data_3RZE
# 
_entry.id   3RZE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RZE         
RCSB  RCSB065566   
WWPDB D_1000065566 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          GPCR-53 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RZE 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shimamura, T.'       1  ? 
'Han, G.W.'           2  ? 
'Shiroishi, M.'       3  ? 
'Weyand, S.'          4  ? 
'Tsujimoto, H.'       5  ? 
'Winter, G.'          6  ? 
'Katritch, V.'        7  ? 
'Abagyan, R.'         8  ? 
'Cherezov, V.'        9  ? 
'Liu, W.'             10 ? 
'Kobayashi, T.'       11 ? 
'Stevens, R.'         12 ? 
'Iwata, S.'           13 ? 
'GPCR Network (GPCR)' 14 ? 
# 
_citation.id                        primary 
_citation.title                     'Structure of the human histamine H1 receptor complex with doxepin.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            475 
_citation.page_first                65 
_citation.page_last                 70 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21697825 
_citation.pdbx_database_id_DOI      10.1038/nature10236 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shimamura, T.' 1  
primary 'Shiroishi, M.' 2  
primary 'Weyand, S.'    3  
primary 'Tsujimoto, H.' 4  
primary 'Winter, G.'    5  
primary 'Katritch, V.'  6  
primary 'Abagyan, R.'   7  
primary 'Cherezov, V.'  8  
primary 'Liu, W.'       9  
primary 'Han, G.W.'     10 
primary 'Kobayashi, T.' 11 
primary 'Stevens, R.C.' 12 
primary 'Iwata, S.'     13 
# 
_cell.entry_id           3RZE 
_cell.length_a           88.144 
_cell.length_b           88.144 
_cell.length_c           331.654 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RZE 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histamine H1 receptor, Lysozyme chimera'                               52382.594 1 3.2.1.17 ? ? ? 
2 non-polymer syn '(3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' 279.376   1 ?        ? ? ? 
3 non-polymer syn '(3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' 279.376   1 ?        ? ? ? 
4 non-polymer syn 'PHOSPHATE ION'                                                         94.971    3 ?        ? ? ? 
5 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate'                        356.540   1 ?        ? ? ? 
6 water       nat water                                                                   18.015    2 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'H1R, HH1R, Endolysin, Lysis protein, Muramidase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPL
CLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDK
CETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSL
NAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLR
MLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCK
NCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRSGENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPL
CLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDK
CETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSL
NAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLR
MLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCK
NCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRSGENLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         GPCR-53 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   THR n 
1 3   MET n 
1 4   ALA n 
1 5   SER n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   MET n 
1 10  PRO n 
1 11  LEU n 
1 12  VAL n 
1 13  VAL n 
1 14  VAL n 
1 15  LEU n 
1 16  SER n 
1 17  THR n 
1 18  ILE n 
1 19  CYS n 
1 20  LEU n 
1 21  VAL n 
1 22  THR n 
1 23  VAL n 
1 24  GLY n 
1 25  LEU n 
1 26  ASN n 
1 27  LEU n 
1 28  LEU n 
1 29  VAL n 
1 30  LEU n 
1 31  TYR n 
1 32  ALA n 
1 33  VAL n 
1 34  ARG n 
1 35  SER n 
1 36  GLU n 
1 37  ARG n 
1 38  LYS n 
1 39  LEU n 
1 40  HIS n 
1 41  THR n 
1 42  VAL n 
1 43  GLY n 
1 44  ASN n 
1 45  LEU n 
1 46  TYR n 
1 47  ILE n 
1 48  VAL n 
1 49  SER n 
1 50  LEU n 
1 51  SER n 
1 52  VAL n 
1 53  ALA n 
1 54  ASP n 
1 55  LEU n 
1 56  ILE n 
1 57  VAL n 
1 58  GLY n 
1 59  ALA n 
1 60  VAL n 
1 61  VAL n 
1 62  MET n 
1 63  PRO n 
1 64  MET n 
1 65  ASN n 
1 66  ILE n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  LEU n 
1 71  MET n 
1 72  SER n 
1 73  LYS n 
1 74  TRP n 
1 75  SER n 
1 76  LEU n 
1 77  GLY n 
1 78  ARG n 
1 79  PRO n 
1 80  LEU n 
1 81  CYS n 
1 82  LEU n 
1 83  PHE n 
1 84  TRP n 
1 85  LEU n 
1 86  SER n 
1 87  MET n 
1 88  ASP n 
1 89  TYR n 
1 90  VAL n 
1 91  ALA n 
1 92  SER n 
1 93  THR n 
1 94  ALA n 
1 95  SER n 
1 96  ILE n 
1 97  PHE n 
1 98  SER n 
1 99  VAL n 
1 100 PHE n 
1 101 ILE n 
1 102 LEU n 
1 103 CYS n 
1 104 ILE n 
1 105 ASP n 
1 106 ARG n 
1 107 TYR n 
1 108 ARG n 
1 109 SER n 
1 110 VAL n 
1 111 GLN n 
1 112 GLN n 
1 113 PRO n 
1 114 LEU n 
1 115 ARG n 
1 116 TYR n 
1 117 LEU n 
1 118 LYS n 
1 119 TYR n 
1 120 ARG n 
1 121 THR n 
1 122 LYS n 
1 123 THR n 
1 124 ARG n 
1 125 ALA n 
1 126 SER n 
1 127 ALA n 
1 128 THR n 
1 129 ILE n 
1 130 LEU n 
1 131 GLY n 
1 132 ALA n 
1 133 TRP n 
1 134 PHE n 
1 135 LEU n 
1 136 SER n 
1 137 PHE n 
1 138 LEU n 
1 139 TRP n 
1 140 VAL n 
1 141 ILE n 
1 142 PRO n 
1 143 ILE n 
1 144 LEU n 
1 145 GLY n 
1 146 TRP n 
1 147 ASN n 
1 148 HIS n 
1 149 PHE n 
1 150 MET n 
1 151 GLN n 
1 152 GLN n 
1 153 THR n 
1 154 SER n 
1 155 VAL n 
1 156 ARG n 
1 157 ARG n 
1 158 GLU n 
1 159 ASP n 
1 160 LYS n 
1 161 CYS n 
1 162 GLU n 
1 163 THR n 
1 164 ASP n 
1 165 PHE n 
1 166 TYR n 
1 167 ASP n 
1 168 VAL n 
1 169 THR n 
1 170 TRP n 
1 171 PHE n 
1 172 LYS n 
1 173 VAL n 
1 174 MET n 
1 175 THR n 
1 176 ALA n 
1 177 ILE n 
1 178 ILE n 
1 179 ASN n 
1 180 PHE n 
1 181 TYR n 
1 182 LEU n 
1 183 PRO n 
1 184 THR n 
1 185 LEU n 
1 186 LEU n 
1 187 MET n 
1 188 LEU n 
1 189 TRP n 
1 190 PHE n 
1 191 TYR n 
1 192 ALA n 
1 193 LYS n 
1 194 ILE n 
1 195 TYR n 
1 196 LYS n 
1 197 ALA n 
1 198 VAL n 
1 199 ARG n 
1 200 GLN n 
1 201 HIS n 
1 202 CYS n 
1 203 ASN n 
1 204 ILE n 
1 205 PHE n 
1 206 GLU n 
1 207 MET n 
1 208 LEU n 
1 209 ARG n 
1 210 ILE n 
1 211 ASP n 
1 212 GLU n 
1 213 GLY n 
1 214 LEU n 
1 215 ARG n 
1 216 LEU n 
1 217 LYS n 
1 218 ILE n 
1 219 TYR n 
1 220 LYS n 
1 221 ASP n 
1 222 THR n 
1 223 GLU n 
1 224 GLY n 
1 225 TYR n 
1 226 TYR n 
1 227 THR n 
1 228 ILE n 
1 229 GLY n 
1 230 ILE n 
1 231 GLY n 
1 232 HIS n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 SER n 
1 238 PRO n 
1 239 SER n 
1 240 LEU n 
1 241 ASN n 
1 242 ALA n 
1 243 ALA n 
1 244 LYS n 
1 245 SER n 
1 246 GLU n 
1 247 LEU n 
1 248 ASP n 
1 249 LYS n 
1 250 ALA n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ASN n 
1 255 THR n 
1 256 ASN n 
1 257 GLY n 
1 258 VAL n 
1 259 ILE n 
1 260 THR n 
1 261 LYS n 
1 262 ASP n 
1 263 GLU n 
1 264 ALA n 
1 265 GLU n 
1 266 LYS n 
1 267 LEU n 
1 268 PHE n 
1 269 ASN n 
1 270 GLN n 
1 271 ASP n 
1 272 VAL n 
1 273 ASP n 
1 274 ALA n 
1 275 ALA n 
1 276 VAL n 
1 277 ARG n 
1 278 GLY n 
1 279 ILE n 
1 280 LEU n 
1 281 ARG n 
1 282 ASN n 
1 283 ALA n 
1 284 LYS n 
1 285 LEU n 
1 286 LYS n 
1 287 PRO n 
1 288 VAL n 
1 289 TYR n 
1 290 ASP n 
1 291 SER n 
1 292 LEU n 
1 293 ASP n 
1 294 ALA n 
1 295 VAL n 
1 296 ARG n 
1 297 ARG n 
1 298 ALA n 
1 299 ALA n 
1 300 LEU n 
1 301 ILE n 
1 302 ASN n 
1 303 MET n 
1 304 VAL n 
1 305 PHE n 
1 306 GLN n 
1 307 MET n 
1 308 GLY n 
1 309 GLU n 
1 310 THR n 
1 311 GLY n 
1 312 VAL n 
1 313 ALA n 
1 314 GLY n 
1 315 PHE n 
1 316 THR n 
1 317 ASN n 
1 318 SER n 
1 319 LEU n 
1 320 ARG n 
1 321 MET n 
1 322 LEU n 
1 323 GLN n 
1 324 GLN n 
1 325 LYS n 
1 326 ARG n 
1 327 TRP n 
1 328 ASP n 
1 329 GLU n 
1 330 ALA n 
1 331 ALA n 
1 332 VAL n 
1 333 ASN n 
1 334 LEU n 
1 335 ALA n 
1 336 LYS n 
1 337 SER n 
1 338 ARG n 
1 339 TRP n 
1 340 TYR n 
1 341 ASN n 
1 342 GLN n 
1 343 THR n 
1 344 PRO n 
1 345 ASN n 
1 346 ARG n 
1 347 ALA n 
1 348 LYS n 
1 349 ARG n 
1 350 VAL n 
1 351 ILE n 
1 352 THR n 
1 353 THR n 
1 354 PHE n 
1 355 ARG n 
1 356 THR n 
1 357 GLY n 
1 358 THR n 
1 359 TRP n 
1 360 ASP n 
1 361 ALA n 
1 362 TYR n 
1 363 LEU n 
1 364 HIS n 
1 365 MET n 
1 366 ASN n 
1 367 ARG n 
1 368 GLU n 
1 369 ARG n 
1 370 LYS n 
1 371 ALA n 
1 372 ALA n 
1 373 LYS n 
1 374 GLN n 
1 375 LEU n 
1 376 GLY n 
1 377 PHE n 
1 378 ILE n 
1 379 MET n 
1 380 ALA n 
1 381 ALA n 
1 382 PHE n 
1 383 ILE n 
1 384 LEU n 
1 385 CYS n 
1 386 TRP n 
1 387 ILE n 
1 388 PRO n 
1 389 TYR n 
1 390 PHE n 
1 391 ILE n 
1 392 PHE n 
1 393 PHE n 
1 394 MET n 
1 395 VAL n 
1 396 ILE n 
1 397 ALA n 
1 398 PHE n 
1 399 CYS n 
1 400 LYS n 
1 401 ASN n 
1 402 CYS n 
1 403 CYS n 
1 404 ASN n 
1 405 GLU n 
1 406 HIS n 
1 407 LEU n 
1 408 HIS n 
1 409 MET n 
1 410 PHE n 
1 411 THR n 
1 412 ILE n 
1 413 TRP n 
1 414 LEU n 
1 415 GLY n 
1 416 TYR n 
1 417 ILE n 
1 418 ASN n 
1 419 SER n 
1 420 THR n 
1 421 LEU n 
1 422 ASN n 
1 423 PRO n 
1 424 LEU n 
1 425 ILE n 
1 426 TYR n 
1 427 PRO n 
1 428 LEU n 
1 429 CYS n 
1 430 ASN n 
1 431 GLU n 
1 432 ASN n 
1 433 PHE n 
1 434 LYS n 
1 435 LYS n 
1 436 THR n 
1 437 PHE n 
1 438 LYS n 
1 439 ARG n 
1 440 ILE n 
1 441 LEU n 
1 442 HIS n 
1 443 ILE n 
1 444 ARG n 
1 445 SER n 
1 446 GLY n 
1 447 GLU n 
1 448 ASN n 
1 449 LEU n 
1 450 TYR n 
1 451 PHE n 
1 452 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 1   202 human ? 'HRH1, E' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 ? ? ? ? 
? ? SMD1163 ? ? ? ? ? ? ? PLASMID ? ? ? pPIC9K ? ? 
1 3 sample ? 363 445 human ? 'HRH1, E' ? ? ? ? ? ? 'Homo sapiens'            9606  ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 ? ? ? ? 
? ? SMD1163 ? ? ? ? ? ? ? PLASMID ? ? ? pPIC9K ? ? 
1 2 sample ? 203 362 human ? 'HRH1, E' ? ? ? ? ? ? 'Enterobacteria phage T4' 10665 ? ? ? ? ? ? ? ? 'Pichia pastoris' 4922 ? ? ? ? 
? ? SMD1163 ? ? ? ? ? ? ? PLASMID ? ? ? pPIC9K ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HRH1_HUMAN P35367 1 
;TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPL
CLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDK
CETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHC
;
20  ? 
2 UNP LYS_BPT4   P00720 1 
;NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY

;
2   ? 
3 UNP HRH1_HUMAN P35367 1 
;LHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILH
IRS
;
405 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RZE A 1   ? 202 ? P35367 20  ? 221 ? 20   221  
2 2 3RZE A 203 ? 362 ? P00720 2   ? 161 ? 1002 1161 
3 3 3RZE A 363 ? 445 ? P35367 405 ? 487 ? 405  487  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 3RZE THR A 255 ? UNP P00720 CYS 54 'ENGINEERED MUTATION' 1054 1 
2 3RZE ALA A 298 ? UNP P00720 CYS 97 'ENGINEERED MUTATION' 1097 2 
3 3RZE GLY A 446 ? UNP P35367 ?   ?  'EXPRESSION TAG'      488  3 
3 3RZE GLU A 447 ? UNP P35367 ?   ?  'EXPRESSION TAG'      489  4 
3 3RZE ASN A 448 ? UNP P35367 ?   ?  'EXPRESSION TAG'      490  5 
3 3RZE LEU A 449 ? UNP P35367 ?   ?  'EXPRESSION TAG'      491  6 
3 3RZE TYR A 450 ? UNP P35367 ?   ?  'EXPRESSION TAG'      492  7 
3 3RZE PHE A 451 ? UNP P35367 ?   ?  'EXPRESSION TAG'      493  8 
3 3RZE GLN A 452 ? UNP P35367 ?   ?  'EXPRESSION TAG'      494  9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5EH non-polymer         . '(3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' ?                   
'C19 H21 N O'    279.376 
ALA 'L-peptide linking' y ALANINE                                                                 ?                   'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                ?                   
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                              ?                   
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                         ?                   'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                ?                   
'C3 H7 N O2 S'   121.158 
D7V non-polymer         . '(3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' ?                   
'C19 H21 N O'    279.376 
GLN 'L-peptide linking' y GLUTAMINE                                                               ?                   
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                         ?                   'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                 ?                   'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                               ?                   
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                   ?                   'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                              ?                   
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                 ?                   
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                  ?                   
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                              ?                   
'C5 H11 N O2 S'  149.211 
OLC non-polymer         . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate'                        1-Oleoyl-R-glycerol 'C21 H40 O4' 
356.540 
PHE 'L-peptide linking' y PHENYLALANINE                                                           ?                   
'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                                                         ?                   'O4 P -3' 
94.971  
PRO 'L-peptide linking' y PROLINE                                                                 ?                   'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                  ?                   'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                               ?                   'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                              ?                   
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                ?                   
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                  ?                   
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RZE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    
'26-30% PEG400, 300mM ammonium phosphate, 10mM MgCl2, 100mM Na-citrate pH 4.5, 1mM doxepin, Lipidic cubic phase, 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-10-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ACCEL Fixed Exit Double Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97780 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97780 
# 
_reflns.entry_id                     3RZE 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             34.5 
_reflns.d_resolution_high            3.1 
_reflns.number_obs                   12152 
_reflns.number_all                   12152 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.14 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.2 
_reflns.B_iso_Wilson_estimate        69.12 
_reflns.pdbx_redundancy              4.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              3.4 
_reflns_shell.percent_possible_all   98.8 
_reflns_shell.Rmerge_I_obs           0.83 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        4.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RZE 
_refine.ls_number_reflns_obs                     11996 
_refine.ls_number_reflns_all                     12152 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.5 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.217 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2145 
_refine.ls_R_factor_R_free                       0.2486 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.64 
_refine.ls_number_reflns_R_free                  797 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.8823 
_refine.correlation_coeff_Fo_to_Fc_free          0.8616 
_refine.B_iso_mean                               89.19 
_refine.aniso_B[1][1]                            -8.1276 
_refine.aniso_B[2][2]                            -8.1276 
_refine.aniso_B[3][3]                            16.2553 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2RH1 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3RZE 
_refine_analyze.Luzzati_coordinate_error_obs    0.625 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3481 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         72 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               3555 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        34.5 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_bond_d                  0.010 ? 2.00  3640 HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               1.21  ? 2.00  4934 HARMONIC     'X-RAY DIFFRACTION' 
t_dihedral_angle_d        ?     ? 2.00  1232 SINUSOIDAL   'X-RAY DIFFRACTION' 
t_incorr_chiral_ct        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_trig_c_planes           ?     ? 2.00  62   HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              ?     ? 5.00  522  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      ?     ? 20.00 3580 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_omega_torsion           2.78  ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_other_torsion           22.77 ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion ?     ? 5.00  471  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_distance        ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_angle           ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ? ?     ?    ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      ?     ? 4.00  4168 SEMIHARMONIC 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.10 
_refine_ls_shell.d_res_low                        3.40 
_refine_ls_shell.number_reflns_R_work             2636 
_refine_ls_shell.R_factor_R_work                  0.2343 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2706 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.99 
_refine_ls_shell.number_reflns_R_free             198 
_refine_ls_shell.number_reflns_all                2834 
_refine_ls_shell.R_factor_all                     0.2369 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RZE 
_struct.title                     'Structure of the human histamine H1 receptor in complex with doxepin' 
_struct.pdbx_descriptor           'Histamine H1 receptor/Lysozyme chimera' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RZE 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Structural Genomics, PSI-Biology, Membrane Protein, GPCR Network, GPCR, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 9   ? VAL A 12  ? MET A 28   VAL A 31   5 ? 4  
HELX_P HELX_P2  2  VAL A 13  ? GLU A 36  ? VAL A 32   GLU A 55   1 ? 24 
HELX_P HELX_P3  3  THR A 41  ? GLY A 43  ? THR A 60   GLY A 62   5 ? 3  
HELX_P HELX_P4  4  ASN A 44  ? VAL A 60  ? ASN A 63   VAL A 79   1 ? 17 
HELX_P HELX_P5  5  VAL A 60  ? MET A 71  ? VAL A 79   MET A 90   1 ? 12 
HELX_P HELX_P6  6  LEU A 76  ? GLN A 112 ? LEU A 95   GLN A 131  1 ? 37 
HELX_P HELX_P7  7  THR A 121 ? PHE A 137 ? THR A 140  PHE A 156  1 ? 17 
HELX_P HELX_P8  8  TRP A 139 ? GLY A 145 ? TRP A 158  GLY A 164  1 ? 7  
HELX_P HELX_P9  9  VAL A 168 ? PHE A 180 ? VAL A 187  PHE A 199  1 ? 13 
HELX_P HELX_P10 10 PHE A 180 ? VAL A 198 ? PHE A 199  VAL A 217  1 ? 19 
HELX_P HELX_P11 11 ASN A 203 ? GLY A 213 ? ASN A 1002 GLY A 1012 1 ? 11 
HELX_P HELX_P12 12 SER A 239 ? GLY A 252 ? SER A 1038 GLY A 1051 1 ? 14 
HELX_P HELX_P13 13 THR A 260 ? ARG A 281 ? THR A 1059 ARG A 1080 1 ? 22 
HELX_P HELX_P14 14 LEU A 285 ? LEU A 292 ? LEU A 1084 LEU A 1091 1 ? 8  
HELX_P HELX_P15 15 ASP A 293 ? GLY A 308 ? ASP A 1092 GLY A 1107 1 ? 16 
HELX_P HELX_P16 16 GLY A 308 ? ALA A 313 ? GLY A 1107 ALA A 1112 1 ? 6  
HELX_P HELX_P17 17 PHE A 315 ? GLN A 324 ? PHE A 1114 GLN A 1123 1 ? 10 
HELX_P HELX_P18 18 ARG A 326 ? ALA A 335 ? ARG A 1125 ALA A 1134 1 ? 10 
HELX_P HELX_P19 19 SER A 337 ? THR A 343 ? SER A 1136 THR A 1142 1 ? 7  
HELX_P HELX_P20 20 THR A 343 ? GLY A 357 ? THR A 1142 GLY A 1156 1 ? 15 
HELX_P HELX_P21 21 TRP A 359 ? LEU A 363 ? TRP A 1158 LEU A 405  5 ? 5  
HELX_P HELX_P22 22 MET A 365 ? LYS A 400 ? MET A 407  LYS A 442  1 ? 36 
HELX_P HELX_P23 23 LEU A 407 ? ASN A 430 ? LEU A 449  ASN A 472  1 ? 24 
HELX_P HELX_P24 24 ASN A 430 ? HIS A 442 ? ASN A 472  HIS A 484  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 81  SG ? ? ? 1_555 A CYS 161 SG ? ? A CYS 100 A CYS 180 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 399 SG ? ? ? 1_555 A CYS 402 SG ? ? A CYS 441 A CYS 444 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 214 ? LYS A 220 ? LEU A 1013 LYS A 1019 
A 2 TYR A 226 ? ILE A 230 ? TYR A 1025 ILE A 1029 
A 3 HIS A 232 ? LEU A 233 ? HIS A 1031 LEU A 1032 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 219 ? N TYR A 1018 O THR A 227 ? O THR A 1026 
A 2 3 N ILE A 228 ? N ILE A 1027 O HIS A 232 ? O HIS A 1031 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE 5EH A 1200' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE D7V A 1201' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE PO4 A 1202' 
AC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE PO4 A 1203' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE PO4 A 1204' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE OLC A 1205' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  ASP A 88  ? ASP A 107  . ? 1_555 ? 
2  AC1 9  TYR A 89  ? TYR A 108  . ? 1_555 ? 
3  AC1 9  SER A 92  ? SER A 111  . ? 1_555 ? 
4  AC1 9  THR A 93  ? THR A 112  . ? 1_555 ? 
5  AC1 9  TRP A 139 ? TRP A 158  . ? 1_555 ? 
6  AC1 9  TRP A 386 ? TRP A 428  . ? 1_555 ? 
7  AC1 9  TYR A 389 ? TYR A 431  . ? 1_555 ? 
8  AC1 9  PHE A 390 ? PHE A 432  . ? 1_555 ? 
9  AC1 9  TYR A 416 ? TYR A 458  . ? 1_555 ? 
10 AC2 12 ASP A 88  ? ASP A 107  . ? 1_555 ? 
11 AC2 12 TYR A 89  ? TYR A 108  . ? 1_555 ? 
12 AC2 12 SER A 92  ? SER A 111  . ? 1_555 ? 
13 AC2 12 THR A 93  ? THR A 112  . ? 1_555 ? 
14 AC2 12 ILE A 96  ? ILE A 115  . ? 1_555 ? 
15 AC2 12 TRP A 139 ? TRP A 158  . ? 1_555 ? 
16 AC2 12 ASN A 179 ? ASN A 198  . ? 1_555 ? 
17 AC2 12 TRP A 386 ? TRP A 428  . ? 1_555 ? 
18 AC2 12 TYR A 389 ? TYR A 431  . ? 1_555 ? 
19 AC2 12 PHE A 390 ? PHE A 432  . ? 1_555 ? 
20 AC2 12 PHE A 393 ? PHE A 435  . ? 1_555 ? 
21 AC2 12 TYR A 416 ? TYR A 458  . ? 1_555 ? 
22 AC3 6  ASP A 159 ? ASP A 178  . ? 1_555 ? 
23 AC3 6  LYS A 160 ? LYS A 179  . ? 1_555 ? 
24 AC3 6  LYS A 172 ? LYS A 191  . ? 1_555 ? 
25 AC3 6  TYR A 389 ? TYR A 431  . ? 1_555 ? 
26 AC3 6  PHE A 393 ? PHE A 435  . ? 1_555 ? 
27 AC3 6  HIS A 408 ? HIS A 450  . ? 1_555 ? 
28 AC4 2  ARG A 277 ? ARG A 1076 . ? 1_555 ? 
29 AC4 2  ARG A 281 ? ARG A 1080 . ? 1_555 ? 
30 AC5 4  THR A 343 ? THR A 1142 . ? 1_555 ? 
31 AC5 4  PRO A 344 ? PRO A 1143 . ? 1_555 ? 
32 AC5 4  ASN A 345 ? ASN A 1144 . ? 1_555 ? 
33 AC5 4  ARG A 346 ? ARG A 1145 . ? 1_555 ? 
34 AC6 4  GLU A 212 ? GLU A 1011 . ? 3_655 ? 
35 AC6 4  ARG A 215 ? ARG A 1014 . ? 3_655 ? 
36 AC6 4  ASN A 254 ? ASN A 1053 . ? 1_555 ? 
37 AC6 4  ASN A 256 ? ASN A 1055 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3RZE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RZE 
_atom_sites.fract_transf_matrix[1][1]   0.011345 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011345 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003015 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 9   ? 11.579 13.109 10.857 1.00 164.07 ? 28   MET A N   1 
ATOM   2    C CA  . MET A 1 9   ? 10.243 12.524 10.957 1.00 166.06 ? 28   MET A CA  1 
ATOM   3    C C   . MET A 1 9   ? 9.813  12.069 12.377 1.00 169.83 ? 28   MET A C   1 
ATOM   4    O O   . MET A 1 9   ? 8.675  12.379 12.739 1.00 169.06 ? 28   MET A O   1 
ATOM   5    C CB  . MET A 1 9   ? 10.010 11.433 9.898  1.00 172.72 ? 28   MET A CB  1 
ATOM   6    C CG  . MET A 1 9   ? 8.549  11.290 9.496  1.00 178.23 ? 28   MET A CG  1 
ATOM   7    S SD  . MET A 1 9   ? 8.299  10.450 7.910  1.00 187.16 ? 28   MET A SD  1 
ATOM   8    C CE  . MET A 1 9   ? 8.650  11.788 6.773  1.00 181.52 ? 28   MET A CE  1 
ATOM   9    N N   . PRO A 1 10  ? 10.637 11.357 13.207 1.00 166.77 ? 29   PRO A N   1 
ATOM   10   C CA  . PRO A 1 10  ? 10.152 10.982 14.554 1.00 166.12 ? 29   PRO A CA  1 
ATOM   11   C C   . PRO A 1 10  ? 10.140 12.135 15.573 1.00 166.31 ? 29   PRO A C   1 
ATOM   12   O O   . PRO A 1 10  ? 9.493  12.012 16.618 1.00 165.51 ? 29   PRO A O   1 
ATOM   13   C CB  . PRO A 1 10  ? 11.096 9.851  14.971 1.00 169.76 ? 29   PRO A CB  1 
ATOM   14   C CG  . PRO A 1 10  ? 12.363 10.136 14.256 1.00 173.76 ? 29   PRO A CG  1 
ATOM   15   C CD  . PRO A 1 10  ? 12.018 10.869 12.983 1.00 169.25 ? 29   PRO A CD  1 
ATOM   16   N N   . LEU A 1 11  ? 10.838 13.258 15.255 1.00 160.14 ? 30   LEU A N   1 
ATOM   17   C CA  . LEU A 1 11  ? 10.970 14.469 16.081 1.00 155.69 ? 30   LEU A CA  1 
ATOM   18   C C   . LEU A 1 11  ? 9.813  15.479 15.910 1.00 158.03 ? 30   LEU A C   1 
ATOM   19   O O   . LEU A 1 11  ? 9.953  16.653 16.263 1.00 153.82 ? 30   LEU A O   1 
ATOM   20   C CB  . LEU A 1 11  ? 12.333 15.141 15.822 1.00 153.72 ? 30   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 11  ? 13.548 14.439 16.417 1.00 158.57 ? 30   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 11  ? 14.698 14.421 15.438 1.00 159.80 ? 30   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 11  ? 13.961 15.077 17.730 1.00 157.08 ? 30   LEU A CD2 1 
ATOM   24   N N   . VAL A 1 12  ? 8.668  15.010 15.391 1.00 158.07 ? 31   VAL A N   1 
ATOM   25   C CA  . VAL A 1 12  ? 7.459  15.813 15.195 1.00 157.79 ? 31   VAL A CA  1 
ATOM   26   C C   . VAL A 1 12  ? 6.764  15.974 16.560 1.00 160.95 ? 31   VAL A C   1 
ATOM   27   O O   . VAL A 1 12  ? 6.453  17.099 16.964 1.00 157.64 ? 31   VAL A O   1 
ATOM   28   C CB  . VAL A 1 12  ? 6.531  15.182 14.108 1.00 165.62 ? 31   VAL A CB  1 
ATOM   29   C CG1 . VAL A 1 12  ? 5.138  15.810 14.107 1.00 165.39 ? 31   VAL A CG1 1 
ATOM   30   C CG2 . VAL A 1 12  ? 7.159  15.284 12.720 1.00 166.59 ? 31   VAL A CG2 1 
ATOM   31   N N   . VAL A 1 13  ? 6.555  14.840 17.269 1.00 160.18 ? 32   VAL A N   1 
ATOM   32   C CA  . VAL A 1 13  ? 5.896  14.762 18.582 1.00 159.49 ? 32   VAL A CA  1 
ATOM   33   C C   . VAL A 1 13  ? 6.879  14.913 19.769 1.00 160.96 ? 32   VAL A C   1 
ATOM   34   O O   . VAL A 1 13  ? 6.440  15.210 20.886 1.00 159.30 ? 32   VAL A O   1 
ATOM   35   C CB  . VAL A 1 13  ? 4.969  13.517 18.738 1.00 167.17 ? 32   VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 13  ? 3.693  13.880 19.494 1.00 166.70 ? 32   VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 13  ? 4.630  12.879 17.389 1.00 170.56 ? 32   VAL A CG2 1 
ATOM   38   N N   . VAL A 1 14  ? 8.200  14.717 19.523 1.00 156.78 ? 33   VAL A N   1 
ATOM   39   C CA  . VAL A 1 14  ? 9.273  14.844 20.524 1.00 154.03 ? 33   VAL A CA  1 
ATOM   40   C C   . VAL A 1 14  ? 9.320  16.285 21.055 1.00 153.23 ? 33   VAL A C   1 
ATOM   41   O O   . VAL A 1 14  ? 9.333  16.486 22.270 1.00 150.88 ? 33   VAL A O   1 
ATOM   42   C CB  . VAL A 1 14  ? 10.643 14.350 19.975 1.00 158.74 ? 33   VAL A CB  1 
ATOM   43   C CG1 . VAL A 1 14  ? 11.797 14.707 20.910 1.00 155.83 ? 33   VAL A CG1 1 
ATOM   44   C CG2 . VAL A 1 14  ? 10.615 12.848 19.717 1.00 162.58 ? 33   VAL A CG2 1 
ATOM   45   N N   . LEU A 1 15  ? 9.287  17.273 20.144 1.00 148.41 ? 34   LEU A N   1 
ATOM   46   C CA  . LEU A 1 15  ? 9.276  18.695 20.487 1.00 144.95 ? 34   LEU A CA  1 
ATOM   47   C C   . LEU A 1 15  ? 7.892  19.116 21.004 1.00 148.36 ? 34   LEU A C   1 
ATOM   48   O O   . LEU A 1 15  ? 7.800  20.068 21.781 1.00 145.59 ? 34   LEU A O   1 
ATOM   49   C CB  . LEU A 1 15  ? 9.686  19.559 19.278 1.00 144.44 ? 34   LEU A CB  1 
ATOM   50   C CG  . LEU A 1 15  ? 11.032 19.249 18.594 1.00 149.61 ? 34   LEU A CG  1 
ATOM   51   C CD1 . LEU A 1 15  ? 11.084 19.843 17.204 1.00 150.18 ? 34   LEU A CD1 1 
ATOM   52   C CD2 . LEU A 1 15  ? 12.215 19.750 19.410 1.00 149.84 ? 34   LEU A CD2 1 
ATOM   53   N N   . SER A 1 16  ? 6.822  18.403 20.576 1.00 147.44 ? 35   SER A N   1 
ATOM   54   C CA  . SER A 1 16  ? 5.433  18.657 20.984 1.00 147.53 ? 35   SER A CA  1 
ATOM   55   C C   . SER A 1 16  ? 5.159  18.241 22.434 1.00 150.49 ? 35   SER A C   1 
ATOM   56   O O   . SER A 1 16  ? 4.441  18.957 23.130 1.00 149.03 ? 35   SER A O   1 
ATOM   57   C CB  . SER A 1 16  ? 4.446  17.981 20.035 1.00 154.06 ? 35   SER A CB  1 
ATOM   58   O OG  . SER A 1 16  ? 4.218  18.763 18.874 1.00 161.28 ? 35   SER A OG  1 
ATOM   59   N N   . THR A 1 17  ? 5.722  17.093 22.887 1.00 147.61 ? 36   THR A N   1 
ATOM   60   C CA  . THR A 1 17  ? 5.580  16.593 24.266 1.00 147.01 ? 36   THR A CA  1 
ATOM   61   C C   . THR A 1 17  ? 6.299  17.529 25.249 1.00 146.70 ? 36   THR A C   1 
ATOM   62   O O   . THR A 1 17  ? 5.812  17.745 26.362 1.00 145.38 ? 36   THR A O   1 
ATOM   63   C CB  . THR A 1 17  ? 6.029  15.124 24.392 1.00 157.69 ? 36   THR A CB  1 
ATOM   64   O OG1 . THR A 1 17  ? 7.267  14.931 23.704 1.00 157.78 ? 36   THR A OG1 1 
ATOM   65   C CG2 . THR A 1 17  ? 4.984  14.142 23.874 1.00 159.86 ? 36   THR A CG2 1 
ATOM   66   N N   . ILE A 1 18  ? 7.446  18.103 24.807 1.00 140.81 ? 37   ILE A N   1 
ATOM   67   C CA  . ILE A 1 18  ? 8.267  19.085 25.526 1.00 136.96 ? 37   ILE A CA  1 
ATOM   68   C C   . ILE A 1 18  ? 7.414  20.356 25.744 1.00 138.39 ? 37   ILE A C   1 
ATOM   69   O O   . ILE A 1 18  ? 7.401  20.910 26.842 1.00 136.47 ? 37   ILE A O   1 
ATOM   70   C CB  . ILE A 1 18  ? 9.598  19.340 24.742 1.00 139.15 ? 37   ILE A CB  1 
ATOM   71   C CG1 . ILE A 1 18  ? 10.589 18.166 24.945 1.00 140.59 ? 37   ILE A CG1 1 
ATOM   72   C CG2 . ILE A 1 18  ? 10.250 20.686 25.103 1.00 137.06 ? 37   ILE A CG2 1 
ATOM   73   C CD1 . ILE A 1 18  ? 11.785 18.103 23.967 1.00 146.78 ? 37   ILE A CD1 1 
ATOM   74   N N   . CYS A 1 19  ? 6.673  20.773 24.703 1.00 134.88 ? 38   CYS A N   1 
ATOM   75   C CA  . CYS A 1 19  ? 5.755  21.913 24.710 1.00 133.30 ? 38   CYS A CA  1 
ATOM   76   C C   . CYS A 1 19  ? 4.576  21.646 25.672 1.00 136.28 ? 38   CYS A C   1 
ATOM   77   O O   . CYS A 1 19  ? 4.161  22.557 26.395 1.00 134.06 ? 38   CYS A O   1 
ATOM   78   C CB  . CYS A 1 19  ? 5.275  22.198 23.286 1.00 135.08 ? 38   CYS A CB  1 
ATOM   79   S SG  . CYS A 1 19  ? 3.865  23.331 23.169 1.00 139.12 ? 38   CYS A SG  1 
ATOM   80   N N   . LEU A 1 20  ? 4.066  20.391 25.683 1.00 134.43 ? 39   LEU A N   1 
ATOM   81   C CA  . LEU A 1 20  ? 2.940  19.935 26.509 1.00 135.28 ? 39   LEU A CA  1 
ATOM   82   C C   . LEU A 1 20  ? 3.207  19.994 28.008 1.00 136.54 ? 39   LEU A C   1 
ATOM   83   O O   . LEU A 1 20  ? 2.277  20.255 28.775 1.00 136.16 ? 39   LEU A O   1 
ATOM   84   C CB  . LEU A 1 20  ? 2.483  18.526 26.104 1.00 138.65 ? 39   LEU A CB  1 
ATOM   85   C CG  . LEU A 1 20  ? 1.719  18.409 24.787 1.00 145.67 ? 39   LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 20  ? 1.798  17.001 24.244 1.00 149.13 ? 39   LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 20  ? 0.267  18.863 24.930 1.00 148.97 ? 39   LEU A CD2 1 
ATOM   88   N N   . VAL A 1 21  ? 4.458  19.730 28.431 1.00 131.22 ? 40   VAL A N   1 
ATOM   89   C CA  . VAL A 1 21  ? 4.830  19.807 29.847 1.00 129.31 ? 40   VAL A CA  1 
ATOM   90   C C   . VAL A 1 21  ? 4.985  21.264 30.295 1.00 130.13 ? 40   VAL A C   1 
ATOM   91   O O   . VAL A 1 21  ? 4.491  21.623 31.361 1.00 128.69 ? 40   VAL A O   1 
ATOM   92   C CB  . VAL A 1 21  ? 5.998  18.881 30.296 1.00 133.10 ? 40   VAL A CB  1 
ATOM   93   C CG1 . VAL A 1 21  ? 5.506  17.463 30.550 1.00 136.04 ? 40   VAL A CG1 1 
ATOM   94   C CG2 . VAL A 1 21  ? 7.156  18.883 29.307 1.00 132.25 ? 40   VAL A CG2 1 
ATOM   95   N N   . THR A 1 22  ? 5.593  22.110 29.437 1.00 125.70 ? 41   THR A N   1 
ATOM   96   C CA  . THR A 1 22  ? 5.823  23.544 29.661 1.00 123.34 ? 41   THR A CA  1 
ATOM   97   C C   . THR A 1 22  ? 4.526  24.337 29.883 1.00 127.71 ? 41   THR A C   1 
ATOM   98   O O   . THR A 1 22  ? 4.534  25.298 30.654 1.00 125.54 ? 41   THR A O   1 
ATOM   99   C CB  . THR A 1 22  ? 6.651  24.141 28.513 1.00 131.76 ? 41   THR A CB  1 
ATOM   100  O OG1 . THR A 1 22  ? 7.660  23.214 28.121 1.00 132.93 ? 41   THR A OG1 1 
ATOM   101  C CG2 . THR A 1 22  ? 7.303  25.461 28.884 1.00 127.99 ? 41   THR A CG2 1 
ATOM   102  N N   . VAL A 1 23  ? 3.425  23.949 29.209 1.00 126.90 ? 42   VAL A N   1 
ATOM   103  C CA  . VAL A 1 23  ? 2.129  24.629 29.360 1.00 127.69 ? 42   VAL A CA  1 
ATOM   104  C C   . VAL A 1 23  ? 1.498  24.404 30.751 1.00 132.23 ? 42   VAL A C   1 
ATOM   105  O O   . VAL A 1 23  ? 0.733  25.246 31.219 1.00 131.90 ? 42   VAL A O   1 
ATOM   106  C CB  . VAL A 1 23  ? 1.122  24.399 28.190 1.00 133.91 ? 42   VAL A CB  1 
ATOM   107  C CG1 . VAL A 1 23  ? 1.663  24.938 26.871 1.00 133.00 ? 42   VAL A CG1 1 
ATOM   108  C CG2 . VAL A 1 23  ? 0.709  22.934 28.056 1.00 136.33 ? 42   VAL A CG2 1 
ATOM   109  N N   . GLY A 1 24  ? 1.847  23.282 31.386 1.00 129.03 ? 43   GLY A N   1 
ATOM   110  C CA  . GLY A 1 24  ? 1.356  22.892 32.704 1.00 129.15 ? 43   GLY A CA  1 
ATOM   111  C C   . GLY A 1 24  ? 2.314  23.160 33.849 1.00 130.11 ? 43   GLY A C   1 
ATOM   112  O O   . GLY A 1 24  ? 1.892  23.677 34.885 1.00 129.43 ? 43   GLY A O   1 
ATOM   113  N N   . LEU A 1 25  ? 3.607  22.788 33.684 1.00 124.42 ? 44   LEU A N   1 
ATOM   114  C CA  . LEU A 1 25  ? 4.651  22.971 34.702 1.00 121.38 ? 44   LEU A CA  1 
ATOM   115  C C   . LEU A 1 25  ? 4.807  24.429 35.102 1.00 122.77 ? 44   LEU A C   1 
ATOM   116  O O   . LEU A 1 25  ? 4.880  24.712 36.290 1.00 121.11 ? 44   LEU A O   1 
ATOM   117  C CB  . LEU A 1 25  ? 6.003  22.373 34.268 1.00 120.51 ? 44   LEU A CB  1 
ATOM   118  C CG  . LEU A 1 25  ? 6.113  20.844 34.160 1.00 126.85 ? 44   LEU A CG  1 
ATOM   119  C CD1 . LEU A 1 25  ? 7.417  20.446 33.500 1.00 126.39 ? 44   LEU A CD1 1 
ATOM   120  C CD2 . LEU A 1 25  ? 5.986  20.160 35.518 1.00 129.25 ? 44   LEU A CD2 1 
ATOM   121  N N   . ASN A 1 26  ? 4.807  25.352 34.125 1.00 119.21 ? 45   ASN A N   1 
ATOM   122  C CA  . ASN A 1 26  ? 4.885  26.792 34.385 1.00 117.69 ? 45   ASN A CA  1 
ATOM   123  C C   . ASN A 1 26  ? 3.569  27.315 34.965 1.00 122.89 ? 45   ASN A C   1 
ATOM   124  O O   . ASN A 1 26  ? 3.584  28.266 35.746 1.00 121.82 ? 45   ASN A O   1 
ATOM   125  C CB  . ASN A 1 26  ? 5.258  27.568 33.122 1.00 118.15 ? 45   ASN A CB  1 
ATOM   126  C CG  . ASN A 1 26  ? 6.741  27.761 32.947 1.00 140.41 ? 45   ASN A CG  1 
ATOM   127  O OD1 . ASN A 1 26  ? 7.398  28.478 33.710 1.00 132.68 ? 45   ASN A OD1 1 
ATOM   128  N ND2 . ASN A 1 26  ? 7.300  27.143 31.922 1.00 133.55 ? 45   ASN A ND2 1 
ATOM   129  N N   . LEU A 1 27  ? 2.438  26.683 34.588 1.00 121.24 ? 46   LEU A N   1 
ATOM   130  C CA  . LEU A 1 27  ? 1.093  27.017 35.060 1.00 122.38 ? 46   LEU A CA  1 
ATOM   131  C C   . LEU A 1 27  ? 0.926  26.577 36.529 1.00 126.79 ? 46   LEU A C   1 
ATOM   132  O O   . LEU A 1 27  ? 0.243  27.255 37.305 1.00 126.84 ? 46   LEU A O   1 
ATOM   133  C CB  . LEU A 1 27  ? 0.060  26.317 34.161 1.00 124.85 ? 46   LEU A CB  1 
ATOM   134  C CG  . LEU A 1 27  ? -1.331 26.927 34.045 1.00 131.08 ? 46   LEU A CG  1 
ATOM   135  C CD1 . LEU A 1 27  ? -1.311 28.228 33.252 1.00 130.17 ? 46   LEU A CD1 1 
ATOM   136  C CD2 . LEU A 1 27  ? -2.272 25.952 33.374 1.00 136.64 ? 46   LEU A CD2 1 
ATOM   137  N N   . LEU A 1 28  ? 1.582  25.449 36.899 1.00 123.10 ? 47   LEU A N   1 
ATOM   138  C CA  . LEU A 1 28  ? 1.605  24.848 38.239 1.00 122.93 ? 47   LEU A CA  1 
ATOM   139  C C   . LEU A 1 28  ? 2.282  25.786 39.247 1.00 125.17 ? 47   LEU A C   1 
ATOM   140  O O   . LEU A 1 28  ? 1.787  25.929 40.365 1.00 125.48 ? 47   LEU A O   1 
ATOM   141  C CB  . LEU A 1 28  ? 2.289  23.452 38.174 1.00 123.33 ? 47   LEU A CB  1 
ATOM   142  C CG  . LEU A 1 28  ? 3.292  23.022 39.262 1.00 126.33 ? 47   LEU A CG  1 
ATOM   143  C CD1 . LEU A 1 28  ? 2.584  22.448 40.475 1.00 127.90 ? 47   LEU A CD1 1 
ATOM   144  C CD2 . LEU A 1 28  ? 4.266  21.997 38.714 1.00 128.20 ? 47   LEU A CD2 1 
ATOM   145  N N   . VAL A 1 29  ? 3.405  26.421 38.834 1.00 119.57 ? 48   VAL A N   1 
ATOM   146  C CA  . VAL A 1 29  ? 4.194  27.386 39.608 1.00 117.07 ? 48   VAL A CA  1 
ATOM   147  C C   . VAL A 1 29  ? 3.303  28.613 39.873 1.00 120.66 ? 48   VAL A C   1 
ATOM   148  O O   . VAL A 1 29  ? 3.236  29.085 41.008 1.00 119.73 ? 48   VAL A O   1 
ATOM   149  C CB  . VAL A 1 29  ? 5.512  27.769 38.860 1.00 119.19 ? 48   VAL A CB  1 
ATOM   150  C CG1 . VAL A 1 29  ? 6.295  28.850 39.603 1.00 117.15 ? 48   VAL A CG1 1 
ATOM   151  C CG2 . VAL A 1 29  ? 6.397  26.550 38.615 1.00 118.92 ? 48   VAL A CG2 1 
ATOM   152  N N   . LEU A 1 30  ? 2.594  29.087 38.824 1.00 117.72 ? 49   LEU A N   1 
ATOM   153  C CA  . LEU A 1 30  ? 1.678  30.229 38.867 1.00 118.03 ? 49   LEU A CA  1 
ATOM   154  C C   . LEU A 1 30  ? 0.471  29.991 39.781 1.00 124.09 ? 49   LEU A C   1 
ATOM   155  O O   . LEU A 1 30  ? 0.000  30.935 40.414 1.00 124.00 ? 49   LEU A O   1 
ATOM   156  C CB  . LEU A 1 30  ? 1.229  30.627 37.450 1.00 118.76 ? 49   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 30  ? 2.292  31.295 36.575 1.00 121.30 ? 49   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 30  ? 1.995  31.096 35.104 1.00 122.34 ? 49   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 30  ? 2.432  32.773 36.901 1.00 122.76 ? 49   LEU A CD2 1 
ATOM   160  N N   . TYR A 1 31  ? -0.011 28.738 39.867 1.00 122.51 ? 50   TYR A N   1 
ATOM   161  C CA  . TYR A 1 31  ? -1.126 28.370 40.742 1.00 124.70 ? 50   TYR A CA  1 
ATOM   162  C C   . TYR A 1 31  ? -0.635 28.245 42.191 1.00 126.16 ? 50   TYR A C   1 
ATOM   163  O O   . TYR A 1 31  ? -1.303 28.731 43.105 1.00 126.16 ? 50   TYR A O   1 
ATOM   164  C CB  . TYR A 1 31  ? -1.783 27.059 40.267 1.00 128.88 ? 50   TYR A CB  1 
ATOM   165  C CG  . TYR A 1 31  ? -3.111 26.743 40.929 1.00 134.38 ? 50   TYR A CG  1 
ATOM   166  C CD1 . TYR A 1 31  ? -4.305 27.246 40.417 1.00 138.81 ? 50   TYR A CD1 1 
ATOM   167  C CD2 . TYR A 1 31  ? -3.180 25.899 42.034 1.00 135.98 ? 50   TYR A CD2 1 
ATOM   168  C CE1 . TYR A 1 31  ? -5.533 26.942 41.009 1.00 142.59 ? 50   TYR A CE1 1 
ATOM   169  C CE2 . TYR A 1 31  ? -4.400 25.587 42.634 1.00 139.79 ? 50   TYR A CE2 1 
ATOM   170  C CZ  . TYR A 1 31  ? -5.576 26.109 42.117 1.00 150.04 ? 50   TYR A CZ  1 
ATOM   171  O OH  . TYR A 1 31  ? -6.784 25.800 42.699 1.00 154.50 ? 50   TYR A OH  1 
ATOM   172  N N   . ALA A 1 32  ? 0.543  27.609 42.385 1.00 120.66 ? 51   ALA A N   1 
ATOM   173  C CA  . ALA A 1 32  ? 1.189  27.371 43.678 1.00 119.28 ? 51   ALA A CA  1 
ATOM   174  C C   . ALA A 1 32  ? 1.451  28.637 44.509 1.00 122.30 ? 51   ALA A C   1 
ATOM   175  O O   . ALA A 1 32  ? 1.406  28.562 45.737 1.00 122.20 ? 51   ALA A O   1 
ATOM   176  C CB  . ALA A 1 32  ? 2.483  26.592 43.485 1.00 118.39 ? 51   ALA A CB  1 
ATOM   177  N N   . VAL A 1 33  ? 1.726  29.785 43.853 1.00 118.00 ? 52   VAL A N   1 
ATOM   178  C CA  . VAL A 1 33  ? 1.990  31.066 44.524 1.00 116.83 ? 52   VAL A CA  1 
ATOM   179  C C   . VAL A 1 33  ? 0.691  31.670 45.068 1.00 123.59 ? 52   VAL A C   1 
ATOM   180  O O   . VAL A 1 33  ? 0.657  32.093 46.221 1.00 123.09 ? 52   VAL A O   1 
ATOM   181  C CB  . VAL A 1 33  ? 2.804  32.057 43.639 1.00 118.81 ? 52   VAL A CB  1 
ATOM   182  C CG1 . VAL A 1 33  ? 2.882  33.450 44.263 1.00 118.19 ? 52   VAL A CG1 1 
ATOM   183  C CG2 . VAL A 1 33  ? 4.205  31.522 43.362 1.00 116.56 ? 52   VAL A CG2 1 
ATOM   184  N N   . ARG A 1 34  ? -0.371 31.689 44.252 1.00 123.02 ? 53   ARG A N   1 
ATOM   185  C CA  . ARG A 1 34  ? -1.665 32.251 44.645 1.00 125.78 ? 53   ARG A CA  1 
ATOM   186  C C   . ARG A 1 34  ? -2.392 31.393 45.679 1.00 132.23 ? 53   ARG A C   1 
ATOM   187  O O   . ARG A 1 34  ? -3.091 31.950 46.531 1.00 133.23 ? 53   ARG A O   1 
ATOM   188  C CB  . ARG A 1 34  ? -2.584 32.487 43.426 1.00 128.68 ? 53   ARG A CB  1 
ATOM   189  C CG  . ARG A 1 34  ? -1.913 33.038 42.161 1.00 142.23 ? 53   ARG A CG  1 
ATOM   190  C CD  . ARG A 1 34  ? -1.332 34.440 42.298 1.00 157.39 ? 53   ARG A CD  1 
ATOM   191  N NE  . ARG A 1 34  ? -0.862 34.946 41.007 1.00 168.85 ? 53   ARG A NE  1 
ATOM   192  C CZ  . ARG A 1 34  ? 0.359  34.752 40.517 1.00 181.86 ? 53   ARG A CZ  1 
ATOM   193  N NH1 . ARG A 1 34  ? 1.259  34.066 41.212 1.00 167.87 ? 53   ARG A NH1 1 
ATOM   194  N NH2 . ARG A 1 34  ? 0.690  35.242 39.330 1.00 169.29 ? 53   ARG A NH2 1 
ATOM   195  N N   . SER A 1 35  ? -2.239 30.048 45.598 1.00 129.52 ? 54   SER A N   1 
ATOM   196  C CA  . SER A 1 35  ? -2.896 29.077 46.490 1.00 131.31 ? 54   SER A CA  1 
ATOM   197  C C   . SER A 1 35  ? -2.347 29.014 47.931 1.00 133.76 ? 54   SER A C   1 
ATOM   198  O O   . SER A 1 35  ? -3.133 28.964 48.885 1.00 134.60 ? 54   SER A O   1 
ATOM   199  C CB  . SER A 1 35  ? -2.939 27.686 45.855 1.00 136.05 ? 54   SER A CB  1 
ATOM   200  O OG  . SER A 1 35  ? -1.654 27.189 45.517 1.00 142.60 ? 54   SER A OG  1 
ATOM   201  N N   . GLU A 1 36  ? -1.008 29.015 48.080 1.00 127.68 ? 55   GLU A N   1 
ATOM   202  C CA  . GLU A 1 36  ? -0.325 28.928 49.371 1.00 126.12 ? 55   GLU A CA  1 
ATOM   203  C C   . GLU A 1 36  ? 0.047  30.296 49.947 1.00 128.31 ? 55   GLU A C   1 
ATOM   204  O O   . GLU A 1 36  ? 0.583  31.145 49.232 1.00 126.38 ? 55   GLU A O   1 
ATOM   205  C CB  . GLU A 1 36  ? 0.918  28.017 49.257 1.00 125.67 ? 55   GLU A CB  1 
ATOM   206  C CG  . GLU A 1 36  ? 1.458  27.505 50.583 1.00 137.16 ? 55   GLU A CG  1 
ATOM   207  C CD  . GLU A 1 36  ? 0.459  26.753 51.441 1.00 166.02 ? 55   GLU A CD  1 
ATOM   208  O OE1 . GLU A 1 36  ? 0.084  25.620 51.062 1.00 168.38 ? 55   GLU A OE1 1 
ATOM   209  O OE2 . GLU A 1 36  ? 0.031  27.309 52.478 1.00 162.28 ? 55   GLU A OE2 1 
ATOM   210  N N   . ARG A 1 37  ? -0.232 30.495 51.248 1.00 125.69 ? 56   ARG A N   1 
ATOM   211  C CA  . ARG A 1 37  ? 0.117  31.725 51.963 1.00 124.77 ? 56   ARG A CA  1 
ATOM   212  C C   . ARG A 1 37  ? 1.619  31.721 52.299 1.00 126.21 ? 56   ARG A C   1 
ATOM   213  O O   . ARG A 1 37  ? 2.230  32.791 52.393 1.00 124.60 ? 56   ARG A O   1 
ATOM   214  C CB  . ARG A 1 37  ? -0.730 31.896 53.238 1.00 126.51 ? 56   ARG A CB  1 
ATOM   215  C CG  . ARG A 1 37  ? -0.910 33.363 53.623 1.00 135.08 ? 56   ARG A CG  1 
ATOM   216  C CD  . ARG A 1 37  ? -1.473 33.566 55.017 1.00 141.18 ? 56   ARG A CD  1 
ATOM   217  N NE  . ARG A 1 37  ? -1.869 34.963 55.220 1.00 147.33 ? 56   ARG A NE  1 
ATOM   218  C CZ  . ARG A 1 37  ? -1.121 35.888 55.815 1.00 158.28 ? 56   ARG A CZ  1 
ATOM   219  N NH1 . ARG A 1 37  ? 0.073  35.576 56.304 1.00 141.21 ? 56   ARG A NH1 1 
ATOM   220  N NH2 . ARG A 1 37  ? -1.568 37.131 55.938 1.00 145.13 ? 56   ARG A NH2 1 
ATOM   221  N N   . LYS A 1 38  ? 2.205  30.504 52.459 1.00 122.03 ? 57   LYS A N   1 
ATOM   222  C CA  . LYS A 1 38  ? 3.620  30.246 52.772 1.00 119.50 ? 57   LYS A CA  1 
ATOM   223  C C   . LYS A 1 38  ? 4.558  30.550 51.593 1.00 122.05 ? 57   LYS A C   1 
ATOM   224  O O   . LYS A 1 38  ? 5.772  30.677 51.794 1.00 119.82 ? 57   LYS A O   1 
ATOM   225  C CB  . LYS A 1 38  ? 3.817  28.796 53.256 1.00 121.80 ? 57   LYS A CB  1 
ATOM   226  C CG  . LYS A 1 38  ? 3.279  28.532 54.663 1.00 131.35 ? 57   LYS A CG  1 
ATOM   227  C CD  . LYS A 1 38  ? 3.637  27.137 55.181 1.00 134.76 ? 57   LYS A CD  1 
ATOM   228  C CE  . LYS A 1 38  ? 4.976  27.070 55.882 1.00 133.83 ? 57   LYS A CE  1 
ATOM   229  N NZ  . LYS A 1 38  ? 4.960  27.791 57.180 1.00 139.48 ? 57   LYS A NZ  1 
ATOM   230  N N   . LEU A 1 39  ? 3.989  30.665 50.369 1.00 119.52 ? 58   LEU A N   1 
ATOM   231  C CA  . LEU A 1 39  ? 4.712  30.964 49.127 1.00 118.02 ? 58   LEU A CA  1 
ATOM   232  C C   . LEU A 1 39  ? 4.422  32.392 48.594 1.00 121.34 ? 58   LEU A C   1 
ATOM   233  O O   . LEU A 1 39  ? 4.705  32.677 47.428 1.00 120.27 ? 58   LEU A O   1 
ATOM   234  C CB  . LEU A 1 39  ? 4.421  29.883 48.063 1.00 118.79 ? 58   LEU A CB  1 
ATOM   235  C CG  . LEU A 1 39  ? 5.325  28.641 48.066 1.00 122.82 ? 58   LEU A CG  1 
ATOM   236  C CD1 . LEU A 1 39  ? 4.919  27.648 49.151 1.00 124.02 ? 58   LEU A CD1 1 
ATOM   237  C CD2 . LEU A 1 39  ? 5.249  27.930 46.738 1.00 126.09 ? 58   LEU A CD2 1 
ATOM   238  N N   . HIS A 1 40  ? 3.905  33.295 49.473 1.00 118.02 ? 59   HIS A N   1 
ATOM   239  C CA  . HIS A 1 40  ? 3.601  34.703 49.168 1.00 117.89 ? 59   HIS A CA  1 
ATOM   240  C C   . HIS A 1 40  ? 4.825  35.615 49.383 1.00 119.14 ? 59   HIS A C   1 
ATOM   241  O O   . HIS A 1 40  ? 4.665  36.819 49.606 1.00 119.14 ? 59   HIS A O   1 
ATOM   242  C CB  . HIS A 1 40  ? 2.410  35.200 50.014 1.00 120.68 ? 59   HIS A CB  1 
ATOM   243  C CG  . HIS A 1 40  ? 1.063  34.747 49.542 1.00 126.19 ? 59   HIS A CG  1 
ATOM   244  N ND1 . HIS A 1 40  ? -0.044 34.806 50.371 1.00 130.12 ? 59   HIS A ND1 1 
ATOM   245  C CD2 . HIS A 1 40  ? 0.677  34.268 48.337 1.00 128.31 ? 59   HIS A CD2 1 
ATOM   246  C CE1 . HIS A 1 40  ? -1.056 34.347 49.654 1.00 131.16 ? 59   HIS A CE1 1 
ATOM   247  N NE2 . HIS A 1 40  ? -0.670 34.008 48.425 1.00 130.64 ? 59   HIS A NE2 1 
ATOM   248  N N   . THR A 1 41  ? 6.043  35.034 49.289 1.00 113.09 ? 60   THR A N   1 
ATOM   249  C CA  . THR A 1 41  ? 7.341  35.697 49.469 1.00 111.02 ? 60   THR A CA  1 
ATOM   250  C C   . THR A 1 41  ? 7.591  36.770 48.406 1.00 114.60 ? 60   THR A C   1 
ATOM   251  O O   . THR A 1 41  ? 7.245  36.584 47.234 1.00 114.25 ? 60   THR A O   1 
ATOM   252  C CB  . THR A 1 41  ? 8.486  34.654 49.481 1.00 115.25 ? 60   THR A CB  1 
ATOM   253  O OG1 . THR A 1 41  ? 8.066  33.468 50.162 1.00 114.62 ? 60   THR A OG1 1 
ATOM   254  C CG2 . THR A 1 41  ? 9.779  35.191 50.109 1.00 112.15 ? 60   THR A CG2 1 
ATOM   255  N N   . VAL A 1 42  ? 8.207  37.889 48.832 1.00 110.46 ? 61   VAL A N   1 
ATOM   256  C CA  . VAL A 1 42  ? 8.588  39.030 47.988 1.00 109.88 ? 61   VAL A CA  1 
ATOM   257  C C   . VAL A 1 42  ? 9.587  38.602 46.896 1.00 111.01 ? 61   VAL A C   1 
ATOM   258  O O   . VAL A 1 42  ? 9.417  38.969 45.732 1.00 111.16 ? 61   VAL A O   1 
ATOM   259  C CB  . VAL A 1 42  ? 9.017  40.283 48.817 1.00 114.24 ? 61   VAL A CB  1 
ATOM   260  C CG1 . VAL A 1 42  ? 9.522  39.906 50.211 1.00 113.63 ? 61   VAL A CG1 1 
ATOM   261  C CG2 . VAL A 1 42  ? 10.018 41.171 48.075 1.00 113.62 ? 61   VAL A CG2 1 
ATOM   262  N N   . GLY A 1 43  ? 10.556 37.770 47.272 1.00 105.05 ? 62   GLY A N   1 
ATOM   263  C CA  . GLY A 1 43  ? 11.551 37.213 46.362 1.00 103.09 ? 62   GLY A CA  1 
ATOM   264  C C   . GLY A 1 43  ? 10.974 36.172 45.420 1.00 104.95 ? 62   GLY A C   1 
ATOM   265  O O   . GLY A 1 43  ? 11.641 35.783 44.459 1.00 103.90 ? 62   GLY A O   1 
ATOM   266  N N   . ASN A 1 44  ? 9.729  35.707 45.695 1.00 101.10 ? 63   ASN A N   1 
ATOM   267  C CA  . ASN A 1 44  ? 9.003  34.733 44.873 1.00 100.82 ? 63   ASN A CA  1 
ATOM   268  C C   . ASN A 1 44  ? 8.174  35.396 43.755 1.00 104.17 ? 63   ASN A C   1 
ATOM   269  O O   . ASN A 1 44  ? 7.681  34.698 42.866 1.00 104.04 ? 63   ASN A O   1 
ATOM   270  C CB  . ASN A 1 44  ? 8.156  33.782 45.730 1.00 102.19 ? 63   ASN A CB  1 
ATOM   271  C CG  . ASN A 1 44  ? 8.869  32.523 46.176 1.00 125.40 ? 63   ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 44  ? 9.886  32.102 45.609 1.00 117.14 ? 63   ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 44  ? 8.318  31.863 47.185 1.00 119.29 ? 63   ASN A ND2 1 
ATOM   274  N N   . LEU A 1 45  ? 8.055  36.744 43.781 1.00 100.16 ? 64   LEU A N   1 
ATOM   275  C CA  . LEU A 1 45  ? 7.373  37.532 42.746 1.00 100.64 ? 64   LEU A CA  1 
ATOM   276  C C   . LEU A 1 45  ? 8.242  37.598 41.473 1.00 103.58 ? 64   LEU A C   1 
ATOM   277  O O   . LEU A 1 45  ? 7.715  37.777 40.373 1.00 104.06 ? 64   LEU A O   1 
ATOM   278  C CB  . LEU A 1 45  ? 7.050  38.954 43.246 1.00 101.53 ? 64   LEU A CB  1 
ATOM   279  C CG  . LEU A 1 45  ? 5.904  39.093 44.256 1.00 107.38 ? 64   LEU A CG  1 
ATOM   280  C CD1 . LEU A 1 45  ? 5.908  40.466 44.888 1.00 108.35 ? 64   LEU A CD1 1 
ATOM   281  C CD2 . LEU A 1 45  ? 4.549  38.836 43.606 1.00 111.00 ? 64   LEU A CD2 1 
ATOM   282  N N   . TYR A 1 46  ? 9.573  37.446 41.644 1.00 98.23  ? 65   TYR A N   1 
ATOM   283  C CA  . TYR A 1 46  ? 10.586 37.414 40.591 1.00 97.05  ? 65   TYR A CA  1 
ATOM   284  C C   . TYR A 1 46  ? 10.587 36.026 39.954 1.00 100.71 ? 65   TYR A C   1 
ATOM   285  O O   . TYR A 1 46  ? 11.027 35.873 38.815 1.00 100.19 ? 65   TYR A O   1 
ATOM   286  C CB  . TYR A 1 46  ? 11.973 37.717 41.176 1.00 97.28  ? 65   TYR A CB  1 
ATOM   287  C CG  . TYR A 1 46  ? 12.097 39.078 41.823 1.00 99.66  ? 65   TYR A CG  1 
ATOM   288  C CD1 . TYR A 1 46  ? 12.463 40.193 41.079 1.00 102.53 ? 65   TYR A CD1 1 
ATOM   289  C CD2 . TYR A 1 46  ? 11.883 39.247 43.187 1.00 100.28 ? 65   TYR A CD2 1 
ATOM   290  C CE1 . TYR A 1 46  ? 12.582 41.451 41.667 1.00 104.24 ? 65   TYR A CE1 1 
ATOM   291  C CE2 . TYR A 1 46  ? 11.991 40.502 43.787 1.00 101.89 ? 65   TYR A CE2 1 
ATOM   292  C CZ  . TYR A 1 46  ? 12.346 41.604 43.023 1.00 110.57 ? 65   TYR A CZ  1 
ATOM   293  O OH  . TYR A 1 46  ? 12.461 42.850 43.597 1.00 112.37 ? 65   TYR A OH  1 
ATOM   294  N N   . ILE A 1 47  ? 10.104 35.016 40.698 1.00 97.83  ? 66   ILE A N   1 
ATOM   295  C CA  . ILE A 1 47  ? 9.977  33.628 40.239 1.00 97.98  ? 66   ILE A CA  1 
ATOM   296  C C   . ILE A 1 47  ? 8.665  33.507 39.436 1.00 104.04 ? 66   ILE A C   1 
ATOM   297  O O   . ILE A 1 47  ? 8.571  32.678 38.527 1.00 103.87 ? 66   ILE A O   1 
ATOM   298  C CB  . ILE A 1 47  ? 10.069 32.631 41.437 1.00 100.54 ? 66   ILE A CB  1 
ATOM   299  C CG1 . ILE A 1 47  ? 11.328 32.874 42.334 1.00 99.71  ? 66   ILE A CG1 1 
ATOM   300  C CG2 . ILE A 1 47  ? 9.948  31.168 41.001 1.00 101.47 ? 66   ILE A CG2 1 
ATOM   301  C CD1 . ILE A 1 47  ? 12.758 32.653 41.686 1.00 105.75 ? 66   ILE A CD1 1 
ATOM   302  N N   . VAL A 1 48  ? 7.677  34.377 39.758 1.00 102.19 ? 67   VAL A N   1 
ATOM   303  C CA  . VAL A 1 48  ? 6.373  34.483 39.092 1.00 103.80 ? 67   VAL A CA  1 
ATOM   304  C C   . VAL A 1 48  ? 6.575  35.022 37.664 1.00 107.82 ? 67   VAL A C   1 
ATOM   305  O O   . VAL A 1 48  ? 6.174  34.359 36.707 1.00 108.18 ? 67   VAL A O   1 
ATOM   306  C CB  . VAL A 1 48  ? 5.362  35.331 39.925 1.00 108.97 ? 67   VAL A CB  1 
ATOM   307  C CG1 . VAL A 1 48  ? 4.167  35.790 39.086 1.00 110.52 ? 67   VAL A CG1 1 
ATOM   308  C CG2 . VAL A 1 48  ? 4.885  34.564 41.155 1.00 109.16 ? 67   VAL A CG2 1 
ATOM   309  N N   . SER A 1 49  ? 7.223  36.205 37.532 1.00 103.72 ? 68   SER A N   1 
ATOM   310  C CA  . SER A 1 49  ? 7.533  36.880 36.263 1.00 103.69 ? 68   SER A CA  1 
ATOM   311  C C   . SER A 1 49  ? 8.331  35.980 35.304 1.00 107.14 ? 68   SER A C   1 
ATOM   312  O O   . SER A 1 49  ? 8.097  36.020 34.095 1.00 107.09 ? 68   SER A O   1 
ATOM   313  C CB  . SER A 1 49  ? 8.276  38.187 36.528 1.00 106.46 ? 68   SER A CB  1 
ATOM   314  O OG  . SER A 1 49  ? 8.718  38.810 35.333 1.00 114.38 ? 68   SER A OG  1 
ATOM   315  N N   . LEU A 1 50  ? 9.251  35.160 35.850 1.00 103.05 ? 69   LEU A N   1 
ATOM   316  C CA  . LEU A 1 50  ? 10.042 34.207 35.081 1.00 102.55 ? 69   LEU A CA  1 
ATOM   317  C C   . LEU A 1 50  ? 9.155  33.050 34.592 1.00 108.16 ? 69   LEU A C   1 
ATOM   318  O O   . LEU A 1 50  ? 9.346  32.579 33.472 1.00 108.48 ? 69   LEU A O   1 
ATOM   319  C CB  . LEU A 1 50  ? 11.226 33.683 35.903 1.00 101.32 ? 69   LEU A CB  1 
ATOM   320  C CG  . LEU A 1 50  ? 12.204 32.781 35.153 1.00 105.80 ? 69   LEU A CG  1 
ATOM   321  C CD1 . LEU A 1 50  ? 13.089 33.583 34.227 1.00 105.81 ? 69   LEU A CD1 1 
ATOM   322  C CD2 . LEU A 1 50  ? 13.038 31.974 36.108 1.00 108.04 ? 69   LEU A CD2 1 
ATOM   323  N N   . SER A 1 51  ? 8.177  32.611 35.412 1.00 105.34 ? 70   SER A N   1 
ATOM   324  C CA  . SER A 1 51  ? 7.243  31.551 35.019 1.00 106.41 ? 70   SER A CA  1 
ATOM   325  C C   . SER A 1 51  ? 6.181  32.044 33.998 1.00 110.62 ? 70   SER A C   1 
ATOM   326  O O   . SER A 1 51  ? 5.622  31.225 33.261 1.00 111.08 ? 70   SER A O   1 
ATOM   327  C CB  . SER A 1 51  ? 6.601  30.892 36.238 1.00 110.73 ? 70   SER A CB  1 
ATOM   328  O OG  . SER A 1 51  ? 5.821  31.797 37.002 1.00 120.69 ? 70   SER A OG  1 
ATOM   329  N N   . VAL A 1 52  ? 5.931  33.383 33.948 1.00 106.40 ? 71   VAL A N   1 
ATOM   330  C CA  . VAL A 1 52  ? 5.015  34.055 33.007 1.00 107.30 ? 71   VAL A CA  1 
ATOM   331  C C   . VAL A 1 52  ? 5.702  34.044 31.633 1.00 110.37 ? 71   VAL A C   1 
ATOM   332  O O   . VAL A 1 52  ? 5.146  33.504 30.672 1.00 111.15 ? 71   VAL A O   1 
ATOM   333  C CB  . VAL A 1 52  ? 4.650  35.503 33.469 1.00 111.49 ? 71   VAL A CB  1 
ATOM   334  C CG1 . VAL A 1 52  ? 4.005  36.321 32.349 1.00 112.57 ? 71   VAL A CG1 1 
ATOM   335  C CG2 . VAL A 1 52  ? 3.750  35.481 34.697 1.00 112.01 ? 71   VAL A CG2 1 
ATOM   336  N N   . ALA A 1 53  ? 6.931  34.614 31.563 1.00 104.93 ? 72   ALA A N   1 
ATOM   337  C CA  . ALA A 1 53  ? 7.760  34.657 30.362 1.00 104.24 ? 72   ALA A CA  1 
ATOM   338  C C   . ALA A 1 53  ? 7.939  33.246 29.817 1.00 108.42 ? 72   ALA A C   1 
ATOM   339  O O   . ALA A 1 53  ? 7.799  33.048 28.617 1.00 109.17 ? 72   ALA A O   1 
ATOM   340  C CB  . ALA A 1 53  ? 9.112  35.275 30.677 1.00 103.56 ? 72   ALA A CB  1 
ATOM   341  N N   . ASP A 1 54  ? 8.159  32.258 30.702 1.00 104.51 ? 73   ASP A N   1 
ATOM   342  C CA  . ASP A 1 54  ? 8.307  30.864 30.301 1.00 105.17 ? 73   ASP A CA  1 
ATOM   343  C C   . ASP A 1 54  ? 6.979  30.161 29.948 1.00 110.77 ? 73   ASP A C   1 
ATOM   344  O O   . ASP A 1 54  ? 7.011  29.089 29.338 1.00 111.66 ? 73   ASP A O   1 
ATOM   345  C CB  . ASP A 1 54  ? 9.170  30.066 31.300 1.00 106.29 ? 73   ASP A CB  1 
ATOM   346  C CG  . ASP A 1 54  ? 10.661 30.394 31.278 1.00 116.47 ? 73   ASP A CG  1 
ATOM   347  O OD1 . ASP A 1 54  ? 11.188 30.721 30.186 1.00 116.74 ? 73   ASP A OD1 1 
ATOM   348  O OD2 . ASP A 1 54  ? 11.317 30.234 32.329 1.00 123.10 ? 73   ASP A OD2 1 
ATOM   349  N N   . LEU A 1 55  ? 5.816  30.759 30.298 1.00 107.47 ? 74   LEU A N   1 
ATOM   350  C CA  . LEU A 1 55  ? 4.525  30.173 29.906 1.00 108.89 ? 74   LEU A CA  1 
ATOM   351  C C   . LEU A 1 55  ? 4.193  30.635 28.489 1.00 112.73 ? 74   LEU A C   1 
ATOM   352  O O   . LEU A 1 55  ? 3.807  29.801 27.662 1.00 114.24 ? 74   LEU A O   1 
ATOM   353  C CB  . LEU A 1 55  ? 3.369  30.488 30.878 1.00 109.70 ? 74   LEU A CB  1 
ATOM   354  C CG  . LEU A 1 55  ? 2.005  29.851 30.535 1.00 116.51 ? 74   LEU A CG  1 
ATOM   355  C CD1 . LEU A 1 55  ? 1.980  28.350 30.840 1.00 117.32 ? 74   LEU A CD1 1 
ATOM   356  C CD2 . LEU A 1 55  ? 0.880  30.562 31.245 1.00 119.94 ? 74   LEU A CD2 1 
ATOM   357  N N   . ILE A 1 56  ? 4.374  31.959 28.201 1.00 107.14 ? 75   ILE A N   1 
ATOM   358  C CA  . ILE A 1 56  ? 4.175  32.547 26.869 1.00 107.07 ? 75   ILE A CA  1 
ATOM   359  C C   . ILE A 1 56  ? 4.954  31.696 25.853 1.00 110.41 ? 75   ILE A C   1 
ATOM   360  O O   . ILE A 1 56  ? 4.378  31.286 24.852 1.00 111.40 ? 75   ILE A O   1 
ATOM   361  C CB  . ILE A 1 56  ? 4.517  34.079 26.853 1.00 108.96 ? 75   ILE A CB  1 
ATOM   362  C CG1 . ILE A 1 56  ? 3.268  34.933 27.142 1.00 110.55 ? 75   ILE A CG1 1 
ATOM   363  C CG2 . ILE A 1 56  ? 5.154  34.545 25.546 1.00 108.99 ? 75   ILE A CG2 1 
ATOM   364  C CD1 . ILE A 1 56  ? 2.918  35.127 28.595 1.00 116.65 ? 75   ILE A CD1 1 
ATOM   365  N N   . VAL A 1 57  ? 6.208  31.325 26.194 1.00 105.39 ? 76   VAL A N   1 
ATOM   366  C CA  . VAL A 1 57  ? 7.085  30.465 25.396 1.00 105.39 ? 76   VAL A CA  1 
ATOM   367  C C   . VAL A 1 57  ? 6.446  29.083 25.142 1.00 112.45 ? 76   VAL A C   1 
ATOM   368  O O   . VAL A 1 57  ? 6.545  28.572 24.034 1.00 113.22 ? 76   VAL A O   1 
ATOM   369  C CB  . VAL A 1 57  ? 8.514  30.375 26.004 1.00 107.12 ? 76   VAL A CB  1 
ATOM   370  C CG1 . VAL A 1 57  ? 9.383  29.348 25.277 1.00 107.31 ? 76   VAL A CG1 1 
ATOM   371  C CG2 . VAL A 1 57  ? 9.194  31.738 25.998 1.00 105.68 ? 76   VAL A CG2 1 
ATOM   372  N N   . GLY A 1 58  ? 5.764  28.528 26.139 1.00 110.56 ? 77   GLY A N   1 
ATOM   373  C CA  . GLY A 1 58  ? 5.114  27.227 26.018 1.00 112.88 ? 77   GLY A CA  1 
ATOM   374  C C   . GLY A 1 58  ? 3.837  27.203 25.197 1.00 120.19 ? 77   GLY A C   1 
ATOM   375  O O   . GLY A 1 58  ? 3.621  26.271 24.419 1.00 121.57 ? 77   GLY A O   1 
ATOM   376  N N   . ALA A 1 59  ? 2.968  28.214 25.388 1.00 117.48 ? 78   ALA A N   1 
ATOM   377  C CA  . ALA A 1 59  ? 1.657  28.321 24.738 1.00 119.66 ? 78   ALA A CA  1 
ATOM   378  C C   . ALA A 1 59  ? 1.630  29.068 23.394 1.00 124.31 ? 78   ALA A C   1 
ATOM   379  O O   . ALA A 1 59  ? 0.760  28.790 22.562 1.00 126.36 ? 78   ALA A O   1 
ATOM   380  C CB  . ALA A 1 59  ? 0.659  28.952 25.700 1.00 120.69 ? 78   ALA A CB  1 
ATOM   381  N N   . VAL A 1 60  ? 2.581  29.970 23.167 1.00 118.71 ? 79   VAL A N   1 
ATOM   382  C CA  . VAL A 1 60  ? 2.579  30.766 21.939 1.00 118.78 ? 79   VAL A CA  1 
ATOM   383  C C   . VAL A 1 60  ? 3.780  30.543 21.013 1.00 121.96 ? 79   VAL A C   1 
ATOM   384  O O   . VAL A 1 60  ? 3.618  30.414 19.800 1.00 122.88 ? 79   VAL A O   1 
ATOM   385  C CB  . VAL A 1 60  ? 2.472  32.273 22.252 1.00 121.66 ? 79   VAL A CB  1 
ATOM   386  C CG1 . VAL A 1 60  ? 2.763  33.095 21.006 1.00 121.97 ? 79   VAL A CG1 1 
ATOM   387  C CG2 . VAL A 1 60  ? 1.094  32.603 22.807 1.00 122.67 ? 79   VAL A CG2 1 
ATOM   388  N N   . VAL A 1 61  ? 4.979  30.514 21.586 1.00 116.89 ? 80   VAL A N   1 
ATOM   389  C CA  . VAL A 1 61  ? 6.211  30.484 20.805 1.00 116.45 ? 80   VAL A CA  1 
ATOM   390  C C   . VAL A 1 61  ? 6.407  29.023 20.405 1.00 123.87 ? 80   VAL A C   1 
ATOM   391  O O   . VAL A 1 61  ? 6.725  28.725 19.253 1.00 124.49 ? 80   VAL A O   1 
ATOM   392  C CB  . VAL A 1 61  ? 7.456  30.961 21.578 1.00 117.73 ? 80   VAL A CB  1 
ATOM   393  C CG1 . VAL A 1 61  ? 8.672  30.980 20.665 1.00 117.27 ? 80   VAL A CG1 1 
ATOM   394  C CG2 . VAL A 1 61  ? 7.211  32.336 22.181 1.00 116.42 ? 80   VAL A CG2 1 
