.175 -48.479  70.488  1.00 87.24  ? 736  ASN A CG    1 
ATOM   5606  O  OD1   . ASN A 1  736  ? -19.560 -48.000  69.419  1.00 79.16  ? 736  ASN A OD1   1 
ATOM   5607  N  ND2   . ASN A 1  736  ? -20.026 -48.934  71.396  1.00 81.92  ? 736  ASN A ND2   1 
ATOM   5608  N  N     . LEU A 1  737  ? -16.261 -50.288  68.141  1.00 59.95  ? 737  LEU A N     1 
ATOM   5609  C  CA    . LEU A 1  737  ? -16.301 -50.542  66.704  1.00 58.94  ? 737  LEU A CA    1 
ATOM   5610  C  C     . LEU A 1  737  ? -16.782 -51.965  66.441  1.00 63.20  ? 737  LEU A C     1 
ATOM   5611  O  O     . LEU A 1  737  ? -16.216 -52.924  66.981  1.00 63.31  ? 737  LEU A O     1 
ATOM   5612  C  CB    . LEU A 1  737  ? -14.931 -50.326  66.032  1.00 57.68  ? 737  LEU A CB    1 
ATOM   5613  C  CG    . LEU A 1  737  ? -14.291 -48.932  66.074  1.00 61.41  ? 737  LEU A CG    1 
ATOM   5614  C  CD1   . LEU A 1  737  ? -13.029 -48.909  65.234  1.00 60.37  ? 737  LEU A CD1   1 
ATOM   5615  C  CD2   . LEU A 1  737  ? -15.250 -47.836  65.602  1.00 63.63  ? 737  LEU A CD2   1 
ATOM   5616  N  N     . LYS A 1  738  ? -17.863 -52.086  65.643  1.00 59.06  ? 738  LYS A N     1 
ATOM   5617  C  CA    . LYS A 1  738  ? -18.459 -53.359  65.245  1.00 58.97  ? 738  LYS A CA    1 
ATOM   5618  C  C     . LYS A 1  738  ? -17.549 -54.046  64.229  1.00 62.92  ? 738  LYS A C     1 
ATOM   5619  O  O     . LYS A 1  738  ? -16.734 -53.379  63.594  1.00 61.04  ? 738  LYS A O     1 
ATOM   5620  C  CB    . LYS A 1  738  ? -19.830 -53.126  64.605  1.00 60.91  ? 738  LYS A CB    1 
ATOM   5621  C  CG    . LYS A 1  738  ? -20.903 -52.573  65.521  1.00 65.95  ? 738  LYS A CG    1 
ATOM   5622  C  CD    . LYS A 1  738  ? -22.221 -52.455  64.759  1.00 71.50  ? 738  LYS A CD    1 
ATOM   5623  C  CE    . LYS A 1  738  ? -23.302 -51.707  65.492  1.00 78.59  ? 738  LYS A CE    1 
ATOM   5624  N  NZ    . LYS A 1  738  ? -22.932 -50.286  65.706  1.00 88.49  ? 738  LYS A NZ    1 
ATOM   5625  N  N     . ASP A 1  739  ? -17.701 -55.364  64.036  1.00 61.86  ? 739  ASP A N     1 
ATOM   5626  C  CA    . ASP A 1  739  ? -16.888 -56.080  63.050  1.00 61.84  ? 739  ASP A CA    1 
ATOM   5627  C  C     . ASP A 1  739  ? -17.257 -55.713  61.603  1.00 64.54  ? 739  ASP A C     1 
ATOM   5628  O  O     . ASP A 1  739  ? -16.472 -55.976  60.689  1.00 64.04  ? 739  ASP A O     1 
ATOM   5629  C  CB    . ASP A 1  739  ? -16.847 -57.598  63.311  1.00 65.61  ? 739  ASP A CB    1 
ATOM   5630  C  CG    . ASP A 1  739  ? -15.866 -58.035  64.399  1.00 82.46  ? 739  ASP A CG    1 
ATOM   5631  O  OD1   . ASP A 1  739  ? -15.344 -57.152  65.131  1.00 83.38  ? 739  ASP A OD1   1 
ATOM   5632  O  OD2   . ASP A 1  739  ? -15.632 -59.258  64.532  1.00 90.73  ? 739  ASP A OD2   1 
ATOM   5633  N  N     . LEU A 1  740  ? -18.420 -55.041  61.416  1.00 59.68  ? 740  LEU A N     1 
ATOM   5634  C  CA    . LEU A 1  740  ? -18.887 -54.511  60.129  1.00 58.06  ? 740  LEU A CA    1 
ATOM   5635  C  C     . LEU A 1  740  ? -18.257 -53.140  59.823  1.00 59.44  ? 740  LEU A C     1 
ATOM   5636  O  O     . LEU A 1  740  ? -18.385 -52.663  58.689  1.00 58.98  ? 740  LEU A O     1 
ATOM   5637  C  CB    . LEU A 1  740  ? -20.426 -54.432  60.045  1.00 58.99  ? 740  LEU A CB    1 
ATOM   5638  C  CG    . LEU A 1  740  ? -21.163 -53.856  61.241  1.00 63.74  ? 740  LEU A CG    1 
ATOM   5639  C  CD1   . LEU A 1  740  ? -22.079 -52.717  60.837  1.00 63.18  ? 740  LEU A CD1   1 
ATOM   5640  C  CD2   . LEU A 1  740  ? -21.899 -54.952  61.988  1.00 68.56  ? 740  LEU A CD2   1 
ATOM   5641  N  N     . ASN A 1  741  ? -17.577 -52.515  60.828  1.00 54.00  ? 741  ASN A N     1 
ATOM   5642  C  CA    . ASN A 1  741  ? -16.897 -51.223  60.695  1.00 51.96  ? 741  ASN A CA    1 
ATOM   5643  C  C     . ASN A 1  741  ? -15.751 -51.374  59.719  1.00 54.61  ? 741  ASN A C     1 
ATOM   5644  O  O     . ASN A 1  741  ? -14.802 -52.112  59.978  1.00 53.72  ? 741  ASN A O     1 
ATOM   5645  C  CB    . ASN A 1  741  ? -16.391 -50.703  62.044  1.00 50.36  ? 741  ASN A CB    1 
ATOM   5646  C  CG    . ASN A 1  741  ? -15.998 -49.242  62.044  1.00 60.36  ? 741  ASN A CG    1 
ATOM   5647  O  OD1   . ASN A 1  741  ? -16.697 -48.396  62.608  1.00 54.03  ? 741  ASN A OD1   1 
ATOM   5648  N  ND2   . ASN A 1  741  ? -14.864 -48.907  61.439  1.00 44.33  ? 741  ASN A ND2   1 
ATOM   5649  N  N     . ASN A 1  742  ? -15.868 -50.683  58.584  1.00 50.94  ? 742  ASN A N     1 
ATOM   5650  C  CA    . ASN A 1  742  ? -14.926 -50.706  57.473  1.00 50.12  ? 742  ASN A CA    1 
ATOM   5651  C  C     . ASN A 1  742  ? -13.501 -50.299  57.849  1.00 54.57  ? 742  ASN A C     1 
ATOM   5652  O  O     . ASN A 1  742  ? -12.558 -50.793  57.240  1.00 53.76  ? 742  ASN A O     1 
ATOM   5653  C  CB    . ASN A 1  742  ? -15.464 -49.889  56.313  1.00 49.73  ? 742  ASN A CB    1 
ATOM   5654  C  CG    . ASN A 1  742  ? -16.859 -50.292  55.893  1.00 72.47  ? 742  ASN A CG    1 
ATOM   5655  O  OD1   . ASN A 1  742  ? -17.080 -51.323  55.242  1.00 69.09  ? 742  ASN A OD1   1 
ATOM   5656  N  ND2   . ASN A 1  742  ? -17.837 -49.496  56.283  1.00 63.69  ? 742  ASN A ND2   1 
ATOM   5657  N  N     . VAL A 1  743  ? -13.337 -49.435  58.867  1.00 52.26  ? 743  VAL A N     1 
ATOM   5658  C  CA    . VAL A 1  743  ? -12.009 -49.032  59.345  1.00 51.69  ? 743  VAL A CA    1 
ATOM   5659  C  C     . VAL A 1  743  ? -11.445 -50.172  60.195  1.00 54.42  ? 743  VAL A C     1 
ATOM   5660  O  O     . VAL A 1  743  ? -10.297 -50.577  59.985  1.00 53.78  ? 743  VAL A O     1 
ATOM   5661  C  CB    . VAL A 1  743  ? -11.977 -47.651  60.061  1.00 55.86  ? 743  VAL A CB    1 
ATOM   5662  C  CG1   . VAL A 1  743  ? -10.569 -47.313  60.550  1.00 55.08  ? 743  VAL A CG1   1 
ATOM   5663  C  CG2   . VAL A 1  743  ? -12.486 -46.546  59.139  1.00 55.57  ? 743  VAL A CG2   1 
ATOM   5664  N  N     . LYS A 1  744  ? -12.280 -50.732  61.096  1.00 50.53  ? 744  LYS A N     1 
ATOM   5665  C  CA    . LYS A 1  744  ? -11.919 -51.876  61.938  1.00 50.77  ? 744  LYS A CA    1 
ATOM   5666  C  C     . LYS A 1  744  ? -11.551 -53.065  61.036  1.00 54.86  ? 744  LYS A C     1 
ATOM   5667  O  O     . LYS A 1  744  ? -10.548 -53.733  61.283  1.00 53.83  ? 744  LYS A O     1 
ATOM   5668  C  CB    . LYS A 1  744  ? -13.082 -52.253  62.879  1.00 53.96  ? 744  LYS A CB    1 
ATOM   5669  C  CG    . LYS A 1  744  ? -12.633 -52.918  64.171  1.00 62.75  ? 744  LYS A CG    1 
ATOM   5670  C  CD    . LYS A 1  744  ? -13.656 -53.922  64.681  1.00 71.36  ? 744  LYS A CD    1 
ATOM   5671  C  CE    . LYS A 1  744  ? -13.180 -54.668  65.903  1.00 80.16  ? 744  LYS A CE    1 
ATOM   5672  N  NZ    . LYS A 1  744  ? -13.143 -53.802  67.113  1.00 90.43  ? 744  LYS A NZ    1 
ATOM   5673  N  N     . GLN A 1  745  ? -12.335 -53.273  59.954  1.00 52.18  ? 745  GLN A N     1 
ATOM   5674  C  CA    . GLN A 1  745  ? -12.138 -54.336  58.968  1.00 52.14  ? 745  GLN A CA    1 
ATOM   5675  C  C     . GLN A 1  745  ? -10.769 -54.276  58.312  1.00 55.36  ? 745  GLN A C     1 
ATOM   5676  O  O     . GLN A 1  745  ? -10.132 -55.317  58.140  1.00 56.01  ? 745  GLN A O     1 
ATOM   5677  C  CB    . GLN A 1  745  ? -13.246 -54.317  57.906  1.00 53.46  ? 745  GLN A CB    1 
ATOM   5678  C  CG    . GLN A 1  745  ? -14.514 -55.001  58.368  1.00 65.05  ? 745  GLN A CG    1 
ATOM   5679  C  CD    . GLN A 1  745  ? -15.393 -55.394  57.218  1.00 84.98  ? 745  GLN A CD    1 
ATOM   5680  O  OE1   . GLN A 1  745  ? -16.066 -54.562  56.598  1.00 80.28  ? 745  GLN A OE1   1 
ATOM   5681  N  NE2   . GLN A 1  745  ? -15.427 -56.684  56.932  1.00 78.55  ? 745  GLN A NE2   1 
ATOM   5682  N  N     . MET A 1  746  ? -10.309 -53.058  57.977  1.00 49.96  ? 746  MET A N     1 
ATOM   5683  C  CA    . MET A 1  746  ? -9.022  -52.832  57.334  1.00 48.49  ? 746  MET A CA    1 
ATOM   5684  C  C     . MET A 1  746  ? -7.837  -53.109  58.248  1.00 52.84  ? 746  MET A C     1 
ATOM   5685  O  O     . MET A 1  746  ? -6.858  -53.711  57.803  1.00 52.04  ? 746  MET A O     1 
ATOM   5686  C  CB    . MET A 1  746  ? -8.957  -51.432  56.727  1.00 49.60  ? 746  MET A CB    1 
ATOM   5687  C  CG    . MET A 1  746  ? -9.540  -51.372  55.334  1.00 52.45  ? 746  MET A CG    1 
ATOM   5688  S  SD    . MET A 1  746  ? -9.364  -49.744  54.574  1.00 55.16  ? 746  MET A SD    1 
ATOM   5689  C  CE    . MET A 1  746  ? -10.728 -48.944  55.250  1.00 52.28  ? 746  MET A CE    1 
ATOM   5690  N  N     . VAL A 1  747  ? -7.927  -52.686  59.520  1.00 50.71  ? 747  VAL A N     1 
ATOM   5691  C  CA    . VAL A 1  747  ? -6.884  -52.910  60.531  1.00 51.32  ? 747  VAL A CA    1 
ATOM   5692  C  C     . VAL A 1  747  ? -6.755  -54.419  60.791  1.00 58.91  ? 747  VAL A C     1 
ATOM   5693  O  O     . VAL A 1  747  ? -5.640  -54.946  60.813  1.00 58.12  ? 747  VAL A O     1 
ATOM   5694  C  CB    . VAL A 1  747  ? -7.168  -52.124  61.837  1.00 54.74  ? 747  VAL A CB    1 
ATOM   5695  C  CG1   . VAL A 1  747  ? -6.068  -52.344  62.863  1.00 54.57  ? 747  VAL A CG1   1 
ATOM   5696  C  CG2   . VAL A 1  747  ? -7.336  -50.638  61.557  1.00 53.79  ? 747  VAL A CG2   1 
ATOM   5697  N  N     . MET A 1  748  ? -7.915  -55.102  60.944  1.00 58.71  ? 748  MET A N     1 
ATOM   5698  C  CA    . MET A 1  748  ? -8.040  -56.538  61.184  1.00 60.41  ? 748  MET A CA    1 
ATOM   5699  C  C     . MET A 1  748  ? -7.306  -57.330  60.118  1.00 64.20  ? 748  MET A C     1 
ATOM   5700  O  O     . MET A 1  748  ? -6.554  -58.242  60.452  1.00 64.42  ? 748  MET A O     1 
ATOM   5701  C  CB    . MET A 1  748  ? -9.517  -56.952  61.259  1.00 64.22  ? 748  MET A CB    1 
ATOM   5702  C  CG    . MET A 1  748  ? -10.132 -56.737  62.632  1.00 69.54  ? 748  MET A CG    1 
ATOM   5703  S  SD    . MET A 1  748  ? -11.729 -57.578  62.858  1.00 76.26  ? 748  MET A SD    1 
ATOM   5704  C  CE    . MET A 1  748  ? -12.828 -56.491  61.938  1.00 72.40  ? 748  MET A CE    1 
ATOM   5705  N  N     . ALA A 1  749  ? -7.479  -56.946  58.843  1.00 60.58  ? 749  ALA A N     1 
ATOM   5706  C  CA    . ALA A 1  749  ? -6.803  -57.577  57.711  1.00 60.47  ? 749  ALA A CA    1 
ATOM   5707  C  C     . ALA A 1  749  ? -5.303  -57.263  57.742  1.00 64.90  ? 749  ALA A C     1 
ATOM   5708  O  O     . ALA A 1  749  ? -4.481  -58.176  57.637  1.00 65.41  ? 749  ALA A O     1 
ATOM   5709  C  CB    . ALA A 1  749  ? -7.419  -57.104  56.400  1.00 60.55  ? 749  ALA A CB    1 
ATOM   5710  N  N     . GLY A 1  750  ? -4.974  -55.990  57.953  1.00 60.48  ? 750  GLY A N     1 
ATOM   5711  C  CA    . GLY A 1  750  ? -3.605  -55.499  57.963  1.00 59.72  ? 750  GLY A CA    1 
ATOM   5712  C  C     . GLY A 1  750  ? -3.294  -54.779  56.669  1.00 63.62  ? 750  GLY A C     1 
ATOM   5713  O  O     . GLY A 1  750  ? -2.127  -54.543  56.343  1.00 63.08  ? 750  GLY A O     1 
ATOM   5714  N  N     . SER A 1  751  ? -4.353  -54.441  55.914  1.00 60.65  ? 751  SER A N     1 
ATOM   5715  C  CA    . SER A 1  751  ? -4.268  -53.718  54.649  1.00 60.28  ? 751  SER A CA    1 
ATOM   5716  C  C     . SER A 1  751  ? -3.891  -52.262  54.917  1.00 64.79  ? 751  SER A C     1 
ATOM   5717  O  O     . SER A 1  751  ? -2.893  -51.788  54.370  1.00 64.93  ? 751  SER A O     1 
ATOM   5718  C  CB    . SER A 1  751  ? -5.584  -53.820  53.883  1.00 63.92  ? 751  SER A CB    1 
ATOM   5719  O  OG    . SER A 1  751  ? -6.693  -53.468  54.693  1.00 72.08  ? 751  SER A OG    1 
ATOM   5720  N  N     . LYS A 1  752  ? -4.659  -51.576  55.800  1.00 60.83  ? 752  LYS A N     1 
ATOM   5721  C  CA    . LYS A 1  752  ? -4.435  -50.193  56.239  1.00 59.64  ? 752  LYS A CA    1 
ATOM   5722  C  C     . LYS A 1  752  ? -4.986  -49.923  57.636  1.00 64.10  ? 752  LYS A C     1 
ATOM   5723  O  O     . LYS A 1  752  ? -5.915  -50.592  58.096  1.00 63.77  ? 752  LYS A O     1 
ATOM   5724  C  CB    . LYS A 1  752  ? -5.006  -49.163  55.246  1.00 60.81  ? 752  LYS A CB    1 
ATOM   5725  C  CG    . LYS A 1  752  ? -4.024  -48.723  54.181  1.00 68.32  ? 752  LYS A CG    1 
ATOM   5726  C  CD    . LYS A 1  752  ? -2.992  -47.744  54.697  1.00 77.83  ? 752  LYS A CD    1 
ATOM   5727  C  CE    . LYS A 1  752  ? -1.917  -47.486  53.668  1.00 94.26  ? 752  LYS A CE    1 
ATOM   5728  N  NZ    . LYS A 1  752  ? -1.024  -48.665  53.478  1.00 106.98 ? 752  LYS A NZ    1 
ATOM   5729  N  N     . GLY A 1  753  ? -4.408  -48.921  58.284  1.00 61.07  ? 753  GLY A N     1 
ATOM   5730  C  CA    . GLY A 1  753  ? -4.819  -48.484  59.607  1.00 61.18  ? 753  GLY A CA    1 
ATOM   5731  C  C     . GLY A 1  753  ? -4.146  -49.198  60.756  1.00 65.03  ? 753  GLY A C     1 
ATOM   5732  O  O     . GLY A 1  753  ? -3.614  -50.304  60.604  1.00 65.12  ? 753  GLY A O     1 
ATOM   5733  N  N     . SER A 1  754  ? -4.204  -48.543  61.924  1.00 60.79  ? 754  SER A N     1 
ATOM   5734  C  CA    . SER A 1  754  ? -3.661  -48.958  63.212  1.00 60.72  ? 754  SER A CA    1 
ATOM   5735  C  C     . SER A 1  754  ? -4.504  -48.290  64.291  1.00 63.76  ? 754  SER A C     1 
ATOM   5736  O  O     . SER A 1  754  ? -5.219  -47.330  63.990  1.00 62.38  ? 754  SER A O     1 
ATOM   5737  C  CB    . SER A 1  754  ? -2.207  -48.512  63.339  1.00 64.44  ? 754  SER A CB    1 
ATOM   5738  O  OG    . SER A 1  754  ? -2.074  -47.116  63.121  1.00 74.34  ? 754  SER A OG    1 
ATOM   5739  N  N     . PHE A 1  755  ? -4.415  -48.787  65.546  1.00 60.71  ? 755  PHE A N     1 
ATOM   5740  C  CA    . PHE A 1  755  ? -5.165  -48.265  66.694  1.00 60.32  ? 755  PHE A CA    1 
ATOM   5741  C  C     . PHE A 1  755  ? -5.140  -46.759  66.747  1.00 60.94  ? 755  PHE A C     1 
ATOM   5742  O  O     . PHE A 1  755  ? -6.203  -46.141  66.833  1.00 61.02  ? 755  PHE A O     1 
ATOM   5743  C  CB    . PHE A 1  755  ? -4.628  -48.830  68.019  1.00 62.97  ? 755  PHE A CB    1 
ATOM   5744  C  CG    . PHE A 1  755  ? -5.105  -48.091  69.250  1.00 65.06  ? 755  PHE A CG    1 
ATOM   5745  C  CD1   . PHE A 1  755  ? -6.387  -48.289  69.746  1.00 69.37  ? 755  PHE A CD1   1 
ATOM   5746  C  CD2   . PHE A 1  755  ? -4.269  -47.203  69.916  1.00 67.18  ? 755  PHE A CD2   1 
ATOM   5747  C  CE1   . PHE A 1  755  ? -6.825  -47.609  70.882  1.00 70.90  ? 755  PHE A CE1   1 
ATOM   5748  C  CE2   . PHE A 1  755  ? -4.713  -46.515  71.050  1.00 70.65  ? 755  PHE A CE2   1 
ATOM   5749  C  CZ    . PHE A 1  755  ? -5.987  -46.724  71.527  1.00 69.56  ? 755  PHE A CZ    1 
ATOM   5750  N  N     . ILE A 1  756  ? -3.922  -46.177  66.705  1.00 54.30  ? 756  ILE A N     1 
ATOM   5751  C  CA    . ILE A 1  756  ? -3.691  -44.739  66.774  1.00 52.39  ? 756  ILE A CA    1 
ATOM   5752  C  C     . ILE A 1  756  ? -4.573  -43.951  65.816  1.00 53.12  ? 756  ILE A C     1 
ATOM   5753  O  O     . ILE A 1  756  ? -5.078  -42.900  66.201  1.00 52.72  ? 756  ILE A O     1 
ATOM   5754  C  CB    . ILE A 1  756  ? -2.179  -44.383  66.720  1.00 55.28  ? 756  ILE A CB    1 
ATOM   5755  C  CG1   . ILE A 1  756  ? -1.896  -42.980  67.294  1.00 55.91  ? 756  ILE A CG1   1 
ATOM   5756  C  CG2   . ILE A 1  756  ? -1.540  -44.601  65.339  1.00 55.28  ? 756  ILE A CG2   1 
ATOM   5757  C  CD1   . ILE A 1  756  ? -0.708  -42.924  68.319  1.00 64.53  ? 756  ILE A CD1   1 
ATOM   5758  N  N     . ASN A 1  757  ? -4.828  -44.505  64.612  1.00 47.94  ? 757  ASN A N     1 
ATOM   5759  C  CA    . ASN A 1  757  ? -5.670  -43.880  63.593  1.00 47.01  ? 757  ASN A CA    1 
ATOM   5760  C  C     . ASN A 1  757  ? -7.131  -43.799  64.036  1.00 49.85  ? 757  ASN A C     1 
ATOM   5761  O  O     . ASN A 1  757  ? -7.725  -42.720  63.970  1.00 48.94  ? 757  ASN A O     1 
ATOM   5762  C  CB    . ASN A 1  757  ? -5.506  -44.569  62.235  1.00 47.10  ? 757  ASN A CB    1 
ATOM   5763  C  CG    . ASN A 1  757  ? -4.123  -44.412  61.648  1.00 64.43  ? 757  ASN A CG    1 
ATOM   5764  O  OD1   . ASN A 1  757  ? -3.611  -43.298  61.495  1.00 59.70  ? 757  ASN A OD1   1 
ATOM   5765  N  ND2   . ASN A 1  757  ? -3.490  -45.520  61.290  1.00 53.39  ? 757  ASN A ND2   1 
ATOM   5766  N  N     . ILE A 1  758  ? -7.677  -44.919  64.547  1.00 46.17  ? 758  ILE A N     1 
ATOM   5767  C  CA    . ILE A 1  758  ? -9.044  -45.015  65.072  1.00 46.25  ? 758  ILE A CA    1 
ATOM   5768  C  C     . ILE A 1  758  ? -9.224  -43.997  66.206  1.00 49.37  ? 758  ILE A C     1 
ATOM   5769  O  O     . ILE A 1  758  ? -10.139 -43.174  66.142  1.00 48.66  ? 758  ILE A O     1 
ATOM   5770  C  CB    . ILE A 1  758  ? -9.365  -46.478  65.527  1.00 49.92  ? 758  ILE A CB    1 
ATOM   5771  C  CG1   . ILE A 1  758  ? -9.619  -47.407  64.325  1.00 49.63  ? 758  ILE A CG1   1 
ATOM   5772  C  CG2   . ILE A 1  758  ? -10.537 -46.537  66.511  1.00 51.88  ? 758  ILE A CG2   1 
ATOM   5773  C  CD1   . ILE A 1  758  ? -8.508  -48.291  64.021  1.00 50.93  ? 758  ILE A CD1   1 
ATOM   5774  N  N     . ALA A 1  759  ? -8.313  -44.050  67.210  1.00 45.71  ? 759  ALA A N     1 
ATOM   5775  C  CA    . ALA A 1  759  ? -8.242  -43.219  68.415  1.00 45.66  ? 759  ALA A CA    1 
ATOM   5776  C  C     . ALA A 1  759  ? -8.321  -41.710  68.144  1.00 49.83  ? 759  ALA A C     1 
ATOM   5777  O  O     . ALA A 1  759  ? -9.089  -41.006  68.805  1.00 49.68  ? 759  ALA A O     1 
ATOM   5778  C  CB    . ALA A 1  759  ? -6.966  -43.542  69.174  1.00 46.24  ? 759  ALA A CB    1 
ATOM   5779  N  N     . GLN A 1  760  ? -7.534  -41.222  67.168  1.00 46.26  ? 760  GLN A N     1 
ATOM   5780  C  CA    . GLN A 1  760  ? -7.485  -39.808  66.796  1.00 45.66  ? 760  GLN A CA    1 
ATOM   5781  C  C     . GLN A 1  760  ? -8.704  -39.369  65.985  1.00 50.95  ? 760  GLN A C     1 
ATOM   5782  O  O     . GLN A 1  760  ? -9.225  -38.281  66.216  1.00 50.96  ? 760  GLN A O     1 
ATOM   5783  C  CB    . GLN A 1  760  ? -6.181  -39.483  66.061  1.00 45.68  ? 760  GLN A CB    1 
ATOM   5784  C  CG    . GLN A 1  760  ? -4.970  -39.510  66.975  1.00 47.73  ? 760  GLN A CG    1 
ATOM   5785  C  CD    . GLN A 1  760  ? -3.712  -39.173  66.233  1.00 66.77  ? 760  GLN A CD    1 
ATOM   5786  O  OE1   . GLN A 1  760  ? -3.319  -39.854  65.278  1.00 59.20  ? 760  GLN A OE1   1 
ATOM   5787  N  NE2   . GLN A 1  760  ? -3.039  -38.122  66.674  1.00 64.98  ? 760  GLN A NE2   1 
ATOM   5788  N  N     . MET A 1  761  ? -9.160  -40.209  65.050  1.00 48.35  ? 761  MET A N     1 
ATOM   5789  C  CA    . MET A 1  761  ? -10.316 -39.908  64.210  1.00 48.92  ? 761  MET A CA    1 
ATOM   5790  C  C     . MET A 1  761  ? -11.652 -39.957  64.961  1.00 54.10  ? 761  MET A C     1 
ATOM   5791  O  O     . MET A 1  761  ? -12.556 -39.183  64.630  1.00 53.34  ? 761  MET A O     1 
ATOM   5792  C  CB    . MET A 1  761  ? -10.382 -40.874  63.026  1.00 51.15  ? 761  MET A CB    1 
ATOM   5793  C  CG    . MET A 1  761  ? -9.370  -40.603  61.960  1.00 54.17  ? 761  MET A CG    1 
ATOM   5794  S  SD    . MET A 1  761  ? -9.802  -41.500  60.451  1.00 58.74  ? 761  MET A SD    1 
ATOM   5795  C  CE    . MET A 1  761  ? -9.114  -43.146  60.827  1.00 55.44  ? 761  MET A CE    1 
ATOM   5796  N  N     . SER A 1  762  ? -11.789 -40.893  65.932  1.00 51.80  ? 762  SER A N     1 
ATOM   5797  C  CA    . SER A 1  762  ? -13.037 -41.118  66.674  1.00 52.79  ? 762  SER A CA    1 
ATOM   5798  C  C     . SER A 1  762  ? -13.093 -40.546  68.085  1.00 57.14  ? 762  SER A C     1 
ATOM   5799  O  O     . SER A 1  762  ? -14.088 -39.907  68.432  1.00 57.83  ? 762  SER A O     1 
ATOM   5800  C  CB    . SER A 1  762  ? -13.380 -42.603  66.722  1.00 56.82  ? 762  SER A CB    1 
ATOM   5801  O  OG    . SER A 1  762  ? -13.244 -43.225  65.456  1.00 67.69  ? 762  SER A OG    1 
ATOM   5802  N  N     . ALA A 1  763  ? -12.061 -40.798  68.904  1.00 52.60  ? 763  ALA A N     1 
ATOM   5803  C  CA    . ALA A 1  763  ? -12.074 -40.404  70.306  1.00 52.64  ? 763  ALA A CA    1 
ATOM   5804  C  C     . ALA A 1  763  ? -11.428 -39.065  70.664  1.00 56.65  ? 763  ALA A C     1 
ATOM   5805  O  O     . ALA A 1  763  ? -12.137 -38.128  71.045  1.00 57.15  ? 763  ALA A O     1 
ATOM   5806  C  CB    . ALA A 1  763  ? -11.521 -41.531  71.169  1.00 53.48  ? 763  ALA A CB    1 
ATOM   5807  N  N     . CYS A 1  764  ? -10.092 -38.978  70.568  1.00 52.21  ? 764  CYS A N     1 
ATOM   5808  C  CA    . CYS A 1  764  ? -9.316  -37.804  70.966  1.00 51.23  ? 764  CYS A CA    1 
ATOM   5809  C  C     . CYS A 1  764  ? -7.984  -37.789  70.216  1.00 51.93  ? 764  CYS A C     1 
ATOM   5810  O  O     . CYS A 1  764  ? -7.296  -38.811  70.187  1.00 51.39  ? 764  CYS A O     1 
ATOM   5811  C  CB    . CYS A 1  764  ? -9.122  -37.826  72.487  1.00 52.35  ? 764  CYS A CB    1 
ATOM   5812  S  SG    . CYS A 1  764  ? -7.669  -36.932  73.093  1.00 55.87  ? 764  CYS A SG    1 
ATOM   5813  N  N     . VAL A 1  765  ? -7.633  -36.646  69.590  1.00 46.75  ? 765  VAL A N     1 
ATOM   5814  C  CA    . VAL A 1  765  ? -6.363  -36.492  68.856  1.00 45.40  ? 765  VAL A CA    1 
ATOM   5815  C  C     . VAL A 1  765  ? -5.183  -36.659  69.843  1.00 50.74  ? 765  VAL A C     1 
ATOM   5816  O  O     . VAL A 1  765  ? -4.342  -37.543  69.643  1.00 50.38  ? 765  VAL A O     1 
ATOM   5817  C  CB    . VAL A 1  765  ? -6.297  -35.188  68.004  1.00 47.50  ? 765  VAL A CB    1 
ATOM   5818  C  CG1   . VAL A 1  765  ? -4.872  -34.869  67.548  1.00 46.02  ? 765  VAL A CG1   1 
ATOM   5819  C  CG2   . VAL A 1  765  ? -7.240  -35.273  66.809  1.00 47.05  ? 765  VAL A CG2   1 
ATOM   5820  N  N     . GLY A 1  766  ? -5.184  -35.855  70.913  1.00 47.60  ? 766  GLY A N     1 
ATOM   5821  C  CA    . GLY A 1  766  ? -4.181  -35.919  71.972  1.00 47.27  ? 766  GLY A CA    1 
ATOM   5822  C  C     . GLY A 1  766  ? -3.173  -34.793  72.033  1.00 49.39  ? 766  GLY A C     1 
ATOM   5823  O  O     . GLY A 1  766  ? -3.291  -33.792  71.319  1.00 48.36  ? 766  GLY A O     1 
ATOM   5824  N  N     . GLN A 1  767  ? -2.165  -34.974  72.902  1.00 45.63  ? 767  GLN A N     1 
ATOM   5825  C  CA    . GLN A 1  767  ? -1.078  -34.025  73.142  1.00 45.47  ? 767  GLN A CA    1 
ATOM   5826  C  C     . GLN A 1  767  ? -0.148  -33.837  71.917  1.00 49.45  ? 767  GLN A C     1 
ATOM   5827  O  O     . GLN A 1  767  ? 0.191   -34.802  71.217  1.00 48.16  ? 767  GLN A O     1 
ATOM   5828  C  CB    . GLN A 1  767  ? -0.293  -34.409  74.426  1.00 46.78  ? 767  GLN A CB    1 
ATOM   5829  C  CG    . GLN A 1  767  ? 0.811   -33.438  74.873  1.00 45.85  ? 767  GLN A CG    1 
ATOM   5830  C  CD    . GLN A 1  767  ? 0.309   -32.057  75.213  1.00 63.59  ? 767  GLN A CD    1 
ATOM   5831  O  OE1   . GLN A 1  767  ? -0.405  -31.835  76.194  1.00 60.42  ? 767  GLN A OE1   1 
ATOM   5832  N  NE2   . GLN A 1  767  ? 0.694   -31.088  74.415  1.00 58.20  ? 767  GLN A NE2   1 
ATOM   5833  N  N     . GLN A 1  768  ? 0.232   -32.565  71.672  1.00 46.07  ? 768  GLN A N     1 
ATOM   5834  C  CA    . GLN A 1  768  ? 1.130   -32.125  70.611  1.00 45.02  ? 768  GLN A CA    1 
ATOM   5835  C  C     . GLN A 1  768  ? 2.468   -31.759  71.191  1.00 48.49  ? 768  GLN A C     1 
ATOM   5836  O  O     . GLN A 1  768  ? 2.531   -31.116  72.238  1.00 48.58  ? 768  GLN A O     1 
ATOM   5837  C  CB    . GLN A 1  768  ? 0.540   -30.924  69.867  1.00 46.23  ? 768  GLN A CB    1 
ATOM   5838  C  CG    . GLN A 1  768  ? 0.109   -31.259  68.446  1.00 59.05  ? 768  GLN A CG    1 
ATOM   5839  C  CD    . GLN A 1  768  ? -1.007  -32.268  68.386  1.00 69.06  ? 768  GLN A CD    1 
ATOM   5840  O  OE1   . GLN A 1  768  ? -1.973  -32.222  69.160  1.00 62.54  ? 768  GLN A OE1   1 
ATOM   5841  N  NE2   . GLN A 1  768  ? -0.862  -33.233  67.496  1.00 57.24  ? 768  GLN A NE2   1 
ATOM   5842  N  N     . SER A 1  769  ? 3.542   -32.158  70.513  1.00 45.18  ? 769  SER A N     1 
ATOM   5843  C  CA    . SER A 1  769  ? 4.891   -31.878  70.982  1.00 45.86  ? 769  SER A CA    1 
ATOM   5844  C  C     . SER A 1  769  ? 5.820   -31.334  69.915  1.00 48.74  ? 769  SER A C     1 
ATOM   5845  O  O     . SER A 1  769  ? 5.736   -31.714  68.742  1.00 48.50  ? 769  SER A O     1 
ATOM   5846  C  CB    . SER A 1  769  ? 5.501   -33.110  71.644  1.00 51.84  ? 769  SER A CB    1 
ATOM   5847  O  OG    . SER A 1  769  ? 5.586   -34.213  70.755  1.00 64.06  ? 769  SER A OG    1 
ATOM   5848  N  N     . VAL A 1  770  ? 6.696   -30.423  70.341  1.00 44.54  ? 770  VAL A N     1 
ATOM   5849  C  CA    . VAL A 1  770  ? 7.735   -29.786  69.537  1.00 44.23  ? 770  VAL A CA    1 
ATOM   5850  C  C     . VAL A 1  770  ? 8.995   -29.856  70.398  1.00 50.05  ? 770  VAL A C     1 
ATOM   5851  O  O     . VAL A 1  770  ? 8.945   -29.509  71.586  1.00 51.01  ? 770  VAL A O     1 
ATOM   5852  C  CB    . VAL A 1  770  ? 7.371   -28.336  69.130  1.00 47.67  ? 770  VAL A CB    1 
ATOM   5853  C  CG1   . VAL A 1  770  ? 8.551   -27.632  68.461  1.00 47.67  ? 770  VAL A CG1   1 
ATOM   5854  C  CG2   . VAL A 1  770  ? 6.142   -28.305  68.227  1.00 46.91  ? 770  VAL A CG2   1 
ATOM   5855  N  N     . GLU A 1  771  ? 10.110  -30.336  69.810  1.00 46.55  ? 771  GLU A N     1 
ATOM   5856  C  CA    . GLU A 1  771  ? 11.406  -30.549  70.471  1.00 47.15  ? 771  GLU A CA    1 
ATOM   5857  C  C     . GLU A 1  771  ? 11.304  -31.592  71.609  1.00 50.54  ? 771  GLU A C     1 
ATOM   5858  O  O     . GLU A 1  771  ? 12.104  -31.575  72.555  1.00 50.19  ? 771  GLU A O     1 
ATOM   5859  C  CB    . GLU A 1  771  ? 12.058  -29.226  70.940  1.00 49.36  ? 771  GLU A CB    1 
ATOM   5860  C  CG    . GLU A 1  771  ? 13.280  -28.819  70.137  1.00 62.06  ? 771  GLU A CG    1 
ATOM   5861  C  CD    . GLU A 1  771  ? 12.990  -27.913  68.958  1.00 91.31  ? 771  GLU A CD    1 
ATOM   5862  O  OE1   . GLU A 1  771  ? 12.358  -28.381  67.981  1.00 87.55  ? 771  GLU A OE1   1 
ATOM   5863  O  OE2   . GLU A 1  771  ? 13.408  -26.733  69.005  1.00 90.71  ? 771  GLU A OE2   1 
ATOM   5864  N  N     . GLY A 1  772  ? 10.321  -32.486  71.497  1.00 46.53  ? 772  GLY A N     1 
ATOM   5865  C  CA    . GLY A 1  772  ? 10.108  -33.545  72.474  1.00 46.93  ? 772  GLY A CA    1 
ATOM   5866  C  C     . GLY A 1  772  ? 9.158   -33.204  73.604  1.00 51.22  ? 772  GLY A C     1 
ATOM   5867  O  O     . GLY A 1  772  ? 8.492   -34.096  74.145  1.00 51.59  ? 772  GLY A O     1 
ATOM   5868  N  N     . LYS A 1  773  ? 9.099   -31.923  73.982  1.00 46.92  ? 773  LYS A N     1 
ATOM   5869  C  CA    . LYS A 1  773  ? 8.215   -31.462  75.045  1.00 46.78  ? 773  LYS A CA    1 
ATOM   5870  C  C     . LYS A 1  773  ? 6.943   -30.823  74.490  1.00 50.34  ? 773  LYS A C     1 
ATOM   5871  O  O     . LYS A 1  773  ? 6.882   -30.531  73.295  1.00 48.96  ? 773  LYS A O     1 
ATOM   5872  C  CB    . LYS A 1  773  ? 8.948   -30.555  76.057  1.00 50.02  ? 773  LYS A CB    1 
ATOM   5873  C  CG    . LYS A 1  773  ? 10.065  -29.682  75.487  1.00 65.66  ? 773  LYS A CG    1 
ATOM   5874  C  CD    . LYS A 1  773  ? 11.354  -29.813  76.307  1.00 76.64  ? 773  LYS A CD    1 
ATOM   5875  C  CE    . LYS A 1  773  ? 12.468  -28.908  75.831  1.00 90.45  ? 773  LYS A CE    1 
ATOM   5876  N  NZ    . LYS A 1  773  ? 13.009  -29.315  74.503  1.00 100.70 ? 773  LYS A NZ    1 
ATOM   5877  N  N     . ARG A 1  774  ? 5.914   -30.645  75.353  1.00 47.74  ? 774  ARG A N     1 
ATOM   5878  C  CA    . ARG A 1  774  ? 4.628   -30.028  74.987  1.00 47.17  ? 774  ARG A CA    1 
ATOM   5879  C  C     . ARG A 1  774  ? 4.752   -28.517  74.683  1.00 51.29  ? 774  ARG A C     1 
ATOM   5880  O  O     . ARG A 1  774  ? 5.710   -27.881  75.137  1.00 51.57  ? 774  ARG A O     1 
ATOM   5881  C  CB    . ARG A 1  774  ? 3.510   -30.363  76.003  1.00 45.99  ? 774  ARG A CB    1 
ATOM   5882  C  CG    . ARG A 1  774  ? 3.788   -30.008  77.456  1.00 49.14  ? 774  ARG A CG    1 
ATOM   5883  C  CD    . ARG A 1  774  ? 2.957   -30.865  78.397  1.00 50.21  ? 774  ARG A CD    1 
ATOM   5884  N  NE    . ARG A 1  774  ? 1.610   -30.340  78.622  1.00 54.53  ? 774  ARG A NE    1 
ATOM   5885  C  CZ    . ARG A 1  774  ? 1.233   -29.666  79.707  1.00 66.20  ? 774  ARG A CZ    1 
ATOM   5886  N  NH1   . ARG A 1  774  ? 2.100   -29.422  80.685  1.00 41.67  ? 774  ARG A NH1   1 
ATOM   5887  N  NH2   . ARG A 1  774  ? -0.012  -29.231  79.824  1.00 58.52  ? 774  ARG A NH2   1 
ATOM   5888  N  N     . ILE A 1  775  ? 3.805   -27.966  73.886  1.00 47.21  ? 775  ILE A N     1 
ATOM   5889  C  CA    . ILE A 1  775  ? 3.794   -26.571  73.418  1.00 47.47  ? 775  ILE A CA    1 
ATOM   5890  C  C     . ILE A 1  775  ? 4.342   -25.530  74.402  1.00 53.91  ? 775  ILE A C     1 
ATOM   5891  O  O     . ILE A 1  775  ? 3.762   -25.302  75.468  1.00 53.87  ? 775  ILE A O     1 
ATOM   5892  C  CB    . ILE A 1  775  ? 2.491   -26.145  72.682  1.00 49.99  ? 775  ILE A CB    1 
ATOM   5893  C  CG1   . ILE A 1  775  ? 2.058   -27.181  71.603  1.00 49.51  ? 775  ILE A CG1   1 
ATOM   5894  C  CG2   . ILE A 1  775  ? 2.587   -24.712  72.106  1.00 50.53  ? 775  ILE A CG2   1 
ATOM   5895  C  CD1   . ILE A 1  775  ? 2.995   -27.402  70.383  1.00 55.91  ? 775  ILE A CD1   1 
ATOM   5896  N  N     . ALA A 1  776  ? 5.493   -24.928  74.022  1.00 51.44  ? 776  ALA A N     1 
ATOM   5897  C  CA    . ALA A 1  776  ? 6.257   -23.934  74.785  1.00 51.81  ? 776  ALA A CA    1 
ATOM   5898  C  C     . ALA A 1  776  ? 5.707   -22.514  74.699  1.00 53.45  ? 776  ALA A C     1 
ATOM   5899  O  O     . ALA A 1  776  ? 5.007   -22.183  73.742  1.00 52.43  ? 776  ALA A O     1 
ATOM   5900  C  CB    . ALA A 1  776  ? 7.715   -23.951  74.340  1.00 52.94  ? 776  ALA A CB    1 
ATOM   5901  N  N     . PHE A 1  777  ? 6.068   -21.672  75.694  1.00 49.21  ? 777  PHE A N     1 
ATOM   5902  C  CA    . PHE A 1  777  ? 5.670   -20.269  75.804  1.00 48.69  ? 777  PHE A CA    1 
ATOM   5903  C  C     . PHE A 1  777  ? 6.448   -19.374  74.818  1.00 52.19  ? 777  PHE A C     1 
ATOM   5904  O  O     . PHE A 1  777  ? 7.452   -18.756  75.191  1.00 51.97  ? 777  PHE A O     1 
ATOM   5905  C  CB    . PHE A 1  777  ? 5.838   -19.765  77.258  1.00 50.90  ? 777  PHE A CB    1 
ATOM   5906  C  CG    . PHE A 1  777  ? 4.978   -20.379  78.345  1.00 52.06  ? 777  PHE A CG    1 
ATOM   5907  C  CD1   . PHE A 1  777  ? 5.403   -20.388  79.665  1.00 55.33  ? 777  PHE A CD1   1 
ATOM   5908  C  CD2   . PHE A 1  777  ? 3.721   -20.893  78.058  1.00 53.89  ? 777  PHE A CD2   1 
ATOM   5909  C  CE1   . PHE A 1  777  ? 4.591   -20.910  80.677  1.00 56.25  ? 777  PHE A CE1   1 
ATOM   5910  C  CE2   . PHE A 1  777  ? 2.915   -21.425  79.071  1.00 56.56  ? 777  PHE A CE2   1 
ATOM   5911  C  CZ    . PHE A 1  777  ? 3.357   -21.431  80.372  1.00 54.79  ? 777  PHE A CZ    1 
ATOM   5912  N  N     . GLY A 1  778  ? 5.966   -19.319  73.573  1.00 48.74  ? 778  GLY A N     1 
ATOM   5913  C  CA    . GLY A 1  778  ? 6.541   -18.506  72.502  1.00 49.11  ? 778  GLY A CA    1 
ATOM   5914  C  C     . GLY A 1  778  ? 6.431   -17.030  72.805  1.00 54.74  ? 778  GLY A C     1 
ATOM   5915  O  O     . GLY A 1  778  ? 7.357   -16.257  72.525  1.00 56.12  ? 778  GLY A O     1 
ATOM   5916  N  N     . PHE A 1  779  ? 5.293   -16.645  73.414  1.00 50.04  ? 779  PHE A N     1 
ATOM   5917  C  CA    . PHE A 1  779  ? 5.046   -15.298  73.910  1.00 50.05  ? 779  PHE A CA    1 
ATOM   5918  C  C     . PHE A 1  779  ? 5.585   -15.280  75.346  1.00 54.17  ? 779  PHE A C     1 
ATOM   5919  O  O     . PHE A 1  779  ? 5.960   -16.336  75.873  1.00 53.81  ? 779  PHE A O     1 
ATOM   5920  C  CB    . PHE A 1  779  ? 3.543   -14.977  73.885  1.00 51.56  ? 779  PHE A CB    1 
ATOM   5921  C  CG    . PHE A 1  779  ? 2.954   -14.822  72.504  1.00 52.25  ? 779  PHE A CG    1 
ATOM   5922  C  CD1   . PHE A 1  779  ? 2.355   -15.900  71.862  1.00 53.97  ? 779  PHE A CD1   1 
ATOM   5923  C  CD2   . PHE A 1  779  ? 2.984   -13.595  71.852  1.00 54.49  ? 779  PHE A CD2   1 
ATOM   5924  C  CE1   . PHE A 1  779  ? 1.814   -15.759  70.582  1.00 54.20  ? 779  PHE A CE1   1 
ATOM   5925  C  CE2   . PHE A 1  779  ? 2.439   -13.454  70.577  1.00 57.00  ? 779  PHE A CE2   1 
ATOM   5926  C  CZ    . PHE A 1  779  ? 1.858   -14.538  69.950  1.00 54.00  ? 779  PHE A CZ    1 
ATOM   5927  N  N     . VAL A 1  780  ? 5.639   -14.106  75.982  1.00 50.89  ? 780  VAL A N     1 
ATOM   5928  C  CA    . VAL A 1  780  ? 6.154   -14.041  77.344  1.00 50.79  ? 780  VAL A CA    1 
ATOM   5929  C  C     . VAL A 1  780  ? 5.197   -14.739  78.308  1.00 54.89  ? 780  VAL A C     1 
ATOM   5930  O  O     . VAL A 1  780  ? 4.073   -14.276  78.511  1.00 55.28  ? 780  VAL A O     1 
ATOM   5931  C  CB    . VAL A 1  780  ? 6.573   -12.622  77.784  1.00 55.28  ? 780  VAL A CB    1 
ATOM   5932  C  CG1   . VAL A 1  780  ? 7.169   -12.643  79.186  1.00 55.78  ? 780  VAL A CG1   1 
ATOM   5933  C  CG2   . VAL A 1  780  ? 7.569   -12.024  76.797  1.00 55.25  ? 780  VAL A CG2   1 
ATOM   5934  N  N     . ASP A 1  781  ? 5.635   -15.904  78.829  1.00 50.60  ? 781  ASP A N     1 
ATOM   5935  C  CA    . ASP A 1  781  ? 4.912   -16.754  79.781  1.00 50.46  ? 781  ASP A CA    1 
ATOM   5936  C  C     . ASP A 1  781  ? 3.539   -17.257  79.322  1.00 52.32  ? 781  ASP A C     1 
ATOM   5937  O  O     . ASP A 1  781  ? 2.719   -17.663  80.152  1.00 52.65  ? 781  ASP A O     1 
ATOM   5938  C  CB    . ASP A 1  781  ? 4.886   -16.155  81.202  1.00 54.30  ? 781  ASP A CB    1 
ATOM   5939  C  CG    . ASP A 1  781  ? 6.242   -15.727  81.760  1.00 74.17  ? 781  ASP A CG    1 
ATOM   5940  O  OD1   . ASP A 1  781  ? 7.279   -16.288  81.314  1.00 75.10  ? 781  ASP A OD1   1 
ATOM   5941  O  OD2   . ASP A 1  781  ? 6.267   -14.834  82.653  1.00 83.77  ? 781  ASP A OD2   1 
ATOM   5942  N  N     . ARG A 1  782  ? 3.311   -17.274  77.997  1.00 46.54  ? 782  ARG A N     1 
ATOM   5943  C  CA    . ARG A 1  782  ? 2.096   -17.805  77.372  1.00 45.24  ? 782  ARG A CA    1 
ATOM   5944  C  C     . ARG A 1  782  ? 2.340   -18.367  75.971  1.00 47.84  ? 782  ARG A C     1 
ATOM   5945  O  O     . ARG A 1  782  ? 3.248   -17.911  75.279  1.00 47.13  ? 782  ARG A O     1 
ATOM   5946  C  CB    . ARG A 1  782  ? 0.891   -16.850  77.444  1.00 44.73  ? 782  ARG A CB    1 
ATOM   5947  C  CG    . ARG A 1  782  ? 1.180   -15.422  77.072  1.00 49.89  ? 782  ARG A CG    1 
ATOM   5948  C  CD    . ARG A 1  782  ? -0.009  -14.544  77.355  1.00 55.48  ? 782  ARG A CD    1 
ATOM   5949  N  NE    . ARG A 1  782  ? 0.138   -13.264  76.668  1.00 64.32  ? 782  ARG A NE    1 
ATOM   5950  C  CZ    . ARG A 1  782  ? -0.871  -12.477  76.311  1.00 79.37  ? 782  ARG A CZ    1 
ATOM   5951  N  NH1   . ARG A 1  782  ? -2.124  -12.818  76.594  1.00 62.55  ? 782  ARG A NH1   1 
ATOM   5952  N  NH2   . ARG A 1  782  ? -0.636  -11.341  75.670  1.00 70.69  ? 782  ARG A NH2   1 
ATOM   5953  N  N     . THR A 1  783  ? 1.560   -19.392  75.578  1.00 44.08  ? 783  THR A N     1 
ATOM   5954  C  CA    . THR A 1  783  ? 1.663   -20.051  74.262  1.00 43.21  ? 783  THR A CA    1 
ATOM   5955  C  C     . THR A 1  783  ? 0.956   -19.239  73.160  1.00 46.26  ? 783  THR A C     1 
ATOM   5956  O  O     . THR A 1  783  ? 1.453   -19.127  72.036  1.00 43.60  ? 783  THR A O     1 
ATOM   5957  C  CB    . THR A 1  783  ? 1.113   -21.472  74.344  1.00 51.49  ? 783  THR A CB    1 
ATOM   5958  O  OG1   . THR A 1  783  ? -0.212  -21.410  74.873  1.00 50.13  ? 783  THR A OG1   1 
ATOM   5959  C  CG2   . THR A 1  783  ? 1.983   -22.383  75.204  1.00 51.61  ? 783  THR A CG2   1 
ATOM   5960  N  N     . LEU A 1  784  ? -0.220  -18.690  73.504  1.00 44.35  ? 784  LEU A N     1 
ATOM   5961  C  CA    . LEU A 1  784  ? -1.045  -17.850  72.646  1.00 44.28  ? 784  LEU A CA    1 
ATOM   5962  C  C     . LEU A 1  784  ? -1.547  -16.608  73.413  1.00 49.53  ? 784  LEU A C     1 
ATOM   5963  O  O     . LEU A 1  784  ? -1.604  -16.643  74.649  1.00 49.40  ? 784  LEU A O     1 
ATOM   5964  C  CB    . LEU A 1  784  ? -2.199  -18.660  72.037  1.00 43.57  ? 784  LEU A CB    1 
ATOM   5965  C  CG    . LEU A 1  784  ? -1.816  -19.533  70.845  1.00 47.26  ? 784  LEU A CG    1 
ATOM   5966  C  CD1   . LEU A 1  784  ? -2.980  -20.388  70.407  1.00 47.31  ? 784  LEU A CD1   1 
ATOM   5967  C  CD2   . LEU A 1  784  ? -1.302  -18.702  69.680  1.00 49.22  ? 784  LEU A CD2   1 
ATOM   5968  N  N     . PRO A 1  785  ? -1.870  -15.489  72.723  1.00 46.77  ? 785  PRO A N     1 
ATOM   5969  C  CA    . PRO A 1  785  ? -2.315  -14.288  73.451  1.00 47.72  ? 785  PRO A CA    1 
ATOM   5970  C  C     . PRO A 1  785  ? -3.770  -14.341  73.936  1.00 51.13  ? 785  PRO A C     1 
ATOM   5971  O  O     . PRO A 1  785  ? -4.280  -13.362  74.488  1.00 51.38  ? 785  PRO A O     1 
ATOM   5972  C  CB    . PRO A 1  785  ? -2.066  -13.162  72.448  1.00 50.05  ? 785  PRO A CB    1 
ATOM   5973  C  CG    . PRO A 1  785  ? -2.228  -13.815  71.119  1.00 53.82  ? 785  PRO A CG    1 
ATOM   5974  C  CD    . PRO A 1  785  ? -1.844  -15.256  71.261  1.00 48.26  ? 785  PRO A CD    1 
ATOM   5975  N  N     . HIS A 1  786  ? -4.420  -15.491  73.745  1.00 46.74  ? 786  HIS A N     1 
ATOM   5976  C  CA    . HIS A 1  786  ? -5.800  -15.743  74.138  1.00 47.78  ? 786  HIS A CA    1 
ATOM   5977  C  C     . HIS A 1  786  ? -5.837  -16.322  75.534  1.00 51.54  ? 786  HIS A C     1 
ATOM   5978  O  O     . HIS A 1  786  ? -6.880  -16.323  76.193  1.00 51.64  ? 786  HIS A O     1 
ATOM   5979  C  CB    . HIS A 1  786  ? -6.457  -16.672  73.120  1.00 48.60  ? 786  HIS A CB    1 
ATOM   5980  C  CG    . HIS A 1  786  ? -6.035  -16.330  71.735  1.00 52.52  ? 786  HIS A CG    1 
ATOM   5981  N  ND1   . HIS A 1  786  ? -6.520  -15.207  71.096  1.00 55.62  ? 786  HIS A ND1   1 
ATOM   5982  C  CD2   . HIS A 1  786  ? -5.080  -16.894  70.963  1.00 54.28  ? 786  HIS A CD2   1 
ATOM   5983  C  CE1   . HIS A 1  786  ? -5.867  -15.138  69.948  1.00 54.92  ? 786  HIS A CE1   1 
ATOM   5984  N  NE2   . HIS A 1  786  ? -5.003  -16.141  69.817  1.00 54.36  ? 786  HIS A NE2   1 
ATOM   5985  N  N     . PHE A 1  787  ? -4.672  -16.791  75.982  1.00 47.47  ? 787  PHE A N     1 
ATOM   5986  C  CA    . PHE A 1  787  ? -4.448  -17.348  77.299  1.00 47.68  ? 787  PHE A CA    1 
ATOM   5987  C  C     . PHE A 1  787  ? -3.811  -16.293  78.201  1.00 53.42  ? 787  PHE A C     1 
ATOM   5988  O  O     . PHE A 1  787  ? -3.342  -15.251  77.728  1.00 53.61  ? 787  PHE A O     1 
ATOM   5989  C  CB    . PHE A 1  787  ? -3.509  -18.561  77.202  1.00 48.54  ? 787  PHE A CB    1 
ATOM   5990  C  CG    . PHE A 1  787  ? -4.008  -19.725  76.386  1.00 49.50  ? 787  PHE A CG    1 
ATOM   5991  C  CD1   . PHE A 1  787  ? -3.265  -20.214  75.322  1.00 52.56  ? 787  PHE A CD1   1 
ATOM   5992  C  CD2   . PHE A 1  787  ? -5.204  -20.357  76.704  1.00 51.81  ? 787  PHE A CD2   1 
ATOM   5993  C  CE1   . PHE A 1  787  ? -3.714  -21.308  74.583  1.00 52.92  ? 787  PHE A CE1   1 
ATOM   5994  C  CE2   . PHE A 1  787  ? -5.652  -21.448  75.966  1.00 54.22  ? 787  PHE A CE2   1 
ATOM   5995  C  CZ    . PHE A 1  787  ? -4.903  -21.919  74.913  1.00 51.93  ? 787  PHE A CZ    1 
ATOM   5996  N  N     . SER A 1  788  ? -3.769  -16.583  79.500  1.00 50.30  ? 788  SER A N     1 
ATOM   5997  C  CA    . SER A 1  788  ? -3.141  -15.707  80.465  1.00 50.99  ? 788  SER A CA    1 
ATOM   5998  C  C     . SER A 1  788  ? -1.693  -16.182  80.722  1.00 54.69  ? 788  SER A C     1 
ATOM   5999  O  O     . SER A 1  788  ? -1.315  -17.299  80.326  1.00 52.74  ? 788  SER A O     1 
ATOM   6000  C  CB    . SER A 1  788  ? -3.953  -15.690  81.755  1.00 55.77  ? 788  SER A CB    1 
ATOM   6001  O  OG    . SER A 1  788  ? -3.873  -14.426  82.390  1.00 66.84  ? 788  SER A OG    1 
ATOM   6002  N  N     . LYS A 1  789  ? -0.884  -15.323  81.379  1.00 52.47  ? 789  LYS A N     1 
ATOM   6003  C  CA    . LYS A 1  789  ? 0.498   -15.624  81.737  1.00 52.09  ? 789  LYS A CA    1 
ATOM   6004  C  C     . LYS A 1  789  ? 0.548   -16.737  82.770  1.00 58.43  ? 789  LYS A C     1 
ATOM   6005  O  O     . LYS A 1  789  ? -0.384  -16.884  83.575  1.00 58.19  ? 789  LYS A O     1 
ATOM   6006  C  CB    . LYS A 1  789  ? 1.241   -14.377  82.216  1.00 54.24  ? 789  LYS A CB    1 
ATOM   6007  C  CG    . LYS A 1  789  ? 1.978   -13.691  81.087  1.00 59.80  ? 789  LYS A CG    1 
ATOM   6008  C  CD    . LYS A 1  789  ? 2.532   -12.357  81.508  1.00 68.82  ? 789  LYS A CD    1 
ATOM   6009  C  CE    . LYS A 1  789  ? 3.103   -11.609  80.335  1.00 78.24  ? 789  LYS A CE    1 
ATOM   6010  N  NZ    . LYS A 1  789  ? 3.196   -10.154  80.620  1.00 91.41  ? 789  LYS A NZ    1 
ATOM   6011  N  N     . ASP A 1  790  ? 1.617   -17.557  82.696  1.00 56.47  ? 790  ASP A N     1 
ATOM   6012  C  CA    . ASP A 1  790  ? 1.860   -18.724  83.543  1.00 56.75  ? 790  ASP A CA    1 
ATOM   6013  C  C     . ASP A 1  790  ? 0.643   -19.682  83.589  1.00 61.59  ? 790  ASP A C     1 
ATOM   6014  O  O     . ASP A 1  790  ? -0.037  -19.788  84.616  1.00 61.73  ? 790  ASP A O     1 
ATOM   6015  C  CB    . ASP A 1  790  ? 2.383   -18.327  84.945  1.00 59.46  ? 790  ASP A CB    1 
ATOM   6016  C  CG    . ASP A 1  790  ? 3.761   -17.680  84.972  1.00 70.03  ? 790  ASP A CG    1 
ATOM   6017  O  OD1   . ASP A 1  790  ? 3.901   -16.608  85.602  1.00 71.45  ? 790  ASP A OD1   1 
ATOM   6018  O  OD2   . ASP A 1  790  ? 4.711   -18.274  84.410  1.00 76.03  ? 790  ASP A OD2   1 
ATOM   6019  N  N     . ASP A 1  791  ? 0.339   -20.323  82.440  1.00 57.98  ? 791  ASP A N     1 
ATOM   6020  C  CA    . ASP A 1  791  ? -0.742  -21.310  82.338  1.00 57.78  ? 791  ASP A CA    1 
ATOM   6021  C  C     . ASP A 1  791  ? -0.175  -22.646  81.848  1.00 61.14  ? 791  ASP A C     1 
ATOM   6022  O  O     . ASP A 1  791  ? 0.253   -22.762  80.700  1.00 60.83  ? 791  ASP A O     1 
ATOM   6023  C  CB    . ASP A 1  791  ? -1.916  -20.816  81.466  1.00 59.59  ? 791  ASP A CB    1 
ATOM   6024  C  CG    . ASP A 1  791  ? -3.137  -21.733  81.440  1.00 65.81  ? 791  ASP A CG    1 
ATOM   6025  O  OD1   . ASP A 1  791  ? -3.174  -22.703  82.228  1.00 65.00  ? 791  ASP A OD1   1 
ATOM   6026  O  OD2   . ASP A 1  791  ? -4.073  -21.455  80.655  1.00 71.78  ? 791  ASP A OD2   1 
ATOM   6027  N  N     . TYR A 1  792  ? -0.157  -23.642  82.734  1.00 57.29  ? 792  TYR A N     1 
ATOM   6028  C  CA    . TYR A 1  792  ? 0.406   -24.959  82.455  1.00 56.38  ? 792  TYR A CA    1 
ATOM   6029  C  C     . TYR A 1  792  ? -0.657  -26.052  82.203  1.00 59.82  ? 792  TYR A C     1 
ATOM   6030  O  O     . TYR A 1  792  ? -0.320  -27.236  82.065  1.00 58.58  ? 792  TYR A O     1 
ATOM   6031  C  CB    . TYR A 1  792  ? 1.380   -25.337  83.582  1.00 57.87  ? 792  TYR A CB    1 
ATOM   6032  C  CG    . TYR A 1  792  ? 2.618   -24.466  83.622  1.00 59.57  ? 792  TYR A CG    1 
ATOM   6033  C  CD1   . TYR A 1  792  ? 2.644   -23.289  84.363  1.00 62.18  ? 792  TYR A CD1   1 
ATOM   6034  C  CD2   . TYR A 1  792  ? 3.772   -24.830  82.934  1.00 60.00  ? 792  TYR A CD2   1 
ATOM   6035  C  CE1   . TYR A 1  792  ? 3.781   -22.482  84.398  1.00 63.33  ? 792  TYR A CE1   1 
ATOM   6036  C  CE2   . TYR A 1  792  ? 4.919   -24.039  82.973  1.00 61.26  ? 792  TYR A CE2   1 
ATOM   6037  C  CZ    . TYR A 1  792  ? 4.919   -22.865  83.707  1.00 69.89  ? 792  TYR A CZ    1 
ATOM   6038  O  OH    . TYR A 1  792  ? 6.051   -22.085  83.741  1.00 71.95  ? 792  TYR A OH    1 
ATOM   6039  N  N     . SER A 1  793  ? -1.937  -25.630  82.102  1.00 56.49  ? 793  SER A N     1 
ATOM   6040  C  CA    . SER A 1  793  ? -3.101  -26.485  81.862  1.00 55.67  ? 793  SER A CA    1 
ATOM   6041  C  C     . SER A 1  793  ? -3.005  -27.207  80.515  1.00 56.86  ? 793  SER A C     1 
ATOM   6042  O  O     . SER A 1  793  ? -2.465  -26.622  79.573  1.00 55.66  ? 793  SER A O     1 