ATOM   395  N N   . MET A 1 62  ? 6.222  28.117 21.359 1.00 122.43 ? 81   MET A N   1 
ATOM   396  C CA  . MET A 1 62  ? 6.457  26.687 21.116 1.00 124.51 ? 81   MET A CA  1 
ATOM   397  C C   . MET A 1 62  ? 5.491  26.021 20.114 1.00 133.15 ? 81   MET A C   1 
ATOM   398  O O   . MET A 1 62  ? 6.010  25.366 19.206 1.00 134.35 ? 81   MET A O   1 
ATOM   399  C CB  . MET A 1 62  ? 6.583  25.876 22.421 1.00 126.49 ? 81   MET A CB  1 
ATOM   400  C CG  . MET A 1 62  ? 8.004  25.779 22.940 1.00 128.49 ? 81   MET A CG  1 
ATOM   401  S SD  . MET A 1 62  ? 8.074  25.656 24.742 1.00 131.21 ? 81   MET A SD  1 
ATOM   402  C CE  . MET A 1 62  ? 9.244  24.345 24.922 1.00 128.26 ? 81   MET A CE  1 
ATOM   403  N N   . PRO A 1 63  ? 4.126  26.148 20.218 1.00 131.86 ? 82   PRO A N   1 
ATOM   404  C CA  . PRO A 1 63  ? 3.248  25.479 19.230 1.00 134.57 ? 82   PRO A CA  1 
ATOM   405  C C   . PRO A 1 63  ? 3.381  26.014 17.803 1.00 138.77 ? 82   PRO A C   1 
ATOM   406  O O   . PRO A 1 63  ? 3.331  25.226 16.860 1.00 139.92 ? 82   PRO A O   1 
ATOM   407  C CB  . PRO A 1 63  ? 1.834  25.699 19.795 1.00 137.49 ? 82   PRO A CB  1 
ATOM   408  C CG  . PRO A 1 63  ? 2.039  26.097 21.231 1.00 139.81 ? 82   PRO A CG  1 
ATOM   409  C CD  . PRO A 1 63  ? 3.314  26.872 21.219 1.00 132.78 ? 82   PRO A CD  1 
ATOM   410  N N   . MET A 1 64  ? 3.581  27.343 17.651 1.00 134.08 ? 83   MET A N   1 
ATOM   411  C CA  . MET A 1 64  ? 3.754  28.024 16.364 1.00 134.36 ? 83   MET A CA  1 
ATOM   412  C C   . MET A 1 64  ? 5.089  27.665 15.684 1.00 138.49 ? 83   MET A C   1 
ATOM   413  O O   . MET A 1 64  ? 5.188  27.759 14.460 1.00 139.21 ? 83   MET A O   1 
ATOM   414  C CB  . MET A 1 64  ? 3.613  29.548 16.517 1.00 135.36 ? 83   MET A CB  1 
ATOM   415  C CG  . MET A 1 64  ? 2.191  30.035 16.765 1.00 140.14 ? 83   MET A CG  1 
ATOM   416  S SD  . MET A 1 64  ? 2.055  31.849 16.716 1.00 143.59 ? 83   MET A SD  1 
ATOM   417  C CE  . MET A 1 64  ? 0.344  32.054 17.122 1.00 142.29 ? 83   MET A CE  1 
ATOM   418  N N   . ASN A 1 65  ? 6.106  27.258 16.466 1.00 134.22 ? 84   ASN A N   1 
ATOM   419  C CA  . ASN A 1 65  ? 7.401  26.853 15.922 1.00 134.33 ? 84   ASN A CA  1 
ATOM   420  C C   . ASN A 1 65  ? 7.372  25.398 15.426 1.00 141.11 ? 84   ASN A C   1 
ATOM   421  O O   . ASN A 1 65  ? 8.189  25.038 14.577 1.00 141.57 ? 84   ASN A O   1 
ATOM   422  C CB  . ASN A 1 65  ? 8.532  27.080 16.924 1.00 133.82 ? 84   ASN A CB  1 
ATOM   423  C CG  . ASN A 1 65  ? 9.888  27.217 16.270 1.00 159.85 ? 84   ASN A CG  1 
ATOM   424  O OD1 . ASN A 1 65  ? 10.353 28.322 15.969 1.00 153.41 ? 84   ASN A OD1 1 
ATOM   425  N ND2 . ASN A 1 65  ? 10.549 26.095 16.015 1.00 152.89 ? 84   ASN A ND2 1 
ATOM   426  N N   . ILE A 1 66  ? 6.429  24.570 15.944 1.00 139.32 ? 85   ILE A N   1 
ATOM   427  C CA  . ILE A 1 66  ? 6.243  23.164 15.532 1.00 141.92 ? 85   ILE A CA  1 
ATOM   428  C C   . ILE A 1 66  ? 5.661  23.125 14.090 1.00 148.35 ? 85   ILE A C   1 
ATOM   429  O O   . ILE A 1 66  ? 6.077  22.285 13.282 1.00 149.60 ? 85   ILE A O   1 
ATOM   430  C CB  . ILE A 1 66  ? 5.394  22.335 16.565 1.00 145.97 ? 85   ILE A CB  1 
ATOM   431  C CG1 . ILE A 1 66  ? 6.013  22.382 17.988 1.00 144.06 ? 85   ILE A CG1 1 
ATOM   432  C CG2 . ILE A 1 66  ? 5.207  20.867 16.108 1.00 149.91 ? 85   ILE A CG2 1 
ATOM   433  C CD1 . ILE A 1 66  ? 5.042  22.071 19.163 1.00 151.61 ? 85   ILE A CD1 1 
ATOM   434  N N   . LEU A 1 67  ? 4.726  24.065 13.777 1.00 145.06 ? 86   LEU A N   1 
ATOM   435  C CA  . LEU A 1 67  ? 4.065  24.228 12.471 1.00 146.86 ? 86   LEU A CA  1 
ATOM   436  C C   . LEU A 1 67  ? 5.074  24.445 11.345 1.00 151.42 ? 86   LEU A C   1 
ATOM   437  O O   . LEU A 1 67  ? 4.905  23.865 10.278 1.00 153.40 ? 86   LEU A O   1 
ATOM   438  C CB  . LEU A 1 67  ? 3.052  25.390 12.498 1.00 146.35 ? 86   LEU A CB  1 
ATOM   439  C CG  . LEU A 1 67  ? 1.726  25.145 13.222 1.00 151.83 ? 86   LEU A CG  1 
ATOM   440  C CD1 . LEU A 1 67  ? 1.199  26.425 13.832 1.00 150.26 ? 86   LEU A CD1 1 
ATOM   441  C CD2 . LEU A 1 67  ? 0.684  24.543 12.287 1.00 157.61 ? 86   LEU A CD2 1 
ATOM   442  N N   . TYR A 1 68  ? 6.132  25.253 11.599 1.00 146.16 ? 87   TYR A N   1 
ATOM   443  C CA  . TYR A 1 68  ? 7.226  25.562 10.664 1.00 146.10 ? 87   TYR A CA  1 
ATOM   444  C C   . TYR A 1 68  ? 8.090  24.342 10.346 1.00 151.60 ? 87   TYR A C   1 
ATOM   445  O O   . TYR A 1 68  ? 8.821  24.355 9.352  1.00 152.21 ? 87   TYR A O   1 
ATOM   446  C CB  . TYR A 1 68  ? 8.120  26.666 11.234 1.00 144.59 ? 87   TYR A CB  1 
ATOM   447  C CG  . TYR A 1 68  ? 7.724  28.067 10.830 1.00 145.63 ? 87   TYR A CG  1 
ATOM   448  C CD1 . TYR A 1 68  ? 8.458  28.774 9.883  1.00 147.50 ? 87   TYR A CD1 1 
ATOM   449  C CD2 . TYR A 1 68  ? 6.653  28.714 11.445 1.00 145.99 ? 87   TYR A CD2 1 
ATOM   450  C CE1 . TYR A 1 68  ? 8.123  30.081 9.537  1.00 147.95 ? 87   TYR A CE1 1 
ATOM   451  C CE2 . TYR A 1 68  ? 6.308  30.020 11.106 1.00 146.63 ? 87   TYR A CE2 1 
ATOM   452  C CZ  . TYR A 1 68  ? 7.050  30.703 10.158 1.00 154.39 ? 87   TYR A CZ  1 
ATOM   453  O OH  . TYR A 1 68  ? 6.699  31.986 9.822  1.00 155.82 ? 87   TYR A OH  1 
ATOM   454  N N   . LEU A 1 69  ? 8.034  23.310 11.205 1.00 148.22 ? 88   LEU A N   1 
ATOM   455  C CA  . LEU A 1 69  ? 8.767  22.058 11.025 1.00 149.45 ? 88   LEU A CA  1 
ATOM   456  C C   . LEU A 1 69  ? 7.915  21.033 10.275 1.00 156.36 ? 88   LEU A C   1 
ATOM   457  O O   . LEU A 1 69  ? 8.461  20.149 9.610  1.00 158.08 ? 88   LEU A O   1 
ATOM   458  C CB  . LEU A 1 69  ? 9.217  21.498 12.376 1.00 148.24 ? 88   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 69  ? 10.423 22.186 12.984 1.00 150.22 ? 88   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 69  ? 10.246 22.359 14.473 1.00 148.40 ? 88   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 69  ? 11.703 21.447 12.633 1.00 153.60 ? 88   LEU A CD2 1 
ATOM   462  N N   . LEU A 1 70  ? 6.580  21.159 10.386 1.00 153.35 ? 89   LEU A N   1 
ATOM   463  C CA  . LEU A 1 70  ? 5.612  20.298 9.715  1.00 156.38 ? 89   LEU A CA  1 
ATOM   464  C C   . LEU A 1 70  ? 5.310  20.866 8.314  1.00 161.66 ? 89   LEU A C   1 
ATOM   465  O O   . LEU A 1 70  ? 5.369  20.130 7.328  1.00 163.84 ? 89   LEU A O   1 
ATOM   466  C CB  . LEU A 1 70  ? 4.334  20.195 10.562 1.00 156.69 ? 89   LEU A CB  1 
ATOM   467  C CG  . LEU A 1 70  ? 3.474  18.970 10.310 1.00 164.80 ? 89   LEU A CG  1 
ATOM   468  C CD1 . LEU A 1 70  ? 3.381  18.109 11.550 1.00 164.91 ? 89   LEU A CD1 1 
ATOM   469  C CD2 . LEU A 1 70  ? 2.097  19.369 9.827  1.00 169.01 ? 89   LEU A CD2 1 
ATOM   470  N N   . MET A 1 71  ? 5.022  22.183 8.237  1.00 156.42 ? 90   MET A N   1 
ATOM   471  C CA  . MET A 1 71  ? 4.709  22.930 7.014  1.00 157.07 ? 90   MET A CA  1 
ATOM   472  C C   . MET A 1 71  ? 5.760  24.037 6.844  1.00 158.44 ? 90   MET A C   1 
ATOM   473  O O   . MET A 1 71  ? 5.752  24.998 7.615  1.00 155.53 ? 90   MET A O   1 
ATOM   474  C CB  . MET A 1 71  ? 3.297  23.555 7.108  1.00 159.97 ? 90   MET A CB  1 
ATOM   475  C CG  . MET A 1 71  ? 2.209  22.585 7.536  1.00 165.94 ? 90   MET A CG  1 
ATOM   476  S SD  . MET A 1 71  ? 0.752  23.439 8.180  1.00 169.99 ? 90   MET A SD  1 
ATOM   477  C CE  . MET A 1 71  ? -0.175 23.675 6.671  1.00 169.75 ? 90   MET A CE  1 
ATOM   478  N N   . SER A 1 72  ? 6.666  23.895 5.847  1.00 156.15 ? 91   SER A N   1 
ATOM   479  C CA  . SER A 1 72  ? 7.766  24.829 5.541  1.00 154.58 ? 91   SER A CA  1 
ATOM   480  C C   . SER A 1 72  ? 7.369  26.320 5.521  1.00 158.10 ? 91   SER A C   1 
ATOM   481  O O   . SER A 1 72  ? 8.127  27.161 6.012  1.00 155.42 ? 91   SER A O   1 
ATOM   482  C CB  . SER A 1 72  ? 8.457  24.435 4.241  1.00 160.03 ? 91   SER A CB  1 
ATOM   483  O OG  . SER A 1 72  ? 9.691  25.117 4.092  1.00 168.29 ? 91   SER A OG  1 
ATOM   484  N N   . LYS A 1 73  ? 6.186  26.634 4.960  1.00 156.86 ? 92   LYS A N   1 
ATOM   485  C CA  . LYS A 1 73  ? 5.633  27.991 4.906  1.00 155.94 ? 92   LYS A CA  1 
ATOM   486  C C   . LYS A 1 73  ? 4.652  28.183 6.061  1.00 160.01 ? 92   LYS A C   1 
ATOM   487  O O   . LYS A 1 73  ? 4.077  27.210 6.558  1.00 160.39 ? 92   LYS A O   1 
ATOM   488  C CB  . LYS A 1 73  ? 4.950  28.269 3.552  1.00 160.46 ? 92   LYS A CB  1 
ATOM   489  C CG  . LYS A 1 73  ? 5.926  28.626 2.432  1.00 170.67 ? 92   LYS A CG  1 
ATOM   490  C CD  . LYS A 1 73  ? 5.238  28.742 1.075  1.00 179.32 ? 92   LYS A CD  1 
ATOM   491  C CE  . LYS A 1 73  ? 6.236  28.897 -0.049 1.00 186.11 ? 92   LYS A CE  1 
ATOM   492  N NZ  . LYS A 1 73  ? 5.577  28.878 -1.381 1.00 193.98 ? 92   LYS A NZ  1 
ATOM   493  N N   . TRP A 1 74  ? 4.462  29.438 6.481  1.00 156.27 ? 93   TRP A N   1 
ATOM   494  C CA  . TRP A 1 74  ? 3.592  29.802 7.600  1.00 155.97 ? 93   TRP A CA  1 
ATOM   495  C C   . TRP A 1 74  ? 2.119  29.970 7.269  1.00 161.49 ? 93   TRP A C   1 
ATOM   496  O O   . TRP A 1 74  ? 1.762  30.767 6.398  1.00 162.07 ? 93   TRP A O   1 
ATOM   497  C CB  . TRP A 1 74  ? 4.117  31.038 8.330  1.00 152.76 ? 93   TRP A CB  1 
ATOM   498  C CG  . TRP A 1 74  ? 4.488  32.192 7.446  1.00 154.48 ? 93   TRP A CG  1 
ATOM   499  C CD1 . TRP A 1 74  ? 3.736  33.300 7.191  1.00 157.73 ? 93   TRP A CD1 1 
ATOM   500  C CD2 . TRP A 1 74  ? 5.731  32.378 6.747  1.00 154.01 ? 93   TRP A CD2 1 
ATOM   501  N NE1 . TRP A 1 74  ? 4.422  34.156 6.359  1.00 157.50 ? 93   TRP A NE1 1 
ATOM   502  C CE2 . TRP A 1 74  ? 5.649  33.615 6.070  1.00 158.26 ? 93   TRP A CE2 1 
ATOM   503  C CE3 . TRP A 1 74  ? 6.898  31.604 6.601  1.00 155.05 ? 93   TRP A CE3 1 
ATOM   504  C CZ2 . TRP A 1 74  ? 6.696  34.108 5.281  1.00 157.57 ? 93   TRP A CZ2 1 
ATOM   505  C CZ3 . TRP A 1 74  ? 7.935  32.094 5.823  1.00 156.51 ? 93   TRP A CZ3 1 
ATOM   506  C CH2 . TRP A 1 74  ? 7.829  33.329 5.171  1.00 157.53 ? 93   TRP A CH2 1 
ATOM   507  N N   . SER A 1 75  ? 1.259  29.254 8.021  1.00 158.31 ? 94   SER A N   1 
ATOM   508  C CA  . SER A 1 75  ? -0.204 29.307 7.914  1.00 159.91 ? 94   SER A CA  1 
ATOM   509  C C   . SER A 1 75  ? -0.728 30.475 8.787  1.00 161.83 ? 94   SER A C   1 
ATOM   510  O O   . SER A 1 75  ? -1.940 30.665 8.938  1.00 162.65 ? 94   SER A O   1 
ATOM   511  C CB  . SER A 1 75  ? -0.813 27.980 8.368  1.00 164.80 ? 94   SER A CB  1 
ATOM   512  O OG  . SER A 1 75  ? -0.138 26.862 7.812  1.00 173.15 ? 94   SER A OG  1 
ATOM   513  N N   . LEU A 1 76  ? 0.219  31.265 9.331  1.00 155.65 ? 95   LEU A N   1 
ATOM   514  C CA  . LEU A 1 76  ? 0.022  32.405 10.221 1.00 153.88 ? 95   LEU A CA  1 
ATOM   515  C C   . LEU A 1 76  ? -0.496 33.745 9.679  1.00 157.23 ? 95   LEU A C   1 
ATOM   516  O O   . LEU A 1 76  ? -1.496 34.263 10.182 1.00 157.29 ? 95   LEU A O   1 
ATOM   517  C CB  . LEU A 1 76  ? 1.360  32.757 10.924 1.00 151.25 ? 95   LEU A CB  1 
ATOM   518  C CG  . LEU A 1 76  ? 1.787  31.876 12.103 1.00 154.67 ? 95   LEU A CG  1 
ATOM   519  C CD1 . LEU A 1 76  ? 2.656  30.713 11.649 1.00 155.16 ? 95   LEU A CD1 1 
ATOM   520  C CD2 . LEU A 1 76  ? 2.560  32.676 13.116 1.00 154.51 ? 95   LEU A CD2 1 
ATOM   521  N N   . GLY A 1 77  ? 0.198  34.284 8.673  1.00 152.99 ? 96   GLY A N   1 
ATOM   522  C CA  . GLY A 1 77  ? -0.083 35.586 8.081  1.00 153.25 ? 96   GLY A CA  1 
ATOM   523  C C   . GLY A 1 77  ? 0.408  36.759 8.904  1.00 154.81 ? 96   GLY A C   1 
ATOM   524  O O   . GLY A 1 77  ? 0.696  36.585 10.088 1.00 152.38 ? 96   GLY A O   1 
ATOM   525  N N   . ARG A 1 78  ? 0.495  37.963 8.294  1.00 152.29 ? 97   ARG A N   1 
ATOM   526  C CA  . ARG A 1 78  ? 0.967  39.206 8.934  1.00 151.17 ? 97   ARG A CA  1 
ATOM   527  C C   . ARG A 1 78  ? 0.564  39.447 10.410 1.00 154.91 ? 97   ARG A C   1 
ATOM   528  O O   . ARG A 1 78  ? 1.474  39.704 11.199 1.00 152.39 ? 97   ARG A O   1 
ATOM   529  C CB  . ARG A 1 78  ? 0.729  40.456 8.058  1.00 153.21 ? 97   ARG A CB  1 
ATOM   530  C CG  . ARG A 1 78  ? 1.716  40.617 6.899  1.00 161.45 ? 97   ARG A CG  1 
ATOM   531  C CD  . ARG A 1 78  ? 3.028  41.283 7.301  1.00 165.63 ? 97   ARG A CD  1 
ATOM   532  N NE  . ARG A 1 78  ? 2.941  42.746 7.283  1.00 168.70 ? 97   ARG A NE  1 
ATOM   533  C CZ  . ARG A 1 78  ? 3.984  43.563 7.401  1.00 177.00 ? 97   ARG A CZ  1 
ATOM   534  N NH1 . ARG A 1 78  ? 5.210  43.072 7.542  1.00 159.46 ? 97   ARG A NH1 1 
ATOM   535  N NH2 . ARG A 1 78  ? 3.811  44.878 7.372  1.00 162.70 ? 97   ARG A NH2 1 
ATOM   536  N N   . PRO A 1 79  ? -0.729 39.329 10.841 1.00 153.74 ? 98   PRO A N   1 
ATOM   537  C CA  . PRO A 1 79  ? -1.045 39.565 12.267 1.00 152.81 ? 98   PRO A CA  1 
ATOM   538  C C   . PRO A 1 79  ? -0.426 38.554 13.246 1.00 155.31 ? 98   PRO A C   1 
ATOM   539  O O   . PRO A 1 79  ? 0.242  38.979 14.193 1.00 152.98 ? 98   PRO A O   1 
ATOM   540  C CB  . PRO A 1 79  ? -2.583 39.560 12.304 1.00 157.02 ? 98   PRO A CB  1 
ATOM   541  C CG  . PRO A 1 79  ? -3.021 39.716 10.874 1.00 163.85 ? 98   PRO A CG  1 
ATOM   542  C CD  . PRO A 1 79  ? -1.961 39.035 10.077 1.00 158.27 ? 98   PRO A CD  1 
ATOM   543  N N   . LEU A 1 80  ? -0.629 37.228 13.011 1.00 153.09 ? 99   LEU A N   1 
ATOM   544  C CA  . LEU A 1 80  ? -0.094 36.132 13.839 1.00 151.40 ? 99   LEU A CA  1 
ATOM   545  C C   . LEU A 1 80  ? 1.429  36.045 13.759 1.00 153.15 ? 99   LEU A C   1 
ATOM   546  O O   . LEU A 1 80  ? 2.073  35.770 14.775 1.00 151.22 ? 99   LEU A O   1 
ATOM   547  C CB  . LEU A 1 80  ? -0.686 34.764 13.427 1.00 152.97 ? 99   LEU A CB  1 
ATOM   548  C CG  . LEU A 1 80  ? -2.126 34.429 13.823 1.00 159.54 ? 99   LEU A CG  1 
ATOM   549  C CD1 . LEU A 1 80  ? -2.641 33.249 13.012 1.00 161.90 ? 99   LEU A CD1 1 
ATOM   550  C CD2 . LEU A 1 80  ? -2.238 34.106 15.304 1.00 160.33 ? 99   LEU A CD2 1 
ATOM   551  N N   . CYS A 1 81  ? 1.998  36.237 12.546 1.00 149.60 ? 100  CYS A N   1 
ATOM   552  C CA  . CYS A 1 81  ? 3.437  36.148 12.315 1.00 147.73 ? 100  CYS A CA  1 
ATOM   553  C C   . CYS A 1 81  ? 4.250  37.294 12.886 1.00 149.82 ? 100  CYS A C   1 
ATOM   554  O O   . CYS A 1 81  ? 5.343  37.039 13.384 1.00 148.11 ? 100  CYS A O   1 
ATOM   555  C CB  . CYS A 1 81  ? 3.772  35.873 10.854 1.00 149.32 ? 100  CYS A CB  1 
ATOM   556  S SG  . CYS A 1 81  ? 5.077  34.640 10.622 1.00 152.37 ? 100  CYS A SG  1 
ATOM   557  N N   . LEU A 1 82  ? 3.727  38.536 12.858 1.00 146.45 ? 101  LEU A N   1 
ATOM   558  C CA  . LEU A 1 82  ? 4.430  39.676 13.457 1.00 144.87 ? 101  LEU A CA  1 
ATOM   559  C C   . LEU A 1 82  ? 4.387  39.608 14.997 1.00 145.75 ? 101  LEU A C   1 
ATOM   560  O O   . LEU A 1 82  ? 5.336  40.054 15.650 1.00 143.82 ? 101  LEU A O   1 
ATOM   561  C CB  . LEU A 1 82  ? 3.878  41.021 12.963 1.00 146.60 ? 101  LEU A CB  1 
ATOM   562  C CG  . LEU A 1 82  ? 4.373  41.508 11.606 1.00 152.68 ? 101  LEU A CG  1 
ATOM   563  C CD1 . LEU A 1 82  ? 3.388  42.477 10.991 1.00 155.30 ? 101  LEU A CD1 1 
ATOM   564  C CD2 . LEU A 1 82  ? 5.737  42.173 11.717 1.00 154.10 ? 101  LEU A CD2 1 
ATOM   565  N N   . PHE A 1 83  ? 3.294  39.039 15.569 1.00 141.57 ? 102  PHE A N   1 
ATOM   566  C CA  . PHE A 1 83  ? 3.118  38.875 17.018 1.00 139.49 ? 102  PHE A CA  1 
ATOM   567  C C   . PHE A 1 83  ? 3.986  37.748 17.560 1.00 139.67 ? 102  PHE A C   1 
ATOM   568  O O   . PHE A 1 83  ? 4.488  37.862 18.674 1.00 137.28 ? 102  PHE A O   1 
ATOM   569  C CB  . PHE A 1 83  ? 1.645  38.672 17.393 1.00 142.76 ? 102  PHE A CB  1 
ATOM   570  C CG  . PHE A 1 83  ? 1.285  39.243 18.744 1.00 143.75 ? 102  PHE A CG  1 
ATOM   571  C CD1 . PHE A 1 83  ? 1.202  40.619 18.937 1.00 147.25 ? 102  PHE A CD1 1 
ATOM   572  C CD2 . PHE A 1 83  ? 1.009  38.407 19.819 1.00 145.10 ? 102  PHE A CD2 1 
ATOM   573  C CE1 . PHE A 1 83  ? 0.864  41.147 20.187 1.00 147.88 ? 102  PHE A CE1 1 
ATOM   574  C CE2 . PHE A 1 83  ? 0.666  38.937 21.067 1.00 147.57 ? 102  PHE A CE2 1 
ATOM   575  C CZ  . PHE A 1 83  ? 0.595  40.303 21.242 1.00 146.12 ? 102  PHE A CZ  1 
ATOM   576  N N   . TRP A 1 84  ? 4.186  36.679 16.763 1.00 135.67 ? 103  TRP A N   1 
ATOM   577  C CA  . TRP A 1 84  ? 5.062  35.559 17.106 1.00 133.73 ? 103  TRP A CA  1 
ATOM   578  C C   . TRP A 1 84  ? 6.520  36.040 17.112 1.00 134.84 ? 103  TRP A C   1 
ATOM   579  O O   . TRP A 1 84  ? 7.313  35.558 17.919 1.00 132.56 ? 103  TRP A O   1 
ATOM   580  C CB  . TRP A 1 84  ? 4.884  34.401 16.118 1.00 133.70 ? 103  TRP A CB  1 
ATOM   581  C CG  . TRP A 1 84  ? 5.727  33.201 16.431 1.00 133.97 ? 103  TRP A CG  1 
ATOM   582  C CD1 . TRP A 1 84  ? 5.441  32.212 17.323 1.00 136.41 ? 103  TRP A CD1 1 
ATOM   583  C CD2 . TRP A 1 84  ? 7.011  32.877 15.873 1.00 133.02 ? 103  TRP A CD2 1 
ATOM   584  N NE1 . TRP A 1 84  ? 6.441  31.267 17.322 1.00 135.37 ? 103  TRP A NE1 1 
ATOM   585  C CE2 . TRP A 1 84  ? 7.424  31.656 16.451 1.00 136.61 ? 103  TRP A CE2 1 
ATOM   586  C CE3 . TRP A 1 84  ? 7.855  33.502 14.937 1.00 134.58 ? 103  TRP A CE3 1 
ATOM   587  C CZ2 . TRP A 1 84  ? 8.643  31.046 16.127 1.00 135.58 ? 103  TRP A CZ2 1 
ATOM   588  C CZ3 . TRP A 1 84  ? 9.063  32.897 14.618 1.00 135.63 ? 103  TRP A CZ3 1 
ATOM   589  C CH2 . TRP A 1 84  ? 9.446  31.684 15.209 1.00 135.93 ? 103  TRP A CH2 1 
ATOM   590  N N   . LEU A 1 85  ? 6.862  36.999 16.221 1.00 131.39 ? 104  LEU A N   1 
ATOM   591  C CA  . LEU A 1 85  ? 8.190  37.620 16.139 1.00 129.92 ? 104  LEU A CA  1 
ATOM   592  C C   . LEU A 1 85  ? 8.428  38.481 17.382 1.00 129.64 ? 104  LEU A C   1 
ATOM   593  O O   . LEU A 1 85  ? 9.571  38.613 17.820 1.00 128.14 ? 104  LEU A O   1 
ATOM   594  C CB  . LEU A 1 85  ? 8.316  38.507 14.886 1.00 131.67 ? 104  LEU A CB  1 
ATOM   595  C CG  . LEU A 1 85  ? 8.528  37.815 13.539 1.00 138.39 ? 104  LEU A CG  1 
ATOM   596  C CD1 . LEU A 1 85  ? 8.113  38.731 12.395 1.00 140.72 ? 104  LEU A CD1 1 
ATOM   597  C CD2 . LEU A 1 85  ? 9.972  37.359 13.361 1.00 140.46 ? 104  LEU A CD2 1 
ATOM   598  N N   . SER A 1 86  ? 7.347  39.078 17.932 1.00 124.05 ? 105  SER A N   1 
ATOM   599  C CA  . SER A 1 86  ? 7.396  39.901 19.137 1.00 121.74 ? 105  SER A CA  1 
ATOM   600  C C   . SER A 1 86  ? 7.485  39.018 20.385 1.00 121.46 ? 105  SER A C   1 
ATOM   601  O O   . SER A 1 86  ? 8.440  39.159 21.146 1.00 119.70 ? 105  SER A O   1 
ATOM   602  C CB  . SER A 1 86  ? 6.183  40.824 19.216 1.00 126.26 ? 105  SER A CB  1 
ATOM   603  O OG  . SER A 1 86  ? 6.372  41.990 18.433 1.00 135.69 ? 105  SER A OG  1 
ATOM   604  N N   . MET A 1 87  ? 6.529  38.068 20.556 1.00 116.83 ? 106  MET A N   1 
ATOM   605  C CA  . MET A 1 87  ? 6.441  37.145 21.698 1.00 115.01 ? 106  MET A CA  1 
ATOM   606  C C   . MET A 1 87  ? 7.651  36.243 21.923 1.00 115.92 ? 106  MET A C   1 
ATOM   607  O O   . MET A 1 87  ? 7.839  35.766 23.036 1.00 114.29 ? 106  MET A O   1 
ATOM   608  C CB  . MET A 1 87  ? 5.113  36.360 21.717 1.00 118.65 ? 106  MET A CB  1 
ATOM   609  C CG  . MET A 1 87  ? 3.872  37.243 21.891 1.00 123.67 ? 106  MET A CG  1 
ATOM   610  S SD  . MET A 1 87  ? 3.906  38.461 23.253 1.00 126.93 ? 106  MET A SD  1 
ATOM   611  C CE  . MET A 1 87  ? 4.127  39.975 22.347 1.00 124.36 ? 106  MET A CE  1 
ATOM   612  N N   . ASP A 1 88  ? 8.478  36.028 20.891 1.00 111.70 ? 107  ASP A N   1 
ATOM   613  C CA  . ASP A 1 88  ? 9.705  35.243 21.005 1.00 110.09 ? 107  ASP A CA  1 
ATOM   614  C C   . ASP A 1 88  ? 10.806 36.150 21.569 1.00 111.07 ? 107  ASP A C   1 
ATOM   615  O O   . ASP A 1 88  ? 11.526 35.744 22.481 1.00 109.62 ? 107  ASP A O   1 
ATOM   616  C CB  . ASP A 1 88  ? 10.099 34.647 19.639 1.00 113.11 ? 107  ASP A CB  1 
ATOM   617  C CG  . ASP A 1 88  ? 11.470 33.999 19.590 1.00 122.19 ? 107  ASP A CG  1 
ATOM   618  O OD1 . ASP A 1 88  ? 12.431 34.680 19.173 1.00 122.29 ? 107  ASP A OD1 1 
ATOM   619  O OD2 . ASP A 1 88  ? 11.577 32.801 19.941 1.00 127.27 ? 107  ASP A OD2 1 
ATOM   620  N N   . TYR A 1 89  ? 10.907 37.385 21.046 1.00 106.44 ? 108  TYR A N   1 
ATOM   621  C CA  . TYR A 1 89  ? 11.896 38.369 21.476 1.00 104.79 ? 108  TYR A CA  1 
ATOM   622  C C   . TYR A 1 89  ? 11.567 39.040 22.815 1.00 106.69 ? 108  TYR A C   1 
ATOM   623  O O   . TYR A 1 89  ? 12.484 39.290 23.596 1.00 105.11 ? 108  TYR A O   1 
ATOM   624  C CB  . TYR A 1 89  ? 12.179 39.396 20.368 1.00 106.73 ? 108  TYR A CB  1 
ATOM   625  C CG  . TYR A 1 89  ? 13.174 38.903 19.337 1.00 108.22 ? 108  TYR A CG  1 
ATOM   626  C CD1 . TYR A 1 89  ? 14.543 38.927 19.591 1.00 109.70 ? 108  TYR A CD1 1 
ATOM   627  C CD2 . TYR A 1 89  ? 12.747 38.402 18.111 1.00 109.72 ? 108  TYR A CD2 1 
ATOM   628  C CE1 . TYR A 1 89  ? 15.465 38.484 18.642 1.00 111.04 ? 108  TYR A CE1 1 
ATOM   629  C CE2 . TYR A 1 89  ? 13.658 37.944 17.158 1.00 110.99 ? 108  TYR A CE2 1 
ATOM   630  C CZ  . TYR A 1 89  ? 15.018 37.987 17.428 1.00 116.95 ? 108  TYR A CZ  1 
ATOM   631  O OH  . TYR A 1 89  ? 15.927 37.538 16.498 1.00 116.63 ? 108  TYR A OH  1 
ATOM   632  N N   . VAL A 1 90  ? 10.275 39.313 23.089 1.00 103.11 ? 109  VAL A N   1 
ATOM   633  C CA  . VAL A 1 90  ? 9.817  39.938 24.340 1.00 102.22 ? 109  VAL A CA  1 
ATOM   634  C C   . VAL A 1 90  ? 9.956  38.966 25.537 1.00 102.88 ? 109  VAL A C   1 
ATOM   635  O O   . VAL A 1 90  ? 10.558 39.348 26.541 1.00 101.49 ? 109  VAL A O   1 
ATOM   636  C CB  . VAL A 1 90  ? 8.399  40.591 24.230 1.00 107.79 ? 109  VAL A CB  1 
ATOM   637  C CG1 . VAL A 1 90  ? 7.945  41.194 25.561 1.00 107.39 ? 109  VAL A CG1 1 
ATOM   638  C CG2 . VAL A 1 90  ? 8.364  41.657 23.137 1.00 109.07 ? 109  VAL A CG2 1 
ATOM   639  N N   . ALA A 1 91  ? 9.432  37.721 25.418 1.00 97.96  ? 110  ALA A N   1 
ATOM   640  C CA  . ALA A 1 91  ? 9.485  36.698 26.475 1.00 96.02  ? 110  ALA A CA  1 
ATOM   641  C C   . ALA A 1 91  ? 10.890 36.261 26.852 1.00 96.67  ? 110  ALA A C   1 
ATOM   642  O O   . ALA A 1 91  ? 11.150 36.063 28.040 1.00 95.39  ? 110  ALA A O   1 
ATOM   643  C CB  . ALA A 1 91  ? 8.654  35.489 26.099 1.00 97.51  ? 110  ALA A CB  1 
ATOM   644  N N   . SER A 1 92  ? 11.787 36.092 25.858 1.00 91.55  ? 111  SER A N   1 
ATOM   645  C CA  . SER A 1 92  ? 13.178 35.702 26.099 1.00 89.65  ? 111  SER A CA  1 
ATOM   646  C C   . SER A 1 92  ? 13.970 36.818 26.793 1.00 91.64  ? 111  SER A C   1 
ATOM   647  O O   . SER A 1 92  ? 14.814 36.523 27.636 1.00 91.05  ? 111  SER A O   1 
ATOM   648  C CB  . SER A 1 92  ? 13.857 35.260 24.810 1.00 92.91  ? 111  SER A CB  1 
ATOM   649  O OG  . SER A 1 92  ? 13.478 33.938 24.469 1.00 99.48  ? 111  SER A OG  1 
ATOM   650  N N   . THR A 1 93  ? 13.665 38.089 26.475 1.00 86.74  ? 112  THR A N   1 
ATOM   651  C CA  . THR A 1 93  ? 14.284 39.251 27.115 1.00 85.40  ? 112  THR A CA  1 
ATOM   652  C C   . THR A 1 93  ? 13.738 39.348 28.544 1.00 87.53  ? 112  THR A C   1 
ATOM   653  O O   . THR A 1 93  ? 14.503 39.604 29.475 1.00 86.57  ? 112  THR A O   1 
ATOM   654  C CB  . THR A 1 93  ? 14.017 40.512 26.287 1.00 90.92  ? 112  THR A CB  1 
ATOM   655  O OG1 . THR A 1 93  ? 14.575 40.317 24.992 1.00 90.76  ? 112  THR A OG1 1 
ATOM   656  C CG2 . THR A 1 93  ? 14.608 41.770 26.904 1.00 88.01  ? 112  THR A CG2 1 
ATOM   657  N N   . ALA A 1 94  ? 12.417 39.096 28.714 1.00 83.38  ? 113  ALA A N   1 
ATOM   658  C CA  . ALA A 1 94  ? 11.732 39.103 30.012 1.00 82.14  ? 113  ALA A CA  1 
ATOM   659  C C   . ALA A 1 94  ? 12.326 38.048 30.928 1.00 83.29  ? 113  ALA A C   1 
ATOM   660  O O   . ALA A 1 94  ? 12.438 38.294 32.124 1.00 81.88  ? 113  ALA A O   1 
ATOM   661  C CB  . ALA A 1 94  ? 10.242 38.860 29.833 1.00 83.74  ? 113  ALA A CB  1 
ATOM   662  N N   . SER A 1 95  ? 12.742 36.896 30.359 1.00 79.25  ? 114  SER A N   1 
ATOM   663  C CA  . SER A 1 95  ? 13.380 35.806 31.086 1.00 78.02  ? 114  SER A CA  1 
ATOM   664  C C   . SER A 1 95  ? 14.733 36.243 31.642 1.00 80.08  ? 114  SER A C   1 
ATOM   665  O O   . SER A 1 95  ? 14.927 36.131 32.850 1.00 79.00  ? 114  SER A O   1 
ATOM   666  C CB  . SER A 1 95  ? 13.495 34.560 30.218 1.00 82.77  ? 114  SER A CB  1 
ATOM   667  O OG  . SER A 1 95  ? 12.238 33.912 30.116 1.00 94.79  ? 114  SER A OG  1 
ATOM   668  N N   . ILE A 1 96  ? 15.630 36.815 30.807 1.00 76.24  ? 115  ILE A N   1 
ATOM   669  C CA  . ILE A 1 96  ? 16.920 37.317 31.304 1.00 75.54  ? 115  ILE A CA  1 
ATOM   670  C C   . ILE A 1 96  ? 16.693 38.472 32.281 1.00 79.03  ? 115  ILE A C   1 
ATOM   671  O O   . ILE A 1 96  ? 17.425 38.590 33.261 1.00 78.20  ? 115  ILE A O   1 
ATOM   672  C CB  . ILE A 1 96  ? 17.979 37.641 30.198 1.00 79.26  ? 115  ILE A CB  1 
ATOM   673  C CG1 . ILE A 1 96  ? 19.405 37.759 30.798 1.00 79.28  ? 115  ILE A CG1 1 
ATOM   674  C CG2 . ILE A 1 96  ? 17.610 38.877 29.351 1.00 80.96  ? 115  ILE A CG2 1 
ATOM   675  C CD1 . ILE A 1 96  ? 20.538 37.371 29.876 1.00 87.76  ? 115  ILE A CD1 1 
ATOM   676  N N   . PHE A 1 97  ? 15.655 39.290 32.034 1.00 75.84  ? 116  PHE A N   1 
ATOM   677  C CA  . PHE A 1 97  ? 15.347 40.417 32.904 1.00 75.83  ? 116  PHE A CA  1 
ATOM   678  C C   . PHE A 1 97  ? 14.813 40.012 34.277 1.00 77.07  ? 116  PHE A C   1 
ATOM   679  O O   . PHE A 1 97  ? 15.250 40.594 35.267 1.00 75.94  ? 116  PHE A O   1 
ATOM   680  C CB  . PHE A 1 97  ? 14.524 41.502 32.187 1.00 79.27  ? 116  PHE A CB  1 
ATOM   681  C CG  . PHE A 1 97  ? 15.338 42.379 31.251 1.00 82.16  ? 116  PHE A CG  1 
ATOM   682  C CD1 . PHE A 1 97  ? 16.732 42.367 31.288 1.00 85.34  ? 116  PHE A CD1 1 
ATOM   683  C CD2 . PHE A 1 97  ? 14.711 43.247 30.365 1.00 85.82  ? 116  PHE A CD2 1 
ATOM   684  C CE1 . PHE A 1 97  ? 17.478 43.185 30.436 1.00 87.51  ? 116  PHE A CE1 1 
ATOM   685  C CE2 . PHE A 1 97  ? 15.461 44.076 29.522 1.00 89.70  ? 116  PHE A CE2 1 
ATOM   686  C CZ  . PHE A 1 97  ? 16.838 44.037 29.560 1.00 87.70  ? 116  PHE A CZ  1 
ATOM   687  N N   . SER A 1 98  ? 13.953 38.959 34.342 1.00 72.33  ? 117  SER A N   1 
ATOM   688  C CA  . SER A 1 98  ? 13.424 38.386 35.586 1.00 70.78  ? 117  SER A CA  1 
ATOM   689  C C   . SER A 1 98  ? 14.588 37.837 36.415 1.00 73.21  ? 117  SER A C   1 
ATOM   690  O O   . SER A 1 98  ? 14.646 38.097 37.617 1.00 72.88  ? 117  SER A O   1 
ATOM   691  C CB  . SER A 1 98  ? 12.419 37.272 35.302 1.00 73.80  ? 117  SER A CB  1 
ATOM   692  O OG  . SER A 1 98  ? 11.147 37.788 34.948 1.00 82.42  ? 117  SER A OG  1 
ATOM   693  N N   . VAL A 1 99  ? 15.539 37.129 35.759 1.00 68.43  ? 118  VAL A N   1 
ATOM   694  C CA  . VAL A 1 99  ? 16.739 36.575 36.396 1.00 67.10  ? 118  VAL A CA  1 
ATOM   695  C C   . VAL A 1 99  ? 17.644 37.705 36.939 1.00 70.09  ? 118  VAL A C   1 
ATOM   696  O O   . VAL A 1 99  ? 17.983 37.681 38.123 1.00 68.88  ? 118  VAL A O   1 
ATOM   697  C CB  . VAL A 1 99  ? 17.472 35.534 35.498 1.00 70.91  ? 118  VAL A CB  1 
ATOM   698  C CG1 . VAL A 1 99  ? 18.793 35.079 36.111 1.00 70.35  ? 118  VAL A CG1 1 
ATOM   699  C CG2 . VAL A 1 99  ? 16.583 34.323 35.239 1.00 70.79  ? 118  VAL A CG2 1 
ATOM   700  N N   . PHE A 1 100 ? 17.956 38.719 36.106 1.00 66.84  ? 119  PHE A N   1 
ATOM   701  C CA  . PHE A 1 100 ? 18.772 39.875 36.495 1.00 67.06  ? 119  PHE A CA  1 
ATOM   702  C C   . PHE A 1 100 ? 18.120 40.724 37.576 1.00 72.87  ? 119  PHE A C   1 
ATOM   703  O O   . PHE A 1 100 ? 18.832 41.271 38.416 1.00 72.69  ? 119  PHE A O   1 
ATOM   704  C CB  . PHE A 1 100 ? 19.085 40.753 35.289 1.00 69.54  ? 119  PHE A CB  1 
ATOM   705  C CG  . PHE A 1 100 ? 20.201 41.739 35.521 1.00 71.41  ? 119  PHE A CG  1 
ATOM   706  C CD1 . PHE A 1 100 ? 21.529 41.331 35.490 1.00 74.29  ? 119  PHE A CD1 1 
ATOM   707  C CD2 . PHE A 1 100 ? 19.929 43.084 35.735 1.00 74.18  ? 119  PHE A CD2 1 
ATOM   708  C CE1 . PHE A 1 100 ? 22.565 42.248 35.686 1.00 76.05  ? 119  PHE A CE1 1 
ATOM   709  C CE2 . PHE A 1 100 ? 20.967 44.003 35.920 1.00 77.90  ? 119  PHE A CE2 1 
ATOM   710  C CZ  . PHE A 1 100 ? 22.278 43.578 35.899 1.00 75.83  ? 119  PHE A CZ  1 
ATOM   711  N N   . ILE A 1 101 ? 16.780 40.849 37.550 1.00 71.02  ? 120  ILE A N   1 
ATOM   712  C CA  . ILE A 1 101 ? 16.051 41.608 38.564 1.00 71.92  ? 120  ILE A CA  1 
ATOM   713  C C   . ILE A 1 101 ? 15.955 40.823 39.900 1.00 75.75  ? 120  ILE A C   1 
ATOM   714  O O   . ILE A 1 101 ? 15.973 41.440 40.974 1.00 75.44  ? 120  ILE A O   1 
ATOM   715  C CB  . ILE A 1 101 ? 14.724 42.252 38.034 1.00 76.27  ? 120  ILE A CB  1 
ATOM   716  C CG1 . ILE A 1 101 ? 14.334 43.531 38.803 1.00 78.23  ? 120  ILE A CG1 1 
ATOM   717  C CG2 . ILE A 1 101 ? 13.557 41.268 37.926 1.00 76.43  ? 120  ILE A CG2 1 
ATOM   718  C CD1 . ILE A 1 101 ? 15.075 44.777 38.391 1.00 88.46  ? 120  ILE A CD1 1 
ATOM   719  N N   . LEU A 1 102 ? 15.927 39.458 39.818 1.00 71.91  ? 121  LEU A N   1 
ATOM   720  C CA  . LEU A 1 102 ? 15.911 38.537 40.970 1.00 70.92  ? 121  LEU A CA  1 
ATOM   721  C C   . LEU A 1 102 ? 17.270 38.566 41.677 1.00 75.18  ? 121  LEU A C   1 
ATOM   722  O O   . LEU A 1 102 ? 17.299 38.650 42.901 1.00 74.61  ? 121  LEU A O   1 
ATOM   723  C CB  . LEU A 1 102 ? 15.553 37.095 40.536 1.00 70.28  ? 121  LEU A CB  1 
ATOM   724  C CG  . LEU A 1 102 ? 15.800 35.947 41.534 1.00 73.65  ? 121  LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 102 ? 14.706 35.861 42.571 1.00 73.68  ? 121  LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 102 ? 15.904 34.619 40.817 1.00 75.34  ? 121  LEU A CD2 1 
ATOM   727  N N   . CYS A 1 103 ? 18.385 38.495 40.909 1.00 72.34  ? 122  CYS A N   1 
ATOM   728  C CA  . CYS A 1 103 ? 19.751 38.533 41.437 1.00 72.15  ? 122  CYS A CA  1 
ATOM   729  C C   . CYS A 1 103 ? 20.059 39.848 42.133 1.00 78.17  ? 122  CYS A C   1 
ATOM   730  O O   . CYS A 1 103 ? 20.733 39.821 43.164 1.00 78.11  ? 122  CYS A O   1 
ATOM   731  C CB  . CYS A 1 103 ? 20.782 38.217 40.361 1.00 72.37  ? 122  CYS A CB  1 
ATOM   732  S SG  . CYS A 1 103 ? 22.498 38.464 40.888 1.00 76.52  ? 122  CYS A SG  1 
ATOM   733  N N   . ILE A 1 104 ? 19.578 40.993 41.588 1.00 76.13  ? 123  ILE A N   1 
ATOM   734  C CA  . ILE A 1 104 ? 19.794 42.312 42.208 1.00 77.19  ? 123  ILE A CA  1 
ATOM   735  C C   . ILE A 1 104 ? 19.127 42.372 43.608 1.00 81.58  ? 123  ILE A C   1 
ATOM   736  O O   . ILE A 1 104 ? 19.724 42.909 44.551 1.00 81.20  ? 123  ILE A O   1 
ATOM   737  C CB  . ILE A 1 104 ? 19.459 43.501 41.252 1.00 81.42  ? 123  ILE A CB  1 
ATOM   738  C CG1 . ILE A 1 104 ? 20.544 43.623 40.160 1.00 82.09  ? 123  ILE A CG1 1 
ATOM   739  C CG2 . ILE A 1 104 ? 19.268 44.836 42.009 1.00 83.78  ? 123  ILE A CG2 1 
ATOM   740  C CD1 . ILE A 1 104 ? 20.561 44.920 39.339 1.00 92.21  ? 123  ILE A CD1 1 
ATOM   741  N N   . ASP A 1 105 ? 17.931 41.747 43.746 1.00 78.52  ? 124  ASP A N   1 
ATOM   742  C CA  . ASP A 1 105 ? 17.202 41.654 45.010 1.00 78.65  ? 124  ASP A CA  1 
ATOM   743  C C   . ASP A 1 105 ? 17.995 40.805 45.998 1.00 82.65  ? 124  ASP A C   1 
ATOM   744  O O   . ASP A 1 105 ? 18.386 41.318 47.041 1.00 83.36  ? 124  ASP A O   1 
ATOM   745  C CB  . ASP A 1 105 ? 15.788 41.082 44.801 1.00 80.35  ? 124  ASP A CB  1 
ATOM   746  C CG  . ASP A 1 105 ? 15.136 40.584 46.078 1.00 90.55  ? 124  ASP A CG  1 
ATOM   747  O OD1 . ASP A 1 105 ? 14.569 41.416 46.816 1.00 92.15  ? 124  ASP A OD1 1 
ATOM   748  O OD2 . ASP A 1 105 ? 15.226 39.364 46.354 1.00 95.02  ? 124  ASP A OD2 1 
ATOM   749  N N   . ARG A 1 106 ? 18.256 39.542 45.681 1.00 78.20  ? 125  ARG A N   1 
ATOM   750  C CA  . ARG A 1 106 ? 19.008 38.674 46.590 1.00 77.73  ? 125  ARG A CA  1 
ATOM   751  C C   . ARG A 1 106 ? 20.291 39.327 47.122 1.00 84.03  ? 125  ARG A C   1 
ATOM   752  O O   . ARG A 1 106 ? 20.717 39.060 48.246 1.00 84.11  ? 125  ARG A O   1 
ATOM   753  C CB  . ARG A 1 106 ? 19.342 37.346 45.906 1.00 77.51  ? 125  ARG A CB  1 
ATOM   754  C CG  . ARG A 1 106 ? 18.571 36.155 46.452 1.00 89.07  ? 125  ARG A CG  1 
ATOM   755  C CD  . ARG A 1 106 ? 17.601 35.605 45.419 1.00 103.32 ? 125  ARG A CD  1 
ATOM   756  N NE  . ARG A 1 106 ? 16.299 35.295 46.002 1.00 113.60 ? 125  ARG A NE  1 
ATOM   757  C CZ  . ARG A 1 106 ? 15.656 34.146 45.826 1.00 125.71 ? 125  ARG A CZ  1 
ATOM   758  N NH1 . ARG A 1 106 ? 16.194 33.189 45.082 1.00 111.00 ? 125  ARG A NH1 1 
ATOM   759  N NH2 . ARG A 1 106 ? 14.474 33.951 46.395 1.00 109.92 ? 125  ARG A NH2 1 
ATOM   760  N N   . TYR A 1 107 ? 20.895 40.178 46.300 1.00 82.49  ? 126  TYR A N   1 
ATOM   761  C CA  . TYR A 1 107 ? 22.144 40.853 46.608 1.00 84.01  ? 126  TYR A CA  1 
ATOM   762  C C   . TYR A 1 107 ? 21.924 41.899 47.694 1.00 89.96  ? 126  TYR A C   1 
ATOM   763  O O   . TYR A 1 107 ? 22.657 41.920 48.678 1.00 89.73  ? 126  TYR A O   1 
ATOM   764  C CB  . TYR A 1 107 ? 22.707 41.497 45.335 1.00 86.74  ? 126  TYR A CB  1 
ATOM   765  C CG  . TYR A 1 107 ? 23.962 42.303 45.584 1.00 90.97  ? 126  TYR A CG  1 
ATOM   766  C CD1 . TYR A 1 107 ? 25.205 41.685 45.672 1.00 93.30  ? 126  TYR A CD1 1 
ATOM   767  C CD2 . TYR A 1 107 ? 23.907 43.688 45.732 1.00 93.69  ? 126  TYR A CD2 1 
ATOM   768  C CE1 . TYR A 1 107 ? 26.364 42.422 45.899 1.00 96.56  ? 126  TYR A CE1 1 
ATOM   769  C CE2 . TYR A 1 107 ? 25.058 44.436 45.969 1.00 96.47  ? 126  TYR A CE2 1 
ATOM   770  C CZ  . TYR A 1 107 ? 26.288 43.799 46.047 1.00 106.21 ? 126  TYR A CZ  1 
ATOM   771  O OH  . TYR A 1 107 ? 27.437 44.523 46.276 1.00 110.62 ? 126  TYR A OH  1 
ATOM   772  N N   . ARG A 1 108 ? 20.906 42.761 47.518 1.00 88.66  ? 127  ARG A N   1 
ATOM   773  C CA  . ARG A 1 108 ? 20.557 43.783 48.507 1.00 90.29  ? 127  ARG A CA  1 
ATOM   774  C C   . ARG A 1 108 ? 19.906 43.157 49.751 1.00 93.47  ? 127  ARG A C   1 
ATOM   775  O O   . ARG A 1 108 ? 20.037 43.707 50.846 1.00 93.83  ? 127  ARG A O   1 
ATOM   776  C CB  . ARG A 1 108 ? 19.724 44.945 47.901 1.00 93.12  ? 127  ARG A CB  1 
ATOM   777  C CG  . ARG A 1 108 ? 18.434 44.557 47.162 1.00 102.37 ? 127  ARG A CG  1 
ATOM   778  C CD  . ARG A 1 108 ? 17.252 45.403 47.596 1.00 113.42 ? 127  ARG A CD  1 
ATOM   779  N NE  . ARG A 1 108 ? 16.860 45.105 48.976 1.00 123.13 ? 127  ARG A NE  1 
ATOM   780  C CZ  . ARG A 1 108 ? 15.873 44.282 49.316 1.00 134.04 ? 127  ARG A CZ  1 
ATOM   781  N NH1 . ARG A 1 108 ? 15.604 44.053 50.594 1.00 113.71 ? 127  ARG A NH1 1 
ATOM   782  N NH2 . ARG A 1 108 ? 15.146 43.684 48.380 1.00 123.32 ? 127  ARG A NH2 1 
ATOM   783  N N   . SER A 1 109 ? 19.251 41.984 49.580 1.00 88.73  ? 128  SER A N   1 
ATOM   784  C CA  . SER A 1 109 ? 18.614 41.200 50.643 1.00 88.00  ? 128  SER A CA  1 
ATOM   785  C C   . SER A 1 109 ? 19.705 40.622 51.550 1.00 92.02  ? 128  SER A C   1 
ATOM   786  O O   . SER A 1 109 ? 19.532 40.555 52.769 1.00 92.06  ? 128  SER A O   1 
ATOM   787  C CB  . SER A 1 109 ? 17.786 40.066 50.043 1.00 90.29  ? 128  SER A CB  1 
ATOM   788  O OG  . SER A 1 109 ? 17.131 39.294 51.037 1.00 98.28  ? 128  SER A OG  1 
ATOM   789  N N   . VAL A 1 110 ? 20.829 40.215 50.941 1.00 88.04  ? 129  VAL A N   1 
ATOM   790  C CA  . VAL A 1 110 ? 21.997 39.666 51.622 1.00 87.39  ? 129  VAL A CA  1 
ATOM   791  C C   . VAL A 1 110 ? 22.732 40.803 52.371 1.00 93.59  ? 129  VAL A C   1 
ATOM   792  O O   . VAL A 1 110 ? 23.023 40.653 53.561 1.00 93.48  ? 129  VAL A O   1 
ATOM   793  C CB  . VAL A 1 110 ? 22.883 38.870 50.609 1.00 90.01  ? 129  VAL A CB  1 
ATOM   794  C CG1 . VAL A 1 110 ? 24.358 38.846 50.997 1.00 90.04  ? 129  VAL A CG1 1 
ATOM   795  C CG2 . VAL A 1 110 ? 22.353 37.454 50.418 1.00 88.62  ? 129  VAL A CG2 1 
ATOM   796  N N   . GLN A 1 111 ? 22.968 41.949 51.685 1.00 91.66  ? 130  GLN A N   1 
ATOM   797  C CA  . GLN A 1 111 ? 23.679 43.124 52.211 1.00 93.16  ? 130  GLN A CA  1 
ATOM   798  C C   . GLN A 1 111 ? 22.984 43.845 53.370 1.00 97.35  ? 130  GLN A C   1 
ATOM   799  O O   . GLN A 1 111 ? 23.614 44.082 54.403 1.00 96.60  ? 130  GLN A O   1 
ATOM   800  C CB  . GLN A 1 111 ? 24.053 44.108 51.081 1.00 95.77  ? 130  GLN A CB  1 
ATOM   801  C CG  . GLN A 1 111 ? 25.082 43.569 50.074 1.00 111.87 ? 130  GLN A CG  1 
ATOM   802  C CD  . GLN A 1 111 ? 26.502 43.509 50.594 1.00 130.62 ? 130  GLN A CD  1 
ATOM   803  O OE1 . GLN A 1 111 ? 26.827 42.765 51.529 1.00 124.54 ? 130  GLN A OE1 1 
ATOM   804  N NE2 . GLN A 1 111 ? 27.394 44.248 49.948 1.00 123.91 ? 130  GLN A NE2 1 
ATOM   805  N N   . GLN A 1 112 ? 21.702 44.200 53.197 1.00 94.83  ? 131  GLN A N   1 
ATOM   806  C CA  . GLN A 1 112 ? 20.936 44.898 54.225 1.00 96.11  ? 131  GLN A CA  1 
ATOM   807  C C   . GLN A 1 112 ? 19.707 44.083 54.694 1.00 98.75  ? 131  GLN A C   1 
ATOM   808  O O   . GLN A 1 112 ? 18.646 44.145 54.064 1.00 97.96  ? 131  GLN A O   1 
ATOM   809  C CB  . GLN A 1 112 ? 20.562 46.326 53.769 1.00 99.61  ? 131  GLN A CB  1 
ATOM   810  C CG  . GLN A 1 112 ? 20.051 47.225 54.903 1.00 118.63 ? 131  GLN A CG  1 
ATOM   811  C CD  . GLN A 1 112 ? 19.784 48.661 54.500 1.00 138.61 ? 131  GLN A CD  1 
ATOM   812  O OE1 . GLN A 1 112 ? 20.019 49.093 53.361 1.00 132.45 ? 131  GLN A OE1 1 
ATOM   813  N NE2 . GLN A 1 112 ? 19.289 49.441 55.445 1.00 133.84 ? 131  GLN A NE2 1 
ATOM   814  N N   . PRO A 1 113 ? 19.824 43.325 55.813 1.00 94.66  ? 132  PRO A N   1 
ATOM   815  C CA  . PRO A 1 113 ? 18.660 42.556 56.297 1.00 93.79  ? 132  PRO A CA  1 
ATOM   816  C C   . PRO A 1 113 ? 17.514 43.488 56.712 1.00 99.18  ? 132  PRO A C   1 
ATOM   817  O O   . PRO A 1 113 ? 16.350 43.157 56.480 1.00 98.82  ? 132  PRO A O   1 
ATOM   818  C CB  . PRO A 1 113 ? 19.258 41.636 57.362 1.00 94.68  ? 132  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 113 ? 20.472 42.339 57.831 1.00 99.91  ? 132  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 113 ? 21.005 43.131 56.679 1.00 96.07  ? 132  PRO A CD  1 
ATOM   821  N N   . LEU A 1 114 ? 17.846 44.654 57.316 1.00 97.17  ? 133  LEU A N   1 
ATOM   822  C CA  . LEU A 1 114 ? 16.877 45.661 57.759 1.00 98.70  ? 133  LEU A CA  1 
ATOM   823  C C   . LEU A 1 114 ? 16.529 46.665 56.643 1.00 106.87 ? 133  LEU A C   1 
ATOM   824  O O   . LEU A 1 114 ? 17.016 47.804 56.623 1.00 108.36 ? 133  LEU A O   1 
ATOM   825  C CB  . LEU A 1 114 ? 17.377 46.320 59.063 1.00 99.30  ? 133  LEU A CB  1 
ATOM   826  C CG  . LEU A 1 114 ? 17.359 45.451 60.308 1.00 101.71 ? 133  LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 114 ? 18.224 46.037 61.367 1.00 102.70 ? 133  LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 114 ? 15.952 45.261 60.836 1.00 103.32 ? 133  LEU A CD2 1 
ATOM   829  N N   . ARG A 1 115 ? 15.671 46.216 55.711 1.00 104.60 ? 134  ARG A N   1 
ATOM   830  C CA  . ARG A 1 115 ? 15.177 47.023 54.595 1.00 106.12 ? 134  ARG A CA  1 
ATOM   831  C C   . ARG A 1 115 ? 13.689 47.309 54.865 1.00 113.06 ? 134  ARG A C   1 
ATOM   832  O O   . ARG A 1 115 ? 12.887 47.429 53.933 1.00 112.38 ? 134  ARG A O   1 
ATOM   833  C CB  . ARG A 1 115 ? 15.415 46.373 53.218 1.00 104.81 ? 134  ARG A CB  1 
ATOM   834  C CG  . ARG A 1 115 ? 16.856 46.463 52.717 1.00 114.62 ? 134  ARG A CG  1 
ATOM   835  C CD  . ARG A 1 115 ? 17.187 47.805 52.093 1.00 127.89 ? 134  ARG A CD  1 
ATOM   836  N NE  . ARG A 1 115 ? 18.040 47.665 50.913 1.00 137.46 ? 134  ARG A NE  1 
ATOM   837  C CZ  . ARG A 1 115 ? 18.541 48.686 50.225 1.00 153.07 ? 134  ARG A CZ  1 
ATOM   838  N NH1 . ARG A 1 115 ? 18.297 49.936 50.603 1.00 142.25 ? 134  ARG A NH1 1 
ATOM   839  N NH2 . ARG A 1 115 ? 19.296 48.466 49.157 1.00 138.13 ? 134  ARG A NH2 1 
ATOM   840  N N   . TYR A 1 116 ? 13.346 47.464 56.172 1.00 112.69 ? 135  TYR A N   1 
ATOM   841  C CA  . TYR A 1 116 ? 12.026 47.796 56.728 1.00 115.07 ? 135  TYR A CA  1 
ATOM   842  C C   . TYR A 1 116 ? 11.625 49.215 56.284 1.00 124.32 ? 135  TYR A C   1 
ATOM   843  O O   . TYR A 1 116 ? 10.612 49.750 56.741 1.00 125.79 ? 135  TYR A O   1 
ATOM   844  C CB  . TYR A 1 116 ? 12.080 47.763 58.276 1.00 116.79 ? 135  TYR A CB  1 
ATOM   845  C CG  . TYR A 1 116 ? 12.949 48.856 58.866 1.00 119.92 ? 135  TYR A CG  1 
ATOM   846  C CD1 . TYR A 1 116 ? 12.398 50.066 59.279 1.00 124.50 ? 135  TYR A CD1 1 
ATOM   847  C CD2 . TYR A 1 116 ? 14.329 48.697 58.972 1.00 119.57 ? 135  TYR A CD2 1 
ATOM   848  C CE1 . TYR A 1 116 ? 13.199 51.094 59.769 1.00 126.58 ? 135  TYR A CE1 1 
ATOM   849  C CE2 . TYR A 1 116 ? 15.138 49.719 59.460 1.00 122.02 ? 135  TYR A CE2 1 
ATOM   850  C CZ  . TYR A 1 116 ? 14.568 50.914 59.861 1.00 131.52 ? 135  TYR A CZ  1 
ATOM   851  O OH  . TYR A 1 116 ? 15.359 51.920 60.350 1.00 135.73 ? 135  TYR A OH  1 
ATOM   852  N N   . LEU A 1 117 ? 12.452 49.817 55.403 1.00 123.95 ? 136  LEU A N   1 
ATOM   853  C CA  . LEU A 1 117 ? 12.289 51.132 54.788 1.00 127.75 ? 136  LEU A CA  1 
ATOM   854  C C   . LEU A 1 117 ? 11.417 51.026 53.507 1.00 134.88 ? 136  LEU A C   1 
ATOM   855  O O   . LEU A 1 117 ? 11.444 51.928 52.657 1.00 135.98 ? 136  LEU A O   1 
ATOM   856  C CB  . LEU A 1 117 ? 13.675 51.754 54.489 1.00 128.17 ? 136  LEU A CB  1 
ATOM   857  C CG  . LEU A 1 117 ? 14.596 51.076 53.461 1.00 130.53 ? 136  LEU A CG  1 
ATOM   858  C CD1 . LEU A 1 117 ? 14.806 51.972 52.252 1.00 131.72 ? 136  LEU A CD1 1 
ATOM   859  C CD2 . LEU A 1 117 ? 15.939 50.748 54.080 1.00 132.43 ? 136  LEU A CD2 1 
ATOM   860  N N   . LYS A 1 118 ? 10.681 49.931 53.349 1.00 132.47 ? 137  LYS A N   1 
ATOM   861  C CA  . LYS A 1 118 ? 9.808  49.771 52.182 1.00 133.57 ? 137  LYS A CA  1 
ATOM   862  C C   . LYS A 1 118 ? 10.466 49.290 50.883 1.00 137.15 ? 137  LYS A C   1 
ATOM   863  O O   . LYS A 1 118 ? 9.985  49.575 49.786 1.00 137.02 ? 137  LYS A O   1 
ATOM   864  C CB  . LYS A 1 118 ? 8.991  51.046 51.951 1.00 139.83 ? 137  LYS A CB  1 
ATOM   865  C CG  . LYS A 1 118 ? 7.653  51.065 52.672 1.00 157.05 ? 137  LYS A CG  1 
ATOM   866  C CD  . LYS A 1 118 ? 7.736  50.345 54.008 1.00 165.37 ? 137  LYS A CD  1 
ATOM   867  C CE  . LYS A 1 118 ? 6.391  49.756 54.402 1.00 172.50 ? 137  LYS A CE  1 
ATOM   868  N NZ  . LYS A 1 118 ? 6.308  49.490 55.865 1.00 177.48 ? 137  LYS A NZ  1 
ATOM   869  N N   . TYR A 1 119 ? 11.562 48.554 51.024 1.00 133.22 ? 138  TYR A N   1 
ATOM   870  C CA  . TYR A 1 119 ? 12.276 47.925 49.909 1.00 132.07 ? 138  TYR A CA  1 
ATOM   871  C C   . TYR A 1 119 ? 12.108 46.431 49.601 1.00 134.39 ? 138  TYR A C   1 
ATOM   872  O O   . TYR A 1 119 ? 12.238 46.032 48.441 1.00 133.32 ? 138  TYR A O   1 
ATOM   873  C CB  . TYR A 1 119 ? 13.751 48.253 50.184 1.00 133.64 ? 138  TYR A CB  1 
ATOM   874  C CG  . TYR A 1 119 ? 14.453 48.900 49.009 1.00 137.07 ? 138  TYR A CG  1 
ATOM   875  C CD1 . TYR A 1 119 ? 14.736 50.262 49.006 1.00 141.70 ? 138  TYR A CD1 1 
ATOM   876  C CD2 . TYR A 1 119 ? 14.826 48.152 47.894 1.00 136.56 ? 138  TYR A CD2 1 
ATOM   877  C CE1 . TYR A 1 119 ? 15.382 50.865 47.927 1.00 143.82 ? 138  TYR A CE1 1 
ATOM   878  C CE2 . TYR A 1 119 ? 15.463 48.744 46.805 1.00 138.30 ? 138  TYR A CE2 1 
ATOM   879  C CZ  . TYR A 1 119 ? 15.740 50.103 46.826 1.00 148.86 ? 138  TYR A CZ  1 
ATOM   880  O OH  . TYR A 1 119 ? 16.370 50.699 45.760 1.00 151.08 ? 138  TYR A OH  1 
ATOM   881  N N   . ARG A 1 120 ? 11.865 45.653 50.656 1.00 130.59 ? 139  ARG A N   1 
ATOM   882  C CA  . ARG A 1 120 ? 11.535 44.237 50.570 1.00 128.96 ? 139  ARG A CA  1 
ATOM   883  C C   . ARG A 1 120 ? 10.039 44.127 50.823 1.00 133.15 ? 139  ARG A C   1 
ATOM   884  O O   . ARG A 1 120 ? 9.589  43.769 51.911 1.00 133.04 ? 139  ARG A O   1 
ATOM   885  C CB  . ARG A 1 120 ? 12.312 43.435 51.613 1.00 129.01 ? 139  ARG A CB  1 
ATOM   886  C CG  . ARG A 1 120 ? 12.319 41.936 51.364 1.00 139.60 ? 139  ARG A CG  1 
ATOM   887  C CD  . ARG A 1 120 ? 13.149 41.583 50.140 1.00 148.49 ? 139  ARG A CD  1 
ATOM   888  N NE  . ARG A 1 120 ? 13.982 40.405 50.366 1.00 155.94 ? 139  ARG A NE  1 
ATOM   889  C CZ  . ARG A 1 120 ? 13.652 39.173 49.992 1.00 169.82 ? 139  ARG A CZ  1 
ATOM   890  N NH1 . ARG A 1 120 ? 12.500 38.953 49.372 1.00 154.86 ? 139  ARG A NH1 1 
ATOM   891  N NH2 . ARG A 1 120 ? 14.472 38.161 50.239 1.00 158.80 ? 139  ARG A NH2 1 
ATOM   892  N N   . THR A 1 121 ? 9.285  44.460 49.786 1.00 129.59 ? 140  THR A N   1 
ATOM   893  C CA  . THR A 1 121 ? 7.835  44.672 49.836 1.00 130.67 ? 140  THR A CA  1 
ATOM   894  C C   . THR A 1 121 ? 7.281  44.686 48.393 1.00 133.27 ? 140  THR A C   1 
ATOM   895  O O   . THR A 1 121 ? 8.048  44.871 47.443 1.00 131.88 ? 140  THR A O   1 
ATOM   896  C CB  . THR A 1 121 ? 7.309  45.818 50.741 1.00 141.63 ? 140  THR A CB  1 
ATOM   897  O OG1 . THR A 1 121 ? 5.880  45.793 50.786 1.00 143.65 ? 140  THR A OG1 1 
ATOM   898  C CG2 . THR A 1 121 ? 7.789  47.185 50.302 1.00 140.97 ? 140  THR A CG2 1 
ATOM   899  N N   . LYS A 1 122 ? 5.954  44.479 48.244 1.00 130.14 ? 141  LYS A N   1 
ATOM   900  C CA  . LYS A 1 122 ? 5.231  44.464 46.965 1.00 130.10 ? 141  LYS A CA  1 
ATOM   901  C C   . LYS A 1 122 ? 5.411  45.772 46.191 1.00 133.49 ? 141  LYS A C   1 
ATOM   902  O O   . LYS A 1 122 ? 5.626  45.728 44.983 1.00 132.29 ? 141  LYS A O   1 
ATOM   903  C CB  . LYS A 1 122 ? 3.732  44.190 47.186 1.00 134.43 ? 141  LYS A CB  1 
ATOM   904  C CG  . LYS A 1 122 ? 3.424  42.802 47.740 1.00 145.87 ? 141  LYS A CG  1 
ATOM   905  C CD  . LYS A 1 122 ? 1.951  42.649 48.102 1.00 155.68 ? 141  LYS A CD  1 
ATOM   906  C CE  . LYS A 1 122 ? 1.689  42.836 49.577 1.00 163.46 ? 141  LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 122 ? 0.285  42.497 49.933 1.00 172.74 ? 141  LYS A NZ  1 
ATOM   908  N N   . THR A 1 123 ? 5.357  46.929 46.895 1.00 130.64 ? 142  THR A N   1 
ATOM   909  C CA  . THR A 1 123 ? 5.516  48.270 46.311 1.00 131.48 ? 142  THR A CA  1 
ATOM   910  C C   . THR A 1 123 ? 6.871  48.519 45.622 1.00 131.62 ? 142  THR A C   1 
ATOM   911  O O   . THR A 1 123 ? 6.959  49.393 44.756 1.00 132.28 ? 142  THR A O   1 
ATOM   912  C CB  . THR A 1 123 ? 4.998  49.394 47.250 1.00 143.47 ? 142  THR A CB  1 
ATOM   913  O OG1 . THR A 1 123 ? 5.040  50.646 46.563 1.00 147.15 ? 142  THR A OG1 1 
ATOM   914  C CG2 . THR A 1 123 ? 5.773  49.505 48.558 1.00 140.88 ? 142  THR A CG2 1 
ATOM   915  N N   . ARG A 1 124 ? 7.909  47.738 45.988 1.00 123.94 ? 143  ARG A N   1 
ATOM   916  C CA  . ARG A 1 124 ? 9.246  47.827 45.399 1.00 121.51 ? 143  ARG A CA  1 
ATOM   917  C C   . ARG A 1 124 ? 9.538  46.634 44.472 1.00 121.43 ? 143  ARG A C   1 
ATOM   918  O O   . ARG A 1 124 ? 10.321 46.775 43.527 1.00 120.26 ? 143  ARG A O   1 
ATOM   919  C CB  . ARG A 1 124 ? 10.317 47.963 46.492 1.00 119.91 ? 143  ARG A CB  1 
ATOM   920  C CG  . ARG A 1 124 ? 11.566 48.727 46.058 1.00 128.15 ? 143  ARG A CG  1 
ATOM   921  C CD  . ARG A 1 124 ? 11.360 50.229 46.103 1.00 137.70 ? 143  ARG A CD  1 
ATOM   922  N NE  . ARG A 1 124 ? 12.608 50.959 45.891 1.00 143.13 ? 143  ARG A NE  1 
ATOM   923  C CZ  . ARG A 1 124 ? 12.703 52.284 45.836 1.00 158.52 ? 143  ARG A CZ  1 
ATOM   924  N NH1 . ARG A 1 124 ? 11.619 53.040 45.971 1.00 147.41 ? 143  ARG A NH1 1 
ATOM   925  N NH2 . ARG A 1 124 ? 13.879 52.865 45.643 1.00 146.57 ? 143  ARG A NH2 1 
ATOM   926  N N   . ALA A 1 125 ? 8.903  45.469 44.737 1.00 115.78 ? 144  ALA A N   1 
ATOM   927  C CA  . ALA A 1 125 ? 9.056  44.261 43.926 1.00 113.36 ? 144  ALA A CA  1 
ATOM   928  C C   . ALA A 1 125 ? 8.246  44.395 42.634 1.00 117.69 ? 144  ALA A C   1 
ATOM   929  O O   . ALA A 1 125 ? 8.818  44.246 41.554 1.00 117.22 ? 144  ALA A O   1 
ATOM   930  C CB  . ALA A 1 125 ? 8.619  43.031 44.709 1.00 113.06 ? 144  ALA A CB  1 
ATOM   931  N N   . SER A 1 126 ? 6.930  44.728 42.743 1.00 114.73 ? 145  SER A N   1 
ATOM   932  C CA  . SER A 1 126 ? 6.022  44.913 41.598 1.00 114.94 ? 145  SER A CA  1 
ATOM   933  C C   . SER A 1 126 ? 6.357  46.148 40.742 1.00 118.53 ? 145  SER A C   1 
ATOM   934  O O   . SER A 1 126 ? 5.937  46.213 39.589 1.00 118.65 ? 145  SER A O   1 
ATOM   935  C CB  . SER A 1 126 ? 4.562  44.917 42.042 1.00 119.65 ? 145  SER A CB  1 
ATOM   936  O OG  . SER A 1 126 ? 4.234  43.720 42.730 1.00 126.18 ? 145  SER A OG  1 
ATOM   937  N N   . ALA A 1 127 ? 7.131  47.105 41.294 1.00 114.62 ? 146  ALA A N   1 
ATOM   938  C CA  . ALA A 1 127 ? 7.590  48.296 40.580 1.00 115.31 ? 146  ALA A CA  1 
ATOM   939  C C   . ALA A 1 127 ? 8.745  47.920 39.656 1.00 116.64 ? 146  ALA A C   1 
ATOM   940  O O   . ALA A 1 127 ? 8.859  48.488 38.571 1.00 116.98 ? 146  ALA A O   1 
ATOM   941  C CB  . ALA A 1 127 ? 8.043  49.359 41.564 1.00 117.31 ? 146  ALA A CB  1 
ATOM   942  N N   . THR A 1 128 ? 9.600  46.964 40.090 1.00 110.63 ? 147  THR A N   1 
ATOM   943  C CA  . THR A 1 128 ? 10.745 46.471 39.316 1.00 108.71 ? 147  THR A CA  1 
ATOM   944  C C   . THR A 1 128 ? 10.401 45.292 38.395 1.00 110.87 ? 147  THR A C   1 
ATOM   945  O O   . THR A 1 128 ? 11.167 45.011 37.477 1.00 109.79 ? 147  THR A O   1 
ATOM   946  C CB  . THR A 1 128 ? 12.017 46.303 40.171 1.00 115.21 ? 147  THR A CB  1 
ATOM   947  O OG1 . THR A 1 128 ? 11.693 45.645 41.395 1.00 116.42 ? 147  THR A OG1 1 
ATOM   948  C CG2 . THR A 1 128 ? 12.707 47.632 40.464 1.00 114.31 ? 147  THR A CG2 1 
ATOM   949  N N   . ILE A 1 129 ? 9.246  44.660 38.592 1.00 107.42 ? 148  ILE A N   1 
ATOM   950  C CA  . ILE A 1 129 ? 8.811  43.565 37.717 1.00 106.72 ? 148  ILE A CA  1 
ATOM   951  C C   . ILE A 1 129 ? 7.886  44.044 36.590 1.00 111.70 ? 148  ILE A C   1 
ATOM   952  O O   . ILE A 1 129 ? 7.540  43.283 35.686 1.00 111.27 ? 148  ILE A O   1 
ATOM   953  C CB  . ILE A 1 129 ? 8.100  42.455 38.514 1.00 109.69 ? 148  ILE A CB  1 
ATOM   954  C CG1 . ILE A 1 129 ? 6.822  42.996 39.158 1.00 112.30 ? 148  ILE A CG1 1 
ATOM   955  C CG2 . ILE A 1 129 ? 9.030  41.878 39.570 1.00 108.97 ? 148  ILE A CG2 1 
ATOM   956  C CD1 . ILE A 1 129 ? 5.697  41.987 39.223 1.00 121.97 ? 148  ILE A CD1 1 
ATOM   957  N N   . LEU A 1 130 ? 7.497  45.311 36.665 1.00 109.67 ? 149  LEU A N   1 
ATOM   958  C CA  . LEU A 1 130 ? 6.611  45.966 35.701 1.00 111.21 ? 149  LEU A CA  1 
ATOM   959  C C   . LEU A 1 130 ? 7.536  46.755 34.767 1.00 115.09 ? 149  LEU A C   1 
ATOM   960  O O   . LEU A 1 130 ? 7.392  46.663 33.548 1.00 115.29 ? 149  LEU A O   1 
ATOM   961  C CB  . LEU A 1 130 ? 5.598  46.895 36.396 1.00 113.38 ? 149  LEU A CB  1 
ATOM   962  C CG  . LEU A 1 130 ? 4.437  47.384 35.536 1.00 120.32 ? 149  LEU A CG  1 
ATOM   963  C CD1 . LEU A 1 130 ? 3.114  46.908 36.089 1.00 121.49 ? 149  LEU A CD1 1 
ATOM   964  C CD2 . LEU A 1 130 ? 4.451  48.896 35.412 1.00 124.79 ? 149  LEU A CD2 1 
ATOM   965  N N   . GLY A 1 131 ? 8.516  47.455 35.358 1.00 110.97 ? 150  GLY A N   1 
ATOM   966  C CA  . GLY A 1 131 ? 9.538  48.227 34.658 1.00 110.88 ? 150  GLY A CA  1 
ATOM   967  C C   . GLY A 1 131 ? 10.463 47.366 33.817 1.00 112.18 ? 150  GLY A C   1 
ATOM   968  O O   . GLY A 1 131 ? 10.995 47.839 32.806 1.00 112.82 ? 150  GLY A O   1 
ATOM   969  N N   . ALA A 1 132 ? 10.652 46.087 34.224 1.00 105.48 ? 151  ALA A N   1 
ATOM   970  C CA  . ALA A 1 132 ? 11.458 45.103 33.497 1.00 103.24 ? 151  ALA A CA  1 
ATOM   971  C C   . ALA A 1 132 ? 10.739 44.688 32.210 1.00 105.90 ? 151  ALA A C   1 
ATOM   972  O O   . ALA A 1 132 ? 11.401 44.499 31.190 1.00 105.40 ? 151  ALA A O   1 
ATOM   973  C CB  . ALA A 1 132 ? 11.732 43.886 34.365 1.00 102.17 ? 151  ALA A CB  1 
ATOM   974  N N   . TRP A 1 133 ? 9.391  44.587 32.244 1.00 101.81 ? 152  TRP A N   1 
ATOM   975  C CA  . TRP A 1 133 ? 8.589  44.250 31.066 1.00 102.00 ? 152  TRP A CA  1 
ATOM   976  C C   . TRP A 1 133 ? 8.470  45.419 30.075 1.00 108.41 ? 152  TRP A C   1 
ATOM   977  O O   . TRP A 1 133 ? 8.071  45.205 28.927 1.00 108.29 ? 152  TRP A O   1 
ATOM   978  C CB  . TRP A 1 133 ? 7.217  43.701 31.459 1.00 100.84 ? 152  TRP A CB  1 
ATOM   979  C CG  . TRP A 1 133 ? 7.281  42.322 32.032 1.00 99.86  ? 152  TRP A CG  1 
ATOM   980  C CD1 . TRP A 1 133 ? 7.639  41.982 33.300 1.00 101.74 ? 152  TRP A CD1 1 
ATOM   981  C CD2 . TRP A 1 133 ? 6.985  41.092 31.355 1.00 99.44  ? 152  TRP A CD2 1 
ATOM   982  N NE1 . TRP A 1 133 ? 7.567  40.619 33.466 1.00 100.08 ? 152  TRP A NE1 1 
ATOM   983  C CE2 . TRP A 1 133 ? 7.167  40.046 32.288 1.00 102.05 ? 152  TRP A CE2 1 
ATOM   984  C CE3 . TRP A 1 133 ? 6.580  40.769 30.050 1.00 101.31 ? 152  TRP A CE3 1 
ATOM   985  C CZ2 . TRP A 1 133 ? 6.960  38.699 31.958 1.00 101.08 ? 152  TRP A CZ2 1 
ATOM   986  C CZ3 . TRP A 1 133 ? 6.380  39.434 29.722 1.00 102.50 ? 152  TRP A CZ3 1 
ATOM   987  C CH2 . TRP A 1 133 ? 6.574  38.416 30.668 1.00 102.03 ? 152  TRP A CH2 1 
ATOM   988  N N   . PHE A 1 134 ? 8.835  46.645 30.513 1.00 106.92 ? 153  PHE A N   1 
ATOM   989  C CA  . PHE A 1 134 ? 8.849  47.853 29.685 1.00 109.18 ? 153  PHE A CA  1 
ATOM   990  C C   . PHE A 1 134 ? 10.073 47.809 28.766 1.00 112.72 ? 153  PHE A C   1 
ATOM   991  O O   . PHE A 1 134 ? 9.957  48.146 27.590 1.00 113.05 ? 153  PHE A O   1 
ATOM   992  C CB  . PHE A 1 134 ? 8.850  49.122 30.560 1.00 112.77 ? 153  PHE A CB  1 
ATOM   993  C CG  . PHE A 1 134 ? 9.017  50.437 29.829 1.00 116.93 ? 153  PHE A CG  1 
ATOM   994  C CD1 . PHE A 1 134 ? 7.937  51.041 29.194 1.00 122.30 ? 153  PHE A CD1 1 
ATOM   995  C CD2 . PHE A 1 134 ? 10.246 51.089 29.809 1.00 119.68 ? 153  PHE A CD2 1 
ATOM   996  C CE1 . PHE A 1 134 ? 8.090  52.262 28.526 1.00 125.61 ? 153  PHE A CE1 1 
ATOM   997  C CE2 . PHE A 1 134 ? 10.398 52.312 29.143 1.00 124.92 ? 153  PHE A CE2 1 
ATOM   998  C CZ  . PHE A 1 134 ? 9.319  52.891 28.508 1.00 125.01 ? 153  PHE A CZ  1 
ATOM   999  N N   . LEU A 1 135 ? 11.232 47.375 29.295 1.00 108.36 ? 154  LEU A N   1 
ATOM   1000 C CA  . LEU A 1 135 ? 12.462 47.240 28.516 1.00 108.00 ? 154  LEU A CA  1 
ATOM   1001 C C   . LEU A 1 135 ? 12.425 46.019 27.573 1.00 110.53 ? 154  LEU A C   1 
ATOM   1002 O O   . LEU A 1 135 ? 13.187 45.965 26.603 1.00 109.76 ? 154  LEU A O   1 
ATOM   1003 C CB  . LEU A 1 135 ? 13.686 47.182 29.438 1.00 107.13 ? 154  LEU A CB  1 
ATOM   1004 C CG  . LEU A 1 135 ? 14.696 48.318 29.282 1.00 113.53 ? 154  LEU A CG  1 
ATOM   1005 C CD1 . LEU A 1 135 ? 15.701 48.306 30.412 1.00 112.86 ? 154  LEU A CD1 1 
ATOM   1006 C CD2 . LEU A 1 135 ? 15.425 48.248 27.938 1.00 116.96 ? 154  LEU A CD2 1 
ATOM   1007 N N   . SER A 1 136 ? 11.531 45.054 27.861 1.00 106.58 ? 155  SER A N   1 
ATOM   1008 C CA  . SER A 1 136 ? 11.331 43.835 27.081 1.00 105.99 ? 155  SER A CA  1 
ATOM   1009 C C   . SER A 1 136 ? 10.333 44.046 25.948 1.00 112.25 ? 155  SER A C   1 
ATOM   1010 O O   . SER A 1 136 ? 10.560 43.545 24.845 1.00 111.92 ? 155  SER A O   1 
ATOM   1011 C CB  . SER A 1 136 ? 10.865 42.695 27.978 1.00 108.25 ? 155  SER A CB  1 
ATOM   1012 O OG  . SER A 1 136 ? 11.882 42.341 28.898 1.00 115.94 ? 155  SER A OG  1 
ATOM   1013 N N   . PHE A 1 137 ? 9.231  44.784 26.212 1.00 110.79 ? 156  PHE A N   1 
ATOM   1014 C CA  . PHE A 1 137 ? 8.206  45.078 25.208 1.00 112.53 ? 156  PHE A CA  1 
ATOM   1015 C C   . PHE A 1 137 ? 8.652  46.087 24.149 1.00 118.29 ? 156  PHE A C   1 
ATOM   1016 O O   . PHE A 1 137 ? 7.935  46.289 23.166 1.00 119.28 ? 156  PHE A O   1 
ATOM   1017 C CB  . PHE A 1 137 ? 6.869  45.483 25.846 1.00 115.59 ? 156  PHE A CB  1 
ATOM   1018 C CG  . PHE A 1 137 ? 5.835  44.383 25.812 1.00 117.16 ? 156  PHE A CG  1 
ATOM   1019 C CD1 . PHE A 1 137 ? 5.280  43.965 24.609 1.00 121.31 ? 156  PHE A CD1 1 
ATOM   1020 C CD2 . PHE A 1 137 ? 5.404  43.776 26.983 1.00 118.47 ? 156  PHE A CD2 1 
ATOM   1021 C CE1 . PHE A 1 137 ? 4.329  42.941 24.577 1.00 122.44 ? 156  PHE A CE1 1 
ATOM   1022 C CE2 . PHE A 1 137 ? 4.442  42.760 26.950 1.00 121.49 ? 156  PHE A CE2 1 
ATOM   1023 C CZ  . PHE A 1 137 ? 3.915  42.347 25.747 1.00 120.65 ? 156  PHE A CZ  1 
ATOM   1024 N N   . LEU A 1 138 ? 9.851  46.688 24.324 1.00 115.14 ? 157  LEU A N   1 
ATOM   1025 C CA  . LEU A 1 138 ? 10.451 47.622 23.371 1.00 116.76 ? 157  LEU A CA  1 
ATOM   1026 C C   . LEU A 1 138 ? 10.821 46.903 22.068 1.00 121.81 ? 157  LEU A C   1 
ATOM   1027 O O   . LEU A 1 138 ? 11.051 47.562 21.056 1.00 122.92 ? 157  LEU A O   1 
ATOM   1028 C CB  . LEU A 1 138 ? 11.696 48.302 23.969 1.00 116.73 ? 157  LEU A CB  1 
ATOM   1029 C CG  . LEU A 1 138 ? 11.457 49.472 24.927 1.00 122.67 ? 157  LEU A CG  1 
ATOM   1030 C CD1 . LEU A 1 138 ? 12.720 49.811 25.689 1.00 122.37 ? 157  LEU A CD1 1 
ATOM   1031 C CD2 . LEU A 1 138 ? 10.950 50.709 24.196 1.00 127.86 ? 157  LEU A CD2 1 
ATOM   1032 N N   . TRP A 1 139 ? 10.855 45.550 22.097 1.00 117.56 ? 158  TRP A N   1 
ATOM   1033 C CA  . TRP A 1 139 ? 11.157 44.678 20.960 1.00 117.28 ? 158  TRP A CA  1 
ATOM   1034 C C   . TRP A 1 139 ? 10.111 44.745 19.856 1.00 122.78 ? 158  TRP A C   1 
ATOM   1035 O O   . TRP A 1 139 ? 10.450 44.514 18.697 1.00 122.85 ? 158  TRP A O   1 
ATOM   1036 C CB  . TRP A 1 139 ? 11.365 43.233 21.423 1.00 114.19 ? 158  TRP A CB  1 
ATOM   1037 C CG  . TRP A 1 139 ? 12.765 42.992 21.874 1.00 113.94 ? 158  TRP A CG  1 
ATOM   1038 C CD1 . TRP A 1 139 ? 13.253 43.134 23.138 1.00 115.90 ? 158  TRP A CD1 1 
ATOM   1039 C CD2 . TRP A 1 139 ? 13.892 42.713 21.037 1.00 113.90 ? 158  TRP A CD2 1 
ATOM   1040 N NE1 . TRP A 1 139 ? 14.610 42.912 23.149 1.00 114.91 ? 158  TRP A NE1 1 
ATOM   1041 C CE2 . TRP A 1 139 ? 15.029 42.650 21.870 1.00 117.00 ? 158  TRP A CE2 1 
ATOM   1042 C CE3 . TRP A 1 139 ? 14.050 42.492 19.660 1.00 116.03 ? 158  TRP A CE3 1 
ATOM   1043 C CZ2 . TRP A 1 139 ? 16.306 42.361 21.374 1.00 116.36 ? 158  TRP A CZ2 1 
ATOM   1044 C CZ3 . TRP A 1 139 ? 15.317 42.223 19.169 1.00 117.50 ? 158  TRP A CZ3 1 
ATOM   1045 C CH2 . TRP A 1 139 ? 16.422 42.139 20.023 1.00 117.28 ? 158  TRP A CH2 1 
ATOM   1046 N N   . VAL A 1 140 ? 8.851  45.074 20.214 1.00 120.31 ? 159  VAL A N   1 
ATOM   1047 C CA  . VAL A 1 140 ? 7.717  45.209 19.287 1.00 121.87 ? 159  VAL A CA  1 
ATOM   1048 C C   . VAL A 1 140 ? 7.949  46.401 18.312 1.00 127.57 ? 159  VAL A C   1 
ATOM   1049 O O   . VAL A 1 140 ? 7.488  46.350 17.165 1.00 128.38 ? 159  VAL A O   1 
ATOM   1050 C CB  . VAL A 1 140 ? 6.352  45.264 20.041 1.00 126.37 ? 159  VAL A CB  1 
ATOM   1051 C CG1 . VAL A 1 140 ? 5.173  45.142 19.080 1.00 128.07 ? 159  VAL A CG1 1 
ATOM   1052 C CG2 . VAL A 1 140 ? 6.265  44.171 21.100 1.00 124.37 ? 159  VAL A CG2 1 
ATOM   1053 N N   . ILE A 1 141 ? 8.718  47.430 18.755 1.00 124.24 ? 160  ILE A N   1 
ATOM   1054 C CA  . ILE A 1 141 ? 9.091  48.598 17.947 1.00 125.91 ? 160  ILE A CA  1 