ATOM   6043  C  CB    . SER A 1  793  ? -4.392  -25.677  81.962  1.00 60.05  ? 793  SER A CB    1 
ATOM   6044  O  OG    . SER A 1  793  ? -4.507  -24.695  80.945  1.00 69.36  ? 793  SER A OG    1 
ATOM   6045  N  N     . PRO A 1  794  ? -3.494  -28.475  80.412  1.00 52.61  ? 794  PRO A N     1 
ATOM   6046  C  CA    . PRO A 1  794  ? -3.369  -29.231  79.151  1.00 51.73  ? 794  PRO A CA    1 
ATOM   6047  C  C     . PRO A 1  794  ? -3.746  -28.484  77.873  1.00 55.42  ? 794  PRO A C     1 
ATOM   6048  O  O     . PRO A 1  794  ? -2.995  -28.520  76.891  1.00 53.67  ? 794  PRO A O     1 
ATOM   6049  C  CB    . PRO A 1  794  ? -4.243  -30.474  79.394  1.00 53.47  ? 794  PRO A CB    1 
ATOM   6050  C  CG    . PRO A 1  794  ? -5.013  -30.192  80.635  1.00 58.50  ? 794  PRO A CG    1 
ATOM   6051  C  CD    . PRO A 1  794  ? -4.142  -29.308  81.441  1.00 54.46  ? 794  PRO A CD    1 
ATOM   6052  N  N     . GLU A 1  795  ? -4.885  -27.769  77.924  1.00 53.19  ? 795  GLU A N     1 
ATOM   6053  C  CA    . GLU A 1  795  ? -5.465  -26.959  76.850  1.00 52.96  ? 795  GLU A CA    1 
ATOM   6054  C  C     . GLU A 1  795  ? -4.539  -25.837  76.373  1.00 54.99  ? 795  GLU A C     1 
ATOM   6055  O  O     . GLU A 1  795  ? -4.540  -25.512  75.183  1.00 54.35  ? 795  GLU A O     1 
ATOM   6056  C  CB    . GLU A 1  795  ? -6.844  -26.397  77.271  1.00 55.45  ? 795  GLU A CB    1 
ATOM   6057  C  CG    . GLU A 1  795  ? -6.848  -25.541  78.541  1.00 69.92  ? 795  GLU A CG    1 
ATOM   6058  C  CD    . GLU A 1  795  ? -7.121  -26.215  79.879  1.00 90.92  ? 795  GLU A CD    1 
ATOM   6059  O  OE1   . GLU A 1  795  ? -6.965  -27.455  79.993  1.00 75.19  ? 795  GLU A OE1   1 
ATOM   6060  O  OE2   . GLU A 1  795  ? -7.445  -25.475  80.837  1.00 85.16  ? 795  GLU A OE2   1 
ATOM   6061  N  N     . SER A 1  796  ? -3.760  -25.251  77.294  1.00 50.35  ? 796  SER A N     1 
ATOM   6062  C  CA    . SER A 1  796  ? -2.853  -24.167  76.964  1.00 49.81  ? 796  SER A CA    1 
ATOM   6063  C  C     . SER A 1  796  ? -1.506  -24.660  76.439  1.00 53.75  ? 796  SER A C     1 
ATOM   6064  O  O     . SER A 1  796  ? -0.792  -23.877  75.826  1.00 54.04  ? 796  SER A O     1 
ATOM   6065  C  CB    . SER A 1  796  ? -2.698  -23.209  78.143  1.00 53.17  ? 796  SER A CB    1 
ATOM   6066  O  OG    . SER A 1  796  ? -1.396  -23.204  78.703  1.00 58.10  ? 796  SER A OG    1 
ATOM   6067  N  N     . LYS A 1  797  ? -1.162  -25.941  76.647  1.00 49.71  ? 797  LYS A N     1 
ATOM   6068  C  CA    . LYS A 1  797  ? 0.131   -26.461  76.191  1.00 48.71  ? 797  LYS A CA    1 
ATOM   6069  C  C     . LYS A 1  797  ? 0.116   -27.523  75.075  1.00 51.48  ? 797  LYS A C     1 
ATOM   6070  O  O     . LYS A 1  797  ? 1.049   -28.315  74.963  1.00 51.13  ? 797  LYS A O     1 
ATOM   6071  C  CB    . LYS A 1  797  ? 1.049   -26.819  77.372  1.00 51.22  ? 797  LYS A CB    1 
ATOM   6072  C  CG    . LYS A 1  797  ? 1.600   -25.589  78.104  1.00 59.22  ? 797  LYS A CG    1 
ATOM   6073  C  CD    . LYS A 1  797  ? 2.570   -25.945  79.238  1.00 64.45  ? 797  LYS A CD    1 
ATOM   6074  C  CE    . LYS A 1  797  ? 3.982   -26.230  78.765  1.00 71.31  ? 797  LYS A CE    1 
ATOM   6075  N  NZ    . LYS A 1  797  ? 4.702   -24.999  78.340  1.00 78.91  ? 797  LYS A NZ    1 
ATOM   6076  N  N     . GLY A 1  798  ? -0.908  -27.486  74.229  1.00 47.18  ? 798  GLY A N     1 
ATOM   6077  C  CA    . GLY A 1  798  ? -1.001  -28.368  73.075  1.00 46.54  ? 798  GLY A CA    1 
ATOM   6078  C  C     . GLY A 1  798  ? -1.820  -29.638  73.178  1.00 51.88  ? 798  GLY A C     1 
ATOM   6079  O  O     . GLY A 1  798  ? -1.715  -30.491  72.288  1.00 50.76  ? 798  GLY A O     1 
ATOM   6080  N  N     . PHE A 1  799  ? -2.644  -29.794  74.233  1.00 50.13  ? 799  PHE A N     1 
ATOM   6081  C  CA    . PHE A 1  799  ? -3.473  -30.996  74.314  1.00 50.23  ? 799  PHE A CA    1 
ATOM   6082  C  C     . PHE A 1  799  ? -4.773  -30.824  73.537  1.00 54.23  ? 799  PHE A C     1 
ATOM   6083  O  O     . PHE A 1  799  ? -5.610  -29.999  73.912  1.00 54.74  ? 799  PHE A O     1 
ATOM   6084  C  CB    . PHE A 1  799  ? -3.728  -31.461  75.756  1.00 52.86  ? 799  PHE A CB    1 
ATOM   6085  C  CG    . PHE A 1  799  ? -4.527  -32.743  75.838  1.00 55.21  ? 799  PHE A CG    1 
ATOM   6086  C  CD1   . PHE A 1  799  ? -3.947  -33.967  75.519  1.00 58.52  ? 799  PHE A CD1   1 
ATOM   6087  C  CD2   . PHE A 1  799  ? -5.865  -32.726  76.213  1.00 58.62  ? 799  PHE A CD2   1 
ATOM   6088  C  CE1   . PHE A 1  799  ? -4.690  -35.153  75.585  1.00 59.85  ? 799  PHE A CE1   1 
ATOM   6089  C  CE2   . PHE A 1  799  ? -6.605  -33.913  76.283  1.00 61.81  ? 799  PHE A CE2   1 
ATOM   6090  C  CZ    . PHE A 1  799  ? -6.012  -35.118  75.974  1.00 59.54  ? 799  PHE A CZ    1 
ATOM   6091  N  N     . VAL A 1  800  ? -4.934  -31.609  72.451  1.00 49.69  ? 800  VAL A N     1 
ATOM   6092  C  CA    . VAL A 1  800  ? -6.129  -31.599  71.607  1.00 49.02  ? 800  VAL A CA    1 
ATOM   6093  C  C     . VAL A 1  800  ? -7.114  -32.639  72.127  1.00 53.55  ? 800  VAL A C     1 
ATOM   6094  O  O     . VAL A 1  800  ? -6.962  -33.836  71.876  1.00 51.96  ? 800  VAL A O     1 
ATOM   6095  C  CB    . VAL A 1  800  ? -5.822  -31.756  70.099  1.00 51.89  ? 800  VAL A CB    1 
ATOM   6096  C  CG1   . VAL A 1  800  ? -7.107  -31.727  69.278  1.00 51.77  ? 800  VAL A CG1   1 
ATOM   6097  C  CG2   . VAL A 1  800  ? -4.867  -30.667  69.623  1.00 51.36  ? 800  VAL A CG2   1 
ATOM   6098  N  N     . GLU A 1  801  ? -8.107  -32.159  72.882  1.00 52.65  ? 801  GLU A N     1 
ATOM   6099  C  CA    . GLU A 1  801  ? -9.162  -32.955  73.509  1.00 54.12  ? 801  GLU A CA    1 
ATOM   6100  C  C     . GLU A 1  801  ? -10.087 -33.590  72.471  1.00 58.65  ? 801  GLU A C     1 
ATOM   6101  O  O     . GLU A 1  801  ? -10.546 -34.719  72.663  1.00 58.84  ? 801  GLU A O     1 
ATOM   6102  C  CB    . GLU A 1  801  ? -9.967  -32.062  74.474  1.00 56.74  ? 801  GLU A CB    1 
ATOM   6103  C  CG    . GLU A 1  801  ? -11.094 -32.761  75.224  1.00 70.28  ? 801  GLU A CG    1 
ATOM   6104  C  CD    . GLU A 1  801  ? -11.925 -31.893  76.151  1.00 100.00 ? 801  GLU A CD    1 
ATOM   6105  O  OE1   . GLU A 1  801  ? -12.782 -32.460  76.869  1.00 104.87 ? 801  GLU A OE1   1 
ATOM   6106  O  OE2   . GLU A 1  801  ? -11.724 -30.656  76.167  1.00 94.81  ? 801  GLU A OE2   1 
ATOM   6107  N  N     . ASN A 1  802  ? -10.371 -32.859  71.388  1.00 55.43  ? 802  ASN A N     1 
ATOM   6108  C  CA    . ASN A 1  802  ? -11.277 -33.308  70.337  1.00 55.59  ? 802  ASN A CA    1 
ATOM   6109  C  C     . ASN A 1  802  ? -10.655 -34.253  69.303  1.00 59.17  ? 802  ASN A C     1 
ATOM   6110  O  O     . ASN A 1  802  ? -9.444  -34.233  69.067  1.00 58.16  ? 802  ASN A O     1 
ATOM   6111  C  CB    . ASN A 1  802  ? -11.923 -32.106  69.640  1.00 55.60  ? 802  ASN A CB    1 
ATOM   6112  C  CG    . ASN A 1  802  ? -12.857 -31.306  70.508  1.00 75.86  ? 802  ASN A CG    1 
ATOM   6113  O  OD1   . ASN A 1  802  ? -13.843 -31.823  71.042  1.00 72.30  ? 802  ASN A OD1   1 
ATOM   6114  N  ND2   . ASN A 1  802  ? -12.583 -30.016  70.637  1.00 66.26  ? 802  ASN A ND2   1 
ATOM   6115  N  N     . SER A 1  803  ? -11.519 -35.075  68.684  1.00 55.50  ? 803  SER A N     1 
ATOM   6116  C  CA    . SER A 1  803  ? -11.194 -35.995  67.598  1.00 54.05  ? 803  SER A CA    1 
ATOM   6117  C  C     . SER A 1  803  ? -11.399 -35.245  66.287  1.00 55.61  ? 803  SER A C     1 
ATOM   6118  O  O     . SER A 1  803  ? -12.130 -34.251  66.269  1.00 56.04  ? 803  SER A O     1 
ATOM   6119  C  CB    . SER A 1  803  ? -12.126 -37.205  67.637  1.00 58.24  ? 803  SER A CB    1 
ATOM   6120  O  OG    . SER A 1  803  ? -13.500 -36.846  67.644  1.00 66.50  ? 803  SER A OG    1 
ATOM   6121  N  N     . TYR A 1  804  ? -10.802 -35.727  65.184  1.00 49.87  ? 804  TYR A N     1 
ATOM   6122  C  CA    . TYR A 1  804  ? -10.979 -35.096  63.869  1.00 48.52  ? 804  TYR A CA    1 
ATOM   6123  C  C     . TYR A 1  804  ? -12.465 -35.019  63.473  1.00 51.58  ? 804  TYR A C     1 
ATOM   6124  O  O     . TYR A 1  804  ? -12.869 -34.043  62.848  1.00 51.33  ? 804  TYR A O     1 
ATOM   6125  C  CB    . TYR A 1  804  ? -10.151 -35.803  62.781  1.00 48.43  ? 804  TYR A CB    1 
ATOM   6126  C  CG    . TYR A 1  804  ? -8.650  -35.732  62.978  1.00 48.76  ? 804  TYR A CG    1 
ATOM   6127  C  CD1   . TYR A 1  804  ? -7.916  -36.868  63.302  1.00 50.40  ? 804  TYR A CD1   1 
ATOM   6128  C  CD2   . TYR A 1  804  ? -7.957  -34.536  62.803  1.00 48.78  ? 804  TYR A CD2   1 
ATOM   6129  C  CE1   . TYR A 1  804  ? -6.531  -36.815  63.462  1.00 50.26  ? 804  TYR A CE1   1 
ATOM   6130  C  CE2   . TYR A 1  804  ? -6.573  -34.471  62.962  1.00 48.79  ? 804  TYR A CE2   1 
ATOM   6131  C  CZ    . TYR A 1  804  ? -5.864  -35.615  63.286  1.00 54.52  ? 804  TYR A CZ    1 
ATOM   6132  O  OH    . TYR A 1  804  ? -4.500  -35.567  63.441  1.00 54.30  ? 804  TYR A OH    1 
ATOM   6133  N  N     . LEU A 1  805  ? -13.279 -36.013  63.900  1.00 47.38  ? 805  LEU A N     1 
ATOM   6134  C  CA    . LEU A 1  805  ? -14.726 -36.086  63.667  1.00 47.26  ? 805  LEU A CA    1 
ATOM   6135  C  C     . LEU A 1  805  ? -15.447 -34.898  64.314  1.00 51.51  ? 805  LEU A C     1 
ATOM   6136  O  O     . LEU A 1  805  ? -16.365 -34.336  63.710  1.00 51.68  ? 805  LEU A O     1 
ATOM   6137  C  CB    . LEU A 1  805  ? -15.274 -37.422  64.216  1.00 47.47  ? 805  LEU A CB    1 
ATOM   6138  C  CG    . LEU A 1  805  ? -16.790 -37.596  64.317  1.00 52.67  ? 805  LEU A CG    1 
ATOM   6139  C  CD1   . LEU A 1  805  ? -17.381 -38.059  63.012  1.00 52.59  ? 805  LEU A CD1   1 
ATOM   6140  C  CD2   . LEU A 1  805  ? -17.140 -38.571  65.414  1.00 57.07  ? 805  LEU A CD2   1 
ATOM   6141  N  N     . ARG A 1  806  ? -15.033 -34.527  65.538  1.00 47.94  ? 806  ARG A N     1 
ATOM   6142  C  CA    . ARG A 1  806  ? -15.623 -33.419  66.287  1.00 48.57  ? 806  ARG A CA    1 
ATOM   6143  C  C     . ARG A 1  806  ? -15.182 -32.086  65.725  1.00 51.52  ? 806  ARG A C     1 
ATOM   6144  O  O     . ARG A 1  806  ? -15.998 -31.167  65.609  1.00 51.20  ? 806  ARG A O     1 
ATOM   6145  C  CB    . ARG A 1  806  ? -15.251 -33.511  67.775  1.00 50.31  ? 806  ARG A CB    1 
ATOM   6146  C  CG    . ARG A 1  806  ? -16.460 -33.702  68.672  1.00 67.69  ? 806  ARG A CG    1 
ATOM   6147  C  CD    . ARG A 1  806  ? -16.057 -34.191  70.045  1.00 85.09  ? 806  ARG A CD    1 
ATOM   6148  N  NE    . ARG A 1  806  ? -17.217 -34.325  70.928  1.00 99.71  ? 806  ARG A NE    1 
ATOM   6149  C  CZ    . ARG A 1  806  ? -17.183 -34.892  72.130  1.00 115.72 ? 806  ARG A CZ    1 
ATOM   6150  N  NH1   . ARG A 1  806  ? -16.048 -35.391  72.606  1.00 103.40 ? 806  ARG A NH1   1 
ATOM   6151  N  NH2   . ARG A 1  806  ? -18.286 -34.970  72.864  1.00 102.67 ? 806  ARG A NH2   1 
ATOM   6152  N  N     . GLY A 1  807  ? -13.896 -32.010  65.377  1.00 47.20  ? 807  GLY A N     1 
ATOM   6153  C  CA    . GLY A 1  807  ? -13.241 -30.811  64.878  1.00 46.48  ? 807  GLY A CA    1 
ATOM   6154  C  C     . GLY A 1  807  ? -12.342 -30.211  65.937  1.00 50.22  ? 807  GLY A C     1 
ATOM   6155  O  O     . GLY A 1  807  ? -12.640 -30.292  67.130  1.00 50.77  ? 807  GLY A O     1 
ATOM   6156  N  N     . LEU A 1  808  ? -11.234 -29.613  65.512  1.00 45.88  ? 808  LEU A N     1 
ATOM   6157  C  CA    . LEU A 1  808  ? -10.260 -28.978  66.399  1.00 45.25  ? 808  LEU A CA    1 
ATOM   6158  C  C     . LEU A 1  808  ? -10.604 -27.495  66.606  1.00 48.37  ? 808  LEU A C     1 
ATOM   6159  O  O     . LEU A 1  808  ? -10.937 -26.800  65.635  1.00 48.71  ? 808  LEU A O     1 
ATOM   6160  C  CB    . LEU A 1  808  ? -8.848  -29.099  65.785  1.00 44.36  ? 808  LEU A CB    1 
ATOM   6161  C  CG    . LEU A 1  808  ? -8.075  -30.387  66.035  1.00 47.96  ? 808  LEU A CG    1 
ATOM   6162  C  CD1   . LEU A 1  808  ? -8.447  -31.464  65.039  1.00 47.82  ? 808  LEU A CD1   1 
ATOM   6163  C  CD2   . LEU A 1  808  ? -6.602  -30.139  65.916  1.00 49.14  ? 808  LEU A CD2   1 
ATOM   6164  N  N     . THR A 1  809  ? -10.488 -27.006  67.859  1.00 61.41  ? 809  THR A N     1 
ATOM   6165  C  CA    . THR A 1  809  ? -10.729 -25.594  68.184  1.00 62.45  ? 809  THR A CA    1 
ATOM   6166  C  C     . THR A 1  809  ? -9.561  -24.749  67.615  1.00 64.14  ? 809  THR A C     1 
ATOM   6167  O  O     . THR A 1  809  ? -8.497  -25.324  67.371  1.00 63.05  ? 809  THR A O     1 
ATOM   6168  C  CB    . THR A 1  809  ? -10.946 -25.395  69.691  1.00 71.61  ? 809  THR A CB    1 
ATOM   6169  O  OG1   . THR A 1  809  ? -9.758  -25.751  70.393  1.00 71.10  ? 809  THR A OG1   1 
ATOM   6170  C  CG2   . THR A 1  809  ? -12.147 -26.171  70.225  1.00 70.91  ? 809  THR A CG2   1 
ATOM   6171  N  N     . PRO A 1  810  ? -9.720  -23.419  67.365  1.00 58.97  ? 810  PRO A N     1 
ATOM   6172  C  CA    . PRO A 1  810  ? -8.606  -22.635  66.779  1.00 56.95  ? 810  PRO A CA    1 
ATOM   6173  C  C     . PRO A 1  810  ? -7.240  -22.811  67.449  1.00 57.08  ? 810  PRO A C     1 
ATOM   6174  O  O     . PRO A 1  810  ? -6.229  -22.929  66.756  1.00 55.16  ? 810  PRO A O     1 
ATOM   6175  C  CB    . PRO A 1  810  ? -9.091  -21.193  66.883  1.00 60.99  ? 810  PRO A CB    1 
ATOM   6176  C  CG    . PRO A 1  810  ? -10.550 -21.284  66.962  1.00 66.92  ? 810  PRO A CG    1 
ATOM   6177  C  CD    . PRO A 1  810  ? -10.917 -22.580  67.579  1.00 62.21  ? 810  PRO A CD    1 
ATOM   6178  N  N     . GLN A 1  811  ? -7.226  -22.858  68.792  1.00 52.26  ? 811  GLN A N     1 
ATOM   6179  C  CA    . GLN A 1  811  ? -6.038  -23.058  69.608  1.00 50.39  ? 811  GLN A CA    1 
ATOM   6180  C  C     . GLN A 1  811  ? -5.514  -24.453  69.304  1.00 52.48  ? 811  GLN A C     1 
ATOM   6181  O  O     . GLN A 1  811  ? -4.372  -24.570  68.872  1.00 50.97  ? 811  GLN A O     1 
ATOM   6182  C  CB    . GLN A 1  811  ? -6.363  -22.903  71.109  1.00 52.68  ? 811  GLN A CB    1 
ATOM   6183  C  CG    . GLN A 1  811  ? -6.863  -21.515  71.520  1.00 52.78  ? 811  GLN A CG    1 
ATOM   6184  C  CD    . GLN A 1  811  ? -8.355  -21.259  71.332  1.00 67.81  ? 811  GLN A CD    1 
ATOM   6185  O  OE1   . GLN A 1  811  ? -9.084  -21.976  70.632  1.00 62.72  ? 811  GLN A OE1   1 
ATOM   6186  N  NE2   . GLN A 1  811  ? -8.843  -20.187  71.926  1.00 59.22  ? 811  GLN A NE2   1 
ATOM   6187  N  N     . GLU A 1  812  ? -6.379  -25.493  69.435  1.00 49.61  ? 812  GLU A N     1 
ATOM   6188  C  CA    . GLU A 1  812  ? -6.062  -26.907  69.166  1.00 48.46  ? 812  GLU A CA    1 
ATOM   6189  C  C     . GLU A 1  812  ? -5.434  -27.082  67.777  1.00 51.98  ? 812  GLU A C     1 
ATOM   6190  O  O     . GLU A 1  812  ? -4.394  -27.740  67.645  1.00 49.56  ? 812  GLU A O     1 
ATOM   6191  C  CB    . GLU A 1  812  ? -7.332  -27.778  69.272  1.00 50.10  ? 812  GLU A CB    1 
ATOM   6192  C  CG    . GLU A 1  812  ? -7.704  -28.207  70.683  1.00 63.41  ? 812  GLU A CG    1 
ATOM   6193  C  CD    . GLU A 1  812  ? -9.026  -28.943  70.825  1.00 85.85  ? 812  GLU A CD    1 
ATOM   6194  O  OE1   . GLU A 1  812  ? -9.225  -29.601  71.872  1.00 77.40  ? 812  GLU A OE1   1 
ATOM   6195  O  OE2   . GLU A 1  812  ? -9.868  -28.858  69.901  1.00 82.75  ? 812  GLU A OE2   1 
ATOM   6196  N  N     . PHE A 1  813  ? -6.071  -26.450  66.759  1.00 49.92  ? 813  PHE A N     1 
ATOM   6197  C  CA    . PHE A 1  813  ? -5.682  -26.429  65.352  1.00 48.93  ? 813  PHE A CA    1 
ATOM   6198  C  C     . PHE A 1  813  ? -4.234  -25.944  65.196  1.00 52.87  ? 813  PHE A C     1 
ATOM   6199  O  O     . PHE A 1  813  ? -3.385  -26.702  64.702  1.00 50.81  ? 813  PHE A O     1 
ATOM   6200  C  CB    . PHE A 1  813  ? -6.662  -25.544  64.542  1.00 51.95  ? 813  PHE A CB    1 
ATOM   6201  C  CG    . PHE A 1  813  ? -6.361  -25.452  63.060  1.00 52.76  ? 813  PHE A CG    1 
ATOM   6202  C  CD1   . PHE A 1  813  ? -6.771  -26.454  62.186  1.00 55.05  ? 813  PHE A CD1   1 
ATOM   6203  C  CD2   . PHE A 1  813  ? -5.668  -24.366  62.540  1.00 55.11  ? 813  PHE A CD2   1 
ATOM   6204  C  CE1   . PHE A 1  813  ? -6.482  -26.374  60.821  1.00 54.87  ? 813  PHE A CE1   1 
ATOM   6205  C  CE2   . PHE A 1  813  ? -5.374  -24.292  61.175  1.00 56.91  ? 813  PHE A CE2   1 
ATOM   6206  C  CZ    . PHE A 1  813  ? -5.786  -25.294  60.325  1.00 53.78  ? 813  PHE A CZ    1 
ATOM   6207  N  N     . PHE A 1  814  ? -3.957  -24.693  65.659  1.00 50.64  ? 814  PHE A N     1 
ATOM   6208  C  CA    . PHE A 1  814  ? -2.639  -24.059  65.607  1.00 50.08  ? 814  PHE A CA    1 
ATOM   6209  C  C     . PHE A 1  814  ? -1.591  -24.921  66.276  1.00 51.96  ? 814  PHE A C     1 
ATOM   6210  O  O     . PHE A 1  814  ? -0.487  -25.040  65.752  1.00 50.79  ? 814  PHE A O     1 
ATOM   6211  C  CB    . PHE A 1  814  ? -2.653  -22.644  66.218  1.00 54.26  ? 814  PHE A CB    1 
ATOM   6212  C  CG    . PHE A 1  814  ? -1.401  -21.861  65.889  1.00 56.35  ? 814  PHE A CG    1 
ATOM   6213  C  CD1   . PHE A 1  814  ? -1.313  -21.117  64.717  1.00 59.56  ? 814  PHE A CD1   1 
ATOM   6214  C  CD2   . PHE A 1  814  ? -0.290  -21.903  66.729  1.00 59.11  ? 814  PHE A CD2   1 
ATOM   6215  C  CE1   . PHE A 1  814  ? -0.137  -20.436  64.387  1.00 60.82  ? 814  PHE A CE1   1 
ATOM   6216  C  CE2   . PHE A 1  814  ? 0.884   -21.219  66.401  1.00 62.20  ? 814  PHE A CE2   1 
ATOM   6217  C  CZ    . PHE A 1  814  ? 0.952   -20.489  65.233  1.00 60.42  ? 814  PHE A CZ    1 
ATOM   6218  N  N     . PHE A 1  815  ? -1.941  -25.535  67.414  1.00 48.16  ? 815  PHE A N     1 
ATOM   6219  C  CA    . PHE A 1  815  ? -1.050  -26.418  68.150  1.00 46.90  ? 815  PHE A CA    1 
ATOM   6220  C  C     . PHE A 1  815  ? -0.734  -27.696  67.353  1.00 49.57  ? 815  PHE A C     1 
ATOM   6221  O  O     . PHE A 1  815  ? 0.436   -28.097  67.276  1.00 47.85  ? 815  PHE A O     1 
ATOM   6222  C  CB    . PHE A 1  815  ? -1.620  -26.722  69.542  1.00 49.34  ? 815  PHE A CB    1 
ATOM   6223  C  CG    . PHE A 1  815  ? -1.659  -25.540  70.483  1.00 52.91  ? 815  PHE A CG    1 
ATOM   6224  C  CD1   . PHE A 1  815  ? -2.629  -25.453  71.473  1.00 57.77  ? 815  PHE A CD1   1 
ATOM   6225  C  CD2   . PHE A 1  815  ? -0.718  -24.520  70.390  1.00 55.59  ? 815  PHE A CD2   1 
ATOM   6226  C  CE1   . PHE A 1  815  ? -2.666  -24.357  72.345  1.00 60.86  ? 815  PHE A CE1   1 
ATOM   6227  C  CE2   . PHE A 1  815  ? -0.761  -23.422  71.258  1.00 60.52  ? 815  PHE A CE2   1 
ATOM   6228  C  CZ    . PHE A 1  815  ? -1.728  -23.353  72.234  1.00 60.15  ? 815  PHE A CZ    1 
ATOM   6229  N  N     . HIS A 1  816  ? -1.757  -28.295  66.711  1.00 46.24  ? 816  HIS A N     1 
ATOM   6230  C  CA    . HIS A 1  816  ? -1.557  -29.485  65.882  1.00 44.97  ? 816  HIS A CA    1 
ATOM   6231  C  C     . HIS A 1  816  ? -0.696  -29.109  64.653  1.00 49.55  ? 816  HIS A C     1 
ATOM   6232  O  O     . HIS A 1  816  ? 0.168   -29.896  64.236  1.00 47.48  ? 816  HIS A O     1 
ATOM   6233  C  CB    . HIS A 1  816  ? -2.915  -30.126  65.510  1.00 45.57  ? 816  HIS A CB    1 
ATOM   6234  C  CG    . HIS A 1  816  ? -2.849  -31.359  64.646  1.00 46.93  ? 816  HIS A CG    1 
ATOM   6235  N  ND1   . HIS A 1  816  ? -1.895  -32.338  64.844  1.00 47.38  ? 816  HIS A ND1   1 
ATOM   6236  C  CD2   . HIS A 1  816  ? -3.662  -31.745  63.633  1.00 47.71  ? 816  HIS A CD2   1 
ATOM   6237  C  CE1   . HIS A 1  816  ? -2.134  -33.265  63.928  1.00 45.37  ? 816  HIS A CE1   1 
ATOM   6238  N  NE2   . HIS A 1  816  ? -3.192  -32.954  63.183  1.00 45.85  ? 816  HIS A NE2   1 
ATOM   6239  N  N     . ALA A 1  817  ? -0.885  -27.860  64.148  1.00 47.58  ? 817  ALA A N     1 
ATOM   6240  C  CA    . ALA A 1  817  ? -0.146  -27.272  63.030  1.00 46.92  ? 817  ALA A CA    1 
ATOM   6241  C  C     . ALA A 1  817  ? 1.356   -27.126  63.356  1.00 50.84  ? 817  ALA A C     1 
ATOM   6242  O  O     . ALA A 1  817  ? 2.211   -27.396  62.502  1.00 49.12  ? 817  ALA A O     1 
ATOM   6243  C  CB    . ALA A 1  817  ? -0.742  -25.922  62.682  1.00 49.00  ? 817  ALA A CB    1 
ATOM   6244  N  N     . MET A 1  818  ? 1.664   -26.735  64.606  1.00 48.69  ? 818  MET A N     1 
ATOM   6245  C  CA    . MET A 1  818  ? 3.031   -26.582  65.105  1.00 48.76  ? 818  MET A CA    1 
ATOM   6246  C  C     . MET A 1  818  ? 3.764   -27.922  65.105  1.00 54.17  ? 818  MET A C     1 
ATOM   6247  O  O     . MET A 1  818  ? 4.863   -28.017  64.551  1.00 53.30  ? 818  MET A O     1 
ATOM   6248  C  CB    . MET A 1  818  ? 3.030   -25.974  66.510  1.00 52.11  ? 818  MET A CB    1 
ATOM   6249  C  CG    . MET A 1  818  ? 2.649   -24.524  66.524  1.00 56.58  ? 818  MET A CG    1 
ATOM   6250  S  SD    . MET A 1  818  ? 2.657   -23.848  68.177  1.00 61.75  ? 818  MET A SD    1 
ATOM   6251  C  CE    . MET A 1  818  ? 4.406   -23.687  68.435  1.00 58.48  ? 818  MET A CE    1 
ATOM   6252  N  N     . GLY A 1  819  ? 3.126   -28.938  65.694  1.00 52.26  ? 819  GLY A N     1 
ATOM   6253  C  CA    . GLY A 1  819  ? 3.635   -30.304  65.762  1.00 51.41  ? 819  GLY A CA    1 
ATOM   6254  C  C     . GLY A 1  819  ? 3.756   -30.943  64.392  1.00 54.70  ? 819  GLY A C     1 
ATOM   6255  O  O     . GLY A 1  819  ? 4.714   -31.681  64.135  1.00 53.87  ? 819  GLY A O     1 
ATOM   6256  N  N     . GLY A 1  820  ? 2.799   -30.630  63.513  1.00 50.70  ? 820  GLY A N     1 
ATOM   6257  C  CA    . GLY A 1  820  ? 2.776   -31.129  62.145  1.00 49.38  ? 820  GLY A CA    1 
ATOM   6258  C  C     . GLY A 1  820  ? 3.988   -30.669  61.369  1.00 53.48  ? 820  GLY A C     1 
ATOM   6259  O  O     . GLY A 1  820  ? 4.709   -31.485  60.788  1.00 50.76  ? 820  GLY A O     1 
ATOM   6260  N  N     . ARG A 1  821  ? 4.240   -29.347  61.415  1.00 52.99  ? 821  ARG A N     1 
ATOM   6261  C  CA    . ARG A 1  821  ? 5.366   -28.680  60.758  1.00 53.16  ? 821  ARG A CA    1 
ATOM   6262  C  C     . ARG A 1  821  ? 6.691   -29.367  61.115  1.00 56.34  ? 821  ARG A C     1 
ATOM   6263  O  O     . ARG A 1  821  ? 7.495   -29.636  60.221  1.00 54.46  ? 821  ARG A O     1 
ATOM   6264  C  CB    . ARG A 1  821  ? 5.376   -27.177  61.112  1.00 54.36  ? 821  ARG A CB    1 
ATOM   6265  C  CG    . ARG A 1  821  ? 6.666   -26.432  60.771  1.00 62.70  ? 821  ARG A CG    1 
ATOM   6266  C  CD    . ARG A 1  821  ? 6.791   -26.046  59.309  1.00 66.61  ? 821  ARG A CD    1 
ATOM   6267  N  NE    . ARG A 1  821  ? 6.509   -24.625  59.120  1.00 66.99  ? 821  ARG A NE    1 
ATOM   6268  C  CZ    . ARG A 1  821  ? 5.315   -24.140  58.806  1.00 78.45  ? 821  ARG A CZ    1 
ATOM   6269  N  NH1   . ARG A 1  821  ? 4.287   -24.960  58.611  1.00 66.94  ? 821  ARG A NH1   1 
ATOM   6270  N  NH2   . ARG A 1  821  ? 5.138   -22.834  58.671  1.00 64.28  ? 821  ARG A NH2   1 
ATOM   6271  N  N     . GLU A 1  822  ? 6.876   -29.704  62.407  1.00 54.19  ? 822  GLU A N     1 
ATOM   6272  C  CA    . GLU A 1  822  ? 8.074   -30.381  62.889  1.00 54.30  ? 822  GLU A CA    1 
ATOM   6273  C  C     . GLU A 1  822  ? 8.275   -31.717  62.171  1.00 58.22  ? 822  GLU A C     1 
ATOM   6274  O  O     . GLU A 1  822  ? 9.401   -32.055  61.797  1.00 56.73  ? 822  GLU A O     1 
ATOM   6275  C  CB    . GLU A 1  822  ? 8.055   -30.550  64.420  1.00 56.39  ? 822  GLU A CB    1 
ATOM   6276  C  CG    . GLU A 1  822  ? 9.416   -30.936  64.977  1.00 65.92  ? 822  GLU A CG    1 
ATOM   6277  C  CD    . GLU A 1  822  ? 9.490   -31.177  66.467  1.00 83.91  ? 822  GLU A CD    1 
ATOM   6278  O  OE1   . GLU A 1  822  ? 8.975   -32.219  66.932  1.00 78.89  ? 822  GLU A OE1   1 
ATOM   6279  O  OE2   . GLU A 1  822  ? 10.130  -30.355  67.160  1.00 79.88  ? 822  GLU A OE2   1 
ATOM   6280  N  N     . GLY A 1  823  ? 7.177   -32.428  61.940  1.00 56.19  ? 823  GLY A N     1 
ATOM   6281  C  CA    . GLY A 1  823  ? 7.199   -33.706  61.236  1.00 55.44  ? 823  GLY A CA    1 
ATOM   6282  C  C     . GLY A 1  823  ? 7.664   -33.566  59.803  1.00 59.33  ? 823  GLY A C     1 
ATOM   6283  O  O     . GLY A 1  823  ? 8.435   -34.400  59.321  1.00 58.13  ? 823  GLY A O     1 
ATOM   6284  N  N     . LEU A 1  824  ? 7.222   -32.477  59.136  1.00 56.71  ? 824  LEU A N     1 
ATOM   6285  C  CA    . LEU A 1  824  ? 7.573   -32.144  57.756  1.00 56.12  ? 824  LEU A CA    1 
ATOM   6286  C  C     . LEU A 1  824  ? 9.024   -31.708  57.628  1.00 59.01  ? 824  LEU A C     1 
ATOM   6287  O  O     . LEU A 1  824  ? 9.689   -32.121  56.677  1.00 56.94  ? 824  LEU A O     1 
ATOM   6288  C  CB    . LEU A 1  824  ? 6.612   -31.096  57.180  1.00 57.20  ? 824  LEU A CB    1 
ATOM   6289  C  CG    . LEU A 1  824  ? 5.190   -31.606  56.906  1.00 62.41  ? 824  LEU A CG    1 
ATOM   6290  C  CD1   . LEU A 1  824  ? 4.153   -30.598  57.332  1.00 64.04  ? 824  LEU A CD1   1 
ATOM   6291  C  CD2   . LEU A 1  824  ? 5.003   -31.978  55.445  1.00 65.14  ? 824  LEU A CD2   1 
ATOM   6292  N  N     . ILE A 1  825  ? 9.530   -30.910  58.597  1.00 57.56  ? 825  ILE A N     1 
ATOM   6293  C  CA    . ILE A 1  825  ? 10.933  -30.478  58.608  1.00 58.42  ? 825  ILE A CA    1 
ATOM   6294  C  C     . ILE A 1  825  ? 11.798  -31.709  58.817  1.00 66.23  ? 825  ILE A C     1 
ATOM   6295  O  O     . ILE A 1  825  ? 12.743  -31.915  58.059  1.00 65.86  ? 825  ILE A O     1 
ATOM   6296  C  CB    . ILE A 1  825  ? 11.252  -29.361  59.634  1.00 62.05  ? 825  ILE A CB    1 
ATOM   6297  C  CG1   . ILE A 1  825  ? 10.343  -28.141  59.431  1.00 63.14  ? 825  ILE A CG1   1 
ATOM   6298  C  CG2   . ILE A 1  825  ? 12.734  -28.956  59.559  1.00 62.30  ? 825  ILE A CG2   1 
ATOM   6299  C  CD1   . ILE A 1  825  ? 10.070  -27.408  60.671  1.00 70.14  ? 825  ILE A CD1   1 
ATOM   6300  N  N     . ASP A 1  826  ? 11.426  -32.565  59.790  1.00 66.01  ? 826  ASP A N     1 
ATOM   6301  C  CA    . ASP A 1  826  ? 12.140  -33.807  60.077  1.00 66.84  ? 826  ASP A CA    1 
ATOM   6302  C  C     . ASP A 1  826  ? 12.149  -34.760  58.889  1.00 71.22  ? 826  ASP A C     1 
ATOM   6303  O  O     . ASP A 1  826  ? 13.111  -35.506  58.736  1.00 70.61  ? 826  ASP A O     1 
ATOM   6304  C  CB    . ASP A 1  826  ? 11.604  -34.481  61.344  1.00 69.67  ? 826  ASP A CB    1 
ATOM   6305  C  CG    . ASP A 1  826  ? 11.922  -33.743  62.639  1.00 89.73  ? 826  ASP A CG    1 
ATOM   6306  O  OD1   . ASP A 1  826  ? 11.456  -34.197  63.710  1.00 92.35  ? 826  ASP A OD1   1 
ATOM   6307  O  OD2   . ASP A 1  826  ? 12.627  -32.698  62.580  1.00 97.62  ? 826  ASP A OD2   1 
ATOM   6308  N  N     . THR A 1  827  ? 11.115  -34.692  58.020  1.00 68.34  ? 827  THR A N     1 
ATOM   6309  C  CA    . THR A 1  827  ? 11.033  -35.491  56.798  1.00 67.64  ? 827  THR A CA    1 
ATOM   6310  C  C     . THR A 1  827  ? 12.125  -34.973  55.861  1.00 73.29  ? 827  THR A C     1 
ATOM   6311  O  O     . THR A 1  827  ? 13.071  -35.708  55.568  1.00 72.22  ? 827  THR A O     1 
ATOM   6312  C  CB    . THR A 1  827  ? 9.613   -35.418  56.190  1.00 74.12  ? 827  THR A CB    1 
ATOM   6313  O  OG1   . THR A 1  827  ? 8.666   -35.930  57.128  1.00 74.92  ? 827  THR A OG1   1 
ATOM   6314  C  CG2   . THR A 1  827  ? 9.492   -36.180  54.878  1.00 70.21  ? 827  THR A CG2   1 
ATOM   6315  N  N     . ALA A 1  828  ? 12.025  -33.680  55.474  1.00 72.21  ? 828  ALA A N     1 
ATOM   6316  C  CA    . ALA A 1  828  ? 12.944  -32.947  54.599  1.00 73.28  ? 828  ALA A CA    1 
ATOM   6317  C  C     . ALA A 1  828  ? 14.418  -33.140  54.975  1.00 79.97  ? 828  ALA A C     1 
ATOM   6318  O  O     . ALA A 1  828  ? 15.247  -33.374  54.094  1.00 79.14  ? 828  ALA A O     1 
ATOM   6319  C  CB    . ALA A 1  828  ? 12.594  -31.470  54.622  1.00 75.05  ? 828  ALA A CB    1 
ATOM   6320  N  N     . VAL A 1  829  ? 14.723  -33.059  56.286  1.00 79.33  ? 829  VAL A N     1 
ATOM   6321  C  CA    . VAL A 1  829  ? 16.053  -33.216  56.882  1.00 80.71  ? 829  VAL A CA    1 
ATOM   6322  C  C     . VAL A 1  829  ? 16.573  -34.650  56.681  1.00 86.39  ? 829  VAL A C     1 
ATOM   6323  O  O     . VAL A 1  829  ? 17.686  -34.836  56.171  1.00 86.14  ? 829  VAL A O     1 
ATOM   6324  C  CB    . VAL A 1  829  ? 16.023  -32.799  58.384  1.00 85.54  ? 829  VAL A CB    1 
ATOM   6325  C  CG1   . VAL A 1  829  ? 17.256  -33.285  59.146  1.00 85.55  ? 829  VAL A CG1   1 
ATOM   6326  C  CG2   . VAL A 1  829  ? 15.865  -31.288  58.531  1.00 86.85  ? 829  VAL A CG2   1 
ATOM   6327  N  N     . LYS A 1  830  ? 15.752  -35.647  57.078  1.00 83.87  ? 830  LYS A N     1 
ATOM   6328  C  CA    . LYS A 1  830  ? 16.052  -37.077  57.033  1.00 83.49  ? 830  LYS A CA    1 
ATOM   6329  C  C     . LYS A 1  830  ? 16.471  -37.587  55.665  1.00 86.94  ? 830  LYS A C     1 
ATOM   6330  O  O     . LYS A 1  830  ? 17.593  -38.079  55.527  1.00 86.84  ? 830  LYS A O     1 
ATOM   6331  C  CB    . LYS A 1  830  ? 14.868  -37.892  57.557  1.00 85.98  ? 830  LYS A CB    1 
ATOM   6332  C  CG    . LYS A 1  830  ? 15.245  -38.852  58.663  1.00 104.23 ? 830  LYS A CG    1 
ATOM   6333  C  CD    . LYS A 1  830  ? 14.007  -39.483  59.264  1.00 116.16 ? 830  LYS A CD    1 
ATOM   6334  C  CE    . LYS A 1  830  ? 13.629  -38.903  60.607  1.00 130.12 ? 830  LYS A CE    1 
ATOM   6335  N  NZ    . LYS A 1  830  ? 13.031  -37.546  60.510  1.00 140.01 ? 830  LYS A NZ    1 
ATOM   6336  N  N     . THR A 1  831  ? 15.575  -37.462  54.660  1.00 82.52  ? 831  THR A N     1 
ATOM   6337  C  CA    . THR A 1  831  ? 15.785  -37.919  53.282  1.00 81.70  ? 831  THR A CA    1 
ATOM   6338  C  C     . THR A 1  831  ? 17.164  -37.570  52.724  1.00 85.68  ? 831  THR A C     1 
ATOM   6339  O  O     . THR A 1  831  ? 17.814  -38.441  52.140  1.00 85.24  ? 831  THR A O     1 
ATOM   6340  C  CB    . THR A 1  831  ? 14.627  -37.503  52.364  1.00 89.81  ? 831  THR A CB    1 
ATOM   6341  O  OG1   . THR A 1  831  ? 14.333  -36.119  52.561  1.00 91.27  ? 831  THR A OG1   1 
ATOM   6342  C  CG2   . THR A 1  831  ? 13.374  -38.342  52.586  1.00 87.93  ? 831  THR A CG2   1 
ATOM   6343  N  N     . ALA A 1  832  ? 17.631  -36.322  52.958  1.00 82.10  ? 832  ALA A N     1 
ATOM   6344  C  CA    . ALA A 1  832  ? 18.939  -35.847  52.509  1.00 81.93  ? 832  ALA A CA    1 
ATOM   6345  C  C     . ALA A 1  832  ? 20.081  -36.476  53.313  1.00 84.07  ? 832  ALA A C     1 
ATOM   6346  O  O     . ALA A 1  832  ? 21.057  -36.939  52.712  1.00 84.02  ? 832  ALA A O     1 
ATOM   6347  C  CB    . ALA A 1  832  ? 19.004  -34.332  52.591  1.00 83.79  ? 832  ALA A CB    1 
ATOM   6348  N  N     . GLU A 1  833  ? 19.952  -36.514  54.661  1.00 78.66  ? 833  GLU A N     1 
ATOM   6349  C  CA    . GLU A 1  833  ? 20.974  -37.085  55.539  1.00 77.90  ? 833  GLU A CA    1 
ATOM   6350  C  C     . GLU A 1  833  ? 21.130  -38.597  55.354  1.00 77.66  ? 833  GLU A C     1 
ATOM   6351  O  O     . GLU A 1  833  ? 22.246  -39.059  55.113  1.00 77.30  ? 833  GLU A O     1 
ATOM   6352  C  CB    . GLU A 1  833  ? 20.728  -36.714  57.013  1.00 80.06  ? 833  GLU A CB    1 
ATOM   6353  C  CG    . GLU A 1  833  ? 22.005  -36.715  57.843  1.00 94.93  ? 833  GLU A CG    1 
ATOM   6354  C  CD    . GLU A 1  833  ? 21.878  -36.230  59.274  1.00 122.87 ? 833  GLU A CD    1 
ATOM   6355  O  OE1   . GLU A 1  833  ? 21.416  -37.018  60.131  1.00 125.31 ? 833  GLU A OE1   1 
ATOM   6356  O  OE2   . GLU A 1  833  ? 22.293  -35.081  59.551  1.00 117.41 ? 833  GLU A OE2   1 
ATOM   6357  N  N     . THR A 1  834  ? 20.012  -39.354  55.427  1.00 71.17  ? 834  THR A N     1 
ATOM   6358  C  CA    . THR A 1  834  ? 19.981  -40.818  55.272  1.00 69.18  ? 834  THR A CA    1 
ATOM   6359  C  C     . THR A 1  834  ? 20.539  -41.265  53.927  1.00 70.57  ? 834  THR A C     1 
ATOM   6360  O  O     . THR A 1  834  ? 21.109  -42.352  53.827  1.00 69.55  ? 834  THR A O     1 
ATOM   6361  C  CB    . THR A 1  834  ? 18.568  -41.382  55.492  1.00 75.62  ? 834  THR A CB    1 
ATOM   6362  O  OG1   . THR A 1  834  ? 17.670  -40.844  54.520  1.00 73.16  ? 834  THR A OG1   1 
ATOM   6363  C  CG2   . THR A 1  834  ? 18.042  -41.138  56.898  1.00 75.04  ? 834  THR A CG2   1 
ATOM   6364  N  N     . GLY A 1  835  ? 20.360  -40.418  52.915  1.00 66.09  ? 835  GLY A N     1 
ATOM   6365  C  CA    . GLY A 1  835  ? 20.845  -40.652  51.563  1.00 65.37  ? 835  GLY A CA    1 
ATOM   6366  C  C     . GLY A 1  835  ? 22.353  -40.594  51.495  1.00 68.24  ? 835  GLY A C     1 
ATOM   6367  O  O     . GLY A 1  835  ? 22.977  -41.453  50.864  1.00 67.67  ? 835  GLY A O     1 
ATOM   6368  N  N     . TYR A 1  836  ? 22.943  -39.585  52.161  1.00 64.53  ? 836  TYR A N     1 
ATOM   6369  C  CA    . TYR A 1  836  ? 24.390  -39.414  52.233  1.00 65.13  ? 836  TYR A CA    1 
ATOM   6370  C  C     . TYR A 1  836  ? 25.029  -40.594  52.985  1.00 67.59  ? 836  TYR A C     1 
ATOM   6371  O  O     . TYR A 1  836  ? 26.029  -41.136  52.513  1.00 67.99  ? 836  TYR A O     1 
ATOM   6372  C  CB    . TYR A 1  836  ? 24.747  -38.063  52.881  1.00 67.66  ? 836  TYR A CB    1 
ATOM   6373  C  CG    . TYR A 1  836  ? 26.230  -37.751  52.953  1.00 70.83  ? 836  TYR A CG    1 
ATOM   6374  C  CD1   . TYR A 1  836  ? 27.066  -37.976  51.862  1.00 73.47  ? 836  TYR A CD1   1 
ATOM   6375  C  CD2   . TYR A 1  836  ? 26.782  -37.159  54.083  1.00 72.38  ? 836  TYR A CD2   1 
ATOM   6376  C  CE1   . TYR A 1  836  ? 28.425  -37.670  51.916  1.00 75.80  ? 836  TYR A CE1   1 
ATOM   6377  C  CE2   . TYR A 1  836  ? 28.134  -36.828  54.141  1.00 74.61  ? 836  TYR A CE2   1 
ATOM   6378  C  CZ    . TYR A 1  836  ? 28.955  -37.091  53.056  1.00 83.05  ? 836  TYR A CZ    1 
ATOM   6379  O  OH    . TYR A 1  836  ? 30.294  -36.783  53.111  1.00 86.04  ? 836  TYR A OH    1 
ATOM   6380  N  N     . ILE A 1  837  ? 24.413  -41.022  54.114  1.00 61.62  ? 837  ILE A N     1 
ATOM   6381  C  CA    . ILE A 1  837  ? 24.843  -42.160  54.946  1.00 59.93  ? 837  ILE A CA    1 
ATOM   6382  C  C     . ILE A 1  837  ? 24.954  -43.428  54.083  1.00 59.90  ? 837  ILE A C     1 
ATOM   6383  O  O     . ILE A 1  837  ? 25.974  -44.115  54.117  1.00 59.07  ? 837  ILE A O     1 
ATOM   6384  C  CB    . ILE A 1  837  ? 23.871  -42.355  56.150  1.00 62.39  ? 837  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A 1  837  ? 23.955  -41.178  57.147  1.00 63.92  ? 837  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A 1  837  ? 24.105  -43.691  56.854  1.00 62.03  ? 837  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A 1  837  ? 22.689  -40.972  58.048  1.00 72.92  ? 837  ILE A CD1   1 
ATOM   6388  N  N     . GLN A 1  838  ? 23.903  -43.704  53.300  1.00 54.35  ? 838  GLN A N     1 
ATOM   6389  C  CA    . GLN A 1  838  ? 23.821  -44.847  52.405  1.00 53.37  ? 838  GLN A CA    1 
ATOM   6390  C  C     . GLN A 1  838  ? 24.954  -44.805  51.372  1.00 57.98  ? 838  GLN A C     1 
ATOM   6391  O  O     . GLN A 1  838  ? 25.601  -45.829  51.164  1.00 58.59  ? 838  GLN A O     1 
ATOM   6392  C  CB    . GLN A 1  838  ? 22.432  -44.913  51.744  1.00 53.68  ? 838  GLN A CB    1 
ATOM   6393  C  CG    . GLN A 1  838  ? 22.072  -46.280  51.165  1.00 64.18  ? 838  GLN A CG    1 
ATOM   6394  C  CD    . GLN A 1  838  ? 22.322  -46.420  49.679  1.00 88.49  ? 838  GLN A CD    1 
ATOM   6395  O  OE1   . GLN A 1  838  ? 22.946  -45.568  49.023  1.00 86.34  ? 838  GLN A OE1   1 
ATOM   6396  N  NE2   . GLN A 1  838  ? 21.830  -47.517  49.111  1.00 79.52  ? 838  GLN A NE2   1 
ATOM   6397  N  N     . ARG A 1  839  ? 25.229  -43.622  50.770  1.00 53.79  ? 839  ARG A N     1 
ATOM   6398  C  CA    . ARG A 1  839  ? 26.302  -43.441  49.781  1.00 53.61  ? 839  ARG A CA    1 
ATOM   6399  C  C     . ARG A 1  839  ? 27.655  -43.833  50.374  1.00 56.79  ? 839  ARG A C     1 
ATOM   6400  O  O     . ARG A 1  839  ? 28.407  -44.586  49.753  1.00 56.00  ? 839  ARG A O     1 
ATOM   6401  C  CB    . ARG A 1  839  ? 26.316  -41.996  49.233  1.00 53.82  ? 839  ARG A CB    1 
ATOM   6402  C  CG    . ARG A 1  839  ? 27.713  -41.437  48.972  1.00 63.79  ? 839  ARG A CG    1 
ATOM   6403  C  CD    . ARG A 1  839  ? 27.760  -40.355  47.926  1.00 74.15  ? 839  ARG A CD    1 
ATOM   6404  N  NE    . ARG A 1  839  ? 29.120  -40.192  47.412  1.00 78.38  ? 839  ARG A NE    1 
ATOM   6405  C  CZ    . ARG A 1  839  ? 29.610  -40.851  46.367  1.00 89.81  ? 839  ARG A CZ    1 
ATOM   6406  N  NH1   . ARG A 1  839  ? 28.852  -41.715  45.702  1.00 75.28  ? 839  ARG A NH1   1 
ATOM   6407  N  NH2   . ARG A 1  839  ? 30.855  -40.640  45.968  1.00 78.05  ? 839  ARG A NH2   1 
ATOM   6408  N  N     . ARG A 1  840  ? 27.931  -43.340  51.595  1.00 53.78  ? 840  ARG A N     1 
ATOM   6409  C  CA    . ARG A 1  840  ? 29.158  -43.585  52.350  1.00 54.11  ? 840  ARG A CA    1 
ATOM   6410  C  C     . ARG A 1  840  ? 29.278  -45.070  52.681  1.00 56.35  ? 840  ARG A C     1 
ATOM   6411  O  O     . ARG A 1  840  ? 30.361  -45.634  52.549  1.00 56.60  ? 840  ARG A O     1 
ATOM   6412  C  CB    . ARG A 1  840  ? 29.174  -42.738  53.631  1.00 54.60  ? 840  ARG A CB    1 
ATOM   6413  C  CG    . ARG A 1  840  ? 29.285  -41.230  53.395  1.00 65.43  ? 840  ARG A CG    1 
ATOM   6414  C  CD    . ARG A 1  840  ? 28.579  -40.415  54.469  1.00 78.33  ? 840  ARG A CD    1 
ATOM   6415  N  NE    . ARG A 1  840  ? 28.985  -40.794  55.825  1.00 89.59  ? 840  ARG A NE    1 
ATOM   6416  C  CZ    . ARG A 1  840  ? 28.326  -40.463  56.930  1.00 104.10 ? 840  ARG A CZ    1 
ATOM   6417  N  NH1   . ARG A 1  840  ? 27.222  -39.726  56.861  1.00 91.35  ? 840  ARG A NH1   1 
ATOM   6418  N  NH2   . ARG A 1  840  ? 28.758  -40.874  58.113  1.00 91.71  ? 840  ARG A NH2   1 
ATOM   6419  N  N     . LEU A 1  841  ? 28.152  -45.707  53.066  1.00 51.12  ? 841  LEU A N     1 
ATOM   6420  C  CA    . LEU A 1  841  ? 28.095  -47.128  53.382  1.00 50.23  ? 841  LEU A CA    1 
ATOM   6421  C  C     . LEU A 1  841  ? 28.500  -47.933  52.160  1.00 55.72  ? 841  LEU A C     1 
ATOM   6422  O  O     . LEU A 1  841  ? 29.396  -48.770  52.248  1.00 56.40  ? 841  LEU A O     1 
ATOM   6423  C  CB    . LEU A 1  841  ? 26.684  -47.532  53.848  1.00 48.90  ? 841  LEU A CB    1 
ATOM   6424  C  CG    . LEU A 1  841  ? 26.401  -47.438  55.348  1.00 53.31  ? 841  LEU A CG    1 
ATOM   6425  C  CD1   . LEU A 1  841  ? 24.910  -47.429  55.619  1.00 52.57  ? 841  LEU A CD1   1 
ATOM   6426  C  CD2   . LEU A 1  841  ? 27.037  -48.593  56.104  1.00 55.67  ? 841  LEU A CD2   1 
ATOM   6427  N  N     . VAL A 1  842  ? 27.872  -47.642  51.011  1.00 52.42  ? 842  VAL A N     1 
ATOM   6428  C  CA    . VAL A 1  842  ? 28.136  -48.311  49.739  1.00 52.34  ? 842  VAL A CA    1 
ATOM   6429  C  C     . VAL A 1  842  ? 29.607  -48.144  49.329  1.00 58.71  ? 842  VAL A C     1 
ATOM   6430  O  O     . VAL A 1  842  ? 30.277  -49.141  49.052  1.00 59.09  ? 842  VAL A O     1 
ATOM   6431  C  CB    . VAL A 1  842  ? 27.137  -47.871  48.634  1.00 54.89  ? 842  VAL A CB    1 
ATOM   6432  C  CG1   . VAL A 1  842  ? 27.494  -48.496  47.296  1.00 55.11  ? 842  VAL A CG1   1 
ATOM   6433  C  CG2   . VAL A 1  842  ? 25.706  -48.226  49.012  1.00 53.28  ? 842  VAL A CG2   1 
ATOM   6434  N  N     . LYS A 1  843  ? 30.108  -46.898  49.351  1.00 56.39  ? 843  LYS A N     1 
ATOM   6435  C  CA    . LYS A 1  843  ? 31.479  -46.554  48.974  1.00 57.77  ? 843  LYS A CA    1 
ATOM   6436  C  C     . LYS A 1  843  ? 32.563  -47.244  49.802  1.00 62.28  ? 843  LYS A C     1 
ATOM   6437  O  O     . LYS A 1  843  ? 33.588  -47.654  49.246  1.00 63.07  ? 843  LYS A O     1 
ATOM   6438  C  CB    . LYS A 1  843  ? 31.676  -45.031  48.956  1.00 60.84  ? 843  LYS A CB    1 
ATOM   6439  C  CG    . LYS A 1  843  ? 31.128  -44.365  47.698  1.00 72.89  ? 843  LYS A CG    1 
ATOM   6440  C  CD    . LYS A 1  843  ? 32.133  -44.401  46.558  1.00 84.07  ? 843  LYS A CD    1 
ATOM   6441  C  CE    . LYS A 1  843  ? 31.497  -44.865  45.278  1.00 94.28  ? 843  LYS A CE    1 
ATOM   6442  N  NZ    . LYS A 1  843  ? 32.525  -45.245  44.283  1.00 104.91 ? 843  LYS A NZ    1 
ATOM   6443  N  N     . ALA A 1  844  ? 32.326  -47.391  51.115  1.00 57.91  ? 844  ALA A N     1 
ATOM   6444  C  CA    . ALA A 1  844  ? 33.267  -48.017  52.046  1.00 58.37  ? 844  ALA A CA    1 
ATOM   6445  C  C     . ALA A 1  844  ? 33.305  -49.531  51.934  1.00 61.68  ? 844  ALA A C     1 
ATOM   6446  O  O     . ALA A 1  844  ? 34.291  -50.152  52.352  1.00 61.11  ? 844  ALA A O     1 
ATOM   6447  C  CB    . ALA A 1  844  ? 32.938  -47.611  53.475  1.00 58.84  ? 844  ALA A CB    1 
ATOM   6448  N  N     . LEU A 1  845  ? 32.238  -50.122  51.372  1.00 58.26  ? 845  LEU A N     1 
ATOM   6449  C  CA    . LEU A 1  845  ? 32.109  -51.570  51.259  1.00 58.48  ? 845  LEU A CA    1 
ATOM   6450  C  C     . LEU A 1  845  ? 32.173  -52.145  49.843  1.00 65.41  ? 845  LEU A C     1 
ATOM   6451  O  O     . LEU A 1  845  ? 32.366  -53.354  49.717  1.00 65.17  ? 845  LEU A O     1 
ATOM   6452  C  CB    . LEU A 1  845  ? 30.857  -52.082  52.007  1.00 57.04  ? 845  LEU A CB    1 
ATOM   6453  C  CG    . LEU A 1  845  ? 30.645  -51.676  53.475  1.00 60.85  ? 845  LEU A CG    1 
ATOM   6454  C  CD1   . LEU A 1  845  ? 29.429  -52.359  54.045  1.00 59.89  ? 845  LEU A CD1   1 
ATOM   6455  C  CD2   . LEU A 1  845  ? 31.837  -52.011  54.335  1.00 63.97  ? 845  LEU A CD2   1 
ATOM   6456  N  N     . GLU A 1  846  ? 32.011  -51.298  48.791  1.00 64.24  ? 846  GLU A N     1 
ATOM   6457  C  CA    . GLU A 1  846  ? 32.029  -51.657  47.358  1.00 65.43  ? 846  GLU A CA    1 
ATOM   6458  C  C     . GLU A 1  846  ? 32.688  -53.024  47.053  1.00 71.95  ? 846  GLU A C     1 
ATOM   6459  O  O     . GLU A 1  846  ? 31.995  -54.017  46.808  1.00 71.39  ? 846  GLU A O     1 
ATOM   6460  C  CB    . GLU A 1  846  ? 32.790  -50.591  46.544  1.00 67.93  ? 846  GLU A CB    1 
ATOM   6461  C  CG    . GLU A 1  846  ? 32.131  -49.244  46.349  1.00 78.92  ? 846  GLU A CG    1 
ATOM   6462  C  CD    . GLU A 1  846  ? 33.042  -48.290  45.600  1.00 100.19 ? 846  GLU A CD    1 
ATOM   6463  O  OE1   . GLU A 1  846  ? 33.694  -47.446  46.258  1.00 95.64  ? 846  GLU A OE1   1 
ATOM   6464  O  OE2   . GLU A 1  846  ? 33.154  -48.428  44.360  1.00 91.24  ? 846  GLU A OE2   1 
ATOM   6465  N  N     . ASP A 1  847  ? 34.042  -53.043  47.132  1.00 70.35  ? 847  ASP A N     1 
ATOM   6466  C  CA    . ASP A 1  847  ? 35.006  -54.107  46.826  1.00 71.52  ? 847  ASP A CA    1 
ATOM   6467  C  C     . ASP A 1  847  ? 35.049  -55.339  47.753  1.00 73.24  ? 847  ASP A C     1 
ATOM   6468  O  O     . ASP A 1  847  ? 35.874  -56.240  47.544  1.00 73.72  ? 847  ASP A O     1 
ATOM   6469  C  CB    . ASP A 1  847  ? 36.406  -53.487  46.661  1.00 75.77  ? 847  ASP A CB    1 
ATOM   6470  C  CG    . ASP A 1  847  ? 36.848  -52.660  47.859  1.00 93.13  ? 847  ASP A CG    1 
ATOM   6471  O  OD1   . ASP A 1  847  ? 36.158  -51.662  48.183  1.00 93.68  ? 847  ASP A OD1   1 
ATOM   6472  O  OD2   . ASP A 1  847  ? 37.892  -52.999  48.463  1.00 102.17 ? 847  ASP A OD2   1 
ATOM   6473  N  N     . ILE A 1  848  ? 34.162  -55.401  48.747  1.00 67.12  ? 848  ILE A N     1 
ATOM   6474  C  CA    . ILE A 1  848  ? 34.127  -56.555  49.632  1.00 66.26  ? 848  ILE A CA    1 
ATOM   6475  C  C     . ILE A 1  848  ? 33.241  -57.637  49.009  1.00 67.31  ? 848  ILE A C     1 
ATOM   6476  O  O     . ILE A 1  848  ? 32.067  -57.392  48.728  1.00 65.46  ? 848  ILE A O     1 
ATOM   6477  C  CB    . ILE A 1  848  ? 33.777  -56.165  51.100  1.00 68.99  ? 848  ILE A CB    1 
ATOM   6478  C  CG1   . ILE A 1  848  ? 34.938  -55.377  51.747  1.00 70.70  ? 848  ILE A CG1   1 
ATOM   6479  C  CG2   . ILE A 1  848  ? 33.468  -57.384  51.947  1.00 69.35  ? 848  ILE A CG2   1 
ATOM   6480  C  CD1   . ILE A 1  848  ? 34.534  -54.133  52.476  1.00 77.49  ? 848  ILE A CD1   1 