ATOM   1055 C C   . ILE A 1 141 ? 9.971  48.183 16.730 1.00 131.14 ? 160  ILE A C   1 
ATOM   1056 O O   . ILE A 1 141 ? 9.441  48.261 15.619 1.00 132.22 ? 160  ILE A O   1 
ATOM   1057 C CB  . ILE A 1 141 ? 9.641  49.787 18.799 1.00 129.26 ? 160  ILE A CB  1 
ATOM   1058 C CG1 . ILE A 1 141 ? 8.611  50.293 19.845 1.00 130.19 ? 160  ILE A CG1 1 
ATOM   1059 C CG2 . ILE A 1 141 ? 10.215 50.925 17.945 1.00 131.56 ? 160  ILE A CG2 1 
ATOM   1060 C CD1 . ILE A 1 141 ? 7.199  50.735 19.325 1.00 140.38 ? 160  ILE A CD1 1 
ATOM   1061 N N   . PRO A 1 142 ? 11.223 47.640 16.867 1.00 127.05 ? 161  PRO A N   1 
ATOM   1062 C CA  . PRO A 1 142 ? 11.978 47.225 15.665 1.00 127.46 ? 161  PRO A CA  1 
ATOM   1063 C C   . PRO A 1 142 ? 11.392 46.045 14.867 1.00 132.24 ? 161  PRO A C   1 
ATOM   1064 O O   . PRO A 1 142 ? 11.943 45.692 13.823 1.00 132.49 ? 161  PRO A O   1 
ATOM   1065 C CB  . PRO A 1 142 ? 13.386 46.932 16.207 1.00 127.91 ? 161  PRO A CB  1 
ATOM   1066 C CG  . PRO A 1 142 ? 13.435 47.591 17.556 1.00 131.76 ? 161  PRO A CG  1 
ATOM   1067 C CD  . PRO A 1 142 ? 12.046 47.441 18.077 1.00 126.98 ? 161  PRO A CD  1 
ATOM   1068 N N   . ILE A 1 143 ? 10.265 45.459 15.329 1.00 129.04 ? 162  ILE A N   1 
ATOM   1069 C CA  . ILE A 1 143 ? 9.563  44.381 14.623 1.00 129.47 ? 162  ILE A CA  1 
ATOM   1070 C C   . ILE A 1 143 ? 8.765  44.980 13.442 1.00 137.60 ? 162  ILE A C   1 
ATOM   1071 O O   . ILE A 1 143 ? 8.681  44.357 12.377 1.00 138.15 ? 162  ILE A O   1 
ATOM   1072 C CB  . ILE A 1 143 ? 8.726  43.497 15.607 1.00 131.26 ? 162  ILE A CB  1 
ATOM   1073 C CG1 . ILE A 1 143 ? 9.617  42.494 16.402 1.00 129.55 ? 162  ILE A CG1 1 
ATOM   1074 C CG2 . ILE A 1 143 ? 7.517  42.800 14.961 1.00 132.89 ? 162  ILE A CG2 1 
ATOM   1075 C CD1 . ILE A 1 143 ? 10.557 41.517 15.606 1.00 135.30 ? 162  ILE A CD1 1 
ATOM   1076 N N   . LEU A 1 144 ? 8.238  46.214 13.619 1.00 136.59 ? 163  LEU A N   1 
ATOM   1077 C CA  . LEU A 1 144 ? 7.487  46.961 12.596 1.00 139.08 ? 163  LEU A CA  1 
ATOM   1078 C C   . LEU A 1 144 ? 8.312  48.088 11.907 1.00 145.09 ? 163  LEU A C   1 
ATOM   1079 O O   . LEU A 1 144 ? 7.794  48.782 11.029 1.00 146.46 ? 163  LEU A O   1 
ATOM   1080 C CB  . LEU A 1 144 ? 6.149  47.495 13.169 1.00 140.16 ? 163  LEU A CB  1 
ATOM   1081 C CG  . LEU A 1 144 ? 6.205  48.407 14.408 1.00 144.45 ? 163  LEU A CG  1 
ATOM   1082 C CD1 . LEU A 1 144 ? 6.023  49.866 14.026 1.00 146.97 ? 163  LEU A CD1 1 
ATOM   1083 C CD2 . LEU A 1 144 ? 5.142  48.014 15.414 1.00 145.76 ? 163  LEU A CD2 1 
ATOM   1084 N N   . GLY A 1 145 ? 9.580  48.229 12.302 1.00 141.62 ? 164  GLY A N   1 
ATOM   1085 C CA  . GLY A 1 145 ? 10.493 49.252 11.802 1.00 143.26 ? 164  GLY A CA  1 
ATOM   1086 C C   . GLY A 1 145 ? 11.399 48.851 10.653 1.00 148.73 ? 164  GLY A C   1 
ATOM   1087 O O   . GLY A 1 145 ? 12.503 48.338 10.867 1.00 146.89 ? 164  GLY A O   1 
ATOM   1088 N N   . TRP A 1 146 ? 10.945 49.129 9.424  1.00 148.50 ? 165  TRP A N   1 
ATOM   1089 C CA  . TRP A 1 146 ? 11.684 48.892 8.180  1.00 149.77 ? 165  TRP A CA  1 
ATOM   1090 C C   . TRP A 1 146 ? 12.194 50.229 7.610  1.00 156.18 ? 165  TRP A C   1 
ATOM   1091 O O   . TRP A 1 146 ? 12.963 50.228 6.645  1.00 157.12 ? 165  TRP A O   1 
ATOM   1092 C CB  . TRP A 1 146 ? 10.833 48.136 7.131  1.00 149.30 ? 165  TRP A CB  1 
ATOM   1093 C CG  . TRP A 1 146 ? 9.375  47.998 7.465  1.00 150.75 ? 165  TRP A CG  1 
ATOM   1094 C CD1 . TRP A 1 146 ? 8.724  46.855 7.819  1.00 152.25 ? 165  TRP A CD1 1 
ATOM   1095 C CD2 . TRP A 1 146 ? 8.393  49.048 7.497  1.00 152.21 ? 165  TRP A CD2 1 
ATOM   1096 N NE1 . TRP A 1 146 ? 7.394  47.120 8.059  1.00 152.71 ? 165  TRP A NE1 1 
ATOM   1097 C CE2 . TRP A 1 146 ? 7.164  48.459 7.873  1.00 155.99 ? 165  TRP A CE2 1 
ATOM   1098 C CE3 . TRP A 1 146 ? 8.434  50.435 7.255  1.00 155.64 ? 165  TRP A CE3 1 
ATOM   1099 C CZ2 . TRP A 1 146 ? 5.983  49.205 8.000  1.00 156.91 ? 165  TRP A CZ2 1 
ATOM   1100 C CZ3 . TRP A 1 146 ? 7.264  51.171 7.378  1.00 158.73 ? 165  TRP A CZ3 1 
ATOM   1101 C CH2 . TRP A 1 146 ? 6.057  50.558 7.747  1.00 158.97 ? 165  TRP A CH2 1 
ATOM   1102 N N   . ASN A 1 147 ? 11.776 51.363 8.232  1.00 153.34 ? 166  ASN A N   1 
ATOM   1103 C CA  . ASN A 1 147 ? 12.126 52.745 7.872  1.00 155.46 ? 166  ASN A CA  1 
ATOM   1104 C C   . ASN A 1 147 ? 13.636 53.013 7.860  1.00 160.34 ? 166  ASN A C   1 
ATOM   1105 O O   . ASN A 1 147 ? 14.103 53.805 7.040  1.00 162.19 ? 166  ASN A O   1 
ATOM   1106 C CB  . ASN A 1 147 ? 11.442 53.736 8.819  1.00 154.76 ? 166  ASN A CB  1 
ATOM   1107 C CG  . ASN A 1 147 ? 9.936  53.742 8.751  1.00 169.49 ? 166  ASN A CG  1 
ATOM   1108 O OD1 . ASN A 1 147 ? 9.277  52.727 8.992  1.00 159.10 ? 166  ASN A OD1 1 
ATOM   1109 N ND2 . ASN A 1 147 ? 9.359  54.863 8.353  1.00 162.81 ? 166  ASN A ND2 1 
ATOM   1110 N N   . HIS A 1 148 ? 14.390 52.351 8.765  1.00 155.26 ? 167  HIS A N   1 
ATOM   1111 C CA  . HIS A 1 148 ? 15.844 52.479 8.933  1.00 155.28 ? 167  HIS A CA  1 
ATOM   1112 C C   . HIS A 1 148 ? 16.671 51.866 7.772  1.00 159.43 ? 167  HIS A C   1 
ATOM   1113 O O   . HIS A 1 148 ? 16.103 51.266 6.854  1.00 158.92 ? 167  HIS A O   1 
ATOM   1114 C CB  . HIS A 1 148 ? 16.263 51.884 10.293 1.00 153.67 ? 167  HIS A CB  1 
ATOM   1115 C CG  . HIS A 1 148 ? 17.381 52.622 10.964 1.00 157.82 ? 167  HIS A CG  1 
ATOM   1116 N ND1 . HIS A 1 148 ? 18.676 52.132 10.957 1.00 159.21 ? 167  HIS A ND1 1 
ATOM   1117 C CD2 . HIS A 1 148 ? 17.362 53.794 11.639 1.00 160.96 ? 167  HIS A CD2 1 
ATOM   1118 C CE1 . HIS A 1 148 ? 19.398 53.014 11.629 1.00 159.68 ? 167  HIS A CE1 1 
ATOM   1119 N NE2 . HIS A 1 148 ? 18.653 54.035 12.053 1.00 161.13 ? 167  HIS A NE2 1 
ATOM   1120 N N   . ARG A 1 156 ? 13.576 37.288 2.100  1.00 149.40 ? 175  ARG A N   1 
ATOM   1121 C CA  . ARG A 1 156 ? 12.989 36.127 2.768  1.00 148.48 ? 175  ARG A CA  1 
ATOM   1122 C C   . ARG A 1 156 ? 13.968 34.939 2.842  1.00 153.08 ? 175  ARG A C   1 
ATOM   1123 O O   . ARG A 1 156 ? 14.761 34.740 1.917  1.00 153.63 ? 175  ARG A O   1 
ATOM   1124 C CB  . ARG A 1 156 ? 11.679 35.716 2.075  1.00 149.30 ? 175  ARG A CB  1 
ATOM   1125 C CG  . ARG A 1 156 ? 10.493 36.622 2.396  1.00 156.30 ? 175  ARG A CG  1 
ATOM   1126 C CD  . ARG A 1 156 ? 9.457  36.579 1.291  1.00 164.23 ? 175  ARG A CD  1 
ATOM   1127 N NE  . ARG A 1 156 ? 8.128  36.178 1.766  1.00 170.13 ? 175  ARG A NE  1 
ATOM   1128 C CZ  . ARG A 1 156 ? 7.566  34.994 1.534  1.00 182.88 ? 175  ARG A CZ  1 
ATOM   1129 N NH1 . ARG A 1 156 ? 8.214  34.067 0.839  1.00 171.18 ? 175  ARG A NH1 1 
ATOM   1130 N NH2 . ARG A 1 156 ? 6.351  34.729 1.994  1.00 168.52 ? 175  ARG A NH2 1 
ATOM   1131 N N   . ARG A 1 157 ? 13.909 34.157 3.950  1.00 149.07 ? 176  ARG A N   1 
ATOM   1132 C CA  . ARG A 1 157 ? 14.748 32.969 4.191  1.00 149.25 ? 176  ARG A CA  1 
ATOM   1133 C C   . ARG A 1 157 ? 13.970 31.739 4.728  1.00 154.17 ? 176  ARG A C   1 
ATOM   1134 O O   . ARG A 1 157 ? 12.736 31.773 4.778  1.00 153.67 ? 176  ARG A O   1 
ATOM   1135 C CB  . ARG A 1 157 ? 15.988 33.309 5.039  1.00 147.36 ? 176  ARG A CB  1 
ATOM   1136 C CG  . ARG A 1 157 ? 17.136 33.831 4.195  1.00 157.51 ? 176  ARG A CG  1 
ATOM   1137 C CD  . ARG A 1 157 ? 18.446 33.870 4.947  1.00 165.73 ? 176  ARG A CD  1 
ATOM   1138 N NE  . ARG A 1 157 ? 19.553 34.171 4.039  1.00 176.24 ? 176  ARG A NE  1 
ATOM   1139 C CZ  . ARG A 1 157 ? 20.451 35.132 4.230  1.00 191.29 ? 176  ARG A CZ  1 
ATOM   1140 N NH1 . ARG A 1 157 ? 20.403 35.891 5.319  1.00 177.13 ? 176  ARG A NH1 1 
ATOM   1141 N NH2 . ARG A 1 157 ? 21.415 35.332 3.342  1.00 180.58 ? 176  ARG A NH2 1 
ATOM   1142 N N   . GLU A 1 158 ? 14.688 30.647 5.088  1.00 151.83 ? 177  GLU A N   1 
ATOM   1143 C CA  . GLU A 1 158 ? 14.080 29.395 5.557  1.00 152.33 ? 177  GLU A CA  1 
ATOM   1144 C C   . GLU A 1 158 ? 14.283 29.038 7.052  1.00 155.92 ? 177  GLU A C   1 
ATOM   1145 O O   . GLU A 1 158 ? 14.007 27.899 7.448  1.00 156.09 ? 177  GLU A O   1 
ATOM   1146 C CB  . GLU A 1 158 ? 14.501 28.234 4.647  1.00 155.99 ? 177  GLU A CB  1 
ATOM   1147 C CG  . GLU A 1 158 ? 13.335 27.372 4.206  1.00 167.07 ? 177  GLU A CG  1 
ATOM   1148 C CD  . GLU A 1 158 ? 13.739 26.165 3.386  1.00 188.25 ? 177  GLU A CD  1 
ATOM   1149 O OE1 . GLU A 1 158 ? 14.362 26.352 2.316  1.00 181.05 ? 177  GLU A OE1 1 
ATOM   1150 O OE2 . GLU A 1 158 ? 13.415 25.030 3.804  1.00 184.79 ? 177  GLU A OE2 1 
ATOM   1151 N N   . ASP A 1 159 ? 14.727 30.005 7.884  1.00 151.82 ? 178  ASP A N   1 
ATOM   1152 C CA  . ASP A 1 159 ? 14.932 29.766 9.320  1.00 150.45 ? 178  ASP A CA  1 
ATOM   1153 C C   . ASP A 1 159 ? 13.659 29.922 10.166 1.00 153.43 ? 178  ASP A C   1 
ATOM   1154 O O   . ASP A 1 159 ? 13.320 29.001 10.915 1.00 152.87 ? 178  ASP A O   1 
ATOM   1155 C CB  . ASP A 1 159 ? 16.132 30.551 9.894  1.00 151.31 ? 178  ASP A CB  1 
ATOM   1156 C CG  . ASP A 1 159 ? 16.341 31.943 9.327  1.00 163.27 ? 178  ASP A CG  1 
ATOM   1157 O OD1 . ASP A 1 159 ? 16.043 32.925 10.041 1.00 163.12 ? 178  ASP A OD1 1 
ATOM   1158 O OD2 . ASP A 1 159 ? 16.845 32.051 8.184  1.00 170.22 ? 178  ASP A OD2 1 
ATOM   1159 N N   . LYS A 1 160 ? 12.950 31.070 10.033 1.00 149.39 ? 179  LYS A N   1 
ATOM   1160 C CA  . LYS A 1 160 ? 11.704 31.363 10.761 1.00 148.13 ? 179  LYS A CA  1 
ATOM   1161 C C   . LYS A 1 160 ? 10.736 32.298 9.980  1.00 151.79 ? 179  LYS A C   1 
ATOM   1162 O O   . LYS A 1 160 ? 10.696 32.234 8.748  1.00 152.95 ? 179  LYS A O   1 
ATOM   1163 C CB  . LYS A 1 160 ? 11.988 31.845 12.210 1.00 148.40 ? 179  LYS A CB  1 
ATOM   1164 C CG  . LYS A 1 160 ? 12.784 33.145 12.345 1.00 159.15 ? 179  LYS A CG  1 
ATOM   1165 C CD  . LYS A 1 160 ? 12.681 33.694 13.765 1.00 166.39 ? 179  LYS A CD  1 
ATOM   1166 C CE  . LYS A 1 160 ? 13.029 35.158 13.856 1.00 174.81 ? 179  LYS A CE  1 
ATOM   1167 N NZ  . LYS A 1 160 ? 14.477 35.401 13.643 1.00 183.66 ? 179  LYS A NZ  1 
ATOM   1168 N N   . CYS A 1 161 ? 9.942  33.130 10.698 1.00 146.35 ? 180  CYS A N   1 
ATOM   1169 C CA  . CYS A 1 161 ? 8.991  34.103 10.151 1.00 146.22 ? 180  CYS A CA  1 
ATOM   1170 C C   . CYS A 1 161 ? 9.719  35.255 9.448  1.00 148.76 ? 180  CYS A C   1 
ATOM   1171 O O   . CYS A 1 161 ? 9.126  35.925 8.597  1.00 149.73 ? 180  CYS A O   1 
ATOM   1172 C CB  . CYS A 1 161 ? 8.067  34.617 11.254 1.00 145.48 ? 180  CYS A CB  1 
ATOM   1173 S SG  . CYS A 1 161 ? 6.775  35.753 10.683 1.00 150.54 ? 180  CYS A SG  1 
ATOM   1174 N N   . GLU A 1 162 ? 11.015 35.450 9.795  1.00 142.79 ? 181  GLU A N   1 
ATOM   1175 C CA  . GLU A 1 162 ? 11.956 36.476 9.331  1.00 142.07 ? 181  GLU A CA  1 
ATOM   1176 C C   . GLU A 1 162 ? 11.850 37.741 10.161 1.00 142.17 ? 181  GLU A C   1 
ATOM   1177 O O   . GLU A 1 162 ? 10.808 38.402 10.192 1.00 141.35 ? 181  GLU A O   1 
ATOM   1178 C CB  . GLU A 1 162 ? 11.934 36.717 7.808  1.00 145.68 ? 181  GLU A CB  1 
ATOM   1179 C CG  . GLU A 1 162 ? 13.145 36.158 7.070  1.00 158.80 ? 181  GLU A CG  1 
ATOM   1180 C CD  . GLU A 1 162 ? 13.486 34.701 7.311  1.00 178.60 ? 181  GLU A CD  1 
ATOM   1181 O OE1 . GLU A 1 162 ? 14.558 34.437 7.900  1.00 168.74 ? 181  GLU A OE1 1 
ATOM   1182 O OE2 . GLU A 1 162 ? 12.682 33.824 6.922  1.00 175.10 ? 181  GLU A OE2 1 
ATOM   1183 N N   . THR A 1 163 ? 12.946 38.096 10.827 1.00 136.72 ? 182  THR A N   1 
ATOM   1184 C CA  . THR A 1 163 ? 12.952 39.183 11.810 1.00 135.03 ? 182  THR A CA  1 
ATOM   1185 C C   . THR A 1 163 ? 13.044 40.613 11.260 1.00 138.00 ? 182  THR A C   1 
ATOM   1186 O O   . THR A 1 163 ? 13.295 41.550 12.019 1.00 137.48 ? 182  THR A O   1 
ATOM   1187 C CB  . THR A 1 163 ? 14.079 38.986 12.847 1.00 141.95 ? 182  THR A CB  1 
ATOM   1188 O OG1 . THR A 1 163 ? 14.049 40.056 13.799 1.00 141.02 ? 182  THR A OG1 1 
ATOM   1189 C CG2 . THR A 1 163 ? 15.436 38.961 12.161 1.00 141.08 ? 182  THR A CG2 1 
ATOM   1190 N N   . ASP A 1 164 ? 12.838 40.788 9.959  1.00 134.27 ? 183  ASP A N   1 
ATOM   1191 C CA  . ASP A 1 164 ? 12.827 42.143 9.359  1.00 134.75 ? 183  ASP A CA  1 
ATOM   1192 C C   . ASP A 1 164 ? 14.256 42.758 9.247  1.00 137.58 ? 183  ASP A C   1 
ATOM   1193 O O   . ASP A 1 164 ? 14.500 43.594 8.378  1.00 138.45 ? 183  ASP A O   1 
ATOM   1194 C CB  . ASP A 1 164 ? 11.711 43.028 9.978  1.00 136.47 ? 183  ASP A CB  1 
ATOM   1195 C CG  . ASP A 1 164 ? 11.280 44.243 9.176  1.00 145.03 ? 183  ASP A CG  1 
ATOM   1196 O OD1 . ASP A 1 164 ? 11.831 45.340 9.420  1.00 145.62 ? 183  ASP A OD1 1 
ATOM   1197 O OD2 . ASP A 1 164 ? 10.318 44.123 8.390  1.00 150.23 ? 183  ASP A OD2 1 
ATOM   1198 N N   . PHE A 1 165 ? 15.191 42.331 10.119 1.00 132.22 ? 184  PHE A N   1 
ATOM   1199 C CA  . PHE A 1 165 ? 16.584 42.786 10.154 1.00 132.10 ? 184  PHE A CA  1 
ATOM   1200 C C   . PHE A 1 165 ? 17.642 41.671 10.142 1.00 134.48 ? 184  PHE A C   1 
ATOM   1201 O O   . PHE A 1 165 ? 18.821 41.930 10.395 1.00 134.10 ? 184  PHE A O   1 
ATOM   1202 C CB  . PHE A 1 165 ? 16.740 43.793 11.327 1.00 133.31 ? 184  PHE A CB  1 
ATOM   1203 C CG  . PHE A 1 165 ? 16.122 43.414 12.659 1.00 132.95 ? 184  PHE A CG  1 
ATOM   1204 C CD1 . PHE A 1 165 ? 16.729 42.477 13.486 1.00 134.36 ? 184  PHE A CD1 1 
ATOM   1205 C CD2 . PHE A 1 165 ? 14.970 44.048 13.116 1.00 134.88 ? 184  PHE A CD2 1 
ATOM   1206 C CE1 . PHE A 1 165 ? 16.167 42.142 14.723 1.00 133.42 ? 184  PHE A CE1 1 
ATOM   1207 C CE2 . PHE A 1 165 ? 14.405 43.704 14.350 1.00 135.84 ? 184  PHE A CE2 1 
ATOM   1208 C CZ  . PHE A 1 165 ? 15.008 42.756 15.145 1.00 132.20 ? 184  PHE A CZ  1 
ATOM   1209 N N   . TYR A 1 166 ? 17.212 40.433 9.799  1.00 130.33 ? 185  TYR A N   1 
ATOM   1210 C CA  . TYR A 1 166 ? 18.046 39.227 9.698  1.00 130.07 ? 185  TYR A CA  1 
ATOM   1211 C C   . TYR A 1 166 ? 19.322 39.405 8.868  1.00 134.93 ? 185  TYR A C   1 
ATOM   1212 O O   . TYR A 1 166 ? 20.320 38.726 9.117  1.00 133.84 ? 185  TYR A O   1 
ATOM   1213 C CB  . TYR A 1 166 ? 17.219 38.016 9.216  1.00 131.80 ? 185  TYR A CB  1 
ATOM   1214 C CG  . TYR A 1 166 ? 16.723 38.099 7.787  1.00 135.96 ? 185  TYR A CG  1 
ATOM   1215 C CD1 . TYR A 1 166 ? 17.349 37.386 6.769  1.00 139.62 ? 185  TYR A CD1 1 
ATOM   1216 C CD2 . TYR A 1 166 ? 15.598 38.853 7.458  1.00 137.19 ? 185  TYR A CD2 1 
ATOM   1217 C CE1 . TYR A 1 166 ? 16.893 37.449 5.453  1.00 142.20 ? 185  TYR A CE1 1 
ATOM   1218 C CE2 . TYR A 1 166 ? 15.143 38.937 6.142  1.00 139.83 ? 185  TYR A CE2 1 
ATOM   1219 C CZ  . TYR A 1 166 ? 15.786 38.223 5.145  1.00 148.37 ? 185  TYR A CZ  1 
ATOM   1220 O OH  . TYR A 1 166 ? 15.340 38.288 3.849  1.00 151.43 ? 185  TYR A OH  1 
ATOM   1221 N N   . ASP A 1 167 ? 19.274 40.327 7.886  1.00 133.16 ? 186  ASP A N   1 
ATOM   1222 C CA  . ASP A 1 167 ? 20.376 40.702 6.996  1.00 134.48 ? 186  ASP A CA  1 
ATOM   1223 C C   . ASP A 1 167 ? 21.309 41.715 7.682  1.00 136.90 ? 186  ASP A C   1 
ATOM   1224 O O   . ASP A 1 167 ? 22.496 41.766 7.349  1.00 138.18 ? 186  ASP A O   1 
ATOM   1225 C CB  . ASP A 1 167 ? 19.825 41.296 5.682  1.00 138.07 ? 186  ASP A CB  1 
ATOM   1226 C CG  . ASP A 1 167 ? 20.007 40.415 4.460  1.00 151.03 ? 186  ASP A CG  1 
ATOM   1227 O OD1 . ASP A 1 167 ? 19.482 39.279 4.461  1.00 150.89 ? 186  ASP A OD1 1 
ATOM   1228 O OD2 . ASP A 1 167 ? 20.636 40.878 3.485  1.00 160.01 ? 186  ASP A OD2 1 
ATOM   1229 N N   . VAL A 1 168 ? 20.767 42.525 8.628  1.00 130.02 ? 187  VAL A N   1 
ATOM   1230 C CA  . VAL A 1 168 ? 21.525 43.545 9.362  1.00 128.79 ? 187  VAL A CA  1 
ATOM   1231 C C   . VAL A 1 168 ? 22.366 42.844 10.434 1.00 130.24 ? 187  VAL A C   1 
ATOM   1232 O O   . VAL A 1 168 ? 21.818 42.408 11.449 1.00 128.04 ? 187  VAL A O   1 
ATOM   1233 C CB  . VAL A 1 168 ? 20.626 44.669 9.967  1.00 131.63 ? 187  VAL A CB  1 
ATOM   1234 C CG1 . VAL A 1 168 ? 21.452 45.898 10.321 1.00 132.41 ? 187  VAL A CG1 1 
ATOM   1235 C CG2 . VAL A 1 168 ? 19.483 45.051 9.034  1.00 132.31 ? 187  VAL A CG2 1 
ATOM   1236 N N   . THR A 1 169 ? 23.684 42.703 10.191 1.00 127.08 ? 188  THR A N   1 
ATOM   1237 C CA  . THR A 1 169 ? 24.581 42.047 11.149 1.00 125.45 ? 188  THR A CA  1 
ATOM   1238 C C   . THR A 1 169 ? 25.181 43.008 12.170 1.00 127.69 ? 188  THR A C   1 
ATOM   1239 O O   . THR A 1 169 ? 25.744 42.542 13.158 1.00 126.40 ? 188  THR A O   1 
ATOM   1240 C CB  . THR A 1 169 ? 25.601 41.096 10.496 1.00 135.61 ? 188  THR A CB  1 
ATOM   1241 O OG1 . THR A 1 169 ? 26.586 41.844 9.788  1.00 139.22 ? 188  THR A OG1 1 
ATOM   1242 C CG2 . THR A 1 169 ? 24.951 40.034 9.609  1.00 134.36 ? 188  THR A CG2 1 
ATOM   1243 N N   . TRP A 1 170 ? 25.049 44.336 11.958 1.00 124.15 ? 189  TRP A N   1 
ATOM   1244 C CA  . TRP A 1 170 ? 25.541 45.312 12.936 1.00 123.49 ? 189  TRP A CA  1 
ATOM   1245 C C   . TRP A 1 170 ? 24.541 45.483 14.088 1.00 122.10 ? 189  TRP A C   1 
ATOM   1246 O O   . TRP A 1 170 ? 24.955 45.693 15.228 1.00 120.66 ? 189  TRP A O   1 
ATOM   1247 C CB  . TRP A 1 170 ? 25.960 46.655 12.297 1.00 125.17 ? 189  TRP A CB  1 
ATOM   1248 C CG  . TRP A 1 170 ? 24.850 47.527 11.772 1.00 126.91 ? 189  TRP A CG  1 
ATOM   1249 C CD1 . TRP A 1 170 ? 24.513 47.719 10.464 1.00 131.43 ? 189  TRP A CD1 1 
ATOM   1250 C CD2 . TRP A 1 170 ? 24.029 48.431 12.534 1.00 126.32 ? 189  TRP A CD2 1 
ATOM   1251 N NE1 . TRP A 1 170 ? 23.496 48.644 10.366 1.00 131.34 ? 189  TRP A NE1 1 
ATOM   1252 C CE2 . TRP A 1 170 ? 23.173 49.090 11.622 1.00 131.61 ? 189  TRP A CE2 1 
ATOM   1253 C CE3 . TRP A 1 170 ? 23.908 48.722 13.907 1.00 126.19 ? 189  TRP A CE3 1 
ATOM   1254 C CZ2 . TRP A 1 170 ? 22.211 50.021 12.036 1.00 131.03 ? 189  TRP A CZ2 1 
ATOM   1255 C CZ3 . TRP A 1 170 ? 22.949 49.636 14.316 1.00 127.74 ? 189  TRP A CZ3 1 
ATOM   1256 C CH2 . TRP A 1 170 ? 22.117 50.279 13.388 1.00 129.79 ? 189  TRP A CH2 1 
ATOM   1257 N N   . PHE A 1 171 ? 23.229 45.392 13.781 1.00 116.02 ? 190  PHE A N   1 
ATOM   1258 C CA  . PHE A 1 171 ? 22.142 45.486 14.756 1.00 113.30 ? 190  PHE A CA  1 
ATOM   1259 C C   . PHE A 1 171 ? 21.985 44.158 15.496 1.00 113.46 ? 190  PHE A C   1 
ATOM   1260 O O   . PHE A 1 171 ? 21.705 44.167 16.694 1.00 111.08 ? 190  PHE A O   1 
ATOM   1261 C CB  . PHE A 1 171 ? 20.826 45.885 14.071 1.00 115.39 ? 190  PHE A CB  1 
ATOM   1262 C CG  . PHE A 1 171 ? 19.638 46.049 14.993 1.00 115.46 ? 190  PHE A CG  1 
ATOM   1263 C CD1 . PHE A 1 171 ? 19.445 47.230 15.702 1.00 118.92 ? 190  PHE A CD1 1 
ATOM   1264 C CD2 . PHE A 1 171 ? 18.688 45.042 15.116 1.00 115.89 ? 190  PHE A CD2 1 
ATOM   1265 C CE1 . PHE A 1 171 ? 18.338 47.388 16.542 1.00 118.57 ? 190  PHE A CE1 1 
ATOM   1266 C CE2 . PHE A 1 171 ? 17.580 45.202 15.956 1.00 117.48 ? 190  PHE A CE2 1 
ATOM   1267 C CZ  . PHE A 1 171 ? 17.411 46.375 16.660 1.00 115.94 ? 190  PHE A CZ  1 
ATOM   1268 N N   . LYS A 1 172 ? 22.160 43.024 14.780 1.00 109.47 ? 191  LYS A N   1 
ATOM   1269 C CA  . LYS A 1 172 ? 22.083 41.670 15.331 1.00 107.59 ? 191  LYS A CA  1 
ATOM   1270 C C   . LYS A 1 172 ? 23.112 41.452 16.448 1.00 111.00 ? 191  LYS A C   1 
ATOM   1271 O O   . LYS A 1 172 ? 22.816 40.736 17.404 1.00 109.24 ? 191  LYS A O   1 
ATOM   1272 C CB  . LYS A 1 172 ? 22.290 40.622 14.232 1.00 110.77 ? 191  LYS A CB  1 
ATOM   1273 C CG  . LYS A 1 172 ? 21.009 39.990 13.713 1.00 123.48 ? 191  LYS A CG  1 
ATOM   1274 C CD  . LYS A 1 172 ? 21.308 38.618 13.104 1.00 135.11 ? 191  LYS A CD  1 
ATOM   1275 C CE  . LYS A 1 172 ? 20.135 37.971 12.402 1.00 145.97 ? 191  LYS A CE  1 
ATOM   1276 N NZ  . LYS A 1 172 ? 19.083 37.493 13.341 1.00 153.27 ? 191  LYS A NZ  1 
ATOM   1277 N N   . VAL A 1 173 ? 24.311 42.063 16.328 1.00 108.98 ? 192  VAL A N   1 
ATOM   1278 C CA  . VAL A 1 173 ? 25.383 41.948 17.329 1.00 108.63 ? 192  VAL A CA  1 
ATOM   1279 C C   . VAL A 1 173 ? 25.214 42.922 18.491 1.00 111.88 ? 192  VAL A C   1 
ATOM   1280 O O   . VAL A 1 173 ? 25.671 42.631 19.595 1.00 110.32 ? 192  VAL A O   1 
ATOM   1281 C CB  . VAL A 1 173 ? 26.827 41.957 16.753 1.00 114.73 ? 192  VAL A CB  1 
ATOM   1282 C CG1 . VAL A 1 173 ? 27.042 40.810 15.769 1.00 115.22 ? 192  VAL A CG1 1 
ATOM   1283 C CG2 . VAL A 1 173 ? 27.191 43.303 16.124 1.00 116.66 ? 192  VAL A CG2 1 
ATOM   1284 N N   . MET A 1 174 ? 24.570 44.074 18.241 1.00 109.57 ? 193  MET A N   1 
ATOM   1285 C CA  . MET A 1 174 ? 24.321 45.086 19.263 1.00 109.44 ? 193  MET A CA  1 
ATOM   1286 C C   . MET A 1 174 ? 23.200 44.645 20.220 1.00 112.36 ? 193  MET A C   1 
ATOM   1287 O O   . MET A 1 174 ? 23.266 44.958 21.407 1.00 111.37 ? 193  MET A O   1 
ATOM   1288 C CB  . MET A 1 174 ? 24.015 46.441 18.626 1.00 113.55 ? 193  MET A CB  1 
ATOM   1289 C CG  . MET A 1 174 ? 24.447 47.603 19.482 1.00 118.39 ? 193  MET A CG  1 
ATOM   1290 S SD  . MET A 1 174 ? 23.738 49.176 18.943 1.00 125.04 ? 193  MET A SD  1 
ATOM   1291 C CE  . MET A 1 174 ? 22.070 49.030 19.606 1.00 119.89 ? 193  MET A CE  1 
ATOM   1292 N N   . THR A 1 175 ? 22.191 43.905 19.712 1.00 108.61 ? 194  THR A N   1 
ATOM   1293 C CA  . THR A 1 175 ? 21.102 43.368 20.540 1.00 106.61 ? 194  THR A CA  1 
ATOM   1294 C C   . THR A 1 175 ? 21.563 42.094 21.250 1.00 109.10 ? 194  THR A C   1 
ATOM   1295 O O   . THR A 1 175 ? 20.990 41.726 22.276 1.00 107.41 ? 194  THR A O   1 
ATOM   1296 C CB  . THR A 1 175 ? 19.824 43.127 19.734 1.00 112.91 ? 194  THR A CB  1 
ATOM   1297 O OG1 . THR A 1 175 ? 20.102 42.266 18.631 1.00 112.10 ? 194  THR A OG1 1 
ATOM   1298 C CG2 . THR A 1 175 ? 19.162 44.417 19.278 1.00 112.38 ? 194  THR A CG2 1 
ATOM   1299 N N   . ALA A 1 176 ? 22.598 41.424 20.699 1.00 105.70 ? 195  ALA A N   1 
ATOM   1300 C CA  . ALA A 1 176 ? 23.197 40.224 21.276 1.00 104.28 ? 195  ALA A CA  1 
ATOM   1301 C C   . ALA A 1 176 ? 23.882 40.590 22.592 1.00 106.88 ? 195  ALA A C   1 
ATOM   1302 O O   . ALA A 1 176 ? 23.747 39.858 23.567 1.00 105.22 ? 195  ALA A O   1 
ATOM   1303 C CB  . ALA A 1 176 ? 24.206 39.623 20.311 1.00 106.32 ? 195  ALA A CB  1 
ATOM   1304 N N   . ILE A 1 177 ? 24.565 41.747 22.636 1.00 103.79 ? 196  ILE A N   1 
ATOM   1305 C CA  . ILE A 1 177 ? 25.245 42.213 23.841 1.00 103.06 ? 196  ILE A CA  1 
ATOM   1306 C C   . ILE A 1 177 ? 24.270 42.892 24.805 1.00 105.21 ? 196  ILE A C   1 
ATOM   1307 O O   . ILE A 1 177 ? 24.150 42.437 25.940 1.00 103.52 ? 196  ILE A O   1 
ATOM   1308 C CB  . ILE A 1 177 ? 26.520 43.040 23.525 1.00 108.25 ? 196  ILE A CB  1 
ATOM   1309 C CG1 . ILE A 1 177 ? 27.523 42.196 22.709 1.00 109.78 ? 196  ILE A CG1 1 
ATOM   1310 C CG2 . ILE A 1 177 ? 27.176 43.565 24.808 1.00 109.17 ? 196  ILE A CG2 1 
ATOM   1311 C CD1 . ILE A 1 177 ? 28.350 42.981 21.707 1.00 119.58 ? 196  ILE A CD1 1 
ATOM   1312 N N   . ILE A 1 178 ? 23.552 43.940 24.345 1.00 101.97 ? 197  ILE A N   1 
ATOM   1313 C CA  . ILE A 1 178 ? 22.568 44.701 25.133 1.00 101.10 ? 197  ILE A CA  1 
ATOM   1314 C C   . ILE A 1 178 ? 21.536 43.811 25.856 1.00 102.00 ? 197  ILE A C   1 
ATOM   1315 O O   . ILE A 1 178 ? 21.268 44.039 27.038 1.00 100.94 ? 197  ILE A O   1 
ATOM   1316 C CB  . ILE A 1 178 ? 21.941 45.872 24.292 1.00 105.93 ? 197  ILE A CB  1 
ATOM   1317 C CG1 . ILE A 1 178 ? 22.904 47.096 24.167 1.00 108.57 ? 197  ILE A CG1 1 
ATOM   1318 C CG2 . ILE A 1 178 ? 20.511 46.281 24.713 1.00 106.02 ? 197  ILE A CG2 1 
ATOM   1319 C CD1 . ILE A 1 178 ? 23.289 47.896 25.500 1.00 114.68 ? 197  ILE A CD1 1 
ATOM   1320 N N   . ASN A 1 179 ? 21.009 42.777 25.172 1.00 96.83  ? 198  ASN A N   1 
ATOM   1321 C CA  . ASN A 1 179 ? 20.013 41.868 25.751 1.00 94.61  ? 198  ASN A CA  1 
ATOM   1322 C C   . ASN A 1 179 ? 20.549 40.548 26.354 1.00 96.45  ? 198  ASN A C   1 
ATOM   1323 O O   . ASN A 1 179 ? 19.799 39.862 27.052 1.00 95.00  ? 198  ASN A O   1 
ATOM   1324 C CB  . ASN A 1 179 ? 18.845 41.637 24.787 1.00 94.18  ? 198  ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 179 ? 18.078 42.896 24.479 1.00 113.01 ? 198  ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 179 ? 17.055 43.194 25.099 1.00 106.63 ? 198  ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 179 ? 18.566 43.679 23.528 1.00 105.12 ? 198  ASN A ND2 1 
ATOM   1328 N N   . PHE A 1 180 ? 21.830 40.199 26.116 1.00 92.61  ? 199  PHE A N   1 
ATOM   1329 C CA  . PHE A 1 180 ? 22.400 38.970 26.671 1.00 91.24  ? 199  PHE A CA  1 
ATOM   1330 C C   . PHE A 1 180 ? 23.798 39.126 27.266 1.00 95.82  ? 199  PHE A C   1 
ATOM   1331 O O   . PHE A 1 180 ? 23.934 38.922 28.466 1.00 94.92  ? 199  PHE A O   1 
ATOM   1332 C CB  . PHE A 1 180 ? 22.299 37.789 25.689 1.00 93.08  ? 199  PHE A CB  1 
ATOM   1333 C CG  . PHE A 1 180 ? 22.787 36.452 26.203 1.00 93.89  ? 199  PHE A CG  1 
ATOM   1334 C CD1 . PHE A 1 180 ? 21.926 35.591 26.875 1.00 95.73  ? 199  PHE A CD1 1 
ATOM   1335 C CD2 . PHE A 1 180 ? 24.095 36.033 25.972 1.00 96.70  ? 199  PHE A CD2 1 
ATOM   1336 C CE1 . PHE A 1 180 ? 22.372 34.347 27.330 1.00 96.32  ? 199  PHE A CE1 1 
ATOM   1337 C CE2 . PHE A 1 180 ? 24.541 34.791 26.430 1.00 99.27  ? 199  PHE A CE2 1 
ATOM   1338 C CZ  . PHE A 1 180 ? 23.676 33.955 27.104 1.00 96.24  ? 199  PHE A CZ  1 
ATOM   1339 N N   . TYR A 1 181 ? 24.827 39.466 26.455 1.00 93.77  ? 200  TYR A N   1 
ATOM   1340 C CA  . TYR A 1 181 ? 26.221 39.603 26.915 1.00 94.38  ? 200  TYR A CA  1 
ATOM   1341 C C   . TYR A 1 181 ? 26.446 40.625 28.035 1.00 96.30  ? 200  TYR A C   1 
ATOM   1342 O O   . TYR A 1 181 ? 27.252 40.371 28.933 1.00 95.07  ? 200  TYR A O   1 
ATOM   1343 C CB  . TYR A 1 181 ? 27.205 39.793 25.743 1.00 98.15  ? 200  TYR A CB  1 
ATOM   1344 C CG  . TYR A 1 181 ? 27.283 38.589 24.827 1.00 101.01 ? 200  TYR A CG  1 
ATOM   1345 C CD1 . TYR A 1 181 ? 28.084 37.495 25.148 1.00 103.56 ? 200  TYR A CD1 1 
ATOM   1346 C CD2 . TYR A 1 181 ? 26.553 38.539 23.642 1.00 101.99 ? 200  TYR A CD2 1 
ATOM   1347 C CE1 . TYR A 1 181 ? 28.149 36.377 24.316 1.00 105.23 ? 200  TYR A CE1 1 
ATOM   1348 C CE2 . TYR A 1 181 ? 26.597 37.420 22.810 1.00 103.29 ? 200  TYR A CE2 1 
ATOM   1349 C CZ  . TYR A 1 181 ? 27.402 36.343 23.149 1.00 111.33 ? 200  TYR A CZ  1 
ATOM   1350 O OH  . TYR A 1 181 ? 27.474 35.242 22.332 1.00 113.24 ? 200  TYR A OH  1 
ATOM   1351 N N   . LEU A 1 182 ? 25.719 41.761 27.991 1.00 92.48  ? 201  LEU A N   1 
ATOM   1352 C CA  . LEU A 1 182 ? 25.779 42.802 29.016 1.00 92.17  ? 201  LEU A CA  1 
ATOM   1353 C C   . LEU A 1 182 ? 25.087 42.308 30.306 1.00 92.38  ? 201  LEU A C   1 
ATOM   1354 O O   . LEU A 1 182 ? 25.799 42.227 31.311 1.00 91.74  ? 201  LEU A O   1 
ATOM   1355 C CB  . LEU A 1 182 ? 25.225 44.155 28.519 1.00 93.73  ? 201  LEU A CB  1 
ATOM   1356 C CG  . LEU A 1 182 ? 25.289 45.333 29.499 1.00 99.78  ? 201  LEU A CG  1 
ATOM   1357 C CD1 . LEU A 1 182 ? 26.620 46.072 29.391 1.00 102.25 ? 201  LEU A CD1 1 
ATOM   1358 C CD2 . LEU A 1 182 ? 24.121 46.289 29.272 1.00 103.41 ? 201  LEU A CD2 1 
ATOM   1359 N N   . PRO A 1 183 ? 23.776 41.893 30.330 1.00 86.29  ? 202  PRO A N   1 
ATOM   1360 C CA  . PRO A 1 183 ? 23.212 41.376 31.593 1.00 83.86  ? 202  PRO A CA  1 
ATOM   1361 C C   . PRO A 1 183 ? 23.954 40.155 32.154 1.00 85.32  ? 202  PRO A C   1 
ATOM   1362 O O   . PRO A 1 183 ? 24.330 40.215 33.318 1.00 84.84  ? 202  PRO A O   1 
ATOM   1363 C CB  . PRO A 1 183 ? 21.739 41.097 31.266 1.00 84.91  ? 202  PRO A CB  1 
ATOM   1364 C CG  . PRO A 1 183 ? 21.667 41.025 29.806 1.00 90.46  ? 202  PRO A CG  1 
ATOM   1365 C CD  . PRO A 1 183 ? 22.749 41.906 29.264 1.00 87.70  ? 202  PRO A CD  1 
ATOM   1366 N N   . THR A 1 184 ? 24.259 39.112 31.332 1.00 80.37  ? 203  THR A N   1 
ATOM   1367 C CA  . THR A 1 184 ? 24.993 37.921 31.796 1.00 79.19  ? 203  THR A CA  1 
ATOM   1368 C C   . THR A 1 184 ? 26.330 38.193 32.481 1.00 83.39  ? 203  THR A C   1 
ATOM   1369 O O   . THR A 1 184 ? 26.733 37.401 33.326 1.00 82.64  ? 203  THR A O   1 
ATOM   1370 C CB  . THR A 1 184 ? 25.074 36.798 30.754 1.00 85.88  ? 203  THR A CB  1 
ATOM   1371 O OG1 . THR A 1 184 ? 25.426 35.605 31.445 1.00 85.26  ? 203  THR A OG1 1 
ATOM   1372 C CG2 . THR A 1 184 ? 26.125 37.052 29.677 1.00 86.89  ? 203  THR A CG2 1 
ATOM   1373 N N   . LEU A 1 185 ? 27.017 39.285 32.118 1.00 81.05  ? 204  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 185 ? 28.290 39.634 32.743 1.00 81.80  ? 204  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 185 ? 28.073 40.364 34.076 1.00 84.75  ? 204  LEU A C   1 
ATOM   1376 O O   . LEU A 1 185 ? 28.758 40.056 35.053 1.00 84.36  ? 204  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 185 ? 29.177 40.440 31.785 1.00 83.94  ? 204  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 185 ? 30.447 39.732 31.308 1.00 89.93  ? 204  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 185 ? 30.150 38.749 30.177 1.00 89.97  ? 204  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 185 ? 31.479 40.738 30.857 1.00 94.76  ? 204  LEU A CD2 1 
ATOM   1381 N N   . LEU A 1 186 ? 27.097 41.302 34.119 1.00 80.58  ? 205  LEU A N   1 
ATOM   1382 C CA  . LEU A 1 186 ? 26.726 42.069 35.316 1.00 79.50  ? 205  LEU A CA  1 
ATOM   1383 C C   . LEU A 1 186 ? 26.049 41.163 36.337 1.00 80.60  ? 205  LEU A C   1 
ATOM   1384 O O   . LEU A 1 186 ? 26.254 41.333 37.537 1.00 80.22  ? 205  LEU A O   1 
ATOM   1385 C CB  . LEU A 1 186 ? 25.796 43.241 34.955 1.00 80.02  ? 205  LEU A CB  1 
ATOM   1386 C CG  . LEU A 1 186 ? 26.416 44.637 34.919 1.00 86.64  ? 205  LEU A CG  1 
ATOM   1387 C CD1 . LEU A 1 186 ? 26.993 44.948 33.540 1.00 88.45  ? 205  LEU A CD1 1 
ATOM   1388 C CD2 . LEU A 1 186 ? 25.392 45.689 35.299 1.00 88.44  ? 205  LEU A CD2 1 
ATOM   1389 N N   . MET A 1 187 ? 25.262 40.192 35.852 1.00 75.58  ? 206  MET A N   1 
ATOM   1390 C CA  . MET A 1 187 ? 24.552 39.197 36.647 1.00 73.93  ? 206  MET A CA  1 
ATOM   1391 C C   . MET A 1 187 ? 25.564 38.330 37.367 1.00 77.96  ? 206  MET A C   1 
ATOM   1392 O O   . MET A 1 187 ? 25.421 38.109 38.568 1.00 76.56  ? 206  MET A O   1 
ATOM   1393 C CB  . MET A 1 187 ? 23.729 38.324 35.718 1.00 75.80  ? 206  MET A CB  1 
ATOM   1394 C CG  . MET A 1 187 ? 22.434 37.885 36.286 1.00 78.40  ? 206  MET A CG  1 
ATOM   1395 S SD  . MET A 1 187 ? 21.403 37.301 34.934 1.00 82.63  ? 206  MET A SD  1 
ATOM   1396 C CE  . MET A 1 187 ? 22.395 35.911 34.319 1.00 79.49  ? 206  MET A CE  1 
ATOM   1397 N N   . LEU A 1 188 ? 26.598 37.858 36.625 1.00 76.09  ? 207  LEU A N   1 
ATOM   1398 C CA  . LEU A 1 188 ? 27.708 37.044 37.128 1.00 76.52  ? 207  LEU A CA  1 
ATOM   1399 C C   . LEU A 1 188 ? 28.508 37.831 38.176 1.00 82.22  ? 207  LEU A C   1 
ATOM   1400 O O   . LEU A 1 188 ? 28.750 37.301 39.260 1.00 81.41  ? 207  LEU A O   1 
ATOM   1401 C CB  . LEU A 1 188 ? 28.617 36.589 35.966 1.00 77.81  ? 207  LEU A CB  1 
ATOM   1402 C CG  . LEU A 1 188 ? 28.587 35.095 35.579 1.00 82.46  ? 207  LEU A CG  1 
ATOM   1403 C CD1 . LEU A 1 188 ? 27.235 34.666 35.009 1.00 81.40  ? 207  LEU A CD1 1 
ATOM   1404 C CD2 . LEU A 1 188 ? 29.661 34.783 34.554 1.00 87.14  ? 207  LEU A CD2 1 
ATOM   1405 N N   . TRP A 1 189 ? 28.847 39.115 37.875 1.00 80.60  ? 208  TRP A N   1 
ATOM   1406 C CA  . TRP A 1 189 ? 29.576 40.045 38.755 1.00 81.58  ? 208  TRP A CA  1 
ATOM   1407 C C   . TRP A 1 189 ? 28.890 40.193 40.119 1.00 82.10  ? 208  TRP A C   1 
ATOM   1408 O O   . TRP A 1 189 ? 29.570 40.154 41.148 1.00 81.98  ? 208  TRP A O   1 
ATOM   1409 C CB  . TRP A 1 189 ? 29.750 41.417 38.068 1.00 82.54  ? 208  TRP A CB  1 
ATOM   1410 C CG  . TRP A 1 189 ? 30.225 42.535 38.957 1.00 85.33  ? 208  TRP A CG  1 
ATOM   1411 C CD1 . TRP A 1 189 ? 29.460 43.516 39.517 1.00 88.40  ? 208  TRP A CD1 1 
ATOM   1412 C CD2 . TRP A 1 189 ? 31.580 42.816 39.339 1.00 87.05  ? 208  TRP A CD2 1 
ATOM   1413 N NE1 . TRP A 1 189 ? 30.250 44.382 40.240 1.00 89.71  ? 208  TRP A NE1 1 
ATOM   1414 C CE2 . TRP A 1 189 ? 31.558 43.980 40.142 1.00 92.23  ? 208  TRP A CE2 1 
ATOM   1415 C CE3 . TRP A 1 189 ? 32.813 42.189 39.092 1.00 89.53  ? 208  TRP A CE3 1 
ATOM   1416 C CZ2 . TRP A 1 189 ? 32.722 44.537 40.691 1.00 93.50  ? 208  TRP A CZ2 1 
ATOM   1417 C CZ3 . TRP A 1 189 ? 33.965 42.743 39.632 1.00 93.01  ? 208  TRP A CZ3 1 
ATOM   1418 C CH2 . TRP A 1 189 ? 33.914 43.900 40.424 1.00 94.64  ? 208  TRP A CH2 1 
ATOM   1419 N N   . PHE A 1 190 ? 27.552 40.340 40.115 1.00 75.86  ? 209  PHE A N   1 
ATOM   1420 C CA  . PHE A 1 190 ? 26.730 40.473 41.318 1.00 74.14  ? 209  PHE A CA  1 
ATOM   1421 C C   . PHE A 1 190 ? 26.647 39.154 42.087 1.00 75.64  ? 209  PHE A C   1 
ATOM   1422 O O   . PHE A 1 190 ? 26.708 39.170 43.317 1.00 74.58  ? 209  PHE A O   1 
ATOM   1423 C CB  . PHE A 1 190 ? 25.324 40.983 40.961 1.00 75.40  ? 209  PHE A CB  1 
ATOM   1424 C CG  . PHE A 1 190 ? 25.169 42.482 40.843 1.00 78.24  ? 209  PHE A CG  1 
ATOM   1425 C CD1 . PHE A 1 190 ? 26.219 43.277 40.395 1.00 83.00  ? 209  PHE A CD1 1 
ATOM   1426 C CD2 . PHE A 1 190 ? 23.956 43.095 41.133 1.00 80.51  ? 209  PHE A CD2 1 
ATOM   1427 C CE1 . PHE A 1 190 ? 26.070 44.660 40.272 1.00 85.53  ? 209  PHE A CE1 1 
ATOM   1428 C CE2 . PHE A 1 190 ? 23.807 44.483 41.010 1.00 84.94  ? 209  PHE A CE2 1 
ATOM   1429 C CZ  . PHE A 1 190 ? 24.862 45.254 40.573 1.00 84.61  ? 209  PHE A CZ  1 
ATOM   1430 N N   . TYR A 1 191 ? 26.520 38.017 41.364 1.00 70.84  ? 210  TYR A N   1 
ATOM   1431 C CA  . TYR A 1 191 ? 26.449 36.683 41.963 1.00 69.22  ? 210  TYR A CA  1 
ATOM   1432 C C   . TYR A 1 191 ? 27.775 36.279 42.606 1.00 73.42  ? 210  TYR A C   1 
ATOM   1433 O O   . TYR A 1 191 ? 27.767 35.663 43.674 1.00 72.30  ? 210  TYR A O   1 
ATOM   1434 C CB  . TYR A 1 191 ? 25.981 35.634 40.948 1.00 69.82  ? 210  TYR A CB  1 
ATOM   1435 C CG  . TYR A 1 191 ? 25.766 34.284 41.589 1.00 70.83  ? 210  TYR A CG  1 
ATOM   1436 C CD1 . TYR A 1 191 ? 24.604 34.010 42.306 1.00 71.85  ? 210  TYR A CD1 1 
ATOM   1437 C CD2 . TYR A 1 191 ? 26.750 33.301 41.539 1.00 72.10  ? 210  TYR A CD2 1 
ATOM   1438 C CE1 . TYR A 1 191 ? 24.417 32.782 42.936 1.00 72.14  ? 210  TYR A CE1 1 
ATOM   1439 C CE2 . TYR A 1 191 ? 26.575 32.070 42.165 1.00 72.62  ? 210  TYR A CE2 1 
ATOM   1440 C CZ  . TYR A 1 191 ? 25.406 31.816 42.865 1.00 79.20  ? 210  TYR A CZ  1 
ATOM   1441 O OH  . TYR A 1 191 ? 25.223 30.602 43.475 1.00 81.98  ? 210  TYR A OH  1 
ATOM   1442 N N   . ALA A 1 192 ? 28.908 36.644 41.965 1.00 71.30  ? 211  ALA A N   1 
ATOM   1443 C CA  . ALA A 1 192 ? 30.267 36.411 42.470 1.00 72.15  ? 211  ALA A CA  1 
ATOM   1444 C C   . ALA A 1 192 ? 30.471 37.194 43.773 1.00 75.95  ? 211  ALA A C   1 
ATOM   1445 O O   . ALA A 1 192 ? 31.363 36.866 44.554 1.00 76.48  ? 211  ALA A O   1 
ATOM   1446 C CB  . ALA A 1 192 ? 31.296 36.840 41.436 1.00 74.57  ? 211  ALA A CB  1 
ATOM   1447 N N   . LYS A 1 193 ? 29.624 38.218 44.007 1.00 71.40  ? 212  LYS A N   1 
ATOM   1448 C CA  . LYS A 1 193 ? 29.604 39.021 45.225 1.00 71.05  ? 212  LYS A CA  1 
ATOM   1449 C C   . LYS A 1 193 ? 28.685 38.359 46.276 1.00 73.03  ? 212  LYS A C   1 
ATOM   1450 O O   . LYS A 1 193 ? 29.037 38.347 47.459 1.00 73.21  ? 212  LYS A O   1 
ATOM   1451 C CB  . LYS A 1 193 ? 29.183 40.469 44.931 1.00 74.03  ? 212  LYS A CB  1 
ATOM   1452 C CG  . LYS A 1 193 ? 30.279 41.309 44.293 1.00 91.23  ? 212  LYS A CG  1 
ATOM   1453 C CD  . LYS A 1 193 ? 29.960 42.798 44.376 1.00 102.48 ? 212  LYS A CD  1 
ATOM   1454 C CE  . LYS A 1 193 ? 31.112 43.670 43.925 1.00 116.60 ? 212  LYS A CE  1 
ATOM   1455 N NZ  . LYS A 1 193 ? 32.257 43.644 44.879 1.00 126.10 ? 212  LYS A NZ  1 
ATOM   1456 N N   . ILE A 1 194 ? 27.523 37.790 45.841 1.00 67.24  ? 213  ILE A N   1 
ATOM   1457 C CA  . ILE A 1 194 ? 26.569 37.067 46.705 1.00 65.02  ? 213  ILE A CA  1 
ATOM   1458 C C   . ILE A 1 194 ? 27.274 35.828 47.280 1.00 70.19  ? 213  ILE A C   1 
ATOM   1459 O O   . ILE A 1 194 ? 27.239 35.620 48.492 1.00 69.62  ? 213  ILE A O   1 
ATOM   1460 C CB  . ILE A 1 194 ? 25.243 36.714 45.960 1.00 66.23  ? 213  ILE A CB  1 
ATOM   1461 C CG1 . ILE A 1 194 ? 24.399 37.968 45.721 1.00 66.24  ? 213  ILE A CG1 1 
ATOM   1462 C CG2 . ILE A 1 194 ? 24.425 35.668 46.715 1.00 65.33  ? 213  ILE A CG2 1 
ATOM   1463 C CD1 . ILE A 1 194 ? 23.406 37.839 44.621 1.00 72.27  ? 213  ILE A CD1 1 
ATOM   1464 N N   . TYR A 1 195 ? 27.952 35.048 46.404 1.00 68.31  ? 214  TYR A N   1 
ATOM   1465 C CA  . TYR A 1 195 ? 28.714 33.847 46.753 1.00 69.12  ? 214  TYR A CA  1 
ATOM   1466 C C   . TYR A 1 195 ? 29.913 34.130 47.669 1.00 75.97  ? 214  TYR A C   1 
ATOM   1467 O O   . TYR A 1 195 ? 30.385 33.215 48.336 1.00 75.49  ? 214  TYR A O   1 
ATOM   1468 C CB  . TYR A 1 195 ? 29.257 33.173 45.484 1.00 71.27  ? 214  TYR A CB  1 
ATOM   1469 C CG  . TYR A 1 195 ? 29.885 31.818 45.730 1.00 74.04  ? 214  TYR A CG  1 
ATOM   1470 C CD1 . TYR A 1 195 ? 29.122 30.656 45.687 1.00 75.60  ? 214  TYR A CD1 1 
ATOM   1471 C CD2 . TYR A 1 195 ? 31.251 31.695 45.979 1.00 76.26  ? 214  TYR A CD2 1 
ATOM   1472 C CE1 . TYR A 1 195 ? 29.694 29.406 45.920 1.00 77.66  ? 214  TYR A CE1 1 
ATOM   1473 C CE2 . TYR A 1 195 ? 31.834 30.451 46.217 1.00 78.08  ? 214  TYR A CE2 1 
ATOM   1474 C CZ  . TYR A 1 195 ? 31.052 29.308 46.184 1.00 86.12  ? 214  TYR A CZ  1 
ATOM   1475 O OH  . TYR A 1 195 ? 31.626 28.080 46.414 1.00 89.30  ? 214  TYR A OH  1 
ATOM   1476 N N   . LYS A 1 196 ? 30.397 35.392 47.699 1.00 75.28  ? 215  LYS A N   1 
ATOM   1477 C CA  . LYS A 1 196 ? 31.511 35.831 48.549 1.00 76.78  ? 215  LYS A CA  1 
ATOM   1478 C C   . LYS A 1 196 ? 31.030 36.248 49.939 1.00 81.83  ? 215  LYS A C   1 
ATOM   1479 O O   . LYS A 1 196 ? 31.850 36.338 50.849 1.00 82.90  ? 215  LYS A O   1 
ATOM   1480 C CB  . LYS A 1 196 ? 32.147 37.133 48.019 1.00 80.41  ? 215  LYS A CB  1 
ATOM   1481 C CG  . LYS A 1 196 ? 33.484 37.493 48.666 1.00 92.87  ? 215  LYS A CG  1 
ATOM   1482 C CD  . LYS A 1 196 ? 33.979 38.869 48.220 1.00 101.90 ? 215  LYS A CD  1 
ATOM   1483 C CE  . LYS A 1 196 ? 35.132 39.364 49.064 1.00 111.43 ? 215  LYS A CE  1 
ATOM   1484 N NZ  . LYS A 1 196 ? 35.600 40.709 48.632 1.00 120.11 ? 215  LYS A NZ  1 
ATOM   1485 N N   . ALA A 1 197 ? 29.709 36.475 50.103 1.00 78.42  ? 216  ALA A N   1 
ATOM   1486 C CA  . ALA A 1 197 ? 29.082 36.898 51.358 1.00 78.73  ? 216  ALA A CA  1 
ATOM   1487 C C   . ALA A 1 197 ? 28.685 35.719 52.255 1.00 85.03  ? 216  ALA A C   1 
ATOM   1488 O O   . ALA A 1 197 ? 28.780 35.832 53.480 1.00 85.20  ? 216  ALA A O   1 
ATOM   1489 C CB  . ALA A 1 197 ? 27.807 37.686 51.120 1.00 78.75  ? 216  ALA A CB  1 
ATOM   1490 N N   . VAL A 1 198 ? 28.245 34.599 51.655 1.00 83.24  ? 217  VAL A N   1 
ATOM   1491 C CA  . VAL A 1 198 ? 27.795 33.395 52.375 1.00 83.48  ? 217  VAL A CA  1 
ATOM   1492 C C   . VAL A 1 198 ? 28.707 32.181 52.056 1.00 90.24  ? 217  VAL A C   1 
ATOM   1493 O O   . VAL A 1 198 ? 28.212 31.067 51.849 1.00 89.77  ? 217  VAL A O   1 
ATOM   1494 C CB  . VAL A 1 198 ? 26.272 33.077 52.239 1.00 86.13  ? 217  VAL A CB  1 
ATOM   1495 C CG1 . VAL A 1 198 ? 25.439 33.950 53.175 1.00 85.74  ? 217  VAL A CG1 1 
ATOM   1496 C CG2 . VAL A 1 198 ? 25.786 33.199 50.794 1.00 85.47  ? 217  VAL A CG2 1 
ATOM   1497 N N   . ARG A 1 199 ? 30.025 32.387 52.123 1.00 89.04  ? 218  ARG A N   1 
ATOM   1498 C CA  . ARG A 1 199 ? 30.994 31.325 51.815 1.00 90.11  ? 218  ARG A CA  1 
ATOM   1499 C C   . ARG A 1 199 ? 32.071 30.993 52.876 1.00 95.81  ? 218  ARG A C   1 
ATOM   1500 O O   . ARG A 1 199 ? 33.194 31.492 52.814 1.00 97.72  ? 218  ARG A O   1 
ATOM   1501 C CB  . ARG A 1 199 ? 31.673 31.610 50.471 1.00 90.67  ? 218  ARG A CB  1 
ATOM   1502 C CG  . ARG A 1 199 ? 32.858 30.707 50.170 1.00 102.78 ? 218  ARG A CG  1 
ATOM   1503 C CD  . ARG A 1 199 ? 33.967 31.468 49.461 1.00 116.84 ? 218  ARG A CD  1 
ATOM   1504 N NE  . ARG A 1 199 ? 34.170 30.992 48.096 1.00 126.65 ? 218  ARG A NE  1 
ATOM   1505 C CZ  . ARG A 1 199 ? 34.755 31.702 47.137 1.00 138.70 ? 218  ARG A CZ  1 
ATOM   1506 N NH1 . ARG A 1 199 ? 35.199 32.926 47.392 1.00 125.33 ? 218  ARG A NH1 1 
ATOM   1507 N NH2 . ARG A 1 199 ? 34.898 31.189 45.923 1.00 124.05 ? 218  ARG A NH2 1 
ATOM   1508 N N   . GLN A 1 200 ? 31.656 30.068 53.750 1.00 90.42  ? 219  GLN A N   1 
ATOM   1509 C CA  . GLN A 1 200 ? 32.450 29.424 54.784 1.00 89.99  ? 219  GLN A CA  1 
ATOM   1510 C C   . GLN A 1 200 ? 32.336 27.909 54.604 1.00 91.31  ? 219  GLN A C   1 
ATOM   1511 O O   . GLN A 1 200 ? 33.226 27.275 54.061 1.00 92.51  ? 219  GLN A O   1 
ATOM   1512 C CB  . GLN A 1 200 ? 31.892 29.823 56.146 1.00 90.43  ? 219  GLN A CB  1 
ATOM   1513 C CG  . GLN A 1 200 ? 32.761 29.447 57.299 1.00 101.93 ? 219  GLN A CG  1 
ATOM   1514 C CD  . GLN A 1 200 ? 34.094 29.000 56.834 1.00 117.76 ? 219  GLN A CD  1 
ATOM   1515 O OE1 . GLN A 1 200 ? 34.192 28.197 55.928 1.00 110.23 ? 219  GLN A OE1 1 
ATOM   1516 N NE2 . GLN A 1 200 ? 35.139 29.534 57.429 1.00 111.98 ? 219  GLN A NE2 1 
ATOM   1517 N N   . HIS A 1 201 ? 31.205 27.361 55.049 1.00 83.56  ? 220  HIS A N   1 
ATOM   1518 C CA  . HIS A 1 201 ? 30.851 25.923 55.068 1.00 81.21  ? 220  HIS A CA  1 
ATOM   1519 C C   . HIS A 1 201 ? 31.714 25.079 55.959 1.00 77.13  ? 220  HIS A C   1 
ATOM   1520 O O   . HIS A 1 201 ? 32.017 23.925 55.743 1.00 77.12  ? 220  HIS A O   1 
ATOM   1521 C CB  . HIS A 1 201 ? 30.618 25.348 53.692 1.00 82.79  ? 220  HIS A CB  1 
ATOM   1522 C CG  . HIS A 1 201 ? 29.454 25.972 53.009 1.00 85.42  ? 220  HIS A CG  1 
ATOM   1523 N ND1 . HIS A 1 201 ? 28.401 25.433 52.359 1.00 87.25  ? 220  HIS A ND1 1 
ATOM   1524 C CD2 . HIS A 1 201 ? 29.265 27.331 52.987 1.00 86.57  ? 220  HIS A CD2 1 
ATOM   1525 C CE1 . HIS A 1 201 ? 27.610 26.472 51.946 1.00 85.94  ? 220  HIS A CE1 1 
ATOM   1526 N NE2 . HIS A 1 201 ? 28.153 27.607 52.338 1.00 85.22  ? 220  HIS A NE2 1 
ATOM   1527 N N   . CYS A 1 202 ? 32.083 25.728 57.017 1.00 67.01  ? 221  CYS A N   1 
ATOM   1528 C CA  . CYS A 1 202 ? 32.646 25.048 58.177 1.00 64.64  ? 221  CYS A CA  1 
ATOM   1529 C C   . CYS A 1 202 ? 33.580 23.874 57.905 1.00 60.38  ? 221  CYS A C   1 
ATOM   1530 O O   . CYS A 1 202 ? 33.809 23.472 56.764 1.00 59.93  ? 221  CYS A O   1 
ATOM   1531 C CB  . CYS A 1 202 ? 31.522 24.599 59.117 1.00 64.27  ? 221  CYS A CB  1 
ATOM   1532 S SG  . CYS A 1 202 ? 31.431 25.524 60.667 1.00 67.56  ? 221  CYS A SG  1 
ATOM   1533 N N   . ASN A 1 203 ? 34.107 23.340 59.001 1.00 45.79  ? 1002 ASN A N   1 
ATOM   1534 C CA  . ASN A 1 203 ? 34.985 22.236 59.008 1.00 42.34  ? 1002 ASN A CA  1 
ATOM   1535 C C   . ASN A 1 203 ? 34.972 21.892 60.433 1.00 39.53  ? 1002 ASN A C   1 
ATOM   1536 O O   . ASN A 1 203 ? 34.211 22.408 61.162 1.00 39.40  ? 1002 ASN A O   1 
ATOM   1537 C CB  . ASN A 1 203 ? 36.412 22.472 58.499 1.00 41.64  ? 1002 ASN A CB  1 
ATOM   1538 C CG  . ASN A 1 203 ? 37.044 23.771 58.970 1.00 54.35  ? 1002 ASN A CG  1 
ATOM   1539 O OD1 . ASN A 1 203 ? 37.700 23.809 59.970 1.00 43.76  ? 1002 ASN A OD1 1 
ATOM   1540 N ND2 . ASN A 1 203 ? 36.904 24.803 58.198 1.00 48.98  ? 1002 ASN A ND2 1 
ATOM   1541 N N   . ILE A 1 204 ? 35.819 20.987 60.817 1.00 30.16  ? 1003 ILE A N   1 
ATOM   1542 C CA  . ILE A 1 204 ? 35.869 20.397 62.148 1.00 25.78  ? 1003 ILE A CA  1 
ATOM   1543 C C   . ILE A 1 204 ? 36.513 21.387 63.122 1.00 27.93  ? 1003 ILE A C   1 
ATOM   1544 O O   . ILE A 1 204 ? 36.071 21.459 64.271 1.00 28.45  ? 1003 ILE A O   1 
ATOM   1545 C CB  . ILE A 1 204 ? 36.482 18.971 62.172 1.00 27.50  ? 1003 ILE A CB  1 
ATOM   1546 C CG1 . ILE A 1 204 ? 36.299 18.285 63.523 1.00 25.37  ? 1003 ILE A CG1 1 
ATOM   1547 C CG2 . ILE A 1 204 ? 37.930 18.955 61.695 1.00 28.77  ? 1003 ILE A CG2 1 
ATOM   1548 C CD1 . ILE A 1 204 ? 36.471 16.871 63.478 1.00 29.89  ? 1003 ILE A CD1 1 
ATOM   1549 N N   . PHE A 1 205 ? 37.547 22.142 62.692 1.00 22.19  ? 1004 PHE A N   1 
ATOM   1550 C CA  . PHE A 1 205 ? 38.199 23.119 63.578 1.00 19.84  ? 1004 PHE A CA  1 
ATOM   1551 C C   . PHE A 1 205 ? 37.221 24.217 63.928 1.00 22.79  ? 1004 PHE A C   1 
ATOM   1552 O O   . PHE A 1 205 ? 37.143 24.621 65.084 1.00 20.83  ? 1004 PHE A O   1 
ATOM   1553 C CB  . PHE A 1 205 ? 39.464 23.701 62.933 1.00 21.27  ? 1004 PHE A CB  1 
ATOM   1554 C CG  . PHE A 1 205 ? 40.030 24.927 63.611 1.00 20.77  ? 1004 PHE A CG  1 
ATOM   1555 C CD1 . PHE A 1 205 ? 40.813 24.811 64.755 1.00 22.32  ? 1004 PHE A CD1 1 
ATOM   1556 C CD2 . PHE A 1 205 ? 39.809 26.193 63.089 1.00 22.00  ? 1004 PHE A CD2 1 
ATOM   1557 C CE1 . PHE A 1 205 ? 41.350 25.942 65.367 1.00 22.07  ? 1004 PHE A CE1 1 
ATOM   1558 C CE2 . PHE A 1 205 ? 40.333 27.323 63.711 1.00 24.04  ? 1004 PHE A CE2 1 
ATOM   1559 C CZ  . PHE A 1 205 ? 41.099 27.191 64.846 1.00 20.89  ? 1004 PHE A CZ  1 
ATOM   1560 N N   . GLU A 1 206 ? 36.455 24.669 62.926 1.00 20.06  ? 1005 GLU A N   1 
ATOM   1561 C CA  . GLU A 1 206 ? 35.450 25.693 63.093 1.00 19.76  ? 1005 GLU A CA  1 
ATOM   1562 C C   . GLU A 1 206 ? 34.333 25.208 63.977 1.00 21.92  ? 1005 GLU A C   1 
ATOM   1563 O O   . GLU A 1 206 ? 33.923 25.955 64.850 1.00 21.99  ? 1005 GLU A O   1 
ATOM   1564 C CB  . GLU A 1 206 ? 34.964 26.188 61.742 1.00 22.98  ? 1005 GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 206 ? 36.051 26.893 60.931 1.00 36.97  ? 1005 GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 206 ? 36.705 28.113 61.565 1.00 62.69  ? 1005 GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 206 ? 35.990 28.933 62.189 1.00 62.75  ? 1005 GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 206 ? 37.942 28.255 61.421 1.00 54.58  ? 1005 GLU A OE2 1 
ATOM   1569 N N   . MET A 1 207 ? 33.932 23.921 63.838 1.00 17.80  ? 1006 MET A N   1 
ATOM   1570 C CA  . MET A 1 207 ? 32.911 23.203 64.633 1.00 16.01  ? 1006 MET A CA  1 
ATOM   1571 C C   . MET A 1 207 ? 33.310 23.177 66.135 1.00 16.66  ? 1006 MET A C   1 
ATOM   1572 O O   . MET A 1 207 ? 32.558 23.668 66.977 1.00 17.84  ? 1006 MET A O   1 
ATOM   1573 C CB  . MET A 1 207 ? 32.747 21.768 64.079 1.00 18.49  ? 1006 MET A CB  1 
ATOM   1574 C CG  . MET A 1 207 ? 31.539 21.027 64.594 1.00 22.19  ? 1006 MET A CG  1 
ATOM   1575 S SD  . MET A 1 207 ? 31.786 19.222 64.715 1.00 26.91  ? 1006 MET A SD  1 
ATOM   1576 C CE  . MET A 1 207 ? 30.166 18.659 64.510 1.00 24.25  ? 1006 MET A CE  1 
ATOM   1577 N N   . LEU A 1 208 ? 34.505 22.647 66.464 1.00 10.38  ? 1007 LEU A N   1 
ATOM   1578 C CA  . LEU A 1 208 ? 34.985 22.604 67.850 1.00 8.58   ? 1007 LEU A CA  1 
ATOM   1579 C C   . LEU A 1 208 ? 35.387 23.970 68.423 1.00 11.32  ? 1007 LEU A C   1 
ATOM   1580 O O   . LEU A 1 208 ? 35.476 24.116 69.640 1.00 10.67  ? 1007 LEU A O   1 
ATOM   1581 C CB  . LEU A 1 208 ? 36.054 21.544 68.062 1.00 7.92   ? 1007 LEU A CB  1 
ATOM   1582 C CG  . LEU A 1 208 ? 35.471 20.161 68.179 1.00 10.30  ? 1007 LEU A CG  1 
ATOM   1583 C CD1 . LEU A 1 208 ? 36.043 19.257 67.150 1.00 11.76  ? 1007 LEU A CD1 1 
ATOM   1584 C CD2 . LEU A 1 208 ? 35.678 19.606 69.525 1.00 8.98   ? 1007 LEU A CD2 1 
ATOM   1585 N N   . ARG A 1 209 ? 35.574 24.979 67.552 1.00 9.44   ? 1008 ARG A N   1 
ATOM   1586 C CA  . ARG A 1 209 ? 35.831 26.342 67.986 1.00 8.79   ? 1008 ARG A CA  1 
ATOM   1587 C C   . ARG A 1 209 ? 34.496 26.843 68.542 1.00 10.65  ? 1008 ARG A C   1 
ATOM   1588 O O   . ARG A 1 209 ? 34.480 27.332 69.670 1.00 10.02  ? 1008 ARG A O   1 
ATOM   1589 C CB  . ARG A 1 209 ? 36.335 27.217 66.829 1.00 8.35   ? 1008 ARG A CB  1 
ATOM   1590 C CG  . ARG A 1 209 ? 37.094 28.448 67.268 1.00 12.06  ? 1008 ARG A CG  1 
ATOM   1591 C CD  . ARG A 1 209 ? 37.208 29.417 66.118 1.00 30.92  ? 1008 ARG A CD  1 
ATOM   1592 N NE  . ARG A 1 209 ? 37.660 30.731 66.576 1.00 57.38  ? 1008 ARG A NE  1 
ATOM   1593 C CZ  . ARG A 1 209 ? 38.142 31.687 65.783 1.00 84.24  ? 1008 ARG A CZ  1 
ATOM   1594 N NH1 . ARG A 1 209 ? 38.244 31.487 64.472 1.00 76.91  ? 1008 ARG A NH1 1 
ATOM   1595 N NH2 . ARG A 1 209 ? 38.527 32.850 66.295 1.00 72.76  ? 1008 ARG A NH2 1 
ATOM   1596 N N   . ILE A 1 210 ? 33.365 26.616 67.807 1.00 8.51   ? 1009 ILE A N   1 
ATOM   1597 C CA  . ILE A 1 210 ? 32.005 26.983 68.239 1.00 8.88   ? 1009 ILE A CA  1 
ATOM   1598 C C   . ILE A 1 210 ? 31.708 26.298 69.611 1.00 14.47  ? 1009 ILE A C   1 
ATOM   1599 O O   . ILE A 1 210 ? 31.242 26.961 70.549 1.00 15.49  ? 1009 ILE A O   1 
ATOM   1600 C CB  . ILE A 1 210 ? 30.920 26.572 67.188 1.00 10.12  ? 1009 ILE A CB  1 
ATOM   1601 C CG1 . ILE A 1 210 ? 31.111 27.087 65.733 1.00 10.77  ? 1009 ILE A CG1 1 
ATOM   1602 C CG2 . ILE A 1 210 ? 29.502 26.751 67.688 1.00 10.06  ? 1009 ILE A CG2 1 
ATOM   1603 C CD1 . ILE A 1 210 ? 31.758 28.444 65.506 1.00 24.30  ? 1009 ILE A CD1 1 
ATOM   1604 N N   . ASP A 1 211 ? 32.007 24.985 69.722 1.00 10.95  ? 1010 ASP A N   1 
ATOM   1605 C CA  . ASP A 1 211 ? 31.687 24.199 70.897 1.00 10.77  ? 1010 ASP A CA  1 
ATOM   1606 C C   . ASP A 1 211 ? 32.586 24.317 72.124 1.00 16.80  ? 1010 ASP A C   1 
ATOM   1607 O O   . ASP A 1 211 ? 32.079 24.301 73.247 1.00 17.71  ? 1010 ASP A O   1 
ATOM   1608 C CB  . ASP A 1 211 ? 31.508 22.741 70.497 1.00 12.30  ? 1010 ASP A CB  1 
ATOM   1609 C CG  . ASP A 1 211 ? 30.281 22.462 69.649 1.00 25.58  ? 1010 ASP A CG  1 
ATOM   1610 O OD1 . ASP A 1 211 ? 29.224 23.103 69.894 1.00 26.36  ? 1010 ASP A OD1 1 
ATOM   1611 O OD2 . ASP A 1 211 ? 30.340 21.529 68.821 1.00 29.52  ? 1010 ASP A OD2 1 
ATOM   1612 N N   . GLU A 1 212 ? 33.908 24.372 71.935 1.00 14.62  ? 1011 GLU A N   1 
ATOM   1613 C CA  . GLU A 1 212 ? 34.866 24.439 73.043 1.00 13.58  ? 1011 GLU A CA  1 
ATOM   1614 C C   . GLU A 1 212 ? 35.494 25.816 73.246 1.00 17.70  ? 1011 GLU A C   1 
ATOM   1615 O O   . GLU A 1 212 ? 35.939 26.124 74.341 1.00 18.82  ? 1011 GLU A O   1 
ATOM   1616 C CB  . GLU A 1 212 ? 35.949 23.336 72.909 1.00 14.52  ? 1011 GLU A CB  1 
ATOM   1617 C CG  . GLU A 1 212 ? 35.417 21.933 73.183 1.00 27.50  ? 1011 GLU A CG  1 
ATOM   1618 C CD  . GLU A 1 212 ? 36.394 20.774 73.324 1.00 53.29  ? 1011 GLU A CD  1 
ATOM   1619 O OE1 . GLU A 1 212 ? 35.996 19.636 72.984 1.00 37.80  ? 1011 GLU A OE1 1 
ATOM   1620 O OE2 . GLU A 1 212 ? 37.527 20.982 73.817 1.00 51.24  ? 1011 GLU A OE2 1 
ATOM   1621 N N   . GLY A 1 213 ? 35.567 26.617 72.198 1.00 14.37  ? 1012 GLY A N   1 
ATOM   1622 C CA  . GLY A 1 213 ? 36.190 27.933 72.285 1.00 15.11  ? 1012 GLY A CA  1 
ATOM   1623 C C   . GLY A 1 213 ? 37.695 27.899 72.081 1.00 20.18  ? 1012 GLY A C   1 
ATOM   1624 O O   . GLY A 1 213 ? 38.354 26.935 72.477 1.00 20.83  ? 1012 GLY A O   1 
ATOM   1625 N N   . LEU A 1 214 ? 38.252 28.978 71.505 1.00 16.05  ? 1013 LEU A N   1 
ATOM   1626 C CA  . LEU A 1 214 ? 39.678 29.106 71.232 1.00 16.04  ? 1013 LEU A CA  1 
ATOM   1627 C C   . LEU A 1 214 ? 40.372 30.068 72.188 1.00 20.93  ? 1013 LEU A C   1 
ATOM   1628 O O   . LEU A 1 214 ? 40.219 31.277 72.049 1.00 22.66  ? 1013 LEU A O   1 
ATOM   1629 C CB  . LEU A 1 214 ? 39.836 29.562 69.784 1.00 16.83  ? 1013 LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 214 ? 41.223 29.793 69.227 1.00 22.17  ? 1013 LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 214 ? 41.454 28.910 68.031 1.00 22.96  ? 1013 LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 214 ? 41.341 31.211 68.714 1.00 25.65  ? 1013 LEU A CD2 1 
ATOM   1633 N N   . ARG A 1 215 ? 41.141 29.530 73.146 1.00 15.85  ? 1014 ARG A N   1 
ATOM   1634 C CA  . ARG A 1 215 ? 41.949 30.306 74.101 1.00 15.10  ? 1014 ARG A CA  1 
ATOM   1635 C C   . ARG A 1 215 ? 43.374 30.586 73.531 1.00 20.25  ? 1014 ARG A C   1 
ATOM   1636 O O   . ARG A 1 215 ? 44.083 29.650 73.150 1.00 20.72  ? 1014 ARG A O   1 
ATOM   1637 C CB  . ARG A 1 215 ? 42.062 29.554 75.436 1.00 12.34  ? 1014 ARG A CB  1 
ATOM   1638 C CG  . ARG A 1 215 ? 40.773 29.505 76.225 1.00 14.44  ? 1014 ARG A CG  1 
ATOM   1639 C CD  . ARG A 1 215 ? 40.997 28.988 77.615 1.00 16.06  ? 1014 ARG A CD  1 
ATOM   1640 N NE  . ARG A 1 215 ? 39.727 28.767 78.299 1.00 32.17  ? 1014 ARG A NE  1 
ATOM   1641 C CZ  . ARG A 1 215 ? 39.166 29.626 79.145 1.00 57.48  ? 1014 ARG A CZ  1 
ATOM   1642 N NH1 . ARG A 1 215 ? 39.761 30.778 79.422 1.00 47.14  ? 1014 ARG A NH1 1 
ATOM   1643 N NH2 . ARG A 1 215 ? 38.006 29.340 79.718 1.00 53.72  ? 1014 ARG A NH2 1 
ATOM   1644 N N   . LEU A 1 216 ? 43.793 31.858 73.454 1.00 16.73  ? 1015 LEU A N   1 
ATOM   1645 C CA  . LEU A 1 216 ? 45.143 32.171 72.929 1.00 15.88  ? 1015 LEU A CA  1 
ATOM   1646 C C   . LEU A 1 216 ? 46.221 32.403 74.007 1.00 21.14  ? 1015 LEU A C   1 
ATOM   1647 O O   . LEU A 1 216 ? 47.396 32.547 73.670 1.00 21.50  ? 1015 LEU A O   1 
ATOM   1648 C CB  . LEU A 1 216 ? 45.133 33.244 71.821 1.00 15.41  ? 1015 LEU A CB  1 
ATOM   1649 C CG  . LEU A 1 216 ? 44.291 32.853 70.601 1.00 19.31  ? 1015 LEU A CG  1 
ATOM   1650 C CD1 . LEU A 1 216 ? 44.074 34.012 69.663 1.00 19.03  ? 1015 LEU A CD1 1 
ATOM   1651 C CD2 . LEU A 1 216 ? 44.870 31.646 69.874 1.00 23.46  ? 1015 LEU A CD2 1 
ATOM   1652 N N   . LYS A 1 217 ? 45.813 32.363 75.297 1.00 18.03  ? 1016 LYS A N   1 
ATOM   1653 C CA  . LYS A 1 217 ? 46.652 32.507 76.489 1.00 17.89  ? 1016 LYS A CA  1 
ATOM   1654 C C   . LYS A 1 217 ? 46.299 31.369 77.486 1.00 22.10  ? 1016 LYS A C   1 
ATOM   1655 O O   . LYS A 1 217 ? 45.104 31.092 77.657 1.00 23.07  ? 1016 LYS A O   1 
ATOM   1656 C CB  . LYS A 1 217 ? 46.449 33.898 77.138 1.00 19.74  ? 1016 LYS A CB  1 
ATOM   1657 C CG  . LYS A 1 217 ? 47.295 34.107 78.393 1.00 27.66  ? 1016 LYS A CG  1 
ATOM   1658 C CD  . LYS A 1 217 ? 47.122 35.459 79.016 1.00 41.19  ? 1016 LYS A CD  1 
ATOM   1659 C CE  . LYS A 1 217 ? 48.306 35.780 79.899 1.00 60.28  ? 1016 LYS A CE  1 
ATOM   1660 N NZ  . LYS A 1 217 ? 48.218 37.148 80.481 1.00 70.15  ? 1016 LYS A NZ  1 
ATOM   1661 N N   . ILE A 1 218 ? 47.321 30.708 78.127 1.00 17.18  ? 1017 ILE A N   1 
ATOM   1662 C CA  . ILE A 1 218 ? 47.116 29.600 79.088 1.00 16.38  ? 1017 ILE A CA  1 
ATOM   1663 C C   . ILE A 1 218 ? 46.146 30.043 80.173 1.00 21.50  ? 1017 ILE A C   1 
ATOM   1664 O O   . ILE A 1 218 ? 46.348 31.091 80.801 1.00 21.85  ? 1017 ILE A O   1 
ATOM   1665 C CB  . ILE A 1 218 ? 48.422 28.975 79.711 1.00 19.13  ? 1017 ILE A CB  1 
ATOM   1666 C CG1 . ILE A 1 218 ? 49.274 28.262 78.694 1.00 19.75  ? 1017 ILE A CG1 1 
ATOM   1667 C CG2 . ILE A 1 218 ? 48.118 27.994 80.826 1.00 18.34  ? 1017 ILE A CG2 1 
ATOM   1668 C CD1 . ILE A 1 218 ? 50.651 27.907 79.257 1.00 33.49  ? 1017 ILE A CD1 1 
ATOM   1669 N N   . TYR A 1 219 ? 45.083 29.244 80.361 1.00 17.35  ? 1018 TYR A N   1 
ATOM   1670 C CA  . TYR A 1 219 ? 44.092 29.470 81.390 1.00 17.51  ? 1018 TYR A CA  1 
ATOM   1671 C C   . TYR A 1 219 ? 44.268 28.391 82.458 1.00 20.00  ? 1018 TYR A C   1 
ATOM   1672 O O   . TYR A 1 219 ? 44.387 27.225 82.105 1.00 18.88  ? 1018 TYR A O   1 
ATOM   1673 C CB  . TYR A 1 219 ? 42.670 29.437 80.777 1.00 19.15  ? 1018 TYR A CB  1 
ATOM   1674 C CG  . TYR A 1 219 ? 41.579 29.467 81.822 1.00 22.61  ? 1018 TYR A CG  1 
ATOM   1675 C CD1 . TYR A 1 219 ? 41.390 30.589 82.627 1.00 25.76  ? 1018 TYR A CD1 1 
ATOM   1676 C CD2 . TYR A 1 219 ? 40.798 28.343 82.075 1.00 24.02  ? 1018 TYR A CD2 1 
ATOM   1677 C CE1 . TYR A 1 219 ? 40.448 30.597 83.657 1.00 27.92  ? 1018 TYR A CE1 1 
ATOM   1678 C CE2 . TYR A 1 219 ? 39.850 28.336 83.102 1.00 26.21  ? 1018 TYR A CE2 1 
ATOM   1679 C CZ  . TYR A 1 219 ? 39.675 29.470 83.889 1.00 38.87  ? 1018 TYR A CZ  1 
ATOM   1680 O OH  . TYR A 1 219 ? 38.724 29.501 84.884 1.00 46.48  ? 1018 TYR A OH  1 
ATOM   1681 N N   . LYS A 1 220 ? 44.308 28.772 83.747 1.00 17.50  ? 1019 LYS A N   1 
ATOM   1682 C CA  . LYS A 1 220 ? 44.383 27.830 84.880 1.00 18.00  ? 1019 LYS A CA  1 
ATOM   1683 C C   . LYS A 1 220 ? 42.990 27.767 85.504 1.00 23.73  ? 1019 LYS A C   1 
ATOM   1684 O O   . LYS A 1 220 ? 42.502 28.787 86.017 1.00 24.77  ? 1019 LYS A O   1 
ATOM   1685 C CB  . LYS A 1 220 ? 45.402 28.271 85.935 1.00 20.74  ? 1019 LYS A CB  1 
ATOM   1686 C CG  . LYS A 1 220 ? 45.397 27.443 87.219 1.00 31.86  ? 1019 LYS A CG  1 
ATOM   1687 C CD  . LYS A 1 220 ? 45.867 28.276 88.409 1.00 49.08  ? 1019 LYS A CD  1 
ATOM   1688 C CE  . LYS A 1 220 ? 46.193 27.465 89.640 1.00 63.38  ? 1019 LYS A CE  1 
ATOM   1689 N NZ  . LYS A 1 220 ? 46.134 28.306 90.866 1.00 73.91  ? 1019 LYS A NZ  1 
ATOM   1690 N N   . ASP A 1 221 ? 42.343 26.588 85.457 1.00 19.74  ? 1020 ASP A N   1 
ATOM   1691 C CA  . ASP A 1 221 ? 41.003 26.467 86.009 1.00 19.91  ? 1020 ASP A CA  1 
ATOM   1692 C C   . ASP A 1 221 ? 40.930 26.386 87.556 1.00 28.07  ? 1020 ASP A C   1 
ATOM   1693 O O   . ASP A 1 221 ? 41.948 26.603 88.224 1.00 29.20  ? 1020 ASP A O   1 
ATOM   1694 C CB  . ASP A 1 221 ? 40.166 25.419 85.262 1.00 20.30  ? 1020 ASP A CB  1 
ATOM   1695 C CG  . ASP A 1 221 ? 40.368 23.971 85.649 1.00 32.00  ? 1020 ASP A CG  1 
ATOM   1696 O OD1 . ASP A 1 221 ? 40.942 23.714 86.735 1.00 34.23  ? 1020 ASP A OD1 1 
ATOM   1697 O OD2 . ASP A 1 221 ? 39.889 23.090 84.900 1.00 37.63  ? 1020 ASP A OD2 1 
ATOM   1698 N N   . THR A 1 222 ? 39.726 26.107 88.120 1.00 25.14  ? 1021 THR A N   1 
ATOM   1699 C CA  . THR A 1 222 ? 39.532 26.027 89.570 1.00 25.74  ? 1021 THR A CA  1 
ATOM   1700 C C   . THR A 1 222 ? 40.208 24.860 90.243 1.00 29.56  ? 1021 THR A C   1 
ATOM   1701 O O   . THR A 1 222 ? 40.580 25.000 91.394 1.00 30.51  ? 1021 THR A O   1 
ATOM   1702 C CB  . THR A 1 222 ? 38.094 26.265 89.993 1.00 31.82  ? 1021 THR A CB  1 
ATOM   1703 O OG1 . THR A 1 222 ? 37.220 25.463 89.194 1.00 34.53  ? 1021 THR A OG1 1 
ATOM   1704 C CG2 . THR A 1 222 ? 37.715 27.717 89.899 1.00 26.88  ? 1021 THR A CG2 1 
ATOM   1705 N N   . GLU A 1 223 ? 40.415 23.740 89.541 1.00 25.54  ? 1022 GLU A N   1 
ATOM   1706 C CA  . GLU A 1 223 ? 41.113 22.588 90.121 1.00 26.90  ? 1022 GLU A CA  1 
ATOM   1707 C C   . GLU A 1 223 ? 42.609 22.536 89.718 1.00 34.25  ? 1022 GLU A C   1 
ATOM   1708 O O   . GLU A 1 223 ? 43.282 21.497 89.883 1.00 35.16  ? 1022 GLU A O   1 
ATOM   1709 C CB  . GLU A 1 223 ? 40.392 21.270 89.815 1.00 27.67  ? 1022 GLU A CB  1 
ATOM   1710 C CG  . GLU A 1 223 ? 38.943 21.217 90.252 1.00 39.54  ? 1022 GLU A CG  1 
ATOM   1711 C CD  . GLU A 1 223 ? 38.622 21.678 91.655 1.00 57.64  ? 1022 GLU A CD  1 
ATOM   1712 O OE1 . GLU A 1 223 ? 39.342 21.268 92.595 1.00 50.72  ? 1022 GLU A OE1 1 
ATOM   1713 O OE2 . GLU A 1 223 ? 37.626 22.422 91.815 1.00 47.51  ? 1022 GLU A OE2 1 
ATOM   1714 N N   . GLY A 1 224 ? 43.101 23.680 89.222 1.00 31.10  ? 1023 GLY A N   1 