ATOM   6481  N  N     . MET A 1  849  ? 33.842  -58.804  48.722  1.00 63.88  ? 849  MET A N     1 
ATOM   6482  C  CA    . MET A 1  849  ? 33.153  -59.949  48.129  1.00 63.31  ? 849  MET A CA    1 
ATOM   6483  C  C     . MET A 1  849  ? 33.676  -61.292  48.632  1.00 66.99  ? 849  MET A C     1 
ATOM   6484  O  O     . MET A 1  849  ? 34.809  -61.382  49.101  1.00 67.45  ? 849  MET A O     1 
ATOM   6485  C  CB    . MET A 1  849  ? 33.135  -59.879  46.585  1.00 66.31  ? 849  MET A CB    1 
ATOM   6486  C  CG    . MET A 1  849  ? 34.388  -60.410  45.890  1.00 72.00  ? 849  MET A CG    1 
ATOM   6487  S  SD    . MET A 1  849  ? 34.051  -60.948  44.184  1.00 77.07  ? 849  MET A SD    1 
ATOM   6488  C  CE    . MET A 1  849  ? 35.521  -61.885  43.829  1.00 75.64  ? 849  MET A CE    1 
ATOM   6489  N  N     . VAL A 1  850  ? 32.844  -62.336  48.513  1.00 62.69  ? 850  VAL A N     1 
ATOM   6490  C  CA    . VAL A 1  850  ? 33.168  -63.710  48.893  1.00 62.70  ? 850  VAL A CA    1 
ATOM   6491  C  C     . VAL A 1  850  ? 34.052  -64.314  47.786  1.00 67.37  ? 850  VAL A C     1 
ATOM   6492  O  O     . VAL A 1  850  ? 33.615  -64.427  46.643  1.00 66.92  ? 850  VAL A O     1 
ATOM   6493  C  CB    . VAL A 1  850  ? 31.872  -64.532  49.147  1.00 65.39  ? 850  VAL A CB    1 
ATOM   6494  C  CG1   . VAL A 1  850  ? 32.171  -66.018  49.327  1.00 66.23  ? 850  VAL A CG1   1 
ATOM   6495  C  CG2   . VAL A 1  850  ? 31.108  -63.992  50.349  1.00 63.77  ? 850  VAL A CG2   1 
ATOM   6496  N  N     . HIS A 1  851  ? 35.297  -64.662  48.120  1.00 65.14  ? 851  HIS A N     1 
ATOM   6497  C  CA    . HIS A 1  851  ? 36.228  -65.253  47.161  1.00 67.02  ? 851  HIS A CA    1 
ATOM   6498  C  C     . HIS A 1  851  ? 36.076  -66.780  47.100  1.00 72.78  ? 851  HIS A C     1 
ATOM   6499  O  O     . HIS A 1  851  ? 35.262  -67.344  47.839  1.00 71.60  ? 851  HIS A O     1 
ATOM   6500  C  CB    . HIS A 1  851  ? 37.671  -64.809  47.453  1.00 69.09  ? 851  HIS A CB    1 
ATOM   6501  C  CG    . HIS A 1  851  ? 37.941  -63.375  47.103  1.00 72.26  ? 851  HIS A CG    1 
ATOM   6502  N  ND1   . HIS A 1  851  ? 38.875  -63.033  46.144  1.00 75.33  ? 851  HIS A ND1   1 
ATOM   6503  C  CD2   . HIS A 1  851  ? 37.384  -62.242  47.592  1.00 72.56  ? 851  HIS A CD2   1 
ATOM   6504  C  CE1   . HIS A 1  851  ? 38.859  -61.710  46.084  1.00 74.08  ? 851  HIS A CE1   1 
ATOM   6505  N  NE2   . HIS A 1  851  ? 37.974  -61.191  46.933  1.00 72.77  ? 851  HIS A NE2   1 
ATOM   6506  N  N     . TYR A 1  852  ? 36.832  -67.446  46.205  1.00 71.84  ? 852  TYR A N     1 
ATOM   6507  C  CA    . TYR A 1  852  ? 36.749  -68.896  46.002  1.00 72.94  ? 852  TYR A CA    1 
ATOM   6508  C  C     . TYR A 1  852  ? 37.198  -69.806  47.155  1.00 78.72  ? 852  TYR A C     1 
ATOM   6509  O  O     . TYR A 1  852  ? 36.969  -71.015  47.092  1.00 78.94  ? 852  TYR A O     1 
ATOM   6510  C  CB    . TYR A 1  852  ? 37.326  -69.316  44.637  1.00 75.45  ? 852  TYR A CB    1 
ATOM   6511  C  CG    . TYR A 1  852  ? 36.335  -69.148  43.507  1.00 76.04  ? 852  TYR A CG    1 
ATOM   6512  C  CD1   . TYR A 1  852  ? 36.450  -68.096  42.604  1.00 77.82  ? 852  TYR A CD1   1 
ATOM   6513  C  CD2   . TYR A 1  852  ? 35.268  -70.027  43.354  1.00 76.25  ? 852  TYR A CD2   1 
ATOM   6514  C  CE1   . TYR A 1  852  ? 35.528  -67.925  41.572  1.00 77.96  ? 852  TYR A CE1   1 
ATOM   6515  C  CE2   . TYR A 1  852  ? 34.322  -69.848  42.348  1.00 76.60  ? 852  TYR A CE2   1 
ATOM   6516  C  CZ    . TYR A 1  852  ? 34.467  -68.808  41.445  1.00 83.82  ? 852  TYR A CZ    1 
ATOM   6517  O  OH    . TYR A 1  852  ? 33.540  -68.647  40.441  1.00 83.73  ? 852  TYR A OH    1 
ATOM   6518  N  N     . ASP A 1  853  ? 37.789  -69.228  48.215  1.00 76.35  ? 853  ASP A N     1 
ATOM   6519  C  CA    . ASP A 1  853  ? 38.241  -69.957  49.409  1.00 77.41  ? 853  ASP A CA    1 
ATOM   6520  C  C     . ASP A 1  853  ? 37.291  -69.742  50.600  1.00 80.58  ? 853  ASP A C     1 
ATOM   6521  O  O     . ASP A 1  853  ? 37.673  -69.971  51.753  1.00 80.19  ? 853  ASP A O     1 
ATOM   6522  C  CB    . ASP A 1  853  ? 39.692  -69.570  49.768  1.00 80.72  ? 853  ASP A CB    1 
ATOM   6523  C  CG    . ASP A 1  853  ? 39.976  -68.080  49.843  1.00 91.20  ? 853  ASP A CG    1 
ATOM   6524  O  OD1   . ASP A 1  853  ? 39.068  -67.280  49.514  1.00 90.08  ? 853  ASP A OD1   1 
ATOM   6525  O  OD2   . ASP A 1  853  ? 41.111  -67.712  50.216  1.00 99.05  ? 853  ASP A OD2   1 
ATOM   6526  N  N     . ASN A 1  854  ? 36.039  -69.324  50.296  1.00 76.52  ? 854  ASN A N     1 
ATOM   6527  C  CA    . ASN A 1  854  ? 34.954  -69.023  51.239  1.00 75.13  ? 854  ASN A CA    1 
ATOM   6528  C  C     . ASN A 1  854  ? 35.306  -67.921  52.248  1.00 77.63  ? 854  ASN A C     1 
ATOM   6529  O  O     . ASN A 1  854  ? 34.728  -67.852  53.341  1.00 76.07  ? 854  ASN A O     1 
ATOM   6530  C  CB    . ASN A 1  854  ? 34.388  -70.291  51.900  1.00 78.46  ? 854  ASN A CB    1 
ATOM   6531  C  CG    . ASN A 1  854  ? 33.066  -70.728  51.317  1.00 112.58 ? 854  ASN A CG    1 
ATOM   6532  O  OD1   . ASN A 1  854  ? 32.040  -70.038  51.433  1.00 106.94 ? 854  ASN A OD1   1 
ATOM   6533  N  ND2   . ASN A 1  854  ? 33.059  -71.892  50.683  1.00 109.07 ? 854  ASN A ND2   1 
ATOM   6534  N  N     . THR A 1  855  ? 36.233  -67.035  51.849  1.00 74.25  ? 855  THR A N     1 
ATOM   6535  C  CA    . THR A 1  855  ? 36.675  -65.929  52.681  1.00 73.70  ? 855  THR A CA    1 
ATOM   6536  C  C     . THR A 1  855  ? 36.253  -64.575  52.112  1.00 76.01  ? 855  THR A C     1 
ATOM   6537  O  O     . THR A 1  855  ? 36.283  -64.383  50.894  1.00 76.17  ? 855  THR A O     1 
ATOM   6538  C  CB    . THR A 1  855  ? 38.156  -66.091  53.072  1.00 85.12  ? 855  THR A CB    1 
ATOM   6539  O  OG1   . THR A 1  855  ? 38.396  -65.403  54.296  1.00 88.22  ? 855  THR A OG1   1 
ATOM   6540  C  CG2   . THR A 1  855  ? 39.108  -65.593  52.023  1.00 82.53  ? 855  THR A CG2   1 
ATOM   6541  N  N     . THR A 1  856  ? 35.839  -63.652  53.002  1.00 70.61  ? 856  THR A N     1 
ATOM   6542  C  CA    . THR A 1  856  ? 35.393  -62.298  52.661  1.00 68.92  ? 856  THR A CA    1 
ATOM   6543  C  C     . THR A 1  856  ? 36.620  -61.381  52.569  1.00 73.22  ? 856  THR A C     1 
ATOM   6544  O  O     . THR A 1  856  ? 37.304  -61.157  53.572  1.00 72.47  ? 856  THR A O     1 
ATOM   6545  C  CB    . THR A 1  856  ? 34.334  -61.804  53.666  1.00 72.63  ? 856  THR A CB    1 
ATOM   6546  O  OG1   . THR A 1  856  ? 33.445  -62.863  54.026  1.00 70.84  ? 856  THR A OG1   1 
ATOM   6547  C  CG2   . THR A 1  856  ? 33.535  -60.670  53.134  1.00 69.43  ? 856  THR A CG2   1 
ATOM   6548  N  N     . ARG A 1  857  ? 36.921  -60.896  51.345  1.00 70.92  ? 857  ARG A N     1 
ATOM   6549  C  CA    . ARG A 1  857  ? 38.087  -60.048  51.054  1.00 71.93  ? 857  ARG A CA    1 
ATOM   6550  C  C     . ARG A 1  857  ? 37.765  -58.805  50.202  1.00 76.22  ? 857  ARG A C     1 
ATOM   6551  O  O     . ARG A 1  857  ? 36.821  -58.813  49.406  1.00 75.12  ? 857  ARG A O     1 
ATOM   6552  C  CB    . ARG A 1  857  ? 39.215  -60.865  50.381  1.00 72.36  ? 857  ARG A CB    1 
ATOM   6553  C  CG    . ARG A 1  857  ? 39.778  -62.020  51.202  1.00 79.14  ? 857  ARG A CG    1 
ATOM   6554  C  CD    . ARG A 1  857  ? 41.169  -62.376  50.738  1.00 88.60  ? 857  ARG A CD    1 
ATOM   6555  N  NE    . ARG A 1  857  ? 41.477  -63.799  50.889  1.00 98.45  ? 857  ARG A NE    1 
ATOM   6556  C  CZ    . ARG A 1  857  ? 42.704  -64.314  50.863  1.00 112.15 ? 857  ARG A CZ    1 
ATOM   6557  N  NH1   . ARG A 1  857  ? 43.762  -63.526  50.708  1.00 100.57 ? 857  ARG A NH1   1 
ATOM   6558  N  NH2   . ARG A 1  857  ? 42.883  -65.624  50.988  1.00 95.67  ? 857  ARG A NH2   1 
ATOM   6559  N  N     . ASN A 1  858  ? 38.596  -57.757  50.346  1.00 73.90  ? 858  ASN A N     1 
ATOM   6560  C  CA    . ASN A 1  858  ? 38.483  -56.503  49.599  1.00 73.83  ? 858  ASN A CA    1 
ATOM   6561  C  C     . ASN A 1  858  ? 39.395  -56.478  48.344  1.00 80.02  ? 858  ASN A C     1 
ATOM   6562  O  O     . ASN A 1  858  ? 39.980  -57.507  47.986  1.00 80.40  ? 858  ASN A O     1 
ATOM   6563  C  CB    . ASN A 1  858  ? 38.755  -55.310  50.522  1.00 73.55  ? 858  ASN A CB    1 
ATOM   6564  C  CG    . ASN A 1  858  ? 40.113  -55.316  51.174  1.00 95.27  ? 858  ASN A CG    1 
ATOM   6565  O  OD1   . ASN A 1  858  ? 41.155  -55.488  50.531  1.00 89.53  ? 858  ASN A OD1   1 
ATOM   6566  N  ND2   . ASN A 1  858  ? 40.132  -55.081  52.471  1.00 87.04  ? 858  ASN A ND2   1 
ATOM   6567  N  N     . SER A 1  859  ? 39.527  -55.293  47.700  1.00 77.48  ? 859  SER A N     1 
ATOM   6568  C  CA    . SER A 1  859  ? 40.338  -55.049  46.493  1.00 78.86  ? 859  SER A CA    1 
ATOM   6569  C  C     . SER A 1  859  ? 41.860  -55.291  46.665  1.00 83.78  ? 859  SER A C     1 
ATOM   6570  O  O     . SER A 1  859  ? 42.570  -55.492  45.670  1.00 84.75  ? 859  SER A O     1 
ATOM   6571  C  CB    . SER A 1  859  ? 40.082  -53.643  45.953  1.00 82.50  ? 859  SER A CB    1 
ATOM   6572  O  OG    . SER A 1  859  ? 40.342  -52.640  46.924  1.00 91.62  ? 859  SER A OG    1 
ATOM   6573  N  N     . LEU A 1  860  ? 42.351  -55.255  47.917  1.00 79.29  ? 860  LEU A N     1 
ATOM   6574  C  CA    . LEU A 1  860  ? 43.760  -55.470  48.250  1.00 80.25  ? 860  LEU A CA    1 
ATOM   6575  C  C     . LEU A 1  860  ? 44.008  -56.935  48.614  1.00 83.43  ? 860  LEU A C     1 
ATOM   6576  O  O     . LEU A 1  860  ? 45.163  -57.343  48.797  1.00 84.61  ? 860  LEU A O     1 
ATOM   6577  C  CB    . LEU A 1  860  ? 44.176  -54.557  49.421  1.00 80.27  ? 860  LEU A CB    1 
ATOM   6578  C  CG    . LEU A 1  860  ? 44.199  -53.052  49.153  1.00 84.86  ? 860  LEU A CG    1 
ATOM   6579  C  CD1   . LEU A 1  860  ? 43.896  -52.275  50.419  1.00 84.01  ? 860  LEU A CD1   1 
ATOM   6580  C  CD2   . LEU A 1  860  ? 45.528  -52.615  48.540  1.00 89.27  ? 860  LEU A CD2   1 
ATOM   6581  N  N     . GLY A 1  861  ? 42.919  -57.702  48.711  1.00 77.46  ? 861  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1  861  ? 42.944  -59.110  49.085  1.00 76.84  ? 861  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1  861  ? 43.097  -59.311  50.580  1.00 78.86  ? 861  GLY A C     1 
ATOM   6584  O  O     . GLY A 1  861  ? 43.501  -60.387  51.023  1.00 79.32  ? 861  GLY A O     1 
ATOM   6585  N  N     . ASN A 1  862  ? 42.793  -58.265  51.368  1.00 73.00  ? 862  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1  862  ? 42.870  -58.296  52.824  1.00 71.85  ? 862  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1  862  ? 41.648  -59.028  53.374  1.00 73.22  ? 862  ASN A C     1 
ATOM   6588  O  O     . ASN A 1  862  ? 40.531  -58.800  52.903  1.00 71.56  ? 862  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1  862  ? 42.949  -56.870  53.393  1.00 71.85  ? 862  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1  862  ? 44.178  -56.068  53.008  1.00 94.33  ? 862  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1  862  ? 45.011  -56.467  52.182  1.00 89.54  ? 862  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1  862  ? 44.309  -54.894  53.602  1.00 85.50  ? 862  ASN A ND2   1 
ATOM   6593  N  N     . VAL A 1  863  ? 41.864  -59.918  54.356  1.00 69.13  ? 863  VAL A N     1 
ATOM   6594  C  CA    . VAL A 1  863  ? 40.800  -60.700  54.986  1.00 67.17  ? 863  VAL A CA    1 
ATOM   6595  C  C     . VAL A 1  863  ? 39.950  -59.820  55.900  1.00 70.44  ? 863  VAL A C     1 
ATOM   6596  O  O     . VAL A 1  863  ? 40.484  -59.174  56.805  1.00 70.94  ? 863  VAL A O     1 
ATOM   6597  C  CB    . VAL A 1  863  ? 41.352  -61.965  55.708  1.00 70.97  ? 863  VAL A CB    1 
ATOM   6598  C  CG1   . VAL A 1  863  ? 40.349  -62.544  56.705  1.00 69.34  ? 863  VAL A CG1   1 
ATOM   6599  C  CG2   . VAL A 1  863  ? 41.765  -63.023  54.700  1.00 71.66  ? 863  VAL A CG2   1 
ATOM   6600  N  N     . ILE A 1  864  ? 38.633  -59.788  55.647  1.00 65.30  ? 864  ILE A N     1 
ATOM   6601  C  CA    . ILE A 1  864  ? 37.674  -59.068  56.479  1.00 63.66  ? 864  ILE A CA    1 
ATOM   6602  C  C     . ILE A 1  864  ? 37.064  -60.106  57.425  1.00 67.56  ? 864  ILE A C     1 
ATOM   6603  O  O     . ILE A 1  864  ? 37.084  -59.910  58.642  1.00 67.24  ? 864  ILE A O     1 
ATOM   6604  C  CB    . ILE A 1  864  ? 36.596  -58.333  55.646  1.00 65.63  ? 864  ILE A CB    1 
ATOM   6605  C  CG1   . ILE A 1  864  ? 37.193  -57.481  54.495  1.00 66.76  ? 864  ILE A CG1   1 
ATOM   6606  C  CG2   . ILE A 1  864  ? 35.654  -57.533  56.547  1.00 65.65  ? 864  ILE A CG2   1 
ATOM   6607  C  CD1   . ILE A 1  864  ? 38.046  -56.255  54.890  1.00 75.47  ? 864  ILE A CD1   1 
ATOM   6608  N  N     . GLN A 1  865  ? 36.536  -61.216  56.848  1.00 64.01  ? 865  GLN A N     1 
ATOM   6609  C  CA    . GLN A 1  865  ? 35.935  -62.366  57.537  1.00 63.50  ? 865  GLN A CA    1 
ATOM   6610  C  C     . GLN A 1  865  ? 36.557  -63.652  56.968  1.00 69.40  ? 865  GLN A C     1 
ATOM   6611  O  O     . GLN A 1  865  ? 36.832  -63.715  55.767  1.00 69.06  ? 865  GLN A O     1 
ATOM   6612  C  CB    . GLN A 1  865  ? 34.401  -62.404  57.343  1.00 63.30  ? 865  GLN A CB    1 
ATOM   6613  C  CG    . GLN A 1  865  ? 33.654  -61.159  57.821  1.00 76.82  ? 865  GLN A CG    1 
ATOM   6614  C  CD    . GLN A 1  865  ? 32.177  -61.401  58.026  1.00 95.10  ? 865  GLN A CD    1 
ATOM   6615  O  OE1   . GLN A 1  865  ? 31.404  -61.600  57.079  1.00 89.35  ? 865  GLN A OE1   1 
ATOM   6616  N  NE2   . GLN A 1  865  ? 31.746  -61.345  59.276  1.00 86.86  ? 865  GLN A NE2   1 
ATOM   6617  N  N     . PHE A 1  866  ? 36.774  -64.673  57.822  1.00 67.74  ? 866  PHE A N     1 
ATOM   6618  C  CA    . PHE A 1  866  ? 37.348  -65.967  57.416  1.00 69.04  ? 866  PHE A CA    1 
ATOM   6619  C  C     . PHE A 1  866  ? 36.314  -66.929  56.793  1.00 73.44  ? 866  PHE A C     1 
ATOM   6620  O  O     . PHE A 1  866  ? 36.688  -67.881  56.098  1.00 74.22  ? 866  PHE A O     1 
ATOM   6621  C  CB    . PHE A 1  866  ? 38.138  -66.614  58.567  1.00 71.61  ? 866  PHE A CB    1 
ATOM   6622  C  CG    . PHE A 1  866  ? 39.424  -65.885  58.882  1.00 74.09  ? 866  PHE A CG    1 
ATOM   6623  C  CD1   . PHE A 1  866  ? 39.464  -64.900  59.864  1.00 76.87  ? 866  PHE A CD1   1 
ATOM   6624  C  CD2   . PHE A 1  866  ? 40.595  -66.170  58.185  1.00 77.59  ? 866  PHE A CD2   1 
ATOM   6625  C  CE1   . PHE A 1  866  ? 40.653  -64.215  60.147  1.00 78.76  ? 866  PHE A CE1   1 
ATOM   6626  C  CE2   . PHE A 1  866  ? 41.785  -65.491  58.472  1.00 81.44  ? 866  PHE A CE2   1 
ATOM   6627  C  CZ    . PHE A 1  866  ? 41.805  -64.516  59.449  1.00 79.13  ? 866  PHE A CZ    1 
ATOM   6628  N  N     . ILE A 1  867  ? 35.014  -66.667  57.067  1.00 68.92  ? 867  ILE A N     1 
ATOM   6629  C  CA    . ILE A 1  867  ? 33.801  -67.354  56.581  1.00 67.85  ? 867  ILE A CA    1 
ATOM   6630  C  C     . ILE A 1  867  ? 32.711  -66.278  56.593  1.00 68.70  ? 867  ILE A C     1 
ATOM   6631  O  O     . ILE A 1  867  ? 32.569  -65.594  57.611  1.00 67.65  ? 867  ILE A O     1 
ATOM   6632  C  CB    . ILE A 1  867  ? 33.363  -68.611  57.417  1.00 71.29  ? 867  ILE A CB    1 
ATOM   6633  C  CG1   . ILE A 1  867  ? 34.363  -68.987  58.556  1.00 73.03  ? 867  ILE A CG1   1 
ATOM   6634  C  CG2   . ILE A 1  867  ? 33.074  -69.800  56.495  1.00 72.15  ? 867  ILE A CG2   1 
ATOM   6635  C  CD1   . ILE A 1  867  ? 33.800  -69.848  59.771  1.00 82.33  ? 867  ILE A CD1   1 
ATOM   6636  N  N     . TYR A 1  868  ? 31.977  -66.090  55.474  1.00 63.79  ? 868  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  868  ? 30.925  -65.060  55.379  1.00 62.06  ? 868  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  868  ? 29.850  -65.158  56.466  1.00 64.29  ? 868  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  868  ? 29.145  -66.160  56.579  1.00 63.12  ? 868  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  868  ? 30.317  -64.956  53.960  1.00 62.91  ? 868  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  868  ? 29.159  -63.982  53.831  1.00 63.18  ? 868  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  868  ? 29.308  -62.640  54.172  1.00 64.67  ? 868  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  868  ? 27.929  -64.392  53.329  1.00 63.42  ? 868  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  868  ? 28.243  -61.744  54.070  1.00 64.36  ? 868  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  868  ? 26.865  -63.497  53.193  1.00 63.22  ? 868  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  868  ? 27.025  -62.174  53.571  1.00 68.46  ? 868  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  868  ? 25.984  -61.284  53.436  1.00 65.81  ? 868  TYR A OH    1 
ATOM   6648  N  N     . GLY A 1  869  ? 29.776  -64.109  57.275  1.00 60.76  ? 869  GLY A N     1 
ATOM   6649  C  CA    . GLY A 1  869  ? 28.850  -64.020  58.397  1.00 59.81  ? 869  GLY A CA    1 
ATOM   6650  C  C     . GLY A 1  869  ? 29.106  -65.053  59.476  1.00 63.63  ? 869  GLY A C     1 
ATOM   6651  O  O     . GLY A 1  869  ? 28.194  -65.390  60.227  1.00 62.30  ? 869  GLY A O     1 
ATOM   6652  N  N     . GLU A 1  870  ? 30.354  -65.562  59.555  1.00 61.46  ? 870  GLU A N     1 
ATOM   6653  C  CA    . GLU A 1  870  ? 30.829  -66.560  60.520  1.00 62.15  ? 870  GLU A CA    1 
ATOM   6654  C  C     . GLU A 1  870  ? 30.390  -68.012  60.235  1.00 68.33  ? 870  GLU A C     1 
ATOM   6655  O  O     . GLU A 1  870  ? 30.798  -68.916  60.968  1.00 69.05  ? 870  GLU A O     1 
ATOM   6656  C  CB    . GLU A 1  870  ? 30.593  -66.114  61.984  1.00 62.87  ? 870  GLU A CB    1 
ATOM   6657  C  CG    . GLU A 1  870  ? 31.293  -64.801  62.296  1.00 70.25  ? 870  GLU A CG    1 
ATOM   6658  C  CD    . GLU A 1  870  ? 30.722  -63.919  63.386  1.00 81.57  ? 870  GLU A CD    1 
ATOM   6659  O  OE1   . GLU A 1  870  ? 30.507  -64.414  64.514  1.00 74.30  ? 870  GLU A OE1   1 
ATOM   6660  O  OE2   . GLU A 1  870  ? 30.581  -62.701  63.133  1.00 71.64  ? 870  GLU A OE2   1 
ATOM   6661  N  N     . ASP A 1  871  ? 29.627  -68.246  59.138  1.00 65.47  ? 871  ASP A N     1 
ATOM   6662  C  CA    . ASP A 1  871  ? 29.162  -69.588  58.745  1.00 66.17  ? 871  ASP A CA    1 
ATOM   6663  C  C     . ASP A 1  871  ? 29.341  -69.929  57.262  1.00 70.59  ? 871  ASP A C     1 
ATOM   6664  O  O     . ASP A 1  871  ? 29.244  -71.104  56.897  1.00 71.62  ? 871  ASP A O     1 
ATOM   6665  C  CB    . ASP A 1  871  ? 27.691  -69.811  59.146  1.00 67.33  ? 871  ASP A CB    1 
ATOM   6666  C  CG    . ASP A 1  871  ? 26.663  -69.010  58.357  1.00 74.81  ? 871  ASP A CG    1 
ATOM   6667  O  OD1   . ASP A 1  871  ? 27.067  -68.121  57.578  1.00 75.13  ? 871  ASP A OD1   1 
ATOM   6668  O  OD2   . ASP A 1  871  ? 25.451  -69.215  58.582  1.00 78.99  ? 871  ASP A OD2   1 
ATOM   6669  N  N     . GLY A 1  872  ? 29.508  -68.906  56.427  1.00 65.87  ? 872  GLY A N     1 
ATOM   6670  C  CA    . GLY A 1  872  ? 29.649  -69.062  54.983  1.00 65.87  ? 872  GLY A CA    1 
ATOM   6671  C  C     . GLY A 1  872  ? 28.365  -69.481  54.296  1.00 68.73  ? 872  GLY A C     1 
ATOM   6672  O  O     . GLY A 1  872  ? 28.406  -70.253  53.336  1.00 69.20  ? 872  GLY A O     1 
ATOM   6673  N  N     . MET A 1  873  ? 27.217  -68.972  54.793  1.00 63.73  ? 873  MET A N     1 
ATOM   6674  C  CA    . MET A 1  873  ? 25.872  -69.241  54.277  1.00 62.76  ? 873  MET A CA    1 
ATOM   6675  C  C     . MET A 1  873  ? 25.285  -68.006  53.592  1.00 65.97  ? 873  MET A C     1 
ATOM   6676  O  O     . MET A 1  873  ? 25.553  -66.880  54.031  1.00 64.21  ? 873  MET A O     1 
ATOM   6677  C  CB    . MET A 1  873  ? 24.947  -69.640  55.434  1.00 64.50  ? 873  MET A CB    1 
ATOM   6678  C  CG    . MET A 1  873  ? 24.134  -70.874  55.183  1.00 68.83  ? 873  MET A CG    1 
ATOM   6679  S  SD    . MET A 1  873  ? 25.138  -72.374  55.054  1.00 75.25  ? 873  MET A SD    1 
ATOM   6680  C  CE    . MET A 1  873  ? 25.800  -72.490  56.740  1.00 72.42  ? 873  MET A CE    1 
ATOM   6681  N  N     . ASP A 1  874  ? 24.458  -68.216  52.539  1.00 63.24  ? 874  ASP A N     1 
ATOM   6682  C  CA    . ASP A 1  874  ? 23.766  -67.115  51.866  1.00 62.60  ? 874  ASP A CA    1 
ATOM   6683  C  C     . ASP A 1  874  ? 22.504  -66.791  52.665  1.00 64.61  ? 874  ASP A C     1 
ATOM   6684  O  O     . ASP A 1  874  ? 21.698  -67.688  52.941  1.00 63.79  ? 874  ASP A O     1 
ATOM   6685  C  CB    . ASP A 1  874  ? 23.430  -67.427  50.395  1.00 65.46  ? 874  ASP A CB    1 
ATOM   6686  C  CG    . ASP A 1  874  ? 22.510  -66.392  49.752  1.00 79.72  ? 874  ASP A CG    1 
ATOM   6687  O  OD1   . ASP A 1  874  ? 21.313  -66.698  49.567  1.00 80.52  ? 874  ASP A OD1   1 
ATOM   6688  O  OD2   . ASP A 1  874  ? 22.975  -65.254  49.494  1.00 86.63  ? 874  ASP A OD2   1 
ATOM   6689  N  N     . ALA A 1  875  ? 22.356  -65.503  53.034  1.00 60.06  ? 875  ALA A N     1 
ATOM   6690  C  CA    . ALA A 1  875  ? 21.267  -64.948  53.841  1.00 58.94  ? 875  ALA A CA    1 
ATOM   6691  C  C     . ALA A 1  875  ? 19.836  -65.297  53.414  1.00 63.00  ? 875  ALA A C     1 
ATOM   6692  O  O     . ALA A 1  875  ? 18.979  -65.453  54.285  1.00 61.85  ? 875  ALA A O     1 
ATOM   6693  C  CB    . ALA A 1  875  ? 21.431  -63.452  53.973  1.00 58.80  ? 875  ALA A CB    1 
ATOM   6694  N  N     . ALA A 1  876  ? 19.581  -65.445  52.100  1.00 60.35  ? 876  ALA A N     1 
ATOM   6695  C  CA    . ALA A 1  876  ? 18.257  -65.790  51.586  1.00 60.56  ? 876  ALA A CA    1 
ATOM   6696  C  C     . ALA A 1  876  ? 17.818  -67.212  51.956  1.00 66.59  ? 876  ALA A C     1 
ATOM   6697  O  O     . ALA A 1  876  ? 16.626  -67.441  52.185  1.00 65.82  ? 876  ALA A O     1 
ATOM   6698  C  CB    . ALA A 1  876  ? 18.215  -65.602  50.084  1.00 61.51  ? 876  ALA A CB    1 
ATOM   6699  N  N     . HIS A 1  877  ? 18.782  -68.155  52.051  1.00 65.39  ? 877  HIS A N     1 
ATOM   6700  C  CA    . HIS A 1  877  ? 18.533  -69.564  52.395  1.00 66.73  ? 877  HIS A CA    1 
ATOM   6701  C  C     . HIS A 1  877  ? 18.529  -69.860  53.918  1.00 71.23  ? 877  HIS A C     1 
ATOM   6702  O  O     . HIS A 1  877  ? 18.710  -71.009  54.334  1.00 72.14  ? 877  HIS A O     1 
ATOM   6703  C  CB    . HIS A 1  877  ? 19.536  -70.466  51.667  1.00 68.75  ? 877  HIS A CB    1 
ATOM   6704  C  CG    . HIS A 1  877  ? 19.429  -70.419  50.179  1.00 72.43  ? 877  HIS A CG    1 
ATOM   6705  N  ND1   . HIS A 1  877  ? 18.664  -71.334  49.484  1.00 74.89  ? 877  HIS A ND1   1 
ATOM   6706  C  CD2   . HIS A 1  877  ? 20.009  -69.572  49.301  1.00 73.95  ? 877  HIS A CD2   1 
ATOM   6707  C  CE1   . HIS A 1  877  ? 18.787  -71.005  48.210  1.00 74.48  ? 877  HIS A CE1   1 
ATOM   6708  N  NE2   . HIS A 1  877  ? 19.591  -69.952  48.052  1.00 74.27  ? 877  HIS A NE2   1 
ATOM   6709  N  N     . ILE A 1  878  ? 18.280  -68.828  54.732  1.00 66.36  ? 878  ILE A N     1 
ATOM   6710  C  CA    . ILE A 1  878  ? 18.267  -68.878  56.190  1.00 65.53  ? 878  ILE A CA    1 
ATOM   6711  C  C     . ILE A 1  878  ? 16.870  -68.492  56.712  1.00 67.19  ? 878  ILE A C     1 
ATOM   6712  O  O     . ILE A 1  878  ? 16.164  -67.727  56.053  1.00 66.76  ? 878  ILE A O     1 
ATOM   6713  C  CB    . ILE A 1  878  ? 19.412  -67.925  56.662  1.00 68.61  ? 878  ILE A CB    1 
ATOM   6714  C  CG1   . ILE A 1  878  ? 20.784  -68.616  56.540  1.00 70.12  ? 878  ILE A CG1   1 
ATOM   6715  C  CG2   . ILE A 1  878  ? 19.206  -67.334  58.066  1.00 69.38  ? 878  ILE A CG2   1 
ATOM   6716  C  CD1   . ILE A 1  878  ? 21.958  -67.666  56.425  1.00 79.99  ? 878  ILE A CD1   1 
ATOM   6717  N  N     . GLU A 1  879  ? 16.472  -69.041  57.880  1.00 62.22  ? 879  GLU A N     1 
ATOM   6718  C  CA    . GLU A 1  879  ? 15.203  -68.744  58.557  1.00 60.90  ? 879  GLU A CA    1 
ATOM   6719  C  C     . GLU A 1  879  ? 15.181  -69.152  60.033  1.00 63.39  ? 879  GLU A C     1 
ATOM   6720  O  O     . GLU A 1  879  ? 15.807  -70.144  60.421  1.00 63.03  ? 879  GLU A O     1 
ATOM   6721  C  CB    . GLU A 1  879  ? 13.980  -69.284  57.802  1.00 62.50  ? 879  GLU A CB    1 
ATOM   6722  C  CG    . GLU A 1  879  ? 14.042  -70.759  57.470  1.00 74.21  ? 879  GLU A CG    1 
ATOM   6723  C  CD    . GLU A 1  879  ? 12.973  -71.161  56.481  1.00 98.85  ? 879  GLU A CD    1 
ATOM   6724  O  OE1   . GLU A 1  879  ? 13.290  -71.266  55.273  1.00 97.07  ? 879  GLU A OE1   1 
ATOM   6725  O  OE2   . GLU A 1  879  ? 11.809  -71.340  56.907  1.00 92.36  ? 879  GLU A OE2   1 
ATOM   6726  N  N     . LYS A 1  880  ? 14.458  -68.363  60.849  1.00 58.90  ? 880  LYS A N     1 
ATOM   6727  C  CA    . LYS A 1  880  ? 14.315  -68.543  62.291  1.00 58.69  ? 880  LYS A CA    1 
ATOM   6728  C  C     . LYS A 1  880  ? 13.701  -69.883  62.656  1.00 62.81  ? 880  LYS A C     1 
ATOM   6729  O  O     . LYS A 1  880  ? 12.639  -70.237  62.152  1.00 62.15  ? 880  LYS A O     1 
ATOM   6730  C  CB    . LYS A 1  880  ? 13.513  -67.381  62.902  1.00 60.71  ? 880  LYS A CB    1 
ATOM   6731  C  CG    . LYS A 1  880  ? 14.200  -66.699  64.083  1.00 73.46  ? 880  LYS A CG    1 
ATOM   6732  C  CD    . LYS A 1  880  ? 13.709  -65.253  64.307  1.00 83.01  ? 880  LYS A CD    1 
ATOM   6733  C  CE    . LYS A 1  880  ? 14.487  -64.215  63.510  1.00 93.10  ? 880  LYS A CE    1 
ATOM   6734  N  NZ    . LYS A 1  880  ? 14.153  -62.816  63.909  1.00 98.74  ? 880  LYS A NZ    1 
ATOM   6735  N  N     . GLN A 1  881  ? 14.396  -70.636  63.513  1.00 60.50  ? 881  GLN A N     1 
ATOM   6736  C  CA    . GLN A 1  881  ? 13.957  -71.940  64.021  1.00 61.43  ? 881  GLN A CA    1 
ATOM   6737  C  C     . GLN A 1  881  ? 14.476  -72.198  65.443  1.00 66.00  ? 881  GLN A C     1 
ATOM   6738  O  O     . GLN A 1  881  ? 15.640  -71.916  65.736  1.00 65.08  ? 881  GLN A O     1 
ATOM   6739  C  CB    . GLN A 1  881  ? 14.249  -73.099  63.044  1.00 63.12  ? 881  GLN A CB    1 
ATOM   6740  C  CG    . GLN A 1  881  ? 15.627  -73.073  62.381  1.00 65.74  ? 881  GLN A CG    1 
ATOM   6741  C  CD    . GLN A 1  881  ? 15.664  -73.890  61.111  1.00 71.94  ? 881  GLN A CD    1 
ATOM   6742  O  OE1   . GLN A 1  881  ? 15.083  -74.981  61.013  1.00 63.85  ? 881  GLN A OE1   1 
ATOM   6743  N  NE2   . GLN A 1  881  ? 16.368  -73.383  60.111  1.00 59.84  ? 881  GLN A NE2   1 
ATOM   6744  N  N     . SER A 1  882  ? 13.586  -72.684  66.329  1.00 63.52  ? 882  SER A N     1 
ATOM   6745  C  CA    . SER A 1  882  ? 13.882  -72.941  67.737  1.00 64.11  ? 882  SER A CA    1 
ATOM   6746  C  C     . SER A 1  882  ? 14.844  -74.096  67.984  1.00 70.01  ? 882  SER A C     1 
ATOM   6747  O  O     . SER A 1  882  ? 14.580  -75.224  67.557  1.00 70.39  ? 882  SER A O     1 
ATOM   6748  C  CB    . SER A 1  882  ? 12.596  -73.128  68.542  1.00 67.97  ? 882  SER A CB    1 
ATOM   6749  O  OG    . SER A 1  882  ? 12.141  -74.472  68.551  1.00 77.37  ? 882  SER A OG    1 
ATOM   6750  N  N     . LEU A 1  883  ? 15.948  -73.809  68.704  1.00 67.20  ? 883  LEU A N     1 
ATOM   6751  C  CA    . LEU A 1  883  ? 16.946  -74.798  69.112  1.00 68.28  ? 883  LEU A CA    1 
ATOM   6752  C  C     . LEU A 1  883  ? 16.352  -75.429  70.383  1.00 74.86  ? 883  LEU A C     1 
ATOM   6753  O  O     . LEU A 1  883  ? 16.381  -74.813  71.450  1.00 74.22  ? 883  LEU A O     1 
ATOM   6754  C  CB    . LEU A 1  883  ? 18.300  -74.118  69.408  1.00 67.81  ? 883  LEU A CB    1 
ATOM   6755  C  CG    . LEU A 1  883  ? 18.956  -73.308  68.282  1.00 71.46  ? 883  LEU A CG    1 
ATOM   6756  C  CD1   . LEU A 1  883  ? 19.663  -72.090  68.839  1.00 71.04  ? 883  LEU A CD1   1 
ATOM   6757  C  CD2   . LEU A 1  883  ? 19.950  -74.144  67.507  1.00 74.08  ? 883  LEU A CD2   1 
ATOM   6758  N  N     . ASP A 1  884  ? 15.731  -76.616  70.245  1.00 73.69  ? 884  ASP A N     1 
ATOM   6759  C  CA    . ASP A 1  884  ? 15.014  -77.288  71.334  1.00 75.01  ? 884  ASP A CA    1 
ATOM   6760  C  C     . ASP A 1  884  ? 15.795  -77.734  72.588  1.00 79.56  ? 884  ASP A C     1 
ATOM   6761  O  O     . ASP A 1  884  ? 15.173  -77.951  73.635  1.00 80.48  ? 884  ASP A O     1 
ATOM   6762  C  CB    . ASP A 1  884  ? 14.051  -78.364  70.803  1.00 78.16  ? 884  ASP A CB    1 
ATOM   6763  C  CG    . ASP A 1  884  ? 12.975  -77.837  69.865  1.00 90.69  ? 884  ASP A CG    1 
ATOM   6764  O  OD1   . ASP A 1  884  ? 12.361  -76.788  70.186  1.00 91.01  ? 884  ASP A OD1   1 
ATOM   6765  O  OD2   . ASP A 1  884  ? 12.720  -78.489  68.830  1.00 97.53  ? 884  ASP A OD2   1 
ATOM   6766  N  N     . THR A 1  885  ? 17.134  -77.837  72.509  1.00 74.79  ? 885  THR A N     1 
ATOM   6767  C  CA    . THR A 1  885  ? 17.932  -78.222  73.676  1.00 74.75  ? 885  THR A CA    1 
ATOM   6768  C  C     . THR A 1  885  ? 18.098  -77.103  74.715  1.00 77.09  ? 885  THR A C     1 
ATOM   6769  O  O     . THR A 1  885  ? 18.259  -77.413  75.893  1.00 77.50  ? 885  THR A O     1 
ATOM   6770  C  CB    . THR A 1  885  ? 19.254  -78.915  73.299  1.00 83.18  ? 885  THR A CB    1 
ATOM   6771  O  OG1   . THR A 1  885  ? 19.798  -78.350  72.109  1.00 83.04  ? 885  THR A OG1   1 
ATOM   6772  C  CG2   . THR A 1  885  ? 19.098  -80.403  73.123  1.00 83.16  ? 885  THR A CG2   1 
ATOM   6773  N  N     . ILE A 1  886  ? 18.039  -75.815  74.294  1.00 71.34  ? 886  ILE A N     1 
ATOM   6774  C  CA    . ILE A 1  886  ? 18.221  -74.652  75.185  1.00 69.86  ? 886  ILE A CA    1 
ATOM   6775  C  C     . ILE A 1  886  ? 17.086  -74.405  76.204  1.00 72.91  ? 886  ILE A C     1 
ATOM   6776  O  O     . ILE A 1  886  ? 17.353  -74.065  77.361  1.00 72.24  ? 886  ILE A O     1 
ATOM   6777  C  CB    . ILE A 1  886  ? 18.634  -73.363  74.400  1.00 71.44  ? 886  ILE A CB    1 
ATOM   6778  C  CG1   . ILE A 1  886  ? 19.338  -72.332  75.307  1.00 71.18  ? 886  ILE A CG1   1 
ATOM   6779  C  CG2   . ILE A 1  886  ? 17.461  -72.742  73.637  1.00 71.68  ? 886  ILE A CG2   1 
ATOM   6780  C  CD1   . ILE A 1  886  ? 19.806  -71.033  74.635  1.00 76.52  ? 886  ILE A CD1   1 
ATOM   6781  N  N     . GLY A 1  887  ? 15.846  -74.560  75.758  1.00 69.26  ? 887  GLY A N     1 
ATOM   6782  C  CA    . GLY A 1  887  ? 14.680  -74.269  76.578  1.00 69.36  ? 887  GLY A CA    1 
ATOM   6783  C  C     . GLY A 1  887  ? 14.115  -75.400  77.399  1.00 74.37  ? 887  GLY A C     1 
ATOM   6784  O  O     . GLY A 1  887  ? 14.588  -76.538  77.325  1.00 74.85  ? 887  GLY A O     1 
ATOM   6785  N  N     . GLY A 1  888  ? 13.084  -75.055  78.166  1.00 71.27  ? 888  GLY A N     1 
ATOM   6786  C  CA    . GLY A 1  888  ? 12.330  -75.960  79.025  1.00 72.38  ? 888  GLY A CA    1 
ATOM   6787  C  C     . GLY A 1  888  ? 12.979  -76.266  80.357  1.00 76.22  ? 888  GLY A C     1 
ATOM   6788  O  O     . GLY A 1  888  ? 14.142  -75.925  80.584  1.00 75.07  ? 888  GLY A O     1 
ATOM   6789  N  N     . SER A 1  889  ? 12.222  -76.925  81.246  1.00 74.14  ? 889  SER A N     1 
ATOM   6790  C  CA    . SER A 1  889  ? 12.735  -77.348  82.547  1.00 75.43  ? 889  SER A CA    1 
ATOM   6791  C  C     . SER A 1  889  ? 13.657  -78.565  82.353  1.00 80.55  ? 889  SER A C     1 
ATOM   6792  O  O     . SER A 1  889  ? 13.653  -79.170  81.271  1.00 80.33  ? 889  SER A O     1 
ATOM   6793  C  CB    . SER A 1  889  ? 11.588  -77.673  83.506  1.00 80.28  ? 889  SER A CB    1 
ATOM   6794  O  OG    . SER A 1  889  ? 10.721  -78.688  83.026  1.00 88.61  ? 889  SER A OG    1 
ATOM   6795  N  N     . ASP A 1  890  ? 14.463  -78.909  83.381  1.00 77.32  ? 890  ASP A N     1 
ATOM   6796  C  CA    . ASP A 1  890  ? 15.354  -80.067  83.310  1.00 77.78  ? 890  ASP A CA    1 
ATOM   6797  C  C     . ASP A 1  890  ? 14.533  -81.352  83.162  1.00 82.19  ? 890  ASP A C     1 
ATOM   6798  O  O     . ASP A 1  890  ? 14.901  -82.221  82.370  1.00 82.39  ? 890  ASP A O     1 
ATOM   6799  C  CB    . ASP A 1  890  ? 16.276  -80.135  84.538  1.00 80.61  ? 890  ASP A CB    1 
ATOM   6800  C  CG    . ASP A 1  890  ? 17.313  -79.025  84.622  1.00 92.90  ? 890  ASP A CG    1 
ATOM   6801  O  OD1   . ASP A 1  890  ? 17.855  -78.631  83.559  1.00 92.94  ? 890  ASP A OD1   1 
ATOM   6802  O  OD2   . ASP A 1  890  ? 17.617  -78.578  85.757  1.00 99.13  ? 890  ASP A OD2   1 
ATOM   6803  N  N     . ALA A 1  891  ? 13.383  -81.427  83.874  1.00 78.64  ? 891  ALA A N     1 
ATOM   6804  C  CA    . ALA A 1  891  ? 12.439  -82.550  83.850  1.00 79.50  ? 891  ALA A CA    1 
ATOM   6805  C  C     . ALA A 1  891  ? 11.839  -82.761  82.461  1.00 81.61  ? 891  ALA A C     1 
ATOM   6806  O  O     . ALA A 1  891  ? 11.678  -83.906  82.032  1.00 82.28  ? 891  ALA A O     1 
ATOM   6807  C  CB    . ALA A 1  891  ? 11.329  -82.314  84.860  1.00 81.15  ? 891  ALA A CB    1 
ATOM   6808  N  N     . ALA A 1  892  ? 11.515  -81.650  81.767  1.00 75.42  ? 892  ALA A N     1 
ATOM   6809  C  CA    . ALA A 1  892  ? 10.955  -81.654  80.417  1.00 73.89  ? 892  ALA A CA    1 
ATOM   6810  C  C     . ALA A 1  892  ? 12.017  -82.067  79.413  1.00 74.97  ? 892  ALA A C     1 
ATOM   6811  O  O     . ALA A 1  892  ? 11.693  -82.765  78.449  1.00 74.76  ? 892  ALA A O     1 
ATOM   6812  C  CB    . ALA A 1  892  ? 10.411  -80.278  80.069  1.00 73.37  ? 892  ALA A CB    1 
ATOM   6813  N  N     . PHE A 1  893  ? 13.288  -81.646  79.643  1.00 69.21  ? 893  PHE A N     1 
ATOM   6814  C  CA    . PHE A 1  893  ? 14.413  -82.010  78.781  1.00 68.03  ? 893  PHE A CA    1 
ATOM   6815  C  C     . PHE A 1  893  ? 14.593  -83.513  78.852  1.00 74.40  ? 893  PHE A C     1 
ATOM   6816  O  O     . PHE A 1  893  ? 14.692  -84.159  77.810  1.00 74.79  ? 893  PHE A O     1 
ATOM   6817  C  CB    . PHE A 1  893  ? 15.708  -81.298  79.205  1.00 68.33  ? 893  PHE A CB    1 
ATOM   6818  C  CG    . PHE A 1  893  ? 16.916  -81.656  78.367  1.00 68.89  ? 893  PHE A CG    1 
ATOM   6819  C  CD1   . PHE A 1  893  ? 17.252  -80.909  77.248  1.00 70.13  ? 893  PHE A CD1   1 
ATOM   6820  C  CD2   . PHE A 1  893  ? 17.727  -82.732  78.708  1.00 71.78  ? 893  PHE A CD2   1 
ATOM   6821  C  CE1   . PHE A 1  893  ? 18.379  -81.226  76.489  1.00 70.74  ? 893  PHE A CE1   1 
ATOM   6822  C  CE2   . PHE A 1  893  ? 18.845  -83.059  77.936  1.00 74.31  ? 893  PHE A CE2   1 
ATOM   6823  C  CZ    . PHE A 1  893  ? 19.167  -82.299  76.836  1.00 71.00  ? 893  PHE A CZ    1 
ATOM   6824  N  N     . GLU A 1  894  ? 14.606  -84.064  80.081  1.00 71.95  ? 894  GLU A N     1 
ATOM   6825  C  CA    . GLU A 1  894  ? 14.732  -85.491  80.336  1.00 73.69  ? 894  GLU A CA    1 
ATOM   6826  C  C     . GLU A 1  894  ? 13.569  -86.257  79.688  1.00 78.84  ? 894  GLU A C     1 
ATOM   6827  O  O     . GLU A 1  894  ? 13.819  -87.237  78.985  1.00 79.77  ? 894  GLU A O     1 
ATOM   6828  C  CB    . GLU A 1  894  ? 14.807  -85.757  81.846  1.00 76.25  ? 894  GLU A CB    1 
ATOM   6829  C  CG    . GLU A 1  894  ? 15.137  -87.198  82.198  1.00 91.48  ? 894  GLU A CG    1 
ATOM   6830  C  CD    . GLU A 1  894  ? 15.620  -87.420  83.616  1.00 119.88 ? 894  GLU A CD    1 
ATOM   6831  O  OE1   . GLU A 1  894  ? 14.815  -87.242  84.559  1.00 118.47 ? 894  GLU A OE1   1 
ATOM   6832  O  OE2   . GLU A 1  894  ? 16.801  -87.801  83.783  1.00 117.84 ? 894  GLU A OE2   1 
ATOM   6833  N  N     . LYS A 1  895  ? 12.315  -85.783  79.875  1.00 74.84  ? 895  LYS A N     1 
ATOM   6834  C  CA    . LYS A 1  895  ? 11.130  -86.435  79.310  1.00 75.55  ? 895  LYS A CA    1 
ATOM   6835  C  C     . LYS A 1  895  ? 11.141  -86.486  77.777  1.00 80.24  ? 895  LYS A C     1 
ATOM   6836  O  O     . LYS A 1  895  ? 10.644  -87.453  77.200  1.00 81.18  ? 895  LYS A O     1 
ATOM   6837  C  CB    . LYS A 1  895  ? 9.830   -85.814  79.847  1.00 77.46  ? 895  LYS A CB    1 
ATOM   6838  C  CG    . LYS A 1  895  ? 8.647   -86.787  79.832  1.00 88.25  ? 895  LYS A CG    1 
ATOM   6839  C  CD    . LYS A 1  895  ? 7.328   -86.139  80.240  1.00 95.60  ? 895  LYS A CD    1 
ATOM   6840  C  CE    . LYS A 1  895  ? 6.814   -86.636  81.574  1.00 107.01 ? 895  LYS A CE    1 
ATOM   6841  N  NZ    . LYS A 1  895  ? 6.195   -87.988  81.481  1.00 116.86 ? 895  LYS A NZ    1 
ATOM   6842  N  N     . ARG A 1  896  ? 11.740  -85.472  77.129  1.00 76.11  ? 896  ARG A N     1 
ATOM   6843  C  CA    . ARG A 1  896  ? 11.826  -85.384  75.671  1.00 75.67  ? 896  ARG A CA    1 
ATOM   6844  C  C     . ARG A 1  896  ? 13.021  -86.147  75.065  1.00 81.38  ? 896  ARG A C     1 
ATOM   6845  O  O     . ARG A 1  896  ? 12.892  -86.650  73.945  1.00 81.76  ? 896  ARG A O     1 
ATOM   6846  C  CB    . ARG A 1  896  ? 11.817  -83.907  75.217  1.00 73.64  ? 896  ARG A CB    1 
ATOM   6847  C  CG    . ARG A 1  896  ? 11.862  -83.690  73.699  1.00 82.18  ? 896  ARG A CG    1 
ATOM   6848  C  CD    . ARG A 1  896  ? 11.549  -82.264  73.301  1.00 91.04  ? 896  ARG A CD    1 
ATOM   6849  N  NE    . ARG A 1  896  ? 10.122  -82.094  73.029  1.00 101.64 ? 896  ARG A NE    1 
ATOM   6850  C  CZ    . ARG A 1  896  ? 9.571   -80.974  72.576  1.00 114.43 ? 896  ARG A CZ    1 
ATOM   6851  N  NH1   . ARG A 1  896  ? 10.322  -79.904  72.340  1.00 101.14 ? 896  ARG A NH1   1 
ATOM   6852  N  NH2   . ARG A 1  896  ? 8.263   -80.913  72.356  1.00 98.80  ? 896  ARG A NH2   1 
ATOM   6853  N  N     . TYR A 1  897  ? 14.164  -86.241  75.782  1.00 78.32  ? 897  TYR A N     1 
ATOM   6854  C  CA    . TYR A 1  897  ? 15.376  -86.856  75.223  1.00 78.73  ? 897  TYR A CA    1 
ATOM   6855  C  C     . TYR A 1  897  ? 15.916  -88.166  75.820  1.00 84.36  ? 897  TYR A C     1 
ATOM   6856  O  O     . TYR A 1  897  ? 16.513  -88.954  75.078  1.00 84.79  ? 897  TYR A O     1 
ATOM   6857  C  CB    . TYR A 1  897  ? 16.496  -85.803  75.063  1.00 78.79  ? 897  TYR A CB    1 
ATOM   6858  C  CG    . TYR A 1  897  ? 16.080  -84.597  74.246  1.00 79.36  ? 897  TYR A CG    1 
ATOM   6859  C  CD1   . TYR A 1  897  ? 15.652  -83.425  74.864  1.00 80.53  ? 897  TYR A CD1   1 
ATOM   6860  C  CD2   . TYR A 1  897  ? 16.084  -84.636  72.855  1.00 79.77  ? 897  TYR A CD2   1 
ATOM   6861  C  CE1   . TYR A 1  897  ? 15.239  -82.322  74.116  1.00 80.43  ? 897  TYR A CE1   1 
ATOM   6862  C  CE2   . TYR A 1  897  ? 15.666  -83.543  72.098  1.00 79.17  ? 897  TYR A CE2   1 
ATOM   6863  C  CZ    . TYR A 1  897  ? 15.241  -82.387  72.733  1.00 84.69  ? 897  TYR A CZ    1 
ATOM   6864  O  OH    . TYR A 1  897  ? 14.831  -81.306  71.995  1.00 82.08  ? 897  TYR A OH    1 
ATOM   6865  N  N     . ARG A 1  898  ? 15.745  -88.390  77.135  1.00 81.41  ? 898  ARG A N     1 
ATOM   6866  C  CA    . ARG A 1  898  ? 16.272  -89.581  77.807  1.00 82.72  ? 898  ARG A CA    1 
ATOM   6867  C  C     . ARG A 1  898  ? 15.602  -90.885  77.405  1.00 88.29  ? 898  ARG A C     1 
ATOM   6868  O  O     . ARG A 1  898  ? 14.381  -90.939  77.242  1.00 88.06  ? 898  ARG A O     1 
ATOM   6869  C  CB    . ARG A 1  898  ? 16.271  -89.411  79.342  1.00 83.19  ? 898  ARG A CB    1 
ATOM   6870  C  CG    . ARG A 1  898  ? 17.090  -90.450  80.130  1.00 95.56  ? 898  ARG A CG    1 
ATOM   6871  C  CD    . ARG A 1  898  ? 18.595  -90.278  79.976  1.00 102.87 ? 898  ARG A CD    1 
ATOM   6872  N  NE    . ARG A 1  898  ? 19.352  -91.280  80.730  1.00 107.45 ? 898  ARG A NE    1 
ATOM   6873  C  CZ    . ARG A 1  898  ? 20.193  -92.155  80.187  1.00 120.39 ? 898  ARG A CZ    1 
ATOM   6874  N  NH1   . ARG A 1  898  ? 20.395  -92.168  78.874  1.00 106.10 ? 898  ARG A NH1   1 
ATOM   6875  N  NH2   . ARG A 1  898  ? 20.842  -93.021  80.952  1.00 110.06 ? 898  ARG A NH2   1 
ATOM   6876  N  N     . VAL A 1  899  ? 16.438  -91.932  77.240  1.00 86.07  ? 899  VAL A N     1 
ATOM   6877  C  CA    . VAL A 1  899  ? 16.077  -93.319  76.936  1.00 87.66  ? 899  VAL A CA    1 
ATOM   6878  C  C     . VAL A 1  899  ? 17.015  -94.235  77.690  1.00 92.15  ? 899  VAL A C     1 
ATOM   6879  O  O     . VAL A 1  899  ? 18.185  -94.348  77.319  1.00 92.07  ? 899  VAL A O     1 
ATOM   6880  C  CB    . VAL A 1  899  ? 16.030  -93.693  75.434  1.00 91.87  ? 899  VAL A CB    1 
ATOM   6881  C  CG1   . VAL A 1  899  ? 14.601  -93.926  74.980  1.00 92.12  ? 899  VAL A CG1   1 
ATOM   6882  C  CG2   . VAL A 1  899  ? 16.731  -92.659  74.561  1.00 90.01  ? 899  VAL A CG2   1 
ATOM   6883  N  N     . ASP A 1  900  ? 16.515  -94.852  78.777  1.00 88.92  ? 900  ASP A N     1 
ATOM   6884  C  CA    . ASP A 1  900  ? 17.270  -95.783  79.617  1.00 89.52  ? 900  ASP A CA    1 
ATOM   6885  C  C     . ASP A 1  900  ? 16.696  -97.175  79.368  1.00 93.12  ? 900  ASP A C     1 
ATOM   6886  O  O     . ASP A 1  900  ? 15.689  -97.540  79.980  1.00 93.26  ? 900  ASP A O     1 
ATOM   6887  C  CB    . ASP A 1  900  ? 17.168  -95.382  81.110  1.00 91.45  ? 900  ASP A CB    1 
ATOM   6888  C  CG    . ASP A 1  900  ? 18.298  -95.882  82.002  1.00 105.54 ? 900  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A 1  900  ? 18.395  -97.112  82.210  1.00 108.90 ? 900  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A 1  900  ? 19.041  -95.037  82.551  1.00 110.33 ? 900  ASP A OD2   1 
ATOM   6891  N  N     . LEU A 1  901  ? 17.310  -97.936  78.435  1.00 89.53  ? 901  LEU A N     1 
ATOM   6892  C  CA    . LEU A 1  901  ? 16.868  -99.298  78.089  1.00 91.62  ? 901  LEU A CA    1 
ATOM   6893  C  C     . LEU A 1  901  ? 16.958  -100.231 79.307  1.00 98.25  ? 901  LEU A C     1 
ATOM   6894  O  O     . LEU A 1  901  ? 16.344  -101.299 79.318  1.00 99.63  ? 901  LEU A O     1 
ATOM   6895  C  CB    . LEU A 1  901  ? 17.686  -99.902  76.928  1.00 92.06  ? 901  LEU A CB    1 
ATOM   6896  C  CG    . LEU A 1  901  ? 17.867  -99.094  75.654  1.00 94.54  ? 901  LEU A CG    1 
ATOM   6897  C  CD1   . LEU A 1  901  ? 19.043  -99.609  74.859  1.00 95.11  ? 901  LEU A CD1   1 
ATOM   6898  C  CD2   . LEU A 1  901  ? 16.637  -99.136  74.798  1.00 97.39  ? 901  LEU A CD2   1 
ATOM   6899  N  N     . LEU A 1  902  ? 17.717  -99.804  80.331  1.00 94.90  ? 902  LEU A N     1 
ATOM   6900  C  CA    . LEU A 1  902  ? 17.942  -100.514 81.586  1.00 96.75  ? 902  LEU A CA    1 
ATOM   6901  C  C     . LEU A 1  902  ? 16.947  -100.047 82.680  1.00 101.84 ? 902  LEU A C     1 
ATOM   6902  O  O     . LEU A 1  902  ? 17.279  -100.024 83.870  1.00 101.32 ? 902  LEU A O     1 
ATOM   6903  C  CB    . LEU A 1  902  ? 19.415  -100.340 82.038  1.00 96.35  ? 902  LEU A CB    1 
ATOM   6904  C  CG    . LEU A 1  902  ? 20.500  -100.278 80.944  1.00 100.28 ? 902  LEU A CG    1 
ATOM   6905  C  CD1   . LEU A 1  902  ? 21.801  -99.764  81.499  1.00 99.54  ? 902  LEU A CD1   1 
ATOM   6906  C  CD2   . LEU A 1  902  ? 20.715  -101.621 80.281  1.00 104.77 ? 902  LEU A CD2   1 
ATOM   6907  N  N     . ASN A 1  903  ? 15.713  -99.686  82.251  1.00 99.23  ? 903  ASN A N     1 
ATOM   6908  C  CA    . ASN A 1  903  ? 14.612  -99.204  83.094  1.00 99.06  ? 903  ASN A CA    1 
ATOM   6909  C  C     . ASN A 1  903  ? 13.285  -99.614  82.448  1.00 103.48 ? 903  ASN A C     1 
ATOM   6910  O  O     . ASN A 1  903  ? 12.986  -99.173  81.340  1.00 101.33 ? 903  ASN A O     1 
ATOM   6911  C  CB    . ASN A 1  903  ? 14.689  -97.672  83.242  1.00 96.96  ? 903  ASN A CB    1 
ATOM   6912  C  CG    . ASN A 1  903  ? 13.878  -97.114  84.379  1.00 111.27 ? 903  ASN A CG    1 
ATOM   6913  O  OD1   . ASN A 1  903  ? 12.654  -96.986  84.305  1.00 103.42 ? 903  ASN A OD1   1 
ATOM   6914  N  ND2   . ASN A 1  903  ? 14.555  -96.725  85.442  1.00 101.16 ? 903  ASN A ND2   1 
ATOM   6915  N  N     . THR A 1  904  ? 12.497  -100.462 83.135  1.00 102.63 ? 904  THR A N     1 
ATOM   6916  C  CA    . THR A 1  904  ? 11.207  -100.948 82.626  1.00 104.01 ? 904  THR A CA    1 