ATOM   1715 C CA  . GLY A 1 224 ? 44.486 23.890 88.819 1.00 31.37  ? 1023 GLY A CA  1 
ATOM   1716 C C   . GLY A 1 224 ? 44.875 23.208 87.528 1.00 34.30  ? 1023 GLY A C   1 
ATOM   1717 O O   . GLY A 1 224 ? 45.941 22.602 87.455 1.00 36.79  ? 1023 GLY A O   1 
ATOM   1718 N N   . TYR A 1 225 ? 44.053 23.340 86.496 1.00 27.22  ? 1024 TYR A N   1 
ATOM   1719 C CA  . TYR A 1 225 ? 44.322 22.726 85.205 1.00 25.98  ? 1024 TYR A CA  1 
ATOM   1720 C C   . TYR A 1 225 ? 44.583 23.802 84.140 1.00 28.35  ? 1024 TYR A C   1 
ATOM   1721 O O   . TYR A 1 225 ? 43.804 24.751 84.013 1.00 28.72  ? 1024 TYR A O   1 
ATOM   1722 C CB  . TYR A 1 225 ? 43.154 21.795 84.813 1.00 27.03  ? 1024 TYR A CB  1 
ATOM   1723 C CG  . TYR A 1 225 ? 43.102 20.514 85.623 1.00 31.38  ? 1024 TYR A CG  1 
ATOM   1724 C CD1 . TYR A 1 225 ? 43.659 19.334 85.138 1.00 34.10  ? 1024 TYR A CD1 1 
ATOM   1725 C CD2 . TYR A 1 225 ? 42.510 20.483 86.882 1.00 33.46  ? 1024 TYR A CD2 1 
ATOM   1726 C CE1 . TYR A 1 225 ? 43.609 18.151 85.874 1.00 34.14  ? 1024 TYR A CE1 1 
ATOM   1727 C CE2 . TYR A 1 225 ? 42.485 19.310 87.640 1.00 35.74  ? 1024 TYR A CE2 1 
ATOM   1728 C CZ  . TYR A 1 225 ? 43.037 18.149 87.131 1.00 43.06  ? 1024 TYR A CZ  1 
ATOM   1729 O OH  . TYR A 1 225 ? 43.023 16.996 87.871 1.00 50.42  ? 1024 TYR A OH  1 
ATOM   1730 N N   . TYR A 1 226 ? 45.667 23.624 83.363 1.00 21.77  ? 1025 TYR A N   1 
ATOM   1731 C CA  . TYR A 1 226 ? 46.137 24.534 82.320 1.00 19.10  ? 1025 TYR A CA  1 
ATOM   1732 C C   . TYR A 1 226 ? 45.639 24.174 80.892 1.00 20.43  ? 1025 TYR A C   1 
ATOM   1733 O O   . TYR A 1 226 ? 46.019 23.167 80.304 1.00 19.53  ? 1025 TYR A O   1 
ATOM   1734 C CB  . TYR A 1 226 ? 47.669 24.721 82.423 1.00 21.34  ? 1025 TYR A CB  1 
ATOM   1735 C CG  . TYR A 1 226 ? 48.127 25.215 83.787 1.00 24.77  ? 1025 TYR A CG  1 
ATOM   1736 C CD1 . TYR A 1 226 ? 48.164 26.573 84.085 1.00 27.67  ? 1025 TYR A CD1 1 
ATOM   1737 C CD2 . TYR A 1 226 ? 48.484 24.318 84.794 1.00 26.43  ? 1025 TYR A CD2 1 
ATOM   1738 C CE1 . TYR A 1 226 ? 48.563 27.029 85.342 1.00 30.73  ? 1025 TYR A CE1 1 
ATOM   1739 C CE2 . TYR A 1 226 ? 48.857 24.762 86.063 1.00 28.31  ? 1025 TYR A CE2 1 
ATOM   1740 C CZ  . TYR A 1 226 ? 48.907 26.118 86.328 1.00 38.43  ? 1025 TYR A CZ  1 
ATOM   1741 O OH  . TYR A 1 226 ? 49.292 26.563 87.570 1.00 45.73  ? 1025 TYR A OH  1 
ATOM   1742 N N   . THR A 1 227 ? 44.750 25.007 80.362 1.00 16.96  ? 1026 THR A N   1 
ATOM   1743 C CA  . THR A 1 227 ? 44.112 24.841 79.059 1.00 15.31  ? 1026 THR A CA  1 
ATOM   1744 C C   . THR A 1 227 ? 44.580 25.965 78.165 1.00 17.30  ? 1026 THR A C   1 
ATOM   1745 O O   . THR A 1 227 ? 44.689 27.117 78.619 1.00 18.50  ? 1026 THR A O   1 
ATOM   1746 C CB  . THR A 1 227 ? 42.560 24.914 79.255 1.00 23.63  ? 1026 THR A CB  1 
ATOM   1747 O OG1 . THR A 1 227 ? 42.114 23.769 79.963 1.00 29.60  ? 1026 THR A OG1 1 
ATOM   1748 C CG2 . THR A 1 227 ? 41.782 24.995 77.964 1.00 20.14  ? 1026 THR A CG2 1 
ATOM   1749 N N   . ILE A 1 228 ? 44.800 25.637 76.887 1.00 10.15  ? 1027 ILE A N   1 
ATOM   1750 C CA  . ILE A 1 228 ? 45.148 26.559 75.815 1.00 9.48   ? 1027 ILE A CA  1 
ATOM   1751 C C   . ILE A 1 228 ? 44.523 26.003 74.528 1.00 13.58  ? 1027 ILE A C   1 
ATOM   1752 O O   . ILE A 1 228 ? 44.342 24.791 74.408 1.00 13.31  ? 1027 ILE A O   1 
ATOM   1753 C CB  . ILE A 1 228 ? 46.693 26.768 75.718 1.00 11.99  ? 1027 ILE A CB  1 
ATOM   1754 C CG1 . ILE A 1 228 ? 47.063 27.882 74.753 1.00 11.08  ? 1027 ILE A CG1 1 
ATOM   1755 C CG2 . ILE A 1 228 ? 47.433 25.479 75.349 1.00 14.05  ? 1027 ILE A CG2 1 
ATOM   1756 C CD1 . ILE A 1 228 ? 47.538 29.016 75.369 1.00 17.63  ? 1027 ILE A CD1 1 
ATOM   1757 N N   . GLY A 1 229 ? 44.199 26.885 73.594 1.00 10.67  ? 1028 GLY A N   1 
ATOM   1758 C CA  . GLY A 1 229 ? 43.623 26.511 72.311 1.00 11.39  ? 1028 GLY A CA  1 
ATOM   1759 C C   . GLY A 1 229 ? 42.178 26.076 72.393 1.00 17.17  ? 1028 GLY A C   1 
ATOM   1760 O O   . GLY A 1 229 ? 41.391 26.678 73.123 1.00 16.69  ? 1028 GLY A O   1 
ATOM   1761 N N   . ILE A 1 230 ? 41.821 25.048 71.592 1.00 15.70  ? 1029 ILE A N   1 
ATOM   1762 C CA  . ILE A 1 230 ? 40.499 24.421 71.534 1.00 15.65  ? 1029 ILE A CA  1 
ATOM   1763 C C   . ILE A 1 230 ? 40.558 23.295 72.582 1.00 22.82  ? 1029 ILE A C   1 
ATOM   1764 O O   . ILE A 1 230 ? 40.685 22.106 72.239 1.00 23.82  ? 1029 ILE A O   1 
ATOM   1765 C CB  . ILE A 1 230 ? 40.147 23.885 70.124 1.00 18.77  ? 1029 ILE A CB  1 
ATOM   1766 C CG1 . ILE A 1 230 ? 40.504 24.875 68.985 1.00 19.33  ? 1029 ILE A CG1 1 
ATOM   1767 C CG2 . ILE A 1 230 ? 38.713 23.372 70.049 1.00 19.22  ? 1029 ILE A CG2 1 
ATOM   1768 C CD1 . ILE A 1 230 ? 39.442 25.796 68.529 1.00 23.40  ? 1029 ILE A CD1 1 
ATOM   1769 N N   . GLY A 1 231 ? 40.550 23.716 73.852 1.00 19.36  ? 1030 GLY A N   1 
ATOM   1770 C CA  . GLY A 1 231 ? 40.576 22.846 75.011 1.00 18.76  ? 1030 GLY A CA  1 
ATOM   1771 C C   . GLY A 1 231 ? 41.701 21.847 75.017 1.00 22.83  ? 1030 GLY A C   1 
ATOM   1772 O O   . GLY A 1 231 ? 41.470 20.665 75.275 1.00 23.69  ? 1030 GLY A O   1 
ATOM   1773 N N   . HIS A 1 232 ? 42.917 22.294 74.696 1.00 19.37  ? 1031 HIS A N   1 
ATOM   1774 C CA  . HIS A 1 232 ? 44.058 21.389 74.745 1.00 19.61  ? 1031 HIS A CA  1 
ATOM   1775 C C   . HIS A 1 232 ? 44.538 21.491 76.146 1.00 22.13  ? 1031 HIS A C   1 
ATOM   1776 O O   . HIS A 1 232 ? 44.923 22.578 76.567 1.00 23.22  ? 1031 HIS A O   1 
ATOM   1777 C CB  . HIS A 1 232 ? 45.165 21.783 73.746 1.00 20.88  ? 1031 HIS A CB  1 
ATOM   1778 C CG  . HIS A 1 232 ? 46.419 20.975 73.895 1.00 25.48  ? 1031 HIS A CG  1 
ATOM   1779 N ND1 . HIS A 1 232 ? 46.657 19.859 73.116 1.00 28.00  ? 1031 HIS A ND1 1 
ATOM   1780 C CD2 . HIS A 1 232 ? 47.462 21.148 74.744 1.00 27.81  ? 1031 HIS A CD2 1 
ATOM   1781 C CE1 . HIS A 1 232 ? 47.829 19.392 73.516 1.00 28.52  ? 1031 HIS A CE1 1 
ATOM   1782 N NE2 . HIS A 1 232 ? 48.347 20.133 74.499 1.00 28.69  ? 1031 HIS A NE2 1 
ATOM   1783 N N   . LEU A 1 233 ? 44.445 20.397 76.895 1.00 17.56  ? 1032 LEU A N   1 
ATOM   1784 C CA  . LEU A 1 233 ? 44.890 20.338 78.294 1.00 17.62  ? 1032 LEU A CA  1 
ATOM   1785 C C   . LEU A 1 233 ? 46.390 20.143 78.287 1.00 24.85  ? 1032 LEU A C   1 
ATOM   1786 O O   . LEU A 1 233 ? 46.938 19.482 77.397 1.00 25.96  ? 1032 LEU A O   1 
ATOM   1787 C CB  . LEU A 1 233 ? 44.226 19.159 79.017 1.00 17.69  ? 1032 LEU A CB  1 
ATOM   1788 C CG  . LEU A 1 233 ? 44.126 19.241 80.524 1.00 22.34  ? 1032 LEU A CG  1 
ATOM   1789 C CD1 . LEU A 1 233 ? 42.801 19.876 80.969 1.00 21.38  ? 1032 LEU A CD1 1 
ATOM   1790 C CD2 . LEU A 1 233 ? 44.224 17.871 81.115 1.00 26.48  ? 1032 LEU A CD2 1 
ATOM   1791 N N   . LEU A 1 234 ? 47.067 20.732 79.241 1.00 23.60  ? 1033 LEU A N   1 
ATOM   1792 C CA  . LEU A 1 234 ? 48.505 20.569 79.275 1.00 25.09  ? 1033 LEU A CA  1 
ATOM   1793 C C   . LEU A 1 234 ? 48.803 19.616 80.417 1.00 37.39  ? 1033 LEU A C   1 
ATOM   1794 O O   . LEU A 1 234 ? 48.943 20.017 81.572 1.00 38.11  ? 1033 LEU A O   1 
ATOM   1795 C CB  . LEU A 1 234 ? 49.222 21.932 79.337 1.00 23.85  ? 1033 LEU A CB  1 
ATOM   1796 C CG  . LEU A 1 234 ? 48.858 22.894 78.189 1.00 25.28  ? 1033 LEU A CG  1 
ATOM   1797 C CD1 . LEU A 1 234 ? 49.012 24.318 78.612 1.00 25.02  ? 1033 LEU A CD1 1 
ATOM   1798 C CD2 . LEU A 1 234 ? 49.663 22.618 76.952 1.00 26.00  ? 1033 LEU A CD2 1 
ATOM   1799 N N   . THR A 1 235 ? 48.745 18.316 80.078 1.00 39.51  ? 1034 THR A N   1 
ATOM   1800 C CA  . THR A 1 235 ? 48.907 17.152 80.959 1.00 42.36  ? 1034 THR A CA  1 
ATOM   1801 C C   . THR A 1 235 ? 50.186 17.180 81.773 1.00 50.34  ? 1034 THR A C   1 
ATOM   1802 O O   . THR A 1 235 ? 51.274 17.401 81.230 1.00 49.84  ? 1034 THR A O   1 
ATOM   1803 C CB  . THR A 1 235 ? 48.811 15.835 80.151 1.00 56.27  ? 1034 THR A CB  1 
ATOM   1804 O OG1 . THR A 1 235 ? 49.943 15.700 79.267 1.00 59.55  ? 1034 THR A OG1 1 
ATOM   1805 C CG2 . THR A 1 235 ? 47.487 15.699 79.389 1.00 54.21  ? 1034 THR A CG2 1 
ATOM   1806 N N   . LYS A 1 236 ? 50.047 16.894 83.077 1.00 50.51  ? 1035 LYS A N   1 
ATOM   1807 C CA  . LYS A 1 236 ? 51.143 16.844 84.055 1.00 52.90  ? 1035 LYS A CA  1 
ATOM   1808 C C   . LYS A 1 236 ? 51.913 18.142 84.271 1.00 57.33  ? 1035 LYS A C   1 
ATOM   1809 O O   . LYS A 1 236 ? 53.143 18.191 84.134 1.00 58.62  ? 1035 LYS A O   1 
ATOM   1810 C CB  . LYS A 1 236 ? 52.089 15.636 83.832 1.00 57.16  ? 1035 LYS A CB  1 
ATOM   1811 C CG  . LYS A 1 236 ? 51.377 14.286 83.952 1.00 70.80  ? 1035 LYS A CG  1 
ATOM   1812 C CD  . LYS A 1 236 ? 52.304 13.176 84.395 1.00 85.36  ? 1035 LYS A CD  1 
ATOM   1813 C CE  . LYS A 1 236 ? 53.043 12.504 83.266 1.00 98.65  ? 1035 LYS A CE  1 
ATOM   1814 N NZ  . LYS A 1 236 ? 53.948 11.475 83.817 1.00 112.01 ? 1035 LYS A NZ  1 
ATOM   1815 N N   . SER A 1 237 ? 51.146 19.215 84.510 1.00 51.11  ? 1036 SER A N   1 
ATOM   1816 C CA  . SER A 1 237 ? 51.676 20.543 84.737 1.00 49.66  ? 1036 SER A CA  1 
ATOM   1817 C C   . SER A 1 237 ? 51.308 21.062 86.103 1.00 51.95  ? 1036 SER A C   1 
ATOM   1818 O O   . SER A 1 237 ? 50.310 21.772 86.228 1.00 51.12  ? 1036 SER A O   1 
ATOM   1819 C CB  . SER A 1 237 ? 51.107 21.425 83.638 1.00 50.87  ? 1036 SER A CB  1 
ATOM   1820 O OG  . SER A 1 237 ? 51.655 21.043 82.388 1.00 59.80  ? 1036 SER A OG  1 
ATOM   1821 N N   . PRO A 1 238 ? 52.064 20.674 87.157 1.00 47.94  ? 1037 PRO A N   1 
ATOM   1822 C CA  . PRO A 1 238 ? 51.746 21.170 88.507 1.00 47.52  ? 1037 PRO A CA  1 
ATOM   1823 C C   . PRO A 1 238 ? 51.629 22.693 88.577 1.00 47.82  ? 1037 PRO A C   1 
ATOM   1824 O O   . PRO A 1 238 ? 50.556 23.190 88.936 1.00 48.11  ? 1037 PRO A O   1 
ATOM   1825 C CB  . PRO A 1 238 ? 52.895 20.639 89.367 1.00 51.92  ? 1037 PRO A CB  1 
ATOM   1826 C CG  . PRO A 1 238 ? 53.967 20.230 88.391 1.00 57.33  ? 1037 PRO A CG  1 
ATOM   1827 C CD  . PRO A 1 238 ? 53.250 19.794 87.173 1.00 51.28  ? 1037 PRO A CD  1 
ATOM   1828 N N   . SER A 1 239 ? 52.681 23.425 88.141 1.00 40.67  ? 1038 SER A N   1 
ATOM   1829 C CA  . SER A 1 239 ? 52.751 24.895 88.141 1.00 38.92  ? 1038 SER A CA  1 
ATOM   1830 C C   . SER A 1 239 ? 52.493 25.487 86.765 1.00 38.63  ? 1038 SER A C   1 
ATOM   1831 O O   . SER A 1 239 ? 52.542 24.747 85.782 1.00 38.52  ? 1038 SER A O   1 
ATOM   1832 C CB  . SER A 1 239 ? 54.141 25.339 88.586 1.00 45.04  ? 1038 SER A CB  1 
ATOM   1833 O OG  . SER A 1 239 ? 55.127 24.976 87.632 1.00 54.66  ? 1038 SER A OG  1 
ATOM   1834 N N   . LEU A 1 240 ? 52.316 26.833 86.673 1.00 31.32  ? 1039 LEU A N   1 
ATOM   1835 C CA  . LEU A 1 240 ? 52.161 27.492 85.377 1.00 28.36  ? 1039 LEU A CA  1 
ATOM   1836 C C   . LEU A 1 240 ? 53.454 27.373 84.584 1.00 33.85  ? 1039 LEU A C   1 
ATOM   1837 O O   . LEU A 1 240 ? 53.393 27.161 83.376 1.00 33.87  ? 1039 LEU A O   1 
ATOM   1838 C CB  . LEU A 1 240 ? 51.702 28.956 85.499 1.00 27.54  ? 1039 LEU A CB  1 
ATOM   1839 C CG  . LEU A 1 240 ? 51.856 29.889 84.267 1.00 30.97  ? 1039 LEU A CG  1 
ATOM   1840 C CD1 . LEU A 1 240 ? 51.036 29.416 83.050 1.00 30.30  ? 1039 LEU A CD1 1 
ATOM   1841 C CD2 . LEU A 1 240 ? 51.478 31.311 84.606 1.00 32.05  ? 1039 LEU A CD2 1 
ATOM   1842 N N   . ASN A 1 241 ? 54.616 27.445 85.249 1.00 31.80  ? 1040 ASN A N   1 
ATOM   1843 C CA  . ASN A 1 241 ? 55.887 27.313 84.540 1.00 32.51  ? 1040 ASN A CA  1 
ATOM   1844 C C   . ASN A 1 241 ? 56.108 25.937 83.926 1.00 36.21  ? 1040 ASN A C   1 
ATOM   1845 O O   . ASN A 1 241 ? 56.789 25.849 82.904 1.00 36.65  ? 1040 ASN A O   1 
ATOM   1846 C CB  . ASN A 1 241 ? 57.073 27.800 85.367 1.00 37.24  ? 1040 ASN A CB  1 
ATOM   1847 C CG  . ASN A 1 241 ? 57.340 29.274 85.177 1.00 66.38  ? 1040 ASN A CG  1 
ATOM   1848 O OD1 . ASN A 1 241 ? 56.582 30.141 85.635 1.00 59.02  ? 1040 ASN A OD1 1 
ATOM   1849 N ND2 . ASN A 1 241 ? 58.408 29.589 84.455 1.00 61.73  ? 1040 ASN A ND2 1 
ATOM   1850 N N   . ALA A 1 242 ? 55.485 24.882 84.500 1.00 31.73  ? 1041 ALA A N   1 
ATOM   1851 C CA  . ALA A 1 242 ? 55.566 23.520 83.962 1.00 31.77  ? 1041 ALA A CA  1 
ATOM   1852 C C   . ALA A 1 242 ? 54.711 23.453 82.699 1.00 34.58  ? 1041 ALA A C   1 
ATOM   1853 O O   . ALA A 1 242 ? 55.160 22.918 81.681 1.00 34.63  ? 1041 ALA A O   1 
ATOM   1854 C CB  . ALA A 1 242 ? 55.067 22.513 84.985 1.00 33.37  ? 1041 ALA A CB  1 
ATOM   1855 N N   . ALA A 1 243 ? 53.490 24.046 82.766 1.00 29.66  ? 1042 ALA A N   1 
ATOM   1856 C CA  . ALA A 1 243 ? 52.522 24.166 81.679 1.00 27.39  ? 1042 ALA A CA  1 
ATOM   1857 C C   . ALA A 1 243 ? 53.109 25.008 80.529 1.00 31.54  ? 1042 ALA A C   1 
ATOM   1858 O O   . ALA A 1 243 ? 52.926 24.655 79.351 1.00 31.57  ? 1042 ALA A O   1 
ATOM   1859 C CB  . ALA A 1 243 ? 51.251 24.809 82.203 1.00 26.70  ? 1042 ALA A CB  1 
ATOM   1860 N N   . LYS A 1 244 ? 53.845 26.100 80.876 1.00 26.45  ? 1043 LYS A N   1 
ATOM   1861 C CA  . LYS A 1 244 ? 54.496 26.969 79.903 1.00 24.80  ? 1043 LYS A CA  1 
ATOM   1862 C C   . LYS A 1 244 ? 55.582 26.182 79.202 1.00 29.75  ? 1043 LYS A C   1 
ATOM   1863 O O   . LYS A 1 244 ? 55.623 26.194 77.980 1.00 29.37  ? 1043 LYS A O   1 
ATOM   1864 C CB  . LYS A 1 244 ? 55.053 28.229 80.568 1.00 26.50  ? 1043 LYS A CB  1 
ATOM   1865 C CG  . LYS A 1 244 ? 54.041 29.358 80.687 1.00 28.93  ? 1043 LYS A CG  1 
ATOM   1866 C CD  . LYS A 1 244 ? 54.597 30.479 81.535 1.00 35.95  ? 1043 LYS A CD  1 
ATOM   1867 C CE  . LYS A 1 244 ? 53.921 31.802 81.286 1.00 46.29  ? 1043 LYS A CE  1 
ATOM   1868 N NZ  . LYS A 1 244 ? 54.365 32.832 82.261 1.00 52.83  ? 1043 LYS A NZ  1 
ATOM   1869 N N   . SER A 1 245 ? 56.393 25.413 79.961 1.00 28.46  ? 1044 SER A N   1 
ATOM   1870 C CA  . SER A 1 245 ? 57.466 24.589 79.393 1.00 29.52  ? 1044 SER A CA  1 
ATOM   1871 C C   . SER A 1 245 ? 56.997 23.406 78.517 1.00 32.87  ? 1044 SER A C   1 
ATOM   1872 O O   . SER A 1 245 ? 57.752 22.946 77.652 1.00 34.60  ? 1044 SER A O   1 
ATOM   1873 C CB  . SER A 1 245 ? 58.418 24.099 80.475 1.00 35.05  ? 1044 SER A CB  1 
ATOM   1874 O OG  . SER A 1 245 ? 59.545 23.490 79.862 1.00 51.00  ? 1044 SER A OG  1 
ATOM   1875 N N   . GLU A 1 246 ? 55.787 22.900 78.756 1.00 26.51  ? 1045 GLU A N   1 
ATOM   1876 C CA  . GLU A 1 246 ? 55.270 21.790 77.979 1.00 26.11  ? 1045 GLU A CA  1 
ATOM   1877 C C   . GLU A 1 246 ? 54.766 22.356 76.664 1.00 27.18  ? 1045 GLU A C   1 
ATOM   1878 O O   . GLU A 1 246 ? 55.043 21.791 75.602 1.00 26.40  ? 1045 GLU A O   1 
ATOM   1879 C CB  . GLU A 1 246 ? 54.160 21.089 78.766 1.00 27.69  ? 1045 GLU A CB  1 
ATOM   1880 C CG  . GLU A 1 246 ? 53.627 19.800 78.165 1.00 43.25  ? 1045 GLU A CG  1 
ATOM   1881 C CD  . GLU A 1 246 ? 52.315 19.325 78.768 1.00 76.27  ? 1045 GLU A CD  1 
ATOM   1882 O OE1 . GLU A 1 246 ? 51.976 19.767 79.891 1.00 73.68  ? 1045 GLU A OE1 1 
ATOM   1883 O OE2 . GLU A 1 246 ? 51.618 18.515 78.112 1.00 75.38  ? 1045 GLU A OE2 1 
ATOM   1884 N N   . LEU A 1 247 ? 54.064 23.510 76.742 1.00 22.63  ? 1046 LEU A N   1 
ATOM   1885 C CA  . LEU A 1 247 ? 53.484 24.246 75.608 1.00 20.45  ? 1046 LEU A CA  1 
ATOM   1886 C C   . LEU A 1 247 ? 54.585 24.705 74.661 1.00 24.88  ? 1046 LEU A C   1 
ATOM   1887 O O   . LEU A 1 247 ? 54.442 24.555 73.451 1.00 24.01  ? 1046 LEU A O   1 
ATOM   1888 C CB  . LEU A 1 247 ? 52.669 25.448 76.130 1.00 18.60  ? 1046 LEU A CB  1 
ATOM   1889 C CG  . LEU A 1 247 ? 52.151 26.440 75.108 1.00 21.23  ? 1046 LEU A CG  1 
ATOM   1890 C CD1 . LEU A 1 247 ? 51.017 25.875 74.365 1.00 20.93  ? 1046 LEU A CD1 1 
ATOM   1891 C CD2 . LEU A 1 247 ? 51.687 27.706 75.768 1.00 22.20  ? 1046 LEU A CD2 1 
ATOM   1892 N N   . ASP A 1 248 ? 55.696 25.233 75.225 1.00 22.89  ? 1047 ASP A N   1 
ATOM   1893 C CA  . ASP A 1 248 ? 56.884 25.699 74.501 1.00 23.60  ? 1047 ASP A CA  1 
ATOM   1894 C C   . ASP A 1 248 ? 57.533 24.556 73.712 1.00 26.76  ? 1047 ASP A C   1 
ATOM   1895 O O   . ASP A 1 248 ? 58.002 24.777 72.588 1.00 26.57  ? 1047 ASP A O   1 
ATOM   1896 C CB  . ASP A 1 248 ? 57.884 26.382 75.461 1.00 26.77  ? 1047 ASP A CB  1 
ATOM   1897 C CG  . ASP A 1 248 ? 57.498 27.812 75.853 1.00 39.93  ? 1047 ASP A CG  1 
ATOM   1898 O OD1 . ASP A 1 248 ? 56.450 28.300 75.371 1.00 39.63  ? 1047 ASP A OD1 1 
ATOM   1899 O OD2 . ASP A 1 248 ? 58.253 28.446 76.639 1.00 44.83  ? 1047 ASP A OD2 1 
ATOM   1900 N N   . LYS A 1 249 ? 57.496 23.320 74.284 1.00 22.74  ? 1048 LYS A N   1 
ATOM   1901 C CA  . LYS A 1 249 ? 57.983 22.103 73.637 1.00 22.95  ? 1048 LYS A CA  1 
ATOM   1902 C C   . LYS A 1 249 ? 57.048 21.740 72.466 1.00 26.33  ? 1048 LYS A C   1 
ATOM   1903 O O   . LYS A 1 249 ? 57.535 21.511 71.365 1.00 28.39  ? 1048 LYS A O   1 
ATOM   1904 C CB  . LYS A 1 249 ? 58.124 20.952 74.642 1.00 25.19  ? 1048 LYS A CB  1 
ATOM   1905 C CG  . LYS A 1 249 ? 59.009 19.832 74.131 1.00 36.10  ? 1048 LYS A CG  1 
ATOM   1906 C CD  . LYS A 1 249 ? 59.412 18.863 75.228 1.00 53.30  ? 1048 LYS A CD  1 
ATOM   1907 C CE  . LYS A 1 249 ? 60.145 17.656 74.672 1.00 70.06  ? 1048 LYS A CE  1 
ATOM   1908 N NZ  . LYS A 1 249 ? 60.846 16.878 75.731 1.00 80.84  ? 1048 LYS A NZ  1 
ATOM   1909 N N   . ALA A 1 250 ? 55.720 21.762 72.687 1.00 19.62  ? 1049 ALA A N   1 
ATOM   1910 C CA  . ALA A 1 250 ? 54.701 21.473 71.669 1.00 18.15  ? 1049 ALA A CA  1 
ATOM   1911 C C   . ALA A 1 250 ? 54.738 22.418 70.475 1.00 21.90  ? 1049 ALA A C   1 
ATOM   1912 O O   . ALA A 1 250 ? 54.781 21.965 69.338 1.00 21.62  ? 1049 ALA A O   1 
ATOM   1913 C CB  . ALA A 1 250 ? 53.310 21.515 72.297 1.00 17.35  ? 1049 ALA A CB  1 
ATOM   1914 N N   . ILE A 1 251 ? 54.672 23.734 70.734 1.00 18.14  ? 1050 ILE A N   1 
ATOM   1915 C CA  . ILE A 1 251 ? 54.633 24.749 69.692 1.00 16.73  ? 1050 ILE A CA  1 
ATOM   1916 C C   . ILE A 1 251 ? 55.966 24.921 68.982 1.00 22.54  ? 1050 ILE A C   1 
ATOM   1917 O O   . ILE A 1 251 ? 55.975 25.131 67.773 1.00 24.42  ? 1050 ILE A O   1 
ATOM   1918 C CB  . ILE A 1 251 ? 53.972 26.046 70.207 1.00 17.94  ? 1050 ILE A CB  1 
ATOM   1919 C CG1 . ILE A 1 251 ? 52.470 25.885 70.170 1.00 17.65  ? 1050 ILE A CG1 1 
ATOM   1920 C CG2 . ILE A 1 251 ? 54.343 27.258 69.365 1.00 19.03  ? 1050 ILE A CG2 1 
ATOM   1921 C CD1 . ILE A 1 251 ? 51.931 25.475 71.370 1.00 29.29  ? 1050 ILE A CD1 1 
ATOM   1922 N N   . GLY A 1 252 ? 57.059 24.799 69.731 1.00 18.46  ? 1051 GLY A N   1 
ATOM   1923 C CA  . GLY A 1 252 ? 58.412 24.925 69.215 1.00 19.11  ? 1051 GLY A CA  1 
ATOM   1924 C C   . GLY A 1 252 ? 58.961 26.336 69.251 1.00 22.28  ? 1051 GLY A C   1 
ATOM   1925 O O   . GLY A 1 252 ? 59.688 26.728 68.335 1.00 24.52  ? 1051 GLY A O   1 
ATOM   1926 N N   . ARG A 1 253 ? 58.632 27.106 70.310 1.00 15.93  ? 1052 ARG A N   1 
ATOM   1927 C CA  . ARG A 1 253 ? 59.115 28.470 70.553 1.00 14.94  ? 1052 ARG A CA  1 
ATOM   1928 C C   . ARG A 1 253 ? 58.913 28.901 71.996 1.00 19.09  ? 1052 ARG A C   1 
ATOM   1929 O O   . ARG A 1 253 ? 58.321 28.150 72.771 1.00 18.19  ? 1052 ARG A O   1 
ATOM   1930 C CB  . ARG A 1 253 ? 58.480 29.474 69.597 1.00 12.13  ? 1052 ARG A CB  1 
ATOM   1931 C CG  . ARG A 1 253 ? 56.992 29.684 69.730 1.00 15.19  ? 1052 ARG A CG  1 
ATOM   1932 C CD  . ARG A 1 253 ? 56.589 30.820 68.805 1.00 14.07  ? 1052 ARG A CD  1 
ATOM   1933 N NE  . ARG A 1 253 ? 55.221 31.273 69.036 1.00 14.82  ? 1052 ARG A NE  1 
ATOM   1934 C CZ  . ARG A 1 253 ? 54.885 32.173 69.949 1.00 31.80  ? 1052 ARG A CZ  1 
ATOM   1935 N NH1 . ARG A 1 253 ? 55.812 32.711 70.732 1.00 21.87  ? 1052 ARG A NH1 1 
ATOM   1936 N NH2 . ARG A 1 253 ? 53.619 32.538 70.093 1.00 23.72  ? 1052 ARG A NH2 1 
ATOM   1937 N N   . ASN A 1 254 ? 59.380 30.121 72.357 1.00 16.22  ? 1053 ASN A N   1 
ATOM   1938 C CA  . ASN A 1 254 ? 59.192 30.675 73.698 1.00 16.00  ? 1053 ASN A CA  1 
ATOM   1939 C C   . ASN A 1 254 ? 57.908 31.525 73.729 1.00 20.62  ? 1053 ASN A C   1 
ATOM   1940 O O   . ASN A 1 254 ? 57.950 32.744 73.617 1.00 20.29  ? 1053 ASN A O   1 
ATOM   1941 C CB  . ASN A 1 254 ? 60.423 31.442 74.141 1.00 16.40  ? 1053 ASN A CB  1 
ATOM   1942 C CG  . ASN A 1 254 ? 60.413 31.852 75.584 1.00 47.11  ? 1053 ASN A CG  1 
ATOM   1943 O OD1 . ASN A 1 254 ? 61.431 32.238 76.180 1.00 47.12  ? 1053 ASN A OD1 1 
ATOM   1944 N ND2 . ASN A 1 254 ? 59.251 31.758 76.184 1.00 45.22  ? 1053 ASN A ND2 1 
ATOM   1945 N N   . THR A 1 255 ? 56.766 30.843 73.862 1.00 19.33  ? 1054 THR A N   1 
ATOM   1946 C CA  . THR A 1 255 ? 55.405 31.389 73.809 1.00 18.79  ? 1054 THR A CA  1 
ATOM   1947 C C   . THR A 1 255 ? 55.044 32.308 74.930 1.00 25.04  ? 1054 THR A C   1 
ATOM   1948 O O   . THR A 1 255 ? 54.333 33.279 74.691 1.00 26.04  ? 1054 THR A O   1 
ATOM   1949 C CB  . THR A 1 255 ? 54.350 30.278 73.671 1.00 18.46  ? 1054 THR A CB  1 
ATOM   1950 O OG1 . THR A 1 255 ? 54.373 29.461 74.846 1.00 17.52  ? 1054 THR A OG1 1 
ATOM   1951 C CG2 . THR A 1 255 ? 54.544 29.431 72.416 1.00 12.51  ? 1054 THR A CG2 1 
ATOM   1952 N N   . ASN A 1 256 ? 55.491 32.004 76.144 1.00 22.77  ? 1055 ASN A N   1 
ATOM   1953 C CA  . ASN A 1 256 ? 55.122 32.797 77.311 1.00 23.67  ? 1055 ASN A CA  1 
ATOM   1954 C C   . ASN A 1 256 ? 53.638 32.650 77.641 1.00 28.20  ? 1055 ASN A C   1 
ATOM   1955 O O   . ASN A 1 256 ? 53.005 33.582 78.137 1.00 30.24  ? 1055 ASN A O   1 
ATOM   1956 C CB  . ASN A 1 256 ? 55.470 34.270 77.092 1.00 27.46  ? 1055 ASN A CB  1 
ATOM   1957 C CG  . ASN A 1 256 ? 55.295 35.103 78.347 1.00 63.56  ? 1055 ASN A CG  1 
ATOM   1958 O OD1 . ASN A 1 256 ? 55.214 34.570 79.453 1.00 65.52  ? 1055 ASN A OD1 1 
ATOM   1959 N ND2 . ASN A 1 256 ? 55.236 36.419 78.180 1.00 58.46  ? 1055 ASN A ND2 1 
ATOM   1960 N N   . GLY A 1 257 ? 53.092 31.471 77.359 1.00 22.92  ? 1056 GLY A N   1 
ATOM   1961 C CA  . GLY A 1 257 ? 51.683 31.189 77.596 1.00 21.10  ? 1056 GLY A CA  1 
ATOM   1962 C C   . GLY A 1 257 ? 50.789 31.801 76.539 1.00 21.73  ? 1056 GLY A C   1 
ATOM   1963 O O   . GLY A 1 257 ? 49.574 31.687 76.635 1.00 21.31  ? 1056 GLY A O   1 
ATOM   1964 N N   . VAL A 1 258 ? 51.363 32.448 75.519 1.00 15.30  ? 1057 VAL A N   1 
ATOM   1965 C CA  . VAL A 1 258 ? 50.564 33.076 74.472 1.00 12.81  ? 1057 VAL A CA  1 
ATOM   1966 C C   . VAL A 1 258 ? 50.866 32.511 73.105 1.00 16.88  ? 1057 VAL A C   1 
ATOM   1967 O O   . VAL A 1 258 ? 51.969 32.703 72.581 1.00 17.66  ? 1057 VAL A O   1 
ATOM   1968 C CB  . VAL A 1 258 ? 50.622 34.628 74.469 1.00 15.28  ? 1057 VAL A CB  1 
ATOM   1969 C CG1 . VAL A 1 258 ? 49.734 35.202 73.365 1.00 14.29  ? 1057 VAL A CG1 1 
ATOM   1970 C CG2 . VAL A 1 258 ? 50.245 35.213 75.832 1.00 15.15  ? 1057 VAL A CG2 1 
ATOM   1971 N N   . ILE A 1 259 ? 49.862 31.856 72.521 1.00 12.78  ? 1058 ILE A N   1 
ATOM   1972 C CA  . ILE A 1 259 ? 49.915 31.280 71.177 1.00 12.81  ? 1058 ILE A CA  1 
ATOM   1973 C C   . ILE A 1 259 ? 49.009 32.100 70.239 1.00 21.10  ? 1058 ILE A C   1 
ATOM   1974 O O   . ILE A 1 259 ? 48.336 33.018 70.713 1.00 21.85  ? 1058 ILE A O   1 
ATOM   1975 C CB  . ILE A 1 259 ? 49.661 29.735 71.113 1.00 14.32  ? 1058 ILE A CB  1 
ATOM   1976 C CG1 . ILE A 1 259 ? 48.337 29.333 71.751 1.00 13.22  ? 1058 ILE A CG1 1 
ATOM   1977 C CG2 . ILE A 1 259 ? 50.812 28.955 71.708 1.00 14.19  ? 1058 ILE A CG2 1 
ATOM   1978 C CD1 . ILE A 1 259 ? 47.609 28.456 70.986 1.00 14.84  ? 1058 ILE A CD1 1 
ATOM   1979 N N   . THR A 1 260 ? 49.027 31.788 68.918 1.00 19.76  ? 1059 THR A N   1 
ATOM   1980 C CA  . THR A 1 260 ? 48.274 32.446 67.836 1.00 20.20  ? 1059 THR A CA  1 
ATOM   1981 C C   . THR A 1 260 ? 47.227 31.473 67.281 1.00 26.17  ? 1059 THR A C   1 
ATOM   1982 O O   . THR A 1 260 ? 47.345 30.282 67.561 1.00 27.01  ? 1059 THR A O   1 
ATOM   1983 C CB  . THR A 1 260 ? 49.255 32.887 66.735 1.00 26.31  ? 1059 THR A CB  1 
ATOM   1984 O OG1 . THR A 1 260 ? 49.663 31.751 65.990 1.00 23.52  ? 1059 THR A OG1 1 
ATOM   1985 C CG2 . THR A 1 260 ? 50.494 33.583 67.287 1.00 26.52  ? 1059 THR A CG2 1 
ATOM   1986 N N   . LYS A 1 261 ? 46.227 31.942 66.489 1.00 23.14  ? 1060 LYS A N   1 
ATOM   1987 C CA  . LYS A 1 261 ? 45.182 31.053 65.931 1.00 22.90  ? 1060 LYS A CA  1 
ATOM   1988 C C   . LYS A 1 261 ? 45.769 29.874 65.168 1.00 28.11  ? 1060 LYS A C   1 
ATOM   1989 O O   . LYS A 1 261 ? 45.307 28.741 65.333 1.00 28.25  ? 1060 LYS A O   1 
ATOM   1990 C CB  . LYS A 1 261 ? 44.215 31.816 65.003 1.00 25.60  ? 1060 LYS A CB  1 
ATOM   1991 C CG  . LYS A 1 261 ? 43.048 30.973 64.454 1.00 32.59  ? 1060 LYS A CG  1 
ATOM   1992 C CD  . LYS A 1 261 ? 43.044 30.883 62.918 1.00 47.01  ? 1060 LYS A CD  1 
ATOM   1993 C CE  . LYS A 1 261 ? 43.803 29.712 62.319 1.00 62.56  ? 1060 LYS A CE  1 
ATOM   1994 N NZ  . LYS A 1 261 ? 43.734 29.706 60.827 1.00 71.99  ? 1060 LYS A NZ  1 
ATOM   1995 N N   . ASP A 1 262 ? 46.768 30.157 64.317 1.00 24.82  ? 1061 ASP A N   1 
ATOM   1996 C CA  . ASP A 1 262 ? 47.431 29.188 63.456 1.00 25.58  ? 1061 ASP A CA  1 
ATOM   1997 C C   . ASP A 1 262 ? 48.185 28.123 64.246 1.00 27.13  ? 1061 ASP A C   1 
ATOM   1998 O O   . ASP A 1 262 ? 48.250 26.969 63.799 1.00 27.67  ? 1061 ASP A O   1 
ATOM   1999 C CB  . ASP A 1 262 ? 48.317 29.912 62.441 1.00 29.95  ? 1061 ASP A CB  1 
ATOM   2000 C CG  . ASP A 1 262 ? 47.546 30.902 61.558 1.00 55.96  ? 1061 ASP A CG  1 
ATOM   2001 O OD1 . ASP A 1 262 ? 47.113 31.970 62.083 1.00 58.96  ? 1061 ASP A OD1 1 
ATOM   2002 O OD2 . ASP A 1 262 ? 47.379 30.616 60.345 1.00 65.21  ? 1061 ASP A OD2 1 
ATOM   2003 N N   . GLU A 1 263 ? 48.706 28.498 65.447 1.00 20.52  ? 1062 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 263 ? 49.408 27.587 66.358 1.00 18.15  ? 1062 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 263 ? 48.326 26.734 67.019 1.00 19.13  ? 1062 GLU A C   1 
ATOM   2006 O O   . GLU A 1 263 ? 48.421 25.517 66.986 1.00 18.44  ? 1062 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 263 ? 50.273 28.349 67.391 1.00 18.46  ? 1062 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 263 ? 51.321 29.240 66.748 1.00 26.15  ? 1062 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 263 ? 52.393 29.895 67.602 1.00 54.28  ? 1062 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 263 ? 52.118 30.260 68.769 1.00 41.12  ? 1062 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 263 ? 53.509 30.093 67.071 1.00 59.56  ? 1062 GLU A OE2 1 
ATOM   2012 N N   . ALA A 1 264 ? 47.251 27.368 67.522 1.00 14.13  ? 1063 ALA A N   1 
ATOM   2013 C CA  . ALA A 1 264 ? 46.103 26.699 68.120 1.00 13.50  ? 1063 ALA A CA  1 
ATOM   2014 C C   . ALA A 1 264 ? 45.516 25.675 67.151 1.00 21.50  ? 1063 ALA A C   1 
ATOM   2015 O O   . ALA A 1 264 ? 45.079 24.611 67.596 1.00 22.00  ? 1063 ALA A O   1 
ATOM   2016 C CB  . ALA A 1 264 ? 45.045 27.720 68.495 1.00 13.40  ? 1063 ALA A CB  1 
ATOM   2017 N N   . GLU A 1 265 ? 45.526 25.981 65.831 1.00 20.19  ? 1064 GLU A N   1 
ATOM   2018 C CA  . GLU A 1 265 ? 45.031 25.065 64.802 1.00 21.40  ? 1064 GLU A CA  1 
ATOM   2019 C C   . GLU A 1 265 ? 46.017 23.911 64.582 1.00 25.94  ? 1064 GLU A C   1 
ATOM   2020 O O   . GLU A 1 265 ? 45.570 22.785 64.418 1.00 26.02  ? 1064 GLU A O   1 
ATOM   2021 C CB  . GLU A 1 265 ? 44.690 25.790 63.489 1.00 23.71  ? 1064 GLU A CB  1 
ATOM   2022 C CG  . GLU A 1 265 ? 43.731 24.995 62.621 1.00 36.83  ? 1064 GLU A CG  1 
ATOM   2023 C CD  . GLU A 1 265 ? 43.483 25.510 61.215 1.00 73.60  ? 1064 GLU A CD  1 
ATOM   2024 O OE1 . GLU A 1 265 ? 43.482 24.684 60.272 1.00 76.35  ? 1064 GLU A OE1 1 
ATOM   2025 O OE2 . GLU A 1 265 ? 43.245 26.731 61.060 1.00 74.87  ? 1064 GLU A OE2 1 
ATOM   2026 N N   . LYS A 1 266 ? 47.347 24.178 64.619 1.00 23.01  ? 1065 LYS A N   1 
ATOM   2027 C CA  . LYS A 1 266 ? 48.395 23.156 64.482 1.00 24.12  ? 1065 LYS A CA  1 
ATOM   2028 C C   . LYS A 1 266 ? 48.208 22.121 65.591 1.00 28.26  ? 1065 LYS A C   1 
ATOM   2029 O O   . LYS A 1 266 ? 48.102 20.923 65.320 1.00 29.09  ? 1065 LYS A O   1 
ATOM   2030 C CB  . LYS A 1 266 ? 49.794 23.803 64.585 1.00 28.29  ? 1065 LYS A CB  1 
ATOM   2031 C CG  . LYS A 1 266 ? 50.977 22.836 64.398 1.00 54.67  ? 1065 LYS A CG  1 
ATOM   2032 C CD  . LYS A 1 266 ? 51.986 22.875 65.562 1.00 63.67  ? 1065 LYS A CD  1 
ATOM   2033 C CE  . LYS A 1 266 ? 53.243 22.092 65.237 1.00 72.86  ? 1065 LYS A CE  1 
ATOM   2034 N NZ  . LYS A 1 266 ? 54.179 22.022 66.389 1.00 78.24  ? 1065 LYS A NZ  1 
ATOM   2035 N N   . LEU A 1 267 ? 48.121 22.607 66.835 1.00 23.74  ? 1066 LEU A N   1 
ATOM   2036 C CA  . LEU A 1 267 ? 47.888 21.833 68.058 1.00 22.67  ? 1066 LEU A CA  1 
ATOM   2037 C C   . LEU A 1 267 ? 46.565 21.090 67.944 1.00 25.48  ? 1066 LEU A C   1 
ATOM   2038 O O   . LEU A 1 267 ? 46.489 19.955 68.404 1.00 26.11  ? 1066 LEU A O   1 
ATOM   2039 C CB  . LEU A 1 267 ? 47.775 22.784 69.269 1.00 21.34  ? 1066 LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 267 ? 48.936 22.935 70.223 1.00 25.09  ? 1066 LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 267 ? 48.609 23.996 71.264 1.00 23.01  ? 1066 LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 267 ? 49.247 21.625 70.914 1.00 27.30  ? 1066 LEU A CD2 1 
ATOM   2043 N N   . PHE A 1 268 ? 45.510 21.750 67.389 1.00 19.48  ? 1067 PHE A N   1 
ATOM   2044 C CA  . PHE A 1 268 ? 44.200 21.131 67.256 1.00 18.40  ? 1067 PHE A CA  1 
ATOM   2045 C C   . PHE A 1 268 ? 44.355 19.931 66.373 1.00 24.92  ? 1067 PHE A C   1 
ATOM   2046 O O   . PHE A 1 268 ? 44.121 18.820 66.839 1.00 26.10  ? 1067 PHE A O   1 
ATOM   2047 C CB  . PHE A 1 268 ? 43.137 22.099 66.700 1.00 19.05  ? 1067 PHE A CB  1 
ATOM   2048 C CG  . PHE A 1 268 ? 41.798 21.444 66.445 1.00 19.67  ? 1067 PHE A CG  1 
ATOM   2049 C CD1 . PHE A 1 268 ? 40.992 21.033 67.502 1.00 21.01  ? 1067 PHE A CD1 1 
ATOM   2050 C CD2 . PHE A 1 268 ? 41.342 21.242 65.152 1.00 22.03  ? 1067 PHE A CD2 1 
ATOM   2051 C CE1 . PHE A 1 268 ? 39.751 20.443 67.267 1.00 21.45  ? 1067 PHE A CE1 1 
ATOM   2052 C CE2 . PHE A 1 268 ? 40.097 20.647 64.918 1.00 24.60  ? 1067 PHE A CE2 1 
ATOM   2053 C CZ  . PHE A 1 268 ? 39.309 20.256 65.977 1.00 21.59  ? 1067 PHE A CZ  1 
ATOM   2054 N N   . ASN A 1 269 ? 44.856 20.141 65.133 1.00 21.76  ? 1068 ASN A N   1 
ATOM   2055 C CA  . ASN A 1 269 ? 45.119 19.090 64.148 1.00 22.50  ? 1068 ASN A CA  1 
ATOM   2056 C C   . ASN A 1 269 ? 45.838 17.877 64.772 1.00 29.06  ? 1068 ASN A C   1 
ATOM   2057 O O   . ASN A 1 269 ? 45.527 16.758 64.398 1.00 31.18  ? 1068 ASN A O   1 
ATOM   2058 C CB  . ASN A 1 269 ? 45.871 19.646 62.937 1.00 19.89  ? 1068 ASN A CB  1 
ATOM   2059 C CG  . ASN A 1 269 ? 45.090 20.669 62.136 1.00 42.75  ? 1068 ASN A CG  1 
ATOM   2060 O OD1 . ASN A 1 269 ? 43.915 20.962 62.395 1.00 36.46  ? 1068 ASN A OD1 1 
ATOM   2061 N ND2 . ASN A 1 269 ? 45.730 21.247 61.137 1.00 36.95  ? 1068 ASN A ND2 1 
ATOM   2062 N N   . GLN A 1 270 ? 46.731 18.084 65.762 1.00 24.73  ? 1069 GLN A N   1 
ATOM   2063 C CA  . GLN A 1 270 ? 47.403 16.976 66.430 1.00 24.71  ? 1069 GLN A CA  1 
ATOM   2064 C C   . GLN A 1 270 ? 46.385 16.196 67.224 1.00 27.37  ? 1069 GLN A C   1 
ATOM   2065 O O   . GLN A 1 270 ? 46.193 15.019 66.948 1.00 28.86  ? 1069 GLN A O   1 
ATOM   2066 C CB  . GLN A 1 270 ? 48.570 17.457 67.304 1.00 25.95  ? 1069 GLN A CB  1 
ATOM   2067 C CG  . GLN A 1 270 ? 49.759 17.965 66.495 1.00 39.52  ? 1069 GLN A CG  1 
ATOM   2068 C CD  . GLN A 1 270 ? 50.750 18.762 67.304 1.00 62.43  ? 1069 GLN A CD  1 
ATOM   2069 O OE1 . GLN A 1 270 ? 50.916 18.594 68.526 1.00 56.70  ? 1069 GLN A OE1 1 
ATOM   2070 N NE2 . GLN A 1 270 ? 51.458 19.638 66.617 1.00 55.72  ? 1069 GLN A NE2 1 
ATOM   2071 N N   . ASP A 1 271 ? 45.650 16.876 68.120 1.00 23.02  ? 1070 ASP A N   1 
ATOM   2072 C CA  . ASP A 1 271 ? 44.583 16.313 68.967 1.00 21.94  ? 1070 ASP A CA  1 
ATOM   2073 C C   . ASP A 1 271 ? 43.519 15.540 68.183 1.00 24.47  ? 1070 ASP A C   1 
ATOM   2074 O O   . ASP A 1 271 ? 43.022 14.557 68.702 1.00 23.88  ? 1070 ASP A O   1 
ATOM   2075 C CB  . ASP A 1 271 ? 43.937 17.405 69.842 1.00 22.18  ? 1070 ASP A CB  1 
ATOM   2076 C CG  . ASP A 1 271 ? 44.767 17.858 71.035 1.00 38.15  ? 1070 ASP A CG  1 
ATOM   2077 O OD1 . ASP A 1 271 ? 44.522 18.983 71.537 1.00 39.82  ? 1070 ASP A OD1 1 
ATOM   2078 O OD2 . ASP A 1 271 ? 45.644 17.079 71.486 1.00 46.07  ? 1070 ASP A OD2 1 
ATOM   2079 N N   . VAL A 1 272 ? 43.221 15.943 66.937 1.00 20.97  ? 1071 VAL A N   1 
ATOM   2080 C CA  . VAL A 1 272 ? 42.249 15.283 66.051 1.00 21.85  ? 1071 VAL A CA  1 
ATOM   2081 C C   . VAL A 1 272 ? 42.767 13.909 65.548 1.00 28.93  ? 1071 VAL A C   1 
ATOM   2082 O O   . VAL A 1 272 ? 42.012 12.922 65.525 1.00 27.99  ? 1071 VAL A O   1 
ATOM   2083 C CB  . VAL A 1 272 ? 41.830 16.203 64.876 1.00 25.39  ? 1071 VAL A CB  1 
ATOM   2084 C CG1 . VAL A 1 272 ? 40.780 15.532 63.996 1.00 25.68  ? 1071 VAL A CG1 1 
ATOM   2085 C CG2 . VAL A 1 272 ? 41.310 17.527 65.400 1.00 23.90  ? 1071 VAL A CG2 1 
ATOM   2086 N N   . ASP A 1 273 ? 44.046 13.870 65.114 1.00 27.63  ? 1072 ASP A N   1 
ATOM   2087 C CA  . ASP A 1 273 ? 44.711 12.650 64.672 1.00 29.98  ? 1072 ASP A CA  1 
ATOM   2088 C C   . ASP A 1 273 ? 44.742 11.739 65.908 1.00 34.34  ? 1072 ASP A C   1 
ATOM   2089 O O   . ASP A 1 273 ? 44.213 10.622 65.859 1.00 34.69  ? 1072 ASP A O   1 
ATOM   2090 C CB  . ASP A 1 273 ? 46.124 12.952 64.146 1.00 33.47  ? 1072 ASP A CB  1 
ATOM   2091 C CG  . ASP A 1 273 ? 46.202 13.951 62.992 1.00 56.03  ? 1072 ASP A CG  1 
ATOM   2092 O OD1 . ASP A 1 273 ? 45.292 13.938 62.119 1.00 58.94  ? 1072 ASP A OD1 1 
ATOM   2093 O OD2 . ASP A 1 273 ? 47.186 14.732 62.946 1.00 65.73  ? 1072 ASP A OD2 1 
ATOM   2094 N N   . ALA A 1 274 ? 45.200 12.286 67.055 1.00 29.00  ? 1073 ALA A N   1 
ATOM   2095 C CA  . ALA A 1 274 ? 45.208 11.578 68.327 1.00 28.17  ? 1073 ALA A CA  1 
ATOM   2096 C C   . ALA A 1 274 ? 43.819 10.995 68.680 1.00 30.85  ? 1073 ALA A C   1 
ATOM   2097 O O   . ALA A 1 274 ? 43.751 9.907  69.240 1.00 30.13  ? 1073 ALA A O   1 
ATOM   2098 C CB  . ALA A 1 274 ? 45.681 12.506 69.423 1.00 27.63  ? 1073 ALA A CB  1 
ATOM   2099 N N   . ALA A 1 275 ? 42.718 11.698 68.320 1.00 26.59  ? 1074 ALA A N   1 
ATOM   2100 C CA  . ALA A 1 275 ? 41.347 11.252 68.608 1.00 25.20  ? 1074 ALA A CA  1 
ATOM   2101 C C   . ALA A 1 275 ? 40.921 10.175 67.642 1.00 31.83  ? 1074 ALA A C   1 
ATOM   2102 O O   . ALA A 1 275 ? 40.386 9.174  68.113 1.00 32.92  ? 1074 ALA A O   1 
ATOM   2103 C CB  . ALA A 1 275 ? 40.361 12.417 68.593 1.00 23.66  ? 1074 ALA A CB  1 
ATOM   2104 N N   . VAL A 1 276 ? 41.177 10.341 66.313 1.00 28.71  ? 1075 VAL A N   1 
ATOM   2105 C CA  . VAL A 1 276 ? 40.845 9.302  65.329 1.00 30.09  ? 1075 VAL A CA  1 
ATOM   2106 C C   . VAL A 1 276 ? 41.632 8.001  65.597 1.00 36.47  ? 1075 VAL A C   1 
ATOM   2107 O O   . VAL A 1 276 ? 41.004 6.944  65.657 1.00 37.87  ? 1075 VAL A O   1 
ATOM   2108 C CB  . VAL A 1 276 ? 40.828 9.739  63.845 1.00 34.59  ? 1075 VAL A CB  1 
ATOM   2109 C CG1 . VAL A 1 276 ? 39.874 10.898 63.632 1.00 32.71  ? 1075 VAL A CG1 1 
ATOM   2110 C CG2 . VAL A 1 276 ? 42.213 10.103 63.341 1.00 35.72  ? 1075 VAL A CG2 1 
ATOM   2111 N N   . ARG A 1 277 ? 42.965 8.092  65.882 1.00 32.73  ? 1076 ARG A N   1 
ATOM   2112 C CA  . ARG A 1 277 ? 43.804 6.939  66.250 1.00 34.47  ? 1076 ARG A CA  1 
ATOM   2113 C C   . ARG A 1 277 ? 43.145 6.181  67.411 1.00 39.06  ? 1076 ARG A C   1 
ATOM   2114 O O   . ARG A 1 277 ? 42.897 4.985  67.303 1.00 40.59  ? 1076 ARG A O   1 
ATOM   2115 C CB  . ARG A 1 277 ? 45.235 7.371  66.652 1.00 35.35  ? 1076 ARG A CB  1 
ATOM   2116 C CG  . ARG A 1 277 ? 46.189 7.604  65.465 1.00 48.79  ? 1076 ARG A CG  1 
ATOM   2117 C CD  . ARG A 1 277 ? 47.381 8.505  65.790 1.00 53.14  ? 1076 ARG A CD  1 
ATOM   2118 N NE  . ARG A 1 277 ? 47.966 8.180  67.093 1.00 65.94  ? 1076 ARG A NE  1 
ATOM   2119 C CZ  . ARG A 1 277 ? 48.407 9.080  67.967 1.00 85.50  ? 1076 ARG A CZ  1 
ATOM   2120 N NH1 . ARG A 1 277 ? 48.363 10.375 67.676 1.00 74.61  ? 1076 ARG A NH1 1 
ATOM   2121 N NH2 . ARG A 1 277 ? 48.904 8.692  69.136 1.00 75.54  ? 1076 ARG A NH2 1 
ATOM   2122 N N   . GLY A 1 278 ? 42.789 6.903  68.462 1.00 34.36  ? 1077 GLY A N   1 
ATOM   2123 C CA  . GLY A 1 278 ? 42.119 6.340  69.626 1.00 33.84  ? 1077 GLY A CA  1 
ATOM   2124 C C   . GLY A 1 278 ? 40.756 5.743  69.332 1.00 35.77  ? 1077 GLY A C   1 
ATOM   2125 O O   . GLY A 1 278 ? 40.379 4.762  69.978 1.00 36.90  ? 1077 GLY A O   1 
ATOM   2126 N N   . ILE A 1 279 ? 40.002 6.330  68.366 1.00 28.91  ? 1078 ILE A N   1 
ATOM   2127 C CA  . ILE A 1 279 ? 38.675 5.844  67.990 1.00 27.74  ? 1078 ILE A CA  1 
ATOM   2128 C C   . ILE A 1 279 ? 38.865 4.483  67.369 1.00 35.67  ? 1078 ILE A C   1 
ATOM   2129 O O   . ILE A 1 279 ? 38.180 3.539  67.770 1.00 36.34  ? 1078 ILE A O   1 
ATOM   2130 C CB  . ILE A 1 279 ? 37.906 6.826  67.051 1.00 28.76  ? 1078 ILE A CB  1 
ATOM   2131 C CG1 . ILE A 1 279 ? 37.250 7.958  67.845 1.00 26.16  ? 1078 ILE A CG1 1 
ATOM   2132 C CG2 . ILE A 1 279 ? 36.851 6.122  66.188 1.00 29.69  ? 1078 ILE A CG2 1 
ATOM   2133 C CD1 . ILE A 1 279 ? 37.104 9.224  67.036 1.00 29.90  ? 1078 ILE A CD1 1 
ATOM   2134 N N   . LEU A 1 280 ? 39.813 4.376  66.405 1.00 33.12  ? 1079 LEU A N   1 
ATOM   2135 C CA  . LEU A 1 280 ? 40.103 3.131  65.682 1.00 35.10  ? 1079 LEU A CA  1 
ATOM   2136 C C   . LEU A 1 280 ? 40.679 2.014  66.582 1.00 40.51  ? 1079 LEU A C   1 
ATOM   2137 O O   . LEU A 1 280 ? 40.374 0.845  66.352 1.00 41.96  ? 1079 LEU A O   1 
ATOM   2138 C CB  . LEU A 1 280 ? 40.949 3.380  64.418 1.00 36.18  ? 1079 LEU A CB  1 
ATOM   2139 C CG  . LEU A 1 280 ? 40.422 4.409  63.387 1.00 38.72  ? 1079 LEU A CG  1 
ATOM   2140 C CD1 . LEU A 1 280 ? 41.420 4.605  62.269 1.00 39.97  ? 1079 LEU A CD1 1 
ATOM   2141 C CD2 . LEU A 1 280 ? 39.065 4.011  62.800 1.00 39.55  ? 1079 LEU A CD2 1 
ATOM   2142 N N   . ARG A 1 281 ? 41.429 2.375  67.650 1.00 36.38  ? 1080 ARG A N   1 
ATOM   2143 C CA  . ARG A 1 281 ? 41.949 1.416  68.639 1.00 37.13  ? 1080 ARG A CA  1 
ATOM   2144 C C   . ARG A 1 281 ? 40.779 0.893  69.510 1.00 38.55  ? 1080 ARG A C   1 
ATOM   2145 O O   . ARG A 1 281 ? 40.998 0.085  70.422 1.00 37.13  ? 1080 ARG A O   1 
ATOM   2146 C CB  . ARG A 1 281 ? 42.999 2.073  69.573 1.00 35.20  ? 1080 ARG A CB  1 
ATOM   2147 C CG  . ARG A 1 281 ? 44.332 2.409  68.944 1.00 39.38  ? 1080 ARG A CG  1 
ATOM   2148 C CD  . ARG A 1 281 ? 45.345 2.761  70.024 1.00 50.98  ? 1080 ARG A CD  1 
ATOM   2149 N NE  . ARG A 1 281 ? 46.293 3.800  69.594 1.00 65.01  ? 1080 ARG A NE  1 
ATOM   2150 C CZ  . ARG A 1 281 ? 47.417 3.580  68.911 1.00 82.53  ? 1080 ARG A CZ  1 
ATOM   2151 N NH1 . ARG A 1 281 ? 47.758 2.347  68.554 1.00 72.74  ? 1080 ARG A NH1 1 
ATOM   2152 N NH2 . ARG A 1 281 ? 48.201 4.591  68.571 1.00 68.63  ? 1080 ARG A NH2 1 
ATOM   2153 N N   . ASN A 1 282 ? 39.554 1.406  69.260 1.00 35.06  ? 1081 ASN A N   1 
ATOM   2154 C CA  . ASN A 1 282 ? 38.359 1.053  70.026 1.00 35.12  ? 1081 ASN A CA  1 
ATOM   2155 C C   . ASN A 1 282 ? 37.454 0.090  69.293 1.00 42.81  ? 1081 ASN A C   1 
ATOM   2156 O O   . ASN A 1 282 ? 37.094 0.317  68.129 1.00 43.22  ? 1081 ASN A O   1 
ATOM   2157 C CB  . ASN A 1 282 ? 37.593 2.289  70.482 1.00 30.11  ? 1081 ASN A CB  1 
ATOM   2158 C CG  . ASN A 1 282 ? 36.848 2.070  71.757 1.00 55.84  ? 1081 ASN A CG  1 
ATOM   2159 O OD1 . ASN A 1 282 ? 35.695 1.627  71.760 1.00 48.12  ? 1081 ASN A OD1 1 
ATOM   2160 N ND2 . ASN A 1 282 ? 37.498 2.383  72.868 1.00 51.41  ? 1081 ASN A ND2 1 
ATOM   2161 N N   . ALA A 1 283 ? 37.087 -0.992 70.000 1.00 41.31  ? 1082 ALA A N   1 
ATOM   2162 C CA  . ALA A 1 283 ? 36.249 -2.072 69.489 1.00 43.16  ? 1082 ALA A CA  1 
ATOM   2163 C C   . ALA A 1 283 ? 34.813 -1.661 69.188 1.00 46.28  ? 1082 ALA A C   1 
ATOM   2164 O O   . ALA A 1 283 ? 34.297 -2.018 68.139 1.00 46.97  ? 1082 ALA A O   1 
ATOM   2165 C CB  . ALA A 1 283 ? 36.275 -3.242 70.451 1.00 45.73  ? 1082 ALA A CB  1 
ATOM   2166 N N   . LYS A 1 284 ? 34.171 -0.920 70.089 1.00 42.05  ? 1083 LYS A N   1 
ATOM   2167 C CA  . LYS A 1 284 ? 32.797 -0.459 69.893 1.00 40.76  ? 1083 LYS A CA  1 
ATOM   2168 C C   . LYS A 1 284 ? 32.746 0.729  68.915 1.00 44.47  ? 1083 LYS A C   1 
ATOM   2169 O O   . LYS A 1 284 ? 31.709 0.966  68.277 1.00 44.41  ? 1083 LYS A O   1 
ATOM   2170 C CB  . LYS A 1 284 ? 32.173 -0.053 71.242 1.00 41.40  ? 1083 LYS A CB  1 
ATOM   2171 C CG  . LYS A 1 284 ? 31.746 -1.230 72.116 1.00 56.66  ? 1083 LYS A CG  1 
ATOM   2172 C CD  . LYS A 1 284 ? 30.892 -0.798 73.309 1.00 62.82  ? 1083 LYS A CD  1 
ATOM   2173 C CE  . LYS A 1 284 ? 29.406 -0.975 73.103 1.00 70.57  ? 1083 LYS A CE  1 
ATOM   2174 N NZ  . LYS A 1 284 ? 28.667 -0.794 74.379 1.00 78.32  ? 1083 LYS A NZ  1 
ATOM   2175 N N   . LEU A 1 285 ? 33.852 1.457  68.803 1.00 39.95  ? 1084 LEU A N   1 
ATOM   2176 C CA  . LEU A 1 285 ? 33.900 2.655  67.973 1.00 38.23  ? 1084 LEU A CA  1 
ATOM   2177 C C   . LEU A 1 285 ? 34.220 2.367  66.507 1.00 43.40  ? 1084 LEU A C   1 
ATOM   2178 O O   . LEU A 1 285 ? 33.443 2.715  65.617 1.00 43.45  ? 1084 LEU A O   1 
ATOM   2179 C CB  . LEU A 1 285 ? 34.912 3.654  68.540 1.00 37.09  ? 1084 LEU A CB  1 
ATOM   2180 C CG  . LEU A 1 285 ? 34.401 4.585  69.642 1.00 39.16  ? 1084 LEU A CG  1 
ATOM   2181 C CD1 . LEU A 1 285 ? 35.542 5.400  70.230 1.00 40.01  ? 1084 LEU A CD1 1 
ATOM   2182 C CD2 . LEU A 1 285 ? 33.304 5.495  69.111 1.00 36.71  ? 1084 LEU A CD2 1 
ATOM   2183 N N   . LYS A 1 286 ? 35.366 1.742  66.259 1.00 40.30  ? 1085 LYS A N   1 
ATOM   2184 C CA  . LYS A 1 286 ? 35.837 1.517  64.873 1.00 40.35  ? 1085 LYS A CA  1 
ATOM   2185 C C   . LYS A 1 286 ? 34.696 1.234  63.839 1.00 40.99  ? 1085 LYS A C   1 
ATOM   2186 O O   . LYS A 1 286 ? 34.628 1.983  62.864 1.00 38.50  ? 1085 LYS A O   1 
ATOM   2187 C CB  . LYS A 1 286 ? 37.011 0.511  64.795 1.00 45.12  ? 1085 LYS A CB  1 
ATOM   2188 C CG  . LYS A 1 286 ? 37.757 0.499  63.457 1.00 60.90  ? 1085 LYS A CG  1 
ATOM   2189 C CD  . LYS A 1 286 ? 39.113 -0.230 63.545 1.00 69.68  ? 1085 LYS A CD  1 
ATOM   2190 C CE  . LYS A 1 286 ? 39.586 -0.818 62.229 1.00 80.23  ? 1085 LYS A CE  1 
ATOM   2191 N NZ  . LYS A 1 286 ? 40.066 0.210  61.260 1.00 91.07  ? 1085 LYS A NZ  1 
ATOM   2192 N N   . PRO A 1 287 ? 33.729 0.295  64.071 1.00 37.86  ? 1086 PRO A N   1 
ATOM   2193 C CA  . PRO A 1 287 ? 32.663 0.076  63.073 1.00 38.61  ? 1086 PRO A CA  1 
ATOM   2194 C C   . PRO A 1 287 ? 31.712 1.245  62.781 1.00 43.16  ? 1086 PRO A C   1 
ATOM   2195 O O   . PRO A 1 287 ? 31.207 1.336  61.649 1.00 44.29  ? 1086 PRO A O   1 
ATOM   2196 C CB  . PRO A 1 287 ? 31.912 -1.136 63.624 1.00 40.69  ? 1086 PRO A CB  1 
ATOM   2197 C CG  . PRO A 1 287 ? 32.171 -1.111 65.075 1.00 43.38  ? 1086 PRO A CG  1 
ATOM   2198 C CD  . PRO A 1 287 ? 33.601 -0.679 65.175 1.00 39.11  ? 1086 PRO A CD  1 
ATOM   2199 N N   . VAL A 1 288 ? 31.446 2.131  63.781 1.00 37.38  ? 1087 VAL A N   1 
ATOM   2200 C CA  . VAL A 1 288 ? 30.534 3.263  63.566 1.00 35.30  ? 1087 VAL A CA  1 
ATOM   2201 C C   . VAL A 1 288 ? 31.208 4.336  62.742 1.00 40.04  ? 1087 VAL A C   1 
ATOM   2202 O O   . VAL A 1 288 ? 30.689 4.716  61.693 1.00 41.63  ? 1087 VAL A O   1 
ATOM   2203 C CB  . VAL A 1 288 ? 29.913 3.839  64.847 1.00 36.60  ? 1087 VAL A CB  1 
ATOM   2204 C CG1 . VAL A 1 288 ? 28.741 4.749  64.491 1.00 35.35  ? 1087 VAL A CG1 1 
ATOM   2205 C CG2 . VAL A 1 288 ? 29.464 2.724  65.785 1.00 36.78  ? 1087 VAL A CG2 1 
ATOM   2206 N N   . TYR A 1 289 ? 32.376 4.802  63.213 1.00 34.81  ? 1088 TYR A N   1 
ATOM   2207 C CA  . TYR A 1 289 ? 33.207 5.796  62.552 1.00 33.49  ? 1088 TYR A CA  1 
ATOM   2208 C C   . TYR A 1 289 ? 33.342 5.448  61.057 1.00 38.86  ? 1088 TYR A C   1 
ATOM   2209 O O   . TYR A 1 289 ? 32.901 6.238  60.215 1.00 38.48  ? 1088 TYR A O   1 
ATOM   2210 C CB  . TYR A 1 289 ? 34.579 5.864  63.260 1.00 34.00  ? 1088 TYR A CB  1 
ATOM   2211 C CG  . TYR A 1 289 ? 35.564 6.837  62.647 1.00 35.62  ? 1088 TYR A CG  1 
ATOM   2212 C CD1 . TYR A 1 289 ? 35.437 8.211  62.848 1.00 35.76  ? 1088 TYR A CD1 1 
ATOM   2213 C CD2 . TYR A 1 289 ? 36.644 6.384  61.894 1.00 38.18  ? 1088 TYR A CD2 1 
ATOM   2214 C CE1 . TYR A 1 289 ? 36.340 9.111  62.286 1.00 35.91  ? 1088 TYR A CE1 1 
ATOM   2215 C CE2 . TYR A 1 289 ? 37.561 7.274  61.339 1.00 39.41  ? 1088 TYR A CE2 1 
ATOM   2216 C CZ  . TYR A 1 289 ? 37.400 8.639  61.532 1.00 46.17  ? 1088 TYR A CZ  1 
ATOM   2217 O OH  . TYR A 1 289 ? 38.278 9.529  60.962 1.00 48.60  ? 1088 TYR A OH  1 
ATOM   2218 N N   . ASP A 1 290 ? 33.848 4.213  60.747 1.00 35.92  ? 1089 ASP A N   1 
ATOM   2219 C CA  . ASP A 1 290 ? 34.055 3.683  59.391 1.00 36.59  ? 1089 ASP A CA  1 
ATOM   2220 C C   . ASP A 1 290 ? 32.827 3.827  58.512 1.00 39.91  ? 1089 ASP A C   1 
ATOM   2221 O O   . ASP A 1 290 ? 32.952 4.279  57.386 1.00 40.49  ? 1089 ASP A O   1 
ATOM   2222 C CB  . ASP A 1 290 ? 34.536 2.226  59.423 1.00 40.33  ? 1089 ASP A CB  1 
ATOM   2223 C CG  . ASP A 1 290 ? 35.967 2.005  59.890 1.00 49.65  ? 1089 ASP A CG  1 
ATOM   2224 O OD1 . ASP A 1 290 ? 36.738 2.985  59.931 1.00 47.14  ? 1089 ASP A OD1 1 
ATOM   2225 O OD2 . ASP A 1 290 ? 36.325 0.833  60.190 1.00 61.51  ? 1089 ASP A OD2 1 
ATOM   2226 N N   . SER A 1 291 ? 31.642 3.492  59.030 1.00 36.14  ? 1090 SER A N   1 
ATOM   2227 C CA  . SER A 1 291 ? 30.393 3.608  58.279 1.00 36.53  ? 1090 SER A CA  1 
ATOM   2228 C C   . SER A 1 291 ? 30.034 5.071  57.968 1.00 40.14  ? 1090 SER A C   1 
ATOM   2229 O O   . SER A 1 291 ? 29.375 5.340  56.959 1.00 40.92  ? 1090 SER A O   1 
ATOM   2230 C CB  . SER A 1 291 ? 29.251 2.970  59.067 1.00 38.30  ? 1090 SER A CB  1 
ATOM   2231 O OG  . SER A 1 291 ? 28.141 3.851  59.212 1.00 43.89  ? 1090 SER A OG  1 
ATOM   2232 N N   . LEU A 1 292 ? 30.417 5.998  58.882 1.00 34.46  ? 1091 LEU A N   1 
ATOM   2233 C CA  . LEU A 1 292 ? 30.067 7.419  58.838 1.00 32.49  ? 1091 LEU A CA  1 
ATOM   2234 C C   . LEU A 1 292 ? 30.807 8.227  57.819 1.00 39.36  ? 1091 LEU A C   1 
ATOM   2235 O O   . LEU A 1 292 ? 32.020 8.068  57.651 1.00 39.57  ? 1091 LEU A O   1 
ATOM   2236 C CB  . LEU A 1 292 ? 30.173 8.097  60.229 1.00 29.36  ? 1091 LEU A CB  1 
ATOM   2237 C CG  . LEU A 1 292 ? 29.204 7.632  61.293 1.00 31.67  ? 1091 LEU A CG  1 
ATOM   2238 C CD1 . LEU A 1 292 ? 29.589 8.159  62.623 1.00 28.90  ? 1091 LEU A CD1 1 
ATOM   2239 C CD2 . LEU A 1 292 ? 27.784 8.016  60.963 1.00 34.44  ? 1091 LEU A CD2 1 
ATOM   2240 N N   . ASP A 1 293 ? 30.070 9.160  57.193 1.00 37.29  ? 1092 ASP A N   1 
ATOM   2241 C CA  . ASP A 1 293 ? 30.582 10.124 56.225 1.00 38.21  ? 1092 ASP A CA  1 
ATOM   2242 C C   . ASP A 1 293 ? 31.464 11.209 56.881 1.00 40.39  ? 1092 ASP A C   1 
ATOM   2243 O O   . ASP A 1 293 ? 31.576 11.280 58.109 1.00 38.75  ? 1092 ASP A O   1 
ATOM   2244 C CB  . ASP A 1 293 ? 29.404 10.788 55.504 1.00 41.17  ? 1092 ASP A CB  1 
ATOM   2245 C CG  . ASP A 1 293 ? 28.419 11.478 56.421 1.00 52.02  ? 1092 ASP A CG  1 
ATOM   2246 O OD1 . ASP A 1 293 ? 27.344 10.899 56.674 1.00 52.56  ? 1092 ASP A OD1 1 
ATOM   2247 O OD2 . ASP A 1 293 ? 28.705 12.620 56.846 1.00 56.13  ? 1092 ASP A OD2 1 
ATOM   2248 N N   . ALA A 1 294 ? 32.029 12.088 56.041 1.00 36.74  ? 1093 ALA A N   1 
ATOM   2249 C CA  . ALA A 1 294 ? 32.871 13.240 56.378 1.00 34.28  ? 1093 ALA A CA  1 
ATOM   2250 C C   . ALA A 1 294 ? 32.350 14.087 57.542 1.00 34.61  ? 1093 ALA A C   1 
ATOM   2251 O O   . ALA A 1 294 ? 33.062 14.230 58.539 1.00 33.27  ? 1093 ALA A O   1 
ATOM   2252 C CB  . ALA A 1 294 ? 33.018 14.120 55.153 1.00 36.36  ? 1093 ALA A CB  1 
ATOM   2253 N N   . VAL A 1 295 ? 31.141 14.625 57.420 1.00 30.06  ? 1094 VAL A N   1 
ATOM   2254 C CA  . VAL A 1 295 ? 30.576 15.479 58.461 1.00 27.82  ? 1094 VAL A CA  1 
ATOM   2255 C C   . VAL A 1 295 ? 30.154 14.693 59.701 1.00 30.17  ? 1094 VAL A C   1 
ATOM   2256 O O   . VAL A 1 295 ? 30.341 15.150 60.829 1.00 28.05  ? 1094 VAL A O   1 
ATOM   2257 C CB  . VAL A 1 295 ? 29.365 16.277 57.938 1.00 32.65  ? 1094 VAL A CB  1 
ATOM   2258 C CG1 . VAL A 1 295 ? 29.466 16.466 56.432 1.00 34.79  ? 1094 VAL A CG1 1 
ATOM   2259 C CG2 . VAL A 1 295 ? 28.068 15.575 58.309 1.00 33.03  ? 1094 VAL A CG2 1 
ATOM   2260 N N   . ARG A 1 296 ? 29.580 13.514 59.486 1.00 27.18  ? 1095 ARG A N   1 
ATOM   2261 C CA  . ARG A 1 296 ? 29.083 12.686 60.580 1.00 25.56  ? 1095 ARG A CA  1 
ATOM   2262 C C   . ARG A 1 296 ? 30.211 12.157 61.443 1.00 28.68  ? 1095 ARG A C   1 
ATOM   2263 O O   . ARG A 1 296 ? 30.002 11.982 62.641 1.00 27.78  ? 1095 ARG A O   1 
ATOM   2264 C CB  . ARG A 1 296 ? 28.129 11.597 60.089 1.00 25.67  ? 1095 ARG A CB  1 
ATOM   2265 C CG  . ARG A 1 296 ? 26.743 12.145 59.723 1.00 27.78  ? 1095 ARG A CG  1 
ATOM   2266 C CD  . ARG A 1 296 ? 25.746 11.035 59.486 1.00 27.30  ? 1095 ARG A CD  1 
ATOM   2267 N NE  . ARG A 1 296 ? 24.387 11.536 59.293 1.00 32.10  ? 1095 ARG A NE  1 
ATOM   2268 C CZ  . ARG A 1 296 ? 23.803 11.676 58.107 1.00 44.73  ? 1095 ARG A CZ  1 
ATOM   2269 N NH1 . ARG A 1 296 ? 24.457 11.361 56.997 1.00 31.60  ? 1095 ARG A NH1 1 
ATOM   2270 N NH2 . ARG A 1 296 ? 22.562 12.144 58.022 1.00 31.23  ? 1095 ARG A NH2 1 
ATOM   2271 N N   . ARG A 1 297 ? 31.426 11.986 60.865 1.00 24.99  ? 1096 ARG A N   1 
ATOM   2272 C CA  . ARG A 1 297 ? 32.630 11.576 61.611 1.00 23.52  ? 1096 ARG A CA  1 
ATOM   2273 C C   . ARG A 1 297 ? 33.031 12.708 62.556 1.00 25.80  ? 1096 ARG A C   1 
ATOM   2274 O O   . ARG A 1 297 ? 33.391 12.437 63.706 1.00 25.18  ? 1096 ARG A O   1 
ATOM   2275 C CB  . ARG A 1 297 ? 33.797 11.252 60.672 1.00 22.42  ? 1096 ARG A CB  1 
ATOM   2276 C CG  . ARG A 1 297 ? 33.688 9.891  60.010 1.00 34.11  ? 1096 ARG A CG  1 
ATOM   2277 C CD  . ARG A 1 297 ? 34.655 9.772  58.853 1.00 47.65  ? 1096 ARG A CD  1 
ATOM   2278 N NE  . ARG A 1 297 ? 35.433 8.534  58.921 1.00 57.22  ? 1096 ARG A NE  1 
ATOM   2279 C CZ  . ARG A 1 297 ? 35.409 7.583  57.993 1.00 74.82  ? 1096 ARG A CZ  1 
ATOM   2280 N NH1 . ARG A 1 297 ? 34.655 7.722  56.908 1.00 63.69  ? 1096 ARG A NH1 1 
ATOM   2281 N NH2 . ARG A 1 297 ? 36.148 6.490  58.137 1.00 63.19  ? 1096 ARG A NH2 1 
ATOM   2282 N N   . ALA A 1 298 ? 32.921 13.985 62.074 1.00 21.14  ? 1097 ALA A N   1 
ATOM   2283 C CA  . ALA A 1 298 ? 33.242 15.193 62.840 1.00 18.57  ? 1097 ALA A CA  1 
ATOM   2284 C C   . ALA A 1 298 ? 32.389 15.243 64.100 1.00 22.25  ? 1097 ALA A C   1 
ATOM   2285 O O   . ALA A 1 298 ? 32.970 15.347 65.197 1.00 21.91  ? 1097 ALA A O   1 
ATOM   2286 C CB  . ALA A 1 298 ? 33.033 16.435 62.001 1.00 18.95  ? 1097 ALA A CB  1 
ATOM   2287 N N   . ALA A 1 299 ? 31.033 15.048 63.957 1.00 16.78  ? 1098 ALA A N   1 
ATOM   2288 C CA  . ALA A 1 299 ? 30.091 14.966 65.076 1.00 15.22  ? 1098 ALA A CA  1 
ATOM   2289 C C   . ALA A 1 299 ? 30.513 13.894 66.079 1.00 21.29  ? 1098 ALA A C   1 
ATOM   2290 O O   . ALA A 1 299 ? 30.393 14.128 67.281 1.00 20.81  ? 1098 ALA A O   1 
ATOM   2291 C CB  . ALA A 1 299 ? 28.706 14.668 64.577 1.00 16.42  ? 1098 ALA A CB  1 
ATOM   2292 N N   . LEU A 1 300 ? 31.046 12.736 65.604 1.00 19.58  ? 1099 LEU A N   1 
ATOM   2293 C CA  . LEU A 1 300 ? 31.539 11.687 66.505 1.00 18.81  ? 1099 LEU A CA  1 
ATOM   2294 C C   . LEU A 1 300 ? 32.861 12.104 67.176 1.00 21.97  ? 1099 LEU A C   1 
ATOM   2295 O O   . LEU A 1 300 ? 32.958 11.990 68.393 1.00 21.26  ? 1099 LEU A O   1 
ATOM   2296 C CB  . LEU A 1 300 ? 31.666 10.331 65.803 1.00 19.95  ? 1099 LEU A CB  1 
ATOM   2297 C CG  . LEU A 1 300 ? 31.923 9.154  66.736 1.00 24.39  ? 1099 LEU A CG  1 
ATOM   2298 C CD1 . LEU A 1 300 ? 30.655 8.397  66.996 1.00 25.27  ? 1099 LEU A CD1 1 
ATOM   2299 C CD2 . LEU A 1 300 ? 33.028 8.265  66.213 1.00 26.85  ? 1099 LEU A CD2 1 
ATOM   2300 N N   . ILE A 1 301 ? 33.844 12.623 66.409 1.00 19.15  ? 1100 ILE A N   1 
ATOM   2301 C CA  . ILE A 1 301 ? 35.115 13.150 66.961 1.00 19.32  ? 1100 ILE A CA  1 
ATOM   2302 C C   . ILE A 1 301 ? 34.807 14.202 68.081 1.00 24.11  ? 1100 ILE A C   1 
ATOM   2303 O O   . ILE A 1 301 ? 35.378 14.155 69.182 1.00 22.44  ? 1100 ILE A O   1 
ATOM   2304 C CB  . ILE A 1 301 ? 35.988 13.759 65.822 1.00 22.24  ? 1100 ILE A CB  1 
ATOM   2305 C CG1 . ILE A 1 301 ? 36.597 12.638 64.940 1.00 23.51  ? 1100 ILE A CG1 1 
ATOM   2306 C CG2 . ILE A 1 301 ? 37.085 14.712 66.369 1.00 20.13  ? 1100 ILE A CG2 1 
ATOM   2307 C CD1 . ILE A 1 301 ? 36.614 12.929 63.477 1.00 26.15  ? 1100 ILE A CD1 1 
ATOM   2308 N N   . ASN A 1 302 ? 33.858 15.122 67.777 1.00 20.66  ? 1101 ASN A N   1 
ATOM   2309 C CA  . ASN A 1 302 ? 33.372 16.150 68.683 1.00 19.19  ? 1101 ASN A CA  1 
ATOM   2310 C C   . ASN A 1 302 ? 32.942 15.523 70.045 1.00 23.44  ? 1101 ASN A C   1 
ATOM   2311 O O   . ASN A 1 302 ? 33.306 16.045 71.102 1.00 24.36  ? 1101 ASN A O   1 
ATOM   2312 C CB  . ASN A 1 302 ? 32.209 16.878 68.010 1.00 15.69  ? 1101 ASN A CB  1 
ATOM   2313 C CG  . ASN A 1 302 ? 31.838 18.194 68.625 1.00 20.91  ? 1101 ASN A CG  1 
ATOM   2314 O OD1 . ASN A 1 302 ? 31.636 18.321 69.844 1.00 7.01   ? 1101 ASN A OD1 1 
ATOM   2315 N ND2 . ASN A 1 302 ? 31.660 19.192 67.769 1.00 20.08  ? 1101 ASN A ND2 1 
ATOM   2316 N N   . MET A 1 303 ? 32.189 14.401 70.013 1.00 17.51  ? 1102 MET A N   1 
ATOM   2317 C CA  . MET A 1 303 ? 31.729 13.730 71.224 1.00 15.63  ? 1102 MET A CA  1 
ATOM   2318 C C   . MET A 1 303 ? 32.944 13.198 71.932 1.00 19.04  ? 1102 MET A C   1 
ATOM   2319 O O   . MET A 1 303 ? 33.123 13.501 73.105 1.00 18.52  ? 1102 MET A O   1 
ATOM   2320 C CB  . MET A 1 303 ? 30.722 12.606 70.917 1.00 18.09  ? 1102 MET A CB  1 
ATOM   2321 C CG  . MET A 1 303 ? 29.374 13.120 70.439 1.00 21.20  ? 1102 MET A CG  1 
ATOM   2322 S SD  . MET A 1 303 ? 28.127 11.853 70.075 1.00 26.04  ? 1102 MET A SD  1 
ATOM   2323 C CE  . MET A 1 303 ? 27.733 11.262 71.689 1.00 21.91  ? 1102 MET A CE  1 
ATOM   2324 N N   . VAL A 1 304 ? 33.828 12.485 71.211 1.00 16.74  ? 1103 VAL A N   1 
ATOM   2325 C CA  . VAL A 1 304 ? 35.086 11.940 71.758 1.00 17.85  ? 1103 VAL A CA  1 
ATOM   2326 C C   . VAL A 1 304 ? 35.918 13.033 72.495 1.00 20.38  ? 1103 VAL A C   1 
ATOM   2327 O O   . VAL A 1 304 ? 36.395 12.805 73.611 1.00 19.00  ? 1103 VAL A O   1 
ATOM   2328 C CB  . VAL A 1 304 ? 35.877 11.220 70.639 1.00 23.85  ? 1103 VAL A CB  1 
ATOM   2329 C CG1 . VAL A 1 304 ? 37.269 10.810 71.104 1.00 24.35  ? 1103 VAL A CG1 1 
ATOM   2330 C CG2 . VAL A 1 304 ? 35.095 10.013 70.116 1.00 24.90  ? 1103 VAL A CG2 1 
ATOM   2331 N N   . PHE A 1 305 ? 36.014 14.245 71.873 1.00 15.83  ? 1104 PHE A N   1 
ATOM   2332 C CA  . PHE A 1 305 ? 36.662 15.441 72.413 1.00 13.69  ? 1104 PHE A CA  1 
ATOM   2333 C C   . PHE A 1 305 ? 36.032 15.902 73.748 1.00 16.28  ? 1104 PHE A C   1 
ATOM   2334 O O   . PHE A 1 305 ? 36.763 16.393 74.597 1.00 17.79  ? 1104 PHE A O   1 
ATOM   2335 C CB  . PHE A 1 305 ? 36.591 16.556 71.382 1.00 14.06  ? 1104 PHE A CB  1 
ATOM   2336 C CG  . PHE A 1 305 ? 37.854 16.826 70.596 1.00 15.50  ? 1104 PHE A CG  1 
ATOM   2337 C CD1 . PHE A 1 305 ? 38.613 17.963 70.839 1.00 18.34  ? 1104 PHE A CD1 1 
ATOM   2338 C CD2 . PHE A 1 305 ? 38.259 15.972 69.586 1.00 18.59  ? 1104 PHE A CD2 1 
ATOM   2339 C CE1 . PHE A 1 305 ? 39.766 18.216 70.111 1.00 19.82  ? 1104 PHE A CE1 1 
ATOM   2340 C CE2 . PHE A 1 305 ? 39.422 16.221 68.863 1.00 22.02  ? 1104 PHE A CE2 1 
ATOM   2341 C CZ  . PHE A 1 305 ? 40.164 17.340 69.126 1.00 19.98  ? 1104 PHE A CZ  1 
ATOM   2342 N N   . GLN A 1 306 ? 34.705 15.719 73.953 1.00 11.90  ? 1105 GLN A N   1 
ATOM   2343 C CA  . GLN A 1 306 ? 34.008 16.098 75.189 1.00 10.64  ? 1105 GLN A CA  1 
ATOM   2344 C C   . GLN A 1 306 ? 33.925 15.001 76.264 1.00 16.90  ? 1105 GLN A C   1 
ATOM   2345 O O   . GLN A 1 306 ? 34.079 15.306 77.431 1.00 17.35  ? 1105 GLN A O   1 
ATOM   2346 C CB  . GLN A 1 306 ? 32.607 16.610 74.861 1.00 10.58  ? 1105 GLN A CB  1 
ATOM   2347 C CG  . GLN A 1 306 ? 31.766 17.075 76.062 1.00 9.71   ? 1105 GLN A CG  1 
ATOM   2348 C CD  . GLN A 1 306 ? 30.306 17.241 75.729 1.00 21.94  ? 1105 GLN A CD  1 
ATOM   2349 O OE1 . GLN A 1 306 ? 29.820 16.809 74.681 1.00 23.37  ? 1105 GLN A OE1 1 
ATOM   2350 N NE2 . GLN A 1 306 ? 29.556 17.830 76.642 1.00 14.41  ? 1105 GLN A NE2 1 
ATOM   2351 N N   . MET A 1 307 ? 33.659 13.752 75.893 1.00 15.95  ? 1106 MET A N   1 
ATOM   2352 C CA  . MET A 1 307 ? 33.494 12.674 76.867 1.00 17.35  ? 1106 MET A CA  1 
ATOM   2353 C C   . MET A 1 307 ? 34.584 11.593 76.878 1.00 23.61  ? 1106 MET A C   1 
ATOM   2354 O O   . MET A 1 307 ? 34.720 10.887 77.875 1.00 24.97  ? 1106 MET A O   1 
ATOM   2355 C CB  . MET A 1 307 ? 32.141 12.010 76.652 1.00 20.74  ? 1106 MET A CB  1 
ATOM   2356 C CG  . MET A 1 307 ? 30.986 12.925 76.884 1.00 25.00  ? 1106 MET A CG  1 
ATOM   2357 S SD  . MET A 1 307 ? 29.511 12.164 76.198 1.00 31.29  ? 1106 MET A SD  1 
ATOM   2358 C CE  . MET A 1 307 ? 29.552 12.806 74.537 1.00 28.26  ? 1106 MET A CE  1 
ATOM   2359 N N   . GLY A 1 308 ? 35.294 11.423 75.766 1.00 21.09  ? 1107 GLY A N   1 
ATOM   2360 C CA  . GLY A 1 308 ? 36.348 10.418 75.637 1.00 22.19  ? 1107 GLY A CA  1 
ATOM   2361 C C   . GLY A 1 308 ? 35.894 9.150  74.943 1.00 26.79  ? 1107 GLY A C   1 
ATOM   2362 O O   . GLY A 1 308 ? 34.698 8.857  74.949 1.00 25.54  ? 1107 GLY A O   1 
ATOM   2363 N N   . GLU A 1 309 ? 36.850 8.389  74.338 1.00 25.36  ? 1108 GLU A N   1 
ATOM   2364 C CA  . GLU A 1 309 ? 36.628 7.088  73.685 1.00 27.66  ? 1108 GLU A CA  1 
ATOM   2365 C C   . GLU A 1 309 ? 35.678 6.203  74.513 1.00 33.48  ? 1108 GLU A C   1 
ATOM   2366 O O   . GLU A 1 309 ? 34.652 5.765  73.998 1.00 34.01  ? 1108 GLU A O   1 
ATOM   2367 C CB  . GLU A 1 309 ? 37.961 6.325  73.523 1.00 31.23  ? 1108 GLU A CB  1 
ATOM   2368 C CG  . GLU A 1 309 ? 38.746 6.657  72.268 1.00 47.02  ? 1108 GLU A CG  1 
ATOM   2369 C CD  . GLU A 1 309 ? 39.444 8.006  72.232 1.00 73.80  ? 1108 GLU A CD  1 
ATOM   2370 O OE1 . GLU A 1 309 ? 39.731 8.576  73.314 1.00 55.51  ? 1108 GLU A OE1 1 
ATOM   2371 O OE2 . GLU A 1 309 ? 39.726 8.482  71.107 1.00 78.22  ? 1108 GLU A OE2 1 
ATOM   2372 N N   . THR A 1 310 ? 36.015 5.975  75.797 1.00 30.14  ? 1109 THR A N   1 
ATOM   2373 C CA  . THR A 1 310 ? 35.246 5.146  76.729 1.00 30.50  ? 1109 THR A CA  1 
ATOM   2374 C C   . THR A 1 310 ? 33.808 5.647  76.948 1.00 33.80  ? 1109 THR A C   1 