ATOM   6917  C  C     . THR A 1  904  ? 10.109  -99.869  82.513  1.00 107.49 ? 904  THR A C     1 
ATOM   6918  O  O     . THR A 1  904  ? 9.015   -100.159 82.022  1.00 107.92 ? 904  THR A O     1 
ATOM   6919  C  CB    . THR A 1  904  ? 10.778  -102.260 83.313  1.00 114.71 ? 904  THR A CB    1 
ATOM   6920  O  OG1   . THR A 1  904  ? 9.674   -102.816 82.595  1.00 115.76 ? 904  THR A OG1   1 
ATOM   6921  C  CG2   . THR A 1  904  ? 10.408  -102.077 84.785  1.00 113.65 ? 904  THR A CG2   1 
ATOM   6922  N  N     . ASP A 1  905  ? 10.416  -98.633  82.953  1.00 102.53 ? 905  ASP A N     1 
ATOM   6923  C  CA    . ASP A 1  905  ? 9.512   -97.485  82.924  1.00 100.97 ? 905  ASP A CA    1 
ATOM   6924  C  C     . ASP A 1  905  ? 10.015  -96.383  81.987  1.00 103.13 ? 905  ASP A C     1 
ATOM   6925  O  O     . ASP A 1  905  ? 9.230   -95.508  81.625  1.00 101.47 ? 905  ASP A O     1 
ATOM   6926  C  CB    . ASP A 1  905  ? 9.328   -96.912  84.347  1.00 102.61 ? 905  ASP A CB    1 
ATOM   6927  C  CG    . ASP A 1  905  ? 8.575   -97.795  85.328  1.00 113.99 ? 905  ASP A CG    1 
ATOM   6928  O  OD1   . ASP A 1  905  ? 8.908   -98.999  85.427  1.00 116.11 ? 905  ASP A OD1   1 
ATOM   6929  O  OD2   . ASP A 1  905  ? 7.707   -97.266  86.053  1.00 119.26 ? 905  ASP A OD2   1 
ATOM   6930  N  N     . HIS A 1  906  ? 11.315  -96.400  81.611  1.00 99.97  ? 906  HIS A N     1 
ATOM   6931  C  CA    . HIS A 1  906  ? 11.898  -95.346  80.769  1.00 98.03  ? 906  HIS A CA    1 
ATOM   6932  C  C     . HIS A 1  906  ? 12.602  -95.776  79.478  1.00 100.95 ? 906  HIS A C     1 
ATOM   6933  O  O     . HIS A 1  906  ? 13.476  -95.060  78.978  1.00 98.35  ? 906  HIS A O     1 
ATOM   6934  C  CB    . HIS A 1  906  ? 12.744  -94.380  81.605  1.00 97.93  ? 906  HIS A CB    1 
ATOM   6935  C  CG    . HIS A 1  906  ? 11.935  -93.631  82.610  1.00 101.59 ? 906  HIS A CG    1 
ATOM   6936  N  ND1   . HIS A 1  906  ? 11.615  -94.190  83.837  1.00 105.22 ? 906  HIS A ND1   1 
ATOM   6937  C  CD2   . HIS A 1  906  ? 11.371  -92.406  82.525  1.00 102.24 ? 906  HIS A CD2   1 
ATOM   6938  C  CE1   . HIS A 1  906  ? 10.882  -93.284  84.462  1.00 104.22 ? 906  HIS A CE1   1 
ATOM   6939  N  NE2   . HIS A 1  906  ? 10.713  -92.191  83.714  1.00 102.78 ? 906  HIS A NE2   1 
ATOM   6940  N  N     . THR A 1  907  ? 12.174  -96.909  78.905  1.00 99.39  ? 907  THR A N     1 
ATOM   6941  C  CA    . THR A 1  907  ? 12.681  -97.404  77.625  1.00 99.55  ? 907  THR A CA    1 
ATOM   6942  C  C     . THR A 1  907  ? 11.840  -96.664  76.549  1.00 102.94 ? 907  THR A C     1 
ATOM   6943  O  O     . THR A 1  907  ? 11.870  -95.431  76.478  1.00 100.88 ? 907  THR A O     1 
ATOM   6944  C  CB    . THR A 1  907  ? 12.570  -98.954  77.560  1.00 109.19 ? 907  THR A CB    1 
ATOM   6945  O  OG1   . THR A 1  907  ? 12.958  -99.526  78.806  1.00 113.13 ? 907  THR A OG1   1 
ATOM   6946  C  CG2   . THR A 1  907  ? 13.408  -99.564  76.449  1.00 106.42 ? 907  THR A CG2   1 
ATOM   6947  N  N     . LEU A 1  908  ? 11.093  -97.422  75.730  1.00 100.56 ? 908  LEU A N     1 
ATOM   6948  C  CA    . LEU A 1  908  ? 10.176  -96.983  74.678  1.00 99.59  ? 908  LEU A CA    1 
ATOM   6949  C  C     . LEU A 1  908  ? 9.323   -98.193  74.361  1.00 106.03 ? 908  LEU A C     1 
ATOM   6950  O  O     . LEU A 1  908  ? 9.867   -99.279  74.143  1.00 106.97 ? 908  LEU A O     1 
ATOM   6951  C  CB    . LEU A 1  908  ? 10.862  -96.430  73.396  1.00 98.00  ? 908  LEU A CB    1 
ATOM   6952  C  CG    . LEU A 1  908  ? 12.382  -96.566  73.193  1.00 102.30 ? 908  LEU A CG    1 
ATOM   6953  C  CD1   . LEU A 1  908  ? 12.769  -97.983  72.787  1.00 104.89 ? 908  LEU A CD1   1 
ATOM   6954  C  CD2   . LEU A 1  908  ? 12.871  -95.589  72.143  1.00 102.02 ? 908  LEU A CD2   1 
ATOM   6955  N  N     . ASP A 1  909  ? 7.993   -98.027  74.408  1.00 103.59 ? 909  ASP A N     1 
ATOM   6956  C  CA    . ASP A 1  909  ? 7.027   -99.103  74.187  1.00 106.17 ? 909  ASP A CA    1 
ATOM   6957  C  C     . ASP A 1  909  ? 7.270   -99.878  72.880  1.00 110.34 ? 909  ASP A C     1 
ATOM   6958  O  O     . ASP A 1  909  ? 7.537   -99.244  71.853  1.00 108.29 ? 909  ASP A O     1 
ATOM   6959  C  CB    . ASP A 1  909  ? 5.587   -98.561  74.251  1.00 108.36 ? 909  ASP A CB    1 
ATOM   6960  C  CG    . ASP A 1  909  ? 4.550   -99.601  74.647  1.00 125.24 ? 909  ASP A CG    1 
ATOM   6961  O  OD1   . ASP A 1  909  ? 3.602   -99.823  73.862  1.00 127.03 ? 909  ASP A OD1   1 
ATOM   6962  O  OD2   . ASP A 1  909  ? 4.687   -100.194 75.743  1.00 133.21 ? 909  ASP A OD2   1 
ATOM   6963  N  N     . PRO A 1  910  ? 7.186   -101.241 72.893  1.00 108.79 ? 910  PRO A N     1 
ATOM   6964  C  CA    . PRO A 1  910  ? 7.401   -102.017 71.652  1.00 109.69 ? 910  PRO A CA    1 
ATOM   6965  C  C     . PRO A 1  910  ? 6.444   -101.685 70.507  1.00 113.57 ? 910  PRO A C     1 
ATOM   6966  O  O     . PRO A 1  910  ? 6.597   -102.207 69.403  1.00 114.12 ? 910  PRO A O     1 
ATOM   6967  C  CB    . PRO A 1  910  ? 7.237   -103.470 72.112  1.00 114.31 ? 910  PRO A CB    1 
ATOM   6968  C  CG    . PRO A 1  910  ? 6.406   -103.382 73.333  1.00 119.18 ? 910  PRO A CG    1 
ATOM   6969  C  CD    . PRO A 1  910  ? 6.882   -102.141 74.020  1.00 112.16 ? 910  PRO A CD    1 
ATOM   6970  N  N     . SER A 1  911  ? 5.465   -100.809 70.780  1.00 109.03 ? 911  SER A N     1 
ATOM   6971  C  CA    . SER A 1  911  ? 4.476   -100.328 69.829  1.00 108.42 ? 911  SER A CA    1 
ATOM   6972  C  C     . SER A 1  911  ? 5.076   -99.274  68.898  1.00 109.84 ? 911  SER A C     1 
ATOM   6973  O  O     . SER A 1  911  ? 4.520   -99.038  67.824  1.00 109.24 ? 911  SER A O     1 
ATOM   6974  C  CB    . SER A 1  911  ? 3.277   -99.747  70.571  1.00 111.92 ? 911  SER A CB    1 
ATOM   6975  O  OG    . SER A 1  911  ? 3.685   -98.744  71.487  1.00 118.45 ? 911  SER A OG    1 
ATOM   6976  N  N     . LEU A 1  912  ? 6.195   -98.633  69.307  1.00 104.60 ? 912  LEU A N     1 
ATOM   6977  C  CA    . LEU A 1  912  ? 6.853   -97.596  68.506  1.00 102.22 ? 912  LEU A CA    1 
ATOM   6978  C  C     . LEU A 1  912  ? 8.236   -97.971  67.930  1.00 106.96 ? 912  LEU A C     1 
ATOM   6979  O  O     . LEU A 1  912  ? 8.959   -97.098  67.444  1.00 105.04 ? 912  LEU A O     1 
ATOM   6980  C  CB    . LEU A 1  912  ? 6.846   -96.216  69.209  1.00 99.74  ? 912  LEU A CB    1 
ATOM   6981  C  CG    . LEU A 1  912  ? 7.637   -96.054  70.499  1.00 103.69 ? 912  LEU A CG    1 
ATOM   6982  C  CD1   . LEU A 1  912  ? 8.481   -94.813  70.449  1.00 100.88 ? 912  LEU A CD1   1 
ATOM   6983  C  CD2   . LEU A 1  912  ? 6.713   -95.969  71.685  1.00 107.56 ? 912  LEU A CD2   1 
ATOM   6984  N  N     . LEU A 1  913  ? 8.579   -99.269  67.947  1.00 105.89 ? 913  LEU A N     1 
ATOM   6985  C  CA    . LEU A 1  913  ? 9.855   -99.779  67.441  1.00 106.25 ? 913  LEU A CA    1 
ATOM   6986  C  C     . LEU A 1  913  ? 9.707   -101.245 67.057  1.00 113.64 ? 913  LEU A C     1 
ATOM   6987  O  O     . LEU A 1  913  ? 9.023   -101.994 67.758  1.00 115.40 ? 913  LEU A O     1 
ATOM   6988  C  CB    . LEU A 1  913  ? 10.946  -99.615  68.525  1.00 105.69 ? 913  LEU A CB    1 
ATOM   6989  C  CG    . LEU A 1  913  ? 12.398  -99.922  68.144  1.00 110.55 ? 913  LEU A CG    1 
ATOM   6990  C  CD1   . LEU A 1  913  ? 13.016  -98.782  67.378  1.00 108.48 ? 913  LEU A CD1   1 
ATOM   6991  C  CD2   . LEU A 1  913  ? 13.231  -100.164 69.377  1.00 113.24 ? 913  LEU A CD2   1 
ATOM   6992  N  N     . GLU A 1  914  ? 10.361  -101.656 65.954  1.00 110.71 ? 914  GLU A N     1 
ATOM   6993  C  CA    . GLU A 1  914  ? 10.358  -103.037 65.450  1.00 113.20 ? 914  GLU A CA    1 
ATOM   6994  C  C     . GLU A 1  914  ? 11.064  -103.970 66.448  1.00 119.01 ? 914  GLU A C     1 
ATOM   6995  O  O     . GLU A 1  914  ? 10.631  -105.108 66.654  1.00 120.94 ? 914  GLU A O     1 
ATOM   6996  C  CB    . GLU A 1  914  ? 11.076  -103.102 64.091  1.00 114.34 ? 914  GLU A CB    1 
ATOM   6997  C  CG    . GLU A 1  914  ? 10.538  -104.165 63.155  1.00 125.57 ? 914  GLU A CG    1 
ATOM   6998  C  CD    . GLU A 1  914  ? 9.407   -103.706 62.257  1.00 144.93 ? 914  GLU A CD    1 
ATOM   6999  O  OE1   . GLU A 1  914  ? 9.591   -103.729 61.018  1.00 138.94 ? 914  GLU A OE1   1 
ATOM   7000  O  OE2   . GLU A 1  914  ? 8.336   -103.332 62.786  1.00 139.67 ? 914  GLU A OE2   1 
ATOM   7001  N  N     . SER A 1  915  ? 12.149  -103.463 67.065  1.00 114.25 ? 915  SER A N     1 
ATOM   7002  C  CA    . SER A 1  915  ? 12.993  -104.161 68.033  1.00 115.27 ? 915  SER A CA    1 
ATOM   7003  C  C     . SER A 1  915  ? 12.641  -103.801 69.496  1.00 118.04 ? 915  SER A C     1 
ATOM   7004  O  O     . SER A 1  915  ? 13.483  -103.937 70.386  1.00 117.78 ? 915  SER A O     1 
ATOM   7005  C  CB    . SER A 1  915  ? 14.465  -103.874 67.731  1.00 118.06 ? 915  SER A CB    1 
ATOM   7006  O  OG    . SER A 1  915  ? 14.701  -102.500 67.462  1.00 123.35 ? 915  SER A OG    1 
ATOM   7007  N  N     . GLY A 1  916  ? 11.388  -103.396 69.716  1.00 113.39 ? 916  GLY A N     1 
ATOM   7008  C  CA    . GLY A 1  916  ? 10.842  -102.962 71.002  1.00 112.21 ? 916  GLY A CA    1 
ATOM   7009  C  C     . GLY A 1  916  ? 11.203  -103.756 72.243  1.00 115.88 ? 916  GLY A C     1 
ATOM   7010  O  O     . GLY A 1  916  ? 12.052  -103.325 73.030  1.00 114.36 ? 916  GLY A O     1 
ATOM   7011  N  N     . SER A 1  917  ? 10.539  -104.909 72.440  1.00 113.63 ? 917  SER A N     1 
ATOM   7012  C  CA    . SER A 1  917  ? 10.765  -105.797 73.590  1.00 114.65 ? 917  SER A CA    1 
ATOM   7013  C  C     . SER A 1  917  ? 12.138  -106.477 73.526  1.00 117.30 ? 917  SER A C     1 
ATOM   7014  O  O     . SER A 1  917  ? 12.662  -106.920 74.548  1.00 117.38 ? 917  SER A O     1 
ATOM   7015  C  CB    . SER A 1  917  ? 9.651   -106.836 73.687  1.00 120.94 ? 917  SER A CB    1 
ATOM   7016  O  OG    . SER A 1  917  ? 9.308   -107.344 72.408  1.00 131.05 ? 917  SER A OG    1 
ATOM   7017  N  N     . GLU A 1  918  ? 12.714  -106.531 72.313  1.00 112.39 ? 918  GLU A N     1 
ATOM   7018  C  CA    . GLU A 1  918  ? 14.019  -107.103 71.988  1.00 112.24 ? 918  GLU A CA    1 
ATOM   7019  C  C     . GLU A 1  918  ? 15.157  -106.221 72.517  1.00 110.05 ? 918  GLU A C     1 
ATOM   7020  O  O     . GLU A 1  918  ? 16.239  -106.731 72.817  1.00 110.35 ? 918  GLU A O     1 
ATOM   7021  C  CB    . GLU A 1  918  ? 14.127  -107.245 70.454  1.00 114.08 ? 918  GLU A CB    1 
ATOM   7022  C  CG    . GLU A 1  918  ? 15.212  -108.193 69.962  1.00 128.58 ? 918  GLU A CG    1 
ATOM   7023  C  CD    . GLU A 1  918  ? 15.411  -108.274 68.457  1.00 151.09 ? 918  GLU A CD    1 
ATOM   7024  O  OE1   . GLU A 1  918  ? 16.133  -109.198 68.016  1.00 154.83 ? 918  GLU A OE1   1 
ATOM   7025  O  OE2   . GLU A 1  918  ? 14.862  -107.422 67.720  1.00 138.06 ? 918  GLU A OE2   1 
ATOM   7026  N  N     . ILE A 1  919  ? 14.912  -104.907 72.629  1.00 101.07 ? 919  ILE A N     1 
ATOM   7027  C  CA    . ILE A 1  919  ? 15.918  -103.946 73.056  1.00 97.59  ? 919  ILE A CA    1 
ATOM   7028  C  C     . ILE A 1  919  ? 16.045  -103.683 74.572  1.00 99.06  ? 919  ILE A C     1 
ATOM   7029  O  O     . ILE A 1  919  ? 17.004  -103.030 74.991  1.00 97.15  ? 919  ILE A O     1 
ATOM   7030  C  CB    . ILE A 1  919  ? 15.885  -102.680 72.150  1.00 97.94  ? 919  ILE A CB    1 
ATOM   7031  C  CG1   . ILE A 1  919  ? 17.286  -102.134 71.837  1.00 97.17  ? 919  ILE A CG1   1 
ATOM   7032  C  CG2   . ILE A 1  919  ? 14.887  -101.615 72.601  1.00 96.34  ? 919  ILE A CG2   1 
ATOM   7033  C  CD1   . ILE A 1  919  ? 18.092  -103.020 70.865  1.00 107.55 ? 919  ILE A CD1   1 
ATOM   7034  N  N     . LEU A 1  920  ? 15.107  -104.211 75.390  1.00 95.69  ? 920  LEU A N     1 
ATOM   7035  C  CA    . LEU A 1  920  ? 15.116  -104.051 76.854  1.00 94.99  ? 920  LEU A CA    1 
ATOM   7036  C  C     . LEU A 1  920  ? 16.389  -104.623 77.482  1.00 99.31  ? 920  LEU A C     1 
ATOM   7037  O  O     . LEU A 1  920  ? 16.770  -105.757 77.191  1.00 100.54 ? 920  LEU A O     1 
ATOM   7038  C  CB    . LEU A 1  920  ? 13.898  -104.751 77.489  1.00 96.79  ? 920  LEU A CB    1 
ATOM   7039  C  CG    . LEU A 1  920  ? 12.972  -103.940 78.408  1.00 100.15 ? 920  LEU A CG    1 
ATOM   7040  C  CD1   . LEU A 1  920  ? 11.894  -104.833 78.992  1.00 102.40 ? 920  LEU A CD1   1 
ATOM   7041  C  CD2   . LEU A 1  920  ? 13.725  -103.273 79.550  1.00 101.19 ? 920  LEU A CD2   1 
ATOM   7042  N  N     . GLY A 1  921  ? 17.034  -103.822 78.321  1.00 94.84  ? 921  GLY A N     1 
ATOM   7043  C  CA    . GLY A 1  921  ? 18.241  -104.206 79.046  1.00 95.52  ? 921  GLY A CA    1 
ATOM   7044  C  C     . GLY A 1  921  ? 19.518  -104.348 78.240  1.00 99.63  ? 921  GLY A C     1 
ATOM   7045  O  O     . GLY A 1  921  ? 20.552  -104.716 78.808  1.00 99.71  ? 921  GLY A O     1 
ATOM   7046  N  N     . ASP A 1  922  ? 19.470  -104.048 76.919  1.00 95.90  ? 922  ASP A N     1 
ATOM   7047  C  CA    . ASP A 1  922  ? 20.615  -104.134 76.006  1.00 95.85  ? 922  ASP A CA    1 
ATOM   7048  C  C     . ASP A 1  922  ? 21.682  -103.104 76.407  1.00 98.30  ? 922  ASP A C     1 
ATOM   7049  O  O     . ASP A 1  922  ? 21.596  -101.931 76.040  1.00 95.62  ? 922  ASP A O     1 
ATOM   7050  C  CB    . ASP A 1  922  ? 20.159  -103.959 74.541  1.00 97.24  ? 922  ASP A CB    1 
ATOM   7051  C  CG    . ASP A 1  922  ? 21.061  -104.590 73.491  1.00 109.26 ? 922  ASP A CG    1 
ATOM   7052  O  OD1   . ASP A 1  922  ? 22.303  -104.471 73.621  1.00 109.80 ? 922  ASP A OD1   1 
ATOM   7053  O  OD2   . ASP A 1  922  ? 20.524  -105.138 72.500  1.00 115.67 ? 922  ASP A OD2   1 
ATOM   7054  N  N     . LEU A 1  923  ? 22.657  -103.553 77.213  1.00 96.29  ? 923  LEU A N     1 
ATOM   7055  C  CA    . LEU A 1  923  ? 23.744  -102.727 77.748  1.00 94.73  ? 923  LEU A CA    1 
ATOM   7056  C  C     . LEU A 1  923  ? 24.669  -102.169 76.664  1.00 98.59  ? 923  LEU A C     1 
ATOM   7057  O  O     . LEU A 1  923  ? 24.887  -100.954 76.626  1.00 95.93  ? 923  LEU A O     1 
ATOM   7058  C  CB    . LEU A 1  923  ? 24.525  -103.490 78.825  1.00 96.15  ? 923  LEU A CB    1 
ATOM   7059  C  CG    . LEU A 1  923  ? 23.704  -103.845 80.053  1.00 101.40 ? 923  LEU A CG    1 
ATOM   7060  C  CD1   . LEU A 1  923  ? 23.702  -105.322 80.298  1.00 104.47 ? 923  LEU A CD1   1 
ATOM   7061  C  CD2   . LEU A 1  923  ? 24.163  -103.078 81.263  1.00 102.71 ? 923  LEU A CD2   1 
ATOM   7062  N  N     . LYS A 1  924  ? 25.152  -103.043 75.745  1.00 97.18  ? 924  LYS A N     1 
ATOM   7063  C  CA    . LYS A 1  924  ? 26.036  -102.694 74.618  1.00 96.26  ? 924  LYS A CA    1 
ATOM   7064  C  C     . LYS A 1  924  ? 25.388  -101.658 73.676  1.00 97.45  ? 924  LYS A C     1 
ATOM   7065  O  O     . LYS A 1  924  ? 26.072  -101.025 72.868  1.00 96.29  ? 924  LYS A O     1 
ATOM   7066  C  CB    . LYS A 1  924  ? 26.426  -103.967 73.838  1.00 101.13 ? 924  LYS A CB    1 
ATOM   7067  C  CG    . LYS A 1  924  ? 27.761  -103.857 73.107  1.00 115.00 ? 924  LYS A CG    1 
ATOM   7068  C  CD    . LYS A 1  924  ? 27.994  -105.020 72.151  1.00 127.06 ? 924  LYS A CD    1 
ATOM   7069  C  CE    . LYS A 1  924  ? 29.111  -104.746 71.170  1.00 137.94 ? 924  LYS A CE    1 
ATOM   7070  N  NZ    . LYS A 1  924  ? 28.731  -103.720 70.157  1.00 145.13 ? 924  LYS A NZ    1 
ATOM   7071  N  N     . LEU A 1  925  ? 24.069  -101.485 73.810  1.00 92.59  ? 925  LEU A N     1 
ATOM   7072  C  CA    . LEU A 1  925  ? 23.246  -100.576 73.026  1.00 90.07  ? 925  LEU A CA    1 
ATOM   7073  C  C     . LEU A 1  925  ? 22.995  -99.272  73.773  1.00 91.87  ? 925  LEU A C     1 
ATOM   7074  O  O     . LEU A 1  925  ? 22.991  -98.212  73.152  1.00 89.51  ? 925  LEU A O     1 
ATOM   7075  C  CB    . LEU A 1  925  ? 21.920  -101.285 72.738  1.00 90.90  ? 925  LEU A CB    1 
ATOM   7076  C  CG    . LEU A 1  925  ? 21.302  -101.191 71.360  1.00 94.33  ? 925  LEU A CG    1 
ATOM   7077  C  CD1   . LEU A 1  925  ? 20.404  -100.038 71.276  1.00 92.00  ? 925  LEU A CD1   1 
ATOM   7078  C  CD2   . LEU A 1  925  ? 22.332  -101.245 70.239  1.00 96.53  ? 925  LEU A CD2   1 
ATOM   7079  N  N     . GLN A 1  926  ? 22.802  -99.347  75.106  1.00 89.22  ? 926  GLN A N     1 
ATOM   7080  C  CA    . GLN A 1  926  ? 22.571  -98.179  75.959  1.00 87.35  ? 926  GLN A CA    1 
ATOM   7081  C  C     . GLN A 1  926  ? 23.789  -97.261  76.016  1.00 91.11  ? 926  GLN A C     1 
ATOM   7082  O  O     . GLN A 1  926  ? 23.633  -96.082  76.317  1.00 89.06  ? 926  GLN A O     1 
ATOM   7083  C  CB    . GLN A 1  926  ? 22.142  -98.595  77.373  1.00 89.36  ? 926  GLN A CB    1 
ATOM   7084  C  CG    . GLN A 1  926  ? 20.767  -98.075  77.779  1.00 95.11  ? 926  GLN A CG    1 
ATOM   7085  C  CD    . GLN A 1  926  ? 20.773  -96.647  78.249  1.00 105.91 ? 926  GLN A CD    1 
ATOM   7086  O  OE1   . GLN A 1  926  ? 20.835  -95.706  77.463  1.00 98.46  ? 926  GLN A OE1   1 
ATOM   7087  N  NE2   . GLN A 1  926  ? 20.677  -96.455  79.547  1.00 100.60 ? 926  GLN A NE2   1 
ATOM   7088  N  N     . VAL A 1  927  ? 24.988  -97.789  75.693  1.00 89.48  ? 927  VAL A N     1 
ATOM   7089  C  CA    . VAL A 1  927  ? 26.240  -97.030  75.653  1.00 88.74  ? 927  VAL A CA    1 
ATOM   7090  C  C     . VAL A 1  927  ? 26.193  -95.955  74.548  1.00 90.52  ? 927  VAL A C     1 
ATOM   7091  O  O     . VAL A 1  927  ? 26.803  -94.896  74.697  1.00 88.50  ? 927  VAL A O     1 
ATOM   7092  C  CB    . VAL A 1  927  ? 27.489  -97.959  75.592  1.00 95.13  ? 927  VAL A CB    1 
ATOM   7093  C  CG1   . VAL A 1  927  ? 27.722  -98.533  74.195  1.00 95.86  ? 927  VAL A CG1   1 
ATOM   7094  C  CG2   . VAL A 1  927  ? 28.738  -97.254  76.112  1.00 94.50  ? 927  VAL A CG2   1 
ATOM   7095  N  N     . LEU A 1  928  ? 25.423  -96.222  73.475  1.00 87.54  ? 928  LEU A N     1 
ATOM   7096  C  CA    . LEU A 1  928  ? 25.201  -95.309  72.352  1.00 85.91  ? 928  LEU A CA    1 
ATOM   7097  C  C     . LEU A 1  928  ? 24.188  -94.242  72.747  1.00 87.78  ? 928  LEU A C     1 
ATOM   7098  O  O     . LEU A 1  928  ? 24.417  -93.062  72.484  1.00 85.39  ? 928  LEU A O     1 
ATOM   7099  C  CB    . LEU A 1  928  ? 24.698  -96.078  71.121  1.00 87.04  ? 928  LEU A CB    1 
ATOM   7100  C  CG    . LEU A 1  928  ? 25.766  -96.755  70.278  1.00 93.33  ? 928  LEU A CG    1 
ATOM   7101  C  CD1   . LEU A 1  928  ? 26.054  -98.182  70.768  1.00 96.15  ? 928  LEU A CD1   1 
ATOM   7102  C  CD2   . LEU A 1  928  ? 25.361  -96.769  68.824  1.00 95.70  ? 928  LEU A CD2   1 
ATOM   7103  N  N     . LEU A 1  929  ? 23.075  -94.661  73.390  1.00 85.07  ? 929  LEU A N     1 
ATOM   7104  C  CA    . LEU A 1  929  ? 22.008  -93.781  73.870  1.00 83.67  ? 929  LEU A CA    1 
ATOM   7105  C  C     . LEU A 1  929  ? 22.477  -92.869  74.998  1.00 87.57  ? 929  LEU A C     1 
ATOM   7106  O  O     . LEU A 1  929  ? 21.968  -91.752  75.128  1.00 85.49  ? 929  LEU A O     1 
ATOM   7107  C  CB    . LEU A 1  929  ? 20.789  -94.593  74.318  1.00 84.87  ? 929  LEU A CB    1 
ATOM   7108  C  CG    . LEU A 1  929  ? 19.898  -95.143  73.215  1.00 90.05  ? 929  LEU A CG    1 
ATOM   7109  C  CD1   . LEU A 1  929  ? 18.776  -95.963  73.792  1.00 91.47  ? 929  LEU A CD1   1 
ATOM   7110  C  CD2   . LEU A 1  929  ? 19.317  -94.023  72.355  1.00 90.73  ? 929  LEU A CD2   1 
ATOM   7111  N  N     . ASP A 1  930  ? 23.442  -93.350  75.813  1.00 85.81  ? 930  ASP A N     1 
ATOM   7112  C  CA    . ASP A 1  930  ? 24.058  -92.579  76.888  1.00 85.26  ? 930  ASP A CA    1 
ATOM   7113  C  C     . ASP A 1  930  ? 24.966  -91.535  76.245  1.00 87.80  ? 930  ASP A C     1 
ATOM   7114  O  O     . ASP A 1  930  ? 24.966  -90.391  76.693  1.00 86.58  ? 930  ASP A O     1 
ATOM   7115  C  CB    . ASP A 1  930  ? 24.863  -93.482  77.850  1.00 89.33  ? 930  ASP A CB    1 
ATOM   7116  C  CG    . ASP A 1  930  ? 24.087  -94.095  79.017  1.00 103.69 ? 930  ASP A CG    1 
ATOM   7117  O  OD1   . ASP A 1  930  ? 22.832  -94.064  78.985  1.00 105.02 ? 930  ASP A OD1   1 
ATOM   7118  O  OD2   . ASP A 1  930  ? 24.738  -94.619  79.956  1.00 108.99 ? 930  ASP A OD2   1 
ATOM   7119  N  N     . GLU A 1  931  ? 25.699  -91.918  75.168  1.00 84.34  ? 931  GLU A N     1 
ATOM   7120  C  CA    . GLU A 1  931  ? 26.594  -91.029  74.412  1.00 82.90  ? 931  GLU A CA    1 
ATOM   7121  C  C     . GLU A 1  931  ? 25.791  -89.952  73.681  1.00 82.58  ? 931  GLU A C     1 
ATOM   7122  O  O     . GLU A 1  931  ? 26.230  -88.802  73.617  1.00 79.62  ? 931  GLU A O     1 
ATOM   7123  C  CB    . GLU A 1  931  ? 27.458  -91.828  73.421  1.00 86.00  ? 931  GLU A CB    1 
ATOM   7124  C  CG    . GLU A 1  931  ? 28.679  -91.065  72.927  1.00 101.02 ? 931  GLU A CG    1 
ATOM   7125  C  CD    . GLU A 1  931  ? 29.459  -91.715  71.799  1.00 130.61 ? 931  GLU A CD    1 
ATOM   7126  O  OE1   . GLU A 1  931  ? 30.114  -92.754  72.047  1.00 124.91 ? 931  GLU A OE1   1 
ATOM   7127  O  OE2   . GLU A 1  931  ? 29.456  -91.152  70.679  1.00 126.96 ? 931  GLU A OE2   1 
ATOM   7128  N  N     . GLU A 1  932  ? 24.613  -90.342  73.146  1.00 79.24  ? 932  GLU A N     1 
ATOM   7129  C  CA    . GLU A 1  932  ? 23.648  -89.493  72.444  1.00 77.74  ? 932  GLU A CA    1 
ATOM   7130  C  C     . GLU A 1  932  ? 23.130  -88.404  73.401  1.00 80.55  ? 932  GLU A C     1 
ATOM   7131  O  O     . GLU A 1  932  ? 23.123  -87.223  73.040  1.00 78.87  ? 932  GLU A O     1 
ATOM   7132  C  CB    . GLU A 1  932  ? 22.470  -90.351  71.925  1.00 80.09  ? 932  GLU A CB    1 
ATOM   7133  C  CG    . GLU A 1  932  ? 21.430  -89.583  71.111  1.00 90.71  ? 932  GLU A CG    1 
ATOM   7134  C  CD    . GLU A 1  932  ? 19.962  -89.765  71.468  1.00 108.56 ? 932  GLU A CD    1 
ATOM   7135  O  OE1   . GLU A 1  932  ? 19.117  -89.615  70.555  1.00 93.41  ? 932  GLU A OE1   1 
ATOM   7136  O  OE2   . GLU A 1  932  ? 19.649  -90.006  72.658  1.00 102.27 ? 932  GLU A OE2   1 
ATOM   7137  N  N     . TYR A 1  933  ? 22.706  -88.816  74.618  1.00 77.14  ? 933  TYR A N     1 
ATOM   7138  C  CA    . TYR A 1  933  ? 22.169  -87.949  75.667  1.00 75.50  ? 933  TYR A CA    1 
ATOM   7139  C  C     . TYR A 1  933  ? 23.235  -87.022  76.239  1.00 77.45  ? 933  TYR A C     1 
ATOM   7140  O  O     . TYR A 1  933  ? 22.951  -85.844  76.464  1.00 75.08  ? 933  TYR A O     1 
ATOM   7141  C  CB    . TYR A 1  933  ? 21.524  -88.797  76.774  1.00 77.86  ? 933  TYR A CB    1 
ATOM   7142  C  CG    . TYR A 1  933  ? 20.722  -88.004  77.783  1.00 78.52  ? 933  TYR A CG    1 
ATOM   7143  C  CD1   . TYR A 1  933  ? 19.423  -87.590  77.501  1.00 79.92  ? 933  TYR A CD1   1 
ATOM   7144  C  CD2   . TYR A 1  933  ? 21.241  -87.714  79.040  1.00 79.13  ? 933  TYR A CD2   1 
ATOM   7145  C  CE1   . TYR A 1  933  ? 18.676  -86.871  78.432  1.00 80.41  ? 933  TYR A CE1   1 
ATOM   7146  C  CE2   . TYR A 1  933  ? 20.499  -87.007  79.984  1.00 79.45  ? 933  TYR A CE2   1 
ATOM   7147  C  CZ    . TYR A 1  933  ? 19.214  -86.592  79.679  1.00 87.15  ? 933  TYR A CZ    1 
ATOM   7148  O  OH    . TYR A 1  933  ? 18.483  -85.898  80.612  1.00 88.77  ? 933  TYR A OH    1 
ATOM   7149  N  N     . LYS A 1  934  ? 24.461  -87.548  76.455  1.00 75.19  ? 934  LYS A N     1 
ATOM   7150  C  CA    . LYS A 1  934  ? 25.607  -86.795  76.980  1.00 74.79  ? 934  LYS A CA    1 
ATOM   7151  C  C     . LYS A 1  934  ? 25.984  -85.660  76.025  1.00 78.11  ? 934  LYS A C     1 
ATOM   7152  O  O     . LYS A 1  934  ? 26.397  -84.584  76.475  1.00 77.22  ? 934  LYS A O     1 
ATOM   7153  C  CB    . LYS A 1  934  ? 26.807  -87.720  77.228  1.00 78.62  ? 934  LYS A CB    1 
ATOM   7154  C  CG    . LYS A 1  934  ? 27.607  -87.353  78.464  1.00 93.24  ? 934  LYS A CG    1 
ATOM   7155  C  CD    . LYS A 1  934  ? 28.422  -88.538  78.979  1.00 105.85 ? 934  LYS A CD    1 
ATOM   7156  C  CE    . LYS A 1  934  ? 29.007  -88.267  80.348  1.00 115.23 ? 934  LYS A CE    1 
ATOM   7157  N  NZ    . LYS A 1  934  ? 29.654  -89.474  80.924  1.00 123.52 ? 934  LYS A NZ    1 
ATOM   7158  N  N     . GLN A 1  935  ? 25.807  -85.894  74.708  1.00 74.08  ? 935  GLN A N     1 
ATOM   7159  C  CA    . GLN A 1  935  ? 26.062  -84.884  73.688  1.00 72.39  ? 935  GLN A CA    1 
ATOM   7160  C  C     . GLN A 1  935  ? 24.977  -83.807  73.727  1.00 75.80  ? 935  GLN A C     1 
ATOM   7161  O  O     . GLN A 1  935  ? 25.283  -82.630  73.531  1.00 74.21  ? 935  GLN A O     1 
ATOM   7162  C  CB    . GLN A 1  935  ? 26.180  -85.518  72.295  1.00 73.83  ? 935  GLN A CB    1 
ATOM   7163  C  CG    . GLN A 1  935  ? 26.678  -84.571  71.198  1.00 75.30  ? 935  GLN A CG    1 
ATOM   7164  C  CD    . GLN A 1  935  ? 27.800  -83.663  71.642  1.00 75.77  ? 935  GLN A CD    1 
ATOM   7165  O  OE1   . GLN A 1  935  ? 28.946  -84.081  71.819  1.00 69.77  ? 935  GLN A OE1   1 
ATOM   7166  N  NE2   . GLN A 1  935  ? 27.483  -82.400  71.837  1.00 58.21  ? 935  GLN A NE2   1 
ATOM   7167  N  N     . LEU A 1  936  ? 23.719  -84.210  74.013  1.00 73.05  ? 936  LEU A N     1 
ATOM   7168  C  CA    . LEU A 1  936  ? 22.578  -83.297  74.127  1.00 71.65  ? 936  LEU A CA    1 
ATOM   7169  C  C     . LEU A 1  936  ? 22.691  -82.425  75.389  1.00 74.82  ? 936  LEU A C     1 
ATOM   7170  O  O     . LEU A 1  936  ? 22.274  -81.261  75.365  1.00 72.54  ? 936  LEU A O     1 
ATOM   7171  C  CB    . LEU A 1  936  ? 21.236  -84.052  74.087  1.00 72.33  ? 936  LEU A CB    1 
ATOM   7172  C  CG    . LEU A 1  936  ? 20.905  -84.838  72.808  1.00 77.86  ? 936  LEU A CG    1 
ATOM   7173  C  CD1   . LEU A 1  936  ? 19.728  -85.743  73.025  1.00 78.83  ? 936  LEU A CD1   1 
ATOM   7174  C  CD2   . LEU A 1  936  ? 20.613  -83.920  71.639  1.00 79.71  ? 936  LEU A CD2   1 
ATOM   7175  N  N     . VAL A 1  937  ? 23.281  -82.973  76.477  1.00 72.74  ? 937  VAL A N     1 
ATOM   7176  C  CA    . VAL A 1  937  ? 23.495  -82.177  77.687  1.00 72.41  ? 937  VAL A CA    1 
ATOM   7177  C  C     . VAL A 1  937  ? 24.657  -81.197  77.496  1.00 76.18  ? 937  VAL A C     1 
ATOM   7178  O  O     . VAL A 1  937  ? 24.597  -80.090  78.036  1.00 75.65  ? 937  VAL A O     1 
ATOM   7179  C  CB    . VAL A 1  937  ? 23.507  -82.929  79.042  1.00 77.43  ? 937  VAL A CB    1 
ATOM   7180  C  CG1   . VAL A 1  937  ? 22.228  -83.740  79.237  1.00 77.96  ? 937  VAL A CG1   1 
ATOM   7181  C  CG2   . VAL A 1  937  ? 24.748  -83.800  79.206  1.00 78.47  ? 937  VAL A CG2   1 
ATOM   7182  N  N     . LYS A 1  938  ? 25.680  -81.579  76.675  1.00 72.29  ? 938  LYS A N     1 
ATOM   7183  C  CA    . LYS A 1  938  ? 26.811  -80.706  76.329  1.00 71.17  ? 938  LYS A CA    1 
ATOM   7184  C  C     . LYS A 1  938  ? 26.236  -79.499  75.579  1.00 73.21  ? 938  LYS A C     1 
ATOM   7185  O  O     . LYS A 1  938  ? 26.604  -78.361  75.882  1.00 71.50  ? 938  LYS A O     1 
ATOM   7186  C  CB    . LYS A 1  938  ? 27.855  -81.446  75.451  1.00 74.50  ? 938  LYS A CB    1 
ATOM   7187  C  CG    . LYS A 1  938  ? 29.090  -80.592  75.059  1.00 89.71  ? 938  LYS A CG    1 
ATOM   7188  C  CD    . LYS A 1  938  ? 29.272  -80.328  73.518  1.00 97.29  ? 938  LYS A CD    1 
ATOM   7189  C  CE    . LYS A 1  938  ? 28.620  -79.054  72.970  1.00 95.31  ? 938  LYS A CE    1 
ATOM   7190  N  NZ    . LYS A 1  938  ? 28.896  -78.813  71.518  1.00 86.68  ? 938  LYS A NZ    1 
ATOM   7191  N  N     . ASP A 1  939  ? 25.306  -79.774  74.622  1.00 69.92  ? 939  ASP A N     1 
ATOM   7192  C  CA    . ASP A 1  939  ? 24.608  -78.812  73.767  1.00 68.62  ? 939  ASP A CA    1 
ATOM   7193  C  C     . ASP A 1  939  ? 23.831  -77.796  74.575  1.00 70.36  ? 939  ASP A C     1 
ATOM   7194  O  O     . ASP A 1  939  ? 24.058  -76.599  74.399  1.00 68.77  ? 939  ASP A O     1 
ATOM   7195  C  CB    . ASP A 1  939  ? 23.661  -79.535  72.792  1.00 71.38  ? 939  ASP A CB    1 
ATOM   7196  C  CG    . ASP A 1  939  ? 24.315  -80.124  71.558  1.00 87.33  ? 939  ASP A CG    1 
ATOM   7197  O  OD1   . ASP A 1  939  ? 25.561  -80.288  71.562  1.00 89.45  ? 939  ASP A OD1   1 
ATOM   7198  O  OD2   . ASP A 1  939  ? 23.579  -80.441  70.591  1.00 93.23  ? 939  ASP A OD2   1 
ATOM   7199  N  N     . ARG A 1  940  ? 22.931  -78.268  75.474  1.00 66.44  ? 940  ARG A N     1 
ATOM   7200  C  CA    . ARG A 1  940  ? 22.120  -77.412  76.347  1.00 65.15  ? 940  ARG A CA    1 
ATOM   7201  C  C     . ARG A 1  940  ? 23.031  -76.422  77.076  1.00 67.43  ? 940  ARG A C     1 
ATOM   7202  O  O     . ARG A 1  940  ? 22.786  -75.217  77.004  1.00 65.26  ? 940  ARG A O     1 
ATOM   7203  C  CB    . ARG A 1  940  ? 21.304  -78.266  77.331  1.00 65.26  ? 940  ARG A CB    1 
ATOM   7204  C  CG    . ARG A 1  940  ? 20.344  -77.487  78.224  1.00 69.42  ? 940  ARG A CG    1 
ATOM   7205  C  CD    . ARG A 1  940  ? 19.402  -78.457  78.892  1.00 73.96  ? 940  ARG A CD    1 
ATOM   7206  N  NE    . ARG A 1  940  ? 18.589  -77.846  79.941  1.00 75.20  ? 940  ARG A NE    1 
ATOM   7207  C  CZ    . ARG A 1  940  ? 17.289  -77.602  79.836  1.00 81.99  ? 940  ARG A CZ    1 
ATOM   7208  N  NH1   . ARG A 1  940  ? 16.640  -77.894  78.717  1.00 64.92  ? 940  ARG A NH1   1 
ATOM   7209  N  NH2   . ARG A 1  940  ? 16.625  -77.068  80.848  1.00 69.81  ? 940  ARG A NH2   1 
ATOM   7210  N  N     . LYS A 1  941  ? 24.130  -76.933  77.681  1.00 64.77  ? 941  LYS A N     1 
ATOM   7211  C  CA    . LYS A 1  941  ? 25.137  -76.135  78.379  1.00 64.61  ? 941  LYS A CA    1 
ATOM   7212  C  C     . LYS A 1  941  ? 25.768  -75.114  77.432  1.00 67.24  ? 941  LYS A C     1 
ATOM   7213  O  O     . LYS A 1  941  ? 25.877  -73.943  77.801  1.00 66.86  ? 941  LYS A O     1 
ATOM   7214  C  CB    . LYS A 1  941  ? 26.216  -77.032  79.006  1.00 68.65  ? 941  LYS A CB    1 
ATOM   7215  C  CG    . LYS A 1  941  ? 27.166  -76.292  79.951  1.00 88.36  ? 941  LYS A CG    1 
ATOM   7216  C  CD    . LYS A 1  941  ? 28.506  -77.006  80.068  1.00 102.07 ? 941  LYS A CD    1 
ATOM   7217  C  CE    . LYS A 1  941  ? 29.512  -76.219  80.869  1.00 115.07 ? 941  LYS A CE    1 
ATOM   7218  N  NZ    . LYS A 1  941  ? 30.865  -76.835  80.809  1.00 126.15 ? 941  LYS A NZ    1 
ATOM   7219  N  N     . PHE A 1  942  ? 26.154  -75.551  76.214  1.00 62.62  ? 942  PHE A N     1 
ATOM   7220  C  CA    . PHE A 1  942  ? 26.779  -74.690  75.214  1.00 61.23  ? 942  PHE A CA    1 
ATOM   7221  C  C     . PHE A 1  942  ? 25.850  -73.576  74.733  1.00 64.20  ? 942  PHE A C     1 
ATOM   7222  O  O     . PHE A 1  942  ? 26.245  -72.409  74.766  1.00 63.30  ? 942  PHE A O     1 
ATOM   7223  C  CB    . PHE A 1  942  ? 27.343  -75.509  74.042  1.00 63.20  ? 942  PHE A CB    1 
ATOM   7224  C  CG    . PHE A 1  942  ? 27.904  -74.672  72.919  1.00 63.97  ? 942  PHE A CG    1 
ATOM   7225  C  CD1   . PHE A 1  942  ? 29.087  -73.963  73.082  1.00 67.21  ? 942  PHE A CD1   1 
ATOM   7226  C  CD2   . PHE A 1  942  ? 27.242  -74.581  71.701  1.00 65.58  ? 942  PHE A CD2   1 
ATOM   7227  C  CE1   . PHE A 1  942  ? 29.600  -73.181  72.045  1.00 67.87  ? 942  PHE A CE1   1 
ATOM   7228  C  CE2   . PHE A 1  942  ? 27.757  -73.802  70.662  1.00 67.82  ? 942  PHE A CE2   1 
ATOM   7229  C  CZ    . PHE A 1  942  ? 28.935  -73.113  70.836  1.00 66.16  ? 942  PHE A CZ    1 
ATOM   7230  N  N     . LEU A 1  943  ? 24.619  -73.929  74.305  1.00 60.18  ? 943  LEU A N     1 
ATOM   7231  C  CA    . LEU A 1  943  ? 23.630  -72.959  73.829  1.00 58.45  ? 943  LEU A CA    1 
ATOM   7232  C  C     . LEU A 1  943  ? 23.304  -71.945  74.910  1.00 62.56  ? 943  LEU A C     1 
ATOM   7233  O  O     . LEU A 1  943  ? 23.244  -70.753  74.613  1.00 61.60  ? 943  LEU A O     1 
ATOM   7234  C  CB    . LEU A 1  943  ? 22.333  -73.634  73.359  1.00 58.12  ? 943  LEU A CB    1 
ATOM   7235  C  CG    . LEU A 1  943  ? 22.402  -74.670  72.248  1.00 62.59  ? 943  LEU A CG    1 
ATOM   7236  C  CD1   . LEU A 1  943  ? 21.014  -75.156  71.905  1.00 62.42  ? 943  LEU A CD1   1 
ATOM   7237  C  CD2   . LEU A 1  943  ? 23.096  -74.131  71.008  1.00 64.56  ? 943  LEU A CD2   1 
ATOM   7238  N  N     . ARG A 1  944  ? 23.131  -72.408  76.168  1.00 60.09  ? 944  ARG A N     1 
ATOM   7239  C  CA    . ARG A 1  944  ? 22.826  -71.533  77.300  1.00 60.11  ? 944  ARG A CA    1 
ATOM   7240  C  C     . ARG A 1  944  ? 23.918  -70.495  77.573  1.00 66.73  ? 944  ARG A C     1 
ATOM   7241  O  O     . ARG A 1  944  ? 23.606  -69.423  78.099  1.00 65.73  ? 944  ARG A O     1 
ATOM   7242  C  CB    . ARG A 1  944  ? 22.427  -72.324  78.554  1.00 58.39  ? 944  ARG A CB    1 
ATOM   7243  C  CG    . ARG A 1  944  ? 21.019  -72.876  78.446  1.00 61.41  ? 944  ARG A CG    1 
ATOM   7244  C  CD    . ARG A 1  944  ? 20.476  -73.466  79.722  1.00 66.84  ? 944  ARG A CD    1 
ATOM   7245  N  NE    . ARG A 1  944  ? 19.024  -73.627  79.627  1.00 73.18  ? 944  ARG A NE    1 
ATOM   7246  C  CZ    . ARG A 1  944  ? 18.222  -73.901  80.650  1.00 86.69  ? 944  ARG A CZ    1 
ATOM   7247  N  NH1   . ARG A 1  944  ? 18.719  -74.059  81.870  1.00 73.57  ? 944  ARG A NH1   1 
ATOM   7248  N  NH2   . ARG A 1  944  ? 16.915  -74.014  80.462  1.00 75.01  ? 944  ARG A NH2   1 
ATOM   7249  N  N     . GLU A 1  945  ? 25.182  -70.788  77.174  1.00 65.98  ? 945  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  945  ? 26.277  -69.831  77.334  1.00 66.83  ? 945  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  945  ? 26.455  -68.899  76.143  1.00 70.81  ? 945  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  945  ? 26.891  -67.761  76.329  1.00 70.45  ? 945  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  945  ? 27.588  -70.429  77.895  1.00 69.51  ? 945  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  945  ? 28.217  -71.580  77.130  1.00 84.13  ? 945  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  945  ? 29.228  -72.370  77.946  1.00 116.74 ? 945  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  945  ? 28.896  -73.499  78.376  1.00 114.25 ? 945  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  945  ? 30.345  -71.852  78.175  1.00 116.27 ? 945  GLU A OE2   1 
ATOM   7258  N  N     . VAL A 1  946  ? 26.047  -69.348  74.937  1.00 67.15  ? 946  VAL A N     1 
ATOM   7259  C  CA    . VAL A 1  946  ? 26.077  -68.519  73.728  1.00 66.16  ? 946  VAL A CA    1 
ATOM   7260  C  C     . VAL A 1  946  ? 24.888  -67.551  73.831  1.00 70.57  ? 946  VAL A C     1 
ATOM   7261  O  O     . VAL A 1  946  ? 25.093  -66.340  73.898  1.00 70.28  ? 946  VAL A O     1 
ATOM   7262  C  CB    . VAL A 1  946  ? 26.045  -69.349  72.416  1.00 69.71  ? 946  VAL A CB    1 
ATOM   7263  C  CG1   . VAL A 1  946  ? 26.149  -68.447  71.188  1.00 68.69  ? 946  VAL A CG1   1 
ATOM   7264  C  CG2   . VAL A 1  946  ? 27.150  -70.394  72.398  1.00 70.42  ? 946  VAL A CG2   1 
ATOM   7265  N  N     . PHE A 1  947  ? 23.657  -68.090  73.910  1.00 67.46  ? 947  PHE A N     1 
ATOM   7266  C  CA    . PHE A 1  947  ? 22.434  -67.298  74.037  1.00 67.00  ? 947  PHE A CA    1 
ATOM   7267  C  C     . PHE A 1  947  ? 21.999  -67.228  75.513  1.00 70.20  ? 947  PHE A C     1 
ATOM   7268  O  O     . PHE A 1  947  ? 21.063  -67.917  75.932  1.00 69.79  ? 947  PHE A O     1 
ATOM   7269  C  CB    . PHE A 1  947  ? 21.332  -67.851  73.116  1.00 68.97  ? 947  PHE A CB    1 
ATOM   7270  C  CG    . PHE A 1  947  ? 21.812  -68.234  71.735  1.00 70.93  ? 947  PHE A CG    1 
ATOM   7271  C  CD1   . PHE A 1  947  ? 22.016  -69.565  71.398  1.00 75.26  ? 947  PHE A CD1   1 
ATOM   7272  C  CD2   . PHE A 1  947  ? 22.089  -67.262  70.782  1.00 73.03  ? 947  PHE A CD2   1 
ATOM   7273  C  CE1   . PHE A 1  947  ? 22.462  -69.919  70.120  1.00 76.46  ? 947  PHE A CE1   1 
ATOM   7274  C  CE2   . PHE A 1  947  ? 22.514  -67.616  69.496  1.00 76.05  ? 947  PHE A CE2   1 
ATOM   7275  C  CZ    . PHE A 1  947  ? 22.709  -68.942  69.177  1.00 74.94  ? 947  PHE A CZ    1 
ATOM   7276  N  N     . VAL A 1  948  ? 22.721  -66.384  76.288  1.00 66.31  ? 948  VAL A N     1 
ATOM   7277  C  CA    . VAL A 1  948  ? 22.619  -66.120  77.735  1.00 66.33  ? 948  VAL A CA    1 
ATOM   7278  C  C     . VAL A 1  948  ? 21.189  -65.932  78.270  1.00 70.42  ? 948  VAL A C     1 
ATOM   7279  O  O     . VAL A 1  948  ? 20.839  -66.521  79.301  1.00 70.05  ? 948  VAL A O     1 
ATOM   7280  C  CB    . VAL A 1  948  ? 23.568  -64.960  78.143  1.00 70.00  ? 948  VAL A CB    1 
ATOM   7281  C  CG1   . VAL A 1  948  ? 23.465  -64.633  79.631  1.00 70.54  ? 948  VAL A CG1   1 
ATOM   7282  C  CG2   . VAL A 1  948  ? 25.013  -65.280  77.772  1.00 70.10  ? 948  VAL A CG2   1 
ATOM   7283  N  N     . ASP A 1  949  ? 20.375  -65.115  77.565  1.00 67.20  ? 949  ASP A N     1 
ATOM   7284  C  CA    . ASP A 1  949  ? 18.984  -64.804  77.919  1.00 67.38  ? 949  ASP A CA    1 
ATOM   7285  C  C     . ASP A 1  949  ? 18.062  -66.015  77.817  1.00 71.68  ? 949  ASP A C     1 
ATOM   7286  O  O     . ASP A 1  949  ? 17.022  -66.049  78.467  1.00 70.78  ? 949  ASP A O     1 
ATOM   7287  C  CB    . ASP A 1  949  ? 18.453  -63.641  77.056  1.00 68.84  ? 949  ASP A CB    1 
ATOM   7288  C  CG    . ASP A 1  949  ? 18.381  -63.913  75.560  1.00 85.70  ? 949  ASP A CG    1 
ATOM   7289  O  OD1   . ASP A 1  949  ? 19.288  -64.604  75.031  1.00 87.32  ? 949  ASP A OD1   1 
ATOM   7290  O  OD2   . ASP A 1  949  ? 17.445  -63.398  74.908  1.00 94.20  ? 949  ASP A OD2   1 
ATOM   7291  N  N     . GLY A 1  950  ? 18.461  -66.989  77.005  1.00 69.76  ? 950  GLY A N     1 
ATOM   7292  C  CA    . GLY A 1  950  ? 17.708  -68.211  76.767  1.00 70.65  ? 950  GLY A CA    1 
ATOM   7293  C  C     . GLY A 1  950  ? 16.754  -68.068  75.601  1.00 75.22  ? 950  GLY A C     1 
ATOM   7294  O  O     . GLY A 1  950  ? 15.545  -68.269  75.758  1.00 75.18  ? 950  GLY A O     1 
ATOM   7295  N  N     . GLU A 1  951  ? 17.301  -67.691  74.427  1.00 71.50  ? 951  GLU A N     1 
ATOM   7296  C  CA    . GLU A 1  951  ? 16.541  -67.525  73.191  1.00 70.83  ? 951  GLU A CA    1 
ATOM   7297  C  C     . GLU A 1  951  ? 16.747  -68.745  72.294  1.00 75.53  ? 951  GLU A C     1 
ATOM   7298  O  O     . GLU A 1  951  ? 17.884  -69.081  71.939  1.00 75.74  ? 951  GLU A O     1 
ATOM   7299  C  CB    . GLU A 1  951  ? 16.891  -66.199  72.483  1.00 71.22  ? 951  GLU A CB    1 
ATOM   7300  C  CG    . GLU A 1  951  ? 16.144  -65.927  71.181  1.00 80.75  ? 951  GLU A CG    1 
ATOM   7301  C  CD    . GLU A 1  951  ? 14.627  -66.012  71.153  1.00 105.25 ? 951  GLU A CD    1 
ATOM   7302  O  OE1   . GLU A 1  951  ? 13.980  -65.851  72.213  1.00 99.81  ? 951  GLU A OE1   1 
ATOM   7303  O  OE2   . GLU A 1  951  ? 14.083  -66.200  70.042  1.00 103.62 ? 951  GLU A OE2   1 
ATOM   7304  N  N     . ALA A 1  952  ? 15.637  -69.434  71.980  1.00 71.33  ? 952  ALA A N     1 
ATOM   7305  C  CA    . ALA A 1  952  ? 15.639  -70.648  71.171  1.00 70.60  ? 952  ALA A CA    1 
ATOM   7306  C  C     . ALA A 1  952  ? 15.611  -70.351  69.698  1.00 71.16  ? 952  ALA A C     1 
ATOM   7307  O  O     . ALA A 1  952  ? 16.345  -70.980  68.941  1.00 71.31  ? 952  ALA A O     1 
ATOM   7308  C  CB    . ALA A 1  952  ? 14.452  -71.526  71.542  1.00 72.15  ? 952  ALA A CB    1 
ATOM   7309  N  N     . ASN A 1  953  ? 14.757  -69.402  69.295  1.00 64.65  ? 953  ASN A N     1 
ATOM   7310  C  CA    . ASN A 1  953  ? 14.502  -69.034  67.910  1.00 62.85  ? 953  ASN A CA    1 
ATOM   7311  C  C     . ASN A 1  953  ? 15.605  -68.189  67.293  1.00 64.17  ? 953  ASN A C     1 
ATOM   7312  O  O     . ASN A 1  953  ? 15.782  -67.025  67.652  1.00 63.02  ? 953  ASN A O     1 
ATOM   7313  C  CB    . ASN A 1  953  ? 13.127  -68.390  67.785  1.00 62.39  ? 953  ASN A CB    1 
ATOM   7314  C  CG    . ASN A 1  953  ? 12.089  -69.063  68.650  1.00 86.82  ? 953  ASN A CG    1 
ATOM   7315  O  OD1   . ASN A 1  953  ? 11.436  -70.023  68.240  1.00 85.07  ? 953  ASN A OD1   1 
ATOM   7316  N  ND2   . ASN A 1  953  ? 11.956  -68.612  69.889  1.00 78.57  ? 953  ASN A ND2   1 
ATOM   7317  N  N     . TRP A 1  954  ? 16.367  -68.802  66.379  1.00 59.99  ? 954  TRP A N     1 
ATOM   7318  C  CA    . TRP A 1  954  ? 17.482  -68.166  65.690  1.00 59.29  ? 954  TRP A CA    1 
ATOM   7319  C  C     . TRP A 1  954  ? 17.487  -68.470  64.197  1.00 62.61  ? 954  TRP A C     1 
ATOM   7320  O  O     . TRP A 1  954  ? 17.239  -69.623  63.825  1.00 62.69  ? 954  TRP A O     1 
ATOM   7321  C  CB    . TRP A 1  954  ? 18.809  -68.552  66.341  1.00 58.77  ? 954  TRP A CB    1 
ATOM   7322  C  CG    . TRP A 1  954  ? 18.961  -67.925  67.685  1.00 60.24  ? 954  TRP A CG    1 
ATOM   7323  C  CD1   . TRP A 1  954  ? 18.639  -68.480  68.889  1.00 63.89  ? 954  TRP A CD1   1 
ATOM   7324  C  CD2   . TRP A 1  954  ? 19.318  -66.563  67.953  1.00 59.73  ? 954  TRP A CD2   1 
ATOM   7325  N  NE1   . TRP A 1  954  ? 18.839  -67.567  69.900  1.00 63.37  ? 954  TRP A NE1   1 
ATOM   7326  C  CE2   . TRP A 1  954  ? 19.232  -66.373  69.350  1.00 64.05  ? 954  TRP A CE2   1 
ATOM   7327  C  CE3   . TRP A 1  954  ? 19.716  -65.484  67.148  1.00 60.30  ? 954  TRP A CE3   1 
ATOM   7328  C  CZ2   . TRP A 1  954  ? 19.551  -65.156  69.959  1.00 62.92  ? 954  TRP A CZ2   1 
ATOM   7329  C  CZ3   . TRP A 1  954  ? 20.032  -64.281  67.754  1.00 61.35  ? 954  TRP A CZ3   1 
ATOM   7330  C  CH2   . TRP A 1  954  ? 19.947  -64.125  69.141  1.00 62.30  ? 954  TRP A CH2   1 
ATOM   7331  N  N     . PRO A 1  955  ? 17.747  -67.457  63.321  1.00 58.02  ? 955  PRO A N     1 
ATOM   7332  C  CA    . PRO A 1  955  ? 17.764  -67.729  61.878  1.00 57.54  ? 955  PRO A CA    1 
ATOM   7333  C  C     . PRO A 1  955  ? 18.913  -68.658  61.479  1.00 62.01  ? 955  PRO A C     1 
ATOM   7334  O  O     . PRO A 1  955  ? 20.084  -68.372  61.751  1.00 62.27  ? 955  PRO A O     1 
ATOM   7335  C  CB    . PRO A 1  955  ? 17.794  -66.337  61.242  1.00 58.23  ? 955  PRO A CB    1 
ATOM   7336  C  CG    . PRO A 1  955  ? 18.383  -65.468  62.251  1.00 62.55  ? 955  PRO A CG    1 
ATOM   7337  C  CD    . PRO A 1  955  ? 18.066  -66.040  63.599  1.00 58.78  ? 955  PRO A CD    1 
ATOM   7338  N  N     . LEU A 1  956  ? 18.549  -69.828  60.924  1.00 57.62  ? 956  LEU A N     1 
ATOM   7339  C  CA    . LEU A 1  956  ? 19.490  -70.878  60.550  1.00 57.36  ? 956  LEU A CA    1 
ATOM   7340  C  C     . LEU A 1  956  ? 19.149  -71.508  59.204  1.00 60.26  ? 956  LEU A C     1 
ATOM   7341  O  O     . LEU A 1  956  ? 17.973  -71.508  58.839  1.00 59.19  ? 956  LEU A O     1 
ATOM   7342  C  CB    . LEU A 1  956  ? 19.503  -71.962  61.640  1.00 57.90  ? 956  LEU A CB    1 
ATOM   7343  C  CG    . LEU A 1  956  ? 20.366  -71.681  62.850  1.00 61.64  ? 956  LEU A CG    1 
ATOM   7344  C  CD1   . LEU A 1  956  ? 19.881  -72.466  64.043  1.00 61.98  ? 956  LEU A CD1   1 
ATOM   7345  C  CD2   . LEU A 1  956  ? 21.820  -71.982  62.556  1.00 64.30  ? 956  LEU A CD2   1 
ATOM   7346  N  N     . PRO A 1  957  ? 20.140  -72.074  58.457  1.00 57.05  ? 957  PRO A N     1 
ATOM   7347  C  CA    . PRO A 1  957  ? 19.806  -72.704  57.172  1.00 56.86  ? 957  PRO A CA    1 
ATOM   7348  C  C     . PRO A 1  957  ? 19.081  -74.019  57.398  1.00 59.84  ? 957  PRO A C     1 
ATOM   7349  O  O     . PRO A 1  957  ? 19.161  -74.559  58.499  1.00 59.51  ? 957  PRO A O     1 
ATOM   7350  C  CB    . PRO A 1  957  ? 21.172  -72.912  56.513  1.00 59.31  ? 957  PRO A CB    1 
ATOM   7351  C  CG    . PRO A 1  957  ? 22.113  -73.059  57.638  1.00 64.19  ? 957  PRO A CG    1 
ATOM   7352  C  CD    . PRO A 1  957  ? 21.588  -72.189  58.746  1.00 59.08  ? 957  PRO A CD    1 
ATOM   7353  N  N     . VAL A 1  958  ? 18.353  -74.503  56.372  1.00 56.23  ? 958  VAL A N     1 
ATOM   7354  C  CA    . VAL A 1  958  ? 17.579  -75.755  56.365  1.00 56.95  ? 958  VAL A CA    1 
ATOM   7355  C  C     . VAL A 1  958  ? 16.421  -75.751  57.389  1.00 60.87  ? 958  VAL A C     1 
ATOM   7356  O  O     . VAL A 1  958  ? 16.665  -75.658  58.588  1.00 61.01  ? 958  VAL A O     1 
ATOM   7357  C  CB    . VAL A 1  958  ? 18.486  -77.027  56.465  1.00 61.81  ? 958  VAL A CB    1 
ATOM   7358  C  CG1   . VAL A 1  958  ? 17.668  -78.312  56.479  1.00 62.70  ? 958  VAL A CG1   1 
ATOM   7359  C  CG2   . VAL A 1  958  ? 19.528  -77.066  55.352  1.00 61.80  ? 958  VAL A CG2   1 
ATOM   7360  N  N     . ASN A 1  959  ? 15.170  -75.858  56.917  1.00 57.35  ? 959  ASN A N     1 
ATOM   7361  C  CA    . ASN A 1  959  ? 14.021  -75.933  57.817  1.00 57.22  ? 959  ASN A CA    1 
ATOM   7362  C  C     . ASN A 1  959  ? 13.714  -77.405  58.033  1.00 62.91  ? 959  ASN A C     1 
ATOM   7363  O  O     . ASN A 1  959  ? 13.072  -78.050  57.196  1.00 63.33  ? 959  ASN A O     1 
ATOM   7364  C  CB    . ASN A 1  959  ? 12.807  -75.173  57.281  1.00 56.92  ? 959  ASN A CB    1 
ATOM   7365  C  CG    . ASN A 1  959  ? 11.724  -74.972  58.315  1.00 71.46  ? 959  ASN A CG    1 
ATOM   7366  O  OD1   . ASN A 1  959  ? 10.941  -75.873  58.624  1.00 62.18  ? 959  ASN A OD1   1 
ATOM   7367  N  ND2   . ASN A 1  959  ? 11.668  -73.784  58.884  1.00 62.85  ? 959  ASN A ND2   1 
ATOM   7368  N  N     . ILE A 1  960  ? 14.231  -77.943  59.140  1.00 60.25  ? 960  ILE A N     1 
ATOM   7369  C  CA    . ILE A 1  960  ? 14.081  -79.344  59.514  1.00 61.62  ? 960  ILE A CA    1 
ATOM   7370  C  C     . ILE A 1  960  ? 12.603  -79.717  59.707  1.00 67.76  ? 960  ILE A C     1 
ATOM   7371  O  O     . ILE A 1  960  ? 12.174  -80.759  59.196  1.00 68.77  ? 960  ILE A O     1 
ATOM   7372  C  CB    . ILE A 1  960  ? 15.023  -79.710  60.697  1.00 64.52  ? 960  ILE A CB    1 
ATOM   7373  C  CG1   . ILE A 1  960  ? 16.489  -79.778  60.227  1.00 64.77  ? 960  ILE A CG1   1 
ATOM   7374  C  CG2   . ILE A 1  960  ? 14.640  -81.025  61.344  1.00 66.28  ? 960  ILE A CG2   1 
ATOM   7375  C  CD1   . ILE A 1  960  ? 17.283  -78.535  60.432  1.00 70.35  ? 960  ILE A CD1   1 
ATOM   7376  N  N     . ARG A 1  961  ? 11.816  -78.831  60.367  1.00 63.98  ? 961  ARG A N     1 
ATOM   7377  C  CA    . ARG A 1  961  ? 10.378  -79.035  60.582  1.00 64.09  ? 961  ARG A CA    1 
ATOM   7378  C  C     . ARG A 1  961  ? 9.696   -79.336  59.244  1.00 67.27  ? 961  ARG A C     1 
ATOM   7379  O  O     . ARG A 1  961  ? 9.019   -80.362  59.123  1.00 67.67  ? 961  ARG A O     1 
ATOM   7380  C  CB    . ARG A 1  961  ? 9.746   -77.819  61.289  1.00 63.69  ? 961  ARG A CB    1 
ATOM   7381  C  CG    . ARG A 1  961  ? 8.222   -77.869  61.420  1.00 78.03  ? 961  ARG A CG    1 
ATOM   7382  C  CD    . ARG A 1  961  ? 7.763   -77.675  62.850  1.00 98.12  ? 961  ARG A CD    1 
ATOM   7383  N  NE    . ARG A 1  961  ? 6.414   -77.106  62.923  1.00 114.78 ? 961  ARG A NE    1 
ATOM   7384  C  CZ    . ARG A 1  961  ? 6.147   -75.837  63.223  1.00 132.28 ? 961  ARG A CZ    1 
ATOM   7385  N  NH1   . ARG A 1  961  ? 7.133   -74.988  63.489  1.00 121.69 ? 961  ARG A NH1   1 
ATOM   7386  N  NH2   . ARG A 1  961  ? 4.892   -75.410  63.266  1.00 119.28 ? 961  ARG A NH2   1 
ATOM   7387  N  N     . ARG A 1  962  ? 9.951   -78.489  58.226  1.00 62.60  ? 962  ARG A N     1 
ATOM   7388  C  CA    . ARG A 1  962  ? 9.373   -78.663  56.900  1.00 62.65  ? 962  ARG A CA    1 
ATOM   7389  C  C     . ARG A 1  962  ? 9.766   -79.962  56.231  1.00 67.98  ? 962  ARG A C     1 
ATOM   7390  O  O     . ARG A 1  962  ? 8.893   -80.603  55.655  1.00 69.21  ? 962  ARG A O     1 
ATOM   7391  C  CB    . ARG A 1  962  ? 9.520   -77.426  56.002  1.00 61.22  ? 962  ARG A CB    1 
ATOM   7392  C  CG    . ARG A 1  962  ? 8.511   -76.335  56.378  1.00 70.28  ? 962  ARG A CG    1 
ATOM   7393  C  CD    . ARG A 1  962  ? 8.384   -75.225  55.353  1.00 77.21  ? 962  ARG A CD    1 
ATOM   7394  N  NE    . ARG A 1  962  ? 9.439   -74.213  55.466  1.00 75.96  ? 962  ARG A NE    1 
ATOM   7395  C  CZ    . ARG A 1  962  ? 10.503  -74.145  54.672  1.00 82.62  ? 962  ARG A CZ    1 
ATOM   7396  N  NH1   . ARG A 1  962  ? 10.683  -75.041  53.709  1.00 71.79  ? 962  ARG A NH1   1 
ATOM   7397  N  NH2   . ARG A 1  962  ? 11.399  -73.184  54.837  1.00 59.01  ? 962  ARG A NH2   1 
ATOM   7398  N  N     . ILE A 1  963  ? 11.030  -80.409  56.391  1.00 63.95  ? 963  ILE A N     1 
ATOM   7399  C  CA    . ILE A 1  963  ? 11.488  -81.682  55.820  1.00 65.05  ? 963  ILE A CA    1 
ATOM   7400  C  C     . ILE A 1  963  ? 10.715  -82.852  56.448  1.00 71.82  ? 963  ILE A C     1 
ATOM   7401  O  O     . ILE A 1  963  ? 10.179  -83.689  55.717  1.00 72.41  ? 963  ILE A O     1 
ATOM   7402  C  CB    . ILE A 1  963  ? 13.033  -81.859  55.891  1.00 67.84  ? 963  ILE A CB    1 
ATOM   7403  C  CG1   . ILE A 1  963  ? 13.748  -80.717  55.146  1.00 66.58  ? 963  ILE A CG1   1 
ATOM   7404  C  CG2   . ILE A 1  963  ? 13.475  -83.246  55.358  1.00 70.50  ? 963  ILE A CG2   1 
ATOM   7405  C  CD1   . ILE A 1  963  ? 15.225  -80.673  55.300  1.00 71.48  ? 963  ILE A CD1   1 
ATOM   7406  N  N     . ILE A 1  964  ? 10.623  -82.873  57.794  1.00 69.74  ? 964  ILE A N     1 
ATOM   7407  C  CA    . ILE A 1  964  ? 9.912   -83.909  58.546  1.00 71.53  ? 964  ILE A CA    1 
ATOM   7408  C  C     . ILE A 1  964  ? 8.446   -84.013  58.101  1.00 78.14  ? 964  ILE A C     1 
ATOM   7409  O  O     . ILE A 1  964  ? 8.000   -85.105  57.729  1.00 79.26  ? 964  ILE A O     1 
ATOM   7410  C  CB    . ILE A 1  964  ? 10.137  -83.775  60.090  1.00 73.96  ? 964  ILE A CB    1 
ATOM   7411  C  CG1   . ILE A 1  964  ? 11.360  -84.595  60.537  1.00 75.06  ? 964  ILE A CG1   1 
ATOM   7412  C  CG2   . ILE A 1  964  ? 8.912   -84.182  60.922  1.00 74.99  ? 964  ILE A CG2   1 
ATOM   7413  C  CD1   . ILE A 1  964  ? 12.696  -83.946  60.328  1.00 81.44  ? 964  ILE A CD1   1 
ATOM   7414  N  N     . GLN A 1  965  ? 7.730   -82.871  58.058  1.00 74.62  ? 965  GLN A N     1 
ATOM   7415  C  CA    . GLN A 1  965  ? 6.336   -82.881  57.627  1.00 75.42  ? 965  GLN A CA    1 
ATOM   7416  C  C     . GLN A 1  965  ? 6.155   -83.312  56.164  1.00 80.00  ? 965  GLN A C     1 
ATOM   7417  O  O     . GLN A 1  965  ? 5.147   -83.952  55.844  1.00 80.57  ? 965  GLN A O     1 
ATOM   7418  C  CB    . GLN A 1  965  ? 5.568   -81.598  58.025  1.00 75.63  ? 965  GLN A CB    1 
ATOM   7419  C  CG    . GLN A 1  965  ? 6.144   -80.273  57.521  1.00 85.85  ? 965  GLN A CG    1 
ATOM   7420  C  CD    . GLN A 1  965  ? 5.816   -79.094  58.419  1.00 96.66  ? 965  GLN A CD    1 
ATOM   7421  O  OE1   . GLN A 1  965  ? 5.661   -79.219  59.641  1.00 89.43  ? 965  GLN A OE1   1 
ATOM   7422  N  NE2   . GLN A 1  965  ? 5.748   -77.905  57.836  1.00 86.47  ? 965  GLN A NE2   1 
ATOM   7423  N  N     . ASN A 1  966  ? 7.176   -83.045  55.310  1.00 76.16  ? 966  ASN A N     1 
ATOM   7424  C  CA    . ASN A 1  966  ? 7.186   -83.455  53.904  1.00 76.79  ? 966  ASN A CA    1 
ATOM   7425  C  C     . ASN A 1  966  ? 7.311   -84.967  53.809  1.00 83.46  ? 966  ASN A C     1 
ATOM   7426  O  O     . ASN A 1  966  ? 6.660   -85.562  52.959  1.00 84.55  ? 966  ASN A O     1 
ATOM   7427  C  CB    . ASN A 1  966  ? 8.310   -82.780  53.114  1.00 75.78  ? 966  ASN A CB    1 
ATOM   7428  C  CG    . ASN A 1  966  ? 8.135   -81.300  52.854  1.00 90.62  ? 966  ASN A CG    1 
ATOM   7429  O  OD1   . ASN A 1  966  ? 7.045   -80.724  52.990  1.00 82.70  ? 966  ASN A OD1   1 
ATOM   7430  N  ND2   . ASN A 1  966  ? 9.233   -80.642  52.504  1.00 78.99  ? 966  ASN A ND2   1 
ATOM   7431  N  N     . ALA A 1  967  ? 8.109   -85.591  54.700  1.00 80.79  ? 967  ALA A N     1 
ATOM   7432  C  CA    . ALA A 1  967  ? 8.279   -87.046  54.750  1.00 82.71  ? 967  ALA A CA    1 
ATOM   7433  C  C     . ALA A 1  967  ? 7.001   -87.720  55.234  1.00 87.91  ? 967  ALA A C     1 
ATOM   7434  O  O     . ALA A 1  967  ? 6.608   -88.747  54.680  1.00 88.91  ? 967  ALA A O     1 
ATOM   7435  C  CB    . ALA A 1  967  ? 9.428   -87.409  55.670  1.00 83.64  ? 967  ALA A CB    1 
ATOM   7436  N  N     . GLN A 1  968  ? 6.343   -87.123  56.251  1.00 84.34  ? 968  GLN A N     1 
ATOM   7437  C  CA    . GLN A 1  968  ? 5.094   -87.615  56.842  1.00 85.48  ? 968  GLN A CA    1 
ATOM   7438  C  C     . GLN A 1  968  ? 3.971   -87.714  55.807  1.00 89.94  ? 968  GLN A C     1 
ATOM   7439  O  O     . GLN A 1  968  ? 3.183   -88.660  55.847  1.00 91.31  ? 968  GLN A O     1 
ATOM   7440  C  CB    . GLN A 1  968  ? 4.689   -86.771  58.064  1.00 85.76  ? 968  GLN A CB    1 
ATOM   7441  C  CG    . GLN A 1  968  ? 5.606   -87.002  59.267  1.00 101.11 ? 968  GLN A CG    1 
ATOM   7442  C  CD    . GLN A 1  968  ? 5.097   -86.366  60.534  1.00 119.76 ? 968  GLN A CD    1 
ATOM   7443  O  OE1   . GLN A 1  968  ? 5.253   -85.161  60.761  1.00 112.87 ? 968  GLN A OE1   1 
ATOM   7444  N  NE2   . GLN A 1  968  ? 4.519   -87.177  61.410  1.00 113.58 ? 968  GLN A NE2   1 
ATOM   7445  N  N     . GLN A 1  969  ? 3.945   -86.773  54.849  1.00 85.11  ? 969  GLN A N     1 
ATOM   7446  C  CA    . GLN A 1  969  ? 2.980   -86.756  53.757  1.00 85.48  ? 969  GLN A CA    1 
ATOM   7447  C  C     . GLN A 1  969  ? 3.416   -87.686  52.613  1.00 90.78  ? 969  GLN A C     1 
ATOM   7448  O  O     . GLN A 1  969  ? 2.622   -88.534  52.202  1.00 92.05  ? 969  GLN A O     1 
ATOM   7449  C  CB    . GLN A 1  969  ? 2.755   -85.324  53.255  1.00 84.95  ? 969  GLN A CB    1 
ATOM   7450  C  CG    . GLN A 1  969  ? 1.496   -84.672  53.822  1.00 101.66 ? 969  GLN A CG    1 
ATOM   7451  C  CD    . GLN A 1  969  ? 0.267   -84.904  52.967  1.00 122.55 ? 969  GLN A CD    1 
ATOM   7452  O  OE1   . GLN A 1  969  ? -0.731  -85.471  53.423  1.00 120.81 ? 969  GLN A OE1   1 
ATOM   7453  N  NE2   . GLN A 1  969  ? 0.292   -84.444  51.718  1.00 110.96 ? 969  GLN A NE2   1 
ATOM   7454  N  N     . THR A 1  970  ? 4.676   -87.540  52.121  1.00 86.92  ? 970  THR A N     1 
ATOM   7455  C  CA    . THR A 1  970  ? 5.273   -88.319  51.021  1.00 88.22  ? 970  THR A CA    1 
ATOM   7456  C  C     . THR A 1  970  ? 5.190   -89.827  51.242  1.00 96.69  ? 970  THR A C     1 
ATOM   7457  O  O     . THR A 1  970  ? 4.785   -90.552  50.330  1.00 98.42  ? 970  THR A O     1 
ATOM   7458  C  CB    . THR A 1  970  ? 6.742   -87.882  50.770  1.00 92.39  ? 970  THR A CB    1 
ATOM   7459  O  OG1   . THR A 1  970  ? 6.777   -86.493  50.454  1.00 92.83  ? 970  THR A OG1   1 
ATOM   7460  C  CG2   . THR A 1  970  ? 7.426   -88.666  49.651  1.00 89.59  ? 970  THR A CG2   1 
ATOM   7461  N  N     . PHE A 1  971  ? 5.578   -90.289  52.444  1.00 94.49  ? 971  PHE A N     1 
ATOM   7462  C  CA    . PHE A 1  971  ? 5.652   -91.705  52.785  1.00 97.01  ? 971  PHE A CA    1 
ATOM   7463  C  C     . PHE A 1  971  ? 4.417   -92.307  53.469  1.00 106.61 ? 971  PHE A C     1 
ATOM   7464  O  O     . PHE A 1  971  ? 4.434   -93.492  53.825  1.00 108.45 ? 971  PHE A O     1 
ATOM   7465  C  CB    . PHE A 1  971  ? 6.971   -92.004  53.515  1.00 98.07  ? 971  PHE A CB    1 
ATOM   7466  C  CG    . PHE A 1  971  ? 8.193   -91.651  52.695  1.00 98.17  ? 971  PHE A CG    1 
ATOM   7467  C  CD1   . PHE A 1  971  ? 8.776   -90.391  52.788  1.00 98.80  ? 971  PHE A CD1   1 
ATOM   7468  C  CD2   . PHE A 1  971  ? 8.754   -92.573  51.822  1.00 101.40 ? 971  PHE A CD2   1 
ATOM   7469  C  CE1   . PHE A 1  971  ? 9.900   -90.063  52.025  1.00 98.91  ? 971  PHE A CE1   1 
ATOM   7470  C  CE2   . PHE A 1  971  ? 9.881   -92.246  51.063  1.00 103.53 ? 971  PHE A CE2   1 
ATOM   7471  C  CZ    . PHE A 1  971  ? 10.442  -90.992  51.165  1.00 99.46  ? 971  PHE A CZ    1 
ATOM   7472  N  N     . HIS A 1  972  ? 3.323   -91.514  53.575  1.00 105.41 ? 972  HIS A N     1 
ATOM   7473  C  CA    . HIS A 1  972  ? 2.030   -91.902  54.159  1.00 108.08 ? 972  HIS A CA    1 
ATOM   7474  C  C     . HIS A 1  972  ? 2.187   -92.549  55.545  1.00 115.18 ? 972  HIS A C     1 
ATOM   7475  O  O     . HIS A 1  972  ? 1.683   -93.650  55.794  1.00 116.78 ? 972  HIS A O     1 
ATOM   7476  C  CB    . HIS A 1  972  ? 1.212   -92.771  53.176  1.00 111.38 ? 972  HIS A CB    1 
ATOM   7477  C  CG    . HIS A 1  972  ? 0.683   -92.010  51.998  1.00 114.43 ? 972  HIS A CG    1 
ATOM   7478  N  ND1   . HIS A 1  972  ? 1.523   -91.547  50.995  1.00 115.34 ? 972  HIS A ND1   1 
ATOM   7479  C  CD2   . HIS A 1  972  ? -0.589  -91.661  51.694  1.00 116.71 ? 972  HIS A CD2   1 
ATOM   7480  C  CE1   . HIS A 1  972  ? 0.741   -90.923  50.129  1.00 114.33 ? 972  HIS A CE1   1 
ATOM   7481  N  NE2   . HIS A 1  972  ? -0.538  -90.969  50.504  1.00 115.49 ? 972  HIS A NE2   1 
ATOM   7482  N  N     . ILE A 1  973  ? 2.928   -91.852  56.429  1.00 112.00 ? 973  ILE A N     1 
ATOM   7483  C  CA    . ILE A 1  973  ? 3.229   -92.271  57.799  1.00 113.29 ? 973  ILE A CA    1 
ATOM   7484  C  C     . ILE A 1  973  ? 1.967   -92.353  58.662  1.00 120.05 ? 973  ILE A C     1 
ATOM   7485  O  O     . ILE A 1  973  ? 1.181   -91.401  58.701  1.00 118.80 ? 973  ILE A O     1 
ATOM   7486  C  CB    . ILE A 1  973  ? 4.370   -91.396  58.413  1.00 114.44 ? 973  ILE A CB    1 
ATOM   7487  C  CG1   . ILE A 1  973  ? 5.749   -91.931  57.971  1.00 115.24 ? 973  ILE A CG1   1 
ATOM   7488  C  CG2   . ILE A 1  973  ? 4.289   -91.278  59.957  1.00 114.76 ? 973  ILE A CG2   1 
ATOM   7489  C  CD1   . ILE A 1  973  ? 6.819   -90.887  57.811  1.00 120.39 ? 973  ILE A CD1   1 
ATOM   7490  N  N     . ASP A 1  974  ? 1.769   -93.512  59.319  1.00 119.61 ? 974  ASP A N     1 
ATOM   7491  C  CA    . ASP A 1  974  ? 0.647   -93.744  60.222  1.00 120.79 ? 974  ASP A CA    1 
ATOM   7492  C  C     . ASP A 1  974  ? 1.166   -93.892  61.650  1.00 125.16 ? 974  ASP A C     1 
ATOM   7493  O  O     . ASP A 1  974  ? 2.034   -94.729  61.917  1.00 125.81 ? 974  ASP A O     1 
ATOM   7494  C  CB    . ASP A 1  974  ? -0.227  -94.938  59.772  1.00 125.21 ? 974  ASP A CB    1 
ATOM   7495  C  CG    . ASP A 1  974  ? 0.441   -96.302  59.763  1.00 136.20 ? 974  ASP A CG    1 
ATOM   7496  O  OD1   . ASP A 1  974  ? -0.193  -97.274  60.227  1.00 138.67 ? 974  ASP A OD1   1 
ATOM   7497  O  OD2   . ASP A 1  974  ? 1.585   -96.403  59.265  1.00 141.10 ? 974  ASP A OD2   1 
ATOM   7498  N  N     . HIS A 1  975  ? 0.654   -93.047  62.558  1.00 120.85 ? 975  HIS A N     1 
ATOM   7499  C  CA    . HIS A 1  975  ? 1.033   -93.010  63.975  1.00 120.60 ? 975  HIS A CA    1 
ATOM   7500  C  C     . HIS A 1  975  ? 0.504   -94.237  64.780  1.00 125.38 ? 975  HIS A C     1 
ATOM   7501  O  O     . HIS A 1  975  ? 0.455   -94.192  66.014  1.00 125.08 ? 975  HIS A O     1 
ATOM   7502  C  CB    . HIS A 1  975  ? 0.575   -91.667  64.599  1.00 120.06 ? 975  HIS A CB    1 
ATOM   7503  C  CG    . HIS A 1  975  ? 1.351   -90.457  64.142  1.00 121.36 ? 975  HIS A CG    1 
ATOM   7504  N  ND1   . HIS A 1  975  ? 1.987   -89.619  65.051  1.00 121.66 ? 975  HIS A ND1   1 
ATOM   7505  C  CD2   . HIS A 1  975  ? 1.542   -89.964  62.892  1.00 122.25 ? 975  HIS A CD2   1 
ATOM   7506  C  CE1   . HIS A 1  975  ? 2.556   -88.666  64.327  1.00 119.23 ? 975  HIS A CE1   1 
ATOM   7507  N  NE2   . HIS A 1  975  ? 2.316   -88.830  63.024  1.00 119.80 ? 975  HIS A NE2   1 
ATOM   7508  N  N     . THR A 1  976  ? 0.158   -95.340  64.074  1.00 122.63 ? 976  THR A N     1 
ATOM   7509  C  CA    . THR A 1  976  ? -0.406  -96.581  64.631  1.00 124.46 ? 976  THR A CA    1 
ATOM   7510  C  C     . THR A 1  976  ? 0.458   -97.852  64.415  1.00 128.02 ? 976  THR A C     1 
ATOM   7511  O  O     . THR A 1  976  ? 0.284   -98.840  65.138  1.00 129.27 ? 976  THR A O     1 
ATOM   7512  C  CB    . THR A 1  976  ? -1.842  -96.780  64.102  1.00 133.31 ? 976  THR A CB    1 
ATOM   7513  O  OG1   . THR A 1  976  ? -1.861  -96.564  62.687  1.00 131.56 ? 976  THR A OG1   1 
ATOM   7514  C  CG2   . THR A 1  976  ? -2.853  -95.861  64.781  1.00 130.59 ? 976  THR A CG2   1 
ATOM   7515  N  N     . LYS A 1  977  ? 1.364   -97.825  63.415  1.00 122.22 ? 977  LYS A N     1 
ATOM   7516  C  CA    . LYS A 1  977  ? 2.249   -98.937  63.044  1.00 122.40 ? 977  LYS A CA    1 
ATOM   7517  C  C     . LYS A 1  977  ? 3.667   -98.763  63.646  1.00 121.34 ? 977  LYS A C     1 
ATOM   7518  O  O     . LYS A 1  977  ? 4.213   -97.656  63.559  1.00 118.88 ? 977  LYS A O     1 
ATOM   7519  C  CB    . LYS A 1  977  ? 2.327   -99.035  61.503  1.00 125.31 ? 977  LYS A CB    1 
ATOM   7520  C  CG    . LYS A 1  977  ? 3.076   -100.246 60.957  1.00 144.43 ? 977  LYS A CG    1 
ATOM   7521  C  CD    . LYS A 1  977  ? 3.152   -100.217 59.435  1.00 155.20 ? 977  LYS A CD    1 
ATOM   7522  C  CE    . LYS A 1  977  ? 3.953   -101.369 58.871  1.00 167.95 ? 977  LYS A CE    1 
ATOM   7523  N  NZ    . LYS A 1  977  ? 3.238   -102.668 58.992  1.00 178.97 ? 977  LYS A NZ    1 
ATOM   7524  N  N     . PRO A 1  978  ? 4.294   -99.831  64.214  1.00 115.76 ? 978  PRO A N     1 
ATOM   7525  C  CA    . PRO A 1  978  ? 5.661   -99.685  64.752  1.00 113.18 ? 978  PRO A CA    1 
ATOM   7526  C  C     . PRO A 1  978  ? 6.703   -99.509  63.648  1.00 112.27 ? 978  PRO A C     1 
ATOM   7527  O  O     . PRO A 1  978  ? 6.627   -100.174 62.609  1.00 112.94 ? 978  PRO A O     1 
ATOM   7528  C  CB    . PRO A 1  978  ? 5.889   -100.985 65.536  1.00 117.49 ? 978  PRO A CB    1 
ATOM   7529  C  CG    . PRO A 1  978  ? 4.550   -101.643 65.623  1.00 124.39 ? 978  PRO A CG    1 
ATOM   7530  C  CD    . PRO A 1  978  ? 3.803   -101.206 64.410  1.00 119.70 ? 978  PRO A CD    1 
ATOM   7531  N  N     . SER A 1  979  ? 7.661   -98.592  63.874  1.00 103.70 ? 979  SER A N     1 
ATOM   7532  C  CA    . SER A 1  979  ? 8.730   -98.245  62.937  1.00 100.98 ? 979  SER A CA    1 
ATOM   7533  C  C     . SER A 1  979  ? 9.739   -99.362  62.747  1.00 103.79 ? 979  SER A C     1 
ATOM   7534  O  O     . SER A 1  979  ? 10.085  -100.040 63.709  1.00 104.80 ? 979  SER A O     1 
ATOM   7535  C  CB    . SER A 1  979  ? 9.447   -96.981  63.396  1.00 101.30 ? 979  SER A CB    1 
ATOM   7536  O  OG    . SER A 1  979  ? 10.532  -96.663  62.539  1.00 107.37 ? 979  SER A OG    1 
ATOM   7537  N  N     . ASP A 1  980  ? 10.252  -99.504  61.512  1.00 98.41  ? 980  ASP A N     1 
ATOM   7538  C  CA    . ASP A 1  980  ? 11.260  -100.494 61.114  1.00 98.99  ? 980  ASP A CA    1 
ATOM   7539  C  C     . ASP A 1  980  ? 12.692  -100.044 61.458  1.00 99.24  ? 980  ASP A C     1 
ATOM   7540  O  O     . ASP A 1  980  ? 13.655  -100.774 61.194  1.00 99.39  ? 980  ASP A O     1 
ATOM   7541  C  CB    . ASP A 1  980  ? 11.122  -100.842 59.612  1.00 101.88 ? 980  ASP A CB    1 
ATOM   7542  C  CG    . ASP A 1  980  ? 11.229  -99.681  58.632  1.00 109.91 ? 980  ASP A CG    1 
ATOM   7543  O  OD1   . ASP A 1  980  ? 11.107  -98.519  59.069  1.00 108.10 ? 980  ASP A OD1   1 
ATOM   7544  O  OD2   . ASP A 1  980  ? 11.386  -99.940  57.422  1.00 116.63 ? 980  ASP A OD2   1 
ATOM   7545  N  N     . LEU A 1  981  ? 12.820  -98.848  62.065  1.00 92.61  ? 981  LEU A N     1 
ATOM   7546  C  CA    . LEU A 1  981  ? 14.089  -98.260  62.492  1.00 90.58  ? 981  LEU A CA    1 
ATOM   7547  C  C     . LEU A 1  981  ? 14.700  -98.993  63.682  1.00 94.38  ? 981  LEU A C     1 
ATOM   7548  O  O     . LEU A 1  981  ? 14.002  -99.674  64.436  1.00 95.17  ? 981  LEU A O     1 
ATOM   7549  C  CB    . LEU A 1  981  ? 13.892  -96.782  62.867  1.00 87.95  ? 981  LEU A CB    1 
ATOM   7550  C  CG    . LEU A 1  981  ? 14.014  -95.758  61.748  1.00 91.05  ? 981  LEU A CG    1 
ATOM   7551  C  CD1   . LEU A 1  981  ? 13.327  -94.464  62.130  1.00 89.17  ? 981  LEU A CD1   1 
ATOM   7552  C  CD2   . LEU A 1  981  ? 15.468  -95.479  61.408  1.00 92.84  ? 981  LEU A CD2   1 
ATOM   7553  N  N     . THR A 1  982  ? 16.017  -98.845  63.837  1.00 89.64  ? 982  THR A N     1 
ATOM   7554  C  CA    . THR A 1  982  ? 16.784  -99.396  64.947  1.00 89.93  ? 982  THR A CA    1 
ATOM   7555  C  C     . THR A 1  982  ? 17.499  -98.224  65.619  1.00 91.24  ? 982  THR A C     1 
ATOM   7556  O  O     . THR A 1  982  ? 17.613  -97.154  65.014  1.00 88.64  ? 982  THR A O     1 
ATOM   7557  C  CB    . THR A 1  982  ? 17.757  -100.496 64.474  1.00 98.64  ? 982  THR A CB    1 
ATOM   7558  O  OG1   . THR A 1  982  ? 18.752  -99.940  63.616  1.00 93.05  ? 982  THR A OG1   1 
ATOM   7559  C  CG2   . THR A 1  982  ? 17.051  -101.674 63.801  1.00 100.47 ? 982  THR A CG2   1 
ATOM   7560  N  N     . ILE A 1  983  ? 17.968  -98.411  66.864  1.00 88.26  ? 983  ILE A N     1 
ATOM   7561  C  CA    . ILE A 1  983  ? 18.682  -97.362  67.602  1.00 86.14  ? 983  ILE A CA    1 
ATOM   7562  C  C     . ILE A 1  983  ? 19.981  -97.007  66.868  1.00 90.10  ? 983  ILE A C     1 
ATOM   7563  O  O     . ILE A 1  983  ? 20.293  -95.822  66.729  1.00 87.74  ? 983  ILE A O     1 
ATOM   7564  C  CB    . ILE A 1  983  ? 18.914  -97.744  69.087  1.00 89.69  ? 983  ILE A CB    1 
ATOM   7565  C  CG1   . ILE A 1  983  ? 17.623  -98.238  69.822  1.00 91.14  ? 983  ILE A CG1   1 
ATOM   7566  C  CG2   . ILE A 1  983  ? 19.666  -96.667  69.857  1.00 88.10  ? 983  ILE A CG2   1 
ATOM   7567  C  CD1   . ILE A 1  983  ? 16.427  -97.262  70.010  1.00 97.64  ? 983  ILE A CD1   1 
ATOM   7568  N  N     . LYS A 1  984  ? 20.693  -98.033  66.348  1.00 89.08  ? 984  LYS A N     1 
ATOM   7569  C  CA    . LYS A 1  984  ? 21.921  -97.879  65.564  1.00 89.14  ? 984  LYS A CA    1 
ATOM   7570  C  C     . LYS A 1  984  ? 21.666  -97.054  64.287  1.00 93.34  ? 984  LYS A C     1 
ATOM   7571  O  O     . LYS A 1  984  ? 22.517  -96.241  63.922  1.00 92.15  ? 984  LYS A O     1 
ATOM   7572  C  CB    . LYS A 1  984  ? 22.523  -99.245  65.207  1.00 93.69  ? 984  LYS A CB    1 
ATOM   7573  C  CG    . LYS A 1  984  ? 23.195  -99.952  66.373  1.00 104.65 ? 984  LYS A CG    1 
ATOM   7574  C  CD    . LYS A 1  984  ? 24.278  -100.919 65.899  1.00 116.24 ? 984  LYS A CD    1 
ATOM   7575  C  CE    . LYS A 1  984  ? 25.669  -100.330 65.983  1.00 123.89 ? 984  LYS A CE    1 
ATOM   7576  N  NZ    . LYS A 1  984  ? 26.682  -101.194 65.321  1.00 133.36 ? 984  LYS A NZ    1 
ATOM   7577  N  N     . ASP A 1  985  ? 20.487  -97.239  63.635  1.00 90.50  ? 985  ASP A N     1 
ATOM   7578  C  CA    . ASP A 1  985  ? 20.093  -96.500  62.427  1.00 89.26  ? 985  ASP A CA    1 
ATOM   7579  C  C     . ASP A 1  985  ? 19.979  -94.999  62.708  1.00 89.78  ? 985  ASP A C     1 
ATOM   7580  O  O     . ASP A 1  985  ? 20.512  -94.203  61.938  1.00 88.35  ? 985  ASP A O     1 
ATOM   7581  C  CB    . ASP A 1  985  ? 18.754  -97.016  61.852  1.00 92.46  ? 985  ASP A CB    1 
ATOM   7582  C  CG    . ASP A 1  985  ? 18.769  -98.348  61.113  1.00 111.16 ? 985  ASP A CG    1 
ATOM   7583  O  OD1   . ASP A 1  985  ? 19.847  -98.987  61.051  1.00 114.90 ? 985  ASP A OD1   1 
ATOM   7584  O  OD2   . ASP A 1  985  ? 17.686  -98.788  60.662  1.00 117.78 ? 985  ASP A OD2   1 
ATOM   7585  N  N     . ILE A 1  986  ? 19.295  -94.617  63.808  1.00 84.71  ? 986  ILE A N     1 
ATOM   7586  C  CA    . ILE A 1  986  ? 19.082  -93.212  64.172  1.00 81.70  ? 986  ILE A CA    1 
ATOM   7587  C  C     . ILE A 1  986  ? 20.358  -92.545  64.697  1.00 84.02  ? 986  ILE A C     1 
ATOM   7588  O  O     . ILE A 1  986  ? 20.796  -91.547  64.122  1.00 82.26  ? 986  ILE A O     1 
ATOM   7589  C  CB    . ILE A 1  986  ? 17.854  -92.993  65.114  1.00 84.08  ? 986  ILE A CB    1 
ATOM   7590  C  CG1   . ILE A 1  986  ? 16.605  -93.746  64.612  1.00 85.39  ? 986  ILE A CG1   1 
ATOM   7591  C  CG2   . ILE A 1  986  ? 17.554  -91.495  65.279  1.00 82.61  ? 986  ILE A CG2   1 
ATOM   7592  C  CD1   . ILE A 1  986  ? 15.610  -94.091  65.669  1.00 91.42  ? 986  ILE A CD1   1 
ATOM   7593  N  N     . VAL A 1  987  ? 20.937  -93.092  65.786  1.00 80.87  ? 987  VAL A N     1 
ATOM   7594  C  CA    . VAL A 1  987  ? 22.133  -92.565  66.456  1.00 79.67  ? 987  VAL A CA    1 
ATOM   7595  C  C     . VAL A 1  987  ? 23.296  -92.346  65.480  1.00 84.35  ? 987  VAL A C     1 
ATOM   7596  O  O     . VAL A 1  987  ? 23.795  -91.222  65.375  1.00 82.46  ? 987  VAL A O     1 
ATOM   7597  C  CB    . VAL A 1  987  ? 22.529  -93.398  67.710  1.00 83.91  ? 987  VAL A CB    1 
ATOM   7598  C  CG1   . VAL A 1  987  ? 23.823  -92.891  68.340  1.00 82.97  ? 987  VAL A CG1   1 
ATOM   7599  C  CG2   . VAL A 1  987  ? 21.410  -93.398  68.740  1.00 83.34  ? 987  VAL A CG2   1 
ATOM   7600  N  N     . LEU A 1  988  ? 23.687  -93.399  64.746  1.00 82.96  ? 988  LEU A N     1 
ATOM   7601  C  CA    . LEU A 1  988  ? 24.788  -93.334  63.785  1.00 83.18  ? 988  LEU A CA    1 
ATOM   7602  C  C     . LEU A 1  988  ? 24.428  -92.612  62.489  1.00 85.32  ? 988  LEU A C     1 
ATOM   7603  O  O     . LEU A 1  988  ? 25.315  -92.058  61.839  1.00 84.45  ? 988  LEU A O     1 
ATOM   7604  C  CB    . LEU A 1  988  ? 25.378  -94.725  63.507  1.00 85.82  ? 988  LEU A CB    1 
ATOM   7605  C  CG    . LEU A 1  988  ? 25.962  -95.465  64.713  1.00 91.68  ? 988  LEU A CG    1 
ATOM   7606  C  CD1   . LEU A 1  988  ? 25.984  -96.954  64.469  1.00 94.31  ? 988  LEU A CD1   1 
ATOM   7607  C  CD2   . LEU A 1  988  ? 27.352  -94.953  65.064  1.00 93.66  ? 988  LEU A CD2   1 
ATOM   7608  N  N     . GLY A 1  989  ? 23.143  -92.609  62.140  1.00 81.14  ? 989  GLY A N     1 
ATOM   7609  C  CA    . GLY A 1  989  ? 22.637  -91.923  60.955  1.00 79.87  ? 989  GLY A CA    1 
ATOM   7610  C  C     . GLY A 1  989  ? 22.801  -90.422  61.069  1.00 81.10  ? 989  GLY A C     1 
ATOM   7611  O  O     . GLY A 1  989  ? 23.367  -89.787  60.174  1.00 80.03  ? 989  GLY A O     1 
ATOM   7612  N  N     . VAL A 1  990  ? 22.351  -89.855  62.199  1.00 76.28  ? 990  VAL A N     1 
ATOM   7613  C  CA    . VAL A 1  990  ? 22.486  -88.425  62.461  1.00 74.40  ? 990  VAL A CA    1 
ATOM   7614  C  C     . VAL A 1  990  ? 23.969  -88.046  62.613  1.00 79.23  ? 990  VAL A C     1 
ATOM   7615  O  O     . VAL A 1  990  ? 24.367  -86.967  62.175  1.00 77.71  ? 990  VAL A O     1 
ATOM   7616  C  CB    . VAL A 1  990  ? 21.567  -87.884  63.603  1.00 77.50  ? 990  VAL A CB    1 
ATOM   7617  C  CG1   . VAL A 1  990  ? 20.120  -88.315  63.391  1.00 77.61  ? 990  VAL A CG1   1 
ATOM   7618  C  CG2   . VAL A 1  990  ? 22.051  -88.298  64.994  1.00 78.18  ? 990  VAL A CG2   1 
ATOM   7619  N  N     . LYS A 1  991  ? 24.783  -88.975  63.178  1.00 78.03  ? 991  LYS A N     1 
ATOM   7620  C  CA    . LYS A 1  991  ? 26.224  -88.838  63.405  1.00 78.39  ? 991  LYS A CA    1 
ATOM   7621  C  C     . LYS A 1  991  ? 26.944  -88.757  62.070  1.00 84.31  ? 991  LYS A C     1 
ATOM   7622  O  O     . LYS A 1  991  ? 27.806  -87.898  61.891  1.00 83.14  ? 991  LYS A O     1 
ATOM   7623  C  CB    . LYS A 1  991  ? 26.753  -90.030  64.218  1.00 82.34  ? 991  LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1  991  ? 27.832  -89.658  65.228  1.00 94.86  ? 991  LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1  991  ? 28.307  -90.879  66.026  1.00 102.76 ? 991  LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1  991  ? 29.125  -90.512  67.244  1.00 102.72 ? 991  LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1  991  ? 29.563  -91.721  67.989  1.00 105.62 ? 991  LYS A NZ    1 
ATOM   7628  N  N     . ASP A 1  992  ? 26.556  -89.628  61.123  1.00 83.65  ? 992  ASP A N     1 
ATOM   7629  C  CA    . ASP A 1  992  ? 27.126  -89.670  59.782  1.00 84.80  ? 992  ASP A CA    1 
ATOM   7630  C  C     . ASP A 1  992  ? 26.707  -88.468  58.956  1.00 87.31  ? 992  ASP A C     1 
ATOM   7631  O  O     . ASP A 1  992  ? 27.513  -87.986  58.161  1.00 87.08  ? 992  ASP A O     1 
ATOM   7632  C  CB    . ASP A 1  992  ? 26.749  -90.970  59.062  1.00 89.04  ? 992  ASP A CB    1 
ATOM   7633  C  CG    . ASP A 1  992  ? 27.951  -91.777  58.620  1.00 104.45 ? 992  ASP A CG    1 
ATOM   7634  O  OD1   . ASP A 1  992  ? 28.577  -92.431  59.486  1.00 106.65 ? 992  ASP A OD1   1 
ATOM   7635  O  OD2   . ASP A 1  992  ? 28.269  -91.755  57.409  1.00 111.44 ? 992  ASP A OD2   1 
ATOM   7636  N  N     . LEU A 1  993  ? 25.455  -87.984  59.137  1.00 82.79  ? 993  LEU A N     1 
ATOM   7637  C  CA    . LEU A 1  993  ? 24.927  -86.821  58.412  1.00 81.20  ? 993  LEU A CA    1 
ATOM   7638  C  C     . LEU A 1  993  ? 25.756  -85.574  58.710  1.00 85.99  ? 993  LEU A C     1 
ATOM   7639  O  O     . LEU A 1  993  ? 26.067  -84.821  57.785  1.00 84.35  ? 993  LEU A O     1 
ATOM   7640  C  CB    . LEU A 1  993  ? 23.425  -86.603  58.715  1.00 79.99  ? 993  LEU A CB    1 
ATOM   7641  C  CG    . LEU A 1  993  ? 22.760  -85.273  58.299  1.00 82.16  ? 993  LEU A CG    1 
ATOM   7642  C  CD1   . LEU A 1  993  ? 22.819  -85.040  56.802  1.00 81.98  ? 993  LEU A CD1   1 
ATOM   7643  C  CD2   . LEU A 1  993  ? 21.320  -85.232  58.746  1.00 84.26  ? 993  LEU A CD2   1 
ATOM   7644  N  N     . GLN A 1  994  ? 26.155  -85.400  59.989  1.00 84.94  ? 994  GLN A N     1 
ATOM   7645  C  CA    . GLN A 1  994  ? 26.974  -84.290  60.484  1.00 84.88  ? 994  GLN A CA    1 
ATOM   7646  C  C     . GLN A 1  994  ? 28.335  -84.197  59.778  1.00 93.28  ? 994  GLN A C     1 
ATOM   7647  O  O     . GLN A 1  994  ? 28.821  -83.087  59.538  1.00 92.50  ? 994  GLN A O     1 
ATOM   7648  C  CB    . GLN A 1  994  ? 27.145  -84.374  62.009  1.00 85.88  ? 994  GLN A CB    1 
ATOM   7649  C  CG    . GLN A 1  994  ? 25.904  -83.932  62.774  1.00 93.79  ? 994  GLN A CG    1 
ATOM   7650  C  CD    . GLN A 1  994  ? 26.037  -84.113  64.264  1.00 109.44 ? 994  GLN A CD    1 
ATOM   7651  O  OE1   . GLN A 1  994  ? 26.737  -83.362  64.949  1.00 104.98 ? 994  GLN A OE1   1 
ATOM   7652  N  NE2   . GLN A 1  994  ? 25.332  -85.093  64.807  1.00 99.28  ? 994  GLN A NE2   1 
ATOM   7653  N  N     . GLU A 1  995  ? 28.921  -85.358  59.411  1.00 93.51  ? 995  GLU A N     1 
ATOM   7654  C  CA    . GLU A 1  995  ? 30.202  -85.459  58.703  1.00 95.22  ? 995  GLU A CA    1 
ATOM   7655  C  C     . GLU A 1  995  ? 30.114  -84.861  57.289  1.00 100.30 ? 995  GLU A C     1 
ATOM   7656  O  O     . GLU A 1  995  ? 31.080  -84.259  56.819  1.00 100.38 ? 995  GLU A O     1 
ATOM   7657  C  CB    . GLU A 1  995  ? 30.658  -86.929  58.595  1.00 98.92  ? 995  GLU A CB    1 
ATOM   7658  C  CG    . GLU A 1  995  ? 30.571  -87.735  59.881  1.00 113.04 ? 995  GLU A CG    1 
ATOM   7659  C  CD    . GLU A 1  995  ? 31.767  -87.643  60.808  1.00 144.78 ? 995  GLU A CD    1 
ATOM   7660  O  OE1   . GLU A 1  995  ? 32.137  -86.515  61.208  1.00 144.88 ? 995  GLU A OE1   1 
ATOM   7661  O  OE2   . GLU A 1  995  ? 32.305  -88.713  61.177  1.00 144.28 ? 995  GLU A OE2   1 
ATOM   7662  N  N     . ASN A 1  996  ? 28.968  -85.030  56.615  1.00 97.09  ? 996  ASN A N     1 
ATOM   7663  C  CA    . ASN A 1  996  ? 28.812  -84.555  55.248  1.00 97.16  ? 996  ASN A CA    1 
ATOM   7664  C  C     . ASN A 1  996  ? 28.144  -83.190  55.013  1.00 99.11  ? 996  ASN A C     1 
ATOM   7665  O  O     . ASN A 1  996  ? 27.793  -82.868  53.871  1.00 98.37  ? 996  ASN A O     1 
ATOM   7666  C  CB    . ASN A 1  996  ? 28.284  -85.661  54.344  1.00 102.93 ? 996  ASN A CB    1 
ATOM   7667  C  CG    . ASN A 1  996  ? 29.321  -86.145  53.359  1.00 141.33 ? 996  ASN A CG    1 
ATOM   7668  O  OD1   . ASN A 1  996  ? 30.325  -86.771  53.733  1.00 141.96 ? 996  ASN A OD1   1 
ATOM   7669  N  ND2   . ASN A 1  996  ? 29.112  -85.849  52.077  1.00 132.76 ? 996  ASN A ND2   1 
ATOM   7670  N  N     . LEU A 1  997  ? 28.020  -82.366  56.069  1.00 94.36  ? 997  LEU A N     1 
ATOM   7671  C  CA    . LEU A 1  997  ? 27.462  -81.016  55.940  1.00 92.31  ? 997  LEU A CA    1 
ATOM   7672  C  C     . LEU A 1  997  ? 28.638  -80.077  55.617  1.00 97.45  ? 997  LEU A C     1 
ATOM   7673  O  O     . LEU A 1  997  ? 29.256  -79.510  56.526  1.00 97.12  ? 997  LEU A O     1 
ATOM   7674  C  CB    . LEU A 1  997  ? 26.722  -80.579  57.224  1.00 90.81  ? 997  LEU A CB    1 
ATOM   7675  C  CG    . LEU A 1  997  ? 25.485  -81.378  57.633  1.00 95.12  ? 997  LEU A CG    1 
ATOM   7676  C  CD1   . LEU A 1  997  ? 25.180  -81.173  59.097  1.00 94.60  ? 997  LEU A CD1   1 
ATOM   7677  C  CD2   . LEU A 1  997  ? 24.275  -81.009  56.795  1.00 95.88  ? 997  LEU A CD2   1 
ATOM   7678  N  N     . LEU A 1  998  ? 28.980  -79.966  54.315  1.00 94.74  ? 998  LEU A N     1 
ATOM   7679  C  CA    . LEU A 1  998  ? 30.132  -79.195  53.837  1.00 94.69  ? 998  LEU A CA    1 
ATOM   7680  C  C     . LEU A 1  998  ? 29.915  -77.705  53.556  1.00 97.47  ? 998  LEU A C     1 
ATOM   7681  O  O     . LEU A 1  998  ? 28.885  -77.306  53.012  1.00 96.41  ? 998  LEU A O     1 
ATOM   7682  C  CB    . LEU A 1  998  ? 30.817  -79.890  52.635  1.00 96.24  ? 998  LEU A CB    1 
ATOM   7683  C  CG    . LEU A 1  998  ? 31.910  -80.961  52.894  1.00 102.61 ? 998  LEU A CG    1 
ATOM   7684  C  CD1   . LEU A 1  998  ? 33.071  -80.416  53.701  1.00 102.62 ? 998  LEU A CD1   1 
ATOM   7685  C  CD2   . LEU A 1  998  ? 31.349  -82.239  53.507  1.00 105.86 ? 998  LEU A CD2   1 
ATOM   7686  N  N     . VAL A 1  999  ? 30.925  -76.898  53.923  1.00 93.65  ? 999  VAL A N     1 
ATOM   7687  C  CA    . VAL A 1  999  ? 31.027  -75.448  53.738  1.00 92.00  ? 999  VAL A CA    1 
ATOM   7688  C  C     . VAL A 1  999  ? 32.413  -75.175  53.125  1.00 98.39  ? 999  VAL A C     1 
ATOM   7689  O  O     . VAL A 1  999  ? 32.509  -74.467  52.120  1.00 98.13  ? 999  VAL A O     1 
ATOM   7690  C  CB    . VAL A 1  999  ? 30.781  -74.691  55.073  1.00 93.90  ? 999  VAL A CB    1 
ATOM   7691  C  CG1   . VAL A 1  999  ? 31.468  -73.326  55.104  1.00 92.90  ? 999  VAL A CG1   1 
ATOM   7692  C  CG2   . VAL A 1  999  ? 29.292  -74.553  55.347  1.00 92.35  ? 999  VAL A CG2   1 
ATOM   7693  N  N     . LEU A 1  1000 ? 33.470  -75.779  53.714  1.00 96.79  ? 1000 LEU A N     1 
ATOM   7694  C  CA    . LEU A 1  1000 ? 34.865  -75.686  53.275  1.00 98.05  ? 1000 LEU A CA    1 
ATOM   7695  C  C     . LEU A 1  1000 ? 35.415  -77.099  53.056  1.00 104.12 ? 1000 LEU A C     1 
ATOM   7696  O  O     . LEU A 1  1000 ? 35.301  -77.940  53.948  1.00 104.03 ? 1000 LEU A O     1 
ATOM   7697  C  CB    . LEU A 1  1000 ? 35.707  -74.925  54.314  1.00 97.87  ? 1000 LEU A CB    1 
ATOM   7698  C  CG    . LEU A 1  1000 ? 35.624  -73.403  54.260  1.00 101.42 ? 1000 LEU A CG    1 
ATOM   7699  C  CD1   . LEU A 1  1000 ? 35.602  -72.812  55.652  1.00 100.65 ? 1000 LEU A CD1   1 
ATOM   7700  C  CD2   . LEU A 1  1000 ? 36.767  -72.819  53.435  1.00 105.09 ? 1000 LEU A CD2   1 
ATOM   7701  N  N     . ARG A 1  1001 ? 35.990  -77.362  51.866  1.00 102.53 ? 1001 ARG A N     1 
ATOM   7702  C  CA    . ARG A 1  1001 ? 36.507  -78.685  51.482  1.00 104.49 ? 1001 ARG A CA    1 
ATOM   7703  C  C     . ARG A 1  1001 ? 38.051  -78.862  51.528  1.00 110.57 ? 1001 ARG A C     1 
ATOM   7704  O  O     . ARG A 1  1001 ? 38.624  -79.579  50.698  1.00 112.02 ? 1001 ARG A O     1 
ATOM   7705  C  CB    . ARG A 1  1001 ? 35.905  -79.132  50.131  1.00 104.28 ? 1001 ARG A CB    1 
ATOM   7706  C  CG    . ARG A 1  1001 ? 34.491  -79.699  50.242  1.00 108.97 ? 1001 ARG A CG    1 
ATOM   7707  C  CD    . ARG A 1  1001 ? 33.646  -79.331  49.043  1.00 113.26 ? 1001 ARG A CD    1 
ATOM   7708  N  NE    . ARG A 1  1001 ? 33.241  -77.925  49.083  1.00 118.49 ? 1001 ARG A NE    1 
ATOM   7709  C  CZ    . ARG A 1  1001 ? 32.008  -77.506  49.347  1.00 129.59 ? 1001 ARG A CZ    1 
ATOM   7710  N  NH1   . ARG A 1  1001 ? 31.035  -78.380  49.568  1.00 116.15 ? 1001 ARG A NH1   1 
ATOM   7711  N  NH2   . ARG A 1  1001 ? 31.734  -76.208  49.373  1.00 113.47 ? 1001 ARG A NH2   1 
ATOM   7712  N  N     . GLY A 1  1002 ? 38.689  -78.252  52.525  1.00 106.83 ? 1002 GLY A N     1 
ATOM   7713  C  CA    . GLY A 1  1002 ? 40.133  -78.346  52.726  1.00 108.19 ? 1002 GLY A CA    1 
ATOM   7714  C  C     . GLY A 1  1002 ? 40.534  -79.616  53.450  1.00 113.50 ? 1002 GLY A C     1 
ATOM   7715  O  O     . GLY A 1  1002 ? 39.959  -79.945  54.494  1.00 112.68 ? 1002 GLY A O     1 
ATOM   7716  N  N     . LYS A 1  1003 ? 41.545  -80.328  52.902  1.00 111.43 ? 1003 LYS A N     1 
ATOM   7717  C  CA    . LYS A 1  1003 ? 42.080  -81.602  53.408  1.00 112.37 ? 1003 LYS A CA    1 
ATOM   7718  C  C     . LYS A 1  1003 ? 43.075  -81.456  54.592  1.00 115.97 ? 1003 LYS A C     1 
ATOM   7719  O  O     . LYS A 1  1003 ? 43.825  -82.397  54.872  1.00 117.55 ? 1003 LYS A O     1 
ATOM   7720  C  CB    . LYS A 1  1003 ? 42.707  -82.418  52.251  1.00 116.60 ? 1003 LYS A CB    1 
ATOM   7721  C  CG    . LYS A 1  1003 ? 41.706  -82.969  51.231  1.00 127.52 ? 1003 LYS A CG    1 
ATOM   7722  C  CD    . LYS A 1  1003 ? 41.572  -82.074  49.993  1.00 134.47 ? 1003 LYS A CD    1 
ATOM   7723  C  CE    . LYS A 1  1003 ? 40.451  -82.511  49.078  1.00 139.30 ? 1003 LYS A CE    1 
ATOM   7724  N  NZ    . LYS A 1  1003 ? 40.133  -81.478  48.056  1.00 141.17 ? 1003 LYS A NZ    1 
ATOM   7725  N  N     . ASN A 1  1004 ? 43.058  -80.301  55.302  1.00 110.06 ? 1004 ASN A N     1 
ATOM   7726  C  CA    . ASN A 1  1004 ? 43.963  -80.035  56.428  1.00 109.63 ? 1004 ASN A CA    1 
ATOM   7727  C  C     . ASN A 1  1004 ? 43.286  -79.580  57.723  1.00 110.46 ? 1004 ASN A C     1 
ATOM   7728  O  O     . ASN A 1  1004 ? 42.162  -79.088  57.705  1.00 108.01 ? 1004 ASN A O     1 
ATOM   7729  C  CB    . ASN A 1  1004 ? 45.066  -79.052  56.022  1.00 110.48 ? 1004 ASN A CB    1 
ATOM   7730  C  CG    . ASN A 1  1004 ? 44.577  -77.651  55.750  1.00 125.62 ? 1004 ASN A CG    1 
ATOM   7731  O  OD1   . ASN A 1  1004 ? 44.501  -76.805  56.649  1.00 114.30 ? 1004 ASN A OD1   1 
ATOM   7732  N  ND2   . ASN A 1  1004 ? 44.284  -77.365  54.490  1.00 117.50 ? 1004 ASN A ND2   1 
ATOM   7733  N  N     . GLU A 1  1005 ? 44.029  -79.711  58.834  1.00 107.26 ? 1005 GLU A N     1 
ATOM   7734  C  CA    . GLU A 1  1005 ? 43.700  -79.368  60.225  1.00 105.70 ? 1005 GLU A CA    1 
ATOM   7735  C  C     . GLU A 1  1005 ? 43.059  -77.990  60.466  1.00 105.60 ? 1005 GLU A C     1 
ATOM   7736  O  O     . GLU A 1  1005 ? 42.076  -77.914  61.205  1.00 103.84 ? 1005 GLU A O     1 
ATOM   7737  C  CB    . GLU A 1  1005 ? 44.928  -79.583  61.145  1.00 108.66 ? 1005 GLU A CB    1 
ATOM   7738  C  CG    . GLU A 1  1005 ? 46.172  -78.745  60.831  1.00 122.39 ? 1005 GLU A CG    1 
ATOM   7739  C  CD    . GLU A 1  1005 ? 46.829  -78.927  59.471  1.00 145.98 ? 1005 GLU A CD    1 
ATOM   7740  O  OE1   . GLU A 1  1005 ? 47.263  -80.060  59.161  1.00 142.07 ? 1005 GLU A OE1   1 
ATOM   7741  O  OE2   . GLU A 1  1005 ? 46.889  -77.938  58.705  1.00 138.34 ? 1005 GLU A OE2   1 
ATOM   7742  N  N     . ILE A 1  1006 ? 43.623  -76.915  59.863  1.00 100.46 ? 1006 ILE A N     1 
ATOM   7743  C  CA    . ILE A 1  1006 ? 43.150  -75.529  60.000  1.00 97.74  ? 1006 ILE A CA    1 
ATOM   7744  C  C     . ILE A 1  1006 ? 41.760  -75.354  59.394  1.00 98.12  ? 1006 ILE A C     1 
ATOM   7745  O  O     . ILE A 1  1006 ? 40.847  -74.863  60.066  1.00 95.84  ? 1006 ILE A O     1 
ATOM   7746  C  CB    . ILE A 1  1006 ? 44.194  -74.501  59.456  1.00 101.33 ? 1006 ILE A CB    1 
ATOM   7747  C  CG1   . ILE A 1  1006 ? 45.411  -74.411  60.411  1.00 103.00 ? 1006 ILE A CG1   1 
ATOM   7748  C  CG2   . ILE A 1  1006 ? 43.565  -73.109  59.201  1.00 100.07 ? 1006 ILE A CG2   1 
ATOM   7749  C  CD1   . ILE A 1  1006 ? 46.526  -73.437  60.008  1.00 111.62 ? 1006 ILE A CD1   1 
ATOM   7750  N  N     . ILE A 1  1007 ? 41.607  -75.768  58.132  1.00 94.10  ? 1007 ILE A N     1 
ATOM   7751  C  CA    . ILE A 1  1007 ? 40.348  -75.668  57.407  1.00 92.04  ? 1007 ILE A CA    1 
ATOM   7752  C  C     . ILE A 1  1007 ? 39.309  -76.699  57.904  1.00 95.13  ? 1007 ILE A C     1 
ATOM   7753  O  O     . ILE A 1  1007 ? 38.112  -76.399  57.875  1.00 93.29  ? 1007 ILE A O     1 
ATOM   7754  C  CB    . ILE A 1  1007 ? 40.584  -75.589  55.874  1.00 95.44  ? 1007 ILE A CB    1 
ATOM   7755  C  CG1   . ILE A 1  1007 ? 41.285  -74.263  55.515  1.00 95.61  ? 1007 ILE A CG1   1 
ATOM   7756  C  CG2   . ILE A 1  1007 ? 39.295  -75.696  55.086  1.00 95.22  ? 1007 ILE A CG2   1 
ATOM   7757  C  CD1   . ILE A 1  1007 ? 42.700  -74.382  55.122  1.00 105.16 ? 1007 ILE A CD1   1 
ATOM   7758  N  N     . GLN A 1  1008 ? 39.766  -77.864  58.447  1.00 92.32  ? 1008 GLN A N     1 
ATOM   7759  C  CA    . GLN A 1  1008 ? 38.862  -78.877  59.014  1.00 91.43  ? 1008 GLN A CA    1 
ATOM   7760  C  C     . GLN A 1  1008 ? 38.259  -78.409  60.327  1.00 92.28  ? 1008 GLN A C     1 
ATOM   7761  O  O     . GLN A 1  1008 ? 37.101  -78.722  60.609  1.00 90.64  ? 1008 GLN A O     1 
ATOM   7762  C  CB    . GLN A 1  1008 ? 39.520  -80.261  59.155  1.00 94.76  ? 1008 GLN A CB    1 
ATOM   7763  C  CG    . GLN A 1  1008 ? 39.441  -81.114  57.881  1.00 113.27 ? 1008 GLN A CG    1 
ATOM   7764  C  CD    . GLN A 1  1008 ? 38.032  -81.269  57.331  1.00 133.67 ? 1008 GLN A CD    1 
ATOM   7765  O  OE1   . GLN A 1  1008 ? 37.132  -81.808  57.986  1.00 130.75 ? 1008 GLN A OE1   1 
ATOM   7766  N  NE2   . GLN A 1  1008 ? 37.807  -80.783  56.114  1.00 122.10 ? 1008 GLN A NE2   1 
ATOM   7767  N  N     . ASN A 1  1009 ? 39.032  -77.630  61.108  1.00 87.98  ? 1009 ASN A N     1 
ATOM   7768  C  CA    . ASN A 1  1009 ? 38.562  -77.040  62.359  1.00 86.32  ? 1009 ASN A CA    1 
ATOM   7769  C  C     . ASN A 1  1009 ? 37.719  -75.805  62.082  1.00 87.49  ? 1009 ASN A C     1 
ATOM   7770  O  O     . ASN A 1  1009 ? 36.781  -75.531  62.831  1.00 86.13  ? 1009 ASN A O     1 
ATOM   7771  C  CB    . ASN A 1  1009 ? 39.707  -76.741  63.311  1.00 87.47  ? 1009 ASN A CB    1 
ATOM   7772  C  CG    . ASN A 1  1009 ? 39.899  -77.844  64.316  1.00 111.29 ? 1009 ASN A CG    1 
ATOM   7773  O  OD1   . ASN A 1  1009 ? 39.309  -77.836  65.405  1.00 102.93 ? 1009 ASN A OD1   1 
ATOM   7774  N  ND2   . ASN A 1  1009 ? 40.680  -78.852  63.943  1.00 105.54 ? 1009 ASN A ND2   1 
ATOM   7775  N  N     . ALA A 1  1010 ? 38.024  -75.084  60.986  1.00 82.91  ? 1010 ALA A N     1 
ATOM   7776  C  CA    . ALA A 1  1010 ? 37.253  -73.923  60.543  1.00 80.87  ? 1010 ALA A CA    1 
ATOM   7777  C  C     . ALA A 1  1010 ? 35.863  -74.399  60.104  1.00 82.24  ? 1010 ALA A C     1 
ATOM   7778  O  O     . ALA A 1  1010 ? 34.864  -73.775  60.464  1.00 79.99  ? 1010 ALA A O     1 
ATOM   7779  C  CB    . ALA A 1  1010 ? 37.961  -73.232  59.389  1.00 82.11  ? 1010 ALA A CB    1 
ATOM   7780  N  N     . GLN A 1  1011 ? 35.814  -75.535  59.368  1.00 79.21  ? 1011 GLN A N     1 
ATOM   7781  C  CA    . GLN A 1  1011 ? 34.597  -76.193  58.892  1.00 78.47  ? 1011 GLN A CA    1 
ATOM   7782  C  C     . GLN A 1  1011 ? 33.789  -76.705  60.092  1.00 82.18  ? 1011 GLN A C     1 
ATOM   7783  O  O     . GLN A 1  1011 ? 32.565  -76.549  60.111  1.00 80.85  ? 1011 GLN A O     1 
ATOM   7784  C  CB    . GLN A 1  1011 ? 34.953  -77.327  57.902  1.00 81.12  ? 1011 GLN A CB    1 
ATOM   7785  C  CG    . GLN A 1  1011 ? 33.904  -78.431  57.708  1.00 92.71  ? 1011 GLN A CG    1 
ATOM   7786  C  CD    . GLN A 1  1011 ? 32.593  -77.926  57.166  1.00 106.93 ? 1011 GLN A CD    1 
ATOM   7787  O  OE1   . GLN A 1  1011 ? 32.520  -77.387  56.062  1.00 101.91 ? 1011 GLN A OE1   1 
ATOM   7788  N  NE2   . GLN A 1  1011 ? 31.529  -78.093  57.936  1.00 97.05  ? 1011 GLN A NE2   1 
ATOM   7789  N  N     . ARG A 1  1012 ? 34.483  -77.293  61.088  1.00 79.58  ? 1012 ARG A N     1 
ATOM   7790  C  CA    . ARG A 1  1012 ? 33.903  -77.795  62.333  1.00 79.59  ? 1012 ARG A CA    1 