ATOM   2375 O O   . THR A 1 310 ? 32.872 4.839  76.916 1.00 36.56  ? 1109 THR A O   1 
ATOM   2376 C CB  . THR A 1 310 ? 36.024 4.948  78.034 1.00 36.98  ? 1109 THR A CB  1 
ATOM   2377 O OG1 . THR A 1 310 ? 37.319 4.433  77.728 1.00 44.28  ? 1109 THR A OG1 1 
ATOM   2378 C CG2 . THR A 1 310 ? 35.335 4.013  78.981 1.00 30.99  ? 1109 THR A CG2 1 
ATOM   2379 N N   . GLY A 1 311 ? 33.654 6.950  77.196 1.00 25.90  ? 1110 GLY A N   1 
ATOM   2380 C CA  . GLY A 1 311 ? 32.357 7.579  77.424 1.00 22.67  ? 1110 GLY A CA  1 
ATOM   2381 C C   . GLY A 1 311 ? 31.456 7.486  76.216 1.00 23.00  ? 1110 GLY A C   1 
ATOM   2382 O O   . GLY A 1 311 ? 30.291 7.120  76.353 1.00 22.03  ? 1110 GLY A O   1 
ATOM   2383 N N   . VAL A 1 312 ? 32.008 7.787  75.020 1.00 18.36  ? 1111 VAL A N   1 
ATOM   2384 C CA  . VAL A 1 312 ? 31.302 7.734  73.741 1.00 17.78  ? 1111 VAL A CA  1 
ATOM   2385 C C   . VAL A 1 312 ? 30.886 6.311  73.435 1.00 25.06  ? 1111 VAL A C   1 
ATOM   2386 O O   . VAL A 1 312 ? 29.709 6.113  73.133 1.00 25.99  ? 1111 VAL A O   1 
ATOM   2387 C CB  . VAL A 1 312 ? 32.084 8.394  72.578 1.00 20.47  ? 1111 VAL A CB  1 
ATOM   2388 C CG1 . VAL A 1 312 ? 31.272 8.394  71.285 1.00 20.02  ? 1111 VAL A CG1 1 
ATOM   2389 C CG2 . VAL A 1 312 ? 32.474 9.814  72.937 1.00 19.40  ? 1111 VAL A CG2 1 
ATOM   2390 N N   . ALA A 1 313 ? 31.823 5.311  73.589 1.00 23.27  ? 1112 ALA A N   1 
ATOM   2391 C CA  . ALA A 1 313 ? 31.582 3.858  73.362 1.00 24.53  ? 1112 ALA A CA  1 
ATOM   2392 C C   . ALA A 1 313 ? 30.568 3.190  74.302 1.00 31.12  ? 1112 ALA A C   1 
ATOM   2393 O O   . ALA A 1 313 ? 30.258 2.009  74.110 1.00 34.54  ? 1112 ALA A O   1 
ATOM   2394 C CB  . ALA A 1 313 ? 32.839 3.034  73.622 1.00 26.58  ? 1112 ALA A CB  1 
ATOM   2395 N N   . GLY A 1 314 ? 30.011 3.971  75.236 1.00 26.59  ? 1113 GLY A N   1 
ATOM   2396 C CA  . GLY A 1 314 ? 28.982 3.529  76.169 1.00 26.78  ? 1113 GLY A CA  1 
ATOM   2397 C C   . GLY A 1 314 ? 27.709 4.221  75.696 1.00 31.06  ? 1113 GLY A C   1 
ATOM   2398 O O   . GLY A 1 314 ? 26.929 4.684  76.528 1.00 33.09  ? 1113 GLY A O   1 
ATOM   2399 N N   . PHE A 1 315 ? 27.561 4.325  74.377 1.00 25.69  ? 1114 PHE A N   1 
ATOM   2400 C CA  . PHE A 1 315 ? 26.379 4.873  73.723 1.00 24.39  ? 1114 PHE A CA  1 
ATOM   2401 C C   . PHE A 1 315 ? 25.921 3.810  72.737 1.00 31.08  ? 1114 PHE A C   1 
ATOM   2402 O O   . PHE A 1 315 ? 25.825 4.038  71.531 1.00 31.51  ? 1114 PHE A O   1 
ATOM   2403 C CB  . PHE A 1 315 ? 26.716 6.171  72.991 1.00 24.97  ? 1114 PHE A CB  1 
ATOM   2404 C CG  . PHE A 1 315 ? 26.402 7.411  73.780 1.00 24.58  ? 1114 PHE A CG  1 
ATOM   2405 C CD1 . PHE A 1 315 ? 25.091 7.751  74.068 1.00 26.92  ? 1114 PHE A CD1 1 
ATOM   2406 C CD2 . PHE A 1 315 ? 27.418 8.235  74.233 1.00 25.50  ? 1114 PHE A CD2 1 
ATOM   2407 C CE1 . PHE A 1 315 ? 24.799 8.891  74.793 1.00 26.93  ? 1114 PHE A CE1 1 
ATOM   2408 C CE2 . PHE A 1 315 ? 27.133 9.376  74.958 1.00 27.47  ? 1114 PHE A CE2 1 
ATOM   2409 C CZ  . PHE A 1 315 ? 25.822 9.704  75.238 1.00 25.30  ? 1114 PHE A CZ  1 
ATOM   2410 N N   . THR A 1 316 ? 25.656 2.637  73.294 1.00 29.03  ? 1115 THR A N   1 
ATOM   2411 C CA  . THR A 1 316 ? 25.427 1.381  72.563 1.00 29.83  ? 1115 THR A CA  1 
ATOM   2412 C C   . THR A 1 316 ? 24.268 1.475  71.547 1.00 32.29  ? 1115 THR A C   1 
ATOM   2413 O O   . THR A 1 316 ? 24.509 1.298  70.344 1.00 32.34  ? 1115 THR A O   1 
ATOM   2414 C CB  . THR A 1 316 ? 25.267 0.223  73.529 1.00 38.49  ? 1115 THR A CB  1 
ATOM   2415 O OG1 . THR A 1 316 ? 26.210 0.356  74.604 1.00 34.87  ? 1115 THR A OG1 1 
ATOM   2416 C CG2 . THR A 1 316 ? 25.398 -1.118 72.832 1.00 41.14  ? 1115 THR A CG2 1 
ATOM   2417 N N   . ASN A 1 317 ? 23.035 1.750  72.011 1.00 27.15  ? 1116 ASN A N   1 
ATOM   2418 C CA  . ASN A 1 317 ? 21.892 1.832  71.105 1.00 26.35  ? 1116 ASN A CA  1 
ATOM   2419 C C   . ASN A 1 317 ? 22.055 2.874  70.011 1.00 30.07  ? 1116 ASN A C   1 
ATOM   2420 O O   . ASN A 1 317 ? 22.026 2.500  68.835 1.00 31.60  ? 1116 ASN A O   1 
ATOM   2421 C CB  . ASN A 1 317 ? 20.561 1.946  71.839 1.00 22.47  ? 1116 ASN A CB  1 
ATOM   2422 C CG  . ASN A 1 317 ? 20.208 0.732  72.672 1.00 56.07  ? 1116 ASN A CG  1 
ATOM   2423 O OD1 . ASN A 1 317 ? 20.724 -0.382 72.481 1.00 59.47  ? 1116 ASN A OD1 1 
ATOM   2424 N ND2 . ASN A 1 317 ? 19.305 0.917  73.622 1.00 47.13  ? 1116 ASN A ND2 1 
ATOM   2425 N N   . SER A 1 318 ? 22.298 4.155  70.377 1.00 23.57  ? 1117 SER A N   1 
ATOM   2426 C CA  . SER A 1 318 ? 22.478 5.244  69.409 1.00 22.16  ? 1117 SER A CA  1 
ATOM   2427 C C   . SER A 1 318 ? 23.550 4.923  68.352 1.00 27.01  ? 1117 SER A C   1 
ATOM   2428 O O   . SER A 1 318 ? 23.262 5.036  67.162 1.00 28.26  ? 1117 SER A O   1 
ATOM   2429 C CB  . SER A 1 318 ? 22.787 6.551  70.125 1.00 24.05  ? 1117 SER A CB  1 
ATOM   2430 O OG  . SER A 1 318 ? 21.718 6.958  70.963 1.00 34.24  ? 1117 SER A OG  1 
ATOM   2431 N N   . LEU A 1 319 ? 24.742 4.435  68.784 1.00 21.56  ? 1118 LEU A N   1 
ATOM   2432 C CA  . LEU A 1 319 ? 25.862 4.060  67.918 1.00 21.61  ? 1118 LEU A CA  1 
ATOM   2433 C C   . LEU A 1 319 ? 25.447 3.035  66.882 1.00 30.20  ? 1118 LEU A C   1 
ATOM   2434 O O   . LEU A 1 319 ? 25.955 3.048  65.750 1.00 30.24  ? 1118 LEU A O   1 
ATOM   2435 C CB  . LEU A 1 319 ? 27.014 3.507  68.748 1.00 21.38  ? 1118 LEU A CB  1 
ATOM   2436 C CG  . LEU A 1 319 ? 27.872 4.526  69.475 1.00 22.11  ? 1118 LEU A CG  1 
ATOM   2437 C CD1 . LEU A 1 319 ? 28.658 3.868  70.607 1.00 22.11  ? 1118 LEU A CD1 1 
ATOM   2438 C CD2 . LEU A 1 319 ? 28.813 5.246  68.509 1.00 23.53  ? 1118 LEU A CD2 1 
ATOM   2439 N N   . ARG A 1 320 ? 24.510 2.135  67.271 1.00 31.11  ? 1119 ARG A N   1 
ATOM   2440 C CA  . ARG A 1 320 ? 23.963 1.113  66.374 1.00 33.27  ? 1119 ARG A CA  1 
ATOM   2441 C C   . ARG A 1 320 ? 23.039 1.774  65.353 1.00 37.28  ? 1119 ARG A C   1 
ATOM   2442 O O   . ARG A 1 320 ? 23.180 1.499  64.173 1.00 37.90  ? 1119 ARG A O   1 
ATOM   2443 C CB  . ARG A 1 320 ? 23.230 0.036  67.161 1.00 33.08  ? 1119 ARG A CB  1 
ATOM   2444 C CG  . ARG A 1 320 ? 23.244 -1.326 66.501 1.00 49.32  ? 1119 ARG A CG  1 
ATOM   2445 C CD  . ARG A 1 320 ? 22.058 -2.186 66.937 1.00 67.82  ? 1119 ARG A CD  1 
ATOM   2446 N NE  . ARG A 1 320 ? 21.681 -2.018 68.346 1.00 79.05  ? 1119 ARG A NE  1 
ATOM   2447 C CZ  . ARG A 1 320 ? 22.342 -2.548 69.371 1.00 99.90  ? 1119 ARG A CZ  1 
ATOM   2448 N NH1 . ARG A 1 320 ? 23.440 -3.266 69.163 1.00 91.76  ? 1119 ARG A NH1 1 
ATOM   2449 N NH2 . ARG A 1 320 ? 21.926 -2.340 70.614 1.00 90.30  ? 1119 ARG A NH2 1 
ATOM   2450 N N   . MET A 1 321 ? 22.161 2.667  65.796 1.00 33.09  ? 1120 MET A N   1 
ATOM   2451 C CA  . MET A 1 321 ? 21.298 3.403  64.877 1.00 33.73  ? 1120 MET A CA  1 
ATOM   2452 C C   . MET A 1 321 ? 22.106 4.194  63.844 1.00 37.86  ? 1120 MET A C   1 
ATOM   2453 O O   . MET A 1 321 ? 21.690 4.333  62.694 1.00 37.50  ? 1120 MET A O   1 
ATOM   2454 C CB  . MET A 1 321 ? 20.372 4.343  65.651 1.00 34.93  ? 1120 MET A CB  1 
ATOM   2455 C CG  . MET A 1 321 ? 19.505 3.646  66.687 1.00 38.60  ? 1120 MET A CG  1 
ATOM   2456 S SD  . MET A 1 321 ? 18.608 4.805  67.738 1.00 40.96  ? 1120 MET A SD  1 
ATOM   2457 C CE  . MET A 1 321 ? 18.462 3.851  69.246 1.00 36.73  ? 1120 MET A CE  1 
ATOM   2458 N N   . LEU A 1 322 ? 23.259 4.711  64.262 1.00 35.03  ? 1121 LEU A N   1 
ATOM   2459 C CA  . LEU A 1 322 ? 24.119 5.505  63.388 1.00 35.03  ? 1121 LEU A CA  1 
ATOM   2460 C C   . LEU A 1 322 ? 24.695 4.584  62.341 1.00 41.02  ? 1121 LEU A C   1 
ATOM   2461 O O   . LEU A 1 322 ? 24.466 4.831  61.163 1.00 42.43  ? 1121 LEU A O   1 
ATOM   2462 C CB  . LEU A 1 322 ? 25.226 6.254  64.173 1.00 33.43  ? 1121 LEU A CB  1 
ATOM   2463 C CG  . LEU A 1 322 ? 24.775 7.367  65.136 1.00 36.23  ? 1121 LEU A CG  1 
ATOM   2464 C CD1 . LEU A 1 322 ? 25.913 7.793  66.023 1.00 35.74  ? 1121 LEU A CD1 1 
ATOM   2465 C CD2 . LEU A 1 322 ? 24.237 8.575  64.392 1.00 38.26  ? 1121 LEU A CD2 1 
ATOM   2466 N N   . GLN A 1 323 ? 25.365 3.476  62.773 1.00 37.92  ? 1122 GLN A N   1 
ATOM   2467 C CA  . GLN A 1 323 ? 25.943 2.392  61.941 1.00 39.81  ? 1122 GLN A CA  1 
ATOM   2468 C C   . GLN A 1 323 ? 24.907 1.911  60.912 1.00 44.74  ? 1122 GLN A C   1 
ATOM   2469 O O   . GLN A 1 323 ? 25.219 1.848  59.726 1.00 45.82  ? 1122 GLN A O   1 
ATOM   2470 C CB  . GLN A 1 323 ? 26.339 1.222  62.846 1.00 41.61  ? 1122 GLN A CB  1 
ATOM   2471 C CG  . GLN A 1 323 ? 27.262 0.190  62.236 1.00 59.21  ? 1122 GLN A CG  1 
ATOM   2472 C CD  . GLN A 1 323 ? 27.920 -0.572 63.369 1.00 87.16  ? 1122 GLN A CD  1 
ATOM   2473 O OE1 . GLN A 1 323 ? 28.995 -0.205 63.845 1.00 86.91  ? 1122 GLN A OE1 1 
ATOM   2474 N NE2 . GLN A 1 323 ? 27.241 -1.573 63.922 1.00 76.08  ? 1122 GLN A NE2 1 
ATOM   2475 N N   . GLN A 1 324 ? 23.650 1.672  61.378 1.00 40.82  ? 1123 GLN A N   1 
ATOM   2476 C CA  . GLN A 1 324 ? 22.464 1.231  60.630 1.00 41.36  ? 1123 GLN A CA  1 
ATOM   2477 C C   . GLN A 1 324 ? 21.792 2.331  59.773 1.00 44.24  ? 1123 GLN A C   1 
ATOM   2478 O O   . GLN A 1 324 ? 20.794 2.052  59.105 1.00 45.24  ? 1123 GLN A O   1 
ATOM   2479 C CB  . GLN A 1 324 ? 21.440 0.613  61.596 1.00 42.09  ? 1123 GLN A CB  1 
ATOM   2480 C CG  . GLN A 1 324 ? 21.820 -0.760 62.136 1.00 60.54  ? 1123 GLN A CG  1 
ATOM   2481 C CD  . GLN A 1 324 ? 20.614 -1.443 62.726 1.00 86.00  ? 1123 GLN A CD  1 
ATOM   2482 O OE1 . GLN A 1 324 ? 19.582 -1.620 62.067 1.00 87.97  ? 1123 GLN A OE1 1 
ATOM   2483 N NE2 . GLN A 1 324 ? 20.714 -1.859 63.975 1.00 74.64  ? 1123 GLN A NE2 1 
ATOM   2484 N N   . LYS A 1 325 ? 22.336 3.568  59.797 1.00 39.01  ? 1124 LYS A N   1 
ATOM   2485 C CA  . LYS A 1 325 ? 21.887 4.745  59.026 1.00 38.06  ? 1124 LYS A CA  1 
ATOM   2486 C C   . LYS A 1 325 ? 20.431 5.182  59.280 1.00 41.23  ? 1124 LYS A C   1 
ATOM   2487 O O   . LYS A 1 325 ? 19.715 5.617  58.378 1.00 41.33  ? 1124 LYS A O   1 
ATOM   2488 C CB  . LYS A 1 325 ? 22.293 4.637  57.543 1.00 41.58  ? 1124 LYS A CB  1 
ATOM   2489 C CG  . LYS A 1 325 ? 23.772 4.275  57.407 1.00 48.36  ? 1124 LYS A CG  1 
ATOM   2490 C CD  . LYS A 1 325 ? 24.297 4.293  55.983 1.00 59.73  ? 1124 LYS A CD  1 
ATOM   2491 C CE  . LYS A 1 325 ? 25.790 4.058  55.954 1.00 72.53  ? 1124 LYS A CE  1 
ATOM   2492 N NZ  . LYS A 1 325 ? 26.545 5.092  56.728 1.00 79.32  ? 1124 LYS A NZ  1 
ATOM   2493 N N   . ARG A 1 326 ? 20.037 5.009  60.542 1.00 37.13  ? 1125 ARG A N   1 
ATOM   2494 C CA  . ARG A 1 326 ? 18.773 5.484  61.084 1.00 36.58  ? 1125 ARG A CA  1 
ATOM   2495 C C   . ARG A 1 326 ? 19.076 6.765  61.849 1.00 39.81  ? 1125 ARG A C   1 
ATOM   2496 O O   . ARG A 1 326 ? 19.383 6.750  63.041 1.00 39.07  ? 1125 ARG A O   1 
ATOM   2497 C CB  . ARG A 1 326 ? 18.157 4.440  62.015 1.00 36.80  ? 1125 ARG A CB  1 
ATOM   2498 C CG  . ARG A 1 326 ? 18.457 3.003  61.621 1.00 50.05  ? 1125 ARG A CG  1 
ATOM   2499 C CD  . ARG A 1 326 ? 18.011 2.031  62.701 1.00 63.05  ? 1125 ARG A CD  1 
ATOM   2500 N NE  . ARG A 1 326 ? 17.988 0.653  62.219 1.00 80.21  ? 1125 ARG A NE  1 
ATOM   2501 C CZ  . ARG A 1 326 ? 16.914 0.057  61.712 1.00 96.95  ? 1125 ARG A CZ  1 
ATOM   2502 N NH1 . ARG A 1 326 ? 15.768 0.718  61.618 1.00 83.40  ? 1125 ARG A NH1 1 
ATOM   2503 N NH2 . ARG A 1 326 ? 16.984 -1.201 61.298 1.00 83.65  ? 1125 ARG A NH2 1 
ATOM   2504 N N   . TRP A 1 327 ? 18.990 7.868  61.123 1.00 36.32  ? 1126 TRP A N   1 
ATOM   2505 C CA  . TRP A 1 327 ? 19.443 9.191  61.549 1.00 34.46  ? 1126 TRP A CA  1 
ATOM   2506 C C   . TRP A 1 327 ? 18.411 9.815  62.465 1.00 36.95  ? 1126 TRP A C   1 
ATOM   2507 O O   . TRP A 1 327 ? 18.804 10.405 63.465 1.00 35.38  ? 1126 TRP A O   1 
ATOM   2508 C CB  . TRP A 1 327 ? 19.846 10.142 60.411 1.00 33.89  ? 1126 TRP A CB  1 
ATOM   2509 C CG  . TRP A 1 327 ? 20.795 9.551  59.408 1.00 35.85  ? 1126 TRP A CG  1 
ATOM   2510 C CD1 . TRP A 1 327 ? 20.588 9.440  58.071 1.00 40.48  ? 1126 TRP A CD1 1 
ATOM   2511 C CD2 . TRP A 1 327 ? 22.062 8.924  59.671 1.00 35.39  ? 1126 TRP A CD2 1 
ATOM   2512 N NE1 . TRP A 1 327 ? 21.653 8.805  57.478 1.00 40.33  ? 1126 TRP A NE1 1 
ATOM   2513 C CE2 . TRP A 1 327 ? 22.573 8.482  58.433 1.00 40.28  ? 1126 TRP A CE2 1 
ATOM   2514 C CE3 . TRP A 1 327 ? 22.817 8.691  60.836 1.00 35.36  ? 1126 TRP A CE3 1 
ATOM   2515 C CZ2 . TRP A 1 327 ? 23.823 7.874  58.311 1.00 39.91  ? 1126 TRP A CZ2 1 
ATOM   2516 C CZ3 . TRP A 1 327 ? 24.049 8.058  60.717 1.00 37.07  ? 1126 TRP A CZ3 1 
ATOM   2517 C CH2 . TRP A 1 327 ? 24.539 7.657  59.464 1.00 39.45  ? 1126 TRP A CH2 1 
ATOM   2518 N N   . ASP A 1 328 ? 17.117 9.686  62.156 1.00 34.89  ? 1127 ASP A N   1 
ATOM   2519 C CA  . ASP A 1 328 ? 16.089 10.260 63.022 1.00 34.89  ? 1127 ASP A CA  1 
ATOM   2520 C C   . ASP A 1 328 ? 15.911 9.457  64.329 1.00 37.37  ? 1127 ASP A C   1 
ATOM   2521 O O   . ASP A 1 328 ? 15.774 10.050 65.410 1.00 35.15  ? 1127 ASP A O   1 
ATOM   2522 C CB  . ASP A 1 328 ? 14.775 10.493 62.266 1.00 39.36  ? 1127 ASP A CB  1 
ATOM   2523 C CG  . ASP A 1 328 ? 14.802 11.739 61.395 1.00 56.52  ? 1127 ASP A CG  1 
ATOM   2524 O OD1 . ASP A 1 328 ? 15.004 11.600 60.163 1.00 57.72  ? 1127 ASP A OD1 1 
ATOM   2525 O OD2 . ASP A 1 328 ? 14.632 12.855 61.947 1.00 67.21  ? 1127 ASP A OD2 1 
ATOM   2526 N N   . GLU A 1 329 ? 15.991 8.112  64.229 1.00 34.49  ? 1128 GLU A N   1 
ATOM   2527 C CA  . GLU A 1 329 ? 15.938 7.222  65.375 1.00 33.61  ? 1128 GLU A CA  1 
ATOM   2528 C C   . GLU A 1 329 ? 17.067 7.623  66.314 1.00 35.29  ? 1128 GLU A C   1 
ATOM   2529 O O   . GLU A 1 329 ? 16.790 7.852  67.492 1.00 36.25  ? 1128 GLU A O   1 
ATOM   2530 C CB  . GLU A 1 329 ? 16.134 5.763  64.952 1.00 36.47  ? 1128 GLU A CB  1 
ATOM   2531 C CG  . GLU A 1 329 ? 14.868 5.029  64.538 1.00 54.72  ? 1128 GLU A CG  1 
ATOM   2532 C CD  . GLU A 1 329 ? 15.111 3.626  64.000 1.00 71.42  ? 1128 GLU A CD  1 
ATOM   2533 O OE1 . GLU A 1 329 ? 15.400 2.711  64.809 1.00 47.94  ? 1128 GLU A OE1 1 
ATOM   2534 O OE2 . GLU A 1 329 ? 15.041 3.454  62.759 1.00 57.56  ? 1128 GLU A OE2 1 
ATOM   2535 N N   . ALA A 1 330 ? 18.318 7.774  65.794 1.00 27.83  ? 1129 ALA A N   1 
ATOM   2536 C CA  . ALA A 1 330 ? 19.476 8.164  66.607 1.00 25.04  ? 1129 ALA A CA  1 
ATOM   2537 C C   . ALA A 1 330 ? 19.314 9.565  67.196 1.00 28.57  ? 1129 ALA A C   1 
ATOM   2538 O O   . ALA A 1 330 ? 19.500 9.726  68.410 1.00 26.87  ? 1129 ALA A O   1 
ATOM   2539 C CB  . ALA A 1 330 ? 20.772 8.040  65.823 1.00 25.60  ? 1129 ALA A CB  1 
ATOM   2540 N N   . ALA A 1 331 ? 18.873 10.553 66.377 1.00 25.50  ? 1130 ALA A N   1 
ATOM   2541 C CA  . ALA A 1 331 ? 18.644 11.924 66.848 1.00 24.57  ? 1130 ALA A CA  1 
ATOM   2542 C C   . ALA A 1 331 ? 17.594 11.998 67.964 1.00 29.60  ? 1130 ALA A C   1 
ATOM   2543 O O   . ALA A 1 331 ? 17.665 12.901 68.806 1.00 28.47  ? 1130 ALA A O   1 
ATOM   2544 C CB  . ALA A 1 331 ? 18.240 12.822 65.703 1.00 26.06  ? 1130 ALA A CB  1 
ATOM   2545 N N   . VAL A 1 332 ? 16.628 11.053 67.987 1.00 26.87  ? 1131 VAL A N   1 
ATOM   2546 C CA  . VAL A 1 332 ? 15.637 11.038 69.066 1.00 26.42  ? 1131 VAL A CA  1 
ATOM   2547 C C   . VAL A 1 332 ? 16.247 10.398 70.298 1.00 29.77  ? 1131 VAL A C   1 
ATOM   2548 O O   . VAL A 1 332 ? 16.082 10.898 71.415 1.00 29.31  ? 1131 VAL A O   1 
ATOM   2549 C CB  . VAL A 1 332 ? 14.283 10.413 68.649 1.00 31.37  ? 1131 VAL A CB  1 
ATOM   2550 C CG1 . VAL A 1 332 ? 13.364 10.187 69.849 1.00 30.93  ? 1131 VAL A CG1 1 
ATOM   2551 C CG2 . VAL A 1 332 ? 13.584 11.301 67.627 1.00 32.53  ? 1131 VAL A CG2 1 
ATOM   2552 N N   . ASN A 1 333 ? 16.983 9.308  70.086 1.00 26.37  ? 1132 ASN A N   1 
ATOM   2553 C CA  . ASN A 1 333 ? 17.604 8.563  71.169 1.00 25.25  ? 1132 ASN A CA  1 
ATOM   2554 C C   . ASN A 1 333 ? 18.646 9.392  71.921 1.00 26.97  ? 1132 ASN A C   1 
ATOM   2555 O O   . ASN A 1 333 ? 18.540 9.577  73.142 1.00 25.18  ? 1132 ASN A O   1 
ATOM   2556 C CB  . ASN A 1 333 ? 18.175 7.262  70.658 1.00 24.89  ? 1132 ASN A CB  1 
ATOM   2557 C CG  . ASN A 1 333 ? 18.291 6.246  71.744 1.00 46.01  ? 1132 ASN A CG  1 
ATOM   2558 O OD1 . ASN A 1 333 ? 17.319 5.953  72.468 1.00 37.58  ? 1132 ASN A OD1 1 
ATOM   2559 N ND2 . ASN A 1 333 ? 19.489 5.698  71.883 1.00 37.28  ? 1132 ASN A ND2 1 
ATOM   2560 N N   . LEU A 1 334 ? 19.603 9.963  71.173 1.00 22.97  ? 1133 LEU A N   1 
ATOM   2561 C CA  . LEU A 1 334 ? 20.637 10.822 71.732 1.00 21.26  ? 1133 LEU A CA  1 
ATOM   2562 C C   . LEU A 1 334 ? 20.035 12.016 72.526 1.00 24.11  ? 1133 LEU A C   1 
ATOM   2563 O O   . LEU A 1 334 ? 20.544 12.368 73.593 1.00 22.88  ? 1133 LEU A O   1 
ATOM   2564 C CB  . LEU A 1 334 ? 21.582 11.277 70.616 1.00 20.98  ? 1133 LEU A CB  1 
ATOM   2565 C CG  . LEU A 1 334 ? 22.682 10.299 70.245 1.00 24.60  ? 1133 LEU A CG  1 
ATOM   2566 C CD1 . LEU A 1 334 ? 23.423 10.751 69.016 1.00 23.77  ? 1133 LEU A CD1 1 
ATOM   2567 C CD2 . LEU A 1 334 ? 23.654 10.161 71.365 1.00 27.37  ? 1133 LEU A CD2 1 
ATOM   2568 N N   . ALA A 1 335 ? 18.901 12.568 72.053 1.00 20.64  ? 1134 ALA A N   1 
ATOM   2569 C CA  . ALA A 1 335 ? 18.213 13.671 72.724 1.00 19.77  ? 1134 ALA A CA  1 
ATOM   2570 C C   . ALA A 1 335 ? 17.674 13.261 74.095 1.00 25.32  ? 1134 ALA A C   1 
ATOM   2571 O O   . ALA A 1 335 ? 17.390 14.145 74.904 1.00 25.95  ? 1134 ALA A O   1 
ATOM   2572 C CB  . ALA A 1 335 ? 17.089 14.182 71.858 1.00 21.17  ? 1134 ALA A CB  1 
ATOM   2573 N N   . LYS A 1 336 ? 17.545 11.925 74.369 1.00 20.68  ? 1135 LYS A N   1 
ATOM   2574 C CA  . LYS A 1 336 ? 17.048 11.380 75.657 1.00 19.03  ? 1135 LYS A CA  1 
ATOM   2575 C C   . LYS A 1 336 ? 18.196 11.124 76.658 1.00 24.15  ? 1135 LYS A C   1 
ATOM   2576 O O   . LYS A 1 336 ? 17.934 10.852 77.835 1.00 22.70  ? 1135 LYS A O   1 
ATOM   2577 C CB  . LYS A 1 336 ? 16.256 10.070 75.437 1.00 19.23  ? 1135 LYS A CB  1 
ATOM   2578 C CG  . LYS A 1 336 ? 14.951 10.249 74.698 1.00 15.24  ? 1135 LYS A CG  1 
ATOM   2579 C CD  . LYS A 1 336 ? 14.446 8.984  74.042 1.00 18.16  ? 1135 LYS A CD  1 
ATOM   2580 C CE  . LYS A 1 336 ? 13.035 9.192  73.537 1.00 31.95  ? 1135 LYS A CE  1 
ATOM   2581 N NZ  . LYS A 1 336 ? 12.535 8.064  72.714 1.00 38.35  ? 1135 LYS A NZ  1 
ATOM   2582 N N   . SER A 1 337 ? 19.464 11.175 76.173 1.00 22.62  ? 1136 SER A N   1 
ATOM   2583 C CA  . SER A 1 337 ? 20.663 10.906 76.966 1.00 22.60  ? 1136 SER A CA  1 
ATOM   2584 C C   . SER A 1 337 ? 20.880 11.902 78.081 1.00 27.79  ? 1136 SER A C   1 
ATOM   2585 O O   . SER A 1 337 ? 20.335 13.010 78.045 1.00 28.76  ? 1136 SER A O   1 
ATOM   2586 C CB  . SER A 1 337 ? 21.900 10.835 76.077 1.00 25.75  ? 1136 SER A CB  1 
ATOM   2587 O OG  . SER A 1 337 ? 22.212 12.086 75.484 1.00 35.24  ? 1136 SER A OG  1 
ATOM   2588 N N   . ARG A 1 338 ? 21.698 11.502 79.072 1.00 23.24  ? 1137 ARG A N   1 
ATOM   2589 C CA  . ARG A 1 338 ? 22.080 12.320 80.218 1.00 21.74  ? 1137 ARG A CA  1 
ATOM   2590 C C   . ARG A 1 338 ? 22.985 13.425 79.708 1.00 22.35  ? 1137 ARG A C   1 
ATOM   2591 O O   . ARG A 1 338 ? 22.938 14.532 80.226 1.00 22.59  ? 1137 ARG A O   1 
ATOM   2592 C CB  . ARG A 1 338 ? 22.820 11.471 81.253 1.00 23.28  ? 1137 ARG A CB  1 
ATOM   2593 C CG  . ARG A 1 338 ? 22.516 11.874 82.674 1.00 43.38  ? 1137 ARG A CG  1 
ATOM   2594 C CD  . ARG A 1 338 ? 23.424 11.163 83.657 1.00 56.88  ? 1137 ARG A CD  1 
ATOM   2595 N NE  . ARG A 1 338 ? 22.741 10.099 84.399 1.00 63.76  ? 1137 ARG A NE  1 
ATOM   2596 C CZ  . ARG A 1 338 ? 22.715 8.825  84.023 1.00 76.09  ? 1137 ARG A CZ  1 
ATOM   2597 N NH1 . ARG A 1 338 ? 23.297 8.445  82.890 1.00 54.24  ? 1137 ARG A NH1 1 
ATOM   2598 N NH2 . ARG A 1 338 ? 22.099 7.921  84.771 1.00 68.55  ? 1137 ARG A NH2 1 
ATOM   2599 N N   . TRP A 1 339 ? 23.769 13.133 78.657 1.00 16.30  ? 1138 TRP A N   1 
ATOM   2600 C CA  . TRP A 1 339 ? 24.685 14.054 78.011 1.00 15.40  ? 1138 TRP A CA  1 
ATOM   2601 C C   . TRP A 1 339 ? 23.883 15.228 77.509 1.00 17.83  ? 1138 TRP A C   1 
ATOM   2602 O O   . TRP A 1 339 ? 24.229 16.378 77.789 1.00 15.28  ? 1138 TRP A O   1 
ATOM   2603 C CB  . TRP A 1 339 ? 25.416 13.314 76.878 1.00 14.83  ? 1138 TRP A CB  1 
ATOM   2604 C CG  . TRP A 1 339 ? 26.007 14.160 75.795 1.00 15.87  ? 1138 TRP A CG  1 
ATOM   2605 C CD1 . TRP A 1 339 ? 27.034 15.042 75.917 1.00 18.26  ? 1138 TRP A CD1 1 
ATOM   2606 C CD2 . TRP A 1 339 ? 25.663 14.133 74.399 1.00 16.47  ? 1138 TRP A CD2 1 
ATOM   2607 N NE1 . TRP A 1 339 ? 27.327 15.597 74.696 1.00 17.70  ? 1138 TRP A NE1 1 
ATOM   2608 C CE2 . TRP A 1 339 ? 26.504 15.053 73.744 1.00 19.48  ? 1138 TRP A CE2 1 
ATOM   2609 C CE3 . TRP A 1 339 ? 24.706 13.432 73.639 1.00 18.51  ? 1138 TRP A CE3 1 
ATOM   2610 C CZ2 . TRP A 1 339 ? 26.428 15.291 72.364 1.00 18.91  ? 1138 TRP A CZ2 1 
ATOM   2611 C CZ3 . TRP A 1 339 ? 24.634 13.667 72.271 1.00 20.10  ? 1138 TRP A CZ3 1 
ATOM   2612 C CH2 . TRP A 1 339 ? 25.487 14.588 71.649 1.00 20.33  ? 1138 TRP A CH2 1 
ATOM   2613 N N   . TYR A 1 340 ? 22.754 14.936 76.854 1.00 15.92  ? 1139 TYR A N   1 
ATOM   2614 C CA  . TYR A 1 340 ? 21.857 15.969 76.356 1.00 16.20  ? 1139 TYR A CA  1 
ATOM   2615 C C   . TYR A 1 340 ? 21.275 16.811 77.504 1.00 19.06  ? 1139 TYR A C   1 
ATOM   2616 O O   . TYR A 1 340 ? 21.133 18.019 77.360 1.00 18.70  ? 1139 TYR A O   1 
ATOM   2617 C CB  . TYR A 1 340 ? 20.759 15.372 75.460 1.00 18.52  ? 1139 TYR A CB  1 
ATOM   2618 C CG  . TYR A 1 340 ? 19.806 16.412 74.909 1.00 20.93  ? 1139 TYR A CG  1 
ATOM   2619 C CD1 . TYR A 1 340 ? 19.966 16.921 73.626 1.00 22.84  ? 1139 TYR A CD1 1 
ATOM   2620 C CD2 . TYR A 1 340 ? 18.726 16.869 75.666 1.00 22.45  ? 1139 TYR A CD2 1 
ATOM   2621 C CE1 . TYR A 1 340 ? 19.072 17.857 73.106 1.00 24.82  ? 1139 TYR A CE1 1 
ATOM   2622 C CE2 . TYR A 1 340 ? 17.842 17.821 75.167 1.00 23.91  ? 1139 TYR A CE2 1 
ATOM   2623 C CZ  . TYR A 1 340 ? 18.019 18.315 73.889 1.00 31.75  ? 1139 TYR A CZ  1 
ATOM   2624 O OH  . TYR A 1 340 ? 17.129 19.241 73.414 1.00 33.43  ? 1139 TYR A OH  1 
ATOM   2625 N N   . ASN A 1 341 ? 20.932 16.186 78.628 1.00 16.71  ? 1140 ASN A N   1 
ATOM   2626 C CA  . ASN A 1 341 ? 20.377 16.919 79.763 1.00 17.34  ? 1140 ASN A CA  1 
ATOM   2627 C C   . ASN A 1 341 ? 21.424 17.876 80.373 1.00 17.03  ? 1140 ASN A C   1 
ATOM   2628 O O   . ASN A 1 341 ? 21.071 18.989 80.752 1.00 16.79  ? 1140 ASN A O   1 
ATOM   2629 C CB  . ASN A 1 341 ? 19.741 15.940 80.787 1.00 26.84  ? 1140 ASN A CB  1 
ATOM   2630 C CG  . ASN A 1 341 ? 19.811 16.308 82.269 1.00 75.49  ? 1140 ASN A CG  1 
ATOM   2631 O OD1 . ASN A 1 341 ? 20.548 15.701 83.069 1.00 79.67  ? 1140 ASN A OD1 1 
ATOM   2632 N ND2 . ASN A 1 341 ? 19.088 17.374 82.651 1.00 67.72  ? 1140 ASN A ND2 1 
ATOM   2633 N N   . GLN A 1 342 ? 22.712 17.470 80.388 1.00 11.61  ? 1141 GLN A N   1 
ATOM   2634 C CA  . GLN A 1 342 ? 23.809 18.260 80.956 1.00 10.25  ? 1141 GLN A CA  1 
ATOM   2635 C C   . GLN A 1 342 ? 24.345 19.390 80.068 1.00 12.98  ? 1141 GLN A C   1 
ATOM   2636 O O   . GLN A 1 342 ? 24.381 20.524 80.527 1.00 14.10  ? 1141 GLN A O   1 
ATOM   2637 C CB  . GLN A 1 342 ? 24.879 17.353 81.538 1.00 10.16  ? 1141 GLN A CB  1 
ATOM   2638 C CG  . GLN A 1 342 ? 24.240 16.528 82.631 1.00 14.85  ? 1141 GLN A CG  1 
ATOM   2639 C CD  . GLN A 1 342 ? 25.107 15.543 83.334 1.00 37.83  ? 1141 GLN A CD  1 
ATOM   2640 O OE1 . GLN A 1 342 ? 26.334 15.495 83.157 1.00 41.31  ? 1141 GLN A OE1 1 
ATOM   2641 N NE2 . GLN A 1 342 ? 24.468 14.779 84.212 1.00 17.95  ? 1141 GLN A NE2 1 
ATOM   2642 N N   . THR A 1 343 ? 24.700 19.113 78.805 1.00 9.82   ? 1142 THR A N   1 
ATOM   2643 C CA  . THR A 1 343 ? 25.143 20.139 77.871 1.00 9.83   ? 1142 THR A CA  1 
ATOM   2644 C C   . THR A 1 343 ? 24.035 20.033 76.783 1.00 16.96  ? 1142 THR A C   1 
ATOM   2645 O O   . THR A 1 343 ? 24.082 19.111 75.973 1.00 19.55  ? 1142 THR A O   1 
ATOM   2646 C CB  . THR A 1 343 ? 26.602 19.880 77.446 1.00 17.29  ? 1142 THR A CB  1 
ATOM   2647 O OG1 . THR A 1 343 ? 26.737 18.591 76.837 1.00 18.77  ? 1142 THR A OG1 1 
ATOM   2648 C CG2 . THR A 1 343 ? 27.546 19.952 78.598 1.00 19.79  ? 1142 THR A CG2 1 
ATOM   2649 N N   . PRO A 1 344 ? 23.069 20.945 76.786 1.00 14.47  ? 1143 PRO A N   1 
ATOM   2650 C CA  . PRO A 1 344 ? 21.940 20.860 75.851 1.00 14.30  ? 1143 PRO A CA  1 
ATOM   2651 C C   . PRO A 1 344 ? 22.222 21.511 74.497 1.00 22.07  ? 1143 PRO A C   1 
ATOM   2652 O O   . PRO A 1 344 ? 21.842 20.970 73.459 1.00 24.28  ? 1143 PRO A O   1 
ATOM   2653 C CB  . PRO A 1 344 ? 20.832 21.625 76.578 1.00 16.26  ? 1143 PRO A CB  1 
ATOM   2654 C CG  . PRO A 1 344 ? 21.556 22.595 77.442 1.00 21.95  ? 1143 PRO A CG  1 
ATOM   2655 C CD  . PRO A 1 344 ? 22.812 21.898 77.880 1.00 17.27  ? 1143 PRO A CD  1 
ATOM   2656 N N   . ASN A 1 345 ? 22.879 22.664 74.521 1.00 18.53  ? 1144 ASN A N   1 
ATOM   2657 C CA  . ASN A 1 345 ? 23.159 23.442 73.305 1.00 18.41  ? 1144 ASN A CA  1 
ATOM   2658 C C   . ASN A 1 345 ? 24.217 22.793 72.449 1.00 20.98  ? 1144 ASN A C   1 
ATOM   2659 O O   . ASN A 1 345 ? 24.049 22.778 71.233 1.00 22.29  ? 1144 ASN A O   1 
ATOM   2660 C CB  . ASN A 1 345 ? 23.459 24.914 73.609 1.00 21.57  ? 1144 ASN A CB  1 
ATOM   2661 C CG  . ASN A 1 345 ? 22.520 25.585 74.617 1.00 46.03  ? 1144 ASN A CG  1 
ATOM   2662 O OD1 . ASN A 1 345 ? 21.319 25.299 74.640 1.00 35.70  ? 1144 ASN A OD1 1 
ATOM   2663 N ND2 . ASN A 1 345 ? 23.019 26.479 75.481 1.00 44.11  ? 1144 ASN A ND2 1 
ATOM   2664 N N   . ARG A 1 346 ? 25.246 22.160 73.062 1.00 15.73  ? 1145 ARG A N   1 
ATOM   2665 C CA  . ARG A 1 346 ? 26.261 21.430 72.281 1.00 15.02  ? 1145 ARG A CA  1 
ATOM   2666 C C   . ARG A 1 346 ? 25.627 20.149 71.759 1.00 19.35  ? 1145 ARG A C   1 
ATOM   2667 O O   . ARG A 1 346 ? 25.713 19.895 70.553 1.00 20.39  ? 1145 ARG A O   1 
ATOM   2668 C CB  . ARG A 1 346 ? 27.538 21.107 73.083 1.00 11.81  ? 1145 ARG A CB  1 
ATOM   2669 C CG  . ARG A 1 346 ? 28.727 20.603 72.230 1.00 11.87  ? 1145 ARG A CG  1 
ATOM   2670 C CD  . ARG A 1 346 ? 29.921 20.362 73.146 1.00 16.85  ? 1145 ARG A CD  1 
ATOM   2671 N NE  . ARG A 1 346 ? 31.140 19.880 72.491 1.00 14.80  ? 1145 ARG A NE  1 
ATOM   2672 C CZ  . ARG A 1 346 ? 32.314 19.762 73.115 1.00 25.56  ? 1145 ARG A CZ  1 
ATOM   2673 N NH1 . ARG A 1 346 ? 32.432 20.098 74.393 1.00 17.41  ? 1145 ARG A NH1 1 
ATOM   2674 N NH2 . ARG A 1 346 ? 33.371 19.285 72.472 1.00 9.99   ? 1145 ARG A NH2 1 
ATOM   2675 N N   . ALA A 1 347 ? 24.939 19.380 72.650 1.00 13.67  ? 1146 ALA A N   1 
ATOM   2676 C CA  . ALA A 1 347 ? 24.278 18.136 72.278 1.00 12.40  ? 1146 ALA A CA  1 
ATOM   2677 C C   . ALA A 1 347 ? 23.304 18.348 71.131 1.00 17.10  ? 1146 ALA A C   1 
ATOM   2678 O O   . ALA A 1 347 ? 23.384 17.602 70.154 1.00 18.25  ? 1146 ALA A O   1 
ATOM   2679 C CB  . ALA A 1 347 ? 23.598 17.507 73.465 1.00 12.45  ? 1146 ALA A CB  1 
ATOM   2680 N N   . LYS A 1 348 ? 22.493 19.433 71.164 1.00 12.07  ? 1147 LYS A N   1 
ATOM   2681 C CA  . LYS A 1 348 ? 21.584 19.756 70.058 1.00 12.30  ? 1147 LYS A CA  1 
ATOM   2682 C C   . LYS A 1 348 ? 22.374 19.964 68.761 1.00 17.67  ? 1147 LYS A C   1 
ATOM   2683 O O   . LYS A 1 348 ? 22.059 19.274 67.786 1.00 19.93  ? 1147 LYS A O   1 
ATOM   2684 C CB  . LYS A 1 348 ? 20.686 20.964 70.351 1.00 14.12  ? 1147 LYS A CB  1 
ATOM   2685 C CG  . LYS A 1 348 ? 19.602 20.721 71.406 1.00 28.72  ? 1147 LYS A CG  1 
ATOM   2686 C CD  . LYS A 1 348 ? 18.665 21.921 71.593 1.00 37.17  ? 1147 LYS A CD  1 
ATOM   2687 C CE  . LYS A 1 348 ? 18.451 22.267 73.043 1.00 47.90  ? 1147 LYS A CE  1 
ATOM   2688 N NZ  . LYS A 1 348 ? 17.848 23.615 73.196 1.00 67.27  ? 1147 LYS A NZ  1 
ATOM   2689 N N   . ARG A 1 349 ? 23.441 20.836 68.766 1.00 11.67  ? 1148 ARG A N   1 
ATOM   2690 C CA  . ARG A 1 349 ? 24.260 21.098 67.578 1.00 11.04  ? 1148 ARG A CA  1 
ATOM   2691 C C   . ARG A 1 349 ? 24.862 19.812 67.020 1.00 16.47  ? 1148 ARG A C   1 
ATOM   2692 O O   . ARG A 1 349 ? 24.798 19.598 65.807 1.00 18.38  ? 1148 ARG A O   1 
ATOM   2693 C CB  . ARG A 1 349 ? 25.352 22.141 67.836 1.00 8.61   ? 1148 ARG A CB  1 
ATOM   2694 C CG  . ARG A 1 349 ? 24.862 23.568 68.047 1.00 13.81  ? 1148 ARG A CG  1 
ATOM   2695 C CD  . ARG A 1 349 ? 25.991 24.602 68.167 1.00 18.49  ? 1148 ARG A CD  1 
ATOM   2696 N NE  . ARG A 1 349 ? 26.831 24.393 69.347 1.00 16.86  ? 1148 ARG A NE  1 
ATOM   2697 C CZ  . ARG A 1 349 ? 26.778 25.108 70.466 1.00 36.01  ? 1148 ARG A CZ  1 
ATOM   2698 N NH1 . ARG A 1 349 ? 25.956 26.151 70.563 1.00 13.32  ? 1148 ARG A NH1 1 
ATOM   2699 N NH2 . ARG A 1 349 ? 27.565 24.804 71.489 1.00 40.06  ? 1148 ARG A NH2 1 
ATOM   2700 N N   . VAL A 1 350 ? 25.396 18.927 67.904 1.00 12.40  ? 1149 VAL A N   1 
ATOM   2701 C CA  . VAL A 1 350 ? 25.983 17.631 67.522 1.00 12.31  ? 1149 VAL A CA  1 
ATOM   2702 C C   . VAL A 1 350 ? 24.913 16.671 66.976 1.00 19.98  ? 1149 VAL A C   1 
ATOM   2703 O O   . VAL A 1 350 ? 25.072 16.171 65.863 1.00 20.79  ? 1149 VAL A O   1 
ATOM   2704 C CB  . VAL A 1 350 ? 26.854 17.032 68.646 1.00 13.17  ? 1149 VAL A CB  1 
ATOM   2705 C CG1 . VAL A 1 350 ? 27.136 15.542 68.433 1.00 12.79  ? 1149 VAL A CG1 1 
ATOM   2706 C CG2 . VAL A 1 350 ? 28.154 17.814 68.757 1.00 12.74  ? 1149 VAL A CG2 1 
ATOM   2707 N N   . ILE A 1 351 ? 23.802 16.474 67.727 1.00 17.75  ? 1150 ILE A N   1 
ATOM   2708 C CA  . ILE A 1 351 ? 22.650 15.646 67.331 1.00 18.49  ? 1150 ILE A CA  1 
ATOM   2709 C C   . ILE A 1 351 ? 22.070 16.084 65.946 1.00 25.67  ? 1150 ILE A C   1 
ATOM   2710 O O   . ILE A 1 351 ? 21.807 15.224 65.094 1.00 26.66  ? 1150 ILE A O   1 
ATOM   2711 C CB  . ILE A 1 351 ? 21.598 15.647 68.468 1.00 20.41  ? 1150 ILE A CB  1 
ATOM   2712 C CG1 . ILE A 1 351 ? 22.057 14.732 69.624 1.00 18.92  ? 1150 ILE A CG1 1 
ATOM   2713 C CG2 . ILE A 1 351 ? 20.219 15.261 67.953 1.00 22.59  ? 1150 ILE A CG2 1 
ATOM   2714 C CD1 . ILE A 1 351 ? 21.431 14.986 70.889 1.00 16.39  ? 1150 ILE A CD1 1 
ATOM   2715 N N   . THR A 1 352 ? 21.915 17.419 65.722 1.00 22.79  ? 1151 THR A N   1 
ATOM   2716 C CA  . THR A 1 352 ? 21.444 17.979 64.449 1.00 23.90  ? 1151 THR A CA  1 
ATOM   2717 C C   . THR A 1 352 ? 22.397 17.573 63.324 1.00 27.79  ? 1151 THR A C   1 
ATOM   2718 O O   . THR A 1 352 ? 21.952 17.202 62.238 1.00 29.20  ? 1151 THR A O   1 
ATOM   2719 C CB  . THR A 1 352 ? 21.197 19.496 64.569 1.00 31.08  ? 1151 THR A CB  1 
ATOM   2720 O OG1 . THR A 1 352 ? 19.859 19.681 65.029 1.00 37.92  ? 1151 THR A OG1 1 
ATOM   2721 C CG2 . THR A 1 352 ? 21.377 20.243 63.249 1.00 26.89  ? 1151 THR A CG2 1 
ATOM   2722 N N   . THR A 1 353 ? 23.699 17.593 63.614 1.00 22.75  ? 1152 THR A N   1 
ATOM   2723 C CA  . THR A 1 353 ? 24.725 17.225 62.661 1.00 22.90  ? 1152 THR A CA  1 
ATOM   2724 C C   . THR A 1 353 ? 24.631 15.729 62.309 1.00 29.40  ? 1152 THR A C   1 
ATOM   2725 O O   . THR A 1 353 ? 24.776 15.395 61.139 1.00 31.18  ? 1152 THR A O   1 
ATOM   2726 C CB  . THR A 1 353 ? 26.066 17.804 63.115 1.00 21.56  ? 1152 THR A CB  1 
ATOM   2727 O OG1 . THR A 1 353 ? 25.993 19.230 62.953 1.00 22.62  ? 1152 THR A OG1 1 
ATOM   2728 C CG2 . THR A 1 353 ? 27.254 17.243 62.336 1.00 16.79  ? 1152 THR A CG2 1 
ATOM   2729 N N   . PHE A 1 354 ? 24.314 14.842 63.293 1.00 25.00  ? 1153 PHE A N   1 
ATOM   2730 C CA  . PHE A 1 354 ? 24.159 13.394 63.053 1.00 24.57  ? 1153 PHE A CA  1 
ATOM   2731 C C   . PHE A 1 354 ? 22.895 13.145 62.272 1.00 31.54  ? 1153 PHE A C   1 
ATOM   2732 O O   . PHE A 1 354 ? 22.893 12.291 61.380 1.00 33.59  ? 1153 PHE A O   1 
ATOM   2733 C CB  . PHE A 1 354 ? 24.100 12.578 64.357 1.00 24.62  ? 1153 PHE A CB  1 
ATOM   2734 C CG  . PHE A 1 354 ? 25.415 12.135 64.951 1.00 25.49  ? 1153 PHE A CG  1 
ATOM   2735 C CD1 . PHE A 1 354 ? 26.439 11.650 64.143 1.00 30.50  ? 1153 PHE A CD1 1 
ATOM   2736 C CD2 . PHE A 1 354 ? 25.612 12.145 66.323 1.00 25.42  ? 1153 PHE A CD2 1 
ATOM   2737 C CE1 . PHE A 1 354 ? 27.646 11.219 64.701 1.00 30.68  ? 1153 PHE A CE1 1 
ATOM   2738 C CE2 . PHE A 1 354 ? 26.815 11.715 66.873 1.00 27.47  ? 1153 PHE A CE2 1 
ATOM   2739 C CZ  . PHE A 1 354 ? 27.826 11.256 66.062 1.00 26.84  ? 1153 PHE A CZ  1 
ATOM   2740 N N   . ARG A 1 355 ? 21.823 13.901 62.594 1.00 27.63  ? 1154 ARG A N   1 
ATOM   2741 C CA  . ARG A 1 355 ? 20.531 13.791 61.935 1.00 28.52  ? 1154 ARG A CA  1 
ATOM   2742 C C   . ARG A 1 355 ? 20.649 14.082 60.421 1.00 35.09  ? 1154 ARG A C   1 
ATOM   2743 O O   . ARG A 1 355 ? 20.451 13.174 59.610 1.00 37.36  ? 1154 ARG A O   1 
ATOM   2744 C CB  . ARG A 1 355 ? 19.524 14.731 62.614 1.00 25.97  ? 1154 ARG A CB  1 
ATOM   2745 C CG  . ARG A 1 355 ? 18.075 14.541 62.195 1.00 30.66  ? 1154 ARG A CG  1 
ATOM   2746 C CD  . ARG A 1 355 ? 17.164 15.463 62.978 1.00 45.75  ? 1154 ARG A CD  1 
ATOM   2747 N NE  . ARG A 1 355 ? 17.275 16.862 62.552 1.00 61.87  ? 1154 ARG A NE  1 
ATOM   2748 C CZ  . ARG A 1 355 ? 16.547 17.414 61.584 1.00 81.45  ? 1154 ARG A CZ  1 
ATOM   2749 N NH1 . ARG A 1 355 ? 15.642 16.694 60.929 1.00 71.70  ? 1154 ARG A NH1 1 
ATOM   2750 N NH2 . ARG A 1 355 ? 16.718 18.690 61.262 1.00 68.27  ? 1154 ARG A NH2 1 
ATOM   2751 N N   . THR A 1 356 ? 21.059 15.317 60.061 1.00 29.98  ? 1155 THR A N   1 
ATOM   2752 C CA  . THR A 1 356 ? 21.153 15.838 58.698 1.00 30.53  ? 1155 THR A CA  1 
ATOM   2753 C C   . THR A 1 356 ? 22.388 15.503 57.888 1.00 35.31  ? 1155 THR A C   1 
ATOM   2754 O O   . THR A 1 356 ? 22.313 15.550 56.671 1.00 38.55  ? 1155 THR A O   1 
ATOM   2755 C CB  . THR A 1 356 ? 20.943 17.358 58.701 1.00 37.23  ? 1155 THR A CB  1 
ATOM   2756 O OG1 . THR A 1 356 ? 22.091 18.003 59.253 1.00 32.81  ? 1155 THR A OG1 1 
ATOM   2757 C CG2 . THR A 1 356 ? 19.681 17.784 59.445 1.00 35.97  ? 1155 THR A CG2 1 
ATOM   2758 N N   . GLY A 1 357 ? 23.521 15.277 58.522 1.00 30.21  ? 1156 GLY A N   1 
ATOM   2759 C CA  . GLY A 1 357 ? 24.774 15.056 57.801 1.00 31.56  ? 1156 GLY A CA  1 
ATOM   2760 C C   . GLY A 1 357 ? 25.315 16.308 57.108 1.00 38.68  ? 1156 GLY A C   1 
ATOM   2761 O O   . GLY A 1 357 ? 26.099 16.202 56.152 1.00 40.16  ? 1156 GLY A O   1 
ATOM   2762 N N   . THR A 1 358 ? 24.925 17.510 57.616 1.00 34.76  ? 1157 THR A N   1 
ATOM   2763 C CA  . THR A 1 358 ? 25.303 18.844 57.123 1.00 35.18  ? 1157 THR A CA  1 
ATOM   2764 C C   . THR A 1 358 ? 25.911 19.685 58.243 1.00 37.61  ? 1157 THR A C   1 
ATOM   2765 O O   . THR A 1 358 ? 25.706 19.361 59.415 1.00 37.22  ? 1157 THR A O   1 
ATOM   2766 C CB  . THR A 1 358 ? 24.049 19.609 56.609 1.00 46.96  ? 1157 THR A CB  1 
ATOM   2767 O OG1 . THR A 1 358 ? 23.179 19.963 57.701 1.00 47.14  ? 1157 THR A OG1 1 
ATOM   2768 C CG2 . THR A 1 358 ? 23.286 18.859 55.525 1.00 46.20  ? 1157 THR A CG2 1 
ATOM   2769 N N   . TRP A 1 359 ? 26.544 20.829 57.894 1.00 33.25  ? 1158 TRP A N   1 
ATOM   2770 C CA  . TRP A 1 359 ? 27.108 21.763 58.873 1.00 31.19  ? 1158 TRP A CA  1 
ATOM   2771 C C   . TRP A 1 359 ? 26.113 22.830 59.347 1.00 37.36  ? 1158 TRP A C   1 
ATOM   2772 O O   . TRP A 1 359 ? 26.524 23.767 60.029 1.00 35.04  ? 1158 TRP A O   1 
ATOM   2773 C CB  . TRP A 1 359 ? 28.349 22.442 58.324 1.00 29.46  ? 1158 TRP A CB  1 
ATOM   2774 C CG  . TRP A 1 359 ? 29.466 21.503 58.034 1.00 30.27  ? 1158 TRP A CG  1 
ATOM   2775 C CD1 . TRP A 1 359 ? 29.846 21.043 56.808 1.00 34.88  ? 1158 TRP A CD1 1 
ATOM   2776 C CD2 . TRP A 1 359 ? 30.374 20.929 58.977 1.00 28.37  ? 1158 TRP A CD2 1 
ATOM   2777 N NE1 . TRP A 1 359 ? 30.938 20.220 56.929 1.00 34.22  ? 1158 TRP A NE1 1 
ATOM   2778 C CE2 . TRP A 1 359 ? 31.282 20.128 58.253 1.00 33.13  ? 1158 TRP A CE2 1 
ATOM   2779 C CE3 . TRP A 1 359 ? 30.487 20.982 60.371 1.00 27.78  ? 1158 TRP A CE3 1 
ATOM   2780 C CZ2 . TRP A 1 359 ? 32.312 19.412 58.870 1.00 31.09  ? 1158 TRP A CZ2 1 
ATOM   2781 C CZ3 . TRP A 1 359 ? 31.503 20.259 60.980 1.00 28.45  ? 1158 TRP A CZ3 1 
ATOM   2782 C CH2 . TRP A 1 359 ? 32.414 19.506 60.227 1.00 29.55  ? 1158 TRP A CH2 1 
ATOM   2783 N N   . ASP A 1 360 ? 24.815 22.669 59.029 1.00 37.80  ? 1159 ASP A N   1 
ATOM   2784 C CA  . ASP A 1 360 ? 23.740 23.602 59.386 1.00 39.51  ? 1159 ASP A CA  1 
ATOM   2785 C C   . ASP A 1 360 ? 23.793 24.224 60.800 1.00 41.15  ? 1159 ASP A C   1 
ATOM   2786 O O   . ASP A 1 360 ? 23.646 25.446 60.950 1.00 41.64  ? 1159 ASP A O   1 
ATOM   2787 C CB  . ASP A 1 360 ? 22.363 22.964 59.123 1.00 44.09  ? 1159 ASP A CB  1 
ATOM   2788 C CG  . ASP A 1 360 ? 21.737 23.354 57.788 1.00 69.29  ? 1159 ASP A CG  1 
ATOM   2789 O OD1 . ASP A 1 360 ? 22.314 22.994 56.729 1.00 73.03  ? 1159 ASP A OD1 1 
ATOM   2790 O OD2 . ASP A 1 360 ? 20.650 23.989 57.800 1.00 78.05  ? 1159 ASP A OD2 1 
ATOM   2791 N N   . ALA A 1 361 ? 24.004 23.380 61.823 1.00 35.13  ? 1160 ALA A N   1 
ATOM   2792 C CA  . ALA A 1 361 ? 24.054 23.770 63.234 1.00 33.42  ? 1160 ALA A CA  1 
ATOM   2793 C C   . ALA A 1 361 ? 25.180 24.763 63.544 1.00 36.17  ? 1160 ALA A C   1 
ATOM   2794 O O   . ALA A 1 361 ? 25.060 25.581 64.467 1.00 35.52  ? 1160 ALA A O   1 
ATOM   2795 C CB  . ALA A 1 361 ? 24.212 22.526 64.088 1.00 33.10  ? 1160 ALA A CB  1 
ATOM   2796 N N   . TYR A 1 362 ? 26.259 24.689 62.746 1.00 31.57  ? 1161 TYR A N   1 
ATOM   2797 C CA  . TYR A 1 362 ? 27.457 25.499 62.859 1.00 30.41  ? 1161 TYR A CA  1 
ATOM   2798 C C   . TYR A 1 362 ? 27.521 26.616 61.804 1.00 38.25  ? 1161 TYR A C   1 
ATOM   2799 O O   . TYR A 1 362 ? 28.576 27.195 61.589 1.00 37.31  ? 1161 TYR A O   1 
ATOM   2800 C CB  . TYR A 1 362 ? 28.693 24.571 62.838 1.00 29.93  ? 1161 TYR A CB  1 
ATOM   2801 C CG  . TYR A 1 362 ? 28.682 23.588 63.985 1.00 29.38  ? 1161 TYR A CG  1 
ATOM   2802 C CD1 . TYR A 1 362 ? 29.077 23.974 65.262 1.00 29.70  ? 1161 TYR A CD1 1 
ATOM   2803 C CD2 . TYR A 1 362 ? 28.192 22.299 63.816 1.00 30.38  ? 1161 TYR A CD2 1 
ATOM   2804 C CE1 . TYR A 1 362 ? 28.964 23.109 66.350 1.00 28.32  ? 1161 TYR A CE1 1 
ATOM   2805 C CE2 . TYR A 1 362 ? 28.078 21.420 64.895 1.00 30.29  ? 1161 TYR A CE2 1 
ATOM   2806 C CZ  . TYR A 1 362 ? 28.482 21.823 66.161 1.00 33.21  ? 1161 TYR A CZ  1 
ATOM   2807 O OH  . TYR A 1 362 ? 28.398 20.950 67.225 1.00 28.08  ? 1161 TYR A OH  1 
ATOM   2808 N N   . LEU A 1 363 ? 26.397 26.941 61.162 1.00 35.54  ? 405  LEU A N   1 
ATOM   2809 C CA  . LEU A 1 363 ? 26.377 28.007 60.160 1.00 37.36  ? 405  LEU A CA  1 
ATOM   2810 C C   . LEU A 1 363 ? 25.262 28.986 60.427 1.00 52.26  ? 405  LEU A C   1 
ATOM   2811 O O   . LEU A 1 363 ? 24.229 28.610 60.992 1.00 52.11  ? 405  LEU A O   1 
ATOM   2812 C CB  . LEU A 1 363 ? 26.258 27.477 58.714 1.00 36.26  ? 405  LEU A CB  1 
ATOM   2813 C CG  . LEU A 1 363 ? 27.333 26.527 58.179 1.00 40.45  ? 405  LEU A CG  1 
ATOM   2814 C CD1 . LEU A 1 363 ? 26.867 25.864 56.902 1.00 40.19  ? 405  LEU A CD1 1 
ATOM   2815 C CD2 . LEU A 1 363 ? 28.657 27.224 57.964 1.00 42.52  ? 405  LEU A CD2 1 
ATOM   2816 N N   . HIS A 1 364 ? 25.472 30.246 59.996 1.00 57.12  ? 406  HIS A N   1 
ATOM   2817 C CA  . HIS A 1 364 ? 24.509 31.345 60.100 1.00 60.31  ? 406  HIS A CA  1 
ATOM   2818 C C   . HIS A 1 364 ? 24.015 31.716 58.696 1.00 69.64  ? 406  HIS A C   1 
ATOM   2819 O O   . HIS A 1 364 ? 24.625 31.293 57.701 1.00 69.77  ? 406  HIS A O   1 
ATOM   2820 C CB  . HIS A 1 364 ? 25.137 32.564 60.796 1.00 62.49  ? 406  HIS A CB  1 
ATOM   2821 C CG  . HIS A 1 364 ? 25.651 32.264 62.167 1.00 67.55  ? 406  HIS A CG  1 
ATOM   2822 N ND1 . HIS A 1 364 ? 26.972 31.894 62.377 1.00 70.76  ? 406  HIS A ND1 1 
ATOM   2823 C CD2 . HIS A 1 364 ? 24.998 32.258 63.355 1.00 70.50  ? 406  HIS A CD2 1 
ATOM   2824 C CE1 . HIS A 1 364 ? 27.084 31.687 63.681 1.00 71.13  ? 406  HIS A CE1 1 
ATOM   2825 N NE2 . HIS A 1 364 ? 25.924 31.899 64.313 1.00 71.25  ? 406  HIS A NE2 1 
ATOM   2826 N N   . MET A 1 365 ? 22.905 32.499 58.620 1.00 70.20  ? 407  MET A N   1 
ATOM   2827 C CA  . MET A 1 365 ? 22.256 32.959 57.379 1.00 71.85  ? 407  MET A CA  1 
ATOM   2828 C C   . MET A 1 365 ? 21.902 31.755 56.515 1.00 76.60  ? 407  MET A C   1 
ATOM   2829 O O   . MET A 1 365 ? 22.170 31.774 55.313 1.00 76.34  ? 407  MET A O   1 
ATOM   2830 C CB  . MET A 1 365 ? 23.159 33.925 56.560 1.00 75.44  ? 407  MET A CB  1 
ATOM   2831 C CG  . MET A 1 365 ? 23.663 35.139 57.307 1.00 81.14  ? 407  MET A CG  1 
ATOM   2832 S SD  . MET A 1 365 ? 25.017 35.940 56.394 1.00 87.23  ? 407  MET A SD  1 
ATOM   2833 C CE  . MET A 1 365 ? 25.865 36.779 57.766 1.00 85.01  ? 407  MET A CE  1 
ATOM   2834 N N   . ASN A 1 366 ? 21.363 30.685 57.118 1.00 74.04  ? 408  ASN A N   1 
ATOM   2835 C CA  . ASN A 1 366 ? 21.045 29.489 56.338 1.00 74.70  ? 408  ASN A CA  1 
ATOM   2836 C C   . ASN A 1 366 ? 19.950 29.699 55.268 1.00 79.57  ? 408  ASN A C   1 
ATOM   2837 O O   . ASN A 1 366 ? 19.990 29.035 54.225 1.00 78.93  ? 408  ASN A O   1 
ATOM   2838 C CB  . ASN A 1 366 ? 20.821 28.262 57.226 1.00 77.07  ? 408  ASN A CB  1 
ATOM   2839 C CG  . ASN A 1 366 ? 22.101 27.557 57.642 1.00 103.99 ? 408  ASN A CG  1 
ATOM   2840 O OD1 . ASN A 1 366 ? 22.997 27.282 56.828 1.00 99.52  ? 408  ASN A OD1 1 
ATOM   2841 N ND2 . ASN A 1 366 ? 22.189 27.192 58.914 1.00 96.34  ? 408  ASN A ND2 1 
ATOM   2842 N N   . ARG A 1 367 ? 19.029 30.677 55.499 1.00 76.45  ? 409  ARG A N   1 
ATOM   2843 C CA  . ARG A 1 367 ? 17.956 31.034 54.562 1.00 76.01  ? 409  ARG A CA  1 
ATOM   2844 C C   . ARG A 1 367 ? 18.512 31.697 53.307 1.00 77.20  ? 409  ARG A C   1 
ATOM   2845 O O   . ARG A 1 367 ? 18.050 31.376 52.215 1.00 76.88  ? 409  ARG A O   1 
ATOM   2846 C CB  . ARG A 1 367 ? 16.878 31.899 55.229 1.00 78.99  ? 409  ARG A CB  1 
ATOM   2847 C CG  . ARG A 1 367 ? 15.877 31.082 56.040 1.00 95.96  ? 409  ARG A CG  1 
ATOM   2848 C CD  . ARG A 1 367 ? 14.811 31.952 56.681 1.00 114.78 ? 409  ARG A CD  1 
ATOM   2849 N NE  . ARG A 1 367 ? 13.966 31.184 57.603 1.00 132.66 ? 409  ARG A NE  1 
ATOM   2850 C CZ  . ARG A 1 367 ? 13.982 31.311 58.928 1.00 152.76 ? 409  ARG A CZ  1 
ATOM   2851 N NH1 . ARG A 1 367 ? 14.789 32.190 59.511 1.00 142.56 ? 409  ARG A NH1 1 
ATOM   2852 N NH2 . ARG A 1 367 ? 13.180 30.566 59.681 1.00 141.53 ? 409  ARG A NH2 1 
ATOM   2853 N N   . GLU A 1 368 ? 19.520 32.591 53.460 1.00 72.30  ? 410  GLU A N   1 
ATOM   2854 C CA  . GLU A 1 368 ? 20.222 33.264 52.355 1.00 71.38  ? 410  GLU A CA  1 
ATOM   2855 C C   . GLU A 1 368 ? 21.051 32.222 51.594 1.00 73.00  ? 410  GLU A C   1 
ATOM   2856 O O   . GLU A 1 368 ? 20.967 32.143 50.369 1.00 72.25  ? 410  GLU A O   1 
ATOM   2857 C CB  . GLU A 1 368 ? 21.141 34.389 52.875 1.00 73.16  ? 410  GLU A CB  1 
ATOM   2858 C CG  . GLU A 1 368 ? 20.421 35.681 53.208 1.00 87.34  ? 410  GLU A CG  1 
ATOM   2859 C CD  . GLU A 1 368 ? 20.333 36.008 54.686 1.00 118.36 ? 410  GLU A CD  1 
ATOM   2860 O OE1 . GLU A 1 368 ? 20.896 37.051 55.093 1.00 122.72 ? 410  GLU A OE1 1 
ATOM   2861 O OE2 . GLU A 1 368 ? 19.686 35.239 55.435 1.00 113.37 ? 410  GLU A OE2 1 
ATOM   2862 N N   . ARG A 1 369 ? 21.821 31.403 52.345 1.00 68.29  ? 411  ARG A N   1 
ATOM   2863 C CA  . ARG A 1 369 ? 22.666 30.303 51.879 1.00 67.85  ? 411  ARG A CA  1 
ATOM   2864 C C   . ARG A 1 369 ? 21.853 29.402 50.951 1.00 71.29  ? 411  ARG A C   1 
ATOM   2865 O O   . ARG A 1 369 ? 22.276 29.158 49.823 1.00 70.83  ? 411  ARG A O   1 
ATOM   2866 C CB  . ARG A 1 369 ? 23.159 29.510 53.102 1.00 68.37  ? 411  ARG A CB  1 
ATOM   2867 C CG  . ARG A 1 369 ? 24.338 28.572 52.861 1.00 77.21  ? 411  ARG A CG  1 
ATOM   2868 C CD  . ARG A 1 369 ? 24.900 28.063 54.182 1.00 81.67  ? 411  ARG A CD  1 
ATOM   2869 N NE  . ARG A 1 369 ? 25.374 29.160 55.031 1.00 89.01  ? 411  ARG A NE  1 
ATOM   2870 C CZ  . ARG A 1 369 ? 26.588 29.702 54.957 1.00 108.94 ? 411  ARG A CZ  1 
ATOM   2871 N NH1 . ARG A 1 369 ? 27.479 29.241 54.084 1.00 96.26  ? 411  ARG A NH1 1 
ATOM   2872 N NH2 . ARG A 1 369 ? 26.923 30.705 55.758 1.00 99.50  ? 411  ARG A NH2 1 
ATOM   2873 N N   . LYS A 1 370 ? 20.662 28.961 51.417 1.00 68.15  ? 412  LYS A N   1 
ATOM   2874 C CA  . LYS A 1 370 ? 19.727 28.124 50.668 1.00 68.62  ? 412  LYS A CA  1 
ATOM   2875 C C   . LYS A 1 370 ? 19.287 28.843 49.376 1.00 72.17  ? 412  LYS A C   1 
ATOM   2876 O O   . LYS A 1 370 ? 19.488 28.305 48.280 1.00 72.38  ? 412  LYS A O   1 
ATOM   2877 C CB  . LYS A 1 370 ? 18.515 27.747 51.548 1.00 71.80  ? 412  LYS A CB  1 
ATOM   2878 C CG  . LYS A 1 370 ? 18.469 26.274 51.942 1.00 92.79  ? 412  LYS A CG  1 
ATOM   2879 C CD  . LYS A 1 370 ? 17.119 25.633 51.570 1.00 107.63 ? 412  LYS A CD  1 
ATOM   2880 C CE  . LYS A 1 370 ? 17.139 24.114 51.536 1.00 117.31 ? 412  LYS A CE  1 
ATOM   2881 N NZ  . LYS A 1 370 ? 15.851 23.540 51.053 1.00 120.01 ? 412  LYS A NZ  1 
ATOM   2882 N N   . ALA A 1 371 ? 18.765 30.089 49.514 1.00 67.61  ? 413  ALA A N   1 
ATOM   2883 C CA  . ALA A 1 371 ? 18.306 30.954 48.419 1.00 67.10  ? 413  ALA A CA  1 
ATOM   2884 C C   . ALA A 1 371 ? 19.386 31.266 47.365 1.00 69.04  ? 413  ALA A C   1 
ATOM   2885 O O   . ALA A 1 371 ? 19.044 31.458 46.195 1.00 68.49  ? 413  ALA A O   1 
ATOM   2886 C CB  . ALA A 1 371 ? 17.734 32.247 48.978 1.00 67.88  ? 413  ALA A CB  1 
ATOM   2887 N N   . ALA A 1 372 ? 20.675 31.315 47.782 1.00 64.53  ? 414  ALA A N   1 
ATOM   2888 C CA  . ALA A 1 372 ? 21.828 31.570 46.911 1.00 64.18  ? 414  ALA A CA  1 
ATOM   2889 C C   . ALA A 1 372 ? 22.110 30.376 45.995 1.00 68.60  ? 414  ALA A C   1 
ATOM   2890 O O   . ALA A 1 372 ? 22.429 30.578 44.822 1.00 68.48  ? 414  ALA A O   1 
ATOM   2891 C CB  . ALA A 1 372 ? 23.057 31.896 47.739 1.00 65.00  ? 414  ALA A CB  1 
ATOM   2892 N N   . LYS A 1 373 ? 21.980 29.137 46.527 1.00 65.35  ? 415  LYS A N   1 
ATOM   2893 C CA  . LYS A 1 373 ? 22.163 27.898 45.767 1.00 65.92  ? 415  LYS A CA  1 
ATOM   2894 C C   . LYS A 1 373 ? 21.070 27.843 44.698 1.00 69.85  ? 415  LYS A C   1 
ATOM   2895 O O   . LYS A 1 373 ? 21.369 27.521 43.548 1.00 69.76  ? 415  LYS A O   1 
ATOM   2896 C CB  . LYS A 1 373 ? 22.094 26.670 46.699 1.00 69.05  ? 415  LYS A CB  1 
ATOM   2897 C CG  . LYS A 1 373 ? 22.298 25.316 46.006 1.00 88.37  ? 415  LYS A CG  1 
ATOM   2898 C CD  . LYS A 1 373 ? 21.315 24.257 46.529 1.00 100.05 ? 415  LYS A CD  1 
ATOM   2899 C CE  . LYS A 1 373 ? 21.252 23.025 45.653 1.00 110.63 ? 415  LYS A CE  1 
ATOM   2900 N NZ  . LYS A 1 373 ? 19.850 22.653 45.320 1.00 117.67 ? 415  LYS A NZ  1 
ATOM   2901 N N   . GLN A 1 374 ? 19.818 28.206 45.072 1.00 66.27  ? 416  GLN A N   1 
ATOM   2902 C CA  . GLN A 1 374 ? 18.674 28.249 44.160 1.00 66.46  ? 416  GLN A CA  1 
ATOM   2903 C C   . GLN A 1 374 ? 18.917 29.251 43.035 1.00 70.26  ? 416  GLN A C   1 
ATOM   2904 O O   . GLN A 1 374 ? 18.697 28.891 41.881 1.00 70.61  ? 416  GLN A O   1 
ATOM   2905 C CB  . GLN A 1 374 ? 17.376 28.585 44.900 1.00 67.77  ? 416  GLN A CB  1 
ATOM   2906 C CG  . GLN A 1 374 ? 16.127 28.306 44.067 1.00 83.05  ? 416  GLN A CG  1 
ATOM   2907 C CD  . GLN A 1 374 ? 14.967 29.187 44.448 1.00 101.60 ? 416  GLN A CD  1 
ATOM   2908 O OE1 . GLN A 1 374 ? 15.057 30.418 44.424 1.00 98.75  ? 416  GLN A OE1 1 
ATOM   2909 N NE2 . GLN A 1 374 ? 13.832 28.577 44.750 1.00 90.08  ? 416  GLN A NE2 1 
ATOM   2910 N N   . LEU A 1 375 ? 19.388 30.489 43.361 1.00 66.20  ? 417  LEU A N   1 
ATOM   2911 C CA  . LEU A 1 375 ? 19.698 31.519 42.360 1.00 66.13  ? 417  LEU A CA  1 
ATOM   2912 C C   . LEU A 1 375 ? 20.779 31.028 41.399 1.00 71.90  ? 417  LEU A C   1 
ATOM   2913 O O   . LEU A 1 375 ? 20.613 31.160 40.184 1.00 71.94  ? 417  LEU A O   1 
ATOM   2914 C CB  . LEU A 1 375 ? 20.076 32.866 43.000 1.00 65.53  ? 417  LEU A CB  1 
ATOM   2915 C CG  . LEU A 1 375 ? 20.681 33.954 42.085 1.00 70.34  ? 417  LEU A CG  1 
ATOM   2916 C CD1 . LEU A 1 375 ? 19.702 34.408 40.983 1.00 70.45  ? 417  LEU A CD1 1 
ATOM   2917 C CD2 . LEU A 1 375 ? 21.127 35.143 42.895 1.00 72.73  ? 417  LEU A CD2 1 
ATOM   2918 N N   . GLY A 1 376 ? 21.832 30.423 41.950 1.00 68.99  ? 418  GLY A N   1 
ATOM   2919 C CA  . GLY A 1 376 ? 22.924 29.832 41.184 1.00 69.72  ? 418  GLY A CA  1 
ATOM   2920 C C   . GLY A 1 376 ? 22.456 28.738 40.244 1.00 74.62  ? 418  GLY A C   1 
ATOM   2921 O O   . GLY A 1 376 ? 22.924 28.665 39.111 1.00 74.81  ? 418  GLY A O   1 
ATOM   2922 N N   . PHE A 1 377 ? 21.510 27.900 40.700 1.00 72.01  ? 419  PHE A N   1 
ATOM   2923 C CA  . PHE A 1 377 ? 20.922 26.819 39.914 1.00 73.53  ? 419  PHE A CA  1 
ATOM   2924 C C   . PHE A 1 377 ? 20.161 27.430 38.728 1.00 76.89  ? 419  PHE A C   1 
ATOM   2925 O O   . PHE A 1 377 ? 20.376 27.000 37.593 1.00 77.16  ? 419  PHE A O   1 
ATOM   2926 C CB  . PHE A 1 377 ? 19.981 25.974 40.795 1.00 76.34  ? 419  PHE A CB  1 
ATOM   2927 C CG  . PHE A 1 377 ? 20.184 24.475 40.758 1.00 80.39  ? 419  PHE A CG  1 
ATOM   2928 C CD1 . PHE A 1 377 ? 19.677 23.712 39.711 1.00 85.31  ? 419  PHE A CD1 1 
ATOM   2929 C CD2 . PHE A 1 377 ? 20.832 23.818 41.802 1.00 83.97  ? 419  PHE A CD2 1 
ATOM   2930 C CE1 . PHE A 1 377 ? 19.839 22.320 39.692 1.00 88.36  ? 419  PHE A CE1 1 
ATOM   2931 C CE2 . PHE A 1 377 ? 20.986 22.423 41.789 1.00 88.75  ? 419  PHE A CE2 1 
ATOM   2932 C CZ  . PHE A 1 377 ? 20.496 21.685 40.728 1.00 88.15  ? 419  PHE A CZ  1 
ATOM   2933 N N   . ILE A 1 378 ? 19.321 28.474 38.989 1.00 72.41  ? 420  ILE A N   1 
ATOM   2934 C CA  . ILE A 1 378 ? 18.545 29.222 37.982 1.00 71.77  ? 420  ILE A CA  1 
ATOM   2935 C C   . ILE A 1 378 ? 19.489 29.819 36.921 1.00 77.16  ? 420  ILE A C   1 
ATOM   2936 O O   . ILE A 1 378 ? 19.321 29.528 35.738 1.00 76.96  ? 420  ILE A O   1 
ATOM   2937 C CB  . ILE A 1 378 ? 17.573 30.257 38.645 1.00 73.23  ? 420  ILE A CB  1 
ATOM   2938 C CG1 . ILE A 1 378 ? 16.275 29.559 39.111 1.00 73.24  ? 420  ILE A CG1 1 
ATOM   2939 C CG2 . ILE A 1 378 ? 17.254 31.448 37.726 1.00 73.29  ? 420  ILE A CG2 1 
ATOM   2940 C CD1 . ILE A 1 378 ? 15.359 30.377 40.058 1.00 74.26  ? 420  ILE A CD1 1 
ATOM   2941 N N   . MET A 1 379 ? 20.516 30.582 37.361 1.00 75.53  ? 421  MET A N   1 
ATOM   2942 C CA  . MET A 1 379 ? 21.537 31.187 36.500 1.00 76.90  ? 421  MET A CA  1 
ATOM   2943 C C   . MET A 1 379 ? 22.312 30.129 35.737 1.00 82.61  ? 421  MET A C   1 
ATOM   2944 O O   . MET A 1 379 ? 22.588 30.334 34.562 1.00 83.33  ? 421  MET A O   1 
ATOM   2945 C CB  . MET A 1 379 ? 22.505 32.061 37.305 1.00 79.47  ? 421  MET A CB  1 
ATOM   2946 C CG  . MET A 1 379 ? 22.001 33.467 37.523 1.00 83.68  ? 421  MET A CG  1 
ATOM   2947 S SD  . MET A 1 379 ? 23.081 34.470 38.581 1.00 89.04  ? 421  MET A SD  1 
ATOM   2948 C CE  . MET A 1 379 ? 24.403 34.848 37.445 1.00 87.25  ? 421  MET A CE  1 
ATOM   2949 N N   . ALA A 1 380 ? 22.631 28.986 36.384 1.00 79.87  ? 422  ALA A N   1 
ATOM   2950 C CA  . ALA A 1 380 ? 23.354 27.881 35.752 1.00 81.35  ? 422  ALA A CA  1 
ATOM   2951 C C   . ALA A 1 380 ? 22.560 27.251 34.614 1.00 86.76  ? 422  ALA A C   1 
ATOM   2952 O O   . ALA A 1 380 ? 23.166 26.765 33.666 1.00 87.74  ? 422  ALA A O   1 
ATOM   2953 C CB  . ALA A 1 380 ? 23.716 26.823 36.778 1.00 82.44  ? 422  ALA A CB  1 
ATOM   2954 N N   . ALA A 1 381 ? 21.217 27.264 34.701 1.00 83.32  ? 423  ALA A N   1 
ATOM   2955 C CA  . ALA A 1 381 ? 20.340 26.707 33.671 1.00 84.18  ? 423  ALA A CA  1 
ATOM   2956 C C   . ALA A 1 381 ? 20.276 27.629 32.452 1.00 88.71  ? 423  ALA A C   1 
ATOM   2957 O O   . ALA A 1 381 ? 20.478 27.169 31.328 1.00 89.85  ? 423  ALA A O   1 
ATOM   2958 C CB  . ALA A 1 381 ? 18.945 26.479 34.235 1.00 84.57  ? 423  ALA A CB  1 
ATOM   2959 N N   . PHE A 1 382 ? 20.023 28.933 32.688 1.00 84.51  ? 424  PHE A N   1 
ATOM   2960 C CA  . PHE A 1 382 ? 19.898 29.984 31.673 1.00 84.74  ? 424  PHE A CA  1 
ATOM   2961 C C   . PHE A 1 382 ? 21.162 30.228 30.840 1.00 90.30  ? 424  PHE A C   1 
ATOM   2962 O O   . PHE A 1 382 ? 21.050 30.688 29.708 1.00 90.33  ? 424  PHE A O   1 
ATOM   2963 C CB  . PHE A 1 382 ? 19.412 31.283 32.322 1.00 85.43  ? 424  PHE A CB  1 
ATOM   2964 C CG  . PHE A 1 382 ? 18.684 32.222 31.394 1.00 87.16  ? 424  PHE A CG  1 
ATOM   2965 C CD1 . PHE A 1 382 ? 17.321 32.082 31.167 1.00 90.33  ? 424  PHE A CD1 1 
ATOM   2966 C CD2 . PHE A 1 382 ? 19.350 33.279 30.786 1.00 89.61  ? 424  PHE A CD2 1 
ATOM   2967 C CE1 . PHE A 1 382 ? 16.642 32.961 30.321 1.00 91.63  ? 424  PHE A CE1 1 
ATOM   2968 C CE2 . PHE A 1 382 ? 18.671 34.158 29.939 1.00 92.82  ? 424  PHE A CE2 1 
ATOM   2969 C CZ  . PHE A 1 382 ? 17.319 33.998 29.718 1.00 90.97  ? 424  PHE A CZ  1 
ATOM   2970 N N   . ILE A 1 383 ? 22.351 29.938 31.387 1.00 87.74  ? 425  ILE A N   1 
ATOM   2971 C CA  . ILE A 1 383 ? 23.602 30.102 30.641 1.00 88.89  ? 425  ILE A CA  1 
ATOM   2972 C C   . ILE A 1 383 ? 23.895 28.790 29.883 1.00 97.47  ? 425  ILE A C   1 
ATOM   2973 O O   . ILE A 1 383 ? 24.408 28.828 28.767 1.00 98.42  ? 425  ILE A O   1 
ATOM   2974 C CB  . ILE A 1 383 ? 24.778 30.625 31.530 1.00 91.12  ? 425  ILE A CB  1 
ATOM   2975 C CG1 . ILE A 1 383 ? 24.404 31.886 32.372 1.00 89.68  ? 425  ILE A CG1 1 
ATOM   2976 C CG2 . ILE A 1 383 ? 26.064 30.854 30.733 1.00 93.09  ? 425  ILE A CG2 1 
ATOM   2977 C CD1 . ILE A 1 383 ? 23.566 33.008 31.710 1.00 95.08  ? 425  ILE A CD1 1 
ATOM   2978 N N   . LEU A 1 384 ? 23.483 27.644 30.464 1.00 96.09  ? 426  LEU A N   1 
ATOM   2979 C CA  . LEU A 1 384 ? 23.621 26.299 29.893 1.00 98.24  ? 426  LEU A CA  1 
ATOM   2980 C C   . LEU A 1 384 ? 22.712 26.119 28.668 1.00 104.69 ? 426  LEU A C   1 
ATOM   2981 O O   . LEU A 1 384 ? 23.051 25.361 27.756 1.00 105.90 ? 426  LEU A O   1 
ATOM   2982 C CB  . LEU A 1 384 ? 23.231 25.266 30.962 1.00 98.12  ? 426  LEU A CB  1 
ATOM   2983 C CG  . LEU A 1 384 ? 23.780 23.861 30.810 1.00 104.47 ? 426  LEU A CG  1 
ATOM   2984 C CD1 . LEU A 1 384 ? 24.626 23.491 32.008 1.00 104.41 ? 426  LEU A CD1 1 
ATOM   2985 C CD2 . LEU A 1 384 ? 22.654 22.861 30.610 1.00 107.28 ? 426  LEU A CD2 1 
ATOM   2986 N N   . CYS A 1 385 ? 21.556 26.804 28.665 1.00 101.83 ? 427  CYS A N   1 
ATOM   2987 C CA  . CYS A 1 385 ? 20.533 26.718 27.623 1.00 103.21 ? 427  CYS A CA  1 
ATOM   2988 C C   . CYS A 1 385 ? 20.657 27.722 26.470 1.00 107.37 ? 427  CYS A C   1 
ATOM   2989 O O   . CYS A 1 385 ? 20.305 27.390 25.334 1.00 108.04 ? 427  CYS A O   1 
ATOM   2990 C CB  . CYS A 1 385 ? 19.146 26.778 28.254 1.00 103.11 ? 427  CYS A CB  1 
ATOM   2991 S SG  . CYS A 1 385 ? 18.727 25.338 29.271 1.00 107.75 ? 427  CYS A SG  1 
ATOM   2992 N N   . TRP A 1 386 ? 21.094 28.956 26.771 1.00 102.93 ? 428  TRP A N   1 
ATOM   2993 C CA  . TRP A 1 386 ? 21.181 30.034 25.795 1.00 102.88 ? 428  TRP A CA  1 
ATOM   2994 C C   . TRP A 1 386 ? 22.562 30.351 25.231 1.00 109.33 ? 428  TRP A C   1 
ATOM   2995 O O   . TRP A 1 386 ? 22.623 30.731 24.061 1.00 110.09 ? 428  TRP A O   1 
ATOM   2996 C CB  . TRP A 1 386 ? 20.501 31.298 26.319 1.00 99.96  ? 428  TRP A CB  1 
ATOM   2997 C CG  . TRP A 1 386 ? 19.006 31.225 26.336 1.00 100.40 ? 428  TRP A CG  1 
ATOM   2998 C CD1 . TRP A 1 386 ? 18.205 31.075 27.430 1.00 102.28 ? 428  TRP A CD1 1 
ATOM   2999 C CD2 . TRP A 1 386 ? 18.131 31.342 25.210 1.00 100.96 ? 428  TRP A CD2 1 
ATOM   3000 N NE1 . TRP A 1 386 ? 16.882 31.095 27.055 1.00 101.97 ? 428  TRP A NE1 1 
ATOM   3001 C CE2 . TRP A 1 386 ? 16.806 31.270 25.698 1.00 104.41 ? 428  TRP A CE2 1 
ATOM   3002 C CE3 . TRP A 1 386 ? 18.335 31.511 23.831 1.00 103.22 ? 428  TRP A CE3 1 
ATOM   3003 C CZ2 . TRP A 1 386 ? 15.691 31.346 24.856 1.00 104.45 ? 428  TRP A CZ2 1 
ATOM   3004 C CZ3 . TRP A 1 386 ? 17.230 31.587 22.998 1.00 105.44 ? 428  TRP A CZ3 1 
ATOM   3005 C CH2 . TRP A 1 386 ? 15.927 31.500 23.510 1.00 105.59 ? 428  TRP A CH2 1 
ATOM   3006 N N   . ILE A 1 387 ? 23.611 30.137 26.017 1.00 106.76 ? 429  ILE A N   1 
ATOM   3007 C CA  . ILE A 1 387 ? 24.981 30.344 25.567 1.00 108.19 ? 429  ILE A CA  1 
ATOM   3008 C C   . ILE A 1 387 ? 25.251 29.750 24.185 1.00 114.41 ? 429  ILE A C   1 
ATOM   3009 O O   . ILE A 1 387 ? 25.646 30.472 23.269 1.00 114.81 ? 429  ILE A O   1 
ATOM   3010 C CB  . ILE A 1 387 ? 25.996 29.758 26.568 1.00 111.66 ? 429  ILE A CB  1 
ATOM   3011 C CG1 . ILE A 1 387 ? 27.187 30.703 26.735 1.00 112.51 ? 429  ILE A CG1 1 
ATOM   3012 C CG2 . ILE A 1 387 ? 26.460 28.382 26.113 1.00 114.49 ? 429  ILE A CG2 1 
ATOM   3013 C CD1 . ILE A 1 387 ? 27.138 31.529 28.002 1.00 118.90 ? 429  ILE A CD1 1 
ATOM   3014 N N   . PRO A 1 388 ? 25.050 28.443 24.028 1.00 112.12 ? 430  PRO A N   1 
ATOM   3015 C CA  . PRO A 1 388 ? 25.391 27.797 22.747 1.00 114.31 ? 430  PRO A CA  1 
ATOM   3016 C C   . PRO A 1 388 ? 24.783 28.516 21.534 1.00 119.53 ? 430  PRO A C   1 
ATOM   3017 O O   . PRO A 1 388 ? 25.454 28.632 20.511 1.00 120.69 ? 430  PRO A O   1 
ATOM   3018 C CB  . PRO A 1 388 ? 24.838 26.376 22.908 1.00 116.56 ? 430  PRO A CB  1 
ATOM   3019 C CG  . PRO A 1 388 ? 23.803 26.484 23.962 1.00 118.62 ? 430  PRO A CG  1 
ATOM   3020 C CD  . PRO A 1 388 ? 24.337 27.494 24.911 1.00 112.68 ? 430  PRO A CD  1 
ATOM   3021 N N   . TYR A 1 389 ? 23.535 29.030 21.668 1.00 115.48 ? 431  TYR A N   1 
ATOM   3022 C CA  . TYR A 1 389 ? 22.812 29.778 20.632 1.00 115.85 ? 431  TYR A CA  1 
ATOM   3023 C C   . TYR A 1 389 ? 23.432 31.158 20.393 1.00 120.39 ? 431  TYR A C   1 
ATOM   3024 O O   . TYR A 1 389 ? 23.517 31.586 19.243 1.00 121.47 ? 431  TYR A O   1 
ATOM   3025 C CB  . TYR A 1 389 ? 21.313 29.894 20.994 1.00 115.77 ? 431  TYR A CB  1 
ATOM   3026 C CG  . TYR A 1 389 ? 20.538 30.946 20.222 1.00 117.24 ? 431  TYR A CG  1 
ATOM   3027 C CD1 . TYR A 1 389 ? 20.116 30.713 18.917 1.00 120.59 ? 431  TYR A CD1 1 
ATOM   3028 C CD2 . TYR A 1 389 ? 20.190 32.158 20.814 1.00 116.59 ? 431  TYR A CD2 1 
ATOM   3029 C CE1 . TYR A 1 389 ? 19.401 31.677 18.205 1.00 121.48 ? 431  TYR A CE1 1 
ATOM   3030 C CE2 . TYR A 1 389 ? 19.464 33.124 20.116 1.00 117.53 ? 431  TYR A CE2 1 
ATOM   3031 C CZ  . TYR A 1 389 ? 19.062 32.874 18.815 1.00 125.96 ? 431  TYR A CZ  1 
ATOM   3032 O OH  . TYR A 1 389 ? 18.352 33.821 18.118 1.00 126.38 ? 431  TYR A OH  1 
ATOM   3033 N N   . PHE A 1 390 ? 23.822 31.863 21.473 1.00 116.07 ? 432  PHE A N   1 
ATOM   3034 C CA  . PHE A 1 390 ? 24.436 33.187 21.379 1.00 116.28 ? 432  PHE A CA  1 
ATOM   3035 C C   . PHE A 1 390 ? 25.865 33.126 20.876 1.00 123.29 ? 432  PHE A C   1 
ATOM   3036 O O   . PHE A 1 390 ? 26.332 34.088 20.261 1.00 123.62 ? 432  PHE A O   1 