ATOM   7791  C  C     . ARG A 1  1012 ? 33.177  -76.639  63.052  1.00 82.64  ? 1012 ARG A C     1 
ATOM   7792  O  O     . ARG A 1  1012 ? 31.999  -76.780  63.399  1.00 81.32  ? 1012 ARG A O     1 
ATOM   7793  C  CB    . ARG A 1  1012 ? 35.023  -78.388  63.213  1.00 82.18  ? 1012 ARG A CB    1 
ATOM   7794  C  CG    . ARG A 1  1012 ? 34.592  -78.964  64.566  1.00 95.98  ? 1012 ARG A CG    1 
ATOM   7795  C  CD    . ARG A 1  1012 ? 35.730  -79.706  65.255  1.00 111.41 ? 1012 ARG A CD    1 
ATOM   7796  N  NE    . ARG A 1  1012 ? 35.917  -81.058  64.713  1.00 127.55 ? 1012 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A 1  1012 ? 36.873  -81.411  63.854  1.00 143.71 ? 1012 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A 1  1012 ? 37.760  -80.519  63.430  1.00 131.44 ? 1012 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A 1  1012 ? 36.952  -82.662  63.419  1.00 130.63 ? 1012 ARG A NH2   1 
ATOM   7800  N  N     . ASP A 1  1013 ? 33.874  -75.486  63.213  1.00 79.35  ? 1013 ASP A N     1 
ATOM   7801  C  CA    . ASP A 1  1013 ? 33.375  -74.266  63.857  1.00 77.98  ? 1013 ASP A CA    1 
ATOM   7802  C  C     . ASP A 1  1013 ? 32.163  -73.664  63.148  1.00 79.60  ? 1013 ASP A C     1 
ATOM   7803  O  O     . ASP A 1  1013 ? 31.202  -73.273  63.814  1.00 78.51  ? 1013 ASP A O     1 
ATOM   7804  C  CB    . ASP A 1  1013 ? 34.496  -73.216  63.985  1.00 80.39  ? 1013 ASP A CB    1 
ATOM   7805  C  CG    . ASP A 1  1013 ? 35.565  -73.536  65.018  1.00 97.05  ? 1013 ASP A CG    1 
ATOM   7806  O  OD1   . ASP A 1  1013 ? 35.209  -74.051  66.112  1.00 98.42  ? 1013 ASP A OD1   1 
ATOM   7807  O  OD2   . ASP A 1  1013 ? 36.749  -73.229  64.758  1.00 105.70 ? 1013 ASP A OD2   1 
ATOM   7808  N  N     . ALA A 1  1014 ? 32.205  -73.599  61.803  1.00 74.93  ? 1014 ALA A N     1 
ATOM   7809  C  CA    . ALA A 1  1014 ? 31.128  -73.056  60.976  1.00 72.83  ? 1014 ALA A CA    1 
ATOM   7810  C  C     . ALA A 1  1014 ? 29.811  -73.820  61.131  1.00 74.45  ? 1014 ALA A C     1 
ATOM   7811  O  O     . ALA A 1  1014 ? 28.752  -73.197  61.176  1.00 73.70  ? 1014 ALA A O     1 
ATOM   7812  C  CB    . ALA A 1  1014 ? 31.548  -73.040  59.516  1.00 73.95  ? 1014 ALA A CB    1 
ATOM   7813  N  N     . VAL A 1  1015 ? 29.880  -75.154  61.243  1.00 69.54  ? 1015 VAL A N     1 
ATOM   7814  C  CA    . VAL A 1  1015 ? 28.701  -76.014  61.342  1.00 68.18  ? 1015 VAL A CA    1 
ATOM   7815  C  C     . VAL A 1  1015 ? 28.224  -76.337  62.784  1.00 68.00  ? 1015 VAL A C     1 
ATOM   7816  O  O     . VAL A 1  1015 ? 27.145  -76.909  62.955  1.00 66.56  ? 1015 VAL A O     1 
ATOM   7817  C  CB    . VAL A 1  1015 ? 28.884  -77.254  60.428  1.00 73.69  ? 1015 VAL A CB    1 
ATOM   7818  C  CG1   . VAL A 1  1015 ? 29.643  -78.379  61.133  1.00 75.00  ? 1015 VAL A CG1   1 
ATOM   7819  C  CG2   . VAL A 1  1015 ? 27.553  -77.738  59.860  1.00 73.35  ? 1015 VAL A CG2   1 
ATOM   7820  N  N     . THR A 1  1016 ? 29.008  -75.938  63.803  1.00 63.02  ? 1016 THR A N     1 
ATOM   7821  C  CA    . THR A 1  1016 ? 28.734  -76.162  65.232  1.00 62.24  ? 1016 THR A CA    1 
ATOM   7822  C  C     . THR A 1  1016 ? 27.270  -75.948  65.647  1.00 64.27  ? 1016 THR A C     1 
ATOM   7823  O  O     . THR A 1  1016 ? 26.655  -76.872  66.171  1.00 63.59  ? 1016 THR A O     1 
ATOM   7824  C  CB    . THR A 1  1016 ? 29.744  -75.389  66.100  1.00 68.61  ? 1016 THR A CB    1 
ATOM   7825  O  OG1   . THR A 1  1016 ? 31.056  -75.893  65.858  1.00 70.91  ? 1016 THR A OG1   1 
ATOM   7826  C  CG2   . THR A 1  1016 ? 29.439  -75.471  67.582  1.00 66.09  ? 1016 THR A CG2   1 
ATOM   7827  N  N     . LEU A 1  1017 ? 26.722  -74.747  65.394  1.00 60.32  ? 1017 LEU A N     1 
ATOM   7828  C  CA    . LEU A 1  1017 ? 25.353  -74.374  65.764  1.00 59.35  ? 1017 LEU A CA    1 
ATOM   7829  C  C     . LEU A 1  1017 ? 24.264  -75.148  65.036  1.00 64.35  ? 1017 LEU A C     1 
ATOM   7830  O  O     . LEU A 1  1017 ? 23.308  -75.580  65.678  1.00 63.28  ? 1017 LEU A O     1 
ATOM   7831  C  CB    . LEU A 1  1017 ? 25.132  -72.861  65.622  1.00 57.90  ? 1017 LEU A CB    1 
ATOM   7832  C  CG    . LEU A 1  1017 ? 23.938  -72.284  66.371  1.00 61.52  ? 1017 LEU A CG    1 
ATOM   7833  C  CD1   . LEU A 1  1017 ? 24.209  -72.209  67.872  1.00 61.65  ? 1017 LEU A CD1   1 
ATOM   7834  C  CD2   . LEU A 1  1017 ? 23.574  -70.920  65.830  1.00 62.59  ? 1017 LEU A CD2   1 
ATOM   7835  N  N     . PHE A 1  1018 ? 24.388  -75.303  63.703  1.00 62.87  ? 1018 PHE A N     1 
ATOM   7836  C  CA    . PHE A 1  1018 ? 23.403  -76.033  62.901  1.00 63.78  ? 1018 PHE A CA    1 
ATOM   7837  C  C     . PHE A 1  1018 ? 23.339  -77.504  63.318  1.00 71.20  ? 1018 PHE A C     1 
ATOM   7838  O  O     . PHE A 1  1018 ? 22.259  -78.097  63.284  1.00 71.19  ? 1018 PHE A O     1 
ATOM   7839  C  CB    . PHE A 1  1018 ? 23.654  -75.858  61.390  1.00 65.46  ? 1018 PHE A CB    1 
ATOM   7840  C  CG    . PHE A 1  1018 ? 22.766  -76.686  60.485  1.00 67.46  ? 1018 PHE A CG    1 
ATOM   7841  C  CD1   . PHE A 1  1018 ? 21.404  -76.422  60.384  1.00 69.79  ? 1018 PHE A CD1   1 
ATOM   7842  C  CD2   . PHE A 1  1018 ? 23.292  -77.732  59.735  1.00 70.69  ? 1018 PHE A CD2   1 
ATOM   7843  C  CE1   . PHE A 1  1018 ? 20.584  -77.203  59.563  1.00 71.14  ? 1018 PHE A CE1   1 
ATOM   7844  C  CE2   . PHE A 1  1018 ? 22.470  -78.504  58.907  1.00 73.90  ? 1018 PHE A CE2   1 
ATOM   7845  C  CZ    . PHE A 1  1018 ? 21.123  -78.232  58.824  1.00 71.23  ? 1018 PHE A CZ    1 
ATOM   7846  N  N     . CYS A 1  1019 ? 24.483  -78.071  63.759  1.00 69.91  ? 1019 CYS A N     1 
ATOM   7847  C  CA    . CYS A 1  1019 ? 24.556  -79.443  64.259  1.00 71.44  ? 1019 CYS A CA    1 
ATOM   7848  C  C     . CYS A 1  1019 ? 23.889  -79.550  65.624  1.00 74.81  ? 1019 CYS A C     1 
ATOM   7849  O  O     . CYS A 1  1019 ? 23.256  -80.565  65.896  1.00 74.95  ? 1019 CYS A O     1 
ATOM   7850  C  CB    . CYS A 1  1019 ? 25.992  -79.951  64.284  1.00 73.02  ? 1019 CYS A CB    1 
ATOM   7851  S  SG    . CYS A 1  1019 ? 26.716  -80.169  62.640  1.00 77.70  ? 1019 CYS A SG    1 
ATOM   7852  N  N     . CYS A 1  1020 ? 23.971  -78.478  66.452  1.00 70.87  ? 1020 CYS A N     1 
ATOM   7853  C  CA    . CYS A 1  1020 ? 23.318  -78.411  67.767  1.00 71.12  ? 1020 CYS A CA    1 
ATOM   7854  C  C     . CYS A 1  1020 ? 21.817  -78.556  67.577  1.00 74.84  ? 1020 CYS A C     1 
ATOM   7855  O  O     . CYS A 1  1020 ? 21.142  -79.205  68.379  1.00 75.56  ? 1020 CYS A O     1 
ATOM   7856  C  CB    . CYS A 1  1020 ? 23.653  -77.104  68.483  1.00 70.67  ? 1020 CYS A CB    1 
ATOM   7857  S  SG    . CYS A 1  1020 ? 25.323  -77.036  69.174  1.00 75.22  ? 1020 CYS A SG    1 
ATOM   7858  N  N     . LEU A 1  1021 ? 21.315  -77.944  66.495  1.00 69.94  ? 1021 LEU A N     1 
ATOM   7859  C  CA    . LEU A 1  1021 ? 19.923  -77.948  66.079  1.00 69.09  ? 1021 LEU A CA    1 
ATOM   7860  C  C     . LEU A 1  1021 ? 19.567  -79.337  65.566  1.00 72.95  ? 1021 LEU A C     1 
ATOM   7861  O  O     . LEU A 1  1021 ? 18.560  -79.906  65.995  1.00 73.37  ? 1021 LEU A O     1 
ATOM   7862  C  CB    . LEU A 1  1021 ? 19.738  -76.887  64.974  1.00 68.04  ? 1021 LEU A CB    1 
ATOM   7863  C  CG    . LEU A 1  1021 ? 18.358  -76.747  64.356  1.00 72.68  ? 1021 LEU A CG    1 
ATOM   7864  C  CD1   . LEU A 1  1021 ? 17.438  -75.941  65.256  1.00 72.42  ? 1021 LEU A CD1   1 
ATOM   7865  C  CD2   . LEU A 1  1021 ? 18.453  -76.109  62.981  1.00 74.76  ? 1021 LEU A CD2   1 
ATOM   7866  N  N     . LEU A 1  1022 ? 20.410  -79.873  64.657  1.00 68.60  ? 1022 LEU A N     1 
ATOM   7867  C  CA    . LEU A 1  1022 ? 20.276  -81.173  64.002  1.00 68.85  ? 1022 LEU A CA    1 
ATOM   7868  C  C     . LEU A 1  1022 ? 20.126  -82.319  65.008  1.00 72.27  ? 1022 LEU A C     1 
ATOM   7869  O  O     . LEU A 1  1022 ? 19.231  -83.153  64.843  1.00 72.94  ? 1022 LEU A O     1 
ATOM   7870  C  CB    . LEU A 1  1022 ? 21.503  -81.400  63.118  1.00 69.28  ? 1022 LEU A CB    1 
ATOM   7871  C  CG    . LEU A 1  1022 ? 21.298  -82.271  61.914  1.00 75.15  ? 1022 LEU A CG    1 
ATOM   7872  C  CD1   . LEU A 1  1022 ? 21.183  -81.431  60.679  1.00 74.63  ? 1022 LEU A CD1   1 
ATOM   7873  C  CD2   . LEU A 1  1022 ? 22.438  -83.248  61.763  1.00 79.16  ? 1022 LEU A CD2   1 
ATOM   7874  N  N     . ARG A 1  1023 ? 20.992  -82.337  66.053  1.00 67.12  ? 1023 ARG A N     1 
ATOM   7875  C  CA    . ARG A 1  1023 ? 21.013  -83.333  67.127  1.00 67.44  ? 1023 ARG A CA    1 
ATOM   7876  C  C     . ARG A 1  1023 ? 19.711  -83.282  67.915  1.00 70.53  ? 1023 ARG A C     1 
ATOM   7877  O  O     . ARG A 1  1023 ? 19.040  -84.307  68.038  1.00 71.10  ? 1023 ARG A O     1 
ATOM   7878  C  CB    . ARG A 1  1023 ? 22.192  -83.077  68.086  1.00 67.65  ? 1023 ARG A CB    1 
ATOM   7879  C  CG    . ARG A 1  1023 ? 23.571  -83.443  67.559  1.00 77.48  ? 1023 ARG A CG    1 
ATOM   7880  C  CD    . ARG A 1  1023 ? 24.652  -82.797  68.409  1.00 82.43  ? 1023 ARG A CD    1 
ATOM   7881  N  NE    . ARG A 1  1023 ? 25.744  -82.289  67.580  1.00 92.47  ? 1023 ARG A NE    1 
ATOM   7882  C  CZ    . ARG A 1  1023 ? 26.654  -81.409  67.984  1.00 108.97 ? 1023 ARG A CZ    1 
ATOM   7883  N  NH1   . ARG A 1  1023 ? 26.615  -80.922  69.217  1.00 94.77  ? 1023 ARG A NH1   1 
ATOM   7884  N  NH2   . ARG A 1  1023 ? 27.607  -81.005  67.156  1.00 100.32 ? 1023 ARG A NH2   1 
ATOM   7885  N  N     . SER A 1  1024 ? 19.358  -82.078  68.434  1.00 65.96  ? 1024 SER A N     1 
ATOM   7886  C  CA    . SER A 1  1024 ? 18.157  -81.782  69.229  1.00 65.54  ? 1024 SER A CA    1 
ATOM   7887  C  C     . SER A 1  1024 ? 16.869  -82.161  68.491  1.00 69.44  ? 1024 SER A C     1 
ATOM   7888  O  O     . SER A 1  1024 ? 15.942  -82.697  69.100  1.00 69.80  ? 1024 SER A O     1 
ATOM   7889  C  CB    . SER A 1  1024 ? 18.120  -80.304  69.621  1.00 67.63  ? 1024 SER A CB    1 
ATOM   7890  O  OG    . SER A 1  1024 ? 17.743  -79.439  68.560  1.00 74.43  ? 1024 SER A OG    1 
ATOM   7891  N  N     . ARG A 1  1025 ? 16.820  -81.881  67.182  1.00 64.67  ? 1025 ARG A N     1 
ATOM   7892  C  CA    . ARG A 1  1025 ? 15.658  -82.188  66.378  1.00 64.26  ? 1025 ARG A CA    1 
ATOM   7893  C  C     . ARG A 1  1025 ? 15.559  -83.663  66.015  1.00 69.19  ? 1025 ARG A C     1 
ATOM   7894  O  O     . ARG A 1  1025 ? 14.466  -84.226  66.090  1.00 69.69  ? 1025 ARG A O     1 
ATOM   7895  C  CB    . ARG A 1  1025 ? 15.597  -81.284  65.147  1.00 63.39  ? 1025 ARG A CB    1 
ATOM   7896  C  CG    . ARG A 1  1025 ? 14.176  -80.848  64.792  1.00 76.94  ? 1025 ARG A CG    1 
ATOM   7897  C  CD    . ARG A 1  1025 ? 13.509  -79.946  65.824  1.00 88.56  ? 1025 ARG A CD    1 
ATOM   7898  N  NE    . ARG A 1  1025 ? 14.023  -78.576  65.807  1.00 94.55  ? 1025 ARG A NE    1 
ATOM   7899  C  CZ    . ARG A 1  1025 ? 13.557  -77.612  65.018  1.00 105.97 ? 1025 ARG A CZ    1 
ATOM   7900  N  NH1   . ARG A 1  1025 ? 12.585  -77.866  64.149  1.00 93.40  ? 1025 ARG A NH1   1 
ATOM   7901  N  NH2   . ARG A 1  1025 ? 14.069  -76.392  65.082  1.00 89.36  ? 1025 ARG A NH2   1 
ATOM   7902  N  N     . LEU A 1  1026 ? 16.692  -84.306  65.678  1.00 65.72  ? 1026 LEU A N     1 
ATOM   7903  C  CA    . LEU A 1  1026 ? 16.700  -85.720  65.281  1.00 66.73  ? 1026 LEU A CA    1 
ATOM   7904  C  C     . LEU A 1  1026 ? 17.209  -86.721  66.342  1.00 71.21  ? 1026 LEU A C     1 
ATOM   7905  O  O     . LEU A 1  1026 ? 17.963  -87.650  66.027  1.00 71.71  ? 1026 LEU A O     1 
ATOM   7906  C  CB    . LEU A 1  1026 ? 17.396  -85.905  63.926  1.00 66.68  ? 1026 LEU A CB    1 
ATOM   7907  C  CG    . LEU A 1  1026 ? 16.810  -85.161  62.739  1.00 69.72  ? 1026 LEU A CG    1 
ATOM   7908  C  CD1   . LEU A 1  1026 ? 17.854  -84.992  61.664  1.00 69.85  ? 1026 LEU A CD1   1 
ATOM   7909  C  CD2   . LEU A 1  1026 ? 15.558  -85.856  62.201  1.00 71.89  ? 1026 LEU A CD2   1 
ATOM   7910  N  N     . ALA A 1  1027 ? 16.754  -86.547  67.593  1.00 67.25  ? 1027 ALA A N     1 
ATOM   7911  C  CA    . ALA A 1  1027 ? 17.090  -87.431  68.709  1.00 67.91  ? 1027 ALA A CA    1 
ATOM   7912  C  C     . ALA A 1  1027 ? 16.288  -88.723  68.588  1.00 72.65  ? 1027 ALA A C     1 
ATOM   7913  O  O     . ALA A 1  1027 ? 15.149  -88.690  68.109  1.00 71.46  ? 1027 ALA A O     1 
ATOM   7914  C  CB    . ALA A 1  1027 ? 16.774  -86.746  70.025  1.00 67.89  ? 1027 ALA A CB    1 
ATOM   7915  N  N     . THR A 1  1028 ? 16.882  -89.854  69.034  1.00 71.08  ? 1028 THR A N     1 
ATOM   7916  C  CA    . THR A 1  1028 ? 16.297  -91.206  68.994  1.00 73.15  ? 1028 THR A CA    1 
ATOM   7917  C  C     . THR A 1  1028 ? 14.868  -91.269  69.533  1.00 77.67  ? 1028 THR A C     1 
ATOM   7918  O  O     . THR A 1  1028 ? 14.005  -91.869  68.886  1.00 78.24  ? 1028 THR A O     1 
ATOM   7919  C  CB    . THR A 1  1028 ? 17.231  -92.230  69.645  1.00 83.45  ? 1028 THR A CB    1 
ATOM   7920  O  OG1   . THR A 1  1028 ? 18.549  -92.021  69.147  1.00 85.07  ? 1028 THR A OG1   1 
ATOM   7921  C  CG2   . THR A 1  1028 ? 16.811  -93.664  69.375  1.00 82.69  ? 1028 THR A CG2   1 
ATOM   7922  N  N     . ARG A 1  1029 ? 14.614  -90.631  70.694  1.00 73.55  ? 1029 ARG A N     1 
ATOM   7923  C  CA    . ARG A 1  1029 ? 13.279  -90.590  71.278  1.00 73.69  ? 1029 ARG A CA    1 
ATOM   7924  C  C     . ARG A 1  1029 ? 12.326  -89.867  70.335  1.00 76.69  ? 1029 ARG A C     1 
ATOM   7925  O  O     . ARG A 1  1029 ? 11.382  -90.501  69.875  1.00 77.27  ? 1029 ARG A O     1 
ATOM   7926  C  CB    . ARG A 1  1029 ? 13.282  -89.956  72.684  1.00 74.02  ? 1029 ARG A CB    1 
ATOM   7927  C  CG    . ARG A 1  1029 ? 12.008  -90.214  73.509  1.00 86.88  ? 1029 ARG A CG    1 
ATOM   7928  C  CD    . ARG A 1  1029 ? 11.858  -91.681  73.885  1.00 100.61 ? 1029 ARG A CD    1 
ATOM   7929  N  NE    . ARG A 1  1029 ? 10.727  -91.931  74.776  1.00 109.10 ? 1029 ARG A NE    1 
ATOM   7930  C  CZ    . ARG A 1  1029 ? 10.842  -92.217  76.068  1.00 122.54 ? 1029 ARG A CZ    1 
ATOM   7931  N  NH1   . ARG A 1  1029 ? 12.039  -92.278  76.638  1.00 107.07 ? 1029 ARG A NH1   1 
ATOM   7932  N  NH2   . ARG A 1  1029 ? 9.761   -92.441  76.802  1.00 112.21 ? 1029 ARG A NH2   1 
ATOM   7933  N  N     . ARG A 1  1030 ? 12.631  -88.586  69.975  1.00 71.59  ? 1030 ARG A N     1 
ATOM   7934  C  CA    . ARG A 1  1030 ? 11.838  -87.719  69.082  1.00 70.25  ? 1030 ARG A CA    1 
ATOM   7935  C  C     . ARG A 1  1030 ? 11.470  -88.354  67.744  1.00 73.88  ? 1030 ARG A C     1 
ATOM   7936  O  O     . ARG A 1  1030 ? 10.308  -88.297  67.346  1.00 73.16  ? 1030 ARG A O     1 
ATOM   7937  C  CB    . ARG A 1  1030 ? 12.534  -86.371  68.844  1.00 69.59  ? 1030 ARG A CB    1 
ATOM   7938  C  CG    . ARG A 1  1030 ? 12.483  -85.433  70.040  1.00 81.88  ? 1030 ARG A CG    1 
ATOM   7939  C  CD    . ARG A 1  1030 ? 12.947  -84.036  69.675  1.00 87.58  ? 1030 ARG A CD    1 
ATOM   7940  N  NE    . ARG A 1  1030 ? 11.855  -83.204  69.171  1.00 89.63  ? 1030 ARG A NE    1 
ATOM   7941  C  CZ    . ARG A 1  1030 ? 11.966  -81.911  68.889  1.00 99.24  ? 1030 ARG A CZ    1 
ATOM   7942  N  NH1   . ARG A 1  1030 ? 13.125  -81.286  69.052  1.00 82.72  ? 1030 ARG A NH1   1 
ATOM   7943  N  NH2   . ARG A 1  1030 ? 10.920  -81.232  68.438  1.00 86.73  ? 1030 ARG A NH2   1 
ATOM   7944  N  N     . VAL A 1  1031 ? 12.453  -88.967  67.063  1.00 70.72  ? 1031 VAL A N     1 
ATOM   7945  C  CA    . VAL A 1  1031 ? 12.260  -89.621  65.766  1.00 71.36  ? 1031 VAL A CA    1 
ATOM   7946  C  C     . VAL A 1  1031 ? 11.189  -90.723  65.856  1.00 77.05  ? 1031 VAL A C     1 
ATOM   7947  O  O     . VAL A 1  1031 ? 10.330  -90.815  64.979  1.00 76.77  ? 1031 VAL A O     1 
ATOM   7948  C  CB    . VAL A 1  1031 ? 13.614  -90.111  65.169  1.00 75.80  ? 1031 VAL A CB    1 
ATOM   7949  C  CG1   . VAL A 1  1031 ? 13.416  -90.929  63.894  1.00 76.89  ? 1031 VAL A CG1   1 
ATOM   7950  C  CG2   . VAL A 1  1031 ? 14.556  -88.937  64.898  1.00 73.73  ? 1031 VAL A CG2   1 
ATOM   7951  N  N     . LEU A 1  1032 ? 11.207  -91.504  66.942  1.00 75.65  ? 1032 LEU A N     1 
ATOM   7952  C  CA    . LEU A 1  1032 ? 10.264  -92.605  67.151  1.00 77.98  ? 1032 LEU A CA    1 
ATOM   7953  C  C     . LEU A 1  1032 ? 8.961   -92.205  67.857  1.00 82.72  ? 1032 LEU A C     1 
ATOM   7954  O  O     . LEU A 1  1032 ? 7.881   -92.609  67.420  1.00 83.10  ? 1032 LEU A O     1 
ATOM   7955  C  CB    . LEU A 1  1032 ? 10.944  -93.775  67.889  1.00 79.68  ? 1032 LEU A CB    1 
ATOM   7956  C  CG    . LEU A 1  1032 ? 12.124  -94.444  67.188  1.00 84.98  ? 1032 LEU A CG    1 
ATOM   7957  C  CD1   . LEU A 1  1032 ? 13.037  -95.092  68.186  1.00 86.31  ? 1032 LEU A CD1   1 
ATOM   7958  C  CD2   . LEU A 1  1032 ? 11.662  -95.466  66.170  1.00 89.24  ? 1032 LEU A CD2   1 
ATOM   7959  N  N     . GLN A 1  1033 ? 9.069   -91.448  68.960  1.00 78.93  ? 1033 GLN A N     1 
ATOM   7960  C  CA    . GLN A 1  1033 ? 7.948   -91.001  69.783  1.00 78.88  ? 1033 GLN A CA    1 
ATOM   7961  C  C     . GLN A 1  1033 ? 7.112   -89.910  69.085  1.00 82.69  ? 1033 GLN A C     1 
ATOM   7962  O  O     . GLN A 1  1033 ? 5.910   -90.110  68.895  1.00 83.21  ? 1033 GLN A O     1 
ATOM   7963  C  CB    . GLN A 1  1033 ? 8.466   -90.555  71.168  1.00 79.42  ? 1033 GLN A CB    1 
ATOM   7964  C  CG    . GLN A 1  1033 ? 7.431   -89.943  72.096  1.00 92.22  ? 1033 GLN A CG    1 
ATOM   7965  C  CD    . GLN A 1  1033 ? 6.847   -90.970  73.015  1.00 108.83 ? 1033 GLN A CD    1 
ATOM   7966  O  OE1   . GLN A 1  1033 ? 5.913   -91.694  72.655  1.00 106.32 ? 1033 GLN A OE1   1 
ATOM   7967  N  NE2   . GLN A 1  1033 ? 7.382   -91.045  74.226  1.00 97.01  ? 1033 GLN A NE2   1 
ATOM   7968  N  N     . GLU A 1  1034 ? 7.741   -88.770  68.712  1.00 78.02  ? 1034 GLU A N     1 
ATOM   7969  C  CA    . GLU A 1  1034 ? 7.062   -87.638  68.069  1.00 76.67  ? 1034 GLU A CA    1 
ATOM   7970  C  C     . GLU A 1  1034 ? 6.723   -87.913  66.601  1.00 80.51  ? 1034 GLU A C     1 
ATOM   7971  O  O     . GLU A 1  1034 ? 5.571   -88.212  66.281  1.00 80.33  ? 1034 GLU A O     1 
ATOM   7972  C  CB    . GLU A 1  1034 ? 7.881   -86.324  68.202  1.00 76.11  ? 1034 GLU A CB    1 
ATOM   7973  C  CG    . GLU A 1  1034 ? 7.902   -85.692  69.589  1.00 87.86  ? 1034 GLU A CG    1 
ATOM   7974  C  CD    . GLU A 1  1034 ? 8.426   -84.265  69.680  1.00 106.16 ? 1034 GLU A CD    1 
ATOM   7975  O  OE1   . GLU A 1  1034 ? 8.224   -83.484  68.720  1.00 98.51  ? 1034 GLU A OE1   1 
ATOM   7976  O  OE2   . GLU A 1  1034 ? 8.992   -83.911  70.741  1.00 95.87  ? 1034 GLU A OE2   1 
ATOM   7977  N  N     . TYR A 1  1035 ? 7.742   -87.814  65.725  1.00 77.06  ? 1035 TYR A N     1 
ATOM   7978  C  CA    . TYR A 1  1035 ? 7.684   -87.949  64.268  1.00 77.22  ? 1035 TYR A CA    1 
ATOM   7979  C  C     . TYR A 1  1035 ? 7.117   -89.260  63.762  1.00 83.60  ? 1035 TYR A C     1 
ATOM   7980  O  O     . TYR A 1  1035 ? 6.359   -89.251  62.791  1.00 83.87  ? 1035 TYR A O     1 
ATOM   7981  C  CB    . TYR A 1  1035 ? 9.067   -87.701  63.643  1.00 77.72  ? 1035 TYR A CB    1 
ATOM   7982  C  CG    . TYR A 1  1035 ? 9.772   -86.456  64.130  1.00 78.36  ? 1035 TYR A CG    1 
ATOM   7983  C  CD1   . TYR A 1  1035 ? 11.159  -86.405  64.210  1.00 80.20  ? 1035 TYR A CD1   1 
ATOM   7984  C  CD2   . TYR A 1  1035 ? 9.055   -85.319  64.491  1.00 78.50  ? 1035 TYR A CD2   1 
ATOM   7985  C  CE1   . TYR A 1  1035 ? 11.816  -85.258  64.656  1.00 80.57  ? 1035 TYR A CE1   1 
ATOM   7986  C  CE2   . TYR A 1  1035 ? 9.697   -84.173  64.954  1.00 78.46  ? 1035 TYR A CE2   1 
ATOM   7987  C  CZ    . TYR A 1  1035 ? 11.079  -84.144  65.030  1.00 87.74  ? 1035 TYR A CZ    1 
ATOM   7988  O  OH    . TYR A 1  1035 ? 11.700  -83.000  65.472  1.00 89.03  ? 1035 TYR A OH    1 
ATOM   7989  N  N     . ARG A 1  1036 ? 7.497   -90.381  64.403  1.00 81.62  ? 1036 ARG A N     1 
ATOM   7990  C  CA    . ARG A 1  1036 ? 7.062   -91.739  64.062  1.00 83.75  ? 1036 ARG A CA    1 
ATOM   7991  C  C     . ARG A 1  1036 ? 7.450   -92.128  62.617  1.00 87.87  ? 1036 ARG A C     1 
ATOM   7992  O  O     . ARG A 1  1036 ? 6.660   -92.738  61.887  1.00 88.92  ? 1036 ARG A O     1 
ATOM   7993  C  CB    . ARG A 1  1036 ? 5.565   -91.959  64.402  1.00 85.48  ? 1036 ARG A CB    1 
ATOM   7994  C  CG    . ARG A 1  1036 ? 5.256   -91.671  65.877  1.00 98.96  ? 1036 ARG A CG    1 
ATOM   7995  C  CD    . ARG A 1  1036 ? 3.865   -92.065  66.332  1.00 112.88 ? 1036 ARG A CD    1 
ATOM   7996  N  NE    . ARG A 1  1036 ? 3.637   -93.510  66.287  1.00 125.95 ? 1036 ARG A NE    1 
ATOM   7997  C  CZ    . ARG A 1  1036 ? 3.916   -94.346  67.280  1.00 140.38 ? 1036 ARG A CZ    1 
ATOM   7998  N  NH1   . ARG A 1  1036 ? 4.449   -93.894  68.408  1.00 129.34 ? 1036 ARG A NH1   1 
ATOM   7999  N  NH2   . ARG A 1  1036 ? 3.668   -95.644  67.152  1.00 125.77 ? 1036 ARG A NH2   1 
ATOM   8000  N  N     . LEU A 1  1037 ? 8.700   -91.768  62.229  1.00 82.65  ? 1037 LEU A N     1 
ATOM   8001  C  CA    . LEU A 1  1037 ? 9.302   -92.017  60.910  1.00 82.04  ? 1037 LEU A CA    1 
ATOM   8002  C  C     . LEU A 1  1037 ? 9.695   -93.480  60.712  1.00 87.32  ? 1037 LEU A C     1 
ATOM   8003  O  O     . LEU A 1  1037 ? 9.940   -94.184  61.689  1.00 88.11  ? 1037 LEU A O     1 
ATOM   8004  C  CB    . LEU A 1  1037 ? 10.557  -91.139  60.720  1.00 80.06  ? 1037 LEU A CB    1 
ATOM   8005  C  CG    . LEU A 1  1037 ? 10.353  -89.632  60.643  1.00 81.93  ? 1037 LEU A CG    1 
ATOM   8006  C  CD1   . LEU A 1  1037 ? 11.598  -88.904  61.071  1.00 80.74  ? 1037 LEU A CD1   1 
ATOM   8007  C  CD2   . LEU A 1  1037 ? 9.976   -89.202  59.249  1.00 83.59  ? 1037 LEU A CD2   1 
ATOM   8008  N  N     . THR A 1  1038 ? 9.775   -93.925  59.445  1.00 84.00  ? 1038 THR A N     1 
ATOM   8009  C  CA    . THR A 1  1038 ? 10.219  -95.274  59.072  1.00 85.91  ? 1038 THR A CA    1 
ATOM   8010  C  C     . THR A 1  1038 ? 11.670  -95.175  58.578  1.00 89.51  ? 1038 THR A C     1 
ATOM   8011  O  O     . THR A 1  1038 ? 12.179  -94.060  58.456  1.00 86.86  ? 1038 THR A O     1 
ATOM   8012  C  CB    . THR A 1  1038 ? 9.287   -95.915  58.026  1.00 93.02  ? 1038 THR A CB    1 
ATOM   8013  O  OG1   . THR A 1  1038 ? 9.065   -95.009  56.945  1.00 90.94  ? 1038 THR A OG1   1 
ATOM   8014  C  CG2   . THR A 1  1038 ? 7.970   -96.378  58.618  1.00 91.89  ? 1038 THR A CG2   1 
ATOM   8015  N  N     . LYS A 1  1039 ? 12.341  -96.323  58.317  1.00 88.11  ? 1039 LYS A N     1 
ATOM   8016  C  CA    . LYS A 1  1039 ? 13.720  -96.359  57.816  1.00 87.84  ? 1039 LYS A CA    1 
ATOM   8017  C  C     . LYS A 1  1039 ? 13.805  -95.650  56.457  1.00 91.46  ? 1039 LYS A C     1 
ATOM   8018  O  O     . LYS A 1  1039 ? 14.684  -94.807  56.269  1.00 89.84  ? 1039 LYS A O     1 
ATOM   8019  C  CB    . LYS A 1  1039 ? 14.256  -97.810  57.748  1.00 92.39  ? 1039 LYS A CB    1 
ATOM   8020  C  CG    . LYS A 1  1039 ? 15.601  -98.005  57.020  1.00 101.05 ? 1039 LYS A CG    1 
ATOM   8021  C  CD    . LYS A 1  1039 ? 16.795  -97.353  57.725  1.00 108.01 ? 1039 LYS A CD    1 
ATOM   8022  C  CE    . LYS A 1  1039 ? 18.037  -97.338  56.865  1.00 115.35 ? 1039 LYS A CE    1 
ATOM   8023  N  NZ    . LYS A 1  1039 ? 19.041  -96.354  57.361  1.00 119.42 ? 1039 LYS A NZ    1 
ATOM   8024  N  N     . GLN A 1  1040 ? 12.856  -95.957  55.546  1.00 88.97  ? 1040 GLN A N     1 
ATOM   8025  C  CA    . GLN A 1  1040 ? 12.742  -95.358  54.212  1.00 88.16  ? 1040 GLN A CA    1 
ATOM   8026  C  C     . GLN A 1  1040 ? 12.529  -93.837  54.312  1.00 87.87  ? 1040 GLN A C     1 
ATOM   8027  O  O     . GLN A 1  1040 ? 13.224  -93.077  53.634  1.00 85.62  ? 1040 GLN A O     1 
ATOM   8028  C  CB    . GLN A 1  1040 ? 11.591  -96.022  53.425  1.00 91.37  ? 1040 GLN A CB    1 
ATOM   8029  C  CG    . GLN A 1  1040 ? 11.517  -95.634  51.943  1.00 104.78 ? 1040 GLN A CG    1 
ATOM   8030  C  CD    . GLN A 1  1040 ? 10.133  -95.782  51.349  1.00 124.40 ? 1040 GLN A CD    1 
ATOM   8031  O  OE1   . GLN A 1  1040 ? 9.148   -96.090  52.034  1.00 120.17 ? 1040 GLN A OE1   1 
ATOM   8032  N  NE2   . GLN A 1  1040 ? 10.019  -95.520  50.055  1.00 117.59 ? 1040 GLN A NE2   1 
ATOM   8033  N  N     . ALA A 1  1041 ? 11.589  -93.407  55.173  1.00 83.43  ? 1041 ALA A N     1 
ATOM   8034  C  CA    . ALA A 1  1041 ? 11.288  -91.997  55.390  1.00 81.18  ? 1041 ALA A CA    1 
ATOM   8035  C  C     . ALA A 1  1041 ? 12.463  -91.266  56.049  1.00 85.61  ? 1041 ALA A C     1 
ATOM   8036  O  O     . ALA A 1  1041 ? 12.859  -90.213  55.549  1.00 83.86  ? 1041 ALA A O     1 
ATOM   8037  C  CB    . ALA A 1  1041 ? 10.028  -91.849  56.225  1.00 81.61  ? 1041 ALA A CB    1 
ATOM   8038  N  N     . PHE A 1  1042 ? 13.040  -91.843  57.139  1.00 83.98  ? 1042 PHE A N     1 
ATOM   8039  C  CA    . PHE A 1  1042 ? 14.179  -91.288  57.884  1.00 82.96  ? 1042 PHE A CA    1 
ATOM   8040  C  C     . PHE A 1  1042 ? 15.410  -91.089  56.991  1.00 87.45  ? 1042 PHE A C     1 
ATOM   8041  O  O     . PHE A 1  1042 ? 16.061  -90.042  57.081  1.00 85.82  ? 1042 PHE A O     1 
ATOM   8042  C  CB    . PHE A 1  1042 ? 14.516  -92.154  59.115  1.00 85.85  ? 1042 PHE A CB    1 
ATOM   8043  C  CG    . PHE A 1  1042 ? 15.661  -91.659  59.969  1.00 86.47  ? 1042 PHE A CG    1 
ATOM   8044  C  CD1   . PHE A 1  1042 ? 15.515  -90.537  60.778  1.00 87.67  ? 1042 PHE A CD1   1 
ATOM   8045  C  CD2   . PHE A 1  1042 ? 16.877  -92.333  59.989  1.00 89.75  ? 1042 PHE A CD2   1 
ATOM   8046  C  CE1   . PHE A 1  1042 ? 16.574  -90.082  61.571  1.00 87.76  ? 1042 PHE A CE1   1 
ATOM   8047  C  CE2   . PHE A 1  1042 ? 17.934  -91.881  60.790  1.00 91.74  ? 1042 PHE A CE2   1 
ATOM   8048  C  CZ    . PHE A 1  1042 ? 17.773  -90.762  61.579  1.00 87.95  ? 1042 PHE A CZ    1 
ATOM   8049  N  N     . ASP A 1  1043 ? 15.701  -92.073  56.114  1.00 85.52  ? 1043 ASP A N     1 
ATOM   8050  C  CA    . ASP A 1  1043 ? 16.818  -92.012  55.172  1.00 85.58  ? 1043 ASP A CA    1 
ATOM   8051  C  C     . ASP A 1  1043 ? 16.677  -90.835  54.201  1.00 88.93  ? 1043 ASP A C     1 
ATOM   8052  O  O     . ASP A 1  1043 ? 17.669  -90.149  53.946  1.00 87.66  ? 1043 ASP A O     1 
ATOM   8053  C  CB    . ASP A 1  1043 ? 16.950  -93.333  54.403  1.00 89.51  ? 1043 ASP A CB    1 
ATOM   8054  C  CG    . ASP A 1  1043 ? 18.065  -94.248  54.871  1.00 99.67  ? 1043 ASP A CG    1 
ATOM   8055  O  OD1   . ASP A 1  1043 ? 18.671  -93.960  55.930  1.00 99.72  ? 1043 ASP A OD1   1 
ATOM   8056  O  OD2   . ASP A 1  1043 ? 18.334  -95.250  54.179  1.00 106.79 ? 1043 ASP A OD2   1 
ATOM   8057  N  N     . TRP A 1  1044 ? 15.439  -90.591  53.691  1.00 85.64  ? 1044 TRP A N     1 
ATOM   8058  C  CA    . TRP A 1  1044 ? 15.088  -89.499  52.769  1.00 84.26  ? 1044 TRP A CA    1 
ATOM   8059  C  C     . TRP A 1  1044 ? 15.299  -88.141  53.432  1.00 84.16  ? 1044 TRP A C     1 
ATOM   8060  O  O     . TRP A 1  1044 ? 15.801  -87.217  52.787  1.00 82.16  ? 1044 TRP A O     1 
ATOM   8061  C  CB    . TRP A 1  1044 ? 13.627  -89.642  52.294  1.00 84.02  ? 1044 TRP A CB    1 
ATOM   8062  C  CG    . TRP A 1  1044 ? 13.138  -88.559  51.367  1.00 84.14  ? 1044 TRP A CG    1 
ATOM   8063  C  CD1   . TRP A 1  1044 ? 13.288  -88.509  50.011  1.00 87.45  ? 1044 TRP A CD1   1 
ATOM   8064  C  CD2   . TRP A 1  1044 ? 12.365  -87.402  51.728  1.00 82.42  ? 1044 TRP A CD2   1 
ATOM   8065  N  NE1   . TRP A 1  1044 ? 12.683  -87.378  49.508  1.00 85.34  ? 1044 TRP A NE1   1 
ATOM   8066  C  CE2   . TRP A 1  1044 ? 12.098  -86.688  50.538  1.00 85.49  ? 1044 TRP A CE2   1 
ATOM   8067  C  CE3   . TRP A 1  1044 ? 11.890  -86.886  52.947  1.00 82.76  ? 1044 TRP A CE3   1 
ATOM   8068  C  CZ2   . TRP A 1  1044 ? 11.371  -85.493  50.531  1.00 83.14  ? 1044 TRP A CZ2   1 
ATOM   8069  C  CZ3   . TRP A 1  1044 ? 11.177  -85.696  52.937  1.00 82.46  ? 1044 TRP A CZ3   1 
ATOM   8070  C  CH2   . TRP A 1  1044 ? 10.919  -85.018  51.742  1.00 82.36  ? 1044 TRP A CH2   1 
ATOM   8071  N  N     . VAL A 1  1045 ? 14.915  -88.033  54.721  1.00 79.43  ? 1045 VAL A N     1 
ATOM   8072  C  CA    . VAL A 1  1045 ? 15.054  -86.830  55.541  1.00 76.97  ? 1045 VAL A CA    1 
ATOM   8073  C  C     . VAL A 1  1045 ? 16.531  -86.454  55.625  1.00 79.16  ? 1045 VAL A C     1 
ATOM   8074  O  O     . VAL A 1  1045 ? 16.878  -85.289  55.426  1.00 77.16  ? 1045 VAL A O     1 
ATOM   8075  C  CB    . VAL A 1  1045 ? 14.404  -87.032  56.933  1.00 81.08  ? 1045 VAL A CB    1 
ATOM   8076  C  CG1   . VAL A 1  1045 ? 14.850  -85.965  57.929  1.00 79.41  ? 1045 VAL A CG1   1 
ATOM   8077  C  CG2   . VAL A 1  1045 ? 12.889  -87.048  56.819  1.00 81.10  ? 1045 VAL A CG2   1 
ATOM   8078  N  N     . LEU A 1  1046 ? 17.390  -87.456  55.855  1.00 76.47  ? 1046 LEU A N     1 
ATOM   8079  C  CA    . LEU A 1  1046 ? 18.836  -87.296  55.944  1.00 76.24  ? 1046 LEU A CA    1 
ATOM   8080  C  C     . LEU A 1  1046 ? 19.463  -86.788  54.635  1.00 79.97  ? 1046 LEU A C     1 
ATOM   8081  O  O     . LEU A 1  1046 ? 20.297  -85.884  54.675  1.00 78.04  ? 1046 LEU A O     1 
ATOM   8082  C  CB    . LEU A 1  1046 ? 19.478  -88.611  56.421  1.00 78.24  ? 1046 LEU A CB    1 
ATOM   8083  C  CG    . LEU A 1  1046 ? 19.837  -88.702  57.920  1.00 82.92  ? 1046 LEU A CG    1 
ATOM   8084  C  CD1   . LEU A 1  1046 ? 18.614  -88.545  58.825  1.00 82.52  ? 1046 LEU A CD1   1 
ATOM   8085  C  CD2   . LEU A 1  1046 ? 20.522  -90.010  58.235  1.00 87.39  ? 1046 LEU A CD2   1 
ATOM   8086  N  N     . SER A 1  1047 ? 19.021  -87.327  53.480  1.00 78.32  ? 1047 SER A N     1 
ATOM   8087  C  CA    . SER A 1  1047 ? 19.506  -86.927  52.153  1.00 78.33  ? 1047 SER A CA    1 
ATOM   8088  C  C     . SER A 1  1047 ? 19.088  -85.499  51.808  1.00 80.65  ? 1047 SER A C     1 
ATOM   8089  O  O     . SER A 1  1047 ? 19.887  -84.754  51.232  1.00 79.65  ? 1047 SER A O     1 
ATOM   8090  C  CB    . SER A 1  1047 ? 19.008  -87.891  51.081  1.00 84.05  ? 1047 SER A CB    1 
ATOM   8091  O  OG    . SER A 1  1047 ? 19.699  -89.128  51.136  1.00 97.49  ? 1047 SER A OG    1 
ATOM   8092  N  N     . ASN A 1  1048 ? 17.842  -85.125  52.178  1.00 76.56  ? 1048 ASN A N     1 
ATOM   8093  C  CA    . ASN A 1  1048 ? 17.246  -83.802  51.956  1.00 74.52  ? 1048 ASN A CA    1 
ATOM   8094  C  C     . ASN A 1  1048 ? 17.970  -82.687  52.714  1.00 75.47  ? 1048 ASN A C     1 
ATOM   8095  O  O     . ASN A 1  1048 ? 18.219  -81.634  52.130  1.00 73.55  ? 1048 ASN A O     1 
ATOM   8096  C  CB    . ASN A 1  1048 ? 15.751  -83.817  52.297  1.00 76.96  ? 1048 ASN A CB    1 
ATOM   8097  C  CG    . ASN A 1  1048 ? 14.842  -83.974  51.103  1.00 105.51 ? 1048 ASN A CG    1 
ATOM   8098  O  OD1   . ASN A 1  1048 ? 14.027  -83.094  50.813  1.00 101.75 ? 1048 ASN A OD1   1 
ATOM   8099  N  ND2   . ASN A 1  1048 ? 14.952  -85.094  50.388  1.00 99.14  ? 1048 ASN A ND2   1 
ATOM   8100  N  N     . ILE A 1  1049 ? 18.319  -82.924  53.998  1.00 71.67  ? 1049 ILE A N     1 
ATOM   8101  C  CA    . ILE A 1  1049 ? 19.050  -81.971  54.837  1.00 70.40  ? 1049 ILE A CA    1 
ATOM   8102  C  C     . ILE A 1  1049 ? 20.398  -81.631  54.183  1.00 74.21  ? 1049 ILE A C     1 
ATOM   8103  O  O     . ILE A 1  1049 ? 20.670  -80.453  53.937  1.00 72.78  ? 1049 ILE A O     1 
ATOM   8104  C  CB    . ILE A 1  1049 ? 19.221  -82.496  56.298  1.00 74.14  ? 1049 ILE A CB    1 
ATOM   8105  C  CG1   . ILE A 1  1049 ? 17.867  -82.548  57.036  1.00 74.35  ? 1049 ILE A CG1   1 
ATOM   8106  C  CG2   . ILE A 1  1049 ? 20.245  -81.653  57.089  1.00 74.11  ? 1049 ILE A CG2   1 
ATOM   8107  C  CD1   . ILE A 1  1049 ? 17.834  -83.418  58.289  1.00 81.26  ? 1049 ILE A CD1   1 
ATOM   8108  N  N     . GLU A 1  1050 ? 21.220  -82.669  53.891  1.00 71.80  ? 1050 GLU A N     1 
ATOM   8109  C  CA    . GLU A 1  1050 ? 22.550  -82.557  53.282  1.00 71.89  ? 1050 GLU A CA    1 
ATOM   8110  C  C     . GLU A 1  1050 ? 22.508  -81.731  51.992  1.00 74.12  ? 1050 GLU A C     1 
ATOM   8111  O  O     . GLU A 1  1050 ? 23.248  -80.751  51.864  1.00 71.72  ? 1050 GLU A O     1 
ATOM   8112  C  CB    . GLU A 1  1050 ? 23.147  -83.959  53.034  1.00 75.46  ? 1050 GLU A CB    1 
ATOM   8113  C  CG    . GLU A 1  1050 ? 24.672  -83.997  53.012  1.00 88.05  ? 1050 GLU A CG    1 
ATOM   8114  C  CD    . GLU A 1  1050 ? 25.343  -84.435  51.719  1.00 113.27 ? 1050 GLU A CD    1 
ATOM   8115  O  OE1   . GLU A 1  1050 ? 26.582  -84.615  51.736  1.00 101.12 ? 1050 GLU A OE1   1 
ATOM   8116  O  OE2   . GLU A 1  1050 ? 24.645  -84.576  50.688  1.00 113.09 ? 1050 GLU A OE2   1 
ATOM   8117  N  N     . ALA A 1  1051 ? 21.595  -82.099  51.073  1.00 71.55  ? 1051 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1  1051 ? 21.396  -81.433  49.791  1.00 71.02  ? 1051 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1  1051 ? 21.021  -79.964  49.963  1.00 73.50  ? 1051 ALA A C     1 
ATOM   8120  O  O     . ALA A 1  1051 ? 21.636  -79.114  49.320  1.00 72.97  ? 1051 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1  1051 ? 20.336  -82.160  48.987  1.00 72.61  ? 1051 ALA A CB    1 
ATOM   8122  N  N     . GLN A 1  1052 ? 20.052  -79.663  50.856  1.00 69.10  ? 1052 GLN A N     1 
ATOM   8123  C  CA    . GLN A 1  1052 ? 19.592  -78.297  51.126  1.00 67.17  ? 1052 GLN A CA    1 
ATOM   8124  C  C     . GLN A 1  1052 ? 20.651  -77.436  51.797  1.00 70.43  ? 1052 GLN A C     1 
ATOM   8125  O  O     . GLN A 1  1052 ? 20.683  -76.231  51.552  1.00 69.25  ? 1052 GLN A O     1 
ATOM   8126  C  CB    . GLN A 1  1052 ? 18.302  -78.295  51.952  1.00 67.97  ? 1052 GLN A CB    1 
ATOM   8127  C  CG    . GLN A 1  1052 ? 17.041  -78.380  51.110  1.00 84.37  ? 1052 GLN A CG    1 
ATOM   8128  C  CD    . GLN A 1  1052 ? 15.823  -78.735  51.931  1.00 107.37 ? 1052 GLN A CD    1 
ATOM   8129  O  OE1   . GLN A 1  1052 ? 15.415  -78.007  52.850  1.00 101.65 ? 1052 GLN A OE1   1 
ATOM   8130  N  NE2   . GLN A 1  1052 ? 15.201  -79.858  51.600  1.00 102.55 ? 1052 GLN A NE2   1 
ATOM   8131  N  N     . PHE A 1  1053 ? 21.508  -78.043  52.645  1.00 67.45  ? 1053 PHE A N     1 
ATOM   8132  C  CA    . PHE A 1  1053 ? 22.583  -77.339  53.349  1.00 66.52  ? 1053 PHE A CA    1 
ATOM   8133  C  C     . PHE A 1  1053 ? 23.631  -76.814  52.364  1.00 71.45  ? 1053 PHE A C     1 
ATOM   8134  O  O     . PHE A 1  1053 ? 23.991  -75.636  52.431  1.00 70.35  ? 1053 PHE A O     1 
ATOM   8135  C  CB    . PHE A 1  1053 ? 23.221  -78.231  54.425  1.00 68.84  ? 1053 PHE A CB    1 
ATOM   8136  C  CG    . PHE A 1  1053 ? 24.340  -77.577  55.199  1.00 69.65  ? 1053 PHE A CG    1 
ATOM   8137  C  CD1   . PHE A 1  1053 ? 24.073  -76.830  56.338  1.00 71.53  ? 1053 PHE A CD1   1 
ATOM   8138  C  CD2   . PHE A 1  1053 ? 25.661  -77.711  54.792  1.00 72.40  ? 1053 PHE A CD2   1 
ATOM   8139  C  CE1   . PHE A 1  1053 ? 25.107  -76.226  57.055  1.00 72.14  ? 1053 PHE A CE1   1 
ATOM   8140  C  CE2   . PHE A 1  1053 ? 26.693  -77.096  55.501  1.00 75.00  ? 1053 PHE A CE2   1 
ATOM   8141  C  CZ    . PHE A 1  1053 ? 26.409  -76.362  56.630  1.00 72.10  ? 1053 PHE A CZ    1 
ATOM   8142  N  N     . LEU A 1  1054 ? 24.102  -77.683  51.444  1.00 69.38  ? 1054 LEU A N     1 
ATOM   8143  C  CA    . LEU A 1  1054 ? 25.082  -77.334  50.406  1.00 69.28  ? 1054 LEU A CA    1 
ATOM   8144  C  C     . LEU A 1  1054 ? 24.486  -76.284  49.452  1.00 71.16  ? 1054 LEU A C     1 
ATOM   8145  O  O     . LEU A 1  1054 ? 25.209  -75.426  48.944  1.00 70.23  ? 1054 LEU A O     1 
ATOM   8146  C  CB    . LEU A 1  1054 ? 25.520  -78.592  49.633  1.00 71.00  ? 1054 LEU A CB    1 
ATOM   8147  C  CG    . LEU A 1  1054 ? 26.111  -79.724  50.468  1.00 76.73  ? 1054 LEU A CG    1 
ATOM   8148  C  CD1   . LEU A 1  1054 ? 25.870  -81.052  49.816  1.00 78.75  ? 1054 LEU A CD1   1 
ATOM   8149  C  CD2   . LEU A 1  1054 ? 27.588  -79.522  50.708  1.00 79.89  ? 1054 LEU A CD2   1 
ATOM   8150  N  N     . ARG A 1  1055 ? 23.155  -76.343  49.262  1.00 66.76  ? 1055 ARG A N     1 
ATOM   8151  C  CA    . ARG A 1  1055 ? 22.347  -75.430  48.460  1.00 65.76  ? 1055 ARG A CA    1 
ATOM   8152  C  C     . ARG A 1  1055 ? 22.239  -74.055  49.162  1.00 68.20  ? 1055 ARG A C     1 
ATOM   8153  O  O     . ARG A 1  1055 ? 22.082  -73.029  48.491  1.00 67.06  ? 1055 ARG A O     1 
ATOM   8154  C  CB    . ARG A 1  1055 ? 20.950  -76.040  48.295  1.00 66.50  ? 1055 ARG A CB    1 
ATOM   8155  C  CG    . ARG A 1  1055 ? 20.125  -75.491  47.146  1.00 77.90  ? 1055 ARG A CG    1 
ATOM   8156  C  CD    . ARG A 1  1055 ? 18.711  -76.035  47.207  1.00 87.91  ? 1055 ARG A CD    1 
ATOM   8157  N  NE    . ARG A 1  1055 ? 18.654  -77.477  46.960  1.00 96.59  ? 1055 ARG A NE    1 
ATOM   8158  C  CZ    . ARG A 1  1055 ? 17.608  -78.246  47.245  1.00 113.69 ? 1055 ARG A CZ    1 
ATOM   8159  N  NH1   . ARG A 1  1055 ? 16.521  -77.723  47.799  1.00 101.56 ? 1055 ARG A NH1   1 
ATOM   8160  N  NH2   . ARG A 1  1055 ? 17.642  -79.545  46.982  1.00 104.31 ? 1055 ARG A NH2   1 
ATOM   8161  N  N     . SER A 1  1056 ? 22.320  -74.051  50.511  1.00 63.79  ? 1056 SER A N     1 
ATOM   8162  C  CA    . SER A 1  1056 ? 22.229  -72.861  51.360  1.00 61.65  ? 1056 SER A CA    1 
ATOM   8163  C  C     . SER A 1  1056 ? 23.522  -72.037  51.437  1.00 64.92  ? 1056 SER A C     1 
ATOM   8164  O  O     . SER A 1  1056 ? 23.468  -70.860  51.807  1.00 63.37  ? 1056 SER A O     1 
ATOM   8165  C  CB    . SER A 1  1056 ? 21.747  -73.237  52.759  1.00 63.90  ? 1056 SER A CB    1 
ATOM   8166  O  OG    . SER A 1  1056 ? 20.399  -73.681  52.732  1.00 70.53  ? 1056 SER A OG    1 
ATOM   8167  N  N     . VAL A 1  1057 ? 24.672  -72.650  51.087  1.00 62.29  ? 1057 VAL A N     1 
ATOM   8168  C  CA    . VAL A 1  1057 ? 26.006  -72.030  51.118  1.00 62.17  ? 1057 VAL A CA    1 
ATOM   8169  C  C     . VAL A 1  1057 ? 26.120  -70.862  50.128  1.00 65.65  ? 1057 VAL A C     1 
ATOM   8170  O  O     . VAL A 1  1057 ? 25.576  -70.939  49.018  1.00 65.44  ? 1057 VAL A O     1 
ATOM   8171  C  CB    . VAL A 1  1057 ? 27.124  -73.095  50.937  1.00 67.73  ? 1057 VAL A CB    1 
ATOM   8172  C  CG1   . VAL A 1  1057 ? 28.517  -72.469  50.881  1.00 67.83  ? 1057 VAL A CG1   1 
ATOM   8173  C  CG2   . VAL A 1  1057 ? 27.062  -74.143  52.044  1.00 68.28  ? 1057 VAL A CG2   1 
ATOM   8174  N  N     . VAL A 1  1058 ? 26.802  -69.771  50.557  1.00 62.02  ? 1058 VAL A N     1 
ATOM   8175  C  CA    . VAL A 1  1058 ? 27.044  -68.557  49.767  1.00 61.48  ? 1058 VAL A CA    1 
ATOM   8176  C  C     . VAL A 1  1058 ? 27.944  -68.844  48.551  1.00 66.81  ? 1058 VAL A C     1 
ATOM   8177  O  O     . VAL A 1  1058 ? 28.925  -69.591  48.659  1.00 67.59  ? 1058 VAL A O     1 
ATOM   8178  C  CB    . VAL A 1  1058 ? 27.531  -67.360  50.635  1.00 64.51  ? 1058 VAL A CB    1 
ATOM   8179  C  CG1   . VAL A 1  1058 ? 28.935  -67.590  51.204  1.00 65.36  ? 1058 VAL A CG1   1 
ATOM   8180  C  CG2   . VAL A 1  1058 ? 27.449  -66.036  49.873  1.00 63.53  ? 1058 VAL A CG2   1 
ATOM   8181  N  N     . HIS A 1  1059 ? 27.579  -68.274  47.394  1.00 63.44  ? 1059 HIS A N     1 
ATOM   8182  C  CA    . HIS A 1  1059 ? 28.312  -68.475  46.149  1.00 64.35  ? 1059 HIS A CA    1 
ATOM   8183  C  C     . HIS A 1  1059 ? 29.483  -67.497  46.016  1.00 67.68  ? 1059 HIS A C     1 
ATOM   8184  O  O     . HIS A 1  1059 ? 29.247  -66.292  46.113  1.00 65.78  ? 1059 HIS A O     1 
ATOM   8185  C  CB    . HIS A 1  1059 ? 27.368  -68.327  44.941  1.00 64.92  ? 1059 HIS A CB    1 
ATOM   8186  C  CG    . HIS A 1  1059 ? 26.369  -69.433  44.768  1.00 68.64  ? 1059 HIS A CG    1 
ATOM   8187  N  ND1   . HIS A 1  1059 ? 25.698  -69.602  43.574  1.00 70.98  ? 1059 HIS A ND1   1 
ATOM   8188  C  CD2   . HIS A 1  1059 ? 25.940  -70.374  45.644  1.00 70.56  ? 1059 HIS A CD2   1 
ATOM   8189  C  CE1   . HIS A 1  1059 ? 24.894  -70.637  43.752  1.00 70.79  ? 1059 HIS A CE1   1 
ATOM   8190  N  NE2   . HIS A 1  1059 ? 25.006  -71.136  44.982  1.00 70.84  ? 1059 HIS A NE2   1 
ATOM   8191  N  N     . PRO A 1  1060 ? 30.737  -67.965  45.756  1.00 65.47  ? 1060 PRO A N     1 
ATOM   8192  C  CA    . PRO A 1  1060 ? 31.847  -67.017  45.563  1.00 65.68  ? 1060 PRO A CA    1 
ATOM   8193  C  C     . PRO A 1  1060 ? 31.558  -66.094  44.389  1.00 70.49  ? 1060 PRO A C     1 
ATOM   8194  O  O     . PRO A 1  1060 ? 30.933  -66.505  43.403  1.00 70.39  ? 1060 PRO A O     1 
ATOM   8195  C  CB    . PRO A 1  1060 ? 33.052  -67.918  45.282  1.00 69.03  ? 1060 PRO A CB    1 
ATOM   8196  C  CG    . PRO A 1  1060 ? 32.683  -69.238  45.823  1.00 73.86  ? 1060 PRO A CG    1 
ATOM   8197  C  CD    . PRO A 1  1060 ? 31.206  -69.356  45.607  1.00 68.39  ? 1060 PRO A CD    1 
ATOM   8198  N  N     . GLY A 1  1061 ? 31.971  -64.844  44.535  1.00 67.34  ? 1061 GLY A N     1 
ATOM   8199  C  CA    . GLY A 1  1061 ? 31.721  -63.797  43.556  1.00 66.95  ? 1061 GLY A CA    1 
ATOM   8200  C  C     . GLY A 1  1061 ? 30.656  -62.847  44.057  1.00 69.54  ? 1061 GLY A C     1 
ATOM   8201  O  O     . GLY A 1  1061 ? 30.563  -61.719  43.569  1.00 69.06  ? 1061 GLY A O     1 
ATOM   8202  N  N     . GLU A 1  1062 ? 29.859  -63.305  45.064  1.00 65.22  ? 1062 GLU A N     1 
ATOM   8203  C  CA    . GLU A 1  1062 ? 28.775  -62.572  45.728  1.00 63.43  ? 1062 GLU A CA    1 
ATOM   8204  C  C     . GLU A 1  1062 ? 29.306  -61.277  46.300  1.00 66.94  ? 1062 GLU A C     1 
ATOM   8205  O  O     . GLU A 1  1062 ? 30.157  -61.303  47.185  1.00 66.44  ? 1062 GLU A O     1 
ATOM   8206  C  CB    . GLU A 1  1062 ? 28.157  -63.417  46.858  1.00 64.32  ? 1062 GLU A CB    1 
ATOM   8207  C  CG    . GLU A 1  1062 ? 26.756  -63.940  46.575  1.00 73.66  ? 1062 GLU A CG    1 
ATOM   8208  C  CD    . GLU A 1  1062 ? 25.603  -63.021  46.939  1.00 89.25  ? 1062 GLU A CD    1 
ATOM   8209  O  OE1   . GLU A 1  1062 ? 25.858  -61.898  47.432  1.00 79.06  ? 1062 GLU A OE1   1 
ATOM   8210  O  OE2   . GLU A 1  1062 ? 24.437  -63.435  46.746  1.00 82.07  ? 1062 GLU A OE2   1 
ATOM   8211  N  N     . MET A 1  1063 ? 28.835  -60.145  45.764  1.00 64.03  ? 1063 MET A N     1 
ATOM   8212  C  CA    . MET A 1  1063 ? 29.256  -58.822  46.219  1.00 63.95  ? 1063 MET A CA    1 
ATOM   8213  C  C     . MET A 1  1063 ? 28.531  -58.497  47.529  1.00 66.75  ? 1063 MET A C     1 
ATOM   8214  O  O     . MET A 1  1063 ? 27.520  -57.788  47.557  1.00 66.00  ? 1063 MET A O     1 
ATOM   8215  C  CB    . MET A 1  1063 ? 29.043  -57.755  45.129  1.00 66.29  ? 1063 MET A CB    1 
ATOM   8216  C  CG    . MET A 1  1063 ? 29.831  -58.006  43.840  1.00 71.17  ? 1063 MET A CG    1 
ATOM   8217  S  SD    . MET A 1  1063 ? 31.623  -58.225  44.002  1.00 77.13  ? 1063 MET A SD    1 
ATOM   8218  C  CE    . MET A 1  1063 ? 32.096  -56.678  44.794  1.00 73.63  ? 1063 MET A CE    1 
ATOM   8219  N  N     . VAL A 1  1064 ? 29.042  -59.089  48.611  1.00 62.39  ? 1064 VAL A N     1 
ATOM   8220  C  CA    . VAL A 1  1064 ? 28.514  -58.979  49.966  1.00 60.81  ? 1064 VAL A CA    1 
ATOM   8221  C  C     . VAL A 1  1064 ? 28.708  -57.595  50.582  1.00 64.07  ? 1064 VAL A C     1 
ATOM   8222  O  O     . VAL A 1  1064 ? 27.953  -57.215  51.483  1.00 63.13  ? 1064 VAL A O     1 
ATOM   8223  C  CB    . VAL A 1  1064 ? 29.006  -60.131  50.875  1.00 64.80  ? 1064 VAL A CB    1 
ATOM   8224  C  CG1   . VAL A 1  1064 ? 28.424  -61.462  50.414  1.00 64.91  ? 1064 VAL A CG1   1 
ATOM   8225  C  CG2   . VAL A 1  1064 ? 30.529  -60.198  50.930  1.00 65.52  ? 1064 VAL A CG2   1 
ATOM   8226  N  N     . GLY A 1  1065 ? 29.700  -56.859  50.076  1.00 60.65  ? 1065 GLY A N     1 
ATOM   8227  C  CA    . GLY A 1  1065 ? 30.023  -55.509  50.517  1.00 60.04  ? 1065 GLY A CA    1 
ATOM   8228  C  C     . GLY A 1  1065 ? 28.887  -54.561  50.231  1.00 62.00  ? 1065 GLY A C     1 