ATOM   3037 C CB  . PHE A 1 390 ? 24.314 33.972 22.690 1.00 116.39 ? 432  PHE A CB  1 
ATOM   3038 C CG  . PHE A 1 390 ? 22.992 34.690 22.810 1.00 116.67 ? 432  PHE A CG  1 
ATOM   3039 C CD1 . PHE A 1 390 ? 21.923 34.106 23.478 1.00 118.33 ? 432  PHE A CD1 1 
ATOM   3040 C CD2 . PHE A 1 390 ? 22.806 35.940 22.230 1.00 119.08 ? 432  PHE A CD2 1 
ATOM   3041 C CE1 . PHE A 1 390 ? 20.696 34.766 23.577 1.00 118.42 ? 432  PHE A CE1 1 
ATOM   3042 C CE2 . PHE A 1 390 ? 21.574 36.595 22.323 1.00 121.08 ? 432  PHE A CE2 1 
ATOM   3043 C CZ  . PHE A 1 390 ? 20.531 36.006 23.003 1.00 117.97 ? 432  PHE A CZ  1 
ATOM   3044 N N   . ILE A 1 391 ? 26.557 31.995 21.112 1.00 122.02 ? 433  ILE A N   1 
ATOM   3045 C CA  . ILE A 1 391 ? 27.908 31.787 20.598 1.00 124.59 ? 433  ILE A CA  1 
ATOM   3046 C C   . ILE A 1 391 ? 27.829 31.323 19.121 1.00 132.41 ? 433  ILE A C   1 
ATOM   3047 O O   . ILE A 1 391 ? 28.817 31.416 18.394 1.00 134.13 ? 433  ILE A O   1 
ATOM   3048 C CB  . ILE A 1 391 ? 28.789 30.905 21.534 1.00 127.92 ? 433  ILE A CB  1 
ATOM   3049 C CG1 . ILE A 1 391 ? 30.274 31.290 21.453 1.00 130.06 ? 433  ILE A CG1 1 
ATOM   3050 C CG2 . ILE A 1 391 ? 28.568 29.404 21.349 1.00 129.22 ? 433  ILE A CG2 1 
ATOM   3051 C CD1 . ILE A 1 391 ? 30.711 32.282 22.502 1.00 136.67 ? 433  ILE A CD1 1 
ATOM   3052 N N   . PHE A 1 392 ? 26.627 30.865 18.688 1.00 129.75 ? 434  PHE A N   1 
ATOM   3053 C CA  . PHE A 1 392 ? 26.296 30.444 17.319 1.00 131.64 ? 434  PHE A CA  1 
ATOM   3054 C C   . PHE A 1 392 ? 25.938 31.683 16.491 1.00 136.22 ? 434  PHE A C   1 
ATOM   3055 O O   . PHE A 1 392 ? 26.028 31.659 15.263 1.00 137.60 ? 434  PHE A O   1 
ATOM   3056 C CB  . PHE A 1 392 ? 25.116 29.457 17.336 1.00 133.20 ? 434  PHE A CB  1 
ATOM   3057 C CG  . PHE A 1 392 ? 25.008 28.547 16.138 1.00 137.22 ? 434  PHE A CG  1 
ATOM   3058 C CD1 . PHE A 1 392 ? 25.901 27.496 15.959 1.00 142.41 ? 434  PHE A CD1 1 
ATOM   3059 C CD2 . PHE A 1 392 ? 23.982 28.703 15.216 1.00 140.08 ? 434  PHE A CD2 1 
ATOM   3060 C CE1 . PHE A 1 392 ? 25.794 26.646 14.854 1.00 145.58 ? 434  PHE A CE1 1 
ATOM   3061 C CE2 . PHE A 1 392 ? 23.872 27.845 14.115 1.00 145.06 ? 434  PHE A CE2 1 
ATOM   3062 C CZ  . PHE A 1 392 ? 24.769 26.813 13.950 1.00 144.93 ? 434  PHE A CZ  1 
ATOM   3063 N N   . PHE A 1 393 ? 25.523 32.758 17.182 1.00 131.61 ? 435  PHE A N   1 
ATOM   3064 C CA  . PHE A 1 393 ? 25.196 34.066 16.627 1.00 131.74 ? 435  PHE A CA  1 
ATOM   3065 C C   . PHE A 1 393 ? 26.502 34.804 16.370 1.00 137.98 ? 435  PHE A C   1 
ATOM   3066 O O   . PHE A 1 393 ? 26.593 35.576 15.420 1.00 138.49 ? 435  PHE A O   1 
ATOM   3067 C CB  . PHE A 1 393 ? 24.329 34.848 17.622 1.00 131.56 ? 435  PHE A CB  1 
ATOM   3068 C CG  . PHE A 1 393 ? 22.970 35.249 17.104 1.00 132.73 ? 435  PHE A CG  1 
ATOM   3069 C CD1 . PHE A 1 393 ? 22.632 36.590 16.960 1.00 135.73 ? 435  PHE A CD1 1 
ATOM   3070 C CD2 . PHE A 1 393 ? 22.023 34.287 16.764 1.00 134.96 ? 435  PHE A CD2 1 
ATOM   3071 C CE1 . PHE A 1 393 ? 21.373 36.963 16.480 1.00 136.56 ? 435  PHE A CE1 1 
ATOM   3072 C CE2 . PHE A 1 393 ? 20.771 34.661 16.269 1.00 137.75 ? 435  PHE A CE2 1 
ATOM   3073 C CZ  . PHE A 1 393 ? 20.450 35.996 16.139 1.00 135.68 ? 435  PHE A CZ  1 
ATOM   3074 N N   . MET A 1 394 ? 27.519 34.541 17.218 1.00 136.06 ? 436  MET A N   1 
ATOM   3075 C CA  . MET A 1 394 ? 28.886 35.064 17.130 1.00 138.20 ? 436  MET A CA  1 
ATOM   3076 C C   . MET A 1 394 ? 29.569 34.435 15.892 1.00 145.03 ? 436  MET A C   1 
ATOM   3077 O O   . MET A 1 394 ? 30.465 35.049 15.309 1.00 146.43 ? 436  MET A O   1 
ATOM   3078 C CB  . MET A 1 394 ? 29.656 34.704 18.423 1.00 140.36 ? 436  MET A CB  1 
ATOM   3079 C CG  . MET A 1 394 ? 31.020 35.380 18.573 1.00 145.80 ? 436  MET A CG  1 
ATOM   3080 S SD  . MET A 1 394 ? 31.964 34.796 20.020 1.00 149.75 ? 436  MET A SD  1 
ATOM   3081 C CE  . MET A 1 394 ? 32.726 33.321 19.351 1.00 148.53 ? 436  MET A CE  1 
ATOM   3082 N N   . VAL A 1 395 ? 29.129 33.213 15.498 1.00 142.40 ? 437  VAL A N   1 
ATOM   3083 C CA  . VAL A 1 395 ? 29.614 32.508 14.322 1.00 144.94 ? 437  VAL A CA  1 
ATOM   3084 C C   . VAL A 1 395 ? 29.101 32.908 12.946 1.00 150.40 ? 437  VAL A C   1 
ATOM   3085 O O   . VAL A 1 395 ? 29.908 33.131 12.042 1.00 152.24 ? 437  VAL A O   1 
ATOM   3086 C CB  . VAL A 1 395 ? 29.307 30.938 14.420 1.00 149.16 ? 437  VAL A CB  1 
ATOM   3087 C CG1 . VAL A 1 395 ? 29.660 30.210 13.124 1.00 151.73 ? 437  VAL A CG1 1 
ATOM   3088 C CG2 . VAL A 1 395 ? 30.026 30.288 15.595 1.00 148.65 ? 437  VAL A CG2 1 
ATOM   3089 N N   . ILE A 1 396 ? 27.761 33.080 12.819 1.00 145.86 ? 438  ILE A N   1 
ATOM   3090 C CA  . ILE A 1 396 ? 26.983 33.499 11.610 1.00 146.47 ? 438  ILE A CA  1 
ATOM   3091 C C   . ILE A 1 396 ? 27.285 34.928 11.211 1.00 153.05 ? 438  ILE A C   1 
ATOM   3092 O O   . ILE A 1 396 ? 27.375 35.209 10.013 1.00 154.21 ? 438  ILE A O   1 
ATOM   3093 C CB  . ILE A 1 396 ? 25.468 33.128 11.791 1.00 147.43 ? 438  ILE A CB  1 
ATOM   3094 C CG1 . ILE A 1 396 ? 25.232 31.598 11.892 1.00 147.59 ? 438  ILE A CG1 1 
ATOM   3095 C CG2 . ILE A 1 396 ? 24.603 33.737 10.673 1.00 148.66 ? 438  ILE A CG2 1 
ATOM   3096 C CD1 . ILE A 1 396 ? 23.895 31.177 12.503 1.00 150.43 ? 438  ILE A CD1 1 
ATOM   3097 N N   . ALA A 1 397 ? 27.467 35.836 12.204 1.00 150.26 ? 439  ALA A N   1 
ATOM   3098 C CA  . ALA A 1 397 ? 27.747 37.276 12.040 1.00 151.57 ? 439  ALA A CA  1 
ATOM   3099 C C   . ALA A 1 397 ? 28.779 37.594 10.949 1.00 160.63 ? 439  ALA A C   1 
ATOM   3100 O O   . ALA A 1 397 ? 28.496 38.397 10.057 1.00 161.46 ? 439  ALA A O   1 
ATOM   3101 C CB  . ALA A 1 397 ? 28.176 37.882 13.369 1.00 151.12 ? 439  ALA A CB  1 
ATOM   3102 N N   . PHE A 1 398 ? 29.922 36.908 10.948 1.00 160.05 ? 440  PHE A N   1 
ATOM   3103 C CA  . PHE A 1 398 ? 30.947 37.136 9.916  1.00 163.61 ? 440  PHE A CA  1 
ATOM   3104 C C   . PHE A 1 398 ? 31.096 36.015 8.866  1.00 172.03 ? 440  PHE A C   1 
ATOM   3105 O O   . PHE A 1 398 ? 31.684 36.222 7.804  1.00 174.72 ? 440  PHE A O   1 
ATOM   3106 C CB  . PHE A 1 398 ? 32.303 37.417 10.570 1.00 166.42 ? 440  PHE A CB  1 
ATOM   3107 C CG  . PHE A 1 398 ? 33.257 38.170 9.688  1.00 170.84 ? 440  PHE A CG  1 
ATOM   3108 C CD1 . PHE A 1 398 ? 32.877 39.361 9.092  1.00 174.29 ? 440  PHE A CD1 1 
ATOM   3109 C CD2 . PHE A 1 398 ? 34.534 37.688 9.454  1.00 175.42 ? 440  PHE A CD2 1 
ATOM   3110 C CE1 . PHE A 1 398 ? 33.752 40.057 8.279  1.00 178.03 ? 440  PHE A CE1 1 
ATOM   3111 C CE2 . PHE A 1 398 ? 35.413 38.379 8.642  1.00 181.07 ? 440  PHE A CE2 1 
ATOM   3112 C CZ  . PHE A 1 398 ? 35.021 39.565 8.054  1.00 179.54 ? 440  PHE A CZ  1 
ATOM   3113 N N   . CYS A 1 399 ? 30.529 34.842 9.128  1.00 168.60 ? 441  CYS A N   1 
ATOM   3114 C CA  . CYS A 1 399 ? 30.697 33.702 8.216  1.00 170.86 ? 441  CYS A CA  1 
ATOM   3115 C C   . CYS A 1 399 ? 29.735 33.646 7.014  1.00 175.30 ? 441  CYS A C   1 
ATOM   3116 O O   . CYS A 1 399 ? 30.138 33.308 5.902  1.00 177.34 ? 441  CYS A O   1 
ATOM   3117 C CB  . CYS A 1 399 ? 30.624 32.386 8.996  1.00 170.38 ? 441  CYS A CB  1 
ATOM   3118 S SG  . CYS A 1 399 ? 32.217 31.559 9.216  1.00 177.02 ? 441  CYS A SG  1 
ATOM   3119 N N   . LYS A 1 400 ? 28.472 33.981 7.255  1.00 169.87 ? 442  LYS A N   1 
ATOM   3120 C CA  . LYS A 1 400 ? 27.467 33.988 6.198  1.00 170.33 ? 442  LYS A CA  1 
ATOM   3121 C C   . LYS A 1 400 ? 26.735 32.653 6.109  1.00 174.75 ? 442  LYS A C   1 
ATOM   3122 O O   . LYS A 1 400 ? 26.161 32.318 5.073  1.00 175.63 ? 442  LYS A O   1 
ATOM   3123 C CB  . LYS A 1 400 ? 28.109 34.326 4.851  1.00 175.65 ? 442  LYS A CB  1 
ATOM   3124 N N   . ASN A 1 401 ? 26.760 31.894 7.199  1.00 170.29 ? 443  ASN A N   1 
ATOM   3125 C CA  . ASN A 1 401 ? 26.090 30.600 7.245  1.00 170.19 ? 443  ASN A CA  1 
ATOM   3126 C C   . ASN A 1 401 ? 27.073 29.434 7.217  1.00 175.50 ? 443  ASN A C   1 
ATOM   3127 O O   . ASN A 1 401 ? 26.988 28.559 6.355  1.00 177.29 ? 443  ASN A O   1 
ATOM   3128 C CB  . ASN A 1 401 ? 25.091 30.473 6.093  1.00 172.89 ? 443  ASN A CB  1 
ATOM   3129 C CG  . ASN A 1 401 ? 23.676 30.824 6.507  1.00 193.66 ? 443  ASN A CG  1 
ATOM   3130 O OD1 . ASN A 1 401 ? 23.389 31.002 7.691  1.00 185.09 ? 443  ASN A OD1 1 
ATOM   3131 N ND2 . ASN A 1 401 ? 22.781 30.926 5.531  1.00 186.55 ? 443  ASN A ND2 1 
ATOM   3132 N N   . CYS A 1 402 ? 28.003 29.428 8.166  1.00 170.71 ? 444  CYS A N   1 
ATOM   3133 C CA  . CYS A 1 402 ? 29.002 28.358 8.261  1.00 172.04 ? 444  CYS A CA  1 
ATOM   3134 C C   . CYS A 1 402 ? 28.541 26.917 8.544  1.00 174.36 ? 444  CYS A C   1 
ATOM   3135 O O   . CYS A 1 402 ? 29.309 25.969 8.381  1.00 176.17 ? 444  CYS A O   1 
ATOM   3136 C CB  . CYS A 1 402 ? 30.098 28.759 9.252  1.00 171.74 ? 444  CYS A CB  1 
ATOM   3137 S SG  . CYS A 1 402 ? 31.380 29.827 8.557  1.00 177.97 ? 444  CYS A SG  1 
ATOM   3138 N N   . CYS A 1 403 ? 27.290 26.767 8.968  1.00 167.67 ? 445  CYS A N   1 
ATOM   3139 C CA  . CYS A 1 403 ? 26.699 25.476 9.308  1.00 167.34 ? 445  CYS A CA  1 
ATOM   3140 C C   . CYS A 1 403 ? 25.217 25.391 8.942  1.00 169.26 ? 445  CYS A C   1 
ATOM   3141 O O   . CYS A 1 403 ? 24.563 26.415 8.717  1.00 166.98 ? 445  CYS A O   1 
ATOM   3142 C CB  . CYS A 1 403 ? 26.941 25.122 10.774 1.00 165.92 ? 445  CYS A CB  1 
ATOM   3143 S SG  . CYS A 1 403 ? 27.878 23.590 11.018 1.00 172.47 ? 445  CYS A SG  1 
ATOM   3144 N N   . ASN A 1 404 ? 24.702 24.152 8.886  1.00 166.71 ? 446  ASN A N   1 
ATOM   3145 C CA  . ASN A 1 404 ? 23.326 23.787 8.555  1.00 166.19 ? 446  ASN A CA  1 
ATOM   3146 C C   . ASN A 1 404 ? 22.307 24.359 9.540  1.00 166.06 ? 446  ASN A C   1 
ATOM   3147 O O   . ASN A 1 404 ? 22.671 24.846 10.612 1.00 163.44 ? 446  ASN A O   1 
ATOM   3148 C CB  . ASN A 1 404 ? 23.204 22.256 8.543  1.00 169.57 ? 446  ASN A CB  1 
ATOM   3149 C CG  . ASN A 1 404 ? 22.970 21.636 7.190  1.00 195.09 ? 446  ASN A CG  1 
ATOM   3150 O OD1 . ASN A 1 404 ? 23.843 21.657 6.316  1.00 191.58 ? 446  ASN A OD1 1 
ATOM   3151 N ND2 . ASN A 1 404 ? 21.767 21.122 6.966  1.00 186.72 ? 446  ASN A ND2 1 
ATOM   3152 N N   . GLU A 1 405 ? 21.020 24.273 9.171  1.00 162.18 ? 447  GLU A N   1 
ATOM   3153 C CA  . GLU A 1 405 ? 19.900 24.702 10.006 1.00 159.57 ? 447  GLU A CA  1 
ATOM   3154 C C   . GLU A 1 405 ? 19.321 23.479 10.751 1.00 163.51 ? 447  GLU A C   1 
ATOM   3155 O O   . GLU A 1 405 ? 18.221 23.557 11.302 1.00 161.70 ? 447  GLU A O   1 
ATOM   3156 C CB  . GLU A 1 405 ? 18.823 25.437 9.174  1.00 160.88 ? 447  GLU A CB  1 
ATOM   3157 C CG  . GLU A 1 405 ? 19.310 26.681 8.443  1.00 170.75 ? 447  GLU A CG  1 
ATOM   3158 C CD  . GLU A 1 405 ? 19.778 27.832 9.312  1.00 186.05 ? 447  GLU A CD  1 
ATOM   3159 O OE1 . GLU A 1 405 ? 20.998 27.920 9.580  1.00 180.95 ? 447  GLU A OE1 1 
ATOM   3160 O OE2 . GLU A 1 405 ? 18.927 28.659 9.710  1.00 177.43 ? 447  GLU A OE2 1 
ATOM   3161 N N   . HIS A 1 406 ? 20.080 22.350 10.761 1.00 161.88 ? 448  HIS A N   1 
ATOM   3162 C CA  . HIS A 1 406 ? 19.715 21.110 11.456 1.00 162.35 ? 448  HIS A CA  1 
ATOM   3163 C C   . HIS A 1 406 ? 20.131 21.186 12.935 1.00 164.27 ? 448  HIS A C   1 
ATOM   3164 O O   . HIS A 1 406 ? 19.447 20.625 13.795 1.00 163.32 ? 448  HIS A O   1 
ATOM   3165 C CB  . HIS A 1 406 ? 20.217 19.837 10.712 1.00 166.31 ? 448  HIS A CB  1 
ATOM   3166 C CG  . HIS A 1 406 ? 21.598 19.337 11.054 1.00 170.55 ? 448  HIS A CG  1 
ATOM   3167 N ND1 . HIS A 1 406 ? 22.783 19.991 11.083 1.00 171.66 ? 448  HIS A ND1 1 
ATOM   3168 C CD2 . HIS A 1 406 ? 21.827 17.998 11.335 1.00 174.41 ? 448  HIS A CD2 1 
ATOM   3169 C CE1 . HIS A 1 406 ? 23.744 19.066 11.420 1.00 172.81 ? 448  HIS A CE1 1 
ATOM   3170 N NE2 . HIS A 1 406 ? 23.128 17.893 11.558 1.00 174.76 ? 448  HIS A NE2 1 
ATOM   3171 N N   . LEU A 1 407 ? 21.228 21.931 13.219 1.00 159.70 ? 449  LEU A N   1 
ATOM   3172 C CA  . LEU A 1 407 ? 21.755 22.182 14.563 1.00 157.43 ? 449  LEU A CA  1 
ATOM   3173 C C   . LEU A 1 407 ? 21.279 23.545 15.087 1.00 158.01 ? 449  LEU A C   1 
ATOM   3174 O O   . LEU A 1 407 ? 21.031 23.680 16.284 1.00 155.95 ? 449  LEU A O   1 
ATOM   3175 C CB  . LEU A 1 407 ? 23.294 22.019 14.637 1.00 158.47 ? 449  LEU A CB  1 
ATOM   3176 C CG  . LEU A 1 407 ? 24.207 23.073 13.980 1.00 163.03 ? 449  LEU A CG  1 
ATOM   3177 C CD1 . LEU A 1 407 ? 25.504 23.202 14.745 1.00 162.79 ? 449  LEU A CD1 1 
ATOM   3178 C CD2 . LEU A 1 407 ? 24.517 22.718 12.530 1.00 168.39 ? 449  LEU A CD2 1 
ATOM   3179 N N   . HIS A 1 408 ? 21.110 24.536 14.173 1.00 153.80 ? 450  HIS A N   1 
ATOM   3180 C CA  . HIS A 1 408 ? 20.603 25.884 14.456 1.00 151.22 ? 450  HIS A CA  1 
ATOM   3181 C C   . HIS A 1 408 ? 19.172 25.790 15.000 1.00 153.21 ? 450  HIS A C   1 
ATOM   3182 O O   . HIS A 1 408 ? 18.755 26.632 15.796 1.00 150.49 ? 450  HIS A O   1 
ATOM   3183 C CB  . HIS A 1 408 ? 20.632 26.740 13.180 1.00 152.86 ? 450  HIS A CB  1 
ATOM   3184 C CG  . HIS A 1 408 ? 20.117 28.132 13.376 1.00 154.55 ? 450  HIS A CG  1 
ATOM   3185 N ND1 . HIS A 1 408 ? 20.948 29.151 13.806 1.00 155.31 ? 450  HIS A ND1 1 
ATOM   3186 C CD2 . HIS A 1 408 ? 18.882 28.639 13.155 1.00 155.71 ? 450  HIS A CD2 1 
ATOM   3187 C CE1 . HIS A 1 408 ? 20.193 30.236 13.846 1.00 153.57 ? 450  HIS A CE1 1 
ATOM   3188 N NE2 . HIS A 1 408 ? 18.943 29.977 13.464 1.00 154.10 ? 450  HIS A NE2 1 
ATOM   3189 N N   . MET A 1 409 ? 18.424 24.757 14.561 1.00 150.93 ? 451  MET A N   1 
ATOM   3190 C CA  . MET A 1 409 ? 17.057 24.466 15.001 1.00 149.98 ? 451  MET A CA  1 
ATOM   3191 C C   . MET A 1 409 ? 17.079 23.910 16.433 1.00 151.82 ? 451  MET A C   1 
ATOM   3192 O O   . MET A 1 409 ? 16.084 24.015 17.153 1.00 150.32 ? 451  MET A O   1 
ATOM   3193 C CB  . MET A 1 409 ? 16.405 23.447 14.050 1.00 154.79 ? 451  MET A CB  1 
ATOM   3194 C CG  . MET A 1 409 ? 15.037 23.873 13.527 1.00 158.60 ? 451  MET A CG  1 
ATOM   3195 S SD  . MET A 1 409 ? 13.712 23.967 14.766 1.00 161.33 ? 451  MET A SD  1 
ATOM   3196 C CE  . MET A 1 409 ? 13.789 22.304 15.465 1.00 159.68 ? 451  MET A CE  1 
ATOM   3197 N N   . PHE A 1 410 ? 18.216 23.313 16.842 1.00 148.05 ? 452  PHE A N   1 
ATOM   3198 C CA  . PHE A 1 410 ? 18.365 22.751 18.181 1.00 146.56 ? 452  PHE A CA  1 
ATOM   3199 C C   . PHE A 1 410 ? 18.794 23.774 19.232 1.00 145.52 ? 452  PHE A C   1 
ATOM   3200 O O   . PHE A 1 410 ? 18.326 23.689 20.365 1.00 143.65 ? 452  PHE A O   1 
ATOM   3201 C CB  . PHE A 1 410 ? 19.283 21.523 18.178 1.00 150.59 ? 452  PHE A CB  1 
ATOM   3202 C CG  . PHE A 1 410 ? 18.920 20.528 19.253 1.00 152.58 ? 452  PHE A CG  1 
ATOM   3203 C CD1 . PHE A 1 410 ? 17.857 19.647 19.079 1.00 157.35 ? 452  PHE A CD1 1 
ATOM   3204 C CD2 . PHE A 1 410 ? 19.626 20.485 20.449 1.00 153.69 ? 452  PHE A CD2 1 
ATOM   3205 C CE1 . PHE A 1 410 ? 17.509 18.739 20.083 1.00 158.76 ? 452  PHE A CE1 1 
ATOM   3206 C CE2 . PHE A 1 410 ? 19.280 19.573 21.451 1.00 156.92 ? 452  PHE A CE2 1 
ATOM   3207 C CZ  . PHE A 1 410 ? 18.223 18.706 21.261 1.00 156.66 ? 452  PHE A CZ  1 
ATOM   3208 N N   . THR A 1 411 ? 19.663 24.741 18.861 1.00 139.99 ? 453  THR A N   1 
ATOM   3209 C CA  . THR A 1 411 ? 20.127 25.790 19.777 1.00 137.14 ? 453  THR A CA  1 
ATOM   3210 C C   . THR A 1 411 ? 18.997 26.756 20.149 1.00 139.29 ? 453  THR A C   1 
ATOM   3211 O O   . THR A 1 411 ? 19.050 27.361 21.222 1.00 137.43 ? 453  THR A O   1 
ATOM   3212 C CB  . THR A 1 411 ? 21.422 26.482 19.306 1.00 141.73 ? 453  THR A CB  1 
ATOM   3213 O OG1 . THR A 1 411 ? 21.139 27.428 18.278 1.00 140.46 ? 453  THR A OG1 1 
ATOM   3214 C CG2 . THR A 1 411 ? 22.508 25.503 18.875 1.00 140.91 ? 453  THR A CG2 1 
ATOM   3215 N N   . ILE A 1 412 ? 17.973 26.891 19.272 1.00 136.14 ? 454  ILE A N   1 
ATOM   3216 C CA  . ILE A 1 412 ? 16.786 27.710 19.542 1.00 134.79 ? 454  ILE A CA  1 
ATOM   3217 C C   . ILE A 1 412 ? 15.829 26.923 20.439 1.00 138.10 ? 454  ILE A C   1 
ATOM   3218 O O   . ILE A 1 412 ? 15.138 27.524 21.262 1.00 136.45 ? 454  ILE A O   1 
ATOM   3219 C CB  . ILE A 1 412 ? 16.076 28.302 18.287 1.00 138.88 ? 454  ILE A CB  1 
ATOM   3220 C CG1 . ILE A 1 412 ? 15.560 27.225 17.315 1.00 141.71 ? 454  ILE A CG1 1 
ATOM   3221 C CG2 . ILE A 1 412 ? 16.936 29.326 17.572 1.00 139.45 ? 454  ILE A CG2 1 
ATOM   3222 C CD1 . ILE A 1 412 ? 14.072 27.249 17.121 1.00 150.94 ? 454  ILE A CD1 1 
ATOM   3223 N N   . TRP A 1 413 ? 15.805 25.577 20.285 1.00 135.83 ? 455  TRP A N   1 
ATOM   3224 C CA  . TRP A 1 413 ? 14.979 24.674 21.086 1.00 135.75 ? 455  TRP A CA  1 
ATOM   3225 C C   . TRP A 1 413 ? 15.604 24.371 22.437 1.00 136.19 ? 455  TRP A C   1 
ATOM   3226 O O   . TRP A 1 413 ? 14.877 24.056 23.377 1.00 135.48 ? 455  TRP A O   1 
ATOM   3227 C CB  . TRP A 1 413 ? 14.604 23.400 20.319 1.00 137.41 ? 455  TRP A CB  1 
ATOM   3228 C CG  . TRP A 1 413 ? 13.283 23.530 19.626 1.00 139.67 ? 455  TRP A CG  1 
ATOM   3229 C CD1 . TRP A 1 413 ? 13.064 24.029 18.378 1.00 143.45 ? 455  TRP A CD1 1 
ATOM   3230 C CD2 . TRP A 1 413 ? 11.987 23.277 20.192 1.00 139.86 ? 455  TRP A CD2 1 
ATOM   3231 N NE1 . TRP A 1 413 ? 11.715 24.047 18.104 1.00 143.92 ? 455  TRP A NE1 1 
ATOM   3232 C CE2 . TRP A 1 413 ? 11.029 23.594 19.201 1.00 145.00 ? 455  TRP A CE2 1 
ATOM   3233 C CE3 . TRP A 1 413 ? 11.540 22.783 21.431 1.00 140.73 ? 455  TRP A CE3 1 
ATOM   3234 C CZ2 . TRP A 1 413 ? 9.651  23.438 19.411 1.00 145.08 ? 455  TRP A CZ2 1 
ATOM   3235 C CZ3 . TRP A 1 413 ? 10.176 22.622 21.635 1.00 142.99 ? 455  TRP A CZ3 1 
ATOM   3236 C CH2 . TRP A 1 413 ? 9.248  22.955 20.636 1.00 144.85 ? 455  TRP A CH2 1 
ATOM   3237 N N   . LEU A 1 414 ? 16.943 24.512 22.551 1.00 130.64 ? 456  LEU A N   1 
ATOM   3238 C CA  . LEU A 1 414 ? 17.669 24.335 23.810 1.00 128.64 ? 456  LEU A CA  1 
ATOM   3239 C C   . LEU A 1 414 ? 17.363 25.512 24.733 1.00 128.55 ? 456  LEU A C   1 
ATOM   3240 O O   . LEU A 1 414 ? 17.313 25.343 25.946 1.00 127.38 ? 456  LEU A O   1 
ATOM   3241 C CB  . LEU A 1 414 ? 19.177 24.209 23.580 1.00 129.20 ? 456  LEU A CB  1 
ATOM   3242 C CG  . LEU A 1 414 ? 19.933 23.489 24.685 1.00 133.88 ? 456  LEU A CG  1 
ATOM   3243 C CD1 . LEU A 1 414 ? 19.824 21.977 24.536 1.00 136.33 ? 456  LEU A CD1 1 
ATOM   3244 C CD2 . LEU A 1 414 ? 21.372 23.904 24.701 1.00 136.09 ? 456  LEU A CD2 1 
ATOM   3245 N N   . GLY A 1 415 ? 17.140 26.681 24.138 1.00 122.87 ? 457  GLY A N   1 
ATOM   3246 C CA  . GLY A 1 415 ? 16.730 27.885 24.843 1.00 120.22 ? 457  GLY A CA  1 
ATOM   3247 C C   . GLY A 1 415 ? 15.289 27.746 25.294 1.00 122.37 ? 457  GLY A C   1 
ATOM   3248 O O   . GLY A 1 415 ? 14.913 28.269 26.344 1.00 120.58 ? 457  GLY A O   1 
ATOM   3249 N N   . TYR A 1 416 ? 14.476 27.007 24.507 1.00 119.89 ? 458  TYR A N   1 
ATOM   3250 C CA  . TYR A 1 416 ? 13.080 26.699 24.823 1.00 120.08 ? 458  TYR A CA  1 
ATOM   3251 C C   . TYR A 1 416 ? 13.044 25.589 25.891 1.00 122.39 ? 458  TYR A C   1 
ATOM   3252 O O   . TYR A 1 416 ? 12.014 25.398 26.538 1.00 121.83 ? 458  TYR A O   1 
ATOM   3253 C CB  . TYR A 1 416 ? 12.284 26.272 23.559 1.00 123.83 ? 458  TYR A CB  1 
ATOM   3254 C CG  . TYR A 1 416 ? 12.138 27.309 22.454 1.00 126.44 ? 458  TYR A CG  1 
ATOM   3255 C CD1 . TYR A 1 416 ? 11.970 28.661 22.750 1.00 127.29 ? 458  TYR A CD1 1 
ATOM   3256 C CD2 . TYR A 1 416 ? 12.053 26.923 21.116 1.00 129.03 ? 458  TYR A CD2 1 
ATOM   3257 C CE1 . TYR A 1 416 ? 11.812 29.613 21.738 1.00 128.47 ? 458  TYR A CE1 1 
ATOM   3258 C CE2 . TYR A 1 416 ? 11.894 27.866 20.096 1.00 130.15 ? 458  TYR A CE2 1 
ATOM   3259 C CZ  . TYR A 1 416 ? 11.765 29.209 20.412 1.00 135.54 ? 458  TYR A CZ  1 
ATOM   3260 O OH  . TYR A 1 416 ? 11.602 30.139 19.413 1.00 135.19 ? 458  TYR A OH  1 
ATOM   3261 N N   . ILE A 1 417 ? 14.173 24.859 26.065 1.00 118.38 ? 459  ILE A N   1 
ATOM   3262 C CA  . ILE A 1 417 ? 14.346 23.804 27.070 1.00 118.26 ? 459  ILE A CA  1 
ATOM   3263 C C   . ILE A 1 417 ? 14.433 24.437 28.478 1.00 119.49 ? 459  ILE A C   1 
ATOM   3264 O O   . ILE A 1 417 ? 13.895 23.863 29.424 1.00 119.45 ? 459  ILE A O   1 
ATOM   3265 C CB  . ILE A 1 417 ? 15.508 22.821 26.693 1.00 122.64 ? 459  ILE A CB  1 
ATOM   3266 C CG1 . ILE A 1 417 ? 14.997 21.704 25.750 1.00 125.53 ? 459  ILE A CG1 1 
ATOM   3267 C CG2 . ILE A 1 417 ? 16.242 22.229 27.915 1.00 122.80 ? 459  ILE A CG2 1 
ATOM   3268 C CD1 . ILE A 1 417 ? 16.076 21.031 24.824 1.00 132.90 ? 459  ILE A CD1 1 
ATOM   3269 N N   . ASN A 1 418 ? 15.042 25.649 28.594 1.00 113.36 ? 460  ASN A N   1 
ATOM   3270 C CA  . ASN A 1 418 ? 15.152 26.428 29.838 1.00 110.79 ? 460  ASN A CA  1 
ATOM   3271 C C   . ASN A 1 418 ? 13.759 26.770 30.369 1.00 113.55 ? 460  ASN A C   1 
ATOM   3272 O O   . ASN A 1 418 ? 13.562 26.812 31.580 1.00 112.55 ? 460  ASN A O   1 
ATOM   3273 C CB  . ASN A 1 418 ? 15.939 27.721 29.602 1.00 109.73 ? 460  ASN A CB  1 
ATOM   3274 C CG  . ASN A 1 418 ? 16.129 28.564 30.839 1.00 130.87 ? 460  ASN A CG  1 
ATOM   3275 O OD1 . ASN A 1 418 ? 17.037 28.337 31.643 1.00 125.01 ? 460  ASN A OD1 1 
ATOM   3276 N ND2 . ASN A 1 418 ? 15.255 29.540 31.029 1.00 122.09 ? 460  ASN A ND2 1 
ATOM   3277 N N   . SER A 1 419 ? 12.804 27.019 29.458 1.00 110.34 ? 461  SER A N   1 
ATOM   3278 C CA  . SER A 1 419 ? 11.410 27.326 29.761 1.00 110.22 ? 461  SER A CA  1 
ATOM   3279 C C   . SER A 1 419 ? 10.697 26.115 30.384 1.00 114.06 ? 461  SER A C   1 
ATOM   3280 O O   . SER A 1 419 ? 9.761  26.281 31.168 1.00 113.42 ? 461  SER A O   1 
ATOM   3281 C CB  . SER A 1 419 ? 10.696 27.771 28.493 1.00 115.34 ? 461  SER A CB  1 
ATOM   3282 O OG  . SER A 1 419 ? 9.328  28.047 28.732 1.00 126.08 ? 461  SER A OG  1 
ATOM   3283 N N   . THR A 1 420 ? 11.151 24.906 30.026 1.00 111.08 ? 462  THR A N   1 
ATOM   3284 C CA  . THR A 1 420 ? 10.638 23.632 30.529 1.00 111.88 ? 462  THR A CA  1 
ATOM   3285 C C   . THR A 1 420 ? 11.431 23.233 31.789 1.00 114.44 ? 462  THR A C   1 
ATOM   3286 O O   . THR A 1 420 ? 10.875 22.600 32.690 1.00 114.83 ? 462  THR A O   1 
ATOM   3287 C CB  . THR A 1 420 ? 10.770 22.543 29.440 1.00 118.60 ? 462  THR A CB  1 
ATOM   3288 O OG1 . THR A 1 420 ? 10.511 23.097 28.148 1.00 116.99 ? 462  THR A OG1 1 
ATOM   3289 C CG2 . THR A 1 420 ? 9.869  21.344 29.693 1.00 117.95 ? 462  THR A CG2 1 
ATOM   3290 N N   . LEU A 1 421 ? 12.731 23.605 31.835 1.00 108.94 ? 463  LEU A N   1 
ATOM   3291 C CA  . LEU A 1 421 ? 13.670 23.279 32.909 1.00 107.53 ? 463  LEU A CA  1 
ATOM   3292 C C   . LEU A 1 421 ? 13.510 24.074 34.205 1.00 109.05 ? 463  LEU A C   1 
ATOM   3293 O O   . LEU A 1 421 ? 13.639 23.481 35.272 1.00 108.27 ? 463  LEU A O   1 
ATOM   3294 C CB  . LEU A 1 421 ? 15.124 23.317 32.397 1.00 107.23 ? 463  LEU A CB  1 
ATOM   3295 C CG  . LEU A 1 421 ? 15.779 21.996 31.906 1.00 113.59 ? 463  LEU A CG  1 
ATOM   3296 C CD1 . LEU A 1 421 ? 16.477 21.260 33.035 1.00 113.83 ? 463  LEU A CD1 1 
ATOM   3297 C CD2 . LEU A 1 421 ? 14.814 21.081 31.132 1.00 117.48 ? 463  LEU A CD2 1 
ATOM   3298 N N   . ASN A 1 422 ? 13.240 25.393 34.131 1.00 104.51 ? 464  ASN A N   1 
ATOM   3299 C CA  . ASN A 1 422 ? 13.060 26.237 35.325 1.00 103.02 ? 464  ASN A CA  1 
ATOM   3300 C C   . ASN A 1 422 ? 11.946 25.790 36.295 1.00 107.99 ? 464  ASN A C   1 
ATOM   3301 O O   . ASN A 1 422 ? 12.243 25.711 37.489 1.00 106.70 ? 464  ASN A O   1 
ATOM   3302 C CB  . ASN A 1 422 ? 13.006 27.738 35.003 1.00 101.39 ? 464  ASN A CB  1 
ATOM   3303 C CG  . ASN A 1 422 ? 14.359 28.368 34.737 1.00 115.56 ? 464  ASN A CG  1 
ATOM   3304 O OD1 . ASN A 1 422 ? 15.422 27.858 35.125 1.00 107.50 ? 464  ASN A OD1 1 
ATOM   3305 N ND2 . ASN A 1 422 ? 14.345 29.508 34.072 1.00 105.86 ? 464  ASN A ND2 1 
ATOM   3306 N N   . PRO A 1 423 ? 10.714 25.405 35.848 1.00 106.68 ? 465  PRO A N   1 
ATOM   3307 C CA  . PRO A 1 423 ? 9.702  24.931 36.824 1.00 107.50 ? 465  PRO A CA  1 
ATOM   3308 C C   . PRO A 1 423 ? 10.113 23.674 37.607 1.00 112.20 ? 465  PRO A C   1 
ATOM   3309 O O   . PRO A 1 423 ? 9.587  23.423 38.692 1.00 111.54 ? 465  PRO A O   1 
ATOM   3310 C CB  . PRO A 1 423 ? 8.448  24.703 35.970 1.00 111.09 ? 465  PRO A CB  1 
ATOM   3311 C CG  . PRO A 1 423 ? 8.943  24.571 34.572 1.00 115.83 ? 465  PRO A CG  1 
ATOM   3312 C CD  . PRO A 1 423 ? 10.168 25.416 34.472 1.00 109.43 ? 465  PRO A CD  1 
ATOM   3313 N N   . LEU A 1 424 ? 11.079 22.914 37.059 1.00 110.17 ? 466  LEU A N   1 
ATOM   3314 C CA  . LEU A 1 424 ? 11.658 21.702 37.630 1.00 111.32 ? 466  LEU A CA  1 
ATOM   3315 C C   . LEU A 1 424 ? 12.748 22.062 38.662 1.00 115.55 ? 466  LEU A C   1 
ATOM   3316 O O   . LEU A 1 424 ? 12.980 21.278 39.583 1.00 115.86 ? 466  LEU A O   1 
ATOM   3317 C CB  . LEU A 1 424 ? 12.254 20.853 36.491 1.00 112.62 ? 466  LEU A CB  1 
ATOM   3318 C CG  . LEU A 1 424 ? 12.489 19.368 36.745 1.00 119.06 ? 466  LEU A CG  1 
ATOM   3319 C CD1 . LEU A 1 424 ? 12.046 18.544 35.553 1.00 121.51 ? 466  LEU A CD1 1 
ATOM   3320 C CD2 . LEU A 1 424 ? 13.955 19.085 37.050 1.00 120.73 ? 466  LEU A CD2 1 
ATOM   3321 N N   . ILE A 1 425 ? 13.410 23.236 38.509 1.00 111.63 ? 467  ILE A N   1 
ATOM   3322 C CA  . ILE A 1 425 ? 14.488 23.707 39.397 1.00 110.48 ? 467  ILE A CA  1 
ATOM   3323 C C   . ILE A 1 425 ? 13.990 24.095 40.790 1.00 115.84 ? 467  ILE A C   1 
ATOM   3324 O O   . ILE A 1 425 ? 14.580 23.647 41.773 1.00 115.53 ? 467  ILE A O   1 
ATOM   3325 C CB  . ILE A 1 425 ? 15.398 24.796 38.730 1.00 112.15 ? 467  ILE A CB  1 
ATOM   3326 C CG1 . ILE A 1 425 ? 16.114 24.285 37.444 1.00 113.54 ? 467  ILE A CG1 1 
ATOM   3327 C CG2 . ILE A 1 425 ? 16.392 25.446 39.702 1.00 111.06 ? 467  ILE A CG2 1 
ATOM   3328 C CD1 . ILE A 1 425 ? 16.914 22.907 37.514 1.00 121.96 ? 467  ILE A CD1 1 
ATOM   3329 N N   . TYR A 1 426 ? 12.909 24.907 40.872 1.00 113.90 ? 468  TYR A N   1 
ATOM   3330 C CA  . TYR A 1 426 ? 12.311 25.404 42.127 1.00 114.20 ? 468  TYR A CA  1 
ATOM   3331 C C   . TYR A 1 426 ? 12.131 24.373 43.276 1.00 120.76 ? 468  TYR A C   1 
ATOM   3332 O O   . TYR A 1 426 ? 12.625 24.658 44.368 1.00 119.02 ? 468  TYR A O   1 
ATOM   3333 C CB  . TYR A 1 426 ? 11.038 26.255 41.902 1.00 115.87 ? 468  TYR A CB  1 
ATOM   3334 C CG  . TYR A 1 426 ? 11.019 27.124 40.657 1.00 117.86 ? 468  TYR A CG  1 
ATOM   3335 C CD1 . TYR A 1 426 ? 12.073 27.991 40.365 1.00 118.67 ? 468  TYR A CD1 1 
ATOM   3336 C CD2 . TYR A 1 426 ? 9.907  27.154 39.821 1.00 120.13 ? 468  TYR A CD2 1 
ATOM   3337 C CE1 . TYR A 1 426 ? 12.055 28.798 39.227 1.00 119.91 ? 468  TYR A CE1 1 
ATOM   3338 C CE2 . TYR A 1 426 ? 9.863  27.980 38.697 1.00 121.15 ? 468  TYR A CE2 1 
ATOM   3339 C CZ  . TYR A 1 426 ? 10.943 28.794 38.397 1.00 128.15 ? 468  TYR A CZ  1 
ATOM   3340 O OH  . TYR A 1 426 ? 10.900 29.592 37.277 1.00 129.82 ? 468  TYR A OH  1 
ATOM   3341 N N   . PRO A 1 427 ? 11.508 23.173 43.084 1.00 121.04 ? 469  PRO A N   1 
ATOM   3342 C CA  . PRO A 1 427 ? 11.394 22.226 44.214 1.00 122.37 ? 469  PRO A CA  1 
ATOM   3343 C C   . PRO A 1 427 ? 12.708 21.579 44.685 1.00 126.90 ? 469  PRO A C   1 
ATOM   3344 O O   . PRO A 1 427 ? 12.826 21.275 45.875 1.00 126.59 ? 469  PRO A O   1 
ATOM   3345 C CB  . PRO A 1 427 ? 10.394 21.183 43.706 1.00 126.41 ? 469  PRO A CB  1 
ATOM   3346 C CG  . PRO A 1 427 ? 10.534 21.213 42.232 1.00 130.83 ? 469  PRO A CG  1 
ATOM   3347 C CD  . PRO A 1 427 ? 10.845 22.637 41.873 1.00 124.25 ? 469  PRO A CD  1 
ATOM   3348 N N   . LEU A 1 428 ? 13.687 21.372 43.765 1.00 123.76 ? 470  LEU A N   1 
ATOM   3349 C CA  . LEU A 1 428 ? 14.997 20.760 44.051 1.00 123.79 ? 470  LEU A CA  1 
ATOM   3350 C C   . LEU A 1 428 ? 15.799 21.547 45.091 1.00 126.56 ? 470  LEU A C   1 
ATOM   3351 O O   . LEU A 1 428 ? 16.529 20.945 45.883 1.00 126.53 ? 470  LEU A O   1 
ATOM   3352 C CB  . LEU A 1 428 ? 15.823 20.621 42.756 1.00 124.21 ? 470  LEU A CB  1 
ATOM   3353 C CG  . LEU A 1 428 ? 16.946 19.574 42.756 1.00 130.28 ? 470  LEU A CG  1 
ATOM   3354 C CD1 . LEU A 1 428 ? 17.071 18.923 41.398 1.00 132.07 ? 470  LEU A CD1 1 
ATOM   3355 C CD2 . LEU A 1 428 ? 18.290 20.175 43.164 1.00 131.63 ? 470  LEU A CD2 1 
ATOM   3356 N N   . CYS A 1 429 ? 15.671 22.887 45.069 1.00 121.90 ? 471  CYS A N   1 
ATOM   3357 C CA  . CYS A 1 429 ? 16.396 23.794 45.957 1.00 120.22 ? 471  CYS A CA  1 
ATOM   3358 C C   . CYS A 1 429 ? 15.523 24.364 47.066 1.00 122.63 ? 471  CYS A C   1 
ATOM   3359 O O   . CYS A 1 429 ? 15.987 24.467 48.201 1.00 121.42 ? 471  CYS A O   1 
ATOM   3360 C CB  . CYS A 1 429 ? 17.076 24.899 45.155 1.00 119.66 ? 471  CYS A CB  1 
ATOM   3361 S SG  . CYS A 1 429 ? 17.856 24.337 43.616 1.00 124.34 ? 471  CYS A SG  1 
ATOM   3362 N N   . ASN A 1 430 ? 14.271 24.742 46.744 1.00 119.21 ? 472  ASN A N   1 
ATOM   3363 C CA  . ASN A 1 430 ? 13.336 25.307 47.718 1.00 118.92 ? 472  ASN A CA  1 
ATOM   3364 C C   . ASN A 1 430 ? 12.479 24.224 48.386 1.00 124.38 ? 472  ASN A C   1 
ATOM   3365 O O   . ASN A 1 430 ? 11.886 23.386 47.700 1.00 125.28 ? 472  ASN A O   1 
ATOM   3366 C CB  . ASN A 1 430 ? 12.471 26.404 47.086 1.00 118.70 ? 472  ASN A CB  1 
ATOM   3367 C CG  . ASN A 1 430 ? 11.766 27.292 48.080 1.00 134.84 ? 472  ASN A CG  1 
ATOM   3368 O OD1 . ASN A 1 430 ? 10.573 27.134 48.351 1.00 128.38 ? 472  ASN A OD1 1 
ATOM   3369 N ND2 . ASN A 1 430 ? 12.479 28.266 48.627 1.00 124.89 ? 472  ASN A ND2 1 
ATOM   3370 N N   . GLU A 1 431 ? 12.430 24.255 49.736 1.00 120.42 ? 473  GLU A N   1 
ATOM   3371 C CA  . GLU A 1 431 ? 11.695 23.318 50.594 1.00 121.23 ? 473  GLU A CA  1 
ATOM   3372 C C   . GLU A 1 431 ? 10.176 23.520 50.514 1.00 124.85 ? 473  GLU A C   1 
ATOM   3373 O O   . GLU A 1 431 ? 9.451  22.547 50.303 1.00 125.83 ? 473  GLU A O   1 
ATOM   3374 C CB  . GLU A 1 431 ? 12.184 23.437 52.051 1.00 122.15 ? 473  GLU A CB  1 
ATOM   3375 C CG  . GLU A 1 431 ? 12.158 22.132 52.833 1.00 134.59 ? 473  GLU A CG  1 
ATOM   3376 C CD  . GLU A 1 431 ? 13.359 21.222 52.645 1.00 153.86 ? 473  GLU A CD  1 
ATOM   3377 O OE1 . GLU A 1 431 ? 14.502 21.673 52.892 1.00 142.94 ? 473  GLU A OE1 1 
ATOM   3378 O OE2 . GLU A 1 431 ? 13.150 20.039 52.291 1.00 150.31 ? 473  GLU A OE2 1 
ATOM   3379 N N   . ASN A 1 432 ? 9.703  24.779 50.682 1.00 120.20 ? 474  ASN A N   1 
ATOM   3380 C CA  . ASN A 1 432 ? 8.288  25.170 50.633 1.00 121.15 ? 474  ASN A CA  1 
ATOM   3381 C C   . ASN A 1 432 ? 7.619  24.809 49.304 1.00 126.79 ? 474  ASN A C   1 
ATOM   3382 O O   . ASN A 1 432 ? 6.427  24.504 49.290 1.00 128.72 ? 474  ASN A O   1 
ATOM   3383 C CB  . ASN A 1 432 ? 8.129  26.662 50.909 1.00 120.84 ? 474  ASN A CB  1 
ATOM   3384 C CG  . ASN A 1 432 ? 8.080  27.005 52.372 1.00 145.54 ? 474  ASN A CG  1 
ATOM   3385 O OD1 . ASN A 1 432 ? 9.110  27.177 53.029 1.00 138.81 ? 474  ASN A OD1 1 
ATOM   3386 N ND2 . ASN A 1 432 ? 6.876  27.129 52.910 1.00 139.49 ? 474  ASN A ND2 1 
ATOM   3387 N N   . PHE A 1 433 ? 8.388  24.853 48.196 1.00 122.12 ? 475  PHE A N   1 
ATOM   3388 C CA  . PHE A 1 433 ? 7.932  24.502 46.850 1.00 122.47 ? 475  PHE A CA  1 
ATOM   3389 C C   . PHE A 1 433 ? 7.815  22.984 46.711 1.00 127.70 ? 475  PHE A C   1 
ATOM   3390 O O   . PHE A 1 433 ? 6.820  22.507 46.170 1.00 128.72 ? 475  PHE A O   1 
ATOM   3391 C CB  . PHE A 1 433 ? 8.902  25.053 45.788 1.00 122.76 ? 475  PHE A CB  1 
ATOM   3392 C CG  . PHE A 1 433 ? 8.439  26.317 45.106 1.00 123.60 ? 475  PHE A CG  1 
ATOM   3393 C CD1 . PHE A 1 433 ? 7.701  26.261 43.931 1.00 127.27 ? 475  PHE A CD1 1 
ATOM   3394 C CD2 . PHE A 1 433 ? 8.758  27.566 45.628 1.00 124.43 ? 475  PHE A CD2 1 
ATOM   3395 C CE1 . PHE A 1 433 ? 7.273  27.431 43.300 1.00 127.82 ? 475  PHE A CE1 1 
ATOM   3396 C CE2 . PHE A 1 433 ? 8.334  28.737 44.992 1.00 126.94 ? 475  PHE A CE2 1 
ATOM   3397 C CZ  . PHE A 1 433 ? 7.592  28.661 43.834 1.00 125.83 ? 475  PHE A CZ  1 
ATOM   3398 N N   . LYS A 1 434 ? 8.830  22.236 47.212 1.00 124.28 ? 476  LYS A N   1 
ATOM   3399 C CA  . LYS A 1 434 ? 8.939  20.770 47.179 1.00 126.06 ? 476  LYS A CA  1 
ATOM   3400 C C   . LYS A 1 434 ? 7.713  20.051 47.775 1.00 133.62 ? 476  LYS A C   1 
ATOM   3401 O O   . LYS A 1 434 ? 7.286  19.028 47.232 1.00 135.21 ? 476  LYS A O   1 
ATOM   3402 C CB  . LYS A 1 434 ? 10.235 20.324 47.883 1.00 127.09 ? 476  LYS A CB  1 
ATOM   3403 C CG  . LYS A 1 434 ? 10.649 18.876 47.615 1.00 134.88 ? 476  LYS A CG  1 
ATOM   3404 C CD  . LYS A 1 434 ? 11.567 18.332 48.706 1.00 140.29 ? 476  LYS A CD  1 
ATOM   3405 C CE  . LYS A 1 434 ? 10.803 17.802 49.900 1.00 148.60 ? 476  LYS A CE  1 
ATOM   3406 N NZ  . LYS A 1 434 ? 11.691 17.563 51.066 1.00 153.50 ? 476  LYS A NZ  1 
ATOM   3407 N N   . LYS A 1 435 ? 7.155  20.594 48.879 1.00 130.87 ? 477  LYS A N   1 
ATOM   3408 C CA  . LYS A 1 435 ? 5.985  20.058 49.589 1.00 133.16 ? 477  LYS A CA  1 
ATOM   3409 C C   . LYS A 1 435 ? 4.668  20.467 48.911 1.00 140.27 ? 477  LYS A C   1 
ATOM   3410 O O   . LYS A 1 435 ? 3.754  19.646 48.834 1.00 142.16 ? 477  LYS A O   1 
ATOM   3411 C CB  . LYS A 1 435 ? 6.002  20.499 51.065 1.00 134.21 ? 477  LYS A CB  1 
ATOM   3412 C CG  . LYS A 1 435 ? 5.198  19.610 52.002 1.00 139.50 ? 477  LYS A CG  1 
ATOM   3413 C CD  . LYS A 1 435 ? 5.267  20.132 53.422 1.00 143.78 ? 477  LYS A CD  1 
ATOM   3414 C CE  . LYS A 1 435 ? 4.491  19.269 54.382 1.00 153.24 ? 477  LYS A CE  1 
ATOM   3415 N NZ  . LYS A 1 435 ? 4.446  19.869 55.740 1.00 160.32 ? 477  LYS A NZ  1 
ATOM   3416 N N   . THR A 1 436 ? 4.577  21.732 48.430 1.00 137.20 ? 478  THR A N   1 
ATOM   3417 C CA  . THR A 1 436 ? 3.403  22.288 47.737 1.00 138.99 ? 478  THR A CA  1 
ATOM   3418 C C   . THR A 1 436 ? 3.197  21.586 46.378 1.00 145.75 ? 478  THR A C   1 
ATOM   3419 O O   . THR A 1 436 ? 2.054  21.374 45.968 1.00 147.47 ? 478  THR A O   1 
ATOM   3420 C CB  . THR A 1 436 ? 3.491  23.834 47.649 1.00 146.07 ? 478  THR A CB  1 
ATOM   3421 O OG1 . THR A 1 436 ? 3.790  24.372 48.941 1.00 144.62 ? 478  THR A OG1 1 
ATOM   3422 C CG2 . THR A 1 436 ? 2.202  24.479 47.130 1.00 146.31 ? 478  THR A CG2 1 
ATOM   3423 N N   . PHE A 1 437 ? 4.306  21.204 45.707 1.00 142.53 ? 479  PHE A N   1 
ATOM   3424 C CA  . PHE A 1 437 ? 4.297  20.483 44.431 1.00 144.22 ? 479  PHE A CA  1 
ATOM   3425 C C   . PHE A 1 437 ? 3.893  19.020 44.640 1.00 152.09 ? 479  PHE A C   1 
ATOM   3426 O O   . PHE A 1 437 ? 3.204  18.457 43.790 1.00 153.95 ? 479  PHE A O   1 
ATOM   3427 C CB  . PHE A 1 437 ? 5.673  20.575 43.740 1.00 144.24 ? 479  PHE A CB  1 
ATOM   3428 C CG  . PHE A 1 437 ? 5.912  21.767 42.831 1.00 144.14 ? 479  PHE A CG  1 
ATOM   3429 C CD1 . PHE A 1 437 ? 5.226  22.965 43.023 1.00 146.61 ? 479  PHE A CD1 1 
ATOM   3430 C CD2 . PHE A 1 437 ? 6.856  21.705 41.812 1.00 145.46 ? 479  PHE A CD2 1 
ATOM   3431 C CE1 . PHE A 1 437 ? 5.452  24.062 42.188 1.00 146.15 ? 479  PHE A CE1 1 
ATOM   3432 C CE2 . PHE A 1 437 ? 7.089  22.807 40.984 1.00 146.84 ? 479  PHE A CE2 1 
ATOM   3433 C CZ  . PHE A 1 437 ? 6.385  23.976 41.179 1.00 144.37 ? 479  PHE A CZ  1 
ATOM   3434 N N   . LYS A 1 438 ? 4.313  18.414 45.774 1.00 149.48 ? 480  LYS A N   1 
ATOM   3435 C CA  . LYS A 1 438 ? 3.981  17.035 46.145 1.00 152.33 ? 480  LYS A CA  1 
ATOM   3436 C C   . LYS A 1 438 ? 2.506  16.926 46.569 1.00 159.38 ? 480  LYS A C   1 
ATOM   3437 O O   . LYS A 1 438 ? 1.816  16.002 46.134 1.00 161.76 ? 480  LYS A O   1 
ATOM   3438 C CB  . LYS A 1 438 ? 4.899  16.531 47.275 1.00 154.06 ? 480  LYS A CB  1 
ATOM   3439 C CG  . LYS A 1 438 ? 6.222  15.939 46.806 1.00 166.72 ? 480  LYS A CG  1 
ATOM   3440 C CD  . LYS A 1 438 ? 7.058  15.484 47.998 1.00 175.76 ? 480  LYS A CD  1 
ATOM   3441 C CE  . LYS A 1 438 ? 8.388  14.898 47.598 1.00 183.10 ? 480  LYS A CE  1 
ATOM   3442 N NZ  . LYS A 1 438 ? 9.120  14.350 48.772 1.00 188.32 ? 480  LYS A NZ  1 
ATOM   3443 N N   . ARG A 1 439 ? 2.029  17.878 47.406 1.00 155.58 ? 481  ARG A N   1 
ATOM   3444 C CA  . ARG A 1 439 ? 0.656  17.919 47.920 1.00 157.91 ? 481  ARG A CA  1 
ATOM   3445 C C   . ARG A 1 439 ? -0.408 18.163 46.851 1.00 163.40 ? 481  ARG A C   1 
ATOM   3446 O O   . ARG A 1 439 ? -1.513 17.630 46.977 1.00 165.55 ? 481  ARG A O   1 
ATOM   3447 C CB  . ARG A 1 439 ? 0.520  18.903 49.096 1.00 157.26 ? 481  ARG A CB  1 
ATOM   3448 N N   . ILE A 1 440 ? -0.075 18.947 45.800 1.00 158.93 ? 482  ILE A N   1 
ATOM   3449 C CA  . ILE A 1 440 ? -0.976 19.256 44.679 1.00 160.57 ? 482  ILE A CA  1 
ATOM   3450 C C   . ILE A 1 440 ? -1.091 18.094 43.666 1.00 167.73 ? 482  ILE A C   1 
ATOM   3451 O O   . ILE A 1 440 ? -2.131 17.962 43.011 1.00 169.88 ? 482  ILE A O   1 
ATOM   3452 C CB  . ILE A 1 440 ? -0.664 20.634 44.021 1.00 161.12 ? 482  ILE A CB  1 
ATOM   3453 C CG1 . ILE A 1 440 ? -1.918 21.252 43.376 1.00 163.16 ? 482  ILE A CG1 1 
ATOM   3454 C CG2 . ILE A 1 440 ? 0.517  20.578 43.040 1.00 159.90 ? 482  ILE A CG2 1 
ATOM   3455 C CD1 . ILE A 1 440 ? -2.249 22.635 43.869 1.00 168.84 ? 482  ILE A CD1 1 
ATOM   3456 N N   . LEU A 1 441 ? -0.025 17.263 43.544 1.00 164.26 ? 483  LEU A N   1 
ATOM   3457 C CA  . LEU A 1 441 ? 0.008  16.102 42.647 1.00 166.49 ? 483  LEU A CA  1 
ATOM   3458 C C   . LEU A 1 441 ? -0.868 14.969 43.192 1.00 173.31 ? 483  LEU A C   1 
ATOM   3459 O O   . LEU A 1 441 ? -1.587 14.323 42.423 1.00 175.70 ? 483  LEU A O   1 
ATOM   3460 C CB  . LEU A 1 441 ? 1.451  15.611 42.414 1.00 165.16 ? 483  LEU A CB  1 
ATOM   3461 C CG  . LEU A 1 441 ? 2.272  16.346 41.345 1.00 167.55 ? 483  LEU A CG  1 
ATOM   3462 C CD1 . LEU A 1 441 ? 3.750  16.035 41.491 1.00 165.94 ? 483  LEU A CD1 1 
ATOM   3463 C CD2 . LEU A 1 441 ? 1.804  16.000 39.929 1.00 172.33 ? 483  LEU A CD2 1 
ATOM   3464 N N   . HIS A 1 442 ? -0.840 14.767 44.526 1.00 169.19 ? 484  HIS A N   1 
ATOM   3465 C CA  . HIS A 1 442 ? -1.636 13.755 45.223 1.00 172.17 ? 484  HIS A CA  1 
ATOM   3466 C C   . HIS A 1 442 ? -2.966 14.356 45.726 1.00 175.98 ? 484  HIS A C   1 
ATOM   3467 O O   . HIS A 1 442 ? -3.608 13.817 46.634 1.00 177.90 ? 484  HIS A O   1 
ATOM   3468 C CB  . HIS A 1 442 ? -0.800 13.086 46.328 1.00 172.59 ? 484  HIS A CB  1 
ATOM   3469 C CG  . HIS A 1 442 ? 0.489  12.530 45.807 1.00 174.92 ? 484  HIS A CG  1 
ATOM   3470 N ND1 . HIS A 1 442 ? 1.667  13.248 45.890 1.00 172.95 ? 484  HIS A ND1 1 
ATOM   3471 C CD2 . HIS A 1 442 ? 0.725  11.382 45.131 1.00 179.11 ? 484  HIS A CD2 1 
ATOM   3472 C CE1 . HIS A 1 442 ? 2.585  12.502 45.300 1.00 172.61 ? 484  HIS A CE1 1 
ATOM   3473 N NE2 . HIS A 1 442 ? 2.065  11.370 44.826 1.00 176.65 ? 484  HIS A NE2 1 
ATOM   3474 N N   . ILE A 1 443 ? -3.379 15.468 45.068 1.00 170.33 ? 485  ILE A N   1 
ATOM   3475 C CA  . ILE A 1 443 ? -4.599 16.269 45.243 1.00 178.37 ? 485  ILE A CA  1 
ATOM   3476 C C   . ILE A 1 443 ? -4.946 16.607 46.705 1.00 175.36 ? 485  ILE A C   1 
ATOM   3477 O O   . ILE A 1 443 ? -4.548 17.656 47.209 1.00 117.73 ? 485  ILE A O   1 
ATOM   3478 C CB  . ILE A 1 443 ? -5.790 15.711 44.380 1.00 185.13 ? 485  ILE A CB  1 
ATOM   3479 C CG1 . ILE A 1 443 ? -5.434 15.701 42.871 1.00 184.47 ? 485  ILE A CG1 1 
ATOM   3480 C CG2 . ILE A 1 443 ? -7.087 16.498 44.616 1.00 187.42 ? 485  ILE A CG2 1 
ATOM   3481 C CD1 . ILE A 1 443 ? -5.673 14.399 42.167 1.00 191.86 ? 485  ILE A CD1 1 
HETATM 3482 C C01 A 5EH B 2 .   ? 14.569 31.755 20.378 0.50 128.73 ? 1200 5EH A C01 1 
HETATM 3483 N N02 A 5EH B 2 .   ? 14.525 32.943 19.512 0.50 135.70 ? 1200 5EH A N02 1 
HETATM 3484 C C03 A 5EH B 2 .   ? 14.452 32.511 18.106 0.50 23.95  ? 1200 5EH A C03 1 
HETATM 3485 C C04 A 5EH B 2 .   ? 15.730 33.765 19.724 0.50 108.61 ? 1200 5EH A C04 1 
HETATM 3486 C C05 A 5EH B 2 .   ? 15.364 35.138 20.280 0.50 60.67  ? 1200 5EH A C05 1 
HETATM 3487 C C06 A 5EH B 2 .   ? 15.773 35.211 21.734 0.50 113.33 ? 1200 5EH A C06 1 
HETATM 3488 C C07 A 5EH B 2 .   ? 16.751 36.014 22.195 0.50 165.91 ? 1200 5EH A C07 1 
HETATM 3489 C C08 A 5EH B 2 .   ? 17.526 36.943 21.311 0.50 153.27 ? 1200 5EH A C08 1 
HETATM 3490 C C09 A 5EH B 2 .   ? 18.420 36.473 20.347 0.50 127.97 ? 1200 5EH A C09 1 
HETATM 3491 C C10 A 5EH B 2 .   ? 19.149 37.384 19.580 0.50 131.79 ? 1200 5EH A C10 1 
HETATM 3492 C C11 A 5EH B 2 .   ? 18.997 38.757 19.793 0.50 91.15  ? 1200 5EH A C11 1 
HETATM 3493 C C12 A 5EH B 2 .   ? 18.119 39.218 20.775 0.50 77.62  ? 1200 5EH A C12 1 
HETATM 3494 C C13 A 5EH B 2 .   ? 17.392 38.303 21.537 0.50 99.53  ? 1200 5EH A C13 1 
HETATM 3495 C C14 A 5EH B 2 .   ? 16.426 38.762 22.605 0.50 29.88  ? 1200 5EH A C14 1 
HETATM 3496 O O15 A 5EH B 2 .   ? 16.962 38.468 23.894 0.50 129.74 ? 1200 5EH A O15 1 
HETATM 3497 C C16 A 5EH B 2 .   ? 17.176 37.205 24.405 0.50 141.60 ? 1200 5EH A C16 1 
HETATM 3498 C C17 A 5EH B 2 .   ? 17.517 37.134 25.758 0.50 123.84 ? 1200 5EH A C17 1 
HETATM 3499 C C18 A 5EH B 2 .   ? 17.770 35.908 26.373 0.50 140.03 ? 1200 5EH A C18 1 
HETATM 3500 C C19 A 5EH B 2 .   ? 17.686 34.733 25.630 0.50 137.78 ? 1200 5EH A C19 1 
HETATM 3501 C C20 A 5EH B 2 .   ? 17.350 34.796 24.279 0.50 113.47 ? 1200 5EH A C20 1 
HETATM 3502 C C21 A 5EH B 2 .   ? 17.092 36.021 23.659 0.50 159.27 ? 1200 5EH A C21 1 
HETATM 3503 C C1  B D7V C 3 .   ? 14.808 32.837 18.106 0.50 73.17  ? 1201 D7V A C1  1 
HETATM 3504 N N1  B D7V C 3 .   ? 14.677 33.217 19.522 0.50 134.26 ? 1201 D7V A N1  1 
HETATM 3505 O O1  B D7V C 3 .   ? 17.822 39.257 22.374 0.50 60.56  ? 1201 D7V A O1  1 
HETATM 3506 C C2  B D7V C 3 .   ? 14.643 32.000 20.349 0.50 132.98 ? 1201 D7V A C2  1 
HETATM 3507 C C3  B D7V C 3 .   ? 15.818 34.061 19.915 0.50 101.39 ? 1201 D7V A C3  1 
HETATM 3508 C C4  B D7V C 3 .   ? 15.343 35.458 20.304 0.50 63.13  ? 1201 D7V A C4  1 
HETATM 3509 C C5  B D7V C 3 .   ? 15.754 35.727 21.733 0.50 97.28  ? 1201 D7V A C5  1 
HETATM 3510 C C6  B D7V C 3 .   ? 16.832 36.440 22.115 0.50 159.20 ? 1201 D7V A C6  1 
HETATM 3511 C C7  B D7V C 3 .   ? 17.090 36.591 23.581 0.50 151.60 ? 1201 D7V A C7  1 
HETATM 3512 C C8  B D7V C 3 .   ? 17.401 35.486 24.375 0.50 133.41 ? 1201 D7V A C8  1 
HETATM 3513 C C9  B D7V C 3 .   ? 17.654 35.666 25.736 0.50 144.02 ? 1201 D7V A C9  1 
HETATM 3514 C C10 B D7V C 3 .   ? 17.597 36.946 26.291 0.50 124.82 ? 1201 D7V A C10 1 
HETATM 3515 C C11 B D7V C 3 .   ? 17.280 38.046 25.491 0.50 95.05  ? 1201 D7V A C11 1 
HETATM 3516 C C12 B D7V C 3 .   ? 17.027 37.857 24.132 0.50 118.35 ? 1201 D7V A C12 1 
HETATM 3517 C C13 B D7V C 3 .   ? 16.702 39.017 23.224 0.50 79.50  ? 1201 D7V A C13 1 
HETATM 3518 C C14 B D7V C 3 .   ? 18.247 38.425 21.362 0.50 105.70 ? 1201 D7V A C14 1 
HETATM 3519 C C15 B D7V C 3 .   ? 17.803 37.105 21.170 0.50 154.58 ? 1201 D7V A C15 1 
HETATM 3520 C C16 B D7V C 3 .   ? 19.189 38.972 20.486 0.50 61.44  ? 1201 D7V A C16 1 
HETATM 3521 C C17 B D7V C 3 .   ? 19.706 38.223 19.432 0.50 50.85  ? 1201 D7V A C17 1 
HETATM 3522 C C18 B D7V C 3 .   ? 19.279 36.910 19.253 0.50 146.65 ? 1201 D7V A C18 1 
HETATM 3523 C C19 B D7V C 3 .   ? 18.351 36.351 20.130 0.50 111.98 ? 1201 D7V A C19 1 
HETATM 3524 P P   . PO4 D 4 .   ? 17.536 33.739 14.081 1.00 172.63 ? 1202 PO4 A P   1 
HETATM 3525 O O1  . PO4 D 4 .   ? 18.998 33.196 13.827 1.00 178.54 ? 1202 PO4 A O1  1 
HETATM 3526 O O2  . PO4 D 4 .   ? 17.291 35.061 13.244 1.00 178.73 ? 1202 PO4 A O2  1 
HETATM 3527 O O3  . PO4 D 4 .   ? 16.485 32.632 13.656 1.00 178.41 ? 1202 PO4 A O3  1 
HETATM 3528 O O4  . PO4 D 4 .   ? 17.396 34.078 15.613 1.00 178.53 ? 1202 PO4 A O4  1 
HETATM 3529 P P   . PO4 E 4 .   ? 51.496 6.331  66.907 1.00 143.96 ? 1203 PO4 A P   1 
HETATM 3530 O O1  . PO4 E 4 .   ? 53.021 5.935  67.064 1.00 149.83 ? 1203 PO4 A O1  1 
HETATM 3531 O O2  . PO4 E 4 .   ? 51.337 7.382  65.738 1.00 150.20 ? 1203 PO4 A O2  1 
HETATM 3532 O O3  . PO4 E 4 .   ? 50.683 5.022  66.529 1.00 150.31 ? 1203 PO4 A O3  1 
HETATM 3533 O O4  . PO4 E 4 .   ? 50.955 6.979  68.247 1.00 149.40 ? 1203 PO4 A O4  1 
HETATM 3534 P P   . PO4 F 4 .   ? 25.747 24.023 77.021 1.00 69.14  ? 1204 PO4 A P   1 
HETATM 3535 O O1  . PO4 F 4 .   ? 27.311 23.734 77.255 1.00 74.51  ? 1204 PO4 A O1  1 
HETATM 3536 O O2  . PO4 F 4 .   ? 25.477 25.488 76.470 1.00 76.27  ? 1204 PO4 A O2  1 
HETATM 3537 O O3  . PO4 F 4 .   ? 25.267 22.981 75.940 1.00 75.67  ? 1204 PO4 A O3  1 
HETATM 3538 O O4  . PO4 F 4 .   ? 24.945 23.988 78.383 1.00 74.92  ? 1204 PO4 A O4  1 
HETATM 3539 C C8  . OLC G 5 .   ? 62.015 33.472 79.867 1.00 34.29  ? 1205 OLC A C8  1 
HETATM 3540 C C24 . OLC G 5 .   ? 51.982 39.310 76.308 1.00 105.76 ? 1205 OLC A C24 1 
HETATM 3541 C C7  . OLC G 5 .   ? 61.432 34.438 78.825 1.00 40.65  ? 1205 OLC A C7  1 
HETATM 3542 C C6  . OLC G 5 .   ? 59.949 34.737 79.110 1.00 208.83 ? 1205 OLC A C6  1 
HETATM 3543 C C5  . OLC G 5 .   ? 59.096 34.762 77.838 1.00 30.82  ? 1205 OLC A C5  1 
HETATM 3544 C C4  . OLC G 5 .   ? 59.629 35.766 76.821 1.00 13.00  ? 1205 OLC A C4  1 
HETATM 3545 C C3  . OLC G 5 .   ? 58.638 36.046 75.698 1.00 13.00  ? 1205 OLC A C3  1 
HETATM 3546 C C2  . OLC G 5 .   ? 57.684 37.193 76.015 1.00 13.00  ? 1205 OLC A C2  1 
HETATM 3547 C C21 . OLC G 5 .   ? 54.192 38.181 75.565 1.00 10.03  ? 1205 OLC A C21 1 
HETATM 3548 C C1  . OLC G 5 .   ? 56.421 37.116 75.166 1.00 39.72  ? 1205 OLC A C1  1 
HETATM 3549 C C22 . OLC G 5 .   ? 53.223 38.518 76.714 1.00 106.62 ? 1205 OLC A C22 1 
HETATM 3550 O O19 . OLC G 5 .   ? 56.417 36.853 73.967 1.00 209.66 ? 1205 OLC A O19 1 
HETATM 3551 O O25 . OLC G 5 .   ? 51.232 39.626 77.491 1.00 114.22 ? 1205 OLC A O25 1 
HETATM 3552 O O23 . OLC G 5 .   ? 52.841 37.354 77.461 1.00 74.71  ? 1205 OLC A O23 1 
HETATM 3553 O O20 . OLC G 5 .   ? 55.313 37.370 75.955 1.00 58.15  ? 1205 OLC A O20 1 
HETATM 3554 O O   . HOH H 6 .   ? 40.008 27.360 59.025 1.00 23.71  ? 1206 HOH A O   1 
HETATM 3555 O O   . HOH H 6 .   ? 49.908 39.518 80.325 1.00 64.64  ? 1207 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 9   ? 3.0028 1.9481 1.2831 -0.1646 -0.2793 -0.1333 28   MET A N   
2    C CA  . MET A 9   ? 3.0466 1.9735 1.2894 -0.2259 -0.3090 -0.1277 28   MET A CA  
3    C C   . MET A 9   ? 3.0971 2.0037 1.3519 -0.2593 -0.3244 -0.1166 28   MET A C   
4    O O   . MET A 9   ? 3.0581 2.0236 1.3420 -0.3044 -0.3362 -0.0980 28   MET A O   
5    C CB  . MET A 9   ? 3.1961 2.0323 1.3341 -0.2410 -0.3302 -0.1493 28   MET A CB  
6    C CG  . MET A 9   ? 3.2659 2.1264 1.3797 -0.3031 -0.3551 -0.1400 28   MET A CG  
7    S SD  . MET A 9   ? 3.4399 2.2262 1.4453 -0.3145 -0.3734 -0.1640 28   MET A SD  
8    C CE  . MET A 9   ? 3.3148 2.2053 1.3769 -0.2717 -0.3431 -0.1595 28   MET A CE  
9    N N   . PRO A 10  ? 3.0905 1.9216 1.3245 -0.2392 -0.3249 -0.1259 29   PRO A N   
10   C CA  . PRO A 10  ? 3.0815 1.9008 1.3294 -0.2738 -0.3397 -0.1128 29   PRO A CA  
11   C C   . PRO A 10  ? 3.0145 1.9374 1.3671 -0.2664 -0.3212 -0.0905 29   PRO A C   
12   O O   . PRO A 10  ? 2.9925 1.9304 1.3657 -0.3011 -0.3333 -0.0758 29   PRO A O   
13   C CB  . PRO A 10  ? 3.1881 1.8889 1.3730 -0.2491 -0.3456 -0.1311 29   PRO A CB  
14   C CG  . PRO A 10  ? 3.2402 1.9357 1.4261 -0.1847 -0.3211 -0.1472 29   PRO A CG  
15   C CD  . PRO A 10  ? 3.1581 1.9170 1.3555 -0.1834 -0.3124 -0.1472 29   PRO A CD  
16   N N   . LEU A 11  ? 2.8921 1.8854 1.3072 -0.2226 -0.2927 -0.0879 30   LEU A N   
17   C CA  . LEU A 11  ? 2.7726 1.8596 1.2833 -0.2086 -0.2728 -0.0692 30   LEU A CA  
18   C C   . LEU A 11  ? 2.7517 1.9399 1.3127 -0.2367 -0.2727 -0.0487 30   LEU A C   
19   O O   . LEU A 11  ? 2.6475 1.9147 1.2822 -0.2181 -0.2535 -0.0351 30   LEU A O   
20   C CB  . LEU A 11  ? 2.7296 1.8353 1.2757 -0.1502 -0.2437 -0.0760 30   LEU A CB  
21   C CG  . LEU A 11  ? 2.8209 1.8576 1.3465 -0.1159 -0.2386 -0.0896 30   LEU A CG  
22   C CD1 . LEU A 11  ? 2.8514 1.8671 1.3533 -0.0667 -0.2214 -0.1065 30   LEU A CD1 
23   C CD2 . LEU A 11  ? 2.7619 1.8454 1.3609 -0.1047 -0.2260 -0.0763 30   LEU A CD2 
24   N N   . VAL A 12  ? 2.7677 1.9522 1.2860 -0.2815 -0.2950 -0.0463 31   VAL A N   
25   C CA  . VAL A 12  ? 2.7198 1.9994 1.2760 -0.3105 -0.2986 -0.0268 31   VAL A CA  
26   C C   . VAL A 12  ? 2.7302 2.0546 1.3307 -0.3387 -0.3062 -0.0076 31   VAL A C   
27   O O   . VAL A 12  ? 2.6351 2.0495 1.3051 -0.3299 -0.2930 0.0095  31   VAL A O   
28   C CB  . VAL A 12  ? 2.8472 2.1082 1.3373 -0.3489 -0.3208 -0.0319 31   VAL A CB  
29   C CG1 . VAL A 12  ? 2.7999 2.1600 1.3242 -0.3865 -0.3298 -0.0097 31   VAL A CG1 
30   C CG2 . VAL A 12  ? 2.8778 2.1161 1.3356 -0.3167 -0.3097 -0.0483 31   VAL A CG2 
31   N N   . VAL A 13  ? 2.7572 2.0148 1.3140 -0.3707 -0.3274 -0.0107 32   VAL A N   
32   C CA  . VAL A 13  ? 2.7282 2.0171 1.3148 -0.4023 -0.3379 0.0067  32   VAL A CA  
33   C C   . VAL A 13  ? 2.7391 2.0110 1.3657 -0.3698 -0.3232 0.0062  32   VAL A C   
34   O O   . VAL A 13  ? 2.6872 2.0074 1.3580 -0.3844 -0.3246 0.0224  32   VAL A O   
35   C CB  . VAL A 13  ? 2.8650 2.1024 1.3843 -0.4634 -0.3708 0.0085  32   VAL A CB  
36   C CG1 . VAL A 13  ? 2.8142 2.1449 1.3747 -0.5064 -0.3815 0.0339  32   VAL A CG1 
37   C CG2 . VAL A 13  ? 2.9485 2.1385 1.3935 -0.4840 -0.3864 -0.0048 32   VAL A CG2 
38   N N   . VAL A 14  ? 2.7125 1.9211 1.3235 -0.3250 -0.3091 -0.0119 33   VAL A N   
39   C CA  . VAL A 14  ? 2.6717 1.8635 1.3172 -0.2898 -0.2942 -0.0143 33   VAL A CA  
40   C C   . VAL A 14  ? 2.5975 1.8909 1.3335 -0.2687 -0.2724 0.0012  33   VAL A C   
41   O O   . VAL A 14  ? 2.5468 1.8632 1.3227 -0.2708 -0.2706 0.0113  33   VAL A O   
42   C CB  . VAL A 14  ? 2.7706 1.8837 1.3772 -0.2447 -0.2836 -0.0366 33   VAL A CB  
43   C CG1 . VAL A 14  ? 2.7164 1.8345 1.3699 -0.2041 -0.2646 -0.0372 33   VAL A CG1 
44   C CG2 . VAL A 14  ? 2.8889 1.8879 1.4006 -0.2638 -0.3071 -0.0520 33   VAL A CG2 
45   N N   . LEU A 15  ? 2.5081 1.8591 1.2718 -0.2505 -0.2574 0.0036  34   LEU A N   
46   C CA  . LEU A 15  ? 2.4088 1.8493 1.2493 -0.2307 -0.2378 0.0180  34   LEU A CA  
47   C C   . LEU A 15  ? 2.4181 1.9321 1.2870 -0.2659 -0.2489 0.0381  34   LEU A C   
48   O O   . LEU A 15  ? 2.3425 1.9182 1.2709 -0.2544 -0.2377 0.0509  34   LEU A O   
49   C CB  . LEU A 15  ? 2.3886 1.8588 1.2407 -0.2009 -0.2195 0.0147  34   LEU A CB  
50   C CG  . LEU A 15  ? 2.4819 1.8952 1.3074 -0.1635 -0.2065 -0.0040 34   LEU A CG  
51   C CD1 . LEU A 15  ? 2.4826 1.9222 1.3015 -0.1482 -0.1956 -0.0062 34   LEU A CD1 
52   C CD2 . LEU A 15  ? 2.4673 1.8864 1.3393 -0.1284 -0.1870 -0.0045 34   LEU A CD2 
53   N N   . SER A 16  ? 2.4232 1.9316 1.2473 -0.3085 -0.2714 0.0410  35   SER A N   
54   C CA  . SER A 16  ? 2.3928 1.9761 1.2367 -0.3458 -0.2844 0.0607  35   SER A CA  
55   C C   . SER A 16  ? 2.4251 2.0092 1.2837 -0.3677 -0.2944 0.0702  35   SER A C   
56   O O   . SER A 16  ? 2.3637 2.0289 1.2699 -0.3742 -0.2925 0.0878  35   SER A O   
57   C CB  . SER A 16  ? 2.4955 2.0737 1.2842 -0.3870 -0.3060 0.0607  35   SER A CB  
58   O OG  . SER A 16  ? 2.5684 2.1942 1.3654 -0.3718 -0.2966 0.0620  35   SER A OG  
59   N N   . THR A 17  ? 2.4330 1.9272 1.2484 -0.3771 -0.3052 0.0591  36   THR A N   
60   C CA  . THR A 17  ? 2.4263 1.9099 1.2495 -0.3971 -0.3149 0.0674  36   THR A CA  
61   C C   . THR A 17  ? 2.3870 1.9088 1.2783 -0.3580 -0.2932 0.0715  36   THR A C   
62   O O   . THR A 17  ? 2.3434 1.9116 1.2689 -0.3713 -0.2961 0.0858  36   THR A O   
63   C CB  . THR A 17  ? 2.6236 1.9924 1.3754 -0.4144 -0.3323 0.0541  36   THR A CB  
64   O OG1 . THR A 17  ? 2.6569 1.9548 1.3831 -0.3730 -0.3201 0.0331  36   THR A OG1 
65   C CG2 . THR A 17  ? 2.6826 2.0224 1.3688 -0.4706 -0.3605 0.0567  36   THR A CG2 
66   N N   . ILE A 18  ? 2.3118 1.8172 1.2212 -0.3110 -0.2718 0.0593  37   ILE A N   
67   C CA  . ILE A 18  ? 2.2317 1.7699 1.2023 -0.2720 -0.2497 0.0610  37   ILE A CA  
68   C C   . ILE A 18  ? 2.1974 1.8368 1.2239 -0.2717 -0.2421 0.0786  37   ILE A C   
69   O O   . ILE A 18  ? 2.1452 1.8236 1.2164 -0.2642 -0.2362 0.0876  37   ILE A O   
70   C CB  . ILE A 18  ? 2.2730 1.7734 1.2407 -0.2285 -0.2308 0.0448  37   ILE A CB  
71   C CG1 . ILE A 18  ? 2.3376 1.7441 1.2601 -0.2186 -0.2358 0.0288  37   ILE A CG1 
72   C CG2 . ILE A 18  ? 2.2067 1.7611 1.2401 -0.1923 -0.2070 0.0495  37   ILE A CG2 
73   C CD1 . ILE A 18  ? 2.4374 1.8009 1.3386 -0.1802 -0.2216 0.0113  37   ILE A CD1 
74   N N   . CYS A 19  ? 2.1418 1.8217 1.1614 -0.2793 -0.2435 0.0832  38   CYS A N   
75   C CA  . CYS A 19  ? 2.0766 1.8501 1.1382 -0.2777 -0.2382 0.0998  38   CYS A CA  
76   C C   . CYS A 19  ? 2.0946 1.9185 1.1648 -0.3133 -0.2547 0.1162  38   CYS A C   
77   O O   . CYS A 19  ? 2.0280 1.9207 1.1448 -0.3020 -0.2473 0.1290  38   CYS A O   
78   C CB  . CYS A 19  ? 2.0986 1.8938 1.1399 -0.2792 -0.2385 0.0999  38   CYS A CB  
79   S SG  . CYS A 19  ? 2.0996 2.0098 1.1766 -0.2839 -0.2385 0.1220  38   CYS A SG  
80   N N   . LEU A 20  ? 2.0995 1.8868 1.1216 -0.3561 -0.2771 0.1157  39   LEU A N   
81   C CA  . LEU A 20  ? 2.0961 1.9269 1.1168 -0.3984 -0.2956 0.1320  39   LEU A CA  
82   C C   . LEU A 20  ? 2.0985 1.9367 1.1528 -0.3925 -0.2923 0.1378  39   LEU A C   
83   O O   . LEU A 20  ? 2.0605 1.9726 1.1403 -0.4101 -0.2981 0.1550  39   LEU A O   
84   C CB  . LEU A 20  ? 2.1803 1.9541 1.1335 -0.4479 -0.3211 0.1288  39   LEU A CB  
85   C CG  . LEU A 20  ? 2.2743 2.0672 1.1934 -0.4702 -0.3315 0.1293  39   LEU A CG  
86   C CD1 . LEU A 20  ? 2.3756 2.0729 1.2177 -0.5060 -0.3526 0.1172  39   LEU A CD1 
87   C CD2 . LEU A 20  ? 2.2705 2.1761 1.2134 -0.4985 -0.3406 0.1520  39   LEU A CD2 
88   N N   . VAL A 21  ? 2.0554 1.8217 1.1086 -0.3677 -0.2833 0.1240  40   VAL A N   
89   C CA  . VAL A 21  ? 2.0193 1.7896 1.1044 -0.3588 -0.2791 0.1282  40   VAL A CA  
90   C C   . VAL A 21  ? 1.9853 1.8248 1.1341 -0.3207 -0.2584 0.1337  40   VAL A C   
91   O O   . VAL A 21  ? 1.9383 1.8321 1.1192 -0.3244 -0.2590 0.1460  40   VAL A O   
92   C CB  . VAL A 21  ? 2.1085 1.7819 1.1667 -0.3506 -0.2803 0.1140  40   VAL A CB  
93   C CG1 . VAL A 21  ? 2.1824 1.8022 1.1843 -0.3973 -0.3054 0.1168  40   VAL A CG1 
94   C CG2 . VAL A 21  ? 2.1246 1.7359 1.1644 -0.3171 -0.2678 0.0947  40   VAL A CG2 
95   N N   . THR A 22  ? 1.9249 1.7635 1.0877 -0.2859 -0.2411 0.1254  41   THR A N   
96   C CA  . THR A 22  ? 1.8606 1.7510 1.0749 -0.2489 -0.2215 0.1292  41   THR A CA  
97   C C   . THR A 22  ? 1.8762 1.8603 1.1160 -0.2549 -0.2240 0.1471  41   THR A C   
98   O O   . THR A 22  ? 1.8214 1.8474 1.1013 -0.2315 -0.2132 0.1528  41   THR A O   
99   C CB  . THR A 22  ? 1.9760 1.8413 1.1890 -0.2184 -0.2056 0.1183  41   THR A CB  
100  O OG1 . THR A 22  ? 2.0291 1.8134 1.2081 -0.2165 -0.2065 0.1024  41   THR A OG1 
101  C CG2 . THR A 22  ? 1.9050 1.7941 1.1642 -0.1802 -0.1851 0.1189  41   THR A CG2 
102  N N   . VAL A 23  ? 1.8630 1.8810 1.0777 -0.2849 -0.2382 0.1557  42   VAL A N   
103  C CA  . VAL A 23  ? 1.8333 1.9490 1.0693 -0.2903 -0.2417 0.1739  42   VAL A CA  
104  C C   . VAL A 23  ? 1.8695 2.0310 1.1236 -0.3084 -0.2505 0.1866  42   VAL A C   
105  O O   . VAL A 23  ? 1.8280 2.0711 1.1126 -0.2960 -0.2467 0.1999  42   VAL A O   
106  C CB  . VAL A 23  ? 1.9095 2.0616 1.1170 -0.3151 -0.2535 0.1808  42   VAL A CB  
107  C CG1 . VAL A 23  ? 1.9097 2.0352 1.1083 -0.2889 -0.2414 0.1710  42   VAL A CG1 
108  C CG2 . VAL A 23  ? 1.9674 2.0849 1.1276 -0.3672 -0.2766 0.1805  42   VAL A CG2 
109  N N   . GLY A 24  ? 1.8542 1.9613 1.0871 -0.3349 -0.2617 0.1824  43   GLY A N   
110  C CA  . GLY A 24  ? 1.8411 1.9806 1.0854 -0.3564 -0.2713 0.1942  43   GLY A CA  
111  C C   . GLY A 24  ? 1.8536 1.9638 1.1261 -0.3295 -0.2598 0.1876  43   GLY A C   
112  O O   . GLY A 24  ? 1.8145 1.9845 1.1189 -0.3221 -0.2571 0.1980  43   GLY A O   
113  N N   . LEU A 25  ? 1.8157 1.8367 1.0751 -0.3145 -0.2533 0.1703  44   LEU A N   
114  C CA  . LEU A 25  ? 1.7802 1.7683 1.0636 -0.2895 -0.2428 0.1627  44   LEU A CA  
115  C C   . LEU A 25  ? 1.7648 1.8040 1.0961 -0.2498 -0.2246 0.1642  44   LEU A C   
116  O O   . LEU A 25  ? 1.7275 1.7892 1.0849 -0.2414 -0.2218 0.1680  44   LEU A O   
117  C CB  . LEU A 25  ? 1.8088 1.7013 1.0686 -0.2768 -0.2382 0.1443  44   LEU A CB  
118  C CG  . LEU A 25  ? 1.9312 1.7507 1.1380 -0.3095 -0.2561 0.1400  44   LEU A CG  
119  C CD1 . LEU A 25  ? 1.9616 1.6962 1.1446 -0.2869 -0.2487 0.1210  44   LEU A CD1 
120  C CD2 . LEU A 25  ? 1.9637 1.7774 1.1700 -0.3299 -0.2670 0.1479  44   LEU A CD2 
121  N N   . ASN A 26  ? 1.7112 1.7675 1.0506 -0.2266 -0.2133 0.1618  45   ASN A N   
122  C CA  . ASN A 26  ? 1.6657 1.7635 1.0424 -0.1894 -0.1973 0.1638  45   ASN A CA  
123  C C   . ASN A 26  ? 1.6960 1.8834 1.0898 -0.1925 -0.2022 0.1806  45   ASN A C   
124  O O   . ASN A 26  ? 1.6623 1.8812 1.0850 -0.1657 -0.1928 0.1830  45   ASN A O   
125  C CB  . ASN A 26  ? 1.6768 1.7613 1.0511 -0.1658 -0.1850 0.1579  45   ASN A CB  
126  C CG  . ASN A 26  ? 1.9787 1.9980 1.3580 -0.1431 -0.1714 0.1429  45   ASN A CG  
127  O OD1 . ASN A 26  ? 1.8729 1.8888 1.2794 -0.1203 -0.1607 0.1397  45   ASN A OD1 
128  N ND2 . ASN A 26  ? 1.9177 1.8870 1.2696 -0.1488 -0.1717 0.1335  45   ASN A ND2 
129  N N   . LEU A 27  ? 1.6678 1.8971 1.0415 -0.2253 -0.2173 0.1922  46   LEU A N   
130  C CA  . LEU A 27  ? 1.6460 1.9715 1.0325 -0.2326 -0.2239 0.2102  46   LEU A CA  
131  C C   . LEU A 27  ? 1.6907 2.0368 1.0899 -0.2466 -0.2305 0.2168  46   LEU A C   
132  O O   . LEU A 27  ? 1.6590 2.0785 1.0821 -0.2321 -0.2279 0.2275  46   LEU A O   
133  C CB  . LEU A 27  ? 1.6755 2.0350 1.0333 -0.2700 -0.2396 0.2203  46   LEU A CB  
134  C CG  . LEU A 27  ? 1.7144 2.1827 1.0833 -0.2687 -0.2431 0.2386  46   LEU A CG  
135  C CD1 . LEU A 27  ? 1.6922 2.1799 1.0737 -0.2246 -0.2279 0.2367  46   LEU A CD1 
136  C CD2 . LEU A 27  ? 1.7853 2.2829 1.1233 -0.3177 -0.2625 0.2488  46   LEU A CD2 
137  N N   . LEU A 28  ? 1.6726 1.9515 1.0532 -0.2721 -0.2387 0.2101  47   LEU A N   
138  C CA  . LEU A 28  ? 1.6680 1.9486 1.0544 -0.2887 -0.2460 0.2153  47   LEU A CA  
139  C C   . LEU A 28  ? 1.6832 1.9671 1.1055 -0.2487 -0.2307 0.2092  47   LEU A C   
140  O O   . LEU A 28  ? 1.6635 2.0004 1.1036 -0.2495 -0.2330 0.2190  47   LEU A O   
141  C CB  . LEU A 28  ? 1.7148 1.9058 1.0652 -0.3197 -0.2575 0.2074  47   LEU A CB  
142  C CG  . LEU A 28  ? 1.7696 1.9050 1.1254 -0.3132 -0.2555 0.1999  47   LEU A CG  
143  C CD1 . LEU A 28  ? 1.7752 1.9520 1.1325 -0.3423 -0.2682 0.2156  47   LEU A CD1 
144  C CD2 . LEU A 28  ? 1.8399 1.8726 1.1584 -0.3230 -0.2602 0.1860  47   LEU A CD2 
145  N N   . VAL A 29  ? 1.6277 1.8568 1.0587 -0.2155 -0.2158 0.1934  48   VAL A N   