ATOM   8229  O  O     . GLY A 1  1065 ? 28.318  -53.977  51.156  1.00 60.47  ? 1065 GLY A O     1 
ATOM   8230  N  N     . VAL A 1  1066 ? 28.502  -54.469  48.947  1.00 58.60  ? 1066 VAL A N     1 
ATOM   8231  C  CA    . VAL A 1  1066 ? 27.375  -53.632  48.511  1.00 57.43  ? 1066 VAL A CA    1 
ATOM   8232  C  C     . VAL A 1  1066 ? 26.078  -54.119  49.177  1.00 60.61  ? 1066 VAL A C     1 
ATOM   8233  O  O     . VAL A 1  1066 ? 25.306  -53.295  49.673  1.00 60.13  ? 1066 VAL A O     1 
ATOM   8234  C  CB    . VAL A 1  1066 ? 27.249  -53.542  46.971  1.00 60.81  ? 1066 VAL A CB    1 
ATOM   8235  C  CG1   . VAL A 1  1066 ? 26.147  -52.567  46.571  1.00 59.57  ? 1066 VAL A CG1   1 
ATOM   8236  C  CG2   . VAL A 1  1066 ? 28.575  -53.130  46.340  1.00 61.81  ? 1066 VAL A CG2   1 
ATOM   8237  N  N     . LEU A 1  1067 ? 25.884  -55.456  49.235  1.00 56.37  ? 1067 LEU A N     1 
ATOM   8238  C  CA    . LEU A 1  1067 ? 24.731  -56.099  49.854  1.00 55.31  ? 1067 LEU A CA    1 
ATOM   8239  C  C     . LEU A 1  1067 ? 24.541  -55.603  51.273  1.00 57.79  ? 1067 LEU A C     1 
ATOM   8240  O  O     . LEU A 1  1067 ? 23.441  -55.175  51.607  1.00 56.66  ? 1067 LEU A O     1 
ATOM   8241  C  CB    . LEU A 1  1067 ? 24.903  -57.627  49.869  1.00 56.20  ? 1067 LEU A CB    1 
ATOM   8242  C  CG    . LEU A 1  1067 ? 23.656  -58.470  49.575  1.00 61.56  ? 1067 LEU A CG    1 
ATOM   8243  C  CD1   . LEU A 1  1067 ? 24.020  -59.918  49.399  1.00 62.96  ? 1067 LEU A CD1   1 
ATOM   8244  C  CD2   . LEU A 1  1067 ? 22.597  -58.354  50.669  1.00 63.77  ? 1067 LEU A CD2   1 
ATOM   8245  N  N     . ALA A 1  1068 ? 25.609  -55.650  52.097  1.00 54.29  ? 1068 ALA A N     1 
ATOM   8246  C  CA    . ALA A 1  1068 ? 25.580  -55.233  53.498  1.00 53.40  ? 1068 ALA A CA    1 
ATOM   8247  C  C     . ALA A 1  1068 ? 25.232  -53.757  53.647  1.00 56.00  ? 1068 ALA A C     1 
ATOM   8248  O  O     . ALA A 1  1068 ? 24.326  -53.417  54.408  1.00 54.83  ? 1068 ALA A O     1 
ATOM   8249  C  CB    . ALA A 1  1068 ? 26.912  -55.534  54.162  1.00 54.85  ? 1068 ALA A CB    1 
ATOM   8250  N  N     . ALA A 1  1069 ? 25.920  -52.896  52.885  1.00 52.84  ? 1069 ALA A N     1 
ATOM   8251  C  CA    . ALA A 1  1069 ? 25.745  -51.447  52.876  1.00 52.74  ? 1069 ALA A CA    1 
ATOM   8252  C  C     . ALA A 1  1069 ? 24.292  -51.034  52.599  1.00 55.89  ? 1069 ALA A C     1 
ATOM   8253  O  O     . ALA A 1  1069 ? 23.728  -50.241  53.363  1.00 54.48  ? 1069 ALA A O     1 
ATOM   8254  C  CB    . ALA A 1  1069 ? 26.671  -50.835  51.843  1.00 54.22  ? 1069 ALA A CB    1 
ATOM   8255  N  N     . GLN A 1  1070 ? 23.689  -51.605  51.521  1.00 52.66  ? 1070 GLN A N     1 
ATOM   8256  C  CA    . GLN A 1  1070 ? 22.307  -51.371  51.075  1.00 51.57  ? 1070 GLN A CA    1 
ATOM   8257  C  C     . GLN A 1  1070 ? 21.295  -51.896  52.103  1.00 54.92  ? 1070 GLN A C     1 
ATOM   8258  O  O     . GLN A 1  1070 ? 20.287  -51.235  52.361  1.00 53.84  ? 1070 GLN A O     1 
ATOM   8259  C  CB    . GLN A 1  1070 ? 22.052  -52.030  49.708  1.00 52.65  ? 1070 GLN A CB    1 
ATOM   8260  C  CG    . GLN A 1  1070 ? 22.815  -51.408  48.538  1.00 67.05  ? 1070 GLN A CG    1 
ATOM   8261  C  CD    . GLN A 1  1070 ? 22.343  -51.910  47.184  1.00 82.92  ? 1070 GLN A CD    1 
ATOM   8262  O  OE1   . GLN A 1  1070 ? 21.988  -53.092  47.003  1.00 75.70  ? 1070 GLN A OE1   1 
ATOM   8263  N  NE2   . GLN A 1  1070 ? 22.344  -51.014  46.191  1.00 71.46  ? 1070 GLN A NE2   1 
ATOM   8264  N  N     . SER A 1  1071 ? 21.585  -53.076  52.697  1.00 51.91  ? 1071 SER A N     1 
ATOM   8265  C  CA    . SER A 1  1071 ? 20.759  -53.738  53.709  1.00 51.59  ? 1071 SER A CA    1 
ATOM   8266  C  C     . SER A 1  1071 ? 20.594  -52.893  54.967  1.00 56.42  ? 1071 SER A C     1 
ATOM   8267  O  O     . SER A 1  1071 ? 19.570  -53.013  55.633  1.00 55.19  ? 1071 SER A O     1 
ATOM   8268  C  CB    . SER A 1  1071 ? 21.332  -55.106  54.061  1.00 55.14  ? 1071 SER A CB    1 
ATOM   8269  O  OG    . SER A 1  1071 ? 21.304  -55.977  52.941  1.00 61.58  ? 1071 SER A OG    1 
ATOM   8270  N  N     . ILE A 1  1072 ? 21.608  -52.049  55.286  1.00 54.53  ? 1072 ILE A N     1 
ATOM   8271  C  CA    . ILE A 1  1072 ? 21.633  -51.115  56.423  1.00 54.47  ? 1072 ILE A CA    1 
ATOM   8272  C  C     . ILE A 1  1072 ? 21.060  -49.761  55.969  1.00 60.99  ? 1072 ILE A C     1 
ATOM   8273  O  O     . ILE A 1  1072 ? 20.186  -49.202  56.641  1.00 60.30  ? 1072 ILE A O     1 
ATOM   8274  C  CB    . ILE A 1  1072 ? 23.071  -50.962  56.995  1.00 57.30  ? 1072 ILE A CB    1 
ATOM   8275  C  CG1   . ILE A 1  1072 ? 23.614  -52.311  57.508  1.00 57.52  ? 1072 ILE A CG1   1 
ATOM   8276  C  CG2   . ILE A 1  1072 ? 23.114  -49.894  58.090  1.00 57.51  ? 1072 ILE A CG2   1 
ATOM   8277  C  CD1   . ILE A 1  1072 ? 25.147  -52.413  57.633  1.00 63.99  ? 1072 ILE A CD1   1 
ATOM   8278  N  N     . GLY A 1  1073 ? 21.574  -49.266  54.838  1.00 59.51  ? 1073 GLY A N     1 
ATOM   8279  C  CA    . GLY A 1  1073 ? 21.201  -47.997  54.224  1.00 60.13  ? 1073 GLY A CA    1 
ATOM   8280  C  C     . GLY A 1  1073 ? 19.724  -47.798  53.945  1.00 65.01  ? 1073 GLY A C     1 
ATOM   8281  O  O     . GLY A 1  1073 ? 19.186  -46.736  54.272  1.00 65.13  ? 1073 GLY A O     1 
ATOM   8282  N  N     . GLU A 1  1074 ? 19.056  -48.803  53.332  1.00 61.41  ? 1074 GLU A N     1 
ATOM   8283  C  CA    . GLU A 1  1074 ? 17.624  -48.728  53.030  1.00 61.15  ? 1074 GLU A CA    1 
ATOM   8284  C  C     . GLU A 1  1074 ? 16.747  -48.594  54.299  1.00 67.21  ? 1074 GLU A C     1 
ATOM   8285  O  O     . GLU A 1  1074 ? 16.018  -47.603  54.378  1.00 66.19  ? 1074 GLU A O     1 
ATOM   8286  C  CB    . GLU A 1  1074 ? 17.159  -49.876  52.117  1.00 62.13  ? 1074 GLU A CB    1 
ATOM   8287  C  CG    . GLU A 1  1074 ? 15.791  -49.646  51.483  1.00 72.86  ? 1074 GLU A CG    1 
ATOM   8288  C  CD    . GLU A 1  1074 ? 14.562  -50.146  52.227  1.00 93.83  ? 1074 GLU A CD    1 
ATOM   8289  O  OE1   . GLU A 1  1074 ? 14.706  -50.941  53.187  1.00 76.85  ? 1074 GLU A OE1   1 
ATOM   8290  O  OE2   . GLU A 1  1074 ? 13.442  -49.761  51.820  1.00 90.82  ? 1074 GLU A OE2   1 
ATOM   8291  N  N     . PRO A 1  1075 ? 16.813  -49.501  55.319  1.00 66.39  ? 1075 PRO A N     1 
ATOM   8292  C  CA    . PRO A 1  1075 ? 15.966  -49.318  56.513  1.00 67.21  ? 1075 PRO A CA    1 
ATOM   8293  C  C     . PRO A 1  1075 ? 16.174  -47.984  57.226  1.00 74.12  ? 1075 PRO A C     1 
ATOM   8294  O  O     . PRO A 1  1075 ? 15.238  -47.487  57.857  1.00 73.88  ? 1075 PRO A O     1 
ATOM   8295  C  CB    . PRO A 1  1075 ? 16.357  -50.502  57.402  1.00 68.77  ? 1075 PRO A CB    1 
ATOM   8296  C  CG    . PRO A 1  1075 ? 16.846  -51.528  56.458  1.00 72.35  ? 1075 PRO A CG    1 
ATOM   8297  C  CD    . PRO A 1  1075 ? 17.601  -50.745  55.438  1.00 67.91  ? 1075 PRO A CD    1 
ATOM   8298  N  N     . ALA A 1  1076 ? 17.385  -47.397  57.089  1.00 72.87  ? 1076 ALA A N     1 
ATOM   8299  C  CA    . ALA A 1  1076 ? 17.753  -46.111  57.674  1.00 74.33  ? 1076 ALA A CA    1 
ATOM   8300  C  C     . ALA A 1  1076 ? 16.942  -44.970  57.073  1.00 80.88  ? 1076 ALA A C     1 
ATOM   8301  O  O     . ALA A 1  1076 ? 16.526  -44.075  57.804  1.00 80.84  ? 1076 ALA A O     1 
ATOM   8302  C  CB    . ALA A 1  1076 ? 19.238  -45.855  57.492  1.00 75.61  ? 1076 ALA A CB    1 
ATOM   8303  N  N     . THR A 1  1077 ? 16.681  -45.022  55.758  1.00 79.61  ? 1077 THR A N     1 
ATOM   8304  C  CA    . THR A 1  1077 ? 15.896  -44.004  55.049  1.00 80.57  ? 1077 THR A CA    1 
ATOM   8305  C  C     . THR A 1  1077 ? 14.430  -44.039  55.483  1.00 88.05  ? 1077 THR A C     1 
ATOM   8306  O  O     . THR A 1  1077 ? 13.755  -43.010  55.463  1.00 87.73  ? 1077 THR A O     1 
ATOM   8307  C  CB    . THR A 1  1077 ? 16.039  -44.166  53.530  1.00 83.82  ? 1077 THR A CB    1 
ATOM   8308  O  OG1   . THR A 1  1077 ? 15.457  -45.404  53.119  1.00 77.84  ? 1077 THR A OG1   1 
ATOM   8309  C  CG2   . THR A 1  1077 ? 17.487  -44.069  53.060  1.00 82.82  ? 1077 THR A CG2   1 
ATOM   8310  N  N     . GLN A 1  1078 ? 13.962  -45.231  55.893  1.00 87.50  ? 1078 GLN A N     1 
ATOM   8311  C  CA    . GLN A 1  1078 ? 12.596  -45.518  56.331  1.00 88.60  ? 1078 GLN A CA    1 
ATOM   8312  C  C     . GLN A 1  1078 ? 12.326  -45.146  57.800  1.00 96.67  ? 1078 GLN A C     1 
ATOM   8313  O  O     . GLN A 1  1078 ? 11.189  -45.284  58.257  1.00 96.54  ? 1078 GLN A O     1 
ATOM   8314  C  CB    . GLN A 1  1078 ? 12.259  -47.008  56.081  1.00 89.37  ? 1078 GLN A CB    1 
ATOM   8315  C  CG    . GLN A 1  1078 ? 12.417  -47.481  54.633  1.00 100.11 ? 1078 GLN A CG    1 
ATOM   8316  C  CD    . GLN A 1  1078 ? 11.318  -46.981  53.731  1.00 117.25 ? 1078 GLN A CD    1 
ATOM   8317  O  OE1   . GLN A 1  1078 ? 10.241  -47.581  53.640  1.00 112.06 ? 1078 GLN A OE1   1 
ATOM   8318  N  NE2   . GLN A 1  1078 ? 11.573  -45.875  53.038  1.00 108.35 ? 1078 GLN A NE2   1 
ATOM   8319  N  N     . MET A 1  1079 ? 13.349  -44.672  58.534  1.00 96.38  ? 1079 MET A N     1 
ATOM   8320  C  CA    . MET A 1  1079 ? 13.199  -44.312  59.946  1.00 98.30  ? 1079 MET A CA    1 
ATOM   8321  C  C     . MET A 1  1079 ? 12.299  -43.096  60.163  1.00 109.71 ? 1079 MET A C     1 
ATOM   8322  O  O     . MET A 1  1079 ? 12.340  -42.159  59.367  1.00 109.22 ? 1079 MET A O     1 
ATOM   8323  C  CB    . MET A 1  1079 ? 14.553  -44.208  60.653  1.00 100.43 ? 1079 MET A CB    1 
ATOM   8324  C  CG    . MET A 1  1079 ? 15.295  -45.531  60.650  1.00 102.90 ? 1079 MET A CG    1 
ATOM   8325  S  SD    . MET A 1  1079 ? 16.468  -45.764  61.991  1.00 106.81 ? 1079 MET A SD    1 
ATOM   8326  C  CE    . MET A 1  1079 ? 17.880  -44.932  61.326  1.00 103.82 ? 1079 MET A CE    1 
ATOM   8327  N  N     . THR A 1  1080 ? 11.432  -43.159  61.200  1.00 112.23 ? 1080 THR A N     1 
ATOM   8328  C  CA    . THR A 1  1080 ? 10.423  -42.136  61.513  1.00 115.07 ? 1080 THR A CA    1 
ATOM   8329  C  C     . THR A 1  1080 ? 10.760  -41.149  62.640  1.00 125.74 ? 1080 THR A C     1 
ATOM   8330  O  O     . THR A 1  1080 ? 11.056  -39.990  62.350  1.00 125.41 ? 1080 THR A O     1 
ATOM   8331  C  CB    . THR A 1  1080 ? 9.005   -42.744  61.585  1.00 123.22 ? 1080 THR A CB    1 
ATOM   8332  O  OG1   . THR A 1  1080 ? 9.075   -44.116  61.997  1.00 122.40 ? 1080 THR A OG1   1 
ATOM   8333  C  CG2   . THR A 1  1080 ? 8.263   -42.640  60.262  1.00 120.88 ? 1080 THR A CG2   1 
ATOM   8334  N  N     . LEU A 1  1081 ? 10.672  -41.584  63.914  1.00 128.09 ? 1081 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1  1081 ? 10.958  -40.726  65.070  1.00 131.53 ? 1081 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1  1081 ? 12.452  -40.796  65.447  1.00 141.38 ? 1081 LEU A C     1 
ATOM   8337  O  O     . LEU A 1  1081 ? 12.844  -41.546  66.352  1.00 140.98 ? 1081 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1  1081 ? 10.034  -41.063  66.264  1.00 132.11 ? 1081 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1  1081 ? 9.272   -39.885  66.881  1.00 137.76 ? 1081 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1  1081 ? 7.878   -40.302  67.308  1.00 138.15 ? 1081 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1  1081 ? 10.036  -39.278  68.051  1.00 140.75 ? 1081 LEU A CD2   1 
ATOM   8342  N  N     . ASN A 1  1082 ? 13.281  -40.007  64.721  1.00 142.32 ? 1082 ASN A N     1 
ATOM   8343  C  CA    . ASN A 1  1082 ? 14.740  -39.935  64.887  1.00 144.29 ? 1082 ASN A CA    1 
ATOM   8344  C  C     . ASN A 1  1082 ? 15.231  -39.419  66.249  1.00 153.13 ? 1082 ASN A C     1 
ATOM   8345  O  O     . ASN A 1  1082 ? 16.373  -39.703  66.616  1.00 153.25 ? 1082 ASN A O     1 
ATOM   8346  C  CB    . ASN A 1  1082 ? 15.418  -39.205  63.709  1.00 146.20 ? 1082 ASN A CB    1 
ATOM   8347  C  CG    . ASN A 1  1082 ? 15.262  -37.695  63.652  1.00 174.63 ? 1082 ASN A CG    1 
ATOM   8348  O  OD1   . ASN A 1  1082 ? 14.296  -37.103  64.154  1.00 171.45 ? 1082 ASN A OD1   1 
ATOM   8349  N  ND2   . ASN A 1  1082 ? 16.204  -37.037  62.989  1.00 166.69 ? 1082 ASN A ND2   1 
ATOM   8350  N  N     . THR A 1  1083 ? 14.382  -38.677  66.997  1.00 152.95 ? 1083 THR A N     1 
ATOM   8351  C  CA    . THR A 1  1083 ? 14.728  -38.167  68.329  1.00 155.06 ? 1083 THR A CA    1 
ATOM   8352  C  C     . THR A 1  1083 ? 14.777  -39.378  69.289  1.00 161.08 ? 1083 THR A C     1 
ATOM   8353  O  O     . THR A 1  1083 ? 15.867  -39.901  69.541  1.00 160.70 ? 1083 THR A O     1 
ATOM   8354  C  CB    . THR A 1  1083 ? 13.779  -37.012  68.749  1.00 164.53 ? 1083 THR A CB    1 
ATOM   8355  O  OG1   . THR A 1  1083 ? 13.624  -36.097  67.660  1.00 164.16 ? 1083 THR A OG1   1 
ATOM   8356  C  CG2   . THR A 1  1083 ? 14.276  -36.256  69.983  1.00 164.25 ? 1083 THR A CG2   1 
ATOM   8357  N  N     . PHE A 1  1084 ? 13.595  -39.845  69.765  1.00 159.11 ? 1084 PHE A N     1 
ATOM   8358  C  CA    . PHE A 1  1084 ? 13.367  -41.012  70.636  1.00 159.30 ? 1084 PHE A CA    1 
ATOM   8359  C  C     . PHE A 1  1084 ? 11.872  -41.229  70.887  1.00 164.33 ? 1084 PHE A C     1 
ATOM   8360  O  O     . PHE A 1  1084 ? 11.143  -40.265  71.134  1.00 164.66 ? 1084 PHE A O     1 
ATOM   8361  C  CB    . PHE A 1  1084 ? 14.151  -40.960  71.977  1.00 162.02 ? 1084 PHE A CB    1 
ATOM   8362  C  CG    . PHE A 1  1084 ? 14.328  -39.608  72.635  1.00 164.94 ? 1084 PHE A CG    1 
ATOM   8363  C  CD1   . PHE A 1  1084 ? 13.273  -38.994  73.301  1.00 168.98 ? 1084 PHE A CD1   1 
ATOM   8364  C  CD2   . PHE A 1  1084 ? 15.567  -38.977  72.641  1.00 167.62 ? 1084 PHE A CD2   1 
ATOM   8365  C  CE1   . PHE A 1  1084 ? 13.443  -37.751  73.920  1.00 171.26 ? 1084 PHE A CE1   1 
ATOM   8366  C  CE2   . PHE A 1  1084 ? 15.737  -37.734  73.260  1.00 171.81 ? 1084 PHE A CE2   1 
ATOM   8367  C  CZ    . PHE A 1  1084 ? 14.673  -37.129  73.892  1.00 170.77 ? 1084 PHE A CZ    1 
ATOM   8368  N  N     . HIS A 1  1085 ? 11.421  -42.497  70.821  1.00 161.14 ? 1085 HIS A N     1 
ATOM   8369  C  CA    . HIS A 1  1085 ? 10.027  -42.887  71.076  1.00 161.53 ? 1085 HIS A CA    1 
ATOM   8370  C  C     . HIS A 1  1085 ? 9.793   -43.021  72.601  1.00 166.56 ? 1085 HIS A C     1 
ATOM   8371  O  O     . HIS A 1  1085 ? 8.653   -43.189  73.046  1.00 166.62 ? 1085 HIS A O     1 
ATOM   8372  C  CB    . HIS A 1  1085 ? 9.693   -44.203  70.339  1.00 161.46 ? 1085 HIS A CB    1 
ATOM   8373  C  CG    . HIS A 1  1085 ? 8.275   -44.298  69.855  1.00 164.88 ? 1085 HIS A CG    1 
ATOM   8374  N  ND1   . HIS A 1  1085 ? 7.376   -45.188  70.419  1.00 166.90 ? 1085 HIS A ND1   1 
ATOM   8375  C  CD2   . HIS A 1  1085 ? 7.651   -43.618  68.863  1.00 166.47 ? 1085 HIS A CD2   1 
ATOM   8376  C  CE1   . HIS A 1  1085 ? 6.239   -45.015  69.763  1.00 166.28 ? 1085 HIS A CE1   1 
ATOM   8377  N  NE2   . HIS A 1  1085 ? 6.356   -44.080  68.819  1.00 166.33 ? 1085 HIS A NE2   1 
ATOM   8378  N  N     . PHE A 1  1086 ? 10.890  -42.906  73.388  1.00 163.45 ? 1086 PHE A N     1 
ATOM   8379  C  CA    . PHE A 1  1086 ? 10.960  -42.988  74.854  1.00 164.01 ? 1086 PHE A CA    1 
ATOM   8380  C  C     . PHE A 1  1086 ? 10.804  -41.588  75.510  1.00 168.24 ? 1086 PHE A C     1 
ATOM   8381  O  O     . PHE A 1  1086 ? 11.146  -41.411  76.684  1.00 168.39 ? 1086 PHE A O     1 
ATOM   8382  C  CB    . PHE A 1  1086 ? 12.300  -43.641  75.282  1.00 165.62 ? 1086 PHE A CB    1 
ATOM   8383  C  CG    . PHE A 1  1086 ? 12.834  -44.745  74.394  1.00 165.97 ? 1086 PHE A CG    1 
ATOM   8384  C  CD1   . PHE A 1  1086 ? 12.426  -46.062  74.571  1.00 168.56 ? 1086 PHE A CD1   1 
ATOM   8385  C  CD2   . PHE A 1  1086 ? 13.765  -44.470  73.398  1.00 167.51 ? 1086 PHE A CD2   1 
ATOM   8386  C  CE1   . PHE A 1  1086 ? 12.923  -47.082  73.752  1.00 168.44 ? 1086 PHE A CE1   1 
ATOM   8387  C  CE2   . PHE A 1  1086 ? 14.258  -45.489  72.577  1.00 169.29 ? 1086 PHE A CE2   1 
ATOM   8388  C  CZ    . PHE A 1  1086 ? 13.837  -46.789  72.763  1.00 166.95 ? 1086 PHE A CZ    1 
ATOM   8389  N  N     . ALA A 1  1087 ? 10.264  -40.609  74.742  1.00 164.56 ? 1087 ALA A N     1 
ATOM   8390  C  CA    . ALA A 1  1087 ? 10.034  -39.212  75.142  1.00 165.35 ? 1087 ALA A CA    1 
ATOM   8391  C  C     . ALA A 1  1087 ? 8.962   -39.017  76.231  1.00 169.42 ? 1087 ALA A C     1 
ATOM   8392  O  O     . ALA A 1  1087 ? 8.931   -37.958  76.866  1.00 170.36 ? 1087 ALA A O     1 
ATOM   8393  C  CB    . ALA A 1  1087 ? 9.700   -38.366  73.918  1.00 165.78 ? 1087 ALA A CB    1 
ATOM   8394  N  N     . GLY A 1  1088 ? 8.105   -40.025  76.424  1.00 164.56 ? 1088 GLY A N     1 
ATOM   8395  C  CA    . GLY A 1  1088 ? 7.037   -40.021  77.421  1.00 164.93 ? 1088 GLY A CA    1 
ATOM   8396  C  C     . GLY A 1  1088 ? 7.533   -39.921  78.852  1.00 168.52 ? 1088 GLY A C     1 
ATOM   8397  O  O     . GLY A 1  1088 ? 6.895   -39.267  79.683  1.00 169.41 ? 1088 GLY A O     1 
ATOM   8398  N  N     . VAL A 1  1089 ? 8.687   -40.566  79.142  1.00 163.43 ? 1089 VAL A N     1 
ATOM   8399  C  CA    . VAL A 1  1089 ? 9.335   -40.563  80.462  1.00 163.58 ? 1089 VAL A CA    1 
ATOM   8400  C  C     . VAL A 1  1089 ? 10.627  -39.714  80.402  1.00 165.32 ? 1089 VAL A C     1 
ATOM   8401  O  O     . VAL A 1  1089 ? 11.410  -39.844  79.455  1.00 163.71 ? 1089 VAL A O     1 
ATOM   8402  C  CB    . VAL A 1  1089 ? 9.575   -41.993  81.041  1.00 167.12 ? 1089 VAL A CB    1 
ATOM   8403  C  CG1   . VAL A 1  1089 ? 9.940   -41.941  82.525  1.00 168.22 ? 1089 VAL A CG1   1 
ATOM   8404  C  CG2   . VAL A 1  1089 ? 8.362   -42.897  80.828  1.00 166.58 ? 1089 VAL A CG2   1 
ATOM   8405  N  N     . ALA A 1  1090 ? 10.822  -38.837  81.412  1.00 161.39 ? 1090 ALA A N     1 
ATOM   8406  C  CA    . ALA A 1  1090 ? 11.959  -37.915  81.533  1.00 160.67 ? 1090 ALA A CA    1 
ATOM   8407  C  C     . ALA A 1  1090 ? 13.329  -38.571  81.825  1.00 161.18 ? 1090 ALA A C     1 
ATOM   8408  O  O     . ALA A 1  1090 ? 14.358  -37.918  81.631  1.00 161.21 ? 1090 ALA A O     1 
ATOM   8409  C  CB    . ALA A 1  1090 ? 11.649  -36.838  82.566  1.00 163.28 ? 1090 ALA A CB    1 
ATOM   8410  N  N     . SER A 1  1091 ? 13.344  -39.846  82.277  1.00 154.47 ? 1091 SER A N     1 
ATOM   8411  C  CA    . SER A 1  1091 ? 14.570  -40.594  82.606  1.00 152.46 ? 1091 SER A CA    1 
ATOM   8412  C  C     . SER A 1  1091 ? 15.057  -41.536  81.469  1.00 151.31 ? 1091 SER A C     1 
ATOM   8413  O  O     . SER A 1  1091 ? 15.989  -42.324  81.678  1.00 150.74 ? 1091 SER A O     1 
ATOM   8414  C  CB    . SER A 1  1091 ? 14.385  -41.362  83.914  1.00 156.09 ? 1091 SER A CB    1 
ATOM   8415  O  OG    . SER A 1  1091 ? 15.600  -41.946  84.352  1.00 163.41 ? 1091 SER A OG    1 
ATOM   8416  N  N     . LYS A 1  1092 ? 14.440  -41.428  80.268  1.00 143.66 ? 1092 LYS A N     1 
ATOM   8417  C  CA    . LYS A 1  1092 ? 14.749  -42.236  79.077  1.00 140.21 ? 1092 LYS A CA    1 
ATOM   8418  C  C     . LYS A 1  1092 ? 15.235  -41.345  77.901  1.00 138.84 ? 1092 LYS A C     1 
ATOM   8419  O  O     . LYS A 1  1092 ? 14.824  -41.540  76.749  1.00 137.29 ? 1092 LYS A O     1 
ATOM   8420  C  CB    . LYS A 1  1092 ? 13.510  -43.069  78.678  1.00 142.07 ? 1092 LYS A CB    1 
ATOM   8421  C  CG    . LYS A 1  1092 ? 13.245  -44.300  79.555  1.00 154.55 ? 1092 LYS A CG    1 
ATOM   8422  C  CD    . LYS A 1  1092 ? 11.747  -44.636  79.683  1.00 161.83 ? 1092 LYS A CD    1 
ATOM   8423  C  CE    . LYS A 1  1092 ? 11.116  -45.268  78.460  1.00 166.53 ? 1092 LYS A CE    1 
ATOM   8424  N  NZ    . LYS A 1  1092 ? 9.633   -45.181  78.498  1.00 172.42 ? 1092 LYS A NZ    1 
ATOM   8425  N  N     . LYS A 1  1093 ? 16.131  -40.381  78.207  1.00 132.35 ? 1093 LYS A N     1 
ATOM   8426  C  CA    . LYS A 1  1093 ? 16.671  -39.413  77.244  1.00 130.07 ? 1093 LYS A CA    1 
ATOM   8427  C  C     . LYS A 1  1093 ? 17.990  -39.862  76.587  1.00 127.73 ? 1093 LYS A C     1 
ATOM   8428  O  O     . LYS A 1  1093 ? 19.070  -39.448  77.016  1.00 128.02 ? 1093 LYS A O     1 
ATOM   8429  C  CB    . LYS A 1  1093 ? 16.802  -38.005  77.882  1.00 134.22 ? 1093 LYS A CB    1 
ATOM   8430  C  CG    . LYS A 1  1093 ? 15.523  -37.450  78.524  1.00 149.55 ? 1093 LYS A CG    1 
ATOM   8431  C  CD    . LYS A 1  1093 ? 14.510  -36.939  77.502  1.00 159.75 ? 1093 LYS A CD    1 
ATOM   8432  C  CE    . LYS A 1  1093 ? 13.151  -36.690  78.105  1.00 170.60 ? 1093 LYS A CE    1 
ATOM   8433  N  NZ    . LYS A 1  1093 ? 12.139  -36.378  77.062  1.00 178.88 ? 1093 LYS A NZ    1 
ATOM   8434  N  N     . VAL A 1  1094 ? 17.890  -40.706  75.539  1.00 118.57 ? 1094 VAL A N     1 
ATOM   8435  C  CA    . VAL A 1  1094 ? 19.037  -41.219  74.772  1.00 115.40 ? 1094 VAL A CA    1 
ATOM   8436  C  C     . VAL A 1  1094 ? 18.875  -40.968  73.277  1.00 113.33 ? 1094 VAL A C     1 
ATOM   8437  O  O     . VAL A 1  1094 ? 17.833  -41.311  72.709  1.00 112.15 ? 1094 VAL A O     1 
ATOM   8438  C  CB    . VAL A 1  1094 ? 19.410  -42.696  75.066  1.00 118.34 ? 1094 VAL A CB    1 
ATOM   8439  C  CG1   . VAL A 1  1094 ? 20.356  -42.800  76.255  1.00 119.03 ? 1094 VAL A CG1   1 
ATOM   8440  C  CG2   . VAL A 1  1094 ? 18.174  -43.574  75.257  1.00 117.54 ? 1094 VAL A CG2   1 
ATOM   8441  N  N     . THR A 1  1095 ? 19.907  -40.369  72.645  1.00 105.95 ? 1095 THR A N     1 
ATOM   8442  C  CA    . THR A 1  1095 ? 19.926  -40.058  71.212  1.00 103.18 ? 1095 THR A CA    1 
ATOM   8443  C  C     . THR A 1  1095 ? 19.866  -41.344  70.392  1.00 101.97 ? 1095 THR A C     1 
ATOM   8444  O  O     . THR A 1  1095 ? 20.827  -42.111  70.392  1.00 101.49 ? 1095 THR A O     1 
ATOM   8445  C  CB    . THR A 1  1095 ? 21.125  -39.158  70.840  1.00 109.13 ? 1095 THR A CB    1 
ATOM   8446  O  OG1   . THR A 1  1095 ? 22.342  -39.750  71.301  1.00 107.96 ? 1095 THR A OG1   1 
ATOM   8447  C  CG2   . THR A 1  1095 ? 20.991  -37.745  71.384  1.00 108.04 ? 1095 THR A CG2   1 
ATOM   8448  N  N     . SER A 1  1096 ? 18.704  -41.613  69.769  1.00 94.74  ? 1096 SER A N     1 
ATOM   8449  C  CA    . SER A 1  1096 ? 18.466  -42.804  68.945  1.00 91.86  ? 1096 SER A CA    1 
ATOM   8450  C  C     . SER A 1  1096 ? 18.291  -42.408  67.470  1.00 91.17  ? 1096 SER A C     1 
ATOM   8451  O  O     . SER A 1  1096 ? 18.706  -41.313  67.090  1.00 91.18  ? 1096 SER A O     1 
ATOM   8452  C  CB    . SER A 1  1096 ? 17.266  -43.597  69.467  1.00 94.93  ? 1096 SER A CB    1 
ATOM   8453  O  OG    . SER A 1  1096 ? 16.050  -42.876  69.362  1.00 103.76 ? 1096 SER A OG    1 
ATOM   8454  N  N     . GLY A 1  1097 ? 17.739  -43.315  66.663  1.00 83.72  ? 1097 GLY A N     1 
ATOM   8455  C  CA    . GLY A 1  1097 ? 17.465  -43.111  65.244  1.00 81.62  ? 1097 GLY A CA    1 
ATOM   8456  C  C     . GLY A 1  1097 ? 18.635  -42.675  64.386  1.00 82.68  ? 1097 GLY A C     1 
ATOM   8457  O  O     . GLY A 1  1097 ? 19.763  -43.135  64.582  1.00 82.24  ? 1097 GLY A O     1 
ATOM   8458  N  N     . VAL A 1  1098 ? 18.352  -41.774  63.424  1.00 77.38  ? 1098 VAL A N     1 
ATOM   8459  C  CA    . VAL A 1  1098 ? 19.301  -41.204  62.455  1.00 76.48  ? 1098 VAL A CA    1 
ATOM   8460  C  C     . VAL A 1  1098 ? 20.474  -40.449  63.110  1.00 79.40  ? 1098 VAL A C     1 
ATOM   8461  O  O     . VAL A 1  1098 ? 21.614  -40.748  62.743  1.00 80.05  ? 1098 VAL A O     1 
ATOM   8462  C  CB    . VAL A 1  1098 ? 18.613  -40.376  61.337  1.00 80.10  ? 1098 VAL A CB    1 
ATOM   8463  C  CG1   . VAL A 1  1098 ? 19.612  -39.967  60.254  1.00 80.06  ? 1098 VAL A CG1   1 
ATOM   8464  C  CG2   . VAL A 1  1098 ? 17.445  -41.141  60.725  1.00 79.03  ? 1098 VAL A CG2   1 
ATOM   8465  N  N     . PRO A 1  1099 ? 20.274  -39.499  64.064  1.00 73.80  ? 1099 PRO A N     1 
ATOM   8466  C  CA    . PRO A 1  1099 ? 21.441  -38.828  64.663  1.00 73.57  ? 1099 PRO A CA    1 
ATOM   8467  C  C     . PRO A 1  1099 ? 22.403  -39.795  65.351  1.00 72.99  ? 1099 PRO A C     1 
ATOM   8468  O  O     . PRO A 1  1099 ? 23.614  -39.572  65.285  1.00 73.75  ? 1099 PRO A O     1 
ATOM   8469  C  CB    . PRO A 1  1099 ? 20.822  -37.836  65.653  1.00 76.62  ? 1099 PRO A CB    1 
ATOM   8470  C  CG    . PRO A 1  1099 ? 19.457  -38.353  65.920  1.00 80.78  ? 1099 PRO A CG    1 
ATOM   8471  C  CD    . PRO A 1  1099 ? 19.016  -38.980  64.639  1.00 75.26  ? 1099 PRO A CD    1 
ATOM   8472  N  N     . ARG A 1  1100 ? 21.874  -40.878  65.974  1.00 64.39  ? 1100 ARG A N     1 
ATOM   8473  C  CA    . ARG A 1  1100 ? 22.707  -41.883  66.624  1.00 62.15  ? 1100 ARG A CA    1 
ATOM   8474  C  C     . ARG A 1  1100 ? 23.526  -42.617  65.590  1.00 62.66  ? 1100 ARG A C     1 
ATOM   8475  O  O     . ARG A 1  1100 ? 24.737  -42.737  65.759  1.00 63.00  ? 1100 ARG A O     1 
ATOM   8476  C  CB    . ARG A 1  1100 ? 21.881  -42.873  67.461  1.00 59.72  ? 1100 ARG A CB    1 
ATOM   8477  C  CG    . ARG A 1  1100 ? 22.711  -43.927  68.223  1.00 66.15  ? 1100 ARG A CG    1 
ATOM   8478  C  CD    . ARG A 1  1100 ? 23.822  -43.316  69.056  1.00 73.92  ? 1100 ARG A CD    1 
ATOM   8479  N  NE    . ARG A 1  1100 ? 24.628  -44.297  69.782  1.00 79.64  ? 1100 ARG A NE    1 
ATOM   8480  C  CZ    . ARG A 1  1100 ? 25.922  -44.138  70.046  1.00 92.59  ? 1100 ARG A CZ    1 
ATOM   8481  N  NH1   . ARG A 1  1100 ? 26.569  -43.062  69.613  1.00 81.87  ? 1100 ARG A NH1   1 
ATOM   8482  N  NH2   . ARG A 1  1100 ? 26.580  -45.054  70.742  1.00 74.71  ? 1100 ARG A NH2   1 
ATOM   8483  N  N     . LEU A 1  1101 ? 22.875  -43.081  64.513  1.00 56.09  ? 1101 LEU A N     1 
ATOM   8484  C  CA    . LEU A 1  1101 ? 23.541  -43.795  63.433  1.00 54.84  ? 1101 LEU A CA    1 
ATOM   8485  C  C     . LEU A 1  1101 ? 24.657  -42.925  62.855  1.00 60.52  ? 1101 LEU A C     1 
ATOM   8486  O  O     . LEU A 1  1101 ? 25.748  -43.435  62.587  1.00 60.65  ? 1101 LEU A O     1 
ATOM   8487  C  CB    . LEU A 1  1101 ? 22.519  -44.218  62.362  1.00 53.44  ? 1101 LEU A CB    1 
ATOM   8488  C  CG    . LEU A 1  1101 ? 23.045  -44.976  61.133  1.00 56.93  ? 1101 LEU A CG    1 
ATOM   8489  C  CD1   . LEU A 1  1101 ? 23.626  -46.337  61.510  1.00 56.49  ? 1101 LEU A CD1   1 
ATOM   8490  C  CD2   . LEU A 1  1101 ? 21.956  -45.126  60.086  1.00 57.78  ? 1101 LEU A CD2   1 
ATOM   8491  N  N     . LYS A 1  1102 ? 24.402  -41.603  62.746  1.00 58.13  ? 1102 LYS A N     1 
ATOM   8492  C  CA    . LYS A 1  1102 ? 25.356  -40.612  62.255  1.00 59.06  ? 1102 LYS A CA    1 
ATOM   8493  C  C     . LYS A 1  1102 ? 26.574  -40.535  63.189  1.00 64.99  ? 1102 LYS A C     1 
ATOM   8494  O  O     . LYS A 1  1102 ? 27.704  -40.579  62.697  1.00 65.38  ? 1102 LYS A O     1 
ATOM   8495  C  CB    . LYS A 1  1102 ? 24.687  -39.238  62.073  1.00 61.67  ? 1102 LYS A CB    1 
ATOM   8496  C  CG    . LYS A 1  1102 ? 25.208  -38.493  60.856  1.00 79.15  ? 1102 LYS A CG    1 
ATOM   8497  C  CD    . LYS A 1  1102 ? 25.119  -36.985  61.020  1.00 93.98  ? 1102 LYS A CD    1 
ATOM   8498  C  CE    . LYS A 1  1102 ? 26.064  -36.266  60.082  1.00 107.90 ? 1102 LYS A CE    1 
ATOM   8499  N  NZ    . LYS A 1  1102 ? 26.219  -34.828  60.439  1.00 118.14 ? 1102 LYS A NZ    1 
ATOM   8500  N  N     . GLU A 1  1103 ? 26.346  -40.496  64.530  1.00 62.04  ? 1103 GLU A N     1 
ATOM   8501  C  CA    . GLU A 1  1103 ? 27.413  -40.463  65.545  1.00 62.94  ? 1103 GLU A CA    1 
ATOM   8502  C  C     . GLU A 1  1103 ? 28.303  -41.698  65.423  1.00 66.68  ? 1103 GLU A C     1 
ATOM   8503  O  O     . GLU A 1  1103 ? 29.531  -41.578  65.449  1.00 67.63  ? 1103 GLU A O     1 
ATOM   8504  C  CB    . GLU A 1  1103 ? 26.837  -40.403  66.975  1.00 64.58  ? 1103 GLU A CB    1 
ATOM   8505  C  CG    . GLU A 1  1103 ? 26.220  -39.071  67.364  1.00 78.31  ? 1103 GLU A CG    1 
ATOM   8506  C  CD    . GLU A 1  1103 ? 25.902  -38.869  68.836  1.00 103.14 ? 1103 GLU A CD    1 
ATOM   8507  O  OE1   . GLU A 1  1103 ? 25.623  -39.863  69.547  1.00 91.48  ? 1103 GLU A OE1   1 
ATOM   8508  O  OE2   . GLU A 1  1103 ? 25.901  -37.695  69.272  1.00 103.05 ? 1103 GLU A OE2   1 
ATOM   8509  N  N     . ILE A 1  1104 ? 27.665  -42.882  65.272  1.00 61.34  ? 1104 ILE A N     1 
ATOM   8510  C  CA    . ILE A 1  1104 ? 28.314  -44.186  65.162  1.00 60.30  ? 1104 ILE A CA    1 
ATOM   8511  C  C     . ILE A 1  1104 ? 29.244  -44.229  63.940  1.00 64.86  ? 1104 ILE A C     1 
ATOM   8512  O  O     . ILE A 1  1104 ? 30.464  -44.310  64.097  1.00 64.90  ? 1104 ILE A O     1 
ATOM   8513  C  CB    . ILE A 1  1104 ? 27.263  -45.348  65.188  1.00 61.62  ? 1104 ILE A CB    1 
ATOM   8514  C  CG1   . ILE A 1  1104 ? 26.471  -45.373  66.516  1.00 61.11  ? 1104 ILE A CG1   1 
ATOM   8515  C  CG2   . ILE A 1  1104 ? 27.929  -46.707  64.935  1.00 62.59  ? 1104 ILE A CG2   1 
ATOM   8516  C  CD1   . ILE A 1  1104 ? 25.191  -46.206  66.503  1.00 61.87  ? 1104 ILE A CD1   1 
ATOM   8517  N  N     . LEU A 1  1105 ? 28.658  -44.130  62.738  1.00 61.66  ? 1105 LEU A N     1 
ATOM   8518  C  CA    . LEU A 1  1105 ? 29.347  -44.193  61.449  1.00 61.95  ? 1105 LEU A CA    1 
ATOM   8519  C  C     . LEU A 1  1105 ? 30.517  -43.226  61.274  1.00 68.77  ? 1105 LEU A C     1 
ATOM   8520  O  O     . LEU A 1  1105 ? 31.530  -43.585  60.667  1.00 68.65  ? 1105 LEU A O     1 
ATOM   8521  C  CB    . LEU A 1  1105 ? 28.335  -44.064  60.309  1.00 60.80  ? 1105 LEU A CB    1 
ATOM   8522  C  CG    . LEU A 1  1105 ? 27.422  -45.270  60.076  1.00 64.10  ? 1105 LEU A CG    1 
ATOM   8523  C  CD1   . LEU A 1  1105 ? 26.699  -45.135  58.779  1.00 63.44  ? 1105 LEU A CD1   1 
ATOM   8524  C  CD2   . LEU A 1  1105 ? 28.201  -46.583  60.049  1.00 66.78  ? 1105 LEU A CD2   1 
ATOM   8525  N  N     . ASN A 1  1106 ? 30.391  -42.024  61.844  1.00 67.18  ? 1106 ASN A N     1 
ATOM   8526  C  CA    . ASN A 1  1106 ? 31.427  -41.001  61.784  1.00 68.81  ? 1106 ASN A CA    1 
ATOM   8527  C  C     . ASN A 1  1106 ? 32.477  -41.175  62.881  1.00 74.09  ? 1106 ASN A C     1 
ATOM   8528  O  O     . ASN A 1  1106 ? 33.513  -40.507  62.825  1.00 75.04  ? 1106 ASN A O     1 
ATOM   8529  C  CB    . ASN A 1  1106 ? 30.802  -39.606  61.854  1.00 70.75  ? 1106 ASN A CB    1 
ATOM   8530  C  CG    . ASN A 1  1106 ? 29.918  -39.272  60.681  1.00 94.95  ? 1106 ASN A CG    1 
ATOM   8531  O  OD1   . ASN A 1  1106 ? 30.308  -39.398  59.518  1.00 89.70  ? 1106 ASN A OD1   1 
ATOM   8532  N  ND2   . ASN A 1  1106 ? 28.711  -38.806  60.959  1.00 86.81  ? 1106 ASN A ND2   1 
ATOM   8533  N  N     . VAL A 1  1107 ? 32.217  -42.071  63.871  1.00 70.44  ? 1107 VAL A N     1 
ATOM   8534  C  CA    . VAL A 1  1107 ? 33.094  -42.341  65.028  1.00 71.39  ? 1107 VAL A CA    1 
ATOM   8535  C  C     . VAL A 1  1107 ? 33.292  -41.024  65.808  1.00 76.27  ? 1107 VAL A C     1 
ATOM   8536  O  O     . VAL A 1  1107 ? 34.388  -40.456  65.865  1.00 76.65  ? 1107 VAL A O     1 
ATOM   8537  C  CB    . VAL A 1  1107 ? 34.392  -43.131  64.648  1.00 76.06  ? 1107 VAL A CB    1 
ATOM   8538  C  CG1   . VAL A 1  1107 ? 35.372  -43.250  65.812  1.00 76.88  ? 1107 VAL A CG1   1 
ATOM   8539  C  CG2   . VAL A 1  1107 ? 34.039  -44.517  64.120  1.00 74.86  ? 1107 VAL A CG2   1 
ATOM   8540  N  N     . ALA A 1  1108 ? 32.161  -40.508  66.325  1.00 73.22  ? 1108 ALA A N     1 
ATOM   8541  C  CA    . ALA A 1  1108 ? 32.060  -39.245  67.047  1.00 74.77  ? 1108 ALA A CA    1 
ATOM   8542  C  C     . ALA A 1  1108 ? 32.868  -39.247  68.333  1.00 82.00  ? 1108 ALA A C     1 
ATOM   8543  O  O     . ALA A 1  1108 ? 32.690  -40.120  69.186  1.00 81.80  ? 1108 ALA A O     1 
ATOM   8544  C  CB    . ALA A 1  1108 ? 30.604  -38.916  67.330  1.00 74.75  ? 1108 ALA A CB    1 
ATOM   8545  N  N     . LYS A 1  1109 ? 33.770  -38.266  68.458  1.00 80.84  ? 1109 LYS A N     1 
ATOM   8546  C  CA    . LYS A 1  1109 ? 34.653  -38.091  69.614  1.00 82.15  ? 1109 LYS A CA    1 
ATOM   8547  C  C     . LYS A 1  1109 ? 33.843  -37.701  70.854  1.00 85.90  ? 1109 LYS A C     1 
ATOM   8548  O  O     . LYS A 1  1109 ? 34.279  -37.934  71.984  1.00 86.04  ? 1109 LYS A O     1 
ATOM   8549  C  CB    . LYS A 1  1109 ? 35.725  -37.025  69.311  1.00 86.64  ? 1109 LYS A CB    1 
ATOM   8550  C  CG    . LYS A 1  1109 ? 36.688  -37.407  68.179  1.00 104.98 ? 1109 LYS A CG    1 
ATOM   8551  C  CD    . LYS A 1  1109 ? 36.626  -36.441  66.979  1.00 117.68 ? 1109 LYS A CD    1 
ATOM   8552  C  CE    . LYS A 1  1109 ? 35.504  -36.706  65.988  1.00 127.07 ? 1109 LYS A CE    1 
ATOM   8553  N  NZ    . LYS A 1  1109 ? 35.687  -37.989  65.256  1.00 135.91 ? 1109 LYS A NZ    1 
ATOM   8554  N  N     . ASN A 1  1110 ? 32.657  -37.124  70.629  1.00 81.78  ? 1110 ASN A N     1 
ATOM   8555  C  CA    . ASN A 1  1110 ? 31.756  -36.662  71.673  1.00 81.79  ? 1110 ASN A CA    1 
ATOM   8556  C  C     . ASN A 1  1110 ? 30.305  -36.941  71.311  1.00 82.70  ? 1110 ASN A C     1 
ATOM   8557  O  O     . ASN A 1  1110 ? 29.753  -36.309  70.407  1.00 82.25  ? 1110 ASN A O     1 
ATOM   8558  C  CB    . ASN A 1  1110 ? 31.978  -35.162  71.964  1.00 86.44  ? 1110 ASN A CB    1 
ATOM   8559  C  CG    . ASN A 1  1110 ? 32.334  -34.302  70.758  1.00 113.79 ? 1110 ASN A CG    1 
ATOM   8560  O  OD1   . ASN A 1  1110 ? 33.327  -33.560  70.776  1.00 112.12 ? 1110 ASN A OD1   1 
ATOM   8561  N  ND2   . ASN A 1  1110 ? 31.539  -34.366  69.687  1.00 101.84 ? 1110 ASN A ND2   1 
ATOM   8562  N  N     . MET A 1  1111 ? 29.693  -37.891  72.021  1.00 76.85  ? 1111 MET A N     1 
ATOM   8563  C  CA    . MET A 1  1111 ? 28.289  -38.255  71.846  1.00 74.84  ? 1111 MET A CA    1 
ATOM   8564  C  C     . MET A 1  1111 ? 27.435  -37.193  72.512  1.00 79.05  ? 1111 MET A C     1 
ATOM   8565  O  O     . MET A 1  1111 ? 27.908  -36.512  73.421  1.00 80.22  ? 1111 MET A O     1 
ATOM   8566  C  CB    . MET A 1  1111 ? 27.979  -39.563  72.571  1.00 76.31  ? 1111 MET A CB    1 
ATOM   8567  C  CG    . MET A 1  1111 ? 28.895  -40.712  72.264  1.00 79.37  ? 1111 MET A CG    1 
ATOM   8568  S  SD    . MET A 1  1111 ? 28.566  -41.997  73.488  1.00 82.86  ? 1111 MET A SD    1 
ATOM   8569  C  CE    . MET A 1  1111 ? 26.916  -42.416  73.062  1.00 78.17  ? 1111 MET A CE    1 
ATOM   8570  N  N     . LYS A 1  1112 ? 26.161  -37.100  72.124  1.00 74.90  ? 1112 LYS A N     1 
ATOM   8571  C  CA    . LYS A 1  1112 ? 25.243  -36.157  72.750  1.00 75.68  ? 1112 LYS A CA    1 
ATOM   8572  C  C     . LYS A 1  1112 ? 24.716  -36.738  74.049  1.00 79.16  ? 1112 LYS A C     1 
ATOM   8573  O  O     . LYS A 1  1112 ? 24.614  -36.005  75.029  1.00 80.42  ? 1112 LYS A O     1 
ATOM   8574  C  CB    . LYS A 1  1112 ? 24.107  -35.741  71.804  1.00 78.37  ? 1112 LYS A CB    1 
ATOM   8575  C  CG    . LYS A 1  1112 ? 24.347  -34.377  71.153  1.00 100.27 ? 1112 LYS A CG    1 
ATOM   8576  C  CD    . LYS A 1  1112 ? 23.260  -33.996  70.150  1.00 110.48 ? 1112 LYS A CD    1 
ATOM   8577  C  CE    . LYS A 1  1112 ? 23.694  -34.195  68.717  1.00 119.02 ? 1112 LYS A CE    1 
ATOM   8578  N  NZ    . LYS A 1  1112 ? 22.719  -33.607  67.759  1.00 125.88 ? 1112 LYS A NZ    1 
ATOM   8579  N  N     . THR A 1  1113 ? 24.430  -38.058  74.080  1.00 74.09  ? 1113 THR A N     1 
ATOM   8580  C  CA    . THR A 1  1113 ? 23.947  -38.745  75.286  1.00 73.78  ? 1113 THR A CA    1 
ATOM   8581  C  C     . THR A 1  1113 ? 24.900  -39.872  75.736  1.00 76.62  ? 1113 THR A C     1 
ATOM   8582  O  O     . THR A 1  1113 ? 24.548  -41.047  75.595  1.00 75.00  ? 1113 THR A O     1 
ATOM   8583  C  CB    . THR A 1  1113 ? 22.487  -39.215  75.132  1.00 82.12  ? 1113 THR A CB    1 
ATOM   8584  O  OG1   . THR A 1  1113 ? 22.367  -40.002  73.946  1.00 82.20  ? 1113 THR A OG1   1 
ATOM   8585  C  CG2   . THR A 1  1113 ? 21.491  -38.064  75.124  1.00 81.11  ? 1113 THR A CG2   1 
ATOM   8586  N  N     . PRO A 1  1114 ? 26.102  -39.560  76.285  1.00 73.87  ? 1114 PRO A N     1 
ATOM   8587  C  CA    . PRO A 1  1114 ? 27.003  -40.636  76.726  1.00 73.51  ? 1114 PRO A CA    1 
ATOM   8588  C  C     . PRO A 1  1114 ? 26.529  -41.238  78.048  1.00 76.91  ? 1114 PRO A C     1 
ATOM   8589  O  O     . PRO A 1  1114 ? 26.412  -40.528  79.052  1.00 77.06  ? 1114 PRO A O     1 
ATOM   8590  C  CB    . PRO A 1  1114 ? 28.369  -39.938  76.846  1.00 76.60  ? 1114 PRO A CB    1 
ATOM   8591  C  CG    . PRO A 1  1114 ? 28.160  -38.528  76.316  1.00 81.69  ? 1114 PRO A CG    1 
ATOM   8592  C  CD    . PRO A 1  1114 ? 26.715  -38.243  76.530  1.00 76.80  ? 1114 PRO A CD    1 
ATOM   8593  N  N     . SER A 1  1115 ? 26.198  -42.541  78.019  1.00 72.75  ? 1115 SER A N     1 
ATOM   8594  C  CA    . SER A 1  1115 ? 25.681  -43.284  79.168  1.00 73.05  ? 1115 SER A CA    1 
ATOM   8595  C  C     . SER A 1  1115 ? 26.536  -44.475  79.561  1.00 77.14  ? 1115 SER A C     1 
ATOM   8596  O  O     . SER A 1  1115 ? 27.255  -45.025  78.729  1.00 76.70  ? 1115 SER A O     1 
ATOM   8597  C  CB    . SER A 1  1115 ? 24.237  -43.726  78.936  1.00 76.20  ? 1115 SER A CB    1 
ATOM   8598  O  OG    . SER A 1  1115 ? 23.723  -44.440  80.052  1.00 85.53  ? 1115 SER A OG    1 
ATOM   8599  N  N     . LEU A 1  1116 ? 26.412  -44.892  80.834  1.00 73.49  ? 1116 LEU A N     1 
ATOM   8600  C  CA    . LEU A 1  1116 ? 27.144  -46.004  81.415  1.00 72.73  ? 1116 LEU A CA    1 
ATOM   8601  C  C     . LEU A 1  1116 ? 26.198  -46.845  82.287  1.00 75.41  ? 1116 LEU A C     1 
ATOM   8602  O  O     . LEU A 1  1116 ? 25.903  -46.476  83.420  1.00 75.97  ? 1116 LEU A O     1 
ATOM   8603  C  CB    . LEU A 1  1116 ? 28.337  -45.428  82.210  1.00 74.07  ? 1116 LEU A CB    1 
ATOM   8604  C  CG    . LEU A 1  1116 ? 29.279  -46.373  82.956  1.00 78.85  ? 1116 LEU A CG    1 
ATOM   8605  C  CD1   . LEU A 1  1116 ? 30.099  -47.226  82.003  1.00 78.11  ? 1116 LEU A CD1   1 
ATOM   8606  C  CD2   . LEU A 1  1116 ? 30.214  -45.581  83.822  1.00 82.08  ? 1116 LEU A CD2   1 
ATOM   8607  N  N     . THR A 1  1117 ? 25.687  -47.951  81.734  1.00 70.26  ? 1117 THR A N     1 
ATOM   8608  C  CA    . THR A 1  1117 ? 24.780  -48.861  82.445  1.00 69.38  ? 1117 THR A CA    1 
ATOM   8609  C  C     . THR A 1  1117 ? 25.552  -49.817  83.369  1.00 72.40  ? 1117 THR A C     1 
ATOM   8610  O  O     . THR A 1  1117 ? 26.300  -50.669  82.892  1.00 70.84  ? 1117 THR A O     1 
ATOM   8611  C  CB    . THR A 1  1117 ? 23.750  -49.506  81.495  1.00 74.34  ? 1117 THR A CB    1 
ATOM   8612  O  OG1   . THR A 1  1117 ? 23.175  -50.647  82.132  1.00 73.98  ? 1117 THR A OG1   1 
ATOM   8613  C  CG2   . THR A 1  1117 ? 24.346  -49.911  80.155  1.00 70.94  ? 1117 THR A CG2   1 
ATOM   8614  N  N     . VAL A 1  1118 ? 25.373  -49.655  84.692  1.00 70.34  ? 1118 VAL A N     1 
ATOM   8615  C  CA    . VAL A 1  1118 ? 26.080  -50.416  85.733  1.00 71.28  ? 1118 VAL A CA    1 
ATOM   8616  C  C     . VAL A 1  1118 ? 25.231  -51.524  86.374  1.00 77.35  ? 1118 VAL A C     1 
ATOM   8617  O  O     . VAL A 1  1118 ? 24.119  -51.265  86.846  1.00 76.99  ? 1118 VAL A O     1 
ATOM   8618  C  CB    . VAL A 1  1118 ? 26.733  -49.470  86.778  1.00 76.01  ? 1118 VAL A CB    1 
ATOM   8619  C  CG1   . VAL A 1  1118 ? 27.416  -50.246  87.895  1.00 76.47  ? 1118 VAL A CG1   1 
ATOM   8620  C  CG2   . VAL A 1  1118 ? 27.725  -48.522  86.114  1.00 76.02  ? 1118 VAL A CG2   1 
ATOM   8621  N  N     . TYR A 1  1119 ? 25.790  -52.756  86.403  1.00 75.37  ? 1119 TYR A N     1 
ATOM   8622  C  CA    . TYR A 1  1119 ? 25.163  -53.960  86.955  1.00 75.72  ? 1119 TYR A CA    1 
ATOM   8623  C  C     . TYR A 1  1119 ? 25.819  -54.341  88.264  1.00 83.47  ? 1119 TYR A C     1 
ATOM   8624  O  O     . TYR A 1  1119 ? 27.047  -54.334  88.360  1.00 83.13  ? 1119 TYR A O     1 
ATOM   8625  C  CB    . TYR A 1  1119 ? 25.252  -55.131  85.958  1.00 75.43  ? 1119 TYR A CB    1 
ATOM   8626  C  CG    . TYR A 1  1119 ? 24.540  -54.872  84.650  1.00 75.27  ? 1119 TYR A CG    1 
ATOM   8627  C  CD1   . TYR A 1  1119 ? 25.199  -54.271  83.582  1.00 76.80  ? 1119 TYR A CD1   1 
ATOM   8628  C  CD2   . TYR A 1  1119 ? 23.203  -55.216  84.482  1.00 75.32  ? 1119 TYR A CD2   1 
ATOM   8629  C  CE1   . TYR A 1  1119 ? 24.542  -54.008  82.381  1.00 76.80  ? 1119 TYR A CE1   1 
ATOM   8630  C  CE2   . TYR A 1  1119 ? 22.536  -54.963  83.284  1.00 75.27  ? 1119 TYR A CE2   1 
ATOM   8631  C  CZ    . TYR A 1  1119 ? 23.210  -54.358  82.235  1.00 81.77  ? 1119 TYR A CZ    1 
ATOM   8632  O  OH    . TYR A 1  1119 ? 22.562  -54.114  81.049  1.00 80.24  ? 1119 TYR A OH    1 
ATOM   8633  N  N     . LEU A 1  1120 ? 24.990  -54.676  89.268  1.00 83.55  ? 1120 LEU A N     1 
ATOM   8634  C  CA    . LEU A 1  1120 ? 25.403  -55.058  90.627  1.00 85.84  ? 1120 LEU A CA    1 
ATOM   8635  C  C     . LEU A 1  1120 ? 26.061  -56.431  90.663  1.00 93.72  ? 1120 LEU A C     1 
ATOM   8636  O  O     . LEU A 1  1120 ? 25.827  -57.244  89.765  1.00 92.69  ? 1120 LEU A O     1 
ATOM   8637  C  CB    . LEU A 1  1120 ? 24.172  -55.054  91.556  1.00 86.24  ? 1120 LEU A CB    1 
ATOM   8638  C  CG    . LEU A 1  1120 ? 23.969  -53.846  92.480  1.00 91.52  ? 1120 LEU A CG    1 
ATOM   8639  C  CD1   . LEU A 1  1120 ? 23.669  -52.563  91.694  1.00 90.95  ? 1120 LEU A CD1   1 
ATOM   8640  C  CD2   . LEU A 1  1120 ? 22.832  -54.104  93.440  1.00 94.17  ? 1120 LEU A CD2   1 
ATOM   8641  N  N     . GLU A 1  1121 ? 26.860  -56.699  91.717  1.00 94.40  ? 1121 GLU A N     1 
ATOM   8642  C  CA    . GLU A 1  1121 ? 27.536  -57.986  91.922  1.00 95.97  ? 1121 GLU A CA    1 
ATOM   8643  C  C     . GLU A 1  1121 ? 26.510  -59.143  91.994  1.00 102.99 ? 1121 GLU A C     1 
ATOM   8644  O  O     . GLU A 1  1121 ? 25.411  -58.921  92.517  1.00 102.36 ? 1121 GLU A O     1 
ATOM   8645  C  CB    . GLU A 1  1121 ? 28.485  -57.957  93.144  1.00 98.88  ? 1121 GLU A CB    1 
ATOM   8646  C  CG    . GLU A 1  1121 ? 27.835  -57.669  94.489  1.00 113.53 ? 1121 GLU A CG    1 
ATOM   8647  C  CD    . GLU A 1  1121 ? 28.655  -58.092  95.694  1.00 145.85 ? 1121 GLU A CD    1 
ATOM   8648  O  OE1   . GLU A 1  1121 ? 28.834  -59.316  95.888  1.00 147.07 ? 1121 GLU A OE1   1 
ATOM   8649  O  OE2   . GLU A 1  1121 ? 29.090  -57.203  96.462  1.00 144.93 ? 1121 GLU A OE2   1 
ATOM   8650  N  N     . PRO A 1  1122 ? 26.823  -60.347  91.423  1.00 102.24 ? 1122 PRO A N     1 
ATOM   8651  C  CA    . PRO A 1  1122 ? 25.838  -61.454  91.397  1.00 102.91 ? 1122 PRO A CA    1 
ATOM   8652  C  C     . PRO A 1  1122 ? 24.899  -61.661  92.594  1.00 110.61 ? 1122 PRO A C     1 
ATOM   8653  O  O     . PRO A 1  1122 ? 23.702  -61.871  92.378  1.00 109.36 ? 1122 PRO A O     1 
ATOM   8654  C  CB    . PRO A 1  1122 ? 26.697  -62.684  91.093  1.00 104.44 ? 1122 PRO A CB    1 
ATOM   8655  C  CG    . PRO A 1  1122 ? 27.812  -62.156  90.273  1.00 107.94 ? 1122 PRO A CG    1 
ATOM   8656  C  CD    . PRO A 1  1122 ? 28.070  -60.737  90.724  1.00 103.68 ? 1122 PRO A CD    1 
ATOM   8657  N  N     . GLY A 1  1123 ? 25.450  -61.565  93.812  1.00 111.31 ? 1123 GLY A N     1 
ATOM   8658  C  CA    . GLY A 1  1123 ? 24.783  -61.728  95.107  1.00 113.53 ? 1123 GLY A CA    1 
ATOM   8659  C  C     . GLY A 1  1123 ? 23.265  -61.603  95.177  1.00 119.76 ? 1123 GLY A C     1 
ATOM   8660  O  O     . GLY A 1  1123 ? 22.588  -62.602  94.916  1.00 119.51 ? 1123 GLY A O     1 
ATOM   8661  N  N     . HIS A 1  1124 ? 22.660  -60.430  95.568  1.00 117.41 ? 1124 HIS A N     1 
ATOM   8662  C  CA    . HIS A 1  1124 ? 23.126  -59.067  95.932  1.00 117.75 ? 1124 HIS A CA    1 
ATOM   8663  C  C     . HIS A 1  1124 ? 22.544  -58.024  94.978  1.00 120.40 ? 1124 HIS A C     1 
ATOM   8664  O  O     . HIS A 1  1124 ? 22.429  -56.853  95.350  1.00 120.59 ? 1124 HIS A O     1 
ATOM   8665  C  CB    . HIS A 1  1124 ? 24.656  -58.908  96.006  1.00 118.89 ? 1124 HIS A CB    1 
ATOM   8666  C  CG    . HIS A 1  1124 ? 25.169  -58.519  97.356  1.00 124.05 ? 1124 HIS A CG    1 
ATOM   8667  N  ND1   . HIS A 1  1124 ? 26.013  -59.350  98.072  1.00 126.71 ? 1124 HIS A ND1   1 
ATOM   8668  C  CD2   . HIS A 1  1124 ? 24.950  -57.394  98.076  1.00 126.91 ? 1124 HIS A CD2   1 
ATOM   8669  C  CE1   . HIS A 1  1124 ? 26.280  -58.706  99.199  1.00 127.46 ? 1124 HIS A CE1   1 
ATOM   8670  N  NE2   . HIS A 1  1124 ? 25.662  -57.525  99.247  1.00 127.97 ? 1124 HIS A NE2   1 
ATOM   8671  N  N     . ALA A 1  1125 ? 22.179  -58.461  93.752  1.00 115.23 ? 1125 ALA A N     1 
ATOM   8672  C  CA    . ALA A 1  1125 ? 21.638  -57.639  92.665  1.00 113.81 ? 1125 ALA A CA    1 
ATOM   8673  C  C     . ALA A 1  1125 ? 20.196  -57.131  92.851  1.00 117.11 ? 1125 ALA A C     1 
ATOM   8674  O  O     . ALA A 1  1125 ? 19.880  -56.042  92.365  1.00 116.53 ? 1125 ALA A O     1 
ATOM   8675  C  CB    . ALA A 1  1125 ? 21.772  -58.373  91.341  1.00 113.24 ? 1125 ALA A CB    1 
ATOM   8676  N  N     . ALA A 1  1126 ? 19.327  -57.914  93.528  1.00 113.16 ? 1126 ALA A N     1 
ATOM   8677  C  CA    . ALA A 1  1126 ? 17.922  -57.549  93.760  1.00 112.55 ? 1126 ALA A CA    1 
ATOM   8678  C  C     . ALA A 1  1126 ? 17.676  -56.694  95.030  1.00 115.76 ? 1126 ALA A C     1 
ATOM   8679  O  O     . ALA A 1  1126 ? 16.526  -56.347  95.319  1.00 116.06 ? 1126 ALA A O     1 
ATOM   8680  C  CB    . ALA A 1  1126 ? 17.047  -58.795  93.765  1.00 113.27 ? 1126 ALA A CB    1 
ATOM   8681  N  N     . ASP A 1  1127 ? 18.752  -56.329  95.760  1.00 111.01 ? 1127 ASP A N     1 
ATOM   8682  C  CA    . ASP A 1  1127 ? 18.671  -55.496  96.963  1.00 111.37 ? 1127 ASP A CA    1 
ATOM   8683  C  C     . ASP A 1  1127 ? 18.720  -54.015  96.572  1.00 111.94 ? 1127 ASP A C     1 
ATOM   8684  O  O     . ASP A 1  1127 ? 19.709  -53.575  95.982  1.00 110.87 ? 1127 ASP A O     1 
ATOM   8685  C  CB    . ASP A 1  1127 ? 19.804  -55.856  97.951  1.00 114.40 ? 1127 ASP A CB    1 
ATOM   8686  C  CG    . ASP A 1  1127 ? 19.793  -55.114  99.283  1.00 128.69 ? 1127 ASP A CG    1 
ATOM   8687  O  OD1   . ASP A 1  1127 ? 18.709  -54.623  99.689  1.00 130.01 ? 1127 ASP A OD1   1 
ATOM   8688  O  OD2   . ASP A 1  1127 ? 20.855  -55.064  99.942  1.00 136.44 ? 1127 ASP A OD2   1 
ATOM   8689  N  N     . GLN A 1  1128 ? 17.645  -53.257  96.885  1.00 106.81 ? 1128 GLN A N     1 
ATOM   8690  C  CA    . GLN A 1  1128 ? 17.539  -51.830  96.564  1.00 105.70 ? 1128 GLN A CA    1 
ATOM   8691  C  C     . GLN A 1  1128 ? 18.575  -50.979  97.291  1.00 108.49 ? 1128 GLN A C     1 
ATOM   8692  O  O     . GLN A 1  1128 ? 19.229  -50.162  96.644  1.00 107.62 ? 1128 GLN A O     1 
ATOM   8693  C  CB    . GLN A 1  1128 ? 16.107  -51.287  96.786  1.00 107.61 ? 1128 GLN A CB    1 
ATOM   8694  C  CG    . GLN A 1  1128 ? 15.919  -49.830  96.316  1.00 118.02 ? 1128 GLN A CG    1 
ATOM   8695  C  CD    . GLN A 1  1128 ? 14.495  -49.314  96.295  1.00 134.06 ? 1128 GLN A CD    1 
ATOM   8696  O  OE1   . GLN A 1  1128 ? 13.519  -50.067  96.200  1.00 130.02 ? 1128 GLN A OE1   1 
ATOM   8697  N  NE2   . GLN A 1  1128 ? 14.349  -47.998  96.311  1.00 124.37 ? 1128 GLN A NE2   1 
ATOM   8698  N  N     . GLU A 1  1129 ? 18.725  -51.157  98.619  1.00 105.04 ? 1129 GLU A N     1 
ATOM   8699  C  CA    . GLU A 1  1129 ? 19.677  -50.365  99.402  1.00 105.33 ? 1129 GLU A CA    1 
ATOM   8700  C  C     . GLU A 1  1129 ? 21.134  -50.543  98.976  1.00 105.43 ? 1129 GLU A C     1 
ATOM   8701  O  O     . GLU A 1  1129 ? 21.869  -49.557  98.971  1.00 105.67 ? 1129 GLU A O     1 
ATOM   8702  C  CB    . GLU A 1  1129 ? 19.477  -50.519  100.917 1.00 108.73 ? 1129 GLU A CB    1 
ATOM   8703  C  CG    . GLU A 1  1129 ? 19.584  -49.185  101.643 1.00 123.15 ? 1129 GLU A CG    1 
ATOM   8704  C  CD    . GLU A 1  1129 ? 19.320  -49.192  103.138 1.00 149.40 ? 1129 GLU A CD    1 
ATOM   8705  O  OE1   . GLU A 1  1129 ? 18.184  -49.530  103.544 1.00 150.34 ? 1129 GLU A OE1   1 
ATOM   8706  O  OE2   . GLU A 1  1129 ? 20.229  -48.792  103.902 1.00 142.17 ? 1129 GLU A OE2   1 
ATOM   8707  N  N     . GLN A 1  1130 ? 21.527  -51.769  98.554  1.00 98.22  ? 1130 GLN A N     1 
ATOM   8708  C  CA    . GLN A 1  1130 ? 22.873  -52.085  98.052  1.00 96.12  ? 1130 GLN A CA    1 
ATOM   8709  C  C     . GLN A 1  1130 ? 23.170  -51.216  96.826  1.00 94.49  ? 1130 GLN A C     1 
ATOM   8710  O  O     . GLN A 1  1130 ? 24.247  -50.629  96.738  1.00 94.04  ? 1130 GLN A O     1 
ATOM   8711  C  CB    . GLN A 1  1130 ? 22.990  -53.591  97.708  1.00 96.88  ? 1130 GLN A CB    1 
ATOM   8712  C  CG    . GLN A 1  1130 ? 24.240  -54.014  96.901  1.00 111.93 ? 1130 GLN A CG    1 
ATOM   8713  C  CD    . GLN A 1  1130 ? 25.543  -54.079  97.675  1.00 128.35 ? 1130 GLN A CD    1 
ATOM   8714  O  OE1   . GLN A 1  1130 ? 25.583  -54.061  98.914  1.00 124.37 ? 1130 GLN A OE1   1 
ATOM   8715  N  NE2   . GLN A 1  1130 ? 26.642  -54.227  96.948  1.00 116.43 ? 1130 GLN A NE2   1 
ATOM   8716  N  N     . ALA A 1  1131 ? 22.190  -51.110  95.909  1.00 87.14  ? 1131 ALA A N     1 
ATOM   8717  C  CA    . ALA A 1  1131 ? 22.281  -50.303  94.692  1.00 84.61  ? 1131 ALA A CA    1 
ATOM   8718  C  C     . ALA A 1  1131 ? 22.390  -48.818  95.035  1.00 85.85  ? 1131 ALA A C     1 
ATOM   8719  O  O     . ALA A 1  1131 ? 23.244  -48.134  94.469  1.00 85.47  ? 1131 ALA A O     1 
ATOM   8720  C  CB    . ALA A 1  1131 ? 21.072  -50.555  93.803  1.00 84.17  ? 1131 ALA A CB    1 
ATOM   8721  N  N     . LYS A 1  1132 ? 21.560  -48.340  95.998  1.00 80.09  ? 1132 LYS A N     1 
ATOM   8722  C  CA    . LYS A 1  1132 ? 21.535  -46.958  96.472  1.00 79.32  ? 1132 LYS A CA    1 
ATOM   8723  C  C     . LYS A 1  1132 ? 22.903  -46.564  96.999  1.00 81.19  ? 1132 LYS A C     1 
ATOM   8724  O  O     . LYS A 1  1132 ? 23.341  -45.444  96.748  1.00 81.54  ? 1132 LYS A O     1 
ATOM   8725  C  CB    . LYS A 1  1132 ? 20.465  -46.771  97.553  1.00 82.76  ? 1132 LYS A CB    1 
ATOM   8726  C  CG    . LYS A 1  1132 ? 19.938  -45.339  97.641  1.00 99.93  ? 1132 LYS A CG    1 
ATOM   8727  C  CD    . LYS A 1  1132 ? 19.196  -45.033  98.946  1.00 114.64 ? 1132 LYS A CD    1 
ATOM   8728  C  CE    . LYS A 1  1132 ? 17.739  -45.451  98.956  1.00 129.15 ? 1132 LYS A CE    1 
ATOM   8729  N  NZ    . LYS A 1  1132 ? 17.567  -46.866  99.387  1.00 139.63 ? 1132 LYS A NZ    1 
ATOM   8730  N  N     . LEU A 1  1133 ? 23.591  -47.498  97.692  1.00 75.80  ? 1133 LEU A N     1 
ATOM   8731  C  CA    . LEU A 1  1133 ? 24.931  -47.284  98.242  1.00 75.79  ? 1133 LEU A CA    1 
ATOM   8732  C  C     . LEU A 1  1133 ? 25.930  -47.052  97.119  1.00 77.40  ? 1133 LEU A C     1 
ATOM   8733  O  O     . LEU A 1  1133 ? 26.710  -46.103  97.189  1.00 78.21  ? 1133 LEU A O     1 
ATOM   8734  C  CB    . LEU A 1  1133 ? 25.382  -48.468  99.121  1.00 76.13  ? 1133 LEU A CB    1 
ATOM   8735  C  CG    . LEU A 1  1133 ? 24.672  -48.650  100.466 1.00 82.17  ? 1133 LEU A CG    1 
ATOM   8736  C  CD1   . LEU A 1  1133 ? 24.687  -50.106  100.896 1.00 82.02  ? 1133 LEU A CD1   1 
ATOM   8737  C  CD2   . LEU A 1  1133 ? 25.271  -47.760  101.544 1.00 86.62  ? 1133 LEU A CD2   1 
ATOM   8738  N  N     . ILE A 1  1134 ? 25.869  -47.891  96.068  1.00 70.90  ? 1134 ILE A N     1 
ATOM   8739  C  CA    . ILE A 1  1134 ? 26.743  -47.809  94.897  1.00 68.97  ? 1134 ILE A CA    1 
ATOM   8740  C  C     . ILE A 1  1134 ? 26.431  -46.547  94.099  1.00 72.82  ? 1134 ILE A C     1 
ATOM   8741  O  O     . ILE A 1  1134 ? 27.353  -45.902  93.597  1.00 72.00  ? 1134 ILE A O     1 
ATOM   8742  C  CB    . ILE A 1  1134 ? 26.683  -49.117  94.062  1.00 69.95  ? 1134 ILE A CB    1 
ATOM   8743  C  CG1   . ILE A 1  1134 ? 27.244  -50.299  94.884  1.00 70.38  ? 1134 ILE A CG1   1 
ATOM   8744  C  CG2   . ILE A 1  1134 ? 27.455  -48.973  92.751  1.00 69.62  ? 1134 ILE A CG2   1 
ATOM   8745  C  CD1   . ILE A 1  1134 ? 26.590  -51.611  94.661  1.00 74.95  ? 1134 ILE A CD1   1 
ATOM   8746  N  N     . ARG A 1  1135 ? 25.137  -46.169  94.042  1.00 70.41  ? 1135 ARG A N     1 
ATOM   8747  C  CA    . ARG A 1  1135 ? 24.641  -44.971  93.358  1.00 70.62  ? 1135 ARG A CA    1 
ATOM   8748  C  C     . ARG A 1  1135 ? 25.334  -43.757  93.947  1.00 76.32  ? 1135 ARG A C     1 
ATOM   8749  O  O     . ARG A 1  1135 ? 25.867  -42.941  93.194  1.00 75.97  ? 1135 ARG A O     1 
ATOM   8750  C  CB    . ARG A 1  1135 ? 23.107  -44.844  93.511  1.00 71.44  ? 1135 ARG A CB    1 
ATOM   8751  C  CG    . ARG A 1  1135 ? 22.440  -43.903  92.511  1.00 81.23  ? 1135 ARG A CG    1 
ATOM   8752  C  CD    . ARG A 1  1135 ? 22.173  -42.521  93.077  1.00 93.96  ? 1135 ARG A CD    1 
ATOM   8753  N  NE    . ARG A 1  1135 ? 20.787  -42.377  93.520  1.00 104.65 ? 1135 ARG A NE    1 
ATOM   8754  C  CZ    . ARG A 1  1135 ? 20.385  -42.487  94.781  1.00 124.05 ? 1135 ARG A CZ    1 
ATOM   8755  N  NH1   . ARG A 1  1135 ? 21.262  -42.737  95.746  1.00 115.93 ? 1135 ARG A NH1   1 
ATOM   8756  N  NH2   . ARG A 1  1135 ? 19.104  -42.340  95.088  1.00 112.61 ? 1135 ARG A NH2   1 
ATOM   8757  N  N     . SER A 1  1136 ? 25.357  -43.674  95.297  1.00 74.47  ? 1136 SER A N     1 
ATOM   8758  C  CA    . SER A 1  1136 ? 25.978  -42.596  96.066  1.00 76.14  ? 1136 SER A CA    1 
ATOM   8759  C  C     . SER A 1  1136 ? 27.494  -42.591  95.869  1.00 79.52  ? 1136 SER A C     1 
ATOM   8760  O  O     . SER A 1  1136 ? 28.092  -41.517  95.747  1.00 80.12  ? 1136 SER A O     1 
ATOM   8761  C  CB    . SER A 1  1136 ? 25.635  -42.734  97.548  1.00 81.45  ? 1136 SER A CB    1 
ATOM   8762  O  OG    . SER A 1  1136 ? 24.237  -42.661  97.780  1.00 90.36  ? 1136 SER A OG    1 
ATOM   8763  N  N     . ALA A 1  1137 ? 28.092  -43.801  95.797  1.00 74.59  ? 1137 ALA A N     1 
ATOM   8764  C  CA    . ALA A 1  1137 ? 29.523  -44.048  95.632  1.00 74.45  ? 1137 ALA A CA    1 
ATOM   8765  C  C     . ALA A 1  1137 ? 30.072  -43.707  94.250  1.00 78.26  ? 1137 ALA A C     1 
ATOM   8766  O  O     . ALA A 1  1137 ? 31.271  -43.459  94.127  1.00 77.94  ? 1137 ALA A O     1 
ATOM   8767  C  CB    . ALA A 1  1137 ? 29.837  -45.494  95.970  1.00 74.54  ? 1137 ALA A CB    1 
ATOM   8768  N  N     . ILE A 1  1138 ? 29.222  -43.724  93.212  1.00 75.38  ? 1138 ILE A N     1 
ATOM   8769  C  CA    . ILE A 1  1138 ? 29.676  -43.434  91.850  1.00 75.37  ? 1138 ILE A CA    1 
ATOM   8770  C  C     . ILE A 1  1138 ? 29.346  -42.030  91.360  1.00 81.76  ? 1138 ILE A C     1 
ATOM   8771  O  O     . ILE A 1  1138 ? 30.204  -41.401  90.742  1.00 82.25  ? 1138 ILE A O     1 
ATOM   8772  C  CB    . ILE A 1  1138 ? 29.406  -44.560  90.806  1.00 76.75  ? 1138 ILE A CB    1 
ATOM   8773  C  CG1   . ILE A 1  1138 ? 27.907  -44.745  90.508  1.00 76.29  ? 1138 ILE A CG1   1 
ATOM   8774  C  CG2   . ILE A 1  1138 ? 30.070  -45.880  91.236  1.00 77.66  ? 1138 ILE A CG2   1 
ATOM   8775  C  CD1   . ILE A 1  1138 ? 27.615  -45.411  89.194  1.00 83.39  ? 1138 ILE A CD1   1 
ATOM   8776  N  N     . GLU A 1  1139 ? 28.119  -41.535  91.648  1.00 79.17  ? 1139 GLU A N     1 
ATOM   8777  C  CA    . GLU A 1  1139 ? 27.658  -40.200  91.263  1.00 79.92  ? 1139 GLU A CA    1 
ATOM   8778  C  C     . GLU A 1  1139 ? 28.614  -39.136  91.812  1.00 87.06  ? 1139 GLU A C     1 
ATOM   8779  O  O     . GLU A 1  1139 ? 28.878  -39.102  93.026  1.00 88.58  ? 1139 GLU A O     1 
ATOM   8780  C  CB    . GLU A 1  1139 ? 26.214  -39.961  91.745  1.00 81.51  ? 1139 GLU A CB    1 
ATOM   8781  C  CG    . GLU A 1  1139 ? 25.567  -38.694  91.205  1.00 93.06  ? 1139 GLU A CG    1 
ATOM   8782  C  CD    . GLU A 1  1139 ? 24.132  -38.469  91.641  1.00 117.21 ? 1139 GLU A CD    1 
ATOM   8783  O  OE1   . GLU A 1  1139 ? 23.898  -38.279  92.857  1.00 114.36 ? 1139 GLU A OE1   1 
ATOM   8784  O  OE2   . GLU A 1  1139 ? 23.241  -38.455  90.760  1.00 111.52 ? 1139 GLU A OE2   1 
ATOM   8785  N  N     . HIS A 1  1140 ? 29.179  -38.317  90.897  1.00 83.51  ? 1140 HIS A N     1 
ATOM   8786  C  CA    . HIS A 1  1140 ? 30.117  -37.250  91.238  1.00 85.08  ? 1140 HIS A CA    1 
ATOM   8787  C  C     . HIS A 1  1140 ? 29.401  -36.148  92.007  1.00 89.89  ? 1140 HIS A C     1 
ATOM   8788  O  O     . HIS A 1  1140 ? 28.442  -35.558  91.501  1.00 89.16  ? 1140 HIS A O     1 
ATOM   8789  C  CB    . HIS A 1  1140 ? 30.817  -36.705  89.982  1.00 85.70  ? 1140 HIS A CB    1 
ATOM   8790  C  CG    . HIS A 1  1140 ? 31.779  -35.592  90.245  1.00 91.30  ? 1140 HIS A CG    1 
ATOM   8791  N  ND1   . HIS A 1  1140 ? 32.953  -35.801  90.951  1.00 94.36  ? 1140 HIS A ND1   1 
ATOM   8792  C  CD2   . HIS A 1  1140 ? 31.715  -34.292  89.876  1.00 94.23  ? 1140 HIS A CD2   1 
ATOM   8793  C  CE1   . HIS A 1  1140 ? 33.555  -34.625  91.000  1.00 95.56  ? 1140 HIS A CE1   1 
ATOM   8794  N  NE2   . HIS A 1  1140 ? 32.848  -33.687  90.367  1.00 95.92  ? 1140 HIS A NE2   1 
ATOM   8795  N  N     . THR A 1  1141 ? 29.850  -35.908  93.250  1.00 87.71  ? 1141 THR A N     1 
ATOM   8796  C  CA    . THR A 1  1141 ? 29.279  -34.898  94.132  1.00 88.98  ? 1141 THR A CA    1 
ATOM   8797  C  C     . THR A 1  1141 ? 30.329  -33.862  94.505  1.00 94.44  ? 1141 THR A C     1 
ATOM   8798  O  O     . THR A 1  1141 ? 31.373  -34.205  95.053  1.00 94.23  ? 1141 THR A O     1 
ATOM   8799  C  CB    . THR A 1  1141 ? 28.590  -35.556  95.330  1.00 97.18  ? 1141 THR A CB    1 
ATOM   8800  O  OG1   . THR A 1  1141 ? 27.697  -36.562  94.849  1.00 95.77  ? 1141 THR A OG1   1 
ATOM   8801  C  CG2   . THR A 1  1141 ? 27.819  -34.562  96.179  1.00 97.57  ? 1141 THR A CG2   1 
ATOM   8802  N  N     . THR A 1  1142 ? 30.046  -32.598  94.170  1.00 81.39  ? 1142 THR A N     1 
ATOM   8803  C  CA    . THR A 1  1142 ? 30.888  -31.429  94.449  1.00 81.11  ? 1142 THR A CA    1 
ATOM   8804  C  C     . THR A 1  1142 ? 30.375  -30.665  95.688  1.00 83.84  ? 1142 THR A C     1 
ATOM   8805  O  O     . THR A 1  1142 ? 29.242  -30.890  96.124  1.00 83.36  ? 1142 THR A O     1 
ATOM   8806  C  CB    . THR A 1  1142 ? 31.038  -30.529  93.189  1.00 90.24  ? 1142 THR A CB    1 
ATOM   8807  O  OG1   . THR A 1  1142 ? 31.612  -29.274  93.571  1.00 91.69  ? 1142 THR A OG1   1 
ATOM   8808  C  CG2   . THR A 1  1142 ? 29.711  -30.277  92.465  1.00 87.48  ? 1142 THR A CG2   1 
ATOM   8809  N  N     . LEU A 1  1143 ? 31.204  -29.765  96.248  1.00 79.24  ? 1143 LEU A N     1 
ATOM   8810  C  CA    . LEU A 1  1143 ? 30.798  -28.961  97.395  1.00 78.15  ? 1143 LEU A CA    1 
ATOM   8811  C  C     . LEU A 1  1143 ? 29.732  -27.939  96.970  1.00 80.33  ? 1143 LEU A C     1 
ATOM   8812  O  O     . LEU A 1  1143 ? 28.811  -27.668  97.741  1.00 78.87  ? 1143 LEU A O     1 
ATOM   8813  C  CB    . LEU A 1  1143 ? 32.020  -28.286  98.039  1.00 78.72  ? 1143 LEU A CB    1 
ATOM   8814  C  CG    . LEU A 1  1143 ? 31.803  -27.488  99.333  1.00 82.51  ? 1143 LEU A CG    1 
ATOM   8815  C  CD1   . LEU A 1  1143 ? 31.280  -28.361  100.454 1.00 83.45  ? 1143 LEU A CD1   1 
ATOM   8816  C  CD2   . LEU A 1  1143 ? 33.078  -26.825  99.763  1.00 85.16  ? 1143 LEU A CD2   1 
ATOM   8817  N  N     . LYS A 1  1144 ? 29.830  -27.431  95.718  1.00 76.70  ? 1144 LYS A N     1 
ATOM   8818  C  CA    . LYS A 1  1144 ? 28.884  -26.482  95.124  1.00 75.11  ? 1144 LYS A CA    1 
ATOM   8819  C  C     . LYS A 1  1144 ? 27.450  -27.025  95.202  1.00 80.07  ? 1144 LYS A C     1 
ATOM   8820  O  O     . LYS A 1  1144 ? 26.557  -26.322  95.685  1.00 78.67  ? 1144 LYS A O     1 
ATOM   8821  C  CB    . LYS A 1  1144 ? 29.277  -26.163  93.665  1.00 76.66  ? 1144 LYS A CB    1 
ATOM   8822  C  CG    . LYS A 1  1144 ? 28.304  -25.226  92.951  1.00 89.95  ? 1144 LYS A CG    1 
ATOM   8823  C  CD    . LYS A 1  1144 ? 28.916  -24.563  91.729  1.00 102.10 ? 1144 LYS A CD    1 
ATOM   8824  C  CE    . LYS A 1  1144 ? 27.964  -23.584  91.078  1.00 113.50 ? 1144 LYS A CE    1 
ATOM   8825  N  NZ    . LYS A 1  1144 ? 28.588  -22.883  89.922  1.00 122.68 ? 1144 LYS A NZ    1 
ATOM   8826  N  N     . SER A 1  1145 ? 27.261  -28.301  94.784  1.00 78.41  ? 1145 SER A N     1 
ATOM   8827  C  CA    . SER A 1  1145 ? 25.984  -29.022  94.772  1.00 78.62  ? 1145 SER A CA    1 
ATOM   8828  C  C     . SER A 1  1145 ? 25.246  -29.077  96.123  1.00 84.67  ? 1145 SER A C     1 
ATOM   8829  O  O     . SER A 1  1145 ? 24.030  -29.275  96.130  1.00 84.95  ? 1145 SER A O     1 
ATOM   8830  C  CB    . SER A 1  1145 ? 26.171  -30.431  94.218  1.00 82.58  ? 1145 SER A CB    1 
ATOM   8831  O  OG    . SER A 1  1145 ? 26.794  -31.288  95.160  1.00 90.38  ? 1145 SER A OG    1 
ATOM   8832  N  N     . VAL A 1  1146 ? 25.969  -28.916  97.251  1.00 81.89  ? 1146 VAL A N     1 
ATOM   8833  C  CA    . VAL A 1  1146 ? 25.377  -28.963  98.590  1.00 82.35  ? 1146 VAL A CA    1 
ATOM   8834  C  C     . VAL A 1  1146 ? 25.374  -27.625  99.333  1.00 87.29  ? 1146 VAL A C     1 
ATOM   8835  O  O     . VAL A 1  1146 ? 24.824  -27.564  100.434 1.00 88.26  ? 1146 VAL A O     1 
ATOM   8836  C  CB    . VAL A 1  1146 ? 25.922  -30.120  99.468  1.00 87.76  ? 1146 VAL A CB    1 
ATOM   8837  C  CG1   . VAL A 1  1146 ? 25.309  -31.452  99.068  1.00 88.42  ? 1146 VAL A CG1   1 
ATOM   8838  C  CG2   . VAL A 1  1146 ? 27.448  -30.185  99.446  1.00 88.16  ? 1146 VAL A CG2   1 
ATOM   8839  N  N     . THR A 1  1147 ? 25.955  -26.554  98.741  1.00 82.92  ? 1147 THR A N     1 
ATOM   8840  C  CA    . THR A 1  1147 ? 26.044  -25.235  99.392  1.00 82.04  ? 1147 THR A CA    1 
ATOM   8841  C  C     . THR A 1  1147 ? 24.954  -24.236  98.978  1.00 83.41  ? 1147 THR A C     1 
ATOM   8842  O  O     . THR A 1  1147 ? 24.752  -23.999  97.783  1.00 82.31  ? 1147 THR A O     1 
ATOM   8843  C  CB    . THR A 1  1147 ? 27.451  -24.625  99.222  1.00 92.20  ? 1147 THR A CB    1 
ATOM   8844  O  OG1   . THR A 1  1147 ? 28.444  -25.649  99.233  1.00 95.42  ? 1147 THR A OG1   1 
ATOM   8845  C  CG2   . THR A 1  1147 ? 27.773  -23.586  100.286 1.00 91.61  ? 1147 THR A CG2   1 
ATOM   8846  N  N     . ILE A 1  1148 ? 24.289  -23.620  99.977  1.00 78.93  ? 1148 ILE A N     1 
ATOM   8847  C  CA    . ILE A 1  1148 ? 23.272  -22.585  99.761  1.00 77.28  ? 1148 ILE A CA    1 
ATOM   8848  C  C     . ILE A 1  1148 ? 23.994  -21.293  99.393  1.00 79.51  ? 1148 ILE A C     1 
ATOM   8849  O  O     . ILE A 1  1148 ? 23.752  -20.743  98.317  1.00 78.02  ? 1148 ILE A O     1 
ATOM   8850  C  CB    . ILE A 1  1148 ? 22.318  -22.390  100.980 1.00 81.22  ? 1148 ILE A CB    1 
ATOM   8851  C  CG1   . ILE A 1  1148 ? 21.605  -23.706  101.358 1.00 83.10  ? 1148 ILE A CG1   1 
ATOM   8852  C  CG2   . ILE A 1  1148 ? 21.305  -21.255  100.718 1.00 80.62  ? 1148 ILE A CG2   1 
ATOM   8853  C  CD1   . ILE A 1  1148 ? 21.002  -23.737  102.760 1.00 93.82  ? 1148 ILE A CD1   1 
ATOM   8854  N  N     . ALA A 1  1149 ? 24.882  -20.821  100.298 1.00 76.14  ? 1149 ALA A N     1 
ATOM   8855  C  CA    . ALA A 1  1149 ? 25.678  -19.602  100.153 1.00 75.07  ? 1149 ALA A CA    1 
ATOM   8856  C  C     . ALA A 1  1149 ? 27.008  -19.688  100.903 1.00 79.22  ? 1149 ALA A C     1 
ATOM   8857  O  O     . ALA A 1  1149 ? 27.130  -20.426  101.888 1.00 79.16  ? 1149 ALA A O     1 
ATOM   8858  C  CB    . ALA A 1  1149 ? 24.890  -18.404  100.653 1.00 75.49  ? 1149 ALA A CB    1 
ATOM   8859  N  N     . SER A 1  1150 ? 28.001  -18.920  100.422 1.00 75.71  ? 1150 SER A N     1 
ATOM   8860  C  CA    . SER A 1  1150 ? 29.328  -18.806  101.014 1.00 76.60  ? 1150 SER A CA    1 
ATOM   8861  C  C     . SER A 1  1150 ? 29.498  -17.355  101.432 1.00 80.67  ? 1150 SER A C     1 
ATOM   8862  O  O     . SER A 1  1150 ? 29.398  -16.457  100.596 1.00 79.39  ? 1150 SER A O     1 
ATOM   8863  C  CB    . SER A 1  1150 ? 30.414  -19.237  100.030 1.00 80.47  ? 1150 SER A CB    1 
ATOM   8864  O  OG    . SER A 1  1150 ? 30.660  -18.296  98.999  1.00 89.36  ? 1150 SER A OG    1 
ATOM   8865  N  N     . GLU A 1  1151 ? 29.684  -17.126  102.733 1.00 78.77  ? 1151 GLU A N     1 
ATOM   8866  C  CA    . GLU A 1  1151 ? 29.825  -15.790  103.300 1.00 78.68  ? 1151 GLU A CA    1 
ATOM   8867  C  C     . GLU A 1  1151 ? 31.226  -15.535  103.838 1.00 83.65  ? 1151 GLU A C     1 
ATOM   8868  O  O     . GLU A 1  1151 ? 31.901  -16.466  104.278 1.00 84.07  ? 1151 GLU A O     1 
ATOM   8869  C  CB    . GLU A 1  1151 ? 28.805  -15.579  104.429 1.00 80.62  ? 1151 GLU A CB    1 
ATOM   8870  C  CG    . GLU A 1  1151 ? 27.356  -15.446  103.990 1.00 90.19  ? 1151 GLU A CG    1 
ATOM   8871  C  CD    . GLU A 1  1151 ? 26.366  -15.264  105.128 1.00 108.23 ? 1151 GLU A CD    1 
ATOM   8872  O  OE1   . GLU A 1  1151 ? 26.335  -16.121  106.042 1.00 101.22 ? 1151 GLU A OE1   1 
ATOM   8873  O  OE2   . GLU A 1  1151 ? 25.594  -14.279  105.085 1.00 97.77  ? 1151 GLU A OE2   1 
ATOM   8874  N  N     . ILE A 1  1152 ? 31.651  -14.262  103.814 1.00 80.67  ? 1152 ILE A N     1 
ATOM   8875  C  CA    . ILE A 1  1152 ? 32.929  -13.814  104.362 1.00 82.00  ? 1152 ILE A CA    1 
ATOM   8876  C  C     . ILE A 1  1152 ? 32.638  -12.756  105.418 1.00 86.44  ? 1152 ILE A C     1 
ATOM   8877  O  O     . ILE A 1  1152 ? 32.119  -11.688  105.097 1.00 85.01  ? 1152 ILE A O     1 
ATOM   8878  C  CB    . ILE A 1  1152 ? 33.955  -13.353  103.292 1.00 85.06  ? 1152 ILE A CB    1 
ATOM   8879  C  CG1   . ILE A 1  1152 ? 34.348  -14.525  102.359 1.00 85.39  ? 1152 ILE A CG1   1 
ATOM   8880  C  CG2   . ILE A 1  1152 ? 35.200  -12.740  103.970 1.00 87.30  ? 1152 ILE A CG2   1 
ATOM   8881  C  CD1   . ILE A 1  1152 ? 34.992  -14.119  101.022 1.00 92.85  ? 1152 ILE A CD1   1 
ATOM   8882  N  N     . TYR A 1  1153 ? 32.937  -13.077  106.677 1.00 85.25  ? 1153 TYR A N     1 
ATOM   8883  C  CA    . TYR A 1  1153 ? 32.699  -12.200  107.818 1.00 86.52  ? 1153 TYR A CA    1 
ATOM   8884  C  C     . TYR A 1  1153 ? 34.000  -11.776  108.471 1.00 93.22  ? 1153 TYR A C     1 
ATOM   8885  O  O     . TYR A 1  1153 ? 34.953  -12.561  108.527 1.00 93.71  ? 1153 TYR A O     1 
ATOM   8886  C  CB    . TYR A 1  1153 ? 31.880  -12.939  108.895 1.00 88.69  ? 1153 TYR A CB    1 
ATOM   8887  C  CG    . TYR A 1  1153 ? 30.404  -13.108  108.617 1.00 89.61  ? 1153 TYR A CG    1 
ATOM   8888  C  CD1   . TYR A 1  1153 ? 29.941  -14.159  107.831 1.00 90.91  ? 1153 TYR A CD1   1 
ATOM   8889  C  CD2   . TYR A 1  1153 ? 29.461  -12.302  109.247 1.00 90.60  ? 1153 TYR A CD2   1 
ATOM   8890  C  CE1   . TYR A 1  1153 ? 28.578  -14.369  107.634 1.00 91.32  ? 1153 TYR A CE1   1 
ATOM   8891  C  CE2   . TYR A 1  1153 ? 28.094  -12.493  109.045 1.00 91.06  ? 1153 TYR A CE2   1 
ATOM   8892  C  CZ    . TYR A 1  1153 ? 27.657  -13.523  108.228 1.00 98.44  ? 1153 TYR A CZ    1 
ATOM   8893  O  OH    . TYR A 1  1153 ? 26.313  -13.722  108.015 1.00 99.73  ? 1153 TYR A OH    1 
ATOM   8894  N  N     . TYR A 1  1154 ? 34.017  -10.561  109.036 1.00 91.26  ? 1154 TYR A N     1 
ATOM   8895  C  CA    . TYR A 1  1154 ? 35.159  -10.124  109.817 1.00 93.28  ? 1154 TYR A CA    1 
ATOM   8896  C  C     . TYR A 1  1154 ? 34.831  -10.482  111.275 1.00 99.71  ? 1154 TYR A C     1 
ATOM   8897  O  O     . TYR A 1  1154 ? 34.129  -9.737   111.965 1.00 98.89  ? 1154 TYR A O     1 
ATOM   8898  C  CB    . TYR A 1  1154 ? 35.488  -8.631   109.624 1.00 94.46  ? 1154 TYR A CB    1 
ATOM   8899  C  CG    . TYR A 1  1154 ? 36.630  -8.183   110.512 1.00 98.14  ? 1154 TYR A CG    1 
ATOM   8900  C  CD1   . TYR A 1  1154 ? 37.946  -8.528   110.218 1.00 101.04 ? 1154 TYR A CD1   1 
ATOM   8901  C  CD2   . TYR A 1  1154 ? 36.389  -7.474   111.685 1.00 100.02 ? 1154 TYR A CD2   1 
ATOM   8902  C  CE1   . TYR A 1  1154 ? 38.996  -8.159   111.057 1.00 103.76 ? 1154 TYR A CE1   1 
ATOM   8903  C  CE2   . TYR A 1  1154 ? 37.432  -7.094   112.528 1.00 102.80 ? 1154 TYR A CE2   1 
ATOM   8904  C  CZ    . TYR A 1  1154 ? 38.734  -7.444   112.214 1.00 110.18 ? 1154 TYR A CZ    1 
ATOM   8905  O  OH    . TYR A 1  1154 ? 39.758  -7.071   113.048 1.00 111.60 ? 1154 TYR A OH    1 
ATOM   8906  N  N     . ASP A 1  1155 ? 35.278  -11.680  111.691 1.00 99.13  ? 1155 ASP A N     1 
ATOM   8907  C  CA    . ASP A 1  1155 ? 35.093  -12.272  113.019 1.00 101.58 ? 1155 ASP A CA    1 
ATOM   8908  C  C     . ASP A 1  1155 ? 36.491  -12.291  113.670 1.00 108.61 ? 1155 ASP A C     1 
ATOM   8909  O  O     . ASP A 1  1155 ? 37.235  -13.264  113.494 1.00 108.79 ? 1155 ASP A O     1 
ATOM   8910  C  CB    . ASP A 1  1155 ? 34.522  -13.697  112.862 1.00 103.71 ? 1155 ASP A CB    1 
ATOM   8911  C  CG    . ASP A 1  1155 ? 33.674  -14.186  114.016 1.00 117.45 ? 1155 ASP A CG    1 
ATOM   8912  O  OD1   . ASP A 1  1155 ? 32.498  -13.779  114.100 1.00 117.41 ? 1155 ASP A OD1   1 
ATOM   8913  O  OD2   . ASP A 1  1155 ? 34.153  -15.054  114.776 1.00 126.37 ? 1155 ASP A OD2   1 
ATOM   8914  N  N     . PRO A 1  1156 ? 36.911  -11.181  114.330 1.00 107.26 ? 1156 PRO A N     1 
ATOM   8915  C  CA    . PRO A 1  1156 ? 38.280  -11.129  114.869 1.00 109.33 ? 1156 PRO A CA    1 
ATOM   8916  C  C     . PRO A 1  1156 ? 38.535  -12.025  116.072 1.00 116.27 ? 1156 PRO A C     1 
ATOM   8917  O  O     . PRO A 1  1156 ? 39.602  -12.634  116.150 1.00 117.08 ? 1156 PRO A O     1 
ATOM   8918  C  CB    . PRO A 1  1156 ? 38.484  -9.644   115.173 1.00 111.30 ? 1156 PRO A CB    1 
ATOM   8919  C  CG    . PRO A 1  1156 ? 37.122  -9.130   115.453 1.00 114.66 ? 1156 PRO A CG    1 
ATOM   8920  C  CD    . PRO A 1  1156 ? 36.182  -9.921   114.592 1.00 108.44 ? 1156 PRO A CD    1 
ATOM   8921  N  N     . ASP A 1  1157 ? 37.565  -12.107  116.997 1.00 114.20 ? 1157 ASP A N     1 
ATOM   8922  C  CA    . ASP A 1  1157 ? 37.683  -12.938  118.185 1.00 116.75 ? 1157 ASP A CA    1 
ATOM   8923  C  C     . ASP A 1  1157 ? 37.288  -14.360  117.799 1.00 120.71 ? 1157 ASP A C     1 
ATOM   8924  O  O     . ASP A 1  1157 ? 36.127  -14.580  117.446 1.00 118.79 ? 1157 ASP A O     1 
ATOM   8925  C  CB    . ASP A 1  1157 ? 36.787  -12.401  119.317 1.00 119.84 ? 1157 ASP A CB    1 
ATOM   8926  C  CG    . ASP A 1  1157 ? 37.114  -12.942  120.700 1.00 134.72 ? 1157 ASP A CG    1 
ATOM   8927  O  OD1   . ASP A 1  1157 ? 37.334  -12.121  121.621 1.00 137.11 ? 1157 ASP A OD1   1 
ATOM   8928  O  OD2   . ASP A 1  1157 ? 37.124  -14.185  120.869 1.00 140.97 ? 1157 ASP A OD2   1 
ATOM   8929  N  N     . PRO A 1  1158 ? 38.230  -15.336  117.812 1.00 119.28 ? 1158 PRO A N     1 
ATOM   8930  C  CA    . PRO A 1  1158 ? 37.860  -16.710  117.429 1.00 119.18 ? 1158 PRO A CA    1 
ATOM   8931  C  C     . PRO A 1  1158 ? 37.053  -17.433  118.510 1.00 125.37 ? 1158 PRO A C     1 
ATOM   8932  O  O     . PRO A 1  1158 ? 36.295  -18.349  118.184 1.00 124.64 ? 1158 PRO A O     1 
ATOM   8933  C  CB    . PRO A 1  1158 ? 39.212  -17.391  117.154 1.00 122.13 ? 1158 PRO A CB    1 
ATOM   8934  C  CG    . PRO A 1  1158 ? 40.261  -16.305  117.292 1.00 127.13 ? 1158 PRO A CG    1 
ATOM   8935  C  CD    . PRO A 1  1158 ? 39.657  -15.262  118.172 1.00 122.73 ? 1158 PRO A CD    1 
ATOM   8936  N  N     . ARG A 1  1159 ? 37.200  -17.003  119.786 1.00 123.87 ? 1159 ARG A N     1 
ATOM   8937  C  CA    . ARG A 1  1159 ? 36.511  -17.564  120.954 1.00 125.42 ? 1159 ARG A CA    1 
ATOM   8938  C  C     . ARG A 1  1159 ? 35.083  -17.009  121.114 1.00 127.99 ? 1159 ARG A C     1 
ATOM   8939  O  O     . ARG A 1  1159 ? 34.226  -17.700  121.669 1.00 128.16 ? 1159 ARG A O     1 
ATOM   8940  C  CB    . ARG A 1  1159 ? 37.332  -17.333  122.237 1.00 128.79 ? 1159 ARG A CB    1 
ATOM   8941  C  CG    . ARG A 1  1159 ? 38.703  -18.005  122.229 1.00 139.91 ? 1159 ARG A CG    1 
ATOM   8942  C  CD    . ARG A 1  1159 ? 39.515  -17.654  123.462 1.00 149.21 ? 1159 ARG A CD    1 
ATOM   8943  N  NE    . ARG A 1  1159 ? 40.931  -17.996  123.302 1.00 157.89 ? 1159 ARG A NE    1 
ATOM   8944  C  CZ    . ARG A 1  1159 ? 41.479  -19.151  123.673 1.00 171.17 ? 1159 ARG A CZ    1 
ATOM   8945  N  NH1   . ARG A 1  1159 ? 40.736  -20.098  124.233 1.00 158.23 ? 1159 ARG A NH1   1 
ATOM   8946  N  NH2   . ARG A 1  1159 ? 42.774  -19.367  123.485 1.00 159.05 ? 1159 ARG A NH2   1 
ATOM   8947  N  N     . SER A 1  1160 ? 34.838  -15.765  120.644 1.00 122.99 ? 1160 SER A N     1 
ATOM   8948  C  CA    . SER A 1  1160 ? 33.529  -15.106  120.695 1.00 122.01 ? 1160 SER A CA    1 
ATOM   8949  C  C     . SER A 1  1160 ? 33.105  -14.633  119.305 1.00 123.79 ? 1160 SER A C     1 
ATOM   8950  O  O     . SER A 1  1160 ? 33.648  -13.658  118.772 1.00 122.62 ? 1160 SER A O     1 
ATOM   8951  C  CB    . SER A 1  1160 ? 33.526  -13.957  121.697 1.00 126.92 ? 1160 SER A CB    1 
ATOM   8952  O  OG    . SER A 1  1160 ? 33.263  -14.431  123.007 1.00 139.36 ? 1160 SER A OG    1 
ATOM   8953  N  N     . THR A 1  1161 ? 32.136  -15.348  118.716 1.00 119.29 ? 1161 THR A N     1 
ATOM   8954  C  CA    . THR A 1  1161 ? 31.620  -15.095  117.374 1.00 116.57 ? 1161 THR A CA    1 
ATOM   8955  C  C     . THR A 1  1161 ? 30.649  -13.915  117.311 1.00 119.80 ? 1161 THR A C     1 
ATOM   8956  O  O     . THR A 1  1161 ? 29.740  -13.808  118.138 1.00 120.33 ? 1161 THR A O     1 
ATOM   8957  C  CB    . THR A 1  1161 ? 31.106  -16.410  116.770 1.00 123.79 ? 1161 THR A CB    1 
ATOM   8958  O  OG1   . THR A 1  1161 ? 32.201  -17.321  116.743 1.00 126.42 ? 1161 THR A OG1   1 
ATOM   8959  C  CG2   . THR A 1  1161 ? 30.562  -16.259  115.354 1.00 119.00 ? 1161 THR A CG2   1 
ATOM   8960  N  N     . VAL A 1  1162 ? 30.851  -13.042  116.301 1.00 114.78 ? 1162 VAL A N     1 
ATOM   8961  C  CA    . VAL A 1  1162 ? 30.022  -11.871  116.003 1.00 113.58 ? 1162 VAL A CA    1 
ATOM   8962  C  C     . VAL A 1  1162 ? 28.610  -12.340  115.598 1.00 117.19 ? 1162 VAL A C     1 
ATOM   8963  O  O     . VAL A 1  1162 ? 27.633  -11.659  115.911 1.00 116.94 ? 1162 VAL A O     1 
ATOM   8964  C  CB    . VAL A 1  1162 ? 30.663  -10.961  114.921 1.00 115.78 ? 1162 VAL A CB    1 
ATOM   8965  C  CG1   . VAL A 1  1162 ? 29.967  -9.605   114.871 1.00 115.32 ? 1162 VAL A CG1   1 
ATOM   8966  C  CG2   . VAL A 1  1162 ? 32.159  -10.771  115.166 1.00 116.48 ? 1162 VAL A CG2   1 
ATOM   8967  N  N     . ILE A 1  1163 ? 28.513  -13.518  114.927 1.00 113.61 ? 1163 ILE A N     1 
ATOM   8968  C  CA    . ILE A 1  1163 ? 27.252  -14.149  114.512 1.00 112.96 ? 1163 ILE A CA    1 
ATOM   8969  C  C     . ILE A 1  1163 ? 26.549  -14.703  115.772 1.00 121.01 ? 1163 ILE A C     1 
ATOM   8970  O  O     . ILE A 1  1163 ? 27.120  -15.557  116.463 1.00 122.09 ? 1163 ILE A O     1 
ATOM   8971  C  CB    . ILE A 1  1163 ? 27.457  -15.242  113.419 1.00 114.22 ? 1163 ILE A CB    1 
ATOM   8972  C  CG1   . ILE A 1  1163 ? 28.207  -14.688  112.194 1.00 112.32 ? 1163 ILE A CG1   1 
ATOM   8973  C  CG2   . ILE A 1  1163 ? 26.121  -15.874  113.005 1.00 114.27 ? 1163 ILE A CG2   1 
ATOM   8974  C  CD1   . ILE A 1  1163 ? 29.367  -15.508  111.775 1.00 116.90 ? 1163 ILE A CD1   1 
ATOM   8975  N  N     . PRO A 1  1164 ? 25.323  -14.227  116.096 1.00 119.32 ? 1164 PRO A N     1 
ATOM   8976  C  CA    . PRO A 1  1164 ? 24.645  -14.717  117.307 1.00 121.76 ? 1164 PRO A CA    1 
ATOM   8977  C  C     . PRO A 1  1164 ? 23.822  -15.985  117.052 1.00 126.34 ? 1164 PRO A C     1 
ATOM   8978  O  O     . PRO A 1  1164 ? 22.674  -16.100  117.492 1.00 127.44 ? 1164 PRO A O     1 
ATOM   8979  C  CB    . PRO A 1  1164 ? 23.801  -13.513  117.739 1.00 124.13 ? 1164 PRO A CB    1 
ATOM   8980  C  CG    . PRO A 1  1164 ? 23.533  -12.750  116.460 1.00 126.20 ? 1164 PRO A CG    1 
ATOM   8981  C  CD    . PRO A 1  1164 ? 24.499  -13.216  115.398 1.00 119.77 ? 1164 PRO A CD    1 
ATOM   8982  N  N     . GLU A 1  1165 ? 24.433  -16.948  116.350 1.00 121.77 ? 1165 GLU A N     1 
ATOM   8983  C  CA    . GLU A 1  1165 ? 23.816  -18.215  115.981 1.00 121.57 ? 1165 GLU A CA    1 
ATOM   8984  C  C     . GLU A 1  1165 ? 24.855  -19.333  116.033 1.00 126.04 ? 1165 GLU A C     1 
ATOM   8985  O  O     . GLU A 1  1165 ? 24.517  -20.476  116.349 1.00 126.72 ? 1165 GLU A O     1 
ATOM   8986  C  CB    . GLU A 1  1165 ? 23.234  -18.091  114.565 1.00 120.60 ? 1165 GLU A CB    1 
ATOM   8987  C  CG    . GLU A 1  1165 ? 22.130  -19.082  114.247 1.00 131.52 ? 1165 GLU A CG    1 
ATOM   8988  C  CD    . GLU A 1  1165 ? 21.449  -18.885  112.904 1.00 154.27 ? 1165 GLU A CD    1 
ATOM   8989  O  OE1   . GLU A 1  1165 ? 20.244  -19.210  112.804 1.00 151.90 ? 1165 GLU A OE1   1 
ATOM   8990  O  OE2   . GLU A 1  1165 ? 22.115  -18.417  111.951 1.00 148.21 ? 1165 GLU A OE2   1 
ATOM   8991  N  N     . ASP A 1  1166 ? 26.122  -18.993  115.734 1.00 122.05 ? 1166 ASP A N     1 
ATOM   8992  C  CA    . ASP A 1  1166 ? 27.238  -19.933  115.684 1.00 122.42 ? 1166 ASP A CA    1 
ATOM   8993  C  C     . ASP A 1  1166 ? 27.956  -20.181  117.011 1.00 128.94 ? 1166 ASP A C     1 
ATOM   8994  O  O     . ASP A 1  1166 ? 28.751  -21.119  117.082 1.00 129.31 ? 1166 ASP A O     1 
ATOM   8995  C  CB    . ASP A 1  1166 ? 28.244  -19.531  114.584 1.00 122.24 ? 1166 ASP A CB    1 
ATOM   8996  C  CG    . ASP A 1  1166 ? 27.689  -19.503  113.170 1.00 126.13 ? 1166 ASP A CG    1 
ATOM   8997  O  OD1   . ASP A 1  1166 ? 26.836  -20.363  112.845 1.00 125.50 ? 1166 ASP A OD1   1 
ATOM   8998  O  OD2   . ASP A 1  1166 ? 28.136  -18.649  112.377 1.00 129.55 ? 1166 ASP A OD2   1 
ATOM   8999  N  N     . GLU A 1  1167 ? 27.676  -19.372  118.060 1.00 127.16 ? 1167 GLU A N     1 
ATOM   9000  C  CA    . GLU A 1  1167 ? 28.318  -19.511  119.376 1.00 129.64 ? 1167 GLU A CA    1 
ATOM   9001  C  C     . GLU A 1  1167 ? 28.195  -20.912  119.987 1.00 136.06 ? 1167 GLU A C     1 
ATOM   9002  O  O     . GLU A 1  1167 ? 29.117  -21.349  120.675 1.00 137.28 ? 1167 GLU A O     1 
ATOM   9003  C  CB    . GLU A 1  1167 ? 27.876  -18.412  120.352 1.00 132.12 ? 1167 GLU A CB    1 
ATOM   9004  C  CG    . GLU A 1  1167 ? 28.953  -18.063  121.366 1.00 144.64 ? 1167 GLU A CG    1 
ATOM   9005  C  CD    . GLU A 1  1167 ? 28.750  -16.759  122.110 1.00 166.29 ? 1167 GLU A CD    1 
ATOM   9006  O  OE1   . GLU A 1  1167 ? 28.540  -16.806  123.344 1.00 164.89 ? 1167 GLU A OE1   1 
ATOM   9007  O  OE2   . GLU A 1  1167 ? 28.830  -15.688  121.466 1.00 157.48 ? 1167 GLU A OE2   1 
ATOM   9008  N  N     . GLU A 1  1168 ? 27.095  -21.631  119.678 1.00 133.26 ? 1168 GLU A N     1 
ATOM   9009  C  CA    . GLU A 1  1168 ? 26.842  -23.006  120.120 1.00 135.38 ? 1168 GLU A CA    1 
ATOM   9010  C  C     . GLU A 1  1168 ? 27.913  -23.971  119.582 1.00 139.42 ? 1168 GLU A C     1 
ATOM   9011  O  O     . GLU A 1  1168 ? 28.280  -24.920  120.273 1.00 141.25 ? 1168 GLU A O     1 
ATOM   9012  C  CB    . GLU A 1  1168 ? 25.443  -23.465  119.681 1.00 136.44 ? 1168 GLU A CB    1 
ATOM   9013  C  CG    . GLU A 1  1168 ? 24.576  -23.966  120.826 1.00 151.23 ? 1168 GLU A CG    1 
ATOM   9014  C  CD    . GLU A 1  1168 ? 24.943  -25.330  121.380 1.00 175.21 ? 1168 GLU A CD    1 
ATOM   9015  O  OE1   . GLU A 1  1168 ? 24.723  -26.339  120.671 1.00 169.71 ? 1168 GLU A OE1   1 
ATOM   9016  O  OE2   . GLU A 1  1168 ? 25.429  -25.391  122.533 1.00 169.85 ? 1168 GLU A OE2   1 
ATOM   9017  N  N     . ILE A 1  1169 ? 28.417  -23.713  118.360 1.00 133.91 ? 1169 ILE A N     1 
ATOM   9018  C  CA    . ILE A 1  1169 ? 29.475  -24.491  117.705 1.00 133.69 ? 1169 ILE A CA    1 
ATOM   9019  C  C     . ILE A 1  1169 ? 30.823  -24.177  118.400 1.00 139.70 ? 1169 ILE A C     1 
ATOM   9020  O  O     . ILE A 1  1169 ? 31.669  -25.063  118.527 1.00 140.63 ? 1169 ILE A O     1 
ATOM   9021  C  CB    . ILE A 1  1169 ? 29.483  -24.226  116.158 1.00 133.83 ? 1169 ILE A CB    1 
ATOM   9022  C  CG1   . ILE A 1  1169 ? 28.121  -24.577  115.525 1.00 133.01 ? 1169 ILE A CG1   1 
ATOM   9023  C  CG2   . ILE A 1  1169 ? 30.604  -24.975  115.433 1.00 134.40 ? 1169 ILE A CG2   1 
ATOM   9024  C  CD1   . ILE A 1  1169 ? 27.579  -23.544  114.593 1.00 137.32 ? 1169 ILE A CD1   1 
ATOM   9025  N  N     . ILE A 1  1170 ? 30.987  -22.928  118.885 1.00 136.99 ? 1170 ILE A N     1 
ATOM   9026  C  CA    . ILE A 1  1170 ? 32.192  -22.462  119.585 1.00 138.57 ? 1170 ILE A CA    1 
ATOM   9027  C  C     . ILE A 1  1170 ? 32.241  -23.015  121.016 1.00 146.94 ? 1170 ILE A C     1 
ATOM   9028  O  O     . ILE A 1  1170 ? 33.332  -23.136  121.580 1.00 147.78 ? 1170 ILE A O     1 
ATOM   9029  C  CB    . ILE A 1  1170 ? 32.381  -20.913  119.519 1.00 140.38 ? 1170 ILE A CB    1 
ATOM   9030  C  CG1   . ILE A 1  1170 ? 31.871  -20.292  118.189 1.00 137.82 ? 1170 ILE A CG1   1 
ATOM   9031  C  CG2   . ILE A 1  1170 ? 33.830  -20.501  119.812 1.00 142.13 ? 1170 ILE A CG2   1 
ATOM   9032  C  CD1   . ILE A 1  1170 ? 32.622  -20.697  116.839 1.00 144.16 ? 1170 ILE A CD1   1 
ATOM   9033  N  N     . GLN A 1  1171 ? 31.065  -23.373  121.592 1.00 146.36 ? 1171 GLN A N     1 
ATOM   9034  C  CA    . GLN A 1  1171 ? 30.952  -23.987  122.923 1.00 149.97 ? 1171 GLN A CA    1 
ATOM   9035  C  C     . GLN A 1  1171 ? 31.654  -25.350  122.883 1.00 156.40 ? 1171 GLN A C     1 
ATOM   9036  O  O     . GLN A 1  1171 ? 32.430  -25.669  123.786 1.00 158.24 ? 1171 GLN A O     1 
ATOM   9037  C  CB    . GLN A 1  1171 ? 29.480  -24.128  123.351 1.00 151.87 ? 1171 GLN A CB    1 
ATOM   9038  C  CG    . GLN A 1  1171 ? 29.033  -23.094  124.385 1.00 162.40 ? 1171 GLN A CG    1 
ATOM   9039  C  CD    . GLN A 1  1171 ? 28.553  -21.806  123.762 1.00 172.76 ? 1171 GLN A CD    1 
ATOM   9040  O  OE1   . GLN A 1  1171 ? 29.303  -20.834  123.627 1.00 167.17 ? 1171 GLN A OE1   1 
ATOM   9041  N  NE2   . GLN A 1  1171 ? 27.286  -21.764  123.382 1.00 163.29 ? 1171 GLN A NE2   1 
ATOM   9042  N  N     . LEU A 1  1172 ? 31.431  -26.111  121.792 1.00 152.25 ? 1172 LEU A N     1 
ATOM   9043  C  CA    . LEU A 1  1172 ? 32.104  -27.381  121.514 1.00 153.84 ? 1172 LEU A CA    1 
ATOM   9044  C  C     . LEU A 1  1172 ? 33.382  -27.037  120.704 1.00 158.57 ? 1172 LEU A C     1 
ATOM   9045  O  O     . LEU A 1  1172 ? 33.710  -25.852  120.588 1.00 156.69 ? 1172 LEU A O     1 
ATOM   9046  C  CB    . LEU A 1  1172 ? 31.199  -28.394  120.753 1.00 153.07 ? 1172 LEU A CB    1 
ATOM   9047  C  CG    . LEU A 1  1172 ? 29.754  -28.013  120.386 1.00 155.95 ? 1172 LEU A CG    1 
ATOM   9048  C  CD1   . LEU A 1  1172 ? 29.304  -28.747  119.140 1.00 154.29 ? 1172 LEU A CD1   1 
ATOM   9049  C  CD2   . LEU A 1  1172 ? 28.791  -28.305  121.526 1.00 160.03 ? 1172 LEU A CD2   1 
ATOM   9050  N  N     . HIS A 1  1173 ? 34.099  -28.052  120.150 1.00 157.13 ? 1173 HIS A N     1 
ATOM   9051  C  CA    . HIS A 1  1173 ? 35.348  -27.881  119.380 1.00 156.86 ? 1173 HIS A CA    1 
ATOM   9052  C  C     . HIS A 1  1173 ? 36.382  -27.059  120.184 1.00 162.67 ? 1173 HIS A C     1 
ATOM   9053  O  O     . HIS A 1  1173 ? 36.930  -26.067  119.687 1.00 160.45 ? 1173 HIS A O     1 
ATOM   9054  C  CB    . HIS A 1  1173 ? 35.082  -27.271  117.985 1.00 154.42 ? 1173 HIS A CB    1 
ATOM   9055  C  CG    . HIS A 1  1173 ? 34.761  -28.269  116.914 1.00 157.09 ? 1173 HIS A CG    1 
ATOM   9056  N  ND1   . HIS A 1  1173 ? 33.483  -28.378  116.388 1.00 157.16 ? 1173 HIS A ND1   1 
ATOM   9057  C  CD2   . HIS A 1  1173 ? 35.574  -29.136  116.266 1.00 159.64 ? 1173 HIS A CD2   1 
ATOM   9058  C  CE1   . HIS A 1  1173 ? 33.556  -29.313  115.452 1.00 156.25 ? 1173 HIS A CE1   1 
ATOM   9059  N  NE2   . HIS A 1  1173 ? 34.793  -29.800  115.343 1.00 158.11 ? 1173 HIS A NE2   1 
ATOM   9060  N  N     . PHE A 1  1174 ? 36.609  -27.475  121.451 1.00 162.38 ? 1174 PHE A N     1 
ATOM   9061  C  CA    . PHE A 1  1174 ? 37.505  -26.819  122.406 1.00 164.10 ? 1174 PHE A CA    1 
ATOM   9062  C  C     . PHE A 1  1174 ? 38.639  -27.727  122.923 1.00 168.72 ? 1174 PHE A C     1 
ATOM   9063  O  O     . PHE A 1  1174 ? 39.795  -27.299  122.930 1.00 168.34 ? 1174 PHE A O     1 
ATOM   9064  C  CB    . PHE A 1  1174 ? 36.695  -26.191  123.569 1.00 166.93 ? 1174 PHE A CB    1 
ATOM   9065  C  CG    . PHE A 1  1174 ? 36.057  -27.156  124.551 1.00 168.54 ? 1174 PHE A CG    1 
ATOM   9066  C  CD1   . PHE A 1  1174 ? 34.904  -27.861  124.214 1.00 170.19 ? 1174 PHE A CD1   1 
ATOM   9067  C  CD2   . PHE A 1  1174 ? 36.599  -27.347  125.816 1.00 170.04 ? 1174 PHE A CD2   1 
ATOM   9068  C  CE1   . PHE A 1  1174 ? 34.320  -28.755  125.118 1.00 170.87 ? 1174 PHE A CE1   1 
ATOM   9069  C  CE2   . PHE A 1  1174 ? 36.011  -28.238  126.722 1.00 171.64 ? 1174 PHE A CE2   1 
ATOM   9070  C  CZ    . PHE A 1  1174 ? 34.875  -28.934  126.367 1.00 170.20 ? 1174 PHE A CZ    1 
ATOM   9071  N  N     . SER A 1  1175 ? 38.309  -28.968  123.351 1.00 166.20 ? 1175 SER A N     1 
ATOM   9072  C  CA    . SER A 1  1175 ? 39.268  -29.937  123.895 1.00 166.54 ? 1175 SER A CA    1 
ATOM   9073  C  C     . SER A 1  1175 ? 39.018  -31.368  123.379 1.00 169.19 ? 1175 SER A C     1 
ATOM   9074  O  O     . SER A 1  1175 ? 38.173  -31.549  122.498 1.00 168.53 ? 1175 SER A O     1 
ATOM   9075  C  CB    . SER A 1  1175 ? 39.258  -29.893  125.423 1.00 169.22 ? 1175 SER A CB    1 
ATOM   9076  O  OG    . SER A 1  1175 ? 39.689  -28.631  125.909 1.00 174.85 ? 1175 SER A OG    1 
ATOM   9077  N  N     . LEU A 1  1176 ? 39.777  -32.366  123.921 1.00 166.87 ? 1176 LEU A N     1 
ATOM   9078  C  CA    . LEU A 1  1176 ? 39.779  -33.814  123.629 1.00 183.80 ? 1176 LEU A CA    1 
ATOM   9079  C  C     . LEU A 1  1176 ? 38.640  -34.321  122.740 1.00 198.94 ? 1176 LEU A C     1 
ATOM   9080  O  O     . LEU A 1  1176 ? 38.827  -35.273  121.985 1.00 172.23 ? 1176 LEU A O     1 
ATOM   9081  C  CB    . LEU A 1  1176 ? 39.837  -34.626  124.937 1.00 183.89 ? 1176 LEU A CB    1 
ATOM   9082  C  CG    . LEU A 1  1176 ? 40.581  -35.967  124.885 1.00 187.46 ? 1176 LEU A CG    1 
ATOM   9083  C  CD1   . LEU A 1  1176 ? 41.430  -36.162  126.123 1.00 187.93 ? 1176 LEU A CD1   1 
ATOM   9084  C  CD2   . LEU A 1  1176 ? 39.618  -37.136  124.729 1.00 188.52 ? 1176 LEU A CD2   1 
ATOM   9085  N  N     . GLN A 1  1187 ? 46.740  -15.968  116.492 1.00 114.31 ? 1187 GLN A N     1 
ATOM   9086  C  CA    . GLN A 1  1187 ? 47.320  -17.266  116.147 1.00 115.65 ? 1187 GLN A CA    1 
ATOM   9087  C  C     . GLN A 1  1187 ? 46.524  -18.042  115.067 1.00 118.11 ? 1187 GLN A C     1 
ATOM   9088  O  O     . GLN A 1  1187 ? 46.725  -19.251  114.894 1.00 118.84 ? 1187 GLN A O     1 
ATOM   9089  C  CB    . GLN A 1  1187 ? 47.634  -18.108  117.411 1.00 119.80 ? 1187 GLN A CB    1 
ATOM   9090  C  CG    . GLN A 1  1187 ? 46.427  -18.514  118.271 1.00 132.75 ? 1187 GLN A CG    1 
ATOM   9091  C  CD    . GLN A 1  1187 ? 45.828  -19.854  117.894 1.00 149.78 ? 1187 GLN A CD    1 
ATOM   9092  O  OE1   . GLN A 1  1187 ? 46.526  -20.859  117.698 1.00 147.48 ? 1187 GLN A OE1   1 
ATOM   9093  N  NE2   . GLN A 1  1187 ? 44.507  -19.907  117.828 1.00 137.18 ? 1187 GLN A NE2   1 
ATOM   9094  N  N     . GLN A 1  1188 ? 45.647  -17.324  114.322 1.00 111.94 ? 1188 GLN A N     1 
ATOM   9095  C  CA    . GLN A 1  1188 ? 44.813  -17.844  113.228 1.00 109.12 ? 1188 GLN A CA    1 
ATOM   9096  C  C     . GLN A 1  1188 ? 44.676  -16.765  112.135 1.00 110.82 ? 1188 GLN A C     1 
ATOM   9097  O  O     . GLN A 1  1188 ? 45.672  -16.451  111.480 1.00 111.23 ? 1188 GLN A O     1 
ATOM   9098  C  CB    . GLN A 1  1188 ? 43.437  -18.310  113.752 1.00 109.07 ? 1188 GLN A CB    1 
ATOM   9099  C  CG    . GLN A 1  1188 ? 43.408  -19.756  114.241 1.00 121.02 ? 1188 GLN A CG    1 
ATOM   9100  C  CD    . GLN A 1  1188 ? 42.181  -20.098  115.062 1.00 134.26 ? 1188 GLN A CD    1 
ATOM   9101  O  OE1   . GLN A 1  1188 ? 41.100  -19.506  114.921 1.00 124.85 ? 1188 GLN A OE1   1 
ATOM   9102  N  NE2   . GLN A 1  1188 ? 42.316  -21.098  115.923 1.00 128.14 ? 1188 GLN A NE2   1 
ATOM   9103  N  N     . SER A 1  1189 ? 43.455  -16.201  111.951 1.00 104.79 ? 1