146  C CA  . VAL A 29  ? 1.5887 1.8097 1.0496 -0.1782 -0.2011 0.1854  48   VAL A CA  
147  C C   . VAL A 29  ? 1.6006 1.9006 1.0831 -0.1529 -0.1948 0.1948  48   VAL A C   
148  O O   . VAL A 29  ? 1.5723 1.9020 1.0750 -0.1377 -0.1916 0.1970  48   VAL A O   
149  C CB  . VAL A 29  ? 1.6393 1.7894 1.0999 -0.1545 -0.1879 0.1687  48   VAL A CB  
150  C CG1 . VAL A 29  ? 1.6059 1.7499 1.0954 -0.1196 -0.1737 0.1613  48   VAL A CG1 
151  C CG2 . VAL A 29  ? 1.6690 1.7438 1.1056 -0.1735 -0.1937 0.1591  48   VAL A CG2 
152  N N   . LEU A 30  ? 1.5545 1.8886 1.0295 -0.1476 -0.1938 0.2004  49   LEU A N   
153  C CA  . LEU A 30  ? 1.5294 1.9375 1.0178 -0.1202 -0.1884 0.2100  49   LEU A CA  
154  C C   . LEU A 30  ? 1.5745 2.0704 1.0700 -0.1341 -0.1984 0.2265  49   LEU A C   
155  O O   . LEU A 30  ? 1.5501 2.0996 1.0618 -0.1037 -0.1923 0.2314  49   LEU A O   
156  C CB  . LEU A 30  ? 1.5387 1.9601 1.0135 -0.1141 -0.1864 0.2130  49   LEU A CB  
157  C CG  . LEU A 30  ? 1.5944 1.9477 1.0667 -0.0891 -0.1728 0.1994  49   LEU A CG  
158  C CD1 . LEU A 30  ? 1.6158 1.9660 1.0667 -0.0997 -0.1753 0.2013  49   LEU A CD1 
159  C CD2 . LEU A 30  ? 1.6045 1.9671 1.0928 -0.0442 -0.1591 0.1978  49   LEU A CD2 
160  N N   . TYR A 31  ? 1.5551 2.0641 1.0356 -0.1798 -0.2141 0.2353  50   TYR A N   
161  C CA  . TYR A 31  ? 1.5525 2.1471 1.0384 -0.2007 -0.2250 0.2530  50   TYR A CA  
162  C C   . TYR A 31  ? 1.5696 2.1527 1.0711 -0.1963 -0.2235 0.2504  50   TYR A C   
163  O O   . TYR A 31  ? 1.5396 2.1962 1.0579 -0.1820 -0.2222 0.2600  50   TYR A O   
164  C CB  . TYR A 31  ? 1.6106 2.2164 1.0700 -0.2565 -0.2437 0.2642  50   TYR A CB  
165  C CG  . TYR A 31  ? 1.6437 2.3549 1.1071 -0.2825 -0.2557 0.2864  50   TYR A CG  
166  C CD1 . TYR A 31  ? 1.6663 2.4748 1.1331 -0.2781 -0.2577 0.3010  50   TYR A CD1 
167  C CD2 . TYR A 31  ? 1.6625 2.3792 1.1247 -0.3131 -0.2657 0.2942  50   TYR A CD2 
168  C CE1 . TYR A 31  ? 1.6769 2.5926 1.1481 -0.3030 -0.2687 0.3230  50   TYR A CE1 
169  C CE2 . TYR A 31  ? 1.6756 2.4947 1.1412 -0.3402 -0.2768 0.3165  50   TYR A CE2 
170  C CZ  . TYR A 31  ? 1.7695 2.6910 1.2404 -0.3355 -0.2783 0.3309  50   TYR A CZ  
171  O OH  . TYR A 31  ? 1.7874 2.8200 1.2627 -0.3628 -0.2891 0.3543  50   TYR A OH  
172  N N   . ALA A 32  ? 1.5321 2.0252 1.0271 -0.2059 -0.2233 0.2372  51   ALA A N   
173  C CA  . ALA A 32  ? 1.5187 1.9877 1.0255 -0.2036 -0.2224 0.2330  51   ALA A CA  
174  C C   . ALA A 32  ? 1.5405 2.0317 1.0744 -0.1577 -0.2085 0.2271  51   ALA A C   
175  O O   . ALA A 32  ? 1.5272 2.0430 1.0730 -0.1568 -0.2100 0.2307  51   ALA A O   
176  C CB  . ALA A 32  ? 1.5465 1.9127 1.0393 -0.2142 -0.2228 0.2185  51   ALA A CB  
177  N N   . VAL A 33  ? 1.4881 1.9671 1.0282 -0.1207 -0.1956 0.2182  52   VAL A N   
178  C CA  . VAL A 33  ? 1.4643 1.9524 1.0224 -0.0765 -0.1831 0.2112  52   VAL A CA  
179  C C   . VAL A 33  ? 1.5145 2.1017 1.0795 -0.0600 -0.1843 0.2253  52   VAL A C   
180  O O   . VAL A 33  ? 1.4958 2.1084 1.0728 -0.0413 -0.1815 0.2247  52   VAL A O   
181  C CB  . VAL A 33  ? 1.5088 1.9396 1.0658 -0.0457 -0.1700 0.1976  52   VAL A CB  
182  C CG1 . VAL A 33  ? 1.4940 1.9353 1.0615 -0.0016 -0.1592 0.1922  52   VAL A CG1 
183  C CG2 . VAL A 33  ? 1.5110 1.8525 1.0653 -0.0570 -0.1672 0.1833  52   VAL A CG2 
184  N N   . ARG A 34  ? 1.4906 2.1367 1.0470 -0.0661 -0.1887 0.2379  53   ARG A N   
185  C CA  . ARG A 34  ? 1.4889 2.2396 1.0506 -0.0480 -0.1898 0.2529  53   ARG A CA  
186  C C   . ARG A 34  ? 1.5456 2.3656 1.1130 -0.0785 -0.2012 0.2679  53   ARG A C   
187  O O   . ARG A 34  ? 1.5298 2.4251 1.1070 -0.0548 -0.1990 0.2757  53   ARG A O   
188  C CB  . ARG A 34  ? 1.5128 2.3127 1.0638 -0.0466 -0.1917 0.2633  53   ARG A CB  
189  C CG  . ARG A 34  ? 1.7112 2.4408 1.2519 -0.0296 -0.1833 0.2515  53   ARG A CG  
190  C CD  . ARG A 34  ? 1.9151 2.6060 1.4591 0.0231  -0.1685 0.2392  53   ARG A CD  
191  N NE  . ARG A 34  ? 2.0822 2.7190 1.6145 0.0355  -0.1616 0.2323  53   ARG A NE  
192  C CZ  . ARG A 34  ? 2.2782 2.8241 1.8075 0.0260  -0.1570 0.2184  53   ARG A CZ  
193  N NH1 . ARG A 34  ? 2.1147 2.6117 1.6518 0.0060  -0.1587 0.2093  53   ARG A NH1 
194  N NH2 . ARG A 34  ? 2.1356 2.6428 1.6537 0.0376  -0.1506 0.2143  53   ARG A NH2 
195  N N   . SER A 35  ? 1.5231 2.3169 1.0810 -0.1301 -0.2135 0.2725  54   SER A N   
196  C CA  . SER A 35  ? 1.5269 2.3774 1.0849 -0.1686 -0.2265 0.2889  54   SER A CA  
197  C C   . SER A 35  ? 1.5581 2.3950 1.1290 -0.1611 -0.2242 0.2846  54   SER A C   
198  O O   . SER A 35  ? 1.5383 2.4580 1.1178 -0.1643 -0.2281 0.2987  54   SER A O   
199  C CB  . SER A 35  ? 1.6055 2.4227 1.1410 -0.2268 -0.2418 0.2954  54   SER A CB  
200  O OG  . SER A 35  ? 1.7310 2.4320 1.2552 -0.2343 -0.2405 0.2781  54   SER A OG  
201  N N   . GLU A 36  ? 1.5137 2.2518 1.0859 -0.1510 -0.2180 0.2659  55   GLU A N   
202  C CA  . GLU A 36  ? 1.4981 2.2124 1.0813 -0.1443 -0.2160 0.2597  55   GLU A CA  
203  C C   . GLU A 36  ? 1.5204 2.2358 1.1191 -0.0905 -0.2017 0.2469  55   GLU A C   
204  O O   . GLU A 36  ? 1.5114 2.1810 1.1094 -0.0616 -0.1917 0.2336  55   GLU A O   
205  C CB  . GLU A 36  ? 1.5304 2.1409 1.1036 -0.1673 -0.2193 0.2482  55   GLU A CB  
206  C CG  . GLU A 36  ? 1.6794 2.2732 1.2589 -0.1753 -0.2224 0.2476  55   GLU A CG  
207  C CD  . GLU A 36  ? 2.0211 2.6891 1.5979 -0.2074 -0.2347 0.2690  55   GLU A CD  
208  O OE1 . GLU A 36  ? 2.0600 2.7213 1.6164 -0.2532 -0.2483 0.2810  55   GLU A OE1 
209  O OE2 . GLU A 36  ? 1.9466 2.6799 1.5393 -0.1874 -0.2310 0.2740  55   GLU A OE2 
210  N N   . ARG A 37  ? 1.4669 2.2320 1.0765 -0.0787 -0.2015 0.2513  56   ARG A N   
211  C CA  . ARG A 37  ? 1.4531 2.2155 1.0722 -0.0298 -0.1899 0.2385  56   ARG A CA  
212  C C   . ARG A 37  ? 1.5024 2.1673 1.1256 -0.0256 -0.1852 0.2194  56   ARG A C   
213  O O   . ARG A 37  ? 1.4934 2.1216 1.1191 0.0109  -0.1751 0.2041  56   ARG A O   
214  C CB  . ARG A 37  ? 1.4422 2.2955 1.0690 -0.0183 -0.1917 0.2497  56   ARG A CB  
215  C CG  . ARG A 37  ? 1.5432 2.4189 1.1706 0.0392  -0.1805 0.2402  56   ARG A CG  
216  C CD  . ARG A 37  ? 1.5936 2.5435 1.2270 0.0560  -0.1809 0.2464  56   ARG A CD  
217  N NE  . ARG A 37  ? 1.6646 2.6423 1.2908 0.1135  -0.1713 0.2390  56   ARG A NE  
218  C CZ  . ARG A 37  ? 1.8230 2.7465 1.4445 0.1501  -0.1638 0.2199  56   ARG A CZ  
219  N NH1 . ARG A 37  ? 1.6302 2.4775 1.2578 0.1350  -0.1641 0.2069  56   ARG A NH1 
220  N NH2 . ARG A 37  ? 1.6539 2.5986 1.2616 0.2025  -0.1565 0.2139  56   ARG A NH2 
221  N N   . LYS A 38  ? 1.4643 2.0870 1.0854 -0.0637 -0.1933 0.2210  57   LYS A N   
222  C CA  . LYS A 38  ? 1.4594 1.9971 1.0839 -0.0651 -0.1908 0.2057  57   LYS A CA  
223  C C   . LYS A 38  ? 1.5192 1.9793 1.1391 -0.0569 -0.1837 0.1911  57   LYS A C   
224  O O   . LYS A 38  ? 1.5101 1.9073 1.1354 -0.0482 -0.1787 0.1768  57   LYS A O   
225  C CB  . LYS A 38  ? 1.4962 2.0174 1.1143 -0.1064 -0.2027 0.2145  57   LYS A CB  
226  C CG  . LYS A 38  ? 1.5943 2.1771 1.2193 -0.1125 -0.2082 0.2261  57   LYS A CG  
227  C CD  . LYS A 38  ? 1.6510 2.2029 1.2663 -0.1514 -0.2199 0.2341  57   LYS A CD  
228  C CE  . LYS A 38  ? 1.6587 2.1456 1.2808 -0.1395 -0.2163 0.2195  57   LYS A CE  
229  N NZ  . LYS A 38  ? 1.7105 2.2403 1.3488 -0.1138 -0.2115 0.2168  57   LYS A NZ  
230  N N   . LEU A 39  ? 1.4871 1.9570 1.0971 -0.0602 -0.1835 0.1957  58   LEU A N   
231  C CA  . LEU A 39  ? 1.4912 1.8981 1.0950 -0.0532 -0.1768 0.1845  58   LEU A CA  
232  C C   . LEU A 39  ? 1.5283 1.9493 1.1328 -0.0154 -0.1663 0.1800  58   LEU A C   
233  O O   . LEU A 39  ? 1.5290 1.9146 1.1260 -0.0111 -0.1614 0.1754  58   LEU A O   
234  C CB  . LEU A 39  ? 1.5111 1.9047 1.0977 -0.0885 -0.1855 0.1920  58   LEU A CB  
235  C CG  . LEU A 39  ? 1.5876 1.9149 1.1641 -0.1169 -0.1921 0.1876  58   LEU A CG  
236  C CD1 . LEU A 39  ? 1.5949 1.9489 1.1684 -0.1445 -0.2041 0.1995  58   LEU A CD1 
237  C CD2 . LEU A 39  ? 1.6472 1.9421 1.2016 -0.1399 -0.1972 0.1889  58   LEU A CD2 
238  N N   . HIS A 40  ? 1.4686 1.9365 1.0792 0.0138  -0.1627 0.1811  59   HIS A N   
239  C CA  . HIS A 40  ? 1.4655 1.9427 1.0710 0.0547  -0.1536 0.1768  59   HIS A CA  
240  C C   . HIS A 40  ? 1.5053 1.9097 1.1119 0.0783  -0.1444 0.1586  59   HIS A C   
241  O O   . HIS A 40  ? 1.5073 1.9129 1.1067 0.1139  -0.1382 0.1534  59   HIS A O   
242  C CB  . HIS A 40  ? 1.4722 2.0352 1.0778 0.0772  -0.1550 0.1866  59   HIS A CB  
243  C CG  . HIS A 40  ? 1.5156 2.1615 1.1175 0.0638  -0.1618 0.2055  59   HIS A CG  
244  N ND1 . HIS A 40  ? 1.5334 2.2721 1.1383 0.0730  -0.1654 0.2184  59   HIS A ND1 
245  C CD2 . HIS A 40  ? 1.5428 2.1948 1.1377 0.0424  -0.1655 0.2136  59   HIS A CD2 
246  C CE1 . HIS A 40  ? 1.5271 2.3282 1.1282 0.0547  -0.1715 0.2347  59   HIS A CE1 
247  N NE2 . HIS A 40  ? 1.5399 2.2897 1.1341 0.0352  -0.1723 0.2320  59   HIS A NE2 
248  N N   . THR A 41  ? 1.4477 1.7886 1.0606 0.0581  -0.1440 0.1494  60   THR A N   
249  C CA  . THR A 41  ? 1.4426 1.7169 1.0589 0.0710  -0.1367 0.1335  60   THR A CA  
250  C C   . THR A 41  ? 1.5045 1.7408 1.1092 0.0912  -0.1280 0.1280  60   THR A C   
251  O O   . THR A 41  ? 1.5020 1.7397 1.0993 0.0843  -0.1274 0.1340  60   THR A O   
252  C CB  . THR A 41  ? 1.5085 1.7366 1.1338 0.0434  -0.1390 0.1280  60   THR A CB  
253  O OG1 . THR A 41  ? 1.4881 1.7496 1.1175 0.0194  -0.1488 0.1372  60   THR A OG1 
254  C CG2 . THR A 41  ? 1.4824 1.6625 1.1161 0.0532  -0.1337 0.1136  60   THR A CG2 
255  N N   . VAL A 42  ? 1.4654 1.6654 1.0660 0.1146  -0.1219 0.1168  61   VAL A N   
256  C CA  . VAL A 42  ? 1.4786 1.6317 1.0645 0.1334  -0.1140 0.1112  61   VAL A CA  
257  C C   . VAL A 42  ? 1.5075 1.6125 1.0978 0.1120  -0.1101 0.1083  61   VAL A C   
258  O O   . VAL A 42  ? 1.5176 1.6096 1.0965 0.1167  -0.1059 0.1119  61   VAL A O   
259  C CB  . VAL A 42  ? 1.5484 1.6686 1.1236 0.1594  -0.1106 0.1000  61   VAL A CB  
260  C CG1 . VAL A 42  ? 1.5342 1.6598 1.1234 0.1519  -0.1148 0.0929  61   VAL A CG1 
261  C CG2 . VAL A 42  ? 1.5679 1.6175 1.1318 0.1626  -0.1037 0.0920  61   VAL A CG2 
262  N N   . GLY A 43  ? 1.4337 1.5185 1.0394 0.0901  -0.1118 0.1028  62   GLY A N   
263  C CA  . GLY A 43  ? 1.4202 1.4661 1.0305 0.0714  -0.1084 0.0997  62   GLY A CA  
264  C C   . GLY A 43  ? 1.4391 1.5034 1.0450 0.0540  -0.1123 0.1084  62   GLY A C   
265  O O   . GLY A 43  ? 1.4368 1.4702 1.0407 0.0429  -0.1089 0.1062  62   GLY A O   
266  N N   . ASN A 44  ? 1.3739 1.4908 0.9767 0.0505  -0.1199 0.1186  63   ASN A N   
267  C CA  . ASN A 44  ? 1.3654 1.5051 0.9601 0.0305  -0.1260 0.1282  63   ASN A CA  
268  C C   . ASN A 44  ? 1.4064 1.5642 0.9874 0.0431  -0.1229 0.1350  63   ASN A C   
269  O O   . ASN A 44  ? 1.4036 1.5741 0.9756 0.0263  -0.1272 0.1418  63   ASN A O   
270  C CB  . ASN A 44  ? 1.3654 1.5542 0.9630 0.0133  -0.1371 0.1375  63   ASN A CB  
271  C CG  . ASN A 44  ? 1.6669 1.8295 1.2682 -0.0120 -0.1433 0.1348  63   ASN A CG  
272  O OD1 . ASN A 44  ? 1.5799 1.6916 1.1790 -0.0194 -0.1404 0.1272  63   ASN A OD1 
273  N ND2 . ASN A 44  ? 1.5765 1.7750 1.1810 -0.0250 -0.1522 0.1422  63   ASN A ND2 
274  N N   . LEU A 45  ? 1.3584 1.5127 0.9345 0.0727  -0.1159 0.1330  64   LEU A N   
275  C CA  . LEU A 45  ? 1.3661 1.5309 0.9268 0.0904  -0.1119 0.1393  64   LEU A CA  
276  C C   . LEU A 45  ? 1.4229 1.5352 0.9773 0.0835  -0.1052 0.1350  64   LEU A C   
277  O O   . LEU A 45  ? 1.4300 1.5518 0.9718 0.0871  -0.1038 0.1416  64   LEU A O   
278  C CB  . LEU A 45  ? 1.3801 1.5464 0.9312 0.1269  -0.1071 0.1378  64   LEU A CB  
279  C CG  . LEU A 45  ? 1.4324 1.6638 0.9836 0.1432  -0.1125 0.1443  64   LEU A CG  
280  C CD1 . LEU A 45  ? 1.4554 1.6683 0.9932 0.1806  -0.1076 0.1382  64   LEU A CD1 
281  C CD2 . LEU A 45  ? 1.4581 1.7569 1.0024 0.1447  -0.1169 0.1591  64   LEU A CD2 
282  N N   . TYR A 46  ? 1.3688 1.4313 0.9323 0.0740  -0.1010 0.1247  65   TYR A N   
283  C CA  . TYR A 46  ? 1.3701 1.3865 0.9307 0.0660  -0.0941 0.1200  65   TYR A CA  
284  C C   . TYR A 46  ? 1.4156 1.4361 0.9747 0.0411  -0.0993 0.1215  65   TYR A C   
285  O O   . TYR A 46  ? 1.4198 1.4163 0.9707 0.0358  -0.0948 0.1205  65   TYR A O   
286  C CB  . TYR A 46  ? 1.3834 1.3573 0.9556 0.0650  -0.0887 0.1093  65   TYR A CB  
287  C CG  . TYR A 46  ? 1.4202 1.3781 0.9885 0.0859  -0.0849 0.1061  65   TYR A CG  
288  C CD1 . TYR A 46  ? 1.4730 1.3953 1.0272 0.0973  -0.0772 0.1062  65   TYR A CD1 
289  C CD2 . TYR A 46  ? 1.4206 1.3942 0.9954 0.0935  -0.0895 0.1027  65   TYR A CD2 
290  C CE1 . TYR A 46  ? 1.5068 1.4038 1.0500 0.1153  -0.0751 0.1028  65   TYR A CE1 
291  C CE2 . TYR A 46  ? 1.4514 1.4036 1.0164 0.1136  -0.0870 0.0982  65   TYR A CE2 
292  C CZ  . TYR A 46  ? 1.5811 1.4915 1.1286 0.1240  -0.0802 0.0980  65   TYR A CZ  
293  O OH  . TYR A 46  ? 1.6200 1.4989 1.1506 0.1426  -0.0791 0.0932  65   TYR A OH  
294  N N   . ILE A 47  ? 1.3683 1.4165 0.9321 0.0257  -0.1092 0.1241  66   ILE A N   
295  C CA  . ILE A 47  ? 1.3732 1.4207 0.9287 0.0000  -0.1171 0.1260  66   ILE A CA  
296  C C   . ILE A 47  ? 1.4413 1.5297 0.9819 -0.0054 -0.1228 0.1372  66   ILE A C   
297  O O   . ILE A 47  ? 1.4476 1.5258 0.9733 -0.0235 -0.1271 0.1382  66   ILE A O   
298  C CB  . ILE A 47  ? 1.4011 1.4548 0.9643 -0.0161 -0.1261 0.1253  66   ILE A CB  
299  C CG1 . ILE A 47  ? 1.3955 1.4175 0.9754 -0.0078 -0.1205 0.1149  66   ILE A CG1 
300  C CG2 . ILE A 47  ? 1.4223 1.4639 0.9694 -0.0436 -0.1359 0.1272  66   ILE A CG2 
301  C CD1 . ILE A 47  ? 1.4890 1.4597 1.0693 -0.0085 -0.1130 0.1049  66   ILE A CD1 
302  N N   . VAL A 48  ? 1.4020 1.5365 0.9445 0.0123  -0.1227 0.1451  67   VAL A N   
303  C CA  . VAL A 48  ? 1.4091 1.5950 0.9398 0.0130  -0.1273 0.1571  67   VAL A CA  
304  C C   . VAL A 48  ? 1.4726 1.6339 0.9901 0.0225  -0.1199 0.1566  67   VAL A C   
305  O O   . VAL A 48  ? 1.4787 1.6486 0.9829 0.0052  -0.1249 0.1607  67   VAL A O   
306  C CB  . VAL A 48  ? 1.4535 1.6973 0.9895 0.0363  -0.1280 0.1651  67   VAL A CB  
307  C CG1 . VAL A 48  ? 1.4602 1.7553 0.9837 0.0479  -0.1293 0.1771  67   VAL A CG1 
308  C CG2 . VAL A 48  ? 1.4390 1.7236 0.9850 0.0204  -0.1376 0.1696  67   VAL A CG2 
309  N N   . SER A 49  ? 1.4313 1.5592 0.9503 0.0478  -0.1086 0.1516  68   SER A N   
310  C CA  . SER A 49  ? 1.4445 1.5445 0.9507 0.0589  -0.1001 0.1519  68   SER A CA  
311  C C   . SER A 49  ? 1.5022 1.5660 1.0027 0.0371  -0.0991 0.1462  68   SER A C   
312  O O   . SER A 49  ? 1.5064 1.5703 0.9923 0.0365  -0.0974 0.1500  68   SER A O   
313  C CB  . SER A 49  ? 1.4922 1.5530 0.9999 0.0833  -0.0897 0.1470  68   SER A CB  
314  O OG  . SER A 49  ? 1.6075 1.6359 1.1024 0.0905  -0.0813 0.1480  68   SER A OG  
315  N N   . LEU A 50  ? 1.4570 1.4915 0.9669 0.0216  -0.1005 0.1370  69   LEU A N   
316  C CA  . LEU A 50  ? 1.4651 1.4646 0.9667 0.0045  -0.1001 0.1303  69   LEU A CA  
317  C C   . LEU A 50  ? 1.5348 1.5558 1.0190 -0.0183 -0.1123 0.1350  69   LEU A C   
318  O O   . LEU A 50  ? 1.5512 1.5527 1.0180 -0.0265 -0.1120 0.1326  69   LEU A O   
319  C CB  . LEU A 50  ? 1.4563 1.4223 0.9710 -0.0012 -0.0987 0.1201  69   LEU A CB  
320  C CG  . LEU A 50  ? 1.5294 1.4564 1.0340 -0.0114 -0.0966 0.1119  69   LEU A CG  
321  C CD1 . LEU A 50  ? 1.5376 1.4409 1.0420 0.0016  -0.0832 0.1091  69   LEU A CD1 
322  C CD2 . LEU A 50  ? 1.5617 1.4678 1.0755 -0.0183 -0.0995 0.1042  69   LEU A CD2 
323  N N   . SER A 51  ? 1.4844 1.5467 0.9712 -0.0296 -0.1234 0.1419  70   SER A N   
324  C CA  . SER A 51  ? 1.4959 1.5828 0.9642 -0.0563 -0.1369 0.1483  70   SER A CA  
325  C C   . SER A 51  ? 1.5392 1.6683 0.9954 -0.0521 -0.1380 0.1585  70   SER A C   
326  O O   . SER A 51  ? 1.5489 1.6872 0.9846 -0.0751 -0.1476 0.1618  70   SER A O   
327  C CB  . SER A 51  ? 1.5377 1.6574 1.0122 -0.0736 -0.1486 0.1542  70   SER A CB  
328  O OG  . SER A 51  ? 1.6399 1.8149 1.1307 -0.0560 -0.1472 0.1628  70   SER A OG  
329  N N   . VAL A 52  ? 1.4753 1.6265 0.9410 -0.0224 -0.1288 0.1632  71   VAL A N   
330  C CA  . VAL A 52  ? 1.4774 1.6674 0.9322 -0.0100 -0.1278 0.1733  71   VAL A CA  
331  C C   . VAL A 52  ? 1.5361 1.6821 0.9752 -0.0105 -0.1212 0.1677  71   VAL A C   
332  O O   . VAL A 52  ? 1.5471 1.7086 0.9678 -0.0259 -0.1276 0.1716  71   VAL A O   
333  C CB  . VAL A 52  ? 1.5189 1.7337 0.9833 0.0264  -0.1198 0.1790  71   VAL A CB  
334  C CG1 . VAL A 52  ? 1.5299 1.7673 0.9797 0.0456  -0.1159 0.1880  71   VAL A CG1 
335  C CG2 . VAL A 52  ? 1.5025 1.7750 0.9784 0.0287  -0.1271 0.1861  71   VAL A CG2 
336  N N   . ALA A 53  ? 1.4825 1.5758 0.9284 0.0045  -0.1087 0.1589  72   ALA A N   
337  C CA  . ALA A 53  ? 1.4917 1.5437 0.9254 0.0058  -0.1004 0.1535  72   ALA A CA  
338  C C   . ALA A 53  ? 1.5564 1.5898 0.9731 -0.0213 -0.1086 0.1470  72   ALA A C   
339  O O   . ALA A 53  ? 1.5737 1.6037 0.9706 -0.0258 -0.1087 0.1476  72   ALA A O   
340  C CB  . ALA A 53  ? 1.4943 1.4994 0.9413 0.0191  -0.0879 0.1453  72   ALA A CB  
341  N N   . ASP A 54  ? 1.5097 1.5310 0.9301 -0.0389 -0.1166 0.1413  73   ASP A N   
342  C CA  . ASP A 54  ? 1.5347 1.5291 0.9323 -0.0642 -0.1263 0.1346  73   ASP A CA  
343  C C   . ASP A 54  ? 1.5999 1.6322 0.9768 -0.0892 -0.1421 0.1432  73   ASP A C   
344  O O   . ASP A 54  ? 1.6297 1.6345 0.9786 -0.1109 -0.1509 0.1379  73   ASP A O   
345  C CB  . ASP A 54  ? 1.5591 1.5164 0.9632 -0.0719 -0.1287 0.1253  73   ASP A CB  
346  C CG  . ASP A 54  ? 1.6987 1.6127 1.1141 -0.0536 -0.1148 0.1148  73   ASP A CG  
347  O OD1 . ASP A 54  ? 1.7108 1.6076 1.1173 -0.0437 -0.1055 0.1117  73   ASP A OD1 
348  O OD2 . ASP A 54  ? 1.7819 1.6816 1.2135 -0.0512 -0.1138 0.1101  73   ASP A OD2 
349  N N   . LEU A 55  ? 1.5333 1.6291 0.9208 -0.0861 -0.1460 0.1563  74   LEU A N   
350  C CA  . LEU A 55  ? 1.5415 1.6851 0.9109 -0.1110 -0.1609 0.1665  74   LEU A CA  
351  C C   . LEU A 55  ? 1.5912 1.7474 0.9446 -0.1030 -0.1573 0.1698  74   LEU A C   
352  O O   . LEU A 55  ? 1.6205 1.7739 0.9463 -0.1277 -0.1678 0.1693  74   LEU A O   
353  C CB  . LEU A 55  ? 1.5214 1.7389 0.9077 -0.1123 -0.1677 0.1805  74   LEU A CB  
354  C CG  . LEU A 55  ? 1.5931 1.8716 0.9624 -0.1424 -0.1841 0.1932  74   LEU A CG  
355  C CD1 . LEU A 55  ? 1.6193 1.8709 0.9675 -0.1857 -0.2004 0.1904  74   LEU A CD1 
356  C CD2 . LEU A 55  ? 1.6009 1.9663 0.9899 -0.1302 -0.1858 0.2087  74   LEU A CD2 
357  N N   . ILE A 56  ? 1.5128 1.6778 0.8801 -0.0690 -0.1431 0.1731  75   ILE A N   
358  C CA  . ILE A 56  ? 1.5141 1.6870 0.8671 -0.0563 -0.1376 0.1771  75   ILE A CA  
359  C C   . ILE A 56  ? 1.5829 1.7010 0.9111 -0.0717 -0.1378 0.1652  75   ILE A C   
360  O O   . ILE A 56  ? 1.5985 1.7314 0.9026 -0.0858 -0.1451 0.1677  75   ILE A O   
361  C CB  . ILE A 56  ? 1.5338 1.7042 0.9021 -0.0175 -0.1216 0.1810  75   ILE A CB  
362  C CG1 . ILE A 56  ? 1.5288 1.7681 0.9035 0.0009  -0.1241 0.1962  75   ILE A CG1 
363  C CG2 . ILE A 56  ? 1.5501 1.6870 0.9042 -0.0052 -0.1109 0.1785  75   ILE A CG2 
364  C CD1 . ILE A 56  ? 1.5897 1.8574 0.9851 0.0073  -0.1268 0.1991  75   ILE A CD1 
365  N N   . VAL A 57  ? 1.5378 1.5965 0.8701 -0.0704 -0.1314 0.1521  76   VAL A N   
366  C CA  . VAL A 57  ? 1.5642 1.5676 0.8724 -0.0799 -0.1308 0.1391  76   VAL A CA  
367  C C   . VAL A 57  ? 1.6661 1.6645 0.9421 -0.1144 -0.1493 0.1363  76   VAL A C   
368  O O   . VAL A 57  ? 1.6937 1.6690 0.9393 -0.1224 -0.1520 0.1304  76   VAL A O   
369  C CB  . VAL A 57  ? 1.5988 1.5504 0.9209 -0.0686 -0.1206 0.1272  76   VAL A CB  
370  C CG1 . VAL A 57  ? 1.6286 1.5260 0.9226 -0.0759 -0.1211 0.1133  76   VAL A CG1 
371  C CG2 . VAL A 57  ? 1.5725 1.5239 0.9189 -0.0397 -0.1031 0.1300  76   VAL A CG2 
372  N N   . GLY A 58  ? 1.6333 1.6539 0.9135 -0.1353 -0.1624 0.1414  77   GLY A N   
373  C CA  . GLY A 58  ? 1.6759 1.6898 0.9232 -0.1732 -0.1819 0.1407  77   GLY A CA  
374  C C   . GLY A 58  ? 1.7566 1.8243 0.9858 -0.1917 -0.1931 0.1516  77   GLY A C   
375  O O   . GLY A 58  ? 1.7951 1.8385 0.9857 -0.2176 -0.2053 0.1466  77   GLY A O   
376  N N   . ALA A 59  ? 1.6892 1.8310 0.9436 -0.1781 -0.1898 0.1666  78   ALA A N   
377  C CA  . ALA A 59  ? 1.6975 1.9084 0.9408 -0.1921 -0.2001 0.1800  78   ALA A CA  
378  C C   . ALA A 59  ? 1.7560 1.9770 0.9903 -0.1712 -0.1911 0.1814  78   ALA A C   
379  O O   . ALA A 59  ? 1.7770 2.0350 0.9892 -0.1898 -0.2020 0.1878  78   ALA A O   
380  C CB  . ALA A 59  ? 1.6735 1.9662 0.9460 -0.1861 -0.2023 0.1965  78   ALA A CB  
381  N N   . VAL A 60  ? 1.6911 1.8794 0.9401 -0.1357 -0.1724 0.1761  79   VAL A N   
382  C CA  . VAL A 60  ? 1.6915 1.8893 0.9324 -0.1144 -0.1630 0.1795  79   VAL A CA  
383  C C   . VAL A 60  ? 1.7611 1.8896 0.9834 -0.1075 -0.1534 0.1650  79   VAL A C   
384  O O   . VAL A 60  ? 1.7812 1.9098 0.9778 -0.1113 -0.1549 0.1642  79   VAL A O   
385  C CB  . VAL A 60  ? 1.7075 1.9380 0.9769 -0.0757 -0.1489 0.1905  79   VAL A CB  
386  C CG1 . VAL A 60  ? 1.7181 1.9393 0.9769 -0.0523 -0.1371 0.1927  79   VAL A CG1 
387  C CG2 . VAL A 60  ? 1.6886 2.0026 0.9695 -0.0760 -0.1580 0.2068  79   VAL A CG2 
388  N N   . VAL A 61  ? 1.7105 1.7851 0.9457 -0.0964 -0.1432 0.1542  80   VAL A N   
389  C CA  . VAL A 61  ? 1.7275 1.7462 0.9511 -0.0835 -0.1310 0.1422  80   VAL A CA  
390  C C   . VAL A 61  ? 1.8481 1.8236 1.0346 -0.1098 -0.1433 0.1286  80   VAL A C   
391  O O   . VAL A 61  ? 1.8736 1.8250 1.0314 -0.1093 -0.1416 0.1214  80   VAL A O   
392  C CB  . VAL A 61  ? 1.7466 1.7292 0.9973 -0.0629 -0.1162 0.1362  80   VAL A CB  
393  C CG1 . VAL A 61  ? 1.7594 1.6980 0.9984 -0.0495 -0.1030 0.1264  80   VAL A CG1 
394  C CG2 . VAL A 61  ? 1.7081 1.7245 0.9906 -0.0400 -0.1069 0.1486  80   VAL A CG2 
395  N N   . MET A 62  ? 1.8353 1.7977 1.0188 -0.1321 -0.1561 0.1250  81   MET A N   
396  C CA  . MET A 62  ? 1.8933 1.8016 1.0358 -0.1567 -0.1692 0.1115  81   MET A CA  
397  C C   . MET A 62  ? 2.0127 1.9329 1.1134 -0.1848 -0.1856 0.1126  81   MET A C   
398  O O   . MET A 62  ? 2.0572 1.9274 1.1200 -0.1868 -0.1870 0.0994  81   MET A O   
399  C CB  . MET A 62  ? 1.9256 1.8086 1.0719 -0.1734 -0.1788 0.1081  81   MET A CB  
400  C CG  . MET A 62  ? 1.9651 1.7941 1.1229 -0.1516 -0.1664 0.0959  81   MET A CG  
401  S SD  . MET A 62  ? 1.9873 1.8207 1.1772 -0.1564 -0.1698 0.0999  81   MET A SD  
402  C CE  . MET A 62  ? 1.9897 1.7364 1.1474 -0.1578 -0.1734 0.0816  81   MET A CE  
403  N N   . PRO A 63  ? 1.9733 1.9594 1.0773 -0.2062 -0.1984 0.1275  82   PRO A N   
404  C CA  . PRO A 63  ? 2.0175 2.0160 1.0796 -0.2363 -0.2152 0.1284  82   PRO A CA  
405  C C   . PRO A 63  ? 2.0737 2.0779 1.1213 -0.2180 -0.2062 0.1266  82   PRO A C   
406  O O   . PRO A 63  ? 2.1139 2.0864 1.1162 -0.2359 -0.2161 0.1170  82   PRO A O   
407  C CB  . PRO A 63  ? 2.0205 2.1035 1.0999 -0.2577 -0.2278 0.1475  82   PRO A CB  
408  C CG  . PRO A 63  ? 2.0319 2.1277 1.1527 -0.2452 -0.2212 0.1528  82   PRO A CG  
409  C CD  . PRO A 63  ? 1.9488 2.0043 1.0920 -0.2038 -0.1988 0.1442  82   PRO A CD  
410  N N   . MET A 64  ? 1.9908 2.0303 1.0733 -0.1825 -0.1878 0.1354  83   MET A N   
411  C CA  . MET A 64  ? 1.9946 2.0428 1.0679 -0.1613 -0.1768 0.1367  83   MET A CA  
412  C C   . MET A 64  ? 2.0780 2.0542 1.1297 -0.1469 -0.1658 0.1190  83   MET A C   
413  O O   . MET A 64  ? 2.0964 2.0691 1.1239 -0.1404 -0.1623 0.1162  83   MET A O   
414  C CB  . MET A 64  ? 1.9772 2.0753 1.0904 -0.1280 -0.1610 0.1523  83   MET A CB  
415  C CG  . MET A 64  ? 2.0058 2.1868 1.1322 -0.1339 -0.1704 0.1710  83   MET A CG  
416  S SD  . MET A 64  ? 2.0234 2.2496 1.1829 -0.0883 -0.1521 0.1881  83   MET A SD  
417  C CE  . MET A 64  ? 1.9712 2.2959 1.1395 -0.0981 -0.1669 0.2075  83   MET A CE  
418  N N   . ASN A 65  ? 2.0388 1.9624 1.0987 -0.1406 -0.1604 0.1077  84   ASN A N   
419  C CA  . ASN A 65  ? 2.0676 1.9287 1.1076 -0.1247 -0.1501 0.0911  84   ASN A CA  
420  C C   . ASN A 65  ? 2.1903 1.9976 1.1736 -0.1489 -0.1668 0.0750  84   ASN A C   
421  O O   . ASN A 65  ? 2.2202 1.9845 1.1742 -0.1355 -0.1604 0.0615  84   ASN A O   
422  C CB  . ASN A 65  ? 2.0598 1.8929 1.1318 -0.1048 -0.1368 0.0865  84   ASN A CB  
423  C CG  . ASN A 65  ? 2.4033 2.2005 1.4700 -0.0782 -0.1194 0.0761  84   ASN A CG  
424  O OD1 . ASN A 65  ? 2.3055 2.1252 1.3982 -0.0554 -0.1022 0.0839  84   ASN A OD1 
425  N ND2 . ASN A 65  ? 2.3462 2.0869 1.3761 -0.0802 -0.1238 0.0588  84   ASN A ND2 
426  N N   . ILE A 66  ? 2.1731 1.9824 1.1380 -0.1847 -0.1884 0.0768  85   ILE A N   
427  C CA  . ILE A 66  ? 2.2451 1.9981 1.1491 -0.2141 -0.2082 0.0629  85   ILE A CA  
428  C C   . ILE A 66  ? 2.3336 2.1026 1.2004 -0.2234 -0.2143 0.0619  85   ILE A C   
429  O O   . ILE A 66  ? 2.3867 2.0963 1.2010 -0.2264 -0.2198 0.0451  85   ILE A O   
430  C CB  . ILE A 66  ? 2.2997 2.0515 1.1949 -0.2543 -0.2302 0.0679  85   ILE A CB  
431  C CG1 . ILE A 66  ? 2.2686 2.0048 1.2001 -0.2432 -0.2235 0.0687  85   ILE A CG1 
432  C CG2 . ILE A 66  ? 2.3967 2.0790 1.2204 -0.2880 -0.2525 0.0535  85   ILE A CG2 
433  C CD1 . ILE A 66  ? 2.3489 2.1176 1.2940 -0.2766 -0.2398 0.0816  85   ILE A CD1 
434  N N   . LEU A 67  ? 2.2565 2.1058 1.1493 -0.2244 -0.2129 0.0798  86   LEU A N   
435  C CA  . LEU A 67  ? 2.2775 2.1590 1.1435 -0.2312 -0.2178 0.0830  86   LEU A CA  
436  C C   . LEU A 67  ? 2.3530 2.1994 1.2007 -0.2004 -0.2016 0.0712  86   LEU A C   
437  O O   . LEU A 67  ? 2.4013 2.2271 1.2003 -0.2119 -0.2106 0.0617  86   LEU A O   
438  C CB  . LEU A 67  ? 2.2258 2.2029 1.1319 -0.2263 -0.2146 0.1061  86   LEU A CB  
439  C CG  . LEU A 67  ? 2.2734 2.3082 1.1874 -0.2614 -0.2341 0.1202  86   LEU A CG  
440  C CD1 . LEU A 67  ? 2.2087 2.3231 1.1776 -0.2393 -0.2235 0.1410  86   LEU A CD1 
441  C CD2 . LEU A 67  ? 2.3522 2.4138 1.2225 -0.2970 -0.2547 0.1220  86   LEU A CD2 
442  N N   . TYR A 68  ? 2.2761 2.1164 1.1609 -0.1631 -0.1784 0.0718  87   TYR A N   
443  C CA  . TYR A 68  ? 2.2871 2.1015 1.1625 -0.1316 -0.1600 0.0631  87   TYR A CA  
444  C C   . TYR A 68  ? 2.3998 2.1346 1.2256 -0.1311 -0.1641 0.0395  87   TYR A C   
445  O O   . TYR A 68  ? 2.4217 2.1366 1.2250 -0.1099 -0.1531 0.0302  87   TYR A O   
446  C CB  . TYR A 68  ? 2.2455 2.0741 1.1741 -0.0988 -0.1367 0.0712  87   TYR A CB  
447  C CG  . TYR A 68  ? 2.2276 2.1179 1.1879 -0.0824 -0.1247 0.0907  87   TYR A CG  
448  C CD1 . TYR A 68  ? 2.2504 2.1428 1.2110 -0.0566 -0.1066 0.0926  87   TYR A CD1 
449  C CD2 . TYR A 68  ? 2.2039 2.1498 1.1932 -0.0906 -0.1309 0.1082  87   TYR A CD2 
450  C CE1 . TYR A 68  ? 2.2316 2.1727 1.2173 -0.0409 -0.0959 0.1117  87   TYR A CE1 
451  C CE2 . TYR A 68  ? 2.1873 2.1830 1.2011 -0.0711 -0.1200 0.1262  87   TYR A CE2 
452  C CZ  . TYR A 68  ? 2.2887 2.2780 1.2995 -0.0469 -0.1028 0.1280  87   TYR A CZ  
453  O OH  . TYR A 68  ? 2.2864 2.3178 1.3162 -0.0280 -0.0931 0.1466  87   TYR A OH  
454  N N   . LEU A 69  ? 2.3784 2.0672 1.1859 -0.1521 -0.1792 0.0303  88   LEU A N   
455  C CA  . LEU A 69  ? 2.4401 2.0448 1.1935 -0.1515 -0.1861 0.0077  88   LEU A CA  
456  C C   . LEU A 69  ? 2.5601 2.1343 1.2466 -0.1858 -0.2103 -0.0016 88   LEU A C   
457  O O   . LEU A 69  ? 2.6235 2.1304 1.2523 -0.1799 -0.2147 -0.0214 88   LEU A O   
458  C CB  . LEU A 69  ? 2.4342 1.9984 1.1996 -0.1542 -0.1896 0.0033  88   LEU A CB  
459  C CG  . LEU A 69  ? 2.4413 2.0110 1.2553 -0.1172 -0.1663 0.0046  88   LEU A CG  
460  C CD1 . LEU A 69  ? 2.3987 1.9835 1.2562 -0.1267 -0.1688 0.0145  88   LEU A CD1 
461  C CD2 . LEU A 69  ? 2.5183 2.0215 1.2964 -0.0902 -0.1589 -0.0158 88   LEU A CD2 
462  N N   . LEU A 70  ? 2.5029 2.1283 1.1953 -0.2211 -0.2264 0.0129  89   LEU A N   
463  C CA  . LEU A 70  ? 2.5657 2.1767 1.1992 -0.2610 -0.2514 0.0079  89   LEU A CA  
464  C C   . LEU A 70  ? 2.6227 2.2756 1.2439 -0.2520 -0.2462 0.0105  89   LEU A C   
465  O O   . LEU A 70  ? 2.6864 2.2932 1.2456 -0.2594 -0.2558 -0.0054 89   LEU A O   
466  C CB  . LEU A 70  ? 2.5482 2.2067 1.1984 -0.3040 -0.2707 0.0246  89   LEU A CB  
467  C CG  . LEU A 70  ? 2.6852 2.3070 1.2694 -0.3554 -0.3012 0.0179  89   LEU A CG  
468  C CD1 . LEU A 70  ? 2.7046 2.2815 1.2798 -0.3835 -0.3163 0.0171  89   LEU A CD1 
469  C CD2 . LEU A 70  ? 2.7073 2.4166 1.2976 -0.3862 -0.3138 0.0353  89   LEU A CD2 
470  N N   . MET A 71  ? 2.5100 2.2460 1.1873 -0.2340 -0.2309 0.0302  90   MET A N   
471  C CA  . MET A 71  ? 2.5019 2.2885 1.1774 -0.2217 -0.2237 0.0376  90   MET A CA  
472  C C   . MET A 71  ? 2.5004 2.3014 1.2181 -0.1741 -0.1941 0.0423  90   MET A C   
473  O O   . MET A 71  ? 2.4302 2.2745 1.2049 -0.1601 -0.1822 0.0584  90   MET A O   
474  C CB  . MET A 71  ? 2.4996 2.3768 1.2017 -0.2441 -0.2339 0.0604  90   MET A CB  
475  C CG  . MET A 71  ? 2.5843 2.4633 1.2573 -0.2955 -0.2627 0.0610  90   MET A CG  
476  S SD  . MET A 71  ? 2.5792 2.5755 1.3040 -0.3129 -0.2696 0.0910  90   MET A SD  
477  C CE  . MET A 71  ? 2.5667 2.6222 1.2607 -0.3239 -0.2786 0.0977  90   MET A CE  
478  N N   . SER A 72  ? 2.4939 2.2581 1.1811 -0.1502 -0.1828 0.0284  91   SER A N   
479  C CA  . SER A 72  ? 2.4602 2.2344 1.1787 -0.1084 -0.1553 0.0319  91   SER A CA  
480  C C   . SER A 72  ? 2.4618 2.3120 1.2334 -0.0944 -0.1416 0.0571  91   SER A C   
481  O O   . SER A 72  ? 2.4104 2.2693 1.2256 -0.0694 -0.1224 0.0650  91   SER A O   
482  C CB  . SER A 72  ? 2.5567 2.2975 1.2264 -0.0912 -0.1491 0.0161  91   SER A CB  
483  O OG  . SER A 72  ? 2.6519 2.3941 1.3484 -0.0535 -0.1233 0.0174  91   SER A OG  
484  N N   . LYS A 73  ? 2.4307 2.3339 1.1953 -0.1105 -0.1525 0.0696  92   LYS A N   
485  C CA  . LYS A 73  ? 2.3815 2.3555 1.1879 -0.0968 -0.1428 0.0940  92   LYS A CA  
486  C C   . LYS A 73  ? 2.4088 2.4227 1.2481 -0.1148 -0.1543 0.1074  92   LYS A C   
487  O O   . LYS A 73  ? 2.4241 2.4253 1.2446 -0.1467 -0.1741 0.1002  92   LYS A O   
488  C CB  . LYS A 73  ? 2.4346 2.4490 1.2130 -0.0983 -0.1466 0.1009  92   LYS A CB  
489  C CG  . LYS A 73  ? 2.5750 2.5723 1.3374 -0.0702 -0.1281 0.0964  92   LYS A CG  
490  C CD  . LYS A 73  ? 2.6841 2.7171 1.4123 -0.0742 -0.1341 0.1012  92   LYS A CD  
491  C CE  . LYS A 73  ? 2.7847 2.7964 1.4900 -0.0491 -0.1173 0.0942  92   LYS A CE  
492  N NZ  . LYS A 73  ? 2.8873 2.9296 1.5537 -0.0546 -0.1247 0.0964  92   LYS A NZ  
493  N N   . TRP A 74  ? 2.3304 2.3913 1.2157 -0.0942 -0.1421 0.1273  93   TRP A N   
494  C CA  . TRP A 74  ? 2.3003 2.4054 1.2204 -0.1028 -0.1495 0.1414  93   TRP A CA  
495  C C   . TRP A 74  ? 2.3480 2.5262 1.2619 -0.1190 -0.1649 0.1566  93   TRP A C   
496  O O   . TRP A 74  ? 2.3422 2.5614 1.2541 -0.1023 -0.1591 0.1692  93   TRP A O   
497  C CB  . TRP A 74  ? 2.2408 2.3543 1.2089 -0.0713 -0.1301 0.1539  93   TRP A CB  
498  C CG  . TRP A 74  ? 2.2563 2.3835 1.2298 -0.0409 -0.1123 0.1654  93   TRP A CG  
499  C CD1 . TRP A 74  ? 2.2751 2.4562 1.2619 -0.0244 -0.1089 0.1862  93   TRP A CD1 
500  C CD2 . TRP A 74  ? 2.2669 2.3530 1.2317 -0.0224 -0.0950 0.1582  93   TRP A CD2 
501  N NE1 . TRP A 74  ? 2.2765 2.4468 1.2609 0.0010  -0.0914 0.1927  93   TRP A NE1 
502  C CE2 . TRP A 74  ? 2.3083 2.4242 1.2808 0.0013  -0.0823 0.1763  93   TRP A CE2 
503  C CE3 . TRP A 74  ? 2.3044 2.3338 1.2531 -0.0225 -0.0891 0.1389  93   TRP A CE3 
504  C CZ2 . TRP A 74  ? 2.3092 2.4018 1.2760 0.0207  -0.0641 0.1767  93   TRP A CZ2 
505  C CZ3 . TRP A 74  ? 2.3297 2.3424 1.2747 -0.0004 -0.0704 0.1388  93   TRP A CZ3 
506  C CH2 . TRP A 74  ? 2.3286 2.3735 1.2832 0.0187  -0.0582 0.1579  93   TRP A CH2 
507  N N   . SER A 75  ? 2.3012 2.5001 1.2136 -0.1512 -0.1844 0.1571  94   SER A N   
508  C CA  . SER A 75  ? 2.2956 2.5744 1.2057 -0.1715 -0.2013 0.1725  94   SER A CA  
509  C C   . SER A 75  ? 2.2829 2.6239 1.2419 -0.1473 -0.1932 0.1936  94   SER A C   
510  O O   . SER A 75  ? 2.2650 2.6834 1.2315 -0.1574 -0.2049 0.2092  94   SER A O   
511  C CB  . SER A 75  ? 2.3687 2.6397 1.2532 -0.2200 -0.2259 0.1642  94   SER A CB  
512  O OG  . SER A 75  ? 2.5166 2.7087 1.3536 -0.2382 -0.2326 0.1416  94   SER A OG  
513  N N   . LEU A 76  ? 2.2059 2.5127 1.1955 -0.1143 -0.1730 0.1938  95   LEU A N   
514  C CA  . LEU A 76  ? 2.1580 2.4993 1.1895 -0.0860 -0.1626 0.2096  95   LEU A CA  
515  C C   . LEU A 76  ? 2.1795 2.5737 1.2208 -0.0518 -0.1531 0.2298  95   LEU A C   
516  O O   . LEU A 76  ? 2.1526 2.6127 1.2111 -0.0440 -0.1584 0.2457  95   LEU A O   
517  C CB  . LEU A 76  ? 2.1391 2.4141 1.1937 -0.0650 -0.1447 0.2008  95   LEU A CB  
518  C CG  . LEU A 76  ? 2.1921 2.4278 1.2569 -0.0852 -0.1506 0.1877  95   LEU A CG  
519  C CD1 . LEU A 76  ? 2.2318 2.3988 1.2647 -0.1038 -0.1537 0.1664  95   LEU A CD1 
520  C CD2 . LEU A 76  ? 2.1858 2.3975 1.2874 -0.0593 -0.1349 0.1895  95   LEU A CD2 
521  N N   . GLY A 77  ? 2.1399 2.5047 1.1682 -0.0307 -0.1393 0.2294  96   GLY A N   
522  C CA  . GLY A 77  ? 2.1311 2.5285 1.1632 0.0041  -0.1283 0.2481  96   GLY A CA  
523  C C   . GLY A 77  ? 2.1476 2.5247 1.2096 0.0377  -0.1123 0.2569  96   GLY A C   
524  O O   . GLY A 77  ? 2.1159 2.4729 1.2010 0.0331  -0.1122 0.2507  96   GLY A O   
525  N N   . ARG A 78  ? 2.1160 2.4957 1.1747 0.0707  -0.0996 0.2716  97   ARG A N   
526  C CA  . ARG A 78  ? 2.1045 2.4566 1.1827 0.1035  -0.0847 0.2813  97   ARG A CA  
527  C C   . ARG A 78  ? 2.1377 2.5045 1.2438 0.1103  -0.0883 0.2837  97   ARG A C   
528  O O   . ARG A 78  ? 2.1173 2.4320 1.2408 0.1154  -0.0787 0.2769  97   ARG A O   
529  C CB  . ARG A 78  ? 2.1313 2.4956 1.1942 0.1370  -0.0756 0.3009  97   ARG A CB  
530  C CG  . ARG A 78  ? 2.2570 2.5770 1.3003 0.1387  -0.0632 0.2989  97   ARG A CG  
531  C CD  . ARG A 78  ? 2.3291 2.5798 1.3844 0.1498  -0.0460 0.2969  97   ARG A CD  
532  N NE  . ARG A 78  ? 2.3729 2.6128 1.4242 0.1835  -0.0364 0.3168  97   ARG A NE  
533  C CZ  . ARG A 78  ? 2.4966 2.6784 1.5501 0.1942  -0.0218 0.3205  97   ARG A CZ  
534  N NH1 . ARG A 78  ? 2.2855 2.4237 1.3494 0.1754  -0.0139 0.3062  97   ARG A NH1 
535  N NH2 . ARG A 78  ? 2.3242 2.4909 1.3668 0.2237  -0.0154 0.3391  97   ARG A NH2 
536  N N   . PRO A 79  ? 2.0971 2.5359 1.2084 0.1092  -0.1019 0.2926  98   PRO A N   
537  C CA  . PRO A 79  ? 2.0719 2.5250 1.2091 0.1176  -0.1040 0.2944  98   PRO A CA  
538  C C   . PRO A 79  ? 2.1097 2.5273 1.2641 0.0873  -0.1080 0.2763  98   PRO A C   
539  O O   . PRO A 79  ? 2.0874 2.4641 1.2610 0.0993  -0.0993 0.2722  98   PRO A O   
540  C CB  . PRO A 79  ? 2.0937 2.6430 1.2293 0.1209  -0.1180 0.3090  98   PRO A CB  
541  C CG  . PRO A 79  ? 2.1787 2.7588 1.2878 0.1256  -0.1198 0.3184  98   PRO A CG  
542  C CD  . PRO A 79  ? 2.1344 2.6506 1.2287 0.1015  -0.1155 0.3026  98   PRO A CD  
543  N N   . LEU A 80  ? 2.0810 2.5102 1.2254 0.0481  -0.1216 0.2656  99   LEU A N   
544  C CA  . LEU A 80  ? 2.0688 2.4616 1.2221 0.0173  -0.1275 0.2488  99   LEU A CA  
545  C C   . LEU A 80  ? 2.1190 2.4270 1.2729 0.0195  -0.1138 0.2338  99   LEU A C   
546  O O   . LEU A 80  ? 2.1004 2.3726 1.2726 0.0141  -0.1114 0.2243  99   LEU A O   
547  C CB  . LEU A 80  ? 2.0881 2.5046 1.2196 -0.0251 -0.1464 0.2417  99   LEU A CB  
548  C CG  . LEU A 80  ? 2.1418 2.6440 1.2761 -0.0432 -0.1642 0.2535  99   LEU A CG  
549  C CD1 . LEU A 80  ? 2.1766 2.6956 1.2792 -0.0850 -0.1822 0.2480  99   LEU A CD1 
550  C CD2 . LEU A 80  ? 2.1413 2.6497 1.3007 -0.0539 -0.1691 0.2518  99   LEU A CD2 
551  N N   . CYS A 81  ? 2.0897 2.3711 1.2232 0.0266  -0.1052 0.2322  100  CYS A N   
552  C CA  . CYS A 81  ? 2.0897 2.3016 1.2218 0.0291  -0.0917 0.2196  100  CYS A CA  
553  C C   . CYS A 81  ? 2.1198 2.2988 1.2741 0.0561  -0.0750 0.2249  100  CYS A C   
554  O O   . CYS A 81  ? 2.1102 2.2412 1.2760 0.0518  -0.0677 0.2132  100  CYS A O   
555  C CB  . CYS A 81  ? 2.1244 2.3234 1.2258 0.0256  -0.0887 0.2157  100  CYS A CB  
556  S SG  . CYS A 81  ? 2.1903 2.3228 1.2763 0.0064  -0.0863 0.1913  100  CYS A SG  
557  N N   . LEU A 82  ? 2.0678 2.2709 1.2259 0.0835  -0.0698 0.2423  101  LEU A N   
558  C CA  . LEU A 82  ? 2.0549 2.2209 1.2285 0.1073  -0.0560 0.2478  101  LEU A CA  
559  C C   . LEU A 82  ? 2.0582 2.2213 1.2583 0.1058  -0.0598 0.2429  101  LEU A C   
560  O O   . LEU A 82  ? 2.0441 2.1619 1.2587 0.1122  -0.0500 0.2387  101  LEU A O   
561  C CB  . LEU A 82  ? 2.0754 2.2577 1.2372 0.1390  -0.0504 0.2677  101  LEU A CB  
562  C CG  . LEU A 82  ? 2.1666 2.3291 1.3055 0.1472  -0.0402 0.2748  101  LEU A CG  
563  C CD1 . LEU A 82  ? 2.1940 2.3920 1.3147 0.1744  -0.0412 0.2949  101  LEU A CD1 
564  C CD2 . LEU A 82  ? 2.2039 2.3028 1.3483 0.1528  -0.0244 0.2736  101  LEU A CD2 
565  N N   . PHE A 83  ? 1.9863 2.2009 1.1920 0.0956  -0.0743 0.2439  102  PHE A N   
566  C CA  . PHE A 83  ? 1.9497 2.1713 1.1790 0.0925  -0.0793 0.2400  102  PHE A CA  
567  C C   . PHE A 83  ? 1.9616 2.1446 1.2006 0.0647  -0.0816 0.2220  102  PHE A C   
568  O O   . PHE A 83  ? 1.9324 2.0918 1.1919 0.0671  -0.0784 0.2167  102  PHE A O   
569  C CB  . PHE A 83  ? 1.9652 2.2629 1.1963 0.0905  -0.0936 0.2496  102  PHE A CB  
570  C CG  . PHE A 83  ? 1.9650 2.2797 1.2170 0.1082  -0.0938 0.2541  102  PHE A CG  
571  C CD1 . PHE A 83  ? 2.0120 2.3197 1.2630 0.1470  -0.0846 0.2647  102  PHE A CD1 
572  C CD2 . PHE A 83  ? 1.9698 2.3052 1.2384 0.0868  -0.1038 0.2478  102  PHE A CD2 
573  C CE1 . PHE A 83  ? 2.0106 2.3315 1.2765 0.1659  -0.0851 0.2674  102  PHE A CE1 
574  C CE2 . PHE A 83  ? 1.9886 2.3431 1.2753 0.1046  -0.1038 0.2518  102  PHE A CE2 
575  C CZ  . PHE A 83  ? 1.9731 2.3206 1.2581 0.1450  -0.0943 0.2608  102  PHE A CZ  
576  N N   . TRP A 84  ? 1.9202 2.0935 1.1411 0.0404  -0.0870 0.2124  103  TRP A N   
577  C CA  . TRP A 84  ? 1.9099 2.0395 1.1316 0.0176  -0.0891 0.1948  103  TRP A CA  
578  C C   . TRP A 84  ? 1.9396 2.0130 1.1707 0.0313  -0.0722 0.1884  103  TRP A C   
579  O O   . TRP A 84  ? 1.9170 1.9579 1.1618 0.0238  -0.0706 0.1772  103  TRP A O   
580  C CB  . TRP A 84  ? 1.9203 2.0482 1.1115 -0.0071 -0.0992 0.1863  103  TRP A CB  
581  C CG  . TRP A 84  ? 1.9426 2.0208 1.1269 -0.0272 -0.1026 0.1679  103  TRP A CG  
582  C CD1 . TRP A 84  ? 1.9742 2.0493 1.1596 -0.0508 -0.1161 0.1611  103  TRP A CD1 
583  C CD2 . TRP A 84  ? 1.9521 1.9768 1.1252 -0.0231 -0.0922 0.1550  103  TRP A CD2 
584  N NE1 . TRP A 84  ? 1.9845 2.0024 1.1565 -0.0605 -0.1155 0.1441  103  TRP A NE1 
585  C CE2 . TRP A 84  ? 2.0120 2.0010 1.1774 -0.0422 -0.1006 0.1398  103  TRP A CE2 
586  C CE3 . TRP A 84  ? 1.9800 1.9859 1.1475 -0.0045 -0.0765 0.1557  103  TRP A CE3 
587  C CZ2 . TRP A 84  ? 2.0208 1.9577 1.1729 -0.0394 -0.0935 0.1246  103  TRP A CZ2 
588  C CZ3 . TRP A 84  ? 2.0120 1.9722 1.1690 -0.0043 -0.0691 0.1413  103  TRP A CZ3 
589  C CH2 . TRP A 84  ? 2.0296 1.9565 1.1788 -0.0196 -0.0775 0.1255  103  TRP A CH2 
590  N N   . LEU A 85  ? 1.9011 1.9665 1.1245 0.0505  -0.0599 0.1968  104  LEU A N   
591  C CA  . LEU A 85  ? 1.8948 1.9154 1.1261 0.0619  -0.0435 0.1948  104  LEU A CA  
592  C C   . LEU A 85  ? 1.8870 1.8950 1.1437 0.0745  -0.0387 0.1988  104  LEU A C   
593  O O   . LEU A 85  ? 1.8755 1.8472 1.1459 0.0742  -0.0296 0.1925  104  LEU A O   
594  C CB  . LEU A 85  ? 1.9231 1.9430 1.1367 0.0773  -0.0332 0.2066  104  LEU A CB  
595  C CG  . LEU A 85  ? 2.0170 2.0367 1.2044 0.0682  -0.0327 0.2012  104  LEU A CG  
596  C CD1 . LEU A 85  ? 2.0469 2.0843 1.2155 0.0840  -0.0272 0.2172  104  LEU A CD1 
597  C CD2 . LEU A 85  ? 2.0560 2.0357 1.2450 0.0631  -0.0221 0.1886  104  LEU A CD2 
598  N N   . SER A 86  ? 1.8039 1.8445 1.0651 0.0866  -0.0451 0.2094  105  SER A N   
599  C CA  . SER A 86  ? 1.7717 1.8023 1.0516 0.1011  -0.0424 0.2127  105  SER A CA  
600  C C   . SER A 86  ? 1.7608 1.7928 1.0613 0.0849  -0.0503 0.2008  105  SER A C   
601  O O   . SER A 86  ? 1.7448 1.7418 1.0614 0.0842  -0.0441 0.1938  105  SER A O   
602  C CB  . SER A 86  ? 1.8191 1.8864 1.0917 0.1246  -0.0463 0.2280  105  SER A CB  
603  O OG  . SER A 86  ? 1.9512 1.9976 1.2069 0.1459  -0.0363 0.2399  105  SER A OG  
604  N N   . MET A 87  ? 1.6895 1.7619 0.9877 0.0692  -0.0643 0.1991  106  MET A N   
605  C CA  . MET A 87  ? 1.6595 1.7376 0.9728 0.0511  -0.0739 0.1902  106  MET A CA  
606  C C   . MET A 87  ? 1.6849 1.7165 1.0031 0.0342  -0.0713 0.1745  106  MET A C   
607  O O   . MET A 87  ? 1.6612 1.6862 0.9951 0.0255  -0.0758 0.1679  106  MET A O   
608  C CB  . MET A 87  ? 1.6896 1.8234 0.9950 0.0342  -0.0902 0.1946  106  MET A CB  
609  C CG  . MET A 87  ? 1.7333 1.9251 1.0405 0.0546  -0.0934 0.2105  106  MET A CG  
610  S SD  . MET A 87  ? 1.7685 1.9572 1.0972 0.0853  -0.0865 0.2152  106  MET A SD  
611  C CE  . MET A 87  ? 1.7491 1.9139 1.0621 0.1198  -0.0730 0.2256  106  MET A CE  
612  N N   . ASP A 88  ? 1.6461 1.6479 0.9502 0.0321  -0.0638 0.1689  107  ASP A N   
613  C CA  . ASP A 88  ? 1.6390 1.5990 0.9451 0.0224  -0.0597 0.1545  107  ASP A CA  
614  C C   . ASP A 88  ? 1.6531 1.5861 0.9810 0.0366  -0.0459 0.1546  107  ASP A C   
615  O O   . ASP A 88  ? 1.6359 1.5494 0.9798 0.0315  -0.0454 0.1457  107  ASP A O   
616  C CB  . ASP A 88  ? 1.6911 1.6362 0.9704 0.0170  -0.0572 0.1487  107  ASP A CB  
617  C CG  . ASP A 88  ? 1.8199 1.7244 1.0984 0.0151  -0.0499 0.1349  107  ASP A CG  
618  O OD1 . ASP A 88  ? 1.8237 1.7143 1.1083 0.0277  -0.0353 0.1367  107  ASP A OD1 
619  O OD2 . ASP A 88  ? 1.8930 1.7804 1.1623 0.0012  -0.0592 0.1230  107  ASP A OD2 
620  N N   . TYR A 89  ? 1.5954 1.5271 0.9217 0.0530  -0.0357 0.1656  108  TYR A N   
621  C CA  . TYR A 89  ? 1.5786 1.4829 0.9200 0.0630  -0.0236 0.1679  108  TYR A CA  
622  C C   . TYR A 89  ? 1.5961 1.5020 0.9554 0.0710  -0.0267 0.1708  108  TYR A C   
623  O O   . TYR A 89  ? 1.5786 1.4605 0.9546 0.0699  -0.0214 0.1659  108  TYR A O   
624  C CB  . TYR A 89  ? 1.6111 1.5059 0.9381 0.0744  -0.0124 0.1792  108  TYR A CB  
625  C CG  . TYR A 89  ? 1.6374 1.5195 0.9550 0.0676  -0.0038 0.1740  108  TYR A CG  
626  C CD1 . TYR A 89  ? 1.6590 1.5187 0.9904 0.0637  0.0062  0.1684  108  TYR A CD1 
627  C CD2 . TYR A 89  ? 1.6594 1.5561 0.9534 0.0657  -0.0057 0.1745  108  TYR A CD2 
628  C CE1 . TYR A 89  ? 1.6805 1.5357 1.0029 0.0606  0.0149  0.1642  108  TYR A CE1 
629  C CE2 . TYR A 89  ? 1.6826 1.5691 0.9653 0.0625  0.0025  0.1690  108  TYR A CE2 
630  C CZ  . TYR A 89  ? 1.7597 1.6270 1.0570 0.0612  0.0133  0.1640  108  TYR A CZ  
631  O OH  . TYR A 89  ? 1.7605 1.6246 1.0464 0.0610  0.0222  0.1591  108  TYR A OH  
632  N N   . VAL A 90  ? 1.5418 1.4792 0.8968 0.0795  -0.0353 0.1785  109  VAL A N   
633  C CA  . VAL A 90  ? 1.5239 1.4681 0.8917 0.0910  -0.0388 0.1812  109  VAL A CA  
634  C C   . VAL A 90  ? 1.5240 1.4735 0.9114 0.0760  -0.0464 0.1701  109  VAL A C   
635  O O   . VAL A 90  ? 1.5079 1.4370 0.9111 0.0792  -0.0434 0.1659  109  VAL A O   
636  C CB  . VAL A 90  ? 1.5858 1.5684 0.9411 0.1099  -0.0445 0.1941  109  VAL A CB  
637  C CG1 . VAL A 90  ? 1.5745 1.5653 0.9406 0.1251  -0.0479 0.1956  109  VAL A CG1 
638  C CG2 . VAL A 90  ? 1.6137 1.5829 0.9477 0.1278  -0.0364 0.2059  109  VAL A CG2 
639  N N   . ALA A 91  ? 1.4550 1.4284 0.8387 0.0582  -0.0568 0.1657  110  ALA A N   
640  C CA  . ALA A 91  ? 1.4250 1.4015 0.8219 0.0418  -0.0656 0.1568  110  ALA A CA  
641  C C   . ALA A 91  ? 1.4430 1.3785 0.8515 0.0347  -0.0595 0.1448  110  ALA A C   
642  O O   . ALA A 91  ? 1.4225 1.3538 0.8482 0.0317  -0.0623 0.1399  110  ALA A O   
643  C CB  . ALA A 91  ? 1.4400 1.4425 0.8225 0.0213  -0.0786 0.1560  110  ALA A CB  
644  N N   . SER A 92  ? 1.3898 1.2999 0.7886 0.0331  -0.0512 0.1406  111  SER A N   
645  C CA  . SER A 92  ? 1.3729 1.2515 0.7818 0.0295  -0.0442 0.1302  111  SER A CA  
646  C C   . SER A 92  ? 1.3963 1.2605 0.8252 0.0396  -0.0346 0.1324  111  SER A C   
647  O O   . SER A 92  ? 1.3876 1.2387 0.8330 0.0357  -0.0334 0.1247  111  SER A O   
648  C CB  . SER A 92  ? 1.4251 1.2886 0.8164 0.0278  -0.0376 0.1261  111  SER A CB  
649  O OG  . SER A 92  ? 1.5154 1.3774 0.8871 0.0152  -0.0479 0.1186  111  SER A OG  
650  N N   . THR A 93  ? 1.3355 1.2003 0.7599 0.0521  -0.0291 0.1429  112  THR A N   
651  C CA  . THR A 93  ? 1.3215 1.1661 0.7572 0.0599  -0.0220 0.1459  112  THR A CA  
652  C C   . THR A 93  ? 1.3409 1.1948 0.7901 0.0633  -0.0302 0.1437  112  THR A C   
653  O O   . THR A 93  ? 1.3290 1.1666 0.7938 0.0613  -0.0281 0.1386  112  THR A O   
654  C CB  . THR A 93  ? 1.4003 1.2355 0.8186 0.0726  -0.0155 0.1584  112  THR A CB  
655  O OG1 . THR A 93  ? 1.4037 1.2342 0.8107 0.0678  -0.0078 0.1603  112  THR A OG1 
656  C CG2 . THR A 93  ? 1.3724 1.1772 0.7941 0.0785  -0.0098 0.1621  112  THR A CG2 
657  N N   . ALA A 94  ? 1.2800 1.1652 0.7229 0.0674  -0.0399 0.1477  113  ALA A N   
658  C CA  . ALA A 94  ? 1.2541 1.1587 0.7079 0.0716  -0.0482 0.1469  113  ALA A CA  
659  C C   . ALA A 94  ? 1.2640 1.1654 0.7355 0.0558  -0.0527 0.1362  113  ALA A C   
660  O O   . ALA A 94  ? 1.2417 1.1422 0.7271 0.0590  -0.0548 0.1332  113  ALA A O   
661  C CB  . ALA A 94  ? 1.2630 1.2124 0.7065 0.0755  -0.0576 0.1547  113  ALA A CB  
662  N N   . SER A 95  ? 1.2158 1.1119 0.6835 0.0406  -0.0542 0.1303  114  SER A N   
663  C CA  . SER A 95  ? 1.1998 1.0862 0.6784 0.0277  -0.0584 0.1203  114  SER A CA  
664  C C   . SER A 95  ? 1.2285 1.0898 0.7245 0.0309  -0.0496 0.1144  114  SER A C   
665  O O   . SER A 95  ? 1.2092 1.0717 0.7209 0.0294  -0.0533 0.1104  114  SER A O   
666  C CB  . SER A 95  ? 1.2682 1.1469 0.7299 0.0149  -0.0621 0.1153  114  SER A CB  
667  O OG  . SER A 95  ? 1.4166 1.3204 0.8645 0.0045  -0.0744 0.1195  114  SER A OG  
668  N N   . ILE A 96  ? 1.1867 1.0299 0.6801 0.0346  -0.0383 0.1152  115  ILE A N   
669  C CA  . ILE A 96  ? 1.1781 1.0042 0.6881 0.0345  -0.0302 0.1115  115  ILE A CA  
670  C C   . ILE A 96  ? 1.2210 1.0427 0.7390 0.0412  -0.0309 0.1149  115  ILE A C   
671  O O   . ILE A 96  ? 1.2074 1.0221 0.7417 0.0380  -0.0306 0.1097  115  ILE A O   
672  C CB  . ILE A 96  ? 1.2307 1.0446 0.7361 0.0338  -0.0179 0.1132  115  ILE A CB  
673  C CG1 . ILE A 96  ? 1.2266 1.0338 0.7519 0.0289  -0.0115 0.1082  115  ILE A CG1 
674  C CG2 . ILE A 96  ? 1.2595 1.0663 0.7503 0.0403  -0.0119 0.1244  115  ILE A CG2 
675  C CD1 . ILE A 96  ? 1.3336 1.1428 0.8579 0.0269  -0.0016 0.1065  115  ILE A CD1 
676  N N   . PHE A 97  ? 1.1839 1.0100 0.6878 0.0521  -0.0326 0.1232  116  PHE A N   
677  C CA  . PHE A 97  ? 1.1870 1.0037 0.6906 0.0632  -0.0339 0.1258  116  PHE A CA  
678  C C   . PHE A 97  ? 1.1923 1.0278 0.7083 0.0648  -0.0432 0.1209  116  PHE A C   
679  O O   . PHE A 97  ? 1.1801 1.0012 0.7040 0.0672  -0.0432 0.1170  116  PHE A O   
680  C CB  . PHE A 97  ? 1.2403 1.0510 0.7207 0.0793  -0.0318 0.1365  116  PHE A CB  
681  C CG  . PHE A 97  ? 1.2917 1.0701 0.7600 0.0777  -0.0217 0.1422  116  PHE A CG  
682  C CD1 . PHE A 97  ? 1.3339 1.0942 0.8146 0.0627  -0.0150 0.1379  116  PHE A CD1 
683  C CD2 . PHE A 97  ? 1.3494 1.1183 0.7932 0.0912  -0.0190 0.1530  116  PHE A CD2 
684  C CE1 . PHE A 97  ? 1.3734 1.1088 0.8426 0.0579  -0.0059 0.1450  116  PHE A CE1 
685  C CE2 . PHE A 97  ? 1.4135 1.1508 0.8439 0.0877  -0.0100 0.1600  116  PHE A CE2 
686  C CZ  . PHE A 97  ? 1.3891 1.1106 0.8324 0.0695  -0.0035 0.1563  116  PHE A CZ  
687  N N   . SER A 98  ? 1.1215 0.9883 0.6383 0.0603  -0.0515 0.1210  117  SER A N   
688  C CA  . SER A 98  ? 1.0902 0.9805 0.6185 0.0580  -0.0609 0.1179  117  SER A CA  
689  C C   . SER A 98  ? 1.1199 0.9948 0.6668 0.0470  -0.0603 0.1083  117  SER A C   
690  O O   . SER A 98  ? 1.1112 0.9888 0.6689 0.0503  -0.0634 0.1050  117  SER A O   
691  C CB  . SER A 98  ? 1.1194 1.0429 0.6416 0.0484  -0.0700 0.1214  117  SER A CB  
692  O OG  . SER A 98  ? 1.2230 1.1764 0.7323 0.0602  -0.0731 0.1311  117  SER A OG  
693  N N   . VAL A 99  ? 1.0637 0.9237 0.6126 0.0365  -0.0560 0.1039  118  VAL A N   
694  C CA  . VAL A 99  ? 1.0452 0.8938 0.6103 0.0290  -0.0546 0.0956  118  VAL A CA  
695  C C   . VAL A 99  ? 1.0847 0.9173 0.6611 0.0324  -0.0480 0.0937  118  VAL A C   
696  O O   . VAL A 99  ? 1.0640 0.8987 0.6545 0.0309  -0.0515 0.0888  118  VAL A O   
697  C CB  . VAL A 99  ? 1.0982 0.9377 0.6582 0.0219  -0.0515 0.0915  118  VAL A CB  
698  C CG1 . VAL A 99  ? 1.0884 0.9200 0.6646 0.0191  -0.0487 0.0838  118  VAL A CG1 
699  C CG2 . VAL A 99  ? 1.0989 0.9468 0.6441 0.0148  -0.0613 0.0918  118  VAL A CG2 
700  N N   . PHE A 100 ? 1.0522 0.8680 0.6193 0.0355  -0.0397 0.0984  119  PHE A N   
701  C CA  . PHE A 100 ? 1.0607 0.8555 0.6317 0.0344  -0.0345 0.0982  119  PHE A CA  
702  C C   . PHE A 100 ? 1.1378 0.9261 0.7047 0.0438  -0.0403 0.0977  119  PHE A C   
703  O O   . PHE A 100 ? 1.1378 0.9120 0.7121 0.0396  -0.0403 0.0933  119  PHE A O   
704  C CB  . PHE A 100 ? 1.1036 0.8792 0.6595 0.0341  -0.0256 0.1058  119  PHE A CB  
705  C CG  . PHE A 100 ? 1.1338 0.8866 0.6927 0.0248  -0.0201 0.1063  119  PHE A CG  
706  C CD1 . PHE A 100 ? 1.1614 0.9234 0.7379 0.0112  -0.0148 0.1030  119  PHE A CD1 
707  C CD2 . PHE A 100 ? 1.1852 0.9072 0.7261 0.0294  -0.0207 0.1106  119  PHE A CD2 
708  C CE1 . PHE A 100 ? 1.1879 0.9347 0.7670 -0.0019 -0.0105 0.1050  119  PHE A CE1 
709  C CE2 . PHE A 100 ? 1.2416 0.9378 0.7805 0.0158  -0.0171 0.1118  119  PHE A CE2 
710  C CZ  . PHE A 100 ? 1.2033 0.9151 0.7629 -0.0019 -0.0122 0.1095  119  PHE A CZ  
711  N N   . ILE A 101 ? 1.1146 0.9153 0.6683 0.0573  -0.0454 0.1023  120  ILE A N   
712  C CA  . ILE A 101 ? 1.1289 0.9284 0.6755 0.0716  -0.0508 0.1017  120  ILE A CA  
713  C C   . ILE A 101 ? 1.1631 0.9869 0.7282 0.0682  -0.0585 0.0949  120  ILE A C   
714  O O   . ILE A 101 ? 1.1618 0.9777 0.7268 0.0750  -0.0615 0.0905  120  ILE A O   
715  C CB  . ILE A 101 ? 1.1895 0.9959 0.7127 0.0919  -0.0521 0.1103  120  ILE A CB  
716  C CG1 . ILE A 101 ? 1.2276 1.0118 0.7328 0.1118  -0.0541 0.1097  120  ILE A CG1 
717  C CG2 . ILE A 101 ? 1.1747 1.0281 0.7010 0.0940  -0.0586 0.1143  120  ILE A CG2 
718  C CD1 . ILE A 101 ? 1.3819 1.1119 0.8673 0.1123  -0.0483 0.1111  120  ILE A CD1 
719  N N   . LEU A 102 ? 1.1020 0.9504 0.6797 0.0569  -0.0618 0.0938  121  LEU A N   
720  C CA  . LEU A 102 ? 1.0773 0.9465 0.6708 0.0505  -0.0692 0.0890  121  LEU A CA  
721  C C   . LEU A 102 ? 1.1314 0.9840 0.7412 0.0424  -0.0668 0.0810  121  LEU A C   
722  O O   . LEU A 102 ? 1.1191 0.9784 0.7375 0.0442  -0.0716 0.0767  121  LEU A O   
723  C CB  . LEU A 102 ? 1.0625 0.9509 0.6569 0.0391  -0.0741 0.0911  121  LEU A CB  
724  C CG  . LEU A 102 ? 1.0972 0.9967 0.7045 0.0288  -0.0814 0.0869  121  LEU A CG  
725  C CD1 . LEU A 102 ? 1.0868 1.0174 0.6951 0.0320  -0.0902 0.0905  121  LEU A CD1 
726  C CD2 . LEU A 102 ? 1.1220 1.0179 0.7226 0.0164  -0.0841 0.0871  121  LEU A CD2 
727  N N   . CYS A 103 ? 1.0995 0.9356 0.7134 0.0338  -0.0594 0.0796  122  CYS A N   
728  C CA  . CYS A 103 ? 1.0942 0.9227 0.7244 0.0251  -0.0564 0.0735  122  CYS A CA  
729  C C   . CYS A 103 ? 1.1775 0.9874 0.8052 0.0264  -0.0559 0.0713  122  CYS A C   
730  O O   . CYS A 103 ? 1.1711 0.9843 0.8125 0.0210  -0.0588 0.0653  122  CYS A O   
731  C CB  . CYS A 103 ? 1.0976 0.9212 0.7308 0.0177  -0.0480 0.0742  122  CYS A CB  
732  S SG  . CYS A 103 ? 1.1432 0.9677 0.7965 0.0067  -0.0432 0.0693  122  CYS A SG  
733  N N   . ILE A 104 ? 1.1661 0.9533 0.7732 0.0336  -0.0532 0.0760  123  ILE A N   
734  C CA  . ILE A 104 ? 1.1934 0.9509 0.7884 0.0356  -0.0541 0.0736  123  ILE A CA  
735  C C   . ILE A 104 ? 1.2458 1.0128 0.8410 0.0467  -0.0627 0.0677  123  ILE A C   
736  O O   . ILE A 104 ? 1.2453 0.9979 0.8420 0.0421  -0.0656 0.0611  123  ILE A O   
737  C CB  . ILE A 104 ? 1.2679 0.9909 0.8346 0.0423  -0.0496 0.0807  123  ILE A CB  
738  C CG1 . ILE A 104 ? 1.2794 0.9912 0.8486 0.0253  -0.0408 0.0855  123  ILE A CG1 
739  C CG2 . ILE A 104 ? 1.3187 1.0032 0.8615 0.0510  -0.0536 0.0777  123  ILE A CG2 
740  C CD1 . ILE A 104 ? 1.4311 1.1010 0.9715 0.0254  -0.0364 0.0933  123  ILE A CD1 
741  N N   . ASP A 105 ? 1.1977 0.9936 0.7921 0.0592  -0.0672 0.0705  124  ASP A N   
742  C CA  . ASP A 105 ? 1.1921 1.0083 0.7880 0.0702  -0.0749 0.0668  124  ASP A CA  
743  C C   . ASP A 105 ? 1.2291 1.0618 0.8494 0.0569  -0.0785 0.0604  124  ASP A C   
744  O O   . ASP A 105 ? 1.2408 1.0644 0.8621 0.0576  -0.0817 0.0535  124  ASP A O   
745  C CB  . ASP A 105 ? 1.2030 1.0555 0.7942 0.0818  -0.0786 0.0739  124  ASP A CB  
746  C CG  . ASP A 105 ? 1.3178 1.2054 0.9173 0.0872  -0.0865 0.0721  124  ASP A CG  
747  O OD1 . ASP A 105 ? 1.3425 1.2301 0.9287 0.1054  -0.0890 0.0698  124  ASP A OD1 
748  O OD2 . ASP A 105 ? 1.3604 1.2731 0.9770 0.0737  -0.0902 0.0729  124  ASP A OD2 
749  N N   . ARG A 106 ? 1.1607 1.0137 0.7969 0.0460  -0.0786 0.0623  125  ARG A N   
750  C CA  . ARG A 106 ? 1.1432 1.0106 0.7998 0.0362  -0.0822 0.0572  125  ARG A CA  
751  C C   . ARG A 106 ? 1.2257 1.0761 0.8909 0.0284  -0.0801 0.0502  125  ARG A C   
752  O O   . ARG A 106 ? 1.2186 1.0808 0.8964 0.0254  -0.0848 0.0449  125  ARG A O   
753  C CB  . ARG A 106 ? 1.1343 1.0114 0.7994 0.0270  -0.0812 0.0598  125  ARG A CB  
754  C CG  . ARG A 106 ? 1.2720 1.1732 0.9391 0.0256  -0.0895 0.0627  125  ARG A CG  
755  C CD  . ARG A 106 ? 1.4552 1.3624 1.1082 0.0246  -0.0905 0.0700  125  ARG A CD  
756  N NE  . ARG A 106 ? 1.5777 1.5133 1.2254 0.0264  -0.0988 0.0756  125  ARG A NE  
757  C CZ  . ARG A 106 ? 1.7284 1.6781 1.3700 0.0162  -0.1055 0.0813  125  ARG A CZ  
758  N NH1 . ARG A 106 ? 1.5499 1.4808 1.1868 0.0065  -0.1051 0.0805  125  ARG A NH1 
759  N NH2 . ARG A 106 ? 1.5187 1.5013 1.1563 0.0155  -0.1130 0.0881  125  ARG A NH2 
760  N N   . TYR A 107 ? 1.2173 1.0421 0.8746 0.0233  -0.0734 0.0512  126  TYR A N   
761  C CA  . TYR A 107 ? 1.2396 1.0496 0.9028 0.0105  -0.0714 0.0466  126  TYR A CA  
762  C C   . TYR A 107 ? 1.3258 1.1166 0.9757 0.0150  -0.0773 0.0405  126  TYR A C   
763  O O   . TYR A 107 ? 1.3172 1.1138 0.9783 0.0067  -0.0812 0.0340  126  TYR A O   
764  C CB  . TYR A 107 ? 1.2844 1.0727 0.9385 0.0019  -0.0629 0.0519  126  TYR A CB  
765  C CG  . TYR A 107 ? 1.3417 1.1159 0.9987 -0.0159 -0.0614 0.0494  126  TYR A CG  
766  C CD1 . TYR A 107 ? 1.3541 1.1554 1.0354 -0.0296 -0.0588 0.0483  126  TYR A CD1 
767  C CD2 . TYR A 107 ? 1.3979 1.1315 1.0304 -0.0194 -0.0632 0.0486  126  TYR A CD2 
768  C CE1 . TYR A 107 ? 1.3957 1.1924 1.0807 -0.0494 -0.0580 0.0473  126  TYR A CE1 
769  C CE2 . TYR A 107 ? 1.4381 1.1571 1.0701 -0.0411 -0.0634 0.0470  126  TYR A CE2 
770  C CZ  . TYR A 107 ? 1.5402 1.2950 1.2004 -0.0577 -0.0607 0.0469  126  TYR A CZ  
771  O OH  . TYR A 107 ? 1.5977 1.3467 1.2589 -0.0824 -0.0614 0.0467  126  TYR A OH  
772  N N   . ARG A 108 ? 1.3257 1.0935 0.9493 0.0301  -0.0782 0.0422  127  ARG A N   
773  C CA  . ARG A 108 ? 1.3613 1.1050 0.9642 0.0402  -0.0842 0.0355  127  ARG A CA  
774  C C   . ARG A 108 ? 1.3871 1.1645 0.9998 0.0518  -0.0912 0.0310  127  ARG A C   
775  O O   . ARG A 108 ? 1.3978 1.1647 1.0026 0.0549  -0.0968 0.0228  127  ARG A O   
776  C CB  . ARG A 108 ? 1.4222 1.1270 0.9888 0.0571  -0.0828 0.0388  127  ARG A CB  
777  C CG  . ARG A 108 ? 1.5340 1.2608 1.0947 0.0763  -0.0807 0.0472  127  ARG A CG  
778  C CD  . ARG A 108 ? 1.6880 1.4029 1.2184 0.1051  -0.0846 0.0462  127  ARG A CD  
779  N NE  . ARG A 108 ? 1.7995 1.5422 1.3368 0.1147  -0.0914 0.0393  127  ARG A NE  
780  C CZ  . ARG A 108 ? 1.9165 1.7107 1.4655 0.1261  -0.0940 0.0432  127  ARG A CZ  
781  N NH1 . ARG A 108 ? 1.6487 1.4683 1.2035 0.1331  -0.0999 0.0377  127  ARG A NH1 
782  N NH2 . ARG A 108 ? 1.7698 1.5921 1.3237 0.1286  -0.0913 0.0534  127  ARG A NH2 
783  N N   . SER A 109 ? 1.3087 1.1257 0.9368 0.0558  -0.0915 0.0368  128  SER A N   
784  C CA  . SER A 109 ? 1.2833 1.1382 0.9221 0.0627  -0.0981 0.0359  128  SER A CA  
785  C C   . SER A 109 ? 1.3230 1.1892 0.9840 0.0481  -0.1011 0.0299  128  SER A C   
786  O O   . SER A 109 ? 1.3173 1.1993 0.9811 0.0530  -0.1073 0.0252  128  SER A O   
787  C CB  . SER A 109 ? 1.2989 1.1865 0.9452 0.0633  -0.0981 0.0452  128  SER A CB  
788  O OG  . SER A 109 ? 1.3849 1.3099 1.0395 0.0665  -0.1049 0.0467  128  SER A OG  
789  N N   . VAL A 110 ? 1.2691 1.1307 0.9451 0.0319  -0.0967 0.0306  129  VAL A N   
790  C CA  . VAL A 110 ? 1.2491 1.1248 0.9467 0.0192  -0.0985 0.0263  129  VAL A CA  
791  C C   . VAL A 110 ? 1.3365 1.1916 1.0279 0.0126  -0.1010 0.0177  129  VAL A C   
792  O O   . VAL A 110 ? 1.3273 1.1973 1.0271 0.0113  -0.1071 0.0119  129  VAL A O   
793  C CB  . VAL A 110 ? 1.2752 1.1571 0.9876 0.0085  -0.0922 0.0306  129  VAL A CB  
794  C CG1 . VAL A 110 ? 1.2668 1.1575 0.9969 -0.0046 -0.0913 0.0264  129  VAL A CG1 
795  C CG2 . VAL A 110 ? 1.2486 1.1515 0.9672 0.0128  -0.0940 0.0359  129  VAL A CG2 
796  N N   . GLN A 111 ? 1.3305 1.1488 1.0035 0.0078  -0.0972 0.0174  130  GLN A N   
797  C CA  . GLN A 111 ? 1.3643 1.1520 1.0235 -0.0032 -0.1004 0.0100  130  GLN A CA  
798  C C   . GLN A 111 ? 1.4302 1.2013 1.0673 0.0108  -0.1083 0.0014  130  GLN A C   
799  O O   . GLN A 111 ? 1.4197 1.1914 1.0591 0.0021  -0.1143 -0.0067 130  GLN A O   
800  C CB  . GLN A 111 ? 1.4169 1.1646 1.0572 -0.0139 -0.0948 0.0141  130  GLN A CB  
801  C CG  . GLN A 111 ? 1.6072 1.3739 1.2694 -0.0317 -0.0870 0.0212  130  GLN A CG  
802  C CD  . GLN A 111 ? 1.8314 1.6179 1.5135 -0.0542 -0.0885 0.0181  130  GLN A CD  
803  O OE1 . GLN A 111 ? 1.7363 1.5565 1.4392 -0.0533 -0.0928 0.0137  130  GLN A OE1 
804  N NE2 . GLN A 111 ? 1.7537 1.5243 1.4301 -0.0756 -0.0849 0.0218  130  GLN A NE2 
805  N N   . GLN A 112 ? 1.4099 1.1689 1.0243 0.0338  -0.1084 0.0032  131  GLN A N   
806  C CA  . GLN A 112 ? 1.4390 1.1844 1.0282 0.0533  -0.1150 -0.0048 131  GLN A CA  
807  C C   . GLN A 112 ? 1.4546 1.2459 1.0517 0.0748  -0.1168 -0.0011 131  GLN A C   
808  O O   . GLN A 112 ? 1.4472 1.2429 1.0320 0.0924  -0.1139 0.0056  131  GLN A O   
809  C CB  . GLN A 112 ? 1.5180 1.2030 1.0636 0.0645  -0.1149 -0.0071 131  GLN A CB  
810  C CG  . GLN A 112 ? 1.7791 1.4373 1.2910 0.0844  -0.1226 -0.0185 131  GLN A CG  
811  C CD  . GLN A 112 ? 2.0727 1.6597 1.5342 0.0963  -0.1237 -0.0217 131  GLN A CD  
812  O OE1 . GLN A 112 ? 2.0095 1.5633 1.4599 0.0874  -0.1188 -0.0146 131  GLN A OE1 
813  N NE2 . GLN A 112 ? 2.0334 1.5925 1.4596 0.1182  -0.1305 -0.0325 131  GLN A NE2 
814  N N   . PRO A 113 ? 1.3836 1.2126 1.0005 0.0727  -0.1218 -0.0042 132  PRO A N   
815  C CA  . PRO A 113 ? 1.3551 1.2303 0.9782 0.0893  -0.1241 0.0012  132  PRO A CA  
816  C C   . PRO A 113 ? 1.4368 1.3041 1.0276 0.1182  -0.1263 -0.0023 132  PRO A C   
817  O O   . PRO A 113 ? 1.4223 1.3218 1.0106 0.1344  -0.1253 0.0059  132  PRO A O   
818  C CB  . PRO A 113 ? 1.3467 1.2555 0.9953 0.0774  -0.1290 -0.0010 132  PRO A CB  
819  C CG  . PRO A 113 ? 1.4237 1.3026 1.0696 0.0640  -0.1314 -0.0118 132  PRO A CG  
820  C CD  . PRO A 113 ? 1.3940 1.2286 1.0277 0.0543  -0.1260 -0.0114 132  PRO A CD  
821  N N   . LEU A 114 ? 1.4348 1.2592 0.9982 0.1251  -0.1299 -0.0145 133  LEU A N   
822  C CA  . LEU A 114 ? 1.4728 1.2795 0.9978 0.1569  -0.1324 -0.0203 133  LEU A CA  
823  C C   . LEU A 114 ? 1.6040 1.3603 1.0963 0.1697  -0.1282 -0.0179 133  LEU A C   
824  O O   . LEU A 114 ? 1.6554 1.3471 1.1147 0.1698  -0.1303 -0.0266 133  LEU A O   
825  C CB  . LEU A 114 ? 1.4943 1.2773 1.0012 0.1591  -0.1399 -0.0356 133  LEU A CB  
826  C CG  . LEU A 114 ? 1.4984 1.3366 1.0295 0.1572  -0.1446 -0.0374 133  LEU A CG  
827  C CD1 . LEU A 114 ? 1.5248 1.3343 1.0431 0.1490  -0.1517 -0.0523 133  LEU A CD1 
828  C CD2 . LEU A 114 ? 1.5059 1.3914 1.0286 0.1884  -0.1451 -0.0333 133  LEU A CD2 
829  N N   . ARG A 115 ? 1.5630 1.3486 1.0626 0.1792  -0.1229 -0.0053 134  ARG A N   
830  C CA  . ARG A 115 ? 1.6041 1.3532 1.0749 0.1946  -0.1185 -0.0003 134  ARG A CA  
831  C C   . ARG A 115 ? 1.6893 1.4688 1.1378 0.2347  -0.1192 0.0026  134  ARG A C   
832  O O   . ARG A 115 ? 1.6809 1.4694 1.1197 0.2503  -0.1151 0.0124  134  ARG A O   
833  C CB  . ARG A 115 ? 1.5768 1.3352 1.0705 0.1746  -0.1119 0.0117  134  ARG A CB  
834  C CG  . ARG A 115 ? 1.7106 1.4295 1.2148 0.1419  -0.1096 0.0094  134  ARG A CG  
835  C CD  . ARG A 115 ? 1.9157 1.5621 1.3815 0.1439  -0.1084 0.0071  134  ARG A CD  
836  N NE  . ARG A 115 ? 2.0380 1.6683 1.5166 0.1177  -0.1023 0.0143  134  ARG A NE  
837  C CZ  . ARG A 115 ? 2.2652 1.8349 1.7157 0.1097  -0.1006 0.0153  134  ARG A CZ  
838  N NH1 . ARG A 115 ? 2.1634 1.6740 1.5675 0.1258  -0.1054 0.0086  134  ARG A NH1 
839  N NH2 . ARG A 115 ? 2.0724 1.6382 1.5377 0.0858  -0.0944 0.0231  134  ARG A NH2 
840  N N   . TYR A 116 ? 1.6818 1.4794 1.1205 0.2527  -0.1245 -0.0061 135  TYR A N   
841  C CA  . TYR A 116 ? 1.7079 1.5406 1.1236 0.2939  -0.1259 -0.0055 135  TYR A CA  
842  C C   . TYR A 116 ? 1.8646 1.6332 1.2260 0.3273  -0.1252 -0.0102 135  TYR A C   
843  O O   . TYR A 116 ? 1.8880 1.6720 1.2195 0.3684  -0.1263 -0.0122 135  TYR A O   
844  C CB  . TYR A 116 ? 1.7238 1.5762 1.1376 0.3017  -0.1320 -0.0167 135  TYR A CB  
845  C CG  . TYR A 116 ? 1.8017 1.5745 1.1803 0.3022  -0.1370 -0.0344 135  TYR A CG  
846  C CD1 . TYR A 116 ? 1.8921 1.6219 1.2165 0.3414  -0.1399 -0.0448 135  TYR A CD1 
847  C CD2 . TYR A 116 ? 1.8026 1.5417 1.1988 0.2634  -0.1394 -0.0405 135  TYR A CD2 
848  C CE1 . TYR A 116 ? 1.9591 1.6060 1.2445 0.3387  -0.1459 -0.0613 135  TYR A CE1 
849  C CE2 . TYR A 116 ? 1.8695 1.5354 1.2314 0.2586  -0.1451 -0.0558 135  TYR A CE2 
850  C CZ  . TYR A 116 ? 2.0253 1.6416 1.3304 0.2948  -0.1489 -0.0665 135  TYR A CZ  
851  O OH  . TYR A 116 ? 2.1181 1.6552 1.3837 0.2874  -0.1562 -0.0821 135  TYR A OH  
852  N N   . LEU A 117 ? 1.8888 1.5851 1.2356 0.3097  -0.1234 -0.0115 136  LEU A N   
853  C CA  . LEU A 117 ? 1.9801 1.6001 1.2737 0.3329  -0.1230 -0.0140 136  LEU A CA  
854  C C   . LEU A 117 ? 2.0621 1.7067 1.3561 0.3483  -0.1165 0.0018  136  LEU A C   
855  O O   . LEU A 117 ? 2.1089 1.6908 1.3669 0.3584  -0.1147 0.0040  136  LEU A O   
856  C CB  . LEU A 117 ? 2.0181 1.5534 1.2983 0.2991  -0.1250 -0.0209 136  LEU A CB  
857  C CG  . LEU A 117 ? 2.0330 1.5741 1.3526 0.2558  -0.1198 -0.0113 136  LEU A CG  
858  C CD1 . LEU A 117 ? 2.0819 1.5544 1.3686 0.2541  -0.1166 -0.0055 136  LEU A CD1 
859  C CD2 . LEU A 117 ? 2.0517 1.5842 1.3959 0.2162  -0.1234 -0.0193 136  LEU A CD2 
860  N N   . LYS A 118 ? 1.9894 1.7223 1.3217 0.3475  -0.1137 0.0133  137  LYS A N   
861  C CA  . LYS A 118 ? 1.9924 1.7569 1.3259 0.3605  -0.1086 0.0283  137  LYS A CA  
862  C C   . LYS A 118 ? 2.0344 1.7853 1.3916 0.3255  -0.1037 0.0374  137  LYS A C   
863  O O   . LYS A 118 ? 2.0392 1.7841 1.3827 0.3370  -0.0997 0.0472  137  LYS A O   
864  C CB  . LYS A 118 ? 2.1032 1.8289 1.3807 0.4089  -0.1084 0.0277  137  LYS A CB  
865  C CG  . LYS A 118 ? 2.3025 2.0960 1.5687 0.4532  -0.1098 0.0296  137  LYS A CG  
866  C CD  . LYS A 118 ? 2.3812 2.2270 1.6749 0.4430  -0.1137 0.0229  137  LYS A CD  
867  C CE  . LYS A 118 ? 2.4316 2.3832 1.7396 0.4684  -0.1134 0.0332  137  LYS A CE  
868  N NZ  . LYS A 118 ? 2.4797 2.4694 1.7945 0.4746  -0.1176 0.0248  137  LYS A NZ  
869  N N   . TYR A 119 ? 1.9737 1.7229 1.3653 0.2850  -0.1039 0.0342  138  TYR A N   
870  C CA  . TYR A 119 ? 1.9516 1.6969 1.3697 0.2511  -0.0992 0.0417  138  TYR A CA  
871  C C   . TYR A 119 ? 1.9431 1.7577 1.4056 0.2289  -0.0979 0.0508  138  TYR A C   
872  O O   . TYR A 119 ? 1.9255 1.7418 1.3984 0.2142  -0.0936 0.0592  138  TYR A O   
873  C CB  . TYR A 119 ? 1.9902 1.6777 1.4097 0.2223  -0.1002 0.0318  138  TYR A CB  
874  C CG  . TYR A 119 ? 2.0588 1.6870 1.4623 0.2079  -0.0956 0.0358  138  TYR A CG  
875  C CD1 . TYR A 119 ? 2.1587 1.7091 1.5163 0.2174  -0.0976 0.0304  138  TYR A CD1 
876  C CD2 . TYR A 119 ? 2.0368 1.6844 1.4673 0.1847  -0.0898 0.0453  138  TYR A CD2 
877  C CE1 . TYR A 119 ? 2.2091 1.7054 1.5502 0.2013  -0.0937 0.0360  138  TYR A CE1 
878  C CE2 . TYR A 119 ? 2.0801 1.6787 1.4960 0.1715  -0.0850 0.0502  138  TYR A CE2 
879  C CZ  . TYR A 119 ? 2.2532 1.7776 1.6253 0.1786  -0.0869 0.0464  138  TYR A CZ  
880  O OH  . TYR A 119 ? 2.3028 1.7787 1.6587 0.1628  -0.0826 0.0530  138  TYR A OH  
881  N N   . ARG A 120 ? 1.8710 1.7361 1.3549 0.2261  -0.1024 0.0487  139  ARG A N   
882  C CA  . ARG A 120 ? 1.8174 1.7466 1.3358 0.2074  -0.1035 0.0575  139  ARG A CA  
883  C C   . ARG A 120 ? 1.8519 1.8440 1.3632 0.2331  -0.1059 0.0659  139  ARG A C   
884  O O   . ARG A 120 ? 1.8332 1.8695 1.3522 0.2393  -0.1103 0.0651  139  ARG A O   
885  C CB  . ARG A 120 ? 1.8049 1.7471 1.3498 0.1852  -0.1075 0.0511  139  ARG A CB  
886  C CG  . ARG A 120 ? 1.9142 1.8997 1.4903 0.1593  -0.1089 0.0596  139  ARG A CG  
887  C CD  . ARG A 120 ? 2.0339 1.9889 1.6191 0.1374  -0.1040 0.0618  139  ARG A CD  
888  N NE  . ARG A 120 ? 2.1167 2.0802 1.7284 0.1109  -0.1058 0.0609  139  ARG A NE  
889  C CZ  . ARG A 120 ? 2.2778 2.2722 1.9026 0.0962  -0.1081 0.0691  139  ARG A CZ  
890  N NH1 . ARG A 120 ? 2.0807 2.1060 1.6974 0.1017  -0.1091 0.0791  139  ARG A NH1 
891  N NH2 . ARG A 120 ? 2.1325 2.1257 1.7755 0.0761  -0.1100 0.0674  139  ARG A NH2 
892  N N   . THR A 121 ? 1.8095 1.8085 1.3057 0.2481  -0.1028 0.0750  140  THR A N   
893  C CA  . THR A 121 ? 1.8089 1.8650 1.2911 0.2794  -0.1040 0.0838  140  THR A CA  
894  C C   . THR A 121 ? 1.8410 1.9060 1.3165 0.2819  -0.1005 0.0957  140  THR A C   
895  O O   . THR A 121 ? 1.8419 1.8543 1.3147 0.2674  -0.0964 0.0947  140  THR A O   
896  C CB  . THR A 121 ? 1.9615 2.0091 1.4108 0.3220  -0.1051 0.0765  140  THR A CB  
897  O OG1 . THR A 121 ? 1.9647 2.0866 1.4069 0.3507  -0.1061 0.0874  140  THR A OG1 
898  C CG2 . THR A 121 ? 1.9948 1.9560 1.4053 0.3417  -0.1021 0.0686  140  THR A CG2 
899  N N   . LYS A 122 ? 1.7782 1.9150 1.2514 0.2997  -0.1022 0.1077  141  LYS A N   
900  C CA  . LYS A 122 ? 1.7721 1.9327 1.2385 0.3048  -0.1001 0.1203  141  LYS A CA  
901  C C   . LYS A 122 ? 1.8487 1.9433 1.2800 0.3320  -0.0948 0.1179  141  LYS A C   
902  O O   . LYS A 122 ? 1.8413 1.9141 1.2712 0.3201  -0.0915 0.1234  141  LYS A O   
903  C CB  . LYS A 122 ? 1.7946 2.0515 1.2616 0.3241  -0.1037 0.1332  141  LYS A CB  
904  C CG  . LYS A 122 ? 1.9057 2.2322 1.4047 0.2912  -0.1100 0.1401  141  LYS A CG  
905  C CD  . LYS A 122 ? 1.9964 2.4240 1.4946 0.3104  -0.1138 0.1536  141  LYS A CD  
906  C CE  . LYS A 122 ? 2.0840 2.5446 1.5819 0.3296  -0.1159 0.1491  141  LYS A CE  
907  N NZ  . LYS A 122 ? 2.1629 2.7351 1.6651 0.3416  -0.1198 0.1646  141  LYS A NZ  
908  N N   . THR A 123 ? 1.8354 1.8932 1.2352 0.3679  -0.0944 0.1094  142  THR A N   
909  C CA  . THR A 123 ? 1.8848 1.8686 1.2423 0.3964  -0.0908 0.1068  142  THR A CA  
910  C C   . THR A 123 ? 1.9158 1.8136 1.2716 0.3667  -0.0874 0.1013  142  THR A C   
911  O O   . THR A 123 ? 1.9520 1.7965 1.2773 0.3804  -0.0840 0.1044  142  THR A O   
912  C CB  . THR A 123 ? 2.0560 2.0218 1.3733 0.4451  -0.0926 0.0993  142  THR A CB  
913  O OG1 . THR A 123 ? 2.1431 2.0346 1.4135 0.4734  -0.0900 0.0989  142  THR A OG1 
914  C CG2 . THR A 123 ? 2.0343 1.9657 1.3527 0.4369  -0.0960 0.0834  142  THR A CG2 
915  N N   . ARG A 124 ? 1.8109 1.6995 1.1988 0.3268  -0.0881 0.0945  143  ARG A N   
916  C CA  . ARG A 124 ? 1.8004 1.6233 1.1930 0.2956  -0.0847 0.0902  143  ARG A CA  
917  C C   . ARG A 124 ? 1.7772 1.6325 1.2042 0.2612  -0.0822 0.0977  143  ARG A C   
918  O O   . ARG A 124 ? 1.7769 1.5902 1.2023 0.2436  -0.0775 0.0992  143  ARG A O   
919  C CB  . ARG A 124 ? 1.7915 1.5751 1.1896 0.2796  -0.0874 0.0761  143  ARG A CB  
920  C CG  . ARG A 124 ? 1.9288 1.6294 1.3110 0.2617  -0.0847 0.0710  143  ARG A CG  
921  C CD  . ARG A 124 ? 2.0904 1.7225 1.4190 0.2923  -0.0858 0.0677  143  ARG A CD  
922  N NE  . ARG A 124 ? 2.1916 1.7434 1.5033 0.2692  -0.0852 0.0626  143  ARG A NE  
923  C CZ  . ARG A 124 ? 2.4298 1.9028 1.6903 0.2858  -0.0871 0.0598  143  ARG A CZ  
924  N NH1 . ARG A 124 ? 2.3064 1.7683 1.5261 0.3311  -0.0891 0.0606  143  ARG A NH1 
925  N NH2 . ARG A 124 ? 2.3056 1.7105 1.5527 0.2575  -0.0874 0.0567  143  ARG A NH2 
926  N N   . ALA A 125 ? 1.6721 1.6002 1.1267 0.2514  -0.0857 0.1026  144  ALA A N   
927  C CA  . ALA A 125 ? 1.6230 1.5802 1.1039 0.2205  -0.0852 0.1090  144  ALA A CA  
928  C C   . ALA A 125 ? 1.6763 1.6520 1.1435 0.2310  -0.0828 0.1210  144  ALA A C   
929  O O   . ALA A 125 ? 1.6789 1.6275 1.1474 0.2143  -0.0785 0.1233  144  ALA A O   
930  C CB  . ALA A 125 ? 1.5893 1.6098 1.0967 0.2052  -0.0915 0.1108  144  ALA A CB  
931  N N   . SER A 126 ? 1.6275 1.6516 1.0802 0.2608  -0.0853 0.1289  145  SER A N   
932  C CA  . SER A 126 ? 1.6257 1.6776 1.0640 0.2753  -0.0840 0.1414  145  SER A CA  
933  C C   . SER A 126 ? 1.7042 1.6892 1.1102 0.2952  -0.0778 0.1421  145  SER A C   
934  O O   . SER A 126 ? 1.7056 1.7005 1.1020 0.2992  -0.0756 0.1520  145  SER A O   
935  C CB  . SER A 126 ? 1.6607 1.7915 1.0939 0.3024  -0.0885 0.1502  145  SER A CB  
936  O OG  . SER A 126 ? 1.7129 1.9069 1.1746 0.2785  -0.0948 0.1522  145  SER A OG  
937  N N   . ALA A 127 ? 1.6841 1.5994 1.0715 0.3050  -0.0758 0.1323  146  ALA A N   
938  C CA  . ALA A 127 ? 1.7295 1.5693 1.0824 0.3183  -0.0711 0.1330  146  ALA A CA  
939  C C   . ALA A 127 ? 1.7537 1.5569 1.1213 0.2811  -0.0662 0.1331  146  ALA A C   
940  O O   . ALA A 127 ? 1.7762 1.5454 1.1231 0.2850  -0.0617 0.1402  146  ALA A O   
941  C CB  . ALA A 127 ? 1.7850 1.5615 1.1106 0.3357  -0.0726 0.1220  146  ALA A CB  
942  N N   . THR A 128 ? 1.6633 1.4752 1.0650 0.2469  -0.0669 0.1257  147  THR A N   
943  C CA  . THR A 128 ? 1.6416 1.4287 1.0602 0.2130  -0.0620 0.1249  147  THR A CA  
944  C C   . THR A 128 ? 1.6457 1.4824 1.0844 0.1962  -0.0616 0.1318  147  THR A C   
945  O O   . THR A 128 ? 1.6367 1.4539 1.0811 0.1760  -0.0566 0.1330  147  THR A O   
946  C CB  . THR A 128 ? 1.7279 1.4853 1.1642 0.1893  -0.0622 0.1133  147  THR A CB  
947  O OG1 . THR A 128 ? 1.7234 1.5210 1.1791 0.1897  -0.0683 0.1071  147  THR A OG1 
948  C CG2 . THR A 128 ? 1.7497 1.4356 1.1579 0.1955  -0.0609 0.1086  147  THR A CG2 
949  N N   . ILE A 129 ? 1.5786 1.4784 1.0244 0.2045  -0.0671 0.1367  148  ILE A N   
950  C CA  . ILE A 129 ? 1.5507 1.4951 1.0092 0.1871  -0.0687 0.1434  148  ILE A CA  
951  C C   . ILE A 129 ? 1.6154 1.5770 1.0518 0.2062  -0.0672 0.1554  148  ILE A C   
952  O O   . ILE A 129 ? 1.5980 1.5904 1.0392 0.1922  -0.0685 0.1614  148  ILE A O   
953  C CB  . ILE A 129 ? 1.5606 1.5677 1.0393 0.1769  -0.0771 0.1438  148  ILE A CB  
954  C CG1 . ILE A 129 ? 1.5822 1.6354 1.0494 0.2074  -0.0813 0.1498  148  ILE A CG1 
955  C CG2 . ILE A 129 ? 1.5497 1.5408 1.0498 0.1576  -0.0788 0.1329  148  ILE A CG2 
956  C CD1 . ILE A 129 ? 1.6743 1.8068 1.1531 0.1979  -0.0891 0.1585  148  ILE A CD1 
957  N N   . LEU A 130 ? 1.6063 1.5452 1.0155 0.2390  -0.0652 0.1587  149  LEU A N   
958  C CA  . LEU A 130 ? 1.6304 1.5813 1.0136 0.2647  -0.0637 0.1707  149  LEU A CA  
959  C C   . LEU A 130 ? 1.7100 1.5891 1.0738 0.2617  -0.0560 0.1718  149  LEU A C   
960  O O   . LEU A 130 ? 1.7129 1.5978 1.0697 0.2580  -0.0531 0.1802  149  LEU A O   
961  C CB  . LEU A 130 ? 1.6602 1.6278 1.0199 0.3077  -0.0664 0.1739  149  LEU A CB  
962  C CG  . LEU A 130 ? 1.7443 1.7472 1.0801 0.3386  -0.0665 0.1878  149  LEU A CG  
963  C CD1 . LEU A 130 ? 1.7250 1.8205 1.0704 0.3539  -0.0731 0.1940  149  LEU A CD1 
964  C CD2 . LEU A 130 ? 1.8366 1.7753 1.1294 0.3768  -0.0627 0.1898  149  LEU A CD2 
965  N N   . GLY A 131 ? 1.6818 1.4965 1.0380 0.2592  -0.0534 0.1636  150  GLY A N   
966  C CA  . GLY A 131 ? 1.7102 1.4543 1.0485 0.2503  -0.0468 0.1648  150  GLY A CA  
967  C C   . GLY A 131 ? 1.7181 1.4643 1.0799 0.2146  -0.0420 0.1643  150  GLY A C   
968  O O   . GLY A 131 ? 1.7431 1.4535 1.0900 0.2085  -0.0358 0.1706  150  GLY A O   
969  N N   . ALA A 132 ? 1.6082 1.3958 1.0040 0.1920  -0.0448 0.1574  151  ALA A N   
970  C CA  . ALA A 132 ? 1.5707 1.3650 0.9870 0.1621  -0.0412 0.1554  151  ALA A CA  
971  C C   . ALA A 132 ? 1.5964 1.4224 1.0049 0.1639  -0.0405 0.1648  151  ALA A C   
972  O O   . ALA A 132 ? 1.5954 1.4064 1.0029 0.1495  -0.0345 0.1669  151  ALA A O   
973  C CB  . ALA A 132 ? 1.5369 1.3610 0.9840 0.1428  -0.0460 0.1457  151  ALA A CB  
974  N N   . TRP A 133 ? 1.5312 1.4042 0.9329 0.1819  -0.0466 0.1711  152  TRP A N   
975  C CA  . TRP A 133 ? 1.5249 1.4336 0.9170 0.1843  -0.0475 0.1808  152  TRP A CA  
976  C C   . TRP A 133 ? 1.6265 1.5043 0.9881 0.2051  -0.0415 0.1914  152  TRP A C   
977  O O   . TRP A 133 ? 1.6212 1.5194 0.9738 0.2043  -0.0405 0.1994  152  TRP A O   
978  C CB  . TRP A 133 ? 1.4856 1.4635 0.8824 0.1928  -0.0568 0.1852  152  TRP A CB  
979  C CG  . TRP A 133 ? 1.4540 1.4639 0.8763 0.1650  -0.0635 0.1779  152  TRP A CG  
980  C CD1 . TRP A 133 ? 1.4726 1.4802 0.9129 0.1573  -0.0666 0.1691  152  TRP A CD1 
981  C CD2 . TRP A 133 ? 1.4355 1.4791 0.8635 0.1406  -0.0688 0.1790  152  TRP A CD2 
982  N NE1 . TRP A 133 ? 1.4363 1.4735 0.8929 0.1306  -0.0734 0.1658  152  TRP A NE1 
983  C CE2 . TRP A 133 ? 1.4576 1.5144 0.9053 0.1192  -0.0753 0.1713  152  TRP A CE2 
984  C CE3 . TRP A 133 ? 1.4577 1.5189 0.8728 0.1344  -0.0693 0.1856  152  TRP A CE3 
985  C CZ2 . TRP A 133 ? 1.4362 1.5166 0.8877 0.0915  -0.0828 0.1700  152  TRP A CZ2 
986  C CZ3 . TRP A 133 ? 1.4627 1.5495 0.8825 0.1064  -0.0769 0.1832  152  TRP A CZ3 
987  C CH2 . TRP A 133 ? 1.4491 1.5420 0.8853 0.0850  -0.0838 0.1755  152  TRP A CH2 
988  N N   . PHE A 134 ? 1.6317 1.4564 0.9743 0.2225  -0.0381 0.1917  153  PHE A N   
989  C CA  . PHE A 134 ? 1.6868 1.4668 0.9948 0.2415  -0.0329 0.2021  153  PHE A CA  
990  C C   . PHE A 134 ? 1.7438 1.4855 1.0537 0.2150  -0.0247 0.2029  153  PHE A C   
991  O O   . PHE A 134 ? 1.7566 1.4912 1.0476 0.2197  -0.0205 0.2135  153  PHE A O   
992  C CB  . PHE A 134 ? 1.7582 1.4865 1.0400 0.2668  -0.0338 0.2009  153  PHE A CB  
993  C CG  . PHE A 134 ? 1.8462 1.5107 1.0860 0.2839  -0.0293 0.2112  153  PHE A CG  
994  C CD1 . PHE A 134 ? 1.9204 1.5967 1.1296 0.3183  -0.0303 0.2237  153  PHE A CD1 
995  C CD2 . PHE A 134 ? 1.9087 1.5015 1.1372 0.2653  -0.0246 0.2095  153  PHE A CD2 
996  C CE1 . PHE A 134 ? 1.9987 1.6096 1.1644 0.3351  -0.0267 0.2342  153  PHE A CE1 
997  C CE2 . PHE A 134 ? 2.0110 1.5393 1.1962 0.2781  -0.0215 0.2205  153  PHE A CE2 
998  C CZ  . PHE A 134 ? 2.0210 1.5551 1.1737 0.3137  -0.0225 0.2327  153  PHE A CZ  
999  N N   . LEU A 135 ? 1.6870 1.4101 1.0199 0.1884  -0.0225 0.1924  154  LEU A N   
1000 C CA  . LEU A 135 ? 1.6890 1.3868 1.0276 0.1628  -0.0144 0.1928  154  LEU A CA  
1001 C C   . LEU A 135 ? 1.7011 1.4430 1.0555 0.1476  -0.0130 0.1923  154  LEU A C   
1002 O O   . LEU A 135 ? 1.6964 1.4257 1.0482 0.1339  -0.0055 0.1958  154  LEU A O   
1003 C CB  . LEU A 135 ? 1.6805 1.3518 1.0383 0.1418  -0.0129 0.1823  154  LEU A CB  
1004 C CG  . LEU A 135 ? 1.7881 1.3984 1.1270 0.1329  -0.0072 0.1872  154  LEU A CG  
1005 C CD1 . LEU A 135 ? 1.7797 1.3716 1.1369 0.1146  -0.0084 0.1765  154  LEU A CD1 
1006 C CD2 . LEU A 135 ? 1.8337 1.4404 1.1698 0.1160  0.0019  0.1956  154  LEU A CD2 
1007 N N   . SER A 136 ? 1.6298 1.4223 0.9975 0.1495  -0.0206 0.1883  155  SER A N   
1008 C CA  . SER A 136 ? 1.6066 1.4375 0.9833 0.1351  -0.0223 0.1865  155  SER A CA  
1009 C C   . SER A 136 ? 1.6852 1.5401 1.0398 0.1489  -0.0232 0.1983  155  SER A C   
1010 O O   . SER A 136 ? 1.6801 1.5420 1.0301 0.1378  -0.0200 0.1999  155  SER A O   
1011 C CB  . SER A 136 ? 1.6155 1.4847 1.0130 0.1258  -0.0317 0.1776  155  SER A CB  
1012 O OG  . SER A 136 ? 1.7125 1.5618 1.1308 0.1115  -0.0306 0.1667  155  SER A OG  
1013 N N   . PHE A 137 ? 1.6667 1.5365 1.0061 0.1749  -0.0276 0.2066  156  PHE A N   
1014 C CA  . PHE A 137 ? 1.6866 1.5849 1.0042 0.1922  -0.0291 0.2192  156  PHE A CA  
1015 C C   . PHE A 137 ? 1.7825 1.6381 1.0741 0.2015  -0.0202 0.2297  156  PHE A C   
1016 O O   . PHE A 137 ? 1.7942 1.6712 1.0668 0.2142  -0.0204 0.2407  156  PHE A O   
1017 C CB  . PHE A 137 ? 1.7150 1.6520 1.0249 0.2201  -0.0367 0.2253  156  PHE A CB  
1018 C CG  . PHE A 137 ? 1.7063 1.7167 1.0284 0.2111  -0.0464 0.2257  156  PHE A CG  
1019 C CD1 . PHE A 137 ? 1.7508 1.7959 1.0626 0.2061  -0.0484 0.2331  156  PHE A CD1 
1020 C CD2 . PHE A 137 ? 1.7047 1.7501 1.0463 0.2057  -0.0542 0.2195  156  PHE A CD2 
1021 C CE1 . PHE A 137 ? 1.7401 1.8519 1.0602 0.1928  -0.0589 0.2339  156  PHE A CE1 
1022 C CE2 . PHE A 137 ? 1.7174 1.8308 1.0678 0.1926  -0.0642 0.2217  156  PHE A CE2 
1023 C CZ  . PHE A 137 ? 1.6999 1.8451 1.0390 0.1850  -0.0669 0.2288  156  PHE A CZ  
1024 N N   . LEU A 138 ? 1.7623 1.5601 1.0525 0.1926  -0.0126 0.2274  157  LEU A N   
1025 C CA  . LEU A 138 ? 1.8060 1.5586 1.0716 0.1946  -0.0040 0.2381  157  LEU A CA  
1026 C C   . LEU A 138 ? 1.8625 1.6350 1.1307 0.1770  0.0011  0.2402  157  LEU A C   
1027 O O   . LEU A 138 ? 1.8915 1.6417 1.1373 0.1805  0.0077  0.2518  157  LEU A O   
1028 C CB  . LEU A 138 ? 1.8253 1.5182 1.0916 0.1819  0.0014  0.2347  157  LEU A CB  
1029 C CG  . LEU A 138 ? 1.9223 1.5707 1.1679 0.2027  -0.0020 0.2364  157  LEU A CG  
1030 C CD1 . LEU A 138 ? 1.9316 1.5325 1.1854 0.1815  0.0008  0.2292  157  LEU A CD1 
1031 C CD2 . LEU A 138 ? 2.0149 1.6266 1.2165 0.2283  -0.0003 0.2525  157  LEU A CD2 
1032 N N   . TRP A 139 ? 1.7876 1.5995 1.0795 0.1588  -0.0024 0.2290  158  TRP A N   
1033 C CA  . TRP A 139 ? 1.7772 1.6091 1.0697 0.1430  0.0008  0.2273  158  TRP A CA  
1034 C C   . TRP A 139 ? 1.8440 1.7068 1.1143 0.1561  -0.0019 0.2383  158  TRP A C   
1035 O O   . TRP A 139 ? 1.8475 1.7126 1.1075 0.1486  0.0034  0.2413  158  TRP A O   
1036 C CB  . TRP A 139 ? 1.7217 1.5788 1.0382 0.1232  -0.0045 0.2117  158  TRP A CB  
1037 C CG  . TRP A 139 ? 1.7217 1.5509 1.0564 0.1067  0.0021  0.2021  158  TRP A CG  
1038 C CD1 . TRP A 139 ? 1.7462 1.5583 1.0993 0.1032  0.0010  0.1952  158  TRP A CD1 
1039 C CD2 . TRP A 139 ? 1.7251 1.5430 1.0596 0.0938  0.0118  0.2003  158  TRP A CD2 
1040 N NE1 . TRP A 139 ? 1.7354 1.5292 1.1014 0.0877  0.0088  0.1892  158  TRP A NE1 
1041 C CE2 . TRP A 139 ? 1.7639 1.5626 1.1191 0.0825  0.0158  0.1924  158  TRP A CE2 
1042 C CE3 . TRP A 139 ? 1.7547 1.5810 1.0731 0.0916  0.0174  0.2047  158  TRP A CE3 
1043 C CZ2 . TRP A 139 ? 1.7556 1.5484 1.1171 0.0700  0.0255  0.1893  158  TRP A CZ2 
1044 C CZ3 . TRP A 139 ? 1.7747 1.5919 1.0980 0.0800  0.0275  0.2011  158  TRP A CZ3 
1045 C CH2 . TRP A 139 ? 1.7692 1.5725 1.1145 0.0697  0.0315  0.1937  158  TRP A CH2 
1046 N N   . VAL A 140 ? 1.8061 1.6965 1.0685 0.1769  -0.0100 0.2445  159  VAL A N   
1047 C CA  . VAL A 140 ? 1.8200 1.7488 1.0617 0.1926  -0.0140 0.2564  159  VAL A CA  
1048 C C   . VAL A 140 ? 1.9139 1.8071 1.1262 0.2090  -0.0052 0.2718  159  VAL A C   
1049 O O   . VAL A 140 ? 1.9218 1.8388 1.1171 0.2135  -0.0050 0.2806  159  VAL A O   
1050 C CB  . VAL A 140 ? 1.8610 1.8365 1.1041 0.2121  -0.0247 0.2598  159  VAL A CB  
1051 C CG1 . VAL A 140 ? 1.8697 1.9003 1.0960 0.2232  -0.0305 0.2710  159  VAL A CG1 
1052 C CG2 . VAL A 140 ? 1.8173 1.8199 1.0883 0.1928  -0.0328 0.2460  159  VAL A CG2 
1053 N N   . ILE A 141 ? 1.8940 1.7280 1.0987 0.2146  0.0015  0.2750  160  ILE A N   
1054 C CA  . ILE A 141 ? 1.9407 1.7287 1.1148 0.2253  0.0096  0.2902  160  ILE A CA  
1055 C C   . ILE A 141 ? 2.0076 1.7940 1.1811 0.2029  0.0183  0.2919  160  ILE A C   
1056 O O   . ILE A 141 ? 2.0209 1.8281 1.1748 0.2121  0.0190  0.3024  160  ILE A O   
1057 C CB  . ILE A 141 ? 2.0096 1.7306 1.1709 0.2335  0.0123  0.2930  160  ILE A CB  
1058 C CG1 . ILE A 141 ? 2.0231 1.7476 1.1760 0.2641  0.0038  0.2927  160  ILE A CG1 
1059 C CG2 . ILE A 141 ? 2.0689 1.7335 1.1962 0.2361  0.0204  0.3091  160  ILE A CG2 
1060 C CD1 . ILE A 141 ? 2.1499 1.9078 1.2761 0.3006  -0.0012 0.3062  160  ILE A CD1 
1061 N N   . PRO A 142 ? 1.9535 1.7257 1.1481 0.1756  0.0245  0.2815  161  PRO A N   
1062 C CA  . PRO A 142 ? 1.9574 1.7364 1.1490 0.1591  0.0331  0.2834  161  PRO A CA  
1063 C C   . PRO A 142 ? 1.9998 1.8311 1.1935 0.1552  0.0287  0.2770  161  PRO A C   
1064 O O   . PRO A 142 ? 2.0029 1.8410 1.1900 0.1450  0.0354  0.2779  161  PRO A O   
1065 C CB  . PRO A 142 ? 1.9624 1.7202 1.1773 0.1353  0.0397  0.2732  161  PRO A CB  
1066 C CG  . PRO A 142 ? 2.0198 1.7447 1.2416 0.1396  0.0359  0.2708  161  PRO A CG  
1067 C CD  . PRO A 142 ? 1.9511 1.7023 1.1711 0.1607  0.0247  0.2687  161  PRO A CD  
1068 N N   . ILE A 143 ? 1.9447 1.8137 1.1447 0.1626  0.0169  0.2712  162  ILE A N   
1069 C CA  . ILE A 143 ? 1.9351 1.8521 1.1321 0.1565  0.0099  0.2660  162  ILE A CA  
1070 C C   . ILE A 143 ? 2.0415 1.9771 1.2093 0.1737  0.0100  0.2826  162  ILE A C   
1071 O O   . ILE A 143 ? 2.0442 2.0037 1.2010 0.1657  0.0099  0.2815  162  ILE A O   
1072 C CB  . ILE A 143 ? 1.9401 1.8923 1.1550 0.1518  -0.0034 0.2549  162  ILE A CB  
1073 C CG1 . ILE A 143 ? 1.9146 1.8534 1.1544 0.1295  -0.0038 0.2365  162  ILE A CG1 
1074 C CG2 . ILE A 143 ? 1.9464 1.9531 1.1497 0.1510  -0.0143 0.2565  162  ILE A CG2 
1075 C CD1 . ILE A 143 ? 1.9902 1.9223 1.2281 0.1106  0.0013  0.2256  162  ILE A CD1 
1076 N N   . LEU A 144 ? 2.0393 1.9595 1.1912 0.1988  0.0105  0.2978  163  LEU A N   
1077 C CA  . LEU A 144 ? 2.0769 2.0093 1.1983 0.2207  0.0109  0.3160  163  LEU A CA  
1078 C C   . LEU A 144 ? 2.1786 2.0575 1.2766 0.2259  0.0231  0.3308  163  LEU A C   
1079 O O   . LEU A 144 ? 2.2049 2.0859 1.2742 0.2447  0.0243  0.3475  163  LEU A O   
1080 C CB  . LEU A 144 ? 2.0842 2.0437 1.1976 0.2500  0.0015  0.3243  163  LEU A CB  
1081 C CG  . LEU A 144 ? 2.1517 2.0704 1.2661 0.2677  0.0017  0.3255  163  LEU A CG  
1082 C CD1 . LEU A 144 ? 2.2101 2.0865 1.2875 0.2982  0.0061  0.3446  163  LEU A CD1 
1083 C CD2 . LEU A 144 ? 2.1472 2.1141 1.2768 0.2789  -0.0096 0.3197  163  LEU A CD2 
1084 N N   . GLY A 145 ? 2.1454 1.9801 1.2552 0.2079  0.0314  0.3255  164  GLY A N   
1085 C CA  . GLY A 145 ? 2.1901 1.9730 1.2803 0.2051  0.0423  0.3394  164  GLY A CA  
1086 C C   . GLY A 145 ? 2.2576 2.0477 1.3456 0.1854  0.0523  0.3410  164  GLY A C   
1087 O O   . GLY A 145 ? 2.2293 2.0135 1.3382 0.1626  0.0585  0.3305  164  GLY A O   
1088 N N   . TRP A 146 ? 2.2587 2.0637 1.3199 0.1963  0.0543  0.3551  165  TRP A N   
1089 C CA  . TRP A 146 ? 2.2748 2.0892 1.3268 0.1824  0.0642  0.3599  165  TRP A CA  
1090 C C   . TRP A 146 ? 2.3814 2.1488 1.4039 0.1855  0.0734  0.3833  165  TRP A C   
1091 O O   . TRP A 146 ? 2.3952 2.1654 1.4092 0.1723  0.0834  0.3905  165  TRP A O   
1092 C CB  . TRP A 146 ? 2.2547 2.1226 1.2955 0.1892  0.0594  0.3584  165  TRP A CB  
1093 C CG  . TRP A 146 ? 2.2630 2.1639 1.3009 0.2089  0.0458  0.3576  165  TRP A CG  
1094 C CD1 . TRP A 146 ? 2.2613 2.2066 1.3168 0.2027  0.0351  0.3410  165  TRP A CD1 
1095 C CD2 . TRP A 146 ? 2.2915 2.1857 1.3061 0.2381  0.0413  0.3752  165  TRP A CD2 
1096 N NE1 . TRP A 146 ? 2.2599 2.2348 1.3076 0.2240  0.0244  0.3479  165  TRP A NE1 
1097 C CE2 . TRP A 146 ? 2.3195 2.2651 1.3423 0.2488  0.0283  0.3684  165  TRP A CE2 
1098 C CE3 . TRP A 146 ? 2.3605 2.2082 1.3448 0.2569  0.0464  0.3966  165  TRP A CE3 
1099 C CZ2 . TRP A 146 ? 2.3322 2.2928 1.3368 0.2806  0.0213  0.3821  165  TRP A CZ2 
1100 C CZ3 . TRP A 146 ? 2.4052 2.2582 1.3675 0.2903  0.0390  0.4093  165  TRP A CZ3 
1101 C CH2 . TRP A 146 ? 2.3844 2.2973 1.3583 0.3034  0.0271  0.4020  165  TRP A CH2 
1102 N N   . ASN A 147 ? 2.3667 2.0887 1.3707 0.2028  0.0696  0.3950  166  ASN A N   
1103 C CA  . ASN A 147 ? 2.4254 2.0879 1.3936 0.2073  0.0753  0.4181  166  ASN A CA  
1104 C C   . ASN A 147 ? 2.4961 2.1255 1.4706 0.1752  0.0862  0.4215  166  ASN A C   
1105 O O   . ASN A 147 ? 2.5385 2.1394 1.4846 0.1689  0.0935  0.4417  166  ASN A O   
1106 C CB  . ASN A 147 ? 2.4391 2.0536 1.3875 0.2321  0.0673  0.4238  166  ASN A CB  
1107 C CG  . ASN A 147 ? 2.6191 2.2666 1.5541 0.2684  0.0575  0.4264  166  ASN A CG  
1108 O OD1 . ASN A 147 ? 2.4586 2.1665 1.4199 0.2712  0.0509  0.4114  166  ASN A OD1 
1109 N ND2 . ASN A 147 ? 2.5610 2.1725 1.4525 0.2963  0.0561  0.4468  166  ASN A ND2 
1110 N N   . HIS A 148 ? 2.4171 2.0538 1.4283 0.1544  0.0869  0.4031  167  HIS A N   
1111 C CA  . HIS A 148 ? 2.4193 2.0371 1.4436 0.1228  0.0962  0.4039  167  HIS A CA  
1112 C C   . HIS A 148 ? 2.4555 2.1157 1.4864 0.1051  0.1078  0.4062  167  HIS A C   
1113 O O   . HIS A 148 ? 2.4373 2.1386 1.4622 0.1171  0.1079  0.4047  167  HIS A O   
1114 C CB  . HIS A 148 ? 2.3855 2.0060 1.4473 0.1111  0.0922  0.3826  167  HIS A CB  
1115 C CG  . HIS A 148 ? 2.4527 2.0274 1.5164 0.0868  0.0961  0.3878  167  HIS A CG  
1116 N ND1 . HIS A 148 ? 2.4537 2.0518 1.5436 0.0581  0.1049  0.3827  167  HIS A ND1 
1117 C CD2 . HIS A 148 ? 2.5225 2.0309 1.5623 0.0875  0.0917  0.3976  167  HIS A CD2 
1118 C CE1 . HIS A 148 ? 2.4777 2.0279 1.5616 0.0391  0.1052  0.3902  167  HIS A CE1 
1119 N NE2 . HIS A 148 ? 2.5265 2.0171 1.5784 0.0549  0.0970  0.3988  167  HIS A NE2 
1120 N N   . ARG A 156 ? 2.2288 2.2418 1.2061 0.1056  0.0494  0.2014  175  ARG A N   
1121 C CA  . ARG A 156 ? 2.2224 2.2237 1.1956 0.0939  0.0320  0.1815  175  ARG A CA  
1122 C C   . ARG A 156 ? 2.2928 2.2685 1.2551 0.0936  0.0340  0.1578  175  ARG A C   
1123 O O   . ARG A 156 ? 2.3059 2.2835 1.2480 0.1032  0.0450  0.1535  175  ARG A O   
1124 C CB  . ARG A 156 ? 2.2359 2.2581 1.1787 0.0867  0.0157  0.1804  175  ARG A CB  
1125 C CG  . ARG A 156 ? 2.3109 2.3602 1.2674 0.0871  0.0082  0.2000  175  ARG A CG  
1126 C CD  . ARG A 156 ? 2.4110 2.4934 1.3357 0.0859  -0.0012 0.2060  175  ARG A CD  
1127 N NE  . ARG A 156 ? 2.4782 2.5843 1.4019 0.0725  -0.0213 0.2049  175  ARG A NE  
1128 C CZ  . ARG A 156 ? 2.6474 2.7564 1.5448 0.0533  -0.0381 0.1886  175  ARG A CZ  
1129 N NH1 . ARG A 156 ? 2.5183 2.6009 1.3847 0.0485  -0.0374 0.1700  175  ARG A NH1 
1130 N NH2 . ARG A 156 ? 2.4553 2.5934 1.3543 0.0386  -0.0560 0.1911  175  ARG A NH2 
1131 N N   . ARG A 157 ? 2.2458 2.1984 1.2196 0.0843  0.0234  0.1432  176  ARG A N   
1132 C CA  . ARG A 157 ? 2.2625 2.1845 1.2237 0.0860  0.0228  0.1202  176  ARG A CA  
1133 C C   . ARG A 157 ? 2.3401 2.2366 1.2813 0.0698  0.0011  0.1023  176  ARG A C   
1134 O O   . ARG A 157 ? 2.3306 2.2416 1.2665 0.0552  -0.0136 0.1079  176  ARG A O   
1135 C CB  . ARG A 157 ? 2.2293 2.1434 1.2261 0.0944  0.0373  0.1215  176  ARG A CB  
1136 C CG  . ARG A 157 ? 2.3524 2.2835 1.3485 0.1094  0.0579  0.1286  176  ARG A CG  
1137 C CD  . ARG A 157 ? 2.4484 2.3755 1.4731 0.1163  0.0705  0.1258  176  ARG A CD  
1138 N NE  . ARG A 157 ? 2.5759 2.5260 1.5946 0.1297  0.0893  0.1311  176  ARG A NE  
1139 C CZ  . ARG A 157 ? 2.7495 2.7203 1.7983 0.1303  0.1052  0.1473  176  ARG A CZ  
1140 N NH1 . ARG A 157 ? 2.5600 2.5252 1.6452 0.1195  0.1044  0.1582  176  ARG A NH1 
1141 N NH2 . ARG A 157 ? 2.6075 2.6055 1.6482 0.1405  0.1217  0.1528  176  ARG A NH2 
1142 N N   . GLU A 158 ? 2.3273 2.1872 1.2543 0.0725  -0.0011 0.0816  177  GLU A N   
1143 C CA  . GLU A 158 ? 2.3542 2.1793 1.2544 0.0560  -0.0219 0.0640  177  GLU A CA  
1144 C C   . GLU A 158 ? 2.3982 2.2001 1.3261 0.0494  -0.0273 0.0590  177  GLU A C   
1145 O O   . GLU A 158 ? 2.4215 2.1861 1.3229 0.0371  -0.0432 0.0433  177  GLU A O   
1146 C CB  . GLU A 158 ? 2.4309 2.2210 1.2750 0.0631  -0.0256 0.0422  177  GLU A CB  
1147 C CG  . GLU A 158 ? 2.5924 2.3654 1.3902 0.0405  -0.0486 0.0326  177  GLU A CG  
1148 C CD  . GLU A 158 ? 2.8970 2.6234 1.6321 0.0472  -0.0544 0.0087  177  GLU A CD  
1149 O OE1 . GLU A 158 ? 2.8086 2.5454 1.5248 0.0680  -0.0409 0.0065  177  GLU A OE1 
1150 O OE2 . GLU A 158 ? 2.8809 2.5582 1.5820 0.0317  -0.0729 -0.0077 177  GLU A OE2 
1151 N N   . ASP A 159 ? 2.3232 2.1444 1.3008 0.0558  -0.0153 0.0726  178  ASP A N   
1152 C CA  . ASP A 159 ? 2.3021 2.1060 1.3084 0.0504  -0.0195 0.0690  178  ASP A CA  
1153 C C   . ASP A 159 ? 2.3301 2.1470 1.3525 0.0296  -0.0353 0.0775  178  ASP A C   
1154 O O   . ASP A 159 ? 2.3345 2.1263 1.3476 0.0153  -0.0501 0.0672  178  ASP A O   
1155 C CB  . ASP A 159 ? 2.2960 2.1098 1.3435 0.0660  -0.0006 0.0761  178  ASP A CB  
1156 C CG  . ASP A 159 ? 2.4287 2.2776 1.4973 0.0741  0.0153  0.0959  178  ASP A CG  
1157 O OD1 . ASP A 159 ? 2.4104 2.2744 1.5128 0.0699  0.0172  0.1108  178  ASP A OD1 
1158 O OD2 . ASP A 159 ? 2.5201 2.3788 1.5688 0.0853  0.0259  0.0965  178  ASP A OD2 
1159 N N   . LYS A 160 ? 2.2588 2.1151 1.3021 0.0291  -0.0324 0.0968  179  LYS A N   
1160 C CA  . LYS A 160 ? 2.2295 2.1099 1.2888 0.0143  -0.0457 0.1072  179  LYS A CA  
1161 C C   . LYS A 160 ? 2.2624 2.1857 1.3190 0.0166  -0.0458 0.1250  179  LYS A C   
1162 O O   . LYS A 160 ? 2.2847 2.2141 1.3125 0.0199  -0.0438 0.1245  179  LYS A O   
1163 C CB  . LYS A 160 ? 2.2190 2.0982 1.3215 0.0166  -0.0421 0.1121  179  LYS A CB  
1164 C CG  . LYS A 160 ? 2.3415 2.2297 1.4757 0.0346  -0.0232 0.1247  179  LYS A CG  
1165 C CD  . LYS A 160 ? 2.4197 2.3112 1.5912 0.0338  -0.0241 0.1309  179  LYS A CD  
1166 C CE  . LYS A 160 ? 2.5149 2.4167 1.7105 0.0475  -0.0100 0.1470  179  LYS A CE  
1167 N NZ  . LYS A 160 ? 2.6296 2.5150 1.8336 0.0560  0.0063  0.1447  179  LYS A NZ  
1168 N N   . CYS A 161 ? 2.1745 2.1279 1.2584 0.0166  -0.0488 0.1402  180  CYS A N   
1169 C CA  . CYS A 161 ? 2.1587 2.1544 1.2426 0.0236  -0.0491 0.1587  180  CYS A CA  
1170 C C   . CYS A 161 ? 2.1895 2.1839 1.2786 0.0450  -0.0301 0.1707  180  CYS A C   
1171 O O   . CYS A 161 ? 2.1970 2.2183 1.2738 0.0531  -0.0287 0.1843  180  CYS A O   
1172 C CB  . CYS A 161 ? 2.1311 2.1551 1.2413 0.0224  -0.0568 0.1699  180  CYS A CB  
1173 S SG  . CYS A 161 ? 2.1775 2.2576 1.2847 0.0357  -0.0591 0.1929  180  CYS A SG  
1174 N N   . GLU A 162 ? 2.1183 2.0830 1.2242 0.0527  -0.0160 0.1663  181  GLU A N   
1175 C CA  . GLU A 162 ? 2.1086 2.0668 1.2226 0.0678  0.0028  0.1771  181  GLU A CA  
1176 C C   . GLU A 162 ? 2.1003 2.0598 1.2419 0.0766  0.0079  0.1930  181  GLU A C   
1177 O O   . GLU A 162 ? 2.0832 2.0639 1.2235 0.0825  0.0020  0.2061  181  GLU A O   
1178 C CB  . GLU A 162 ? 2.1593 2.1316 1.2443 0.0746  0.0089  0.1840  181  GLU A CB  
1179 C CG  . GLU A 162 ? 2.3357 2.2920 1.4060 0.0776  0.0200  0.1727  181  GLU A CG  
1180 C CD  . GLU A 162 ? 2.5983 2.5324 1.6552 0.0694  0.0121  0.1489  181  GLU A CD  
1181 O OE1 . GLU A 162 ? 2.4747 2.3893 1.5473 0.0728  0.0199  0.1403  181  GLU A OE1 
1182 O OE2 . GLU A 162 ? 2.5632 2.4983 1.5916 0.0594  -0.0026 0.1392  181  GLU A OE2 
1183 N N   . THR A 163 ? 2.0313 1.9679 1.1954 0.0786  0.0186  0.1918  182  THR A N   
1184 C CA  . THR A 163 ? 2.0048 1.9325 1.1931 0.0843  0.0219  0.2032  182  THR A CA  
1185 C C   . THR A 163 ? 2.0460 1.9693 1.2281 0.0962  0.0324  0.2238  182  THR A C   
1186 O O   . THR A 163 ? 2.0407 1.9453 1.2376 0.1003  0.0365  0.2322  182  THR A O   
1187 C CB  . THR A 163 ? 2.0914 1.9963 1.3059 0.0788  0.0274  0.1935  182  THR A CB  
1188 O OG1 . THR A 163 ? 2.0771 1.9700 1.3108 0.0833  0.0292  0.2036  182  THR A OG1 
1189 C CG2 . THR A 163 ? 2.0838 1.9807 1.2959 0.0787  0.0422  0.1919  182  THR A CG2 
1190 N N   . ASP A 164 ? 2.0026 1.9394 1.1597 0.1012  0.0361  0.2321  183  ASP A N   
1191 C CA  . ASP A 164 ? 2.0149 1.9449 1.1602 0.1127  0.0449  0.2537  183  ASP A CA  
1192 C C   . ASP A 164 ? 2.0565 1.9621 1.2090 0.1079  0.0610  0.2598  183  ASP A C   
1193 O O   . ASP A 164 ? 2.0745 1.9757 1.2102 0.1122  0.0700  0.2762  183  ASP A O   
1194 C CB  . ASP A 164 ? 2.0362 1.9672 1.1816 0.1262  0.0370  0.2661  183  ASP A CB  
1195 C CG  . ASP A 164 ? 2.1538 2.0814 1.2753 0.1426  0.0415  0.2884  183  ASP A CG  
1196 O OD1 . ASP A 164 ? 2.1732 2.0660 1.2937 0.1471  0.0497  0.3008  183  ASP A OD1 
1197 O OD2 . ASP A 164 ? 2.2159 2.1742 1.3179 0.1509  0.0352  0.2940  183  ASP A OD2 
1198 N N   . PHE A 165 ? 1.9847 1.8779 1.1614 0.0979  0.0640  0.2476  184  PHE A N   
1199 C CA  . PHE A 165 ? 1.9840 1.8634 1.1719 0.0899  0.0779  0.2521  184  PHE A CA  
1200 C C   . PHE A 165 ? 2.0064 1.8978 1.2055 0.0827  0.0831  0.2349  184  PHE A C   
1201 O O   . PHE A 165 ? 1.9975 1.8856 1.2119 0.0753  0.0934  0.2369  184  PHE A O   
1202 C CB  . PHE A 165 ? 2.0037 1.8534 1.2083 0.0873  0.0774  0.2599  184  PHE A CB  
1203 C CG  . PHE A 165 ? 1.9947 1.8391 1.2179 0.0889  0.0652  0.2478  184  PHE A CG  
1204 C CD1 . PHE A 165 ? 2.0036 1.8514 1.2502 0.0801  0.0634  0.2303  184  PHE A CD1 
1205 C CD2 . PHE A 165 ? 2.0238 1.8609 1.2403 0.1008  0.0561  0.2552  184  PHE A CD2 
1206 C CE1 . PHE A 165 ? 1.9874 1.8314 1.2505 0.0805  0.0522  0.2206  184  PHE A CE1 
1207 C CE2 . PHE A 165 ? 2.0299 1.8679 1.2637 0.1024  0.0454  0.2450  184  PHE A CE2 
1208 C CZ  . PHE A 165 ? 1.9750 1.8159 1.2323 0.0908  0.0435  0.2280  184  PHE A CZ  
1209 N N   . TYR A 166 ? 1.9527 1.8584 1.1407 0.0853  0.0755  0.2187  185  TYR A N   
1210 C CA  . TYR A 166 ? 1.9471 1.8592 1.1358 0.0841  0.0782  0.2002  185  TYR A CA  
1211 C C   . TYR A 166 ? 2.0052 1.9312 1.1904 0.0854  0.0951  0.2052  185  TYR A C   
1212 O O   . TYR A 166 ? 1.9862 1.9178 1.1814 0.0862  0.1006  0.1934  185  TYR A O   
1213 C CB  . TYR A 166 ? 1.9755 1.8927 1.1396 0.0863  0.0660  0.1848  185  TYR A CB  
1214 C CG  . TYR A 166 ? 2.0336 1.9667 1.1657 0.0915  0.0673  0.1914  185  TYR A CG  
1215 C CD1 . TYR A 166 ? 2.0847 2.0262 1.1939 0.0966  0.0738  0.1822  185  TYR A CD1 
1216 C CD2 . TYR A 166 ? 2.0497 1.9911 1.1719 0.0935  0.0615  0.2063  185  TYR A CD2 
1217 C CE1 . TYR A 166 ? 2.1226 2.0797 1.2009 0.1013  0.0747  0.1878  185  TYR A CE1 
1218 C CE2 . TYR A 166 ? 2.0873 2.0459 1.1796 0.0986  0.0624  0.2131  185  TYR A CE2 
1219 C CZ  . TYR A 166 ? 2.2003 2.1663 1.2709 0.1013  0.0688  0.2035  185  TYR A CZ  
1220 O OH  . TYR A 166 ? 2.2433 2.2272 1.2832 0.1062  0.0694  0.2095  185  TYR A OH  
1221 N N   . ASP A 167 ? 1.9851 1.9193 1.1550 0.0867  0.1032  0.2239  186  ASP A N   
1222 C CA  . ASP A 167 ? 1.9973 1.9504 1.1619 0.0859  0.1198  0.2342  186  ASP A CA  
1223 C C   . ASP A 167 ? 2.0219 1.9683 1.2112 0.0736  0.1289  0.2484  186  ASP A C   
1224 O O   . ASP A 167 ? 2.0287 1.9971 1.2244 0.0691  0.1421  0.2524  186  ASP A O   
1225 C CB  . ASP A 167 ? 2.0495 2.0120 1.1846 0.0906  0.1231  0.2503  186  ASP A CB  
1226 C CG  . ASP A 167 ? 2.2142 2.2012 1.3230 0.0998  0.1273  0.2407  186  ASP A CG  
1227 O OD1 . ASP A 167 ? 2.2173 2.2019 1.3140 0.1055  0.1166  0.2205  186  ASP A OD1 
1228 O OD2 . ASP A 167 ? 2.3252 2.3321 1.4222 0.1005  0.1405  0.2539  186  ASP A OD2 
1229 N N   . VAL A 168 ? 1.9403 1.8583 1.1414 0.0679  0.1216  0.2560  187  VAL A N   
1230 C CA  . VAL A 168 ? 1.9240 1.8262 1.1434 0.0538  0.1272  0.2689  187  VAL A CA  
1231 C C   . VAL A 168 ? 1.9298 1.8393 1.1793 0.0483  0.1270  0.2527  187  VAL A C   
1232 O O   . VAL A 168 ? 1.9028 1.7972 1.1649 0.0513  0.1157  0.2397  187  VAL A O   
1233 C CB  . VAL A 168 ? 1.9746 1.8380 1.1887 0.0534  0.1188  0.2816  187  VAL A CB  
1234 C CG1 . VAL A 168 ? 1.9906 1.8312 1.2092 0.0365  0.1259  0.2992  187  VAL A CG1 
1235 C CG2 . VAL A 168 ? 1.9946 1.8542 1.1784 0.0662  0.1149  0.2925  187  VAL A CG2 
1236 N N   . THR A 169 ? 1.8768 1.8145 1.1371 0.0414  0.1396  0.2542  188  THR A N   
1237 C CA  . THR A 169 ? 1.8423 1.7935 1.1306 0.0383  0.1404  0.2403  188  THR A CA  
1238 C C   . THR A 169 ? 1.8677 1.8052 1.1786 0.0190  0.1414  0.2506  188  THR A C   
1239 O O   . THR A 169 ? 1.8409 1.7854 1.1762 0.0163  0.1393  0.2392  188  THR A O   
1240 C CB  . THR A 169 ? 1.9567 1.9509 1.2449 0.0473  0.1512  0.2311  188  THR A CB  
1241 O OG1 . THR A 169 ? 1.9924 2.0165 1.2807 0.0359  0.1660  0.2499  188  THR A OG1 
1242 C CG2 . THR A 169 ? 1.9488 1.9466 1.2097 0.0670  0.1474  0.2167  188  THR A CG2 
1243 N N   . TRP A 170 ? 1.8346 1.7488 1.1339 0.0055  0.1434  0.2720  189  TRP A N   
1244 C CA  . TRP A 170 ? 1.8293 1.7201 1.1427 -0.0150 0.1421  0.2815  189  TRP A CA  
1245 C C   . TRP A 170 ? 1.8248 1.6727 1.1417 -0.0091 0.1275  0.2730  189  TRP A C   
1246 O O   . TRP A 170 ? 1.8040 1.6401 1.1405 -0.0200 0.1237  0.2689  189  TRP A O   
1247 C CB  . TRP A 170 ? 1.8612 1.7384 1.1563 -0.0347 0.1497  0.3081  189  TRP A CB  
1248 C CG  . TRP A 170 ? 1.9086 1.7426 1.1708 -0.0277 0.1447  0.3218  189  TRP A CG  
1249 C CD1 . TRP A 170 ? 1.9721 1.8141 1.2077 -0.0205 0.1504  0.3342  189  TRP A CD1 
1250 C CD2 . TRP A 170 ? 1.9245 1.7009 1.1741 -0.0267 0.1339  0.3266  189  TRP A CD2 
1251 N NE1 . TRP A 170 ? 1.9960 1.7901 1.2041 -0.0138 0.1433  0.3465  189  TRP A NE1 
1252 C CE2 . TRP A 170 ? 2.0108 1.7637 1.2259 -0.0159 0.1332  0.3417  189  TRP A CE2 
1253 C CE3 . TRP A 170 ? 1.9297 1.6731 1.1920 -0.0311 0.1244  0.3189  189  TRP A CE3 
1254 C CZ2 . TRP A 170 ? 2.0297 1.7273 1.2217 -0.0068 0.1236  0.3493  189  TRP A CZ2 
1255 C CZ3 . TRP A 170 ? 1.9754 1.6636 1.2145 -0.0227 0.1150  0.3255  189  TRP A CZ3 
1256 C CH2 . TRP A 170 ? 2.0208 1.6863 1.2245 -0.0095 0.1147  0.3406  189  TRP A CH2 
1257 N N   . PHE A 171 ? 1.7603 1.5901 1.0579 0.0084  0.1195  0.2708  190  PHE A N   
1258 C CA  . PHE A 171 ? 1.7357 1.5348 1.0344 0.0180  0.1059  0.2634  190  PHE A CA  
1259 C C   . PHE A 171 ? 1.7242 1.5424 1.0444 0.0260  0.0989  0.2406  190  PHE A C   
1260 O O   . PHE A 171 ? 1.6948 1.4963 1.0294 0.0257  0.0903  0.2329  190  PHE A O   
1261 C CB  . PHE A 171 ? 1.7770 1.5606 1.0468 0.0340  0.1005  0.2718  190  PHE A CB  
1262 C CG  . PHE A 171 ? 1.7861 1.5463 1.0546 0.0468  0.0872  0.2666  190  PHE A CG  
1263 C CD1 . PHE A 171 ? 1.8468 1.5646 1.1069 0.0458  0.0835  0.2764  190  PHE A CD1 
1264 C CD2 . PHE A 171 ? 1.7835 1.5643 1.0555 0.0599  0.0780  0.2526  190  PHE A CD2 
1265 C CE1 . PHE A 171 ? 1.8488 1.5502 1.1061 0.0615  0.0720  0.2716  190  PHE A CE1 
1266 C CE2 . PHE A 171 ? 1.8077 1.5764 1.0795 0.0715  0.0662  0.2495  190  PHE A CE2 
1267 C CZ  . PHE A 171 ? 1.8027 1.5344 1.0679 0.0743  0.0639  0.2588  190  PHE A CZ  
1268 N N   . LYS A 172 ? 1.6639 1.5134 0.9822 0.0335  0.1020  0.2300  191  LYS A N   
1269 C CA  . LYS A 172 ? 1.6315 1.4937 0.9626 0.0408  0.0953  0.2087  191  LYS A CA  
1270 C C   . LYS A 172 ? 1.6633 1.5307 1.0236 0.0322  0.0969  0.2010  191  LYS A C   
1271 O O   . LYS A 172 ? 1.6385 1.5004 1.0116 0.0359  0.0876  0.1868  191  LYS A O   
1272 C CB  . LYS A 172 ? 1.6684 1.5560 0.9842 0.0503  0.1000  0.2002  191  LYS A CB  
1273 C CG  . LYS A 172 ? 1.8387 1.7218 1.1314 0.0606  0.0896  0.1933  191  LYS A CG  
1274 C CD  . LYS A 172 ? 1.9854 1.8834 1.2648 0.0693  0.0900  0.1767  191  LYS A CD  
1275 C CE  . LYS A 172 ? 2.1335 2.0283 1.3844 0.0754  0.0798  0.1704  191  LYS A CE  
1276 N NZ  . LYS A 172 ? 2.2295 2.1095 1.4847 0.0725  0.0634  0.1617  191  LYS A NZ  
1277 N N   . VAL A 173 ? 1.6297 1.5108 1.0001 0.0195  0.1083  0.2113  192  VAL A N   
1278 C CA  . VAL A 173 ? 1.6116 1.5054 1.0103 0.0094  0.1104  0.2062  192  VAL A CA  
1279 C C   . VAL A 173 ? 1.6598 1.5219 1.0693 -0.0037 0.1036  0.2115  192  VAL A C   
1280 O O   . VAL A 173 ? 1.6312 1.4969 1.0636 -0.0081 0.0998  0.2023  192  VAL A O   
1281 C CB  . VAL A 173 ? 1.6720 1.6076 1.0795 0.0013  0.1250  0.2129  192  VAL A CB  
1282 C CG1 . VAL A 173 ? 1.6718 1.6386 1.0677 0.0199  0.1310  0.2030  192  VAL A CG1 
1283 C CG2 . VAL A 173 ? 1.7013 1.6330 1.0984 -0.0176 0.1331  0.2363  192  VAL A CG2 
1284 N N   . MET A 174 ? 1.6479 1.4773 1.0380 -0.0082 0.1017  0.2261  193  MET A N   
1285 C CA  . MET A 174 ? 1.6590 1.4491 1.0499 -0.0174 0.0946  0.2311  193  MET A CA  
1286 C C   . MET A 174 ? 1.7002 1.4735 1.0953 -0.0024 0.0813  0.2176  193  MET A C   
1287 O O   . MET A 174 ? 1.6896 1.4449 1.0970 -0.0079 0.0751  0.2132  193  MET A O   
1288 C CB  . MET A 174 ? 1.7325 1.4877 1.0943 -0.0236 0.0967  0.2514  193  MET A CB  
1289 C CG  . MET A 174 ? 1.8073 1.5240 1.1669 -0.0425 0.0939  0.2597  193  MET A CG  
1290 S SD  . MET A 174 ? 1.9270 1.5821 1.2418 -0.0424 0.0918  0.2812  193  MET A SD  
1291 C CE  . MET A 174 ? 1.8732 1.5036 1.1784 -0.0108 0.0784  0.2700  193  MET A CE  
1292 N N   . THR A 175 ? 1.6533 1.4357 1.0377 0.0148  0.0768  0.2113  194  THR A N   
1293 C CA  . THR A 175 ? 1.6286 1.4051 1.0170 0.0268  0.0642  0.1998  194  THR A CA  
1294 C C   . THR A 175 ? 1.6453 1.4431 1.0570 0.0261  0.0611  0.1823  194  THR A C   
1295 O O   . THR A 175 ? 1.6223 1.4148 1.0440 0.0298  0.0511  0.1732  194  THR A O   
1296 C CB  . THR A 175 ? 1.7143 1.4953 1.0806 0.0415  0.0592  0.2018  194  THR A CB  
1297 O OG1 . THR A 175 ? 1.6981 1.5041 1.0570 0.0431  0.0647  0.1983  194  THR A OG1 
1298 C CG2 . THR A 175 ? 1.7240 1.4800 1.0657 0.0476  0.0595  0.2188  194  THR A CG2 
1299 N N   . ALA A 176 ? 1.5918 1.4144 1.0101 0.0230  0.0699  0.1784  195  ALA A N   
1300 C CA  . ALA A 176 ? 1.5619 1.4024 0.9978 0.0253  0.0683  0.1628  195  ALA A CA  
1301 C C   . ALA A 176 ? 1.5876 1.4245 1.0490 0.0151  0.0667  0.1608  195  ALA A C   
1302 O O   . ALA A 176 ? 1.5622 1.3990 1.0368 0.0185  0.0588  0.1487  195  ALA A O   
1303 C CB  . ALA A 176 ? 1.5794 1.4482 1.0123 0.0283  0.0795  0.1611  195  ALA A CB  
1304 N N   . ILE A 177 ? 1.5488 1.3804 1.0143 0.0008  0.0731  0.1733  196  ILE A N   
1305 C CA  . ILE A 177 ? 1.5341 1.3611 1.0205 -0.0124 0.0710  0.1724  196  ILE A CA  
1306 C C   . ILE A 177 ? 1.5752 1.3653 1.0569 -0.0112 0.0600  0.1721  196  ILE A C   
1307 O O   . ILE A 177 ? 1.5485 1.3386 1.0461 -0.0089 0.0523  0.1612  196  ILE A O   
1308 C CB  . ILE A 177 ? 1.5934 1.4341 1.0854 -0.0325 0.0815  0.1851  196  ILE A CB  
1309 C CG1 . ILE A 177 ? 1.5941 1.4830 1.0942 -0.0289 0.0926  0.1834  196  ILE A CG1 
1310 C CG2 . ILE A 177 ? 1.6008 1.4353 1.1120 -0.0492 0.0775  0.1840  196  ILE A CG2 
1311 C CD1 . ILE A 177 ? 1.7144 1.6218 1.2072 -0.0443 0.1049  0.2007  196  ILE A CD1 
1312 N N   . ILE A 178 ? 1.5522 1.3122 1.0100 -0.0100 0.0592  0.1840  197  ILE A N   
1313 C CA  . ILE A 178 ? 1.5571 1.2810 1.0034 -0.0035 0.0496  0.1850  197  ILE A CA  
1314 C C   . ILE A 178 ? 1.5628 1.2959 1.0168 0.0122  0.0391  0.1722  197  ILE A C   
1315 O O   . ILE A 178 ? 1.5514 1.2711 1.0128 0.0136  0.0315  0.1668  197  ILE A O   
1316 C CB  . ILE A 178 ? 1.6401 1.3315 1.0534 0.0009  0.0513  0.2009  197  ILE A CB  
1317 C CG1 . ILE A 178 ? 1.6864 1.3497 1.0888 -0.0202 0.0571  0.2144  197  ILE A CG1 
1318 C CG2 . ILE A 178 ? 1.6552 1.3225 1.0507 0.0211  0.0415  0.2008  197  ILE A CG2 
1319 C CD1 . ILE A 178 ? 1.7746 1.4032 1.1795 -0.0330 0.0506  0.2119  197  ILE A CD1 
1320 N N   . ASN A 179 ? 1.4904 1.2471 0.9416 0.0218  0.0383  0.1674  198  ASN A N   
1321 C CA  . ASN A 179 ? 1.4572 1.2248 0.9125 0.0320  0.0277  0.1572  198  ASN A CA  
1322 C C   . ASN A 179 ? 1.4674 1.2544 0.9431 0.0286  0.0249  0.1431  198  ASN A C   
1323 O O   . ASN A 179 ? 1.4458 1.2380 0.9256 0.0329  0.0150  0.1356  198  ASN A O   
1324 C CB  . ASN A 179 ? 1.4563 1.2320 0.8901 0.0431  0.0246  0.1615  198  ASN A CB  
1325 C CG  . ASN A 179 ? 1.7083 1.4645 1.1211 0.0522  0.0244  0.1747  198  ASN A CG  
1326 O OD1 . ASN A 179 ? 1.6301 1.3833 1.0379 0.0633  0.0161  0.1754  198  ASN A OD1 
1327 N ND2 . ASN A 179 ? 1.6178 1.3607 1.0158 0.0490  0.0335  0.1862  198  ASN A ND2 
1328 N N   . PHE A 180 ? 1.4109 1.2100 0.8980 0.0216  0.0333  0.1404  199  PHE A N   
1329 C CA  . PHE A 180 ? 1.3832 1.1977 0.8857 0.0224  0.0310  0.1275  199  PHE A CA  
1330 C C   . PHE A 180 ? 1.4298 1.2562 0.9547 0.0139  0.0372  0.1260  199  PHE A C   
1331 O O   . PHE A 180 ? 1.4131 1.2389 0.9546 0.0118  0.0310  0.1194  199  PHE A O   
1332 C CB  . PHE A 180 ? 1.4081 1.2330 0.8953 0.0303  0.0318  0.1212  199  PHE A CB  
1333 C CG  . PHE A 180 ? 1.4140 1.2453 0.9082 0.0348  0.0280  0.1077  199  PHE A CG  
1334 C CD1 . PHE A 180 ? 1.4420 1.2634 0.9319 0.0364  0.0152  0.0997  199  PHE A CD1 
1335 C CD2 . PHE A 180 ? 1.4413 1.2895 0.9432 0.0383  0.0371  0.1040  199  PHE A CD2 
1336 C CE1 . PHE A 180 ? 1.4499 1.2693 0.9404 0.0409  0.0109  0.0881  199  PHE A CE1 
1337 C CE2 . PHE A 180 ? 1.4728 1.3228 0.9762 0.0468  0.0333  0.0917  199  PHE A CE2 
1338 C CZ  . PHE A 180 ? 1.4431 1.2743 0.9392 0.0479  0.0200  0.0837  199  PHE A CZ  
1339 N N   . TYR A 181 ? 1.3985 1.2403 0.9240 0.0083  0.0490  0.1328  200  TYR A N   
1340 C CA  . TYR A 181 ? 1.3914 1.2558 0.9388 -0.0015 0.0554  0.1332  200  TYR A CA  
1341 C C   . TYR A 181 ? 1.4160 1.2664 0.9766 -0.0168 0.0515  0.1369  200  TYR A C   
1342 O O   . TYR A 181 ? 1.3875 1.2551 0.9695 -0.0220 0.0504  0.1315  200  TYR A O   
1343 C CB  . TYR A 181 ? 1.4313 1.3227 0.9753 -0.0055 0.0691  0.1419  200  TYR A CB  
1344 C CG  . TYR A 181 ? 1.4653 1.3750 0.9978 0.0122  0.0731  0.1343  200  TYR A CG  
1345 C CD1 . TYR A 181 ? 1.4856 1.4200 1.0291 0.0234  0.0745  0.1233  200  TYR A CD1 
1346 C CD2 . TYR A 181 ? 1.4894 1.3893 0.9965 0.0194  0.0750  0.1376  200  TYR A CD2 
1347 C CE1 . TYR A 181 ? 1.5100 1.4526 1.0358 0.0423  0.0773  0.1149  200  TYR A CE1 
1348 C CE2 . TYR A 181 ? 1.5074 1.4184 0.9986 0.0356  0.0775  0.1290  200  TYR A CE2 
1349 C CZ  . TYR A 181 ? 1.6005 1.5299 1.0995 0.0475  0.0786  0.1173  200  TYR A CZ  
1350 O OH  . TYR A 181 ? 1.6309 1.5638 1.1078 0.0658  0.0805  0.1077  200  TYR A OH  
1351 N N   . LEU A 182 ? 1.3838 1.2013 0.9286 -0.0221 0.0486  0.1457  201  LEU A N   
1352 C CA  . LEU A 182 ? 1.3873 1.1797 0.9351 -0.0346 0.0433  0.1483  201  LEU A CA  
1353 C C   . LEU A 182 ? 1.3892 1.1740 0.9468 -0.0250 0.0318  0.1362  201  LEU A C   
1354 O O   . LEU A 182 ? 1.3713 1.1660 0.9483 -0.0334 0.0293  0.1307  201  LEU A O   
1355 C CB  . LEU A 182 ? 1.4294 1.1822 0.9499 -0.0393 0.0437  0.1613  201  LEU A CB  
1356 C CG  . LEU A 182 ? 1.5207 1.2358 1.0345 -0.0515 0.0376  0.1638  201  LEU A CG  
1357 C CD1 . LEU A 182 ? 1.5498 1.2679 1.0672 -0.0793 0.0436  0.1731  201  LEU A CD1 
1358 C CD2 . LEU A 182 ? 1.5932 1.2616 1.0742 -0.0401 0.0330  0.1708  201  LEU A CD2 
1359 N N   . PRO A 183 ? 1.3191 1.0940 0.8655 -0.0089 0.0246  0.1322  202  PRO A N   
1360 C CA  . PRO A 183 ? 1.2847 1.0597 0.8421 -0.0024 0.0141  0.1221  202  PRO A CA  
1361 C C   . PRO A 183 ? 1.2867 1.0888 0.8664 -0.0028 0.0131  0.1118  202  PRO A C   
1362 O O   . PRO A 183 ? 1.2747 1.0786 0.8701 -0.0076 0.0086  0.1067  202  PRO A O   
1363 C CB  . PRO A 183 ? 1.3053 1.0753 0.8457 0.0122  0.0079  0.1226  202  PRO A CB  
1364 C CG  . PRO A 183 ? 1.3795 1.1534 0.9041 0.0145  0.0150  0.1293  202  PRO A CG  
1365 C CD  . PRO A 183 ? 1.3470 1.1146 0.8706 0.0023  0.0251  0.1379  202  PRO A CD  
1366 N N   . THR A 184 ? 1.2182 1.0390 0.7966 0.0030  0.0175  0.1088  203  THR A N   
1367 C CA  . THR A 184 ? 1.1913 1.0328 0.7848 0.0071  0.0167  0.0992  203  THR A CA  
1368 C C   . THR A 184 ? 1.2303 1.0915 0.8468 -0.0022 0.0209  0.0987  203  THR A C   
1369 O O   . THR A 184 ? 1.2119 1.0858 0.8424 0.0021  0.0167  0.0908  203  THR A O   
1370 C CB  . THR A 184 ? 1.2774 1.1278 0.8576 0.0180  0.0202  0.0953  203  THR A CB  
1371 O OG1 . THR A 184 ? 1.2648 1.1223 0.8526 0.0256  0.0152  0.0851  203  THR A OG1 
1372 C CG2 . THR A 184 ? 1.2839 1.1543 0.8633 0.0168  0.0335  0.1010  203  THR A CG2 
1373 N N   . LEU A 185 ? 1.1988 1.0634 0.8174 -0.0160 0.0284  0.1080  204  LEU A N   
1374 C CA  . LEU A 185 ? 1.1933 1.0815 0.8331 -0.0296 0.0316  0.1092  204  LEU A CA  
1375 C C   . LEU A 185 ? 1.2350 1.1035 0.8817 -0.0400 0.0225  0.1069  204  LEU A C   
1376 O O   . LEU A 185 ? 1.2167 1.1050 0.8834 -0.0436 0.0194  0.1014  204  LEU A O   
1377 C CB  . LEU A 185 ? 1.2159 1.1198 0.8535 -0.0445 0.0428  0.1213  204  LEU A CB  
1378 C CG  . LEU A 185 ? 1.2699 1.2249 0.9223 -0.0414 0.0525  0.1215  204  LEU A CG  
1379 C CD1 . LEU A 185 ? 1.2731 1.2347 0.9104 -0.0202 0.0578  0.1183  204  LEU A CD1 
1380 C CD2 . LEU A 185 ? 1.3217 1.2998 0.9791 -0.0649 0.0613  0.1350  204  LEU A CD2 
1381 N N   . LEU A 186 ? 1.2013 1.0310 0.8293 -0.0419 0.0179  0.1108  205  LEU A N   
1382 C CA  . LEU A 186 ? 1.1968 1.0005 0.8234 -0.0475 0.0089  0.1079  205  LEU A CA  
1383 C C   . LEU A 186 ? 1.2058 1.0148 0.8418 -0.0334 -0.0003 0.0972  205  LEU A C   
1384 O O   . LEU A 186 ? 1.1977 1.0060 0.8444 -0.0381 -0.0067 0.0917  205  LEU A O   
1385 C CB  . LEU A 186 ? 1.2276 0.9873 0.8256 -0.0464 0.0071  0.1151  205  LEU A CB  
1386 C CG  . LEU A 186 ? 1.3254 1.0569 0.9099 -0.0673 0.0088  0.1235  205  LEU A CG  
1387 C CD1 . LEU A 186 ? 1.3487 1.0872 0.9249 -0.0780 0.0196  0.1360  205  LEU A CD1 
1388 C CD2 . LEU A 186 ? 1.3750 1.0545 0.9306 -0.0599 0.0016  0.1247  205  LEU A CD2 
1389 N N   . MET A 187 ? 1.1422 0.9569 0.7725 -0.0181 -0.0015 0.0947  206  MET A N   
1390 C CA  . MET A 187 ? 1.1177 0.9382 0.7531 -0.0072 -0.0104 0.0867  206  MET A CA  
1391 C C   . MET A 187 ? 1.1532 0.9985 0.8103 -0.0085 -0.0111 0.0799  206  MET A C   
1392 O O   . MET A 187 ? 1.1314 0.9789 0.7985 -0.0077 -0.0189 0.0744  206  MET A O   
1393 C CB  . MET A 187 ? 1.1460 0.9673 0.7669 0.0036  -0.0107 0.0871  206  MET A CB  
1394 C CG  . MET A 187 ? 1.1826 0.9995 0.7967 0.0110  -0.0211 0.0846  206  MET A CG  
1395 S SD  . MET A 187 ? 1.2446 1.0596 0.8354 0.0176  -0.0211 0.0884  206  MET A SD  
1396 C CE  . MET A 187 ? 1.2014 1.0257 0.7933 0.0191  -0.0170 0.0820  206  MET A CE  
1397 N N   . LEU A 188 ? 1.1204 0.9871 0.7836 -0.0088 -0.0026 0.0809  207  LEU A N   
1398 C CA  . LEU A 188 ? 1.1098 1.0058 0.7918 -0.0061 -0.0014 0.0757  207  LEU A CA  
1399 C C   . LEU A 188 ? 1.1715 1.0797 0.8726 -0.0206 -0.0030 0.0759  207  LEU A C   
1400 O O   . LEU A 188 ? 1.1529 1.0728 0.8676 -0.0175 -0.0092 0.0698  207  LEU A O   
1401 C CB  . LEU A 188 ? 1.1187 1.0383 0.7995 -0.0008 0.0096  0.0782  207  LEU A CB  
1402 C CG  . LEU A 188 ? 1.1799 1.1025 0.8507 0.0191  0.0089  0.0713  207  LEU A CG  
1403 C CD1 . LEU A 188 ? 1.1854 1.0762 0.8312 0.0252  0.0035  0.0700  207  LEU A CD1 
1404 C CD2 . LEU A 188 ? 1.2297 1.1813 0.9000 0.0268  0.0207  0.0733  207  LEU A CD2 
1405 N N   . TRP A 189 ? 1.1543 1.0554 0.8526 -0.0377 0.0013  0.0832  208  TRP A N   
1406 C CA  . TRP A 189 ? 1.1616 1.0669 0.8711 -0.0571 -0.0012 0.0843  208  TRP A CA  
1407 C C   . TRP A 189 ? 1.1748 1.0599 0.8848 -0.0549 -0.0128 0.0768  208  TRP A C   
1408 O O   . TRP A 189 ? 1.1615 1.0651 0.8882 -0.0620 -0.0170 0.0726  208  TRP A O   
1409 C CB  . TRP A 189 ? 1.1857 1.0700 0.8804 -0.0765 0.0035  0.0943  208  TRP A CB  
1410 C CG  . TRP A 189 ? 1.2255 1.0960 0.9205 -0.0992 -0.0019 0.0952  208  TRP A CG  
1411 C CD1 . TRP A 189 ? 1.2875 1.1095 0.9617 -0.1031 -0.0096 0.0937  208  TRP A CD1 
1412 C CD2 . TRP A 189 ? 1.2300 1.1347 0.9429 -0.1215 -0.0004 0.0979  208  TRP A CD2 
1413 N NE1 . TRP A 189 ? 1.3057 1.1221 0.9808 -0.1275 -0.0139 0.0941  208  TRP A NE1 
1414 C CE2 . TRP A 189 ? 1.3116 1.1809 1.0118 -0.1415 -0.0086 0.0973  208  TRP A CE2 
1415 C CE3 . TRP A 189 ? 1.2334 1.1979 0.9704 -0.1256 0.0066  0.1007  208  TRP A CE3 
1416 C CZ2 . TRP A 189 ? 1.3170 1.2078 1.0279 -0.1700 -0.0107 0.0998  208  TRP A CZ2 
1417 C CZ3 . TRP A 189 ? 1.2630 1.2570 1.0141 -0.1520 0.0054  0.1044  208  TRP A CZ3 
1418 C CH2 . TRP A 189 ? 1.3002 1.2572 1.0385 -0.1761 -0.0036 0.1040  208  TRP A CH2 
1419 N N   . PHE A 190 ? 1.1127 0.9653 0.8044 -0.0442 -0.0177 0.0758  209  PHE A N   
1420 C CA  . PHE A 190 ? 1.0972 0.9337 0.7861 -0.0385 -0.0281 0.0695  209  PHE A CA  
1421 C C   . PHE A 190 ? 1.1031 0.9634 0.8074 -0.0273 -0.0334 0.0628  209  PHE A C   
1422 O O   . PHE A 190 ? 1.0851 0.9500 0.7985 -0.0287 -0.0406 0.0574  209  PHE A O   
1423 C CB  . PHE A 190 ? 1.1319 0.9366 0.7963 -0.0278 -0.0306 0.0722  209  PHE A CB  
1424 C CG  . PHE A 190 ? 1.1875 0.9548 0.8304 -0.0352 -0.0305 0.0765  209  PHE A CG  
1425 C CD1 . PHE A 190 ? 1.2508 1.0108 0.8918 -0.0549 -0.0250 0.0819  209  PHE A CD1 
1426 C CD2 . PHE A 190 ? 1.2330 0.9718 0.8541 -0.0219 -0.0361 0.0761  209  PHE A CD2 
1427 C CE1 . PHE A 190 ? 1.3065 1.0222 0.9210 -0.0634 -0.0262 0.0865  209  PHE A CE1 
1428 C CE2 . PHE A 190 ? 1.3125 1.0081 0.9068 -0.0253 -0.0366 0.0797  209  PHE A CE2 
1429 C CZ  . PHE A 190 ? 1.3153 0.9950 0.9047 -0.0469 -0.0320 0.0849  209  PHE A CZ  
1430 N N   . TYR A 191 ? 1.0387 0.9105 0.7422 -0.0164 -0.0306 0.0631  210  TYR A N   
1431 C CA  . TYR A 191 ? 1.0110 0.8969 0.7222 -0.0061 -0.0361 0.0579  210  TYR A CA  
1432 C C   . TYR A 191 ? 1.0475 0.9624 0.7798 -0.0082 -0.0351 0.0546  210  TYR A C   
1433 O O   . TYR A 191 ? 1.0277 0.9508 0.7686 -0.0037 -0.0424 0.0502  210  TYR A O   
1434 C CB  . TYR A 191 ? 1.0250 0.9060 0.7219 0.0047  -0.0344 0.0587  210  TYR A CB  
1435 C CG  . TYR A 191 ? 1.0370 0.9207 0.7336 0.0136  -0.0422 0.0541  210  TYR A CG  
1436 C CD1 . TYR A 191 ? 1.0555 0.9292 0.7452 0.0140  -0.0522 0.0537  210  TYR A CD1 
1437 C CD2 . TYR A 191 ? 1.0470 0.9440 0.7486 0.0220  -0.0399 0.0509  210  TYR A CD2 
1438 C CE1 . TYR A 191 ? 1.0604 0.9335 0.7471 0.0188  -0.0603 0.0512  210  TYR A CE1 
1439 C CE2 . TYR A 191 ? 1.0571 0.9486 0.7533 0.0304  -0.0481 0.0473  210  TYR A CE2 
1440 C CZ  . TYR A 191 ? 1.1478 1.0254 0.8361 0.0268  -0.0586 0.0479  210  TYR A CZ  
1441 O OH  . TYR A 191 ? 1.1887 1.0576 0.8685 0.0320  -0.0674 0.0460  210  TYR A OH  
1442 N N   . ALA A 192 ? 1.0112 0.9460 0.7519 -0.0153 -0.0261 0.0581  211  ALA A N   
1443 C CA  . ALA A 192 ? 1.0021 0.9750 0.7643 -0.0183 -0.0239 0.0569  211  ALA A CA  
1444 C C   . ALA A 192 ? 1.0455 1.0210 0.8193 -0.0325 -0.0311 0.0543  211  ALA A C   
1445 O O   . ALA A 192 ? 1.0355 1.0427 0.8276 -0.0335 -0.0331 0.0519  211  ALA A O   
1446 C CB  . ALA A 192 ? 1.0229 1.0207 0.7898 -0.0264 -0.0126 0.0634  211  ALA A CB  
1447 N N   . LYS A 193 ? 1.0036 0.9451 0.7640 -0.0413 -0.0353 0.0544  212  LYS A N   
1448 C CA  . LYS A 193 ? 1.0013 0.9340 0.7642 -0.0525 -0.0433 0.0504  212  LYS A CA  
1449 C C   . LYS A 193 ? 1.0289 0.9551 0.7910 -0.0385 -0.0528 0.0443  212  LYS A C   
1450 O O   . LYS A 193 ? 1.0228 0.9625 0.7962 -0.0418 -0.0593 0.0395  212  LYS A O   
1451 C CB  . LYS A 193 ? 1.0587 0.9530 0.8011 -0.0657 -0.0433 0.0533  212  LYS A CB  
1452 C CG  . LYS A 193 ? 1.2735 1.1753 1.0174 -0.0881 -0.0368 0.0599  212  LYS A CG  
1453 C CD  . LYS A 193 ? 1.4399 1.2947 1.1590 -0.1038 -0.0404 0.0615  212  LYS A CD  
1454 C CE  . LYS A 193 ? 1.6170 1.4778 1.3356 -0.1329 -0.0363 0.0690  212  LYS A CE  
1455 N NZ  . LYS A 193 ? 1.7178 1.6157 1.4577 -0.1509 -0.0406 0.0659  212  LYS A NZ  
1456 N N   . ILE A 194 ? 0.9656 0.8751 0.7140 -0.0245 -0.0539 0.0453  213  ILE A N   
1457 C CA  . ILE A 194 ? 0.9389 0.8467 0.6850 -0.0134 -0.0627 0.0422  213  ILE A CA  
1458 C C   . ILE A 194 ? 0.9905 0.9242 0.7520 -0.0075 -0.0652 0.0399  213  ILE A C   
1459 O O   . ILE A 194 ? 0.9776 0.9208 0.7468 -0.0065 -0.0727 0.0364  213  ILE A O   
1460 C CB  . ILE A 194 ? 0.9663 0.8566 0.6937 -0.0040 -0.0632 0.0458  213  ILE A CB  
1461 C CG1 . ILE A 194 ? 0.9799 0.8465 0.6906 -0.0048 -0.0629 0.0479  213  ILE A CG1 
1462 C CG2 . ILE A 194 ? 0.9531 0.8499 0.6792 0.0038  -0.0720 0.0449  213  ILE A CG2 
1463 C CD1 . ILE A 194 ? 1.0657 0.9210 0.7593 0.0020  -0.0604 0.0533  213  ILE A CD1 
1464 N N   . TYR A 195 ? 0.9624 0.9070 0.7260 -0.0018 -0.0589 0.0418  214  TYR A N   
1465 C CA  . TYR A 195 ? 0.9628 0.9282 0.7354 0.0087  -0.0601 0.0401  214  TYR A CA  
1466 C C   . TYR A 195 ? 1.0310 1.0295 0.8259 0.0032  -0.0608 0.0380  214  TYR A C   
1467 O O   . TYR A 195 ? 1.0167 1.0325 0.8191 0.0134  -0.0646 0.0363  214  TYR A O   
1468 C CB  . TYR A 195 ? 0.9910 0.9601 0.7569 0.0186  -0.0517 0.0420  214  TYR A CB  
1469 C CG  . TYR A 195 ? 1.0223 1.0029 0.7880 0.0358  -0.0536 0.0399  214  TYR A CG  
1470 C CD1 . TYR A 195 ? 1.0584 1.0111 0.8030 0.0469  -0.0600 0.0390  214  TYR A CD1 
1471 C CD2 . TYR A 195 ? 1.0317 1.0506 0.8154 0.0411  -0.0493 0.0395  214  TYR A CD2 
1472 C CE1 . TYR A 195 ? 1.0866 1.0400 0.8241 0.0645  -0.0627 0.0371  214  TYR A CE1 
1473 C CE2 . TYR A 195 ? 1.0530 1.0808 0.8330 0.0618  -0.0512 0.0378  214  TYR A CE2 
1474 C CZ  . TYR A 195 ? 1.1756 1.1660 0.9305 0.0744  -0.0580 0.0363  214  TYR A CZ  
1475 O OH  . TYR A 195 ? 1.2195 1.2093 0.9641 0.0964  -0.0606 0.0347  214  TYR A OH  
1476 N N   . LYS A 196 ? 1.0172 1.0230 0.8201 -0.0139 -0.0579 0.0385  215  LYS A N   
1477 C CA  . LYS A 196 ? 1.0188 1.0573 0.8413 -0.0251 -0.0596 0.0369  215  LYS A CA  
1478 C C   . LYS A 196 ? 1.0855 1.1150 0.9088 -0.0306 -0.0701 0.0317  215  LYS A C   
1479 O O   . LYS A 196 ? 1.0844 1.1422 0.9231 -0.0371 -0.0740 0.0293  215  LYS A O   
1480 C CB  . LYS A 196 ? 1.0629 1.1051 0.8873 -0.0474 -0.0541 0.0402  215  LYS A CB  
1481 C CG  . LYS A 196 ? 1.1993 1.2848 1.0444 -0.0628 -0.0550 0.0404  215  LYS A CG  
1482 C CD  . LYS A 196 ? 1.3165 1.3973 1.1578 -0.0910 -0.0519 0.0446  215  LYS A CD  
1483 C CE  . LYS A 196 ? 1.4188 1.5381 1.2770 -0.1126 -0.0563 0.0443  215  LYS A CE  
1484 N NZ  . LYS A 196 ? 1.5351 1.6439 1.3845 -0.1449 -0.0548 0.0495  215  LYS A NZ  
1485 N N   . ALA A 197 ? 1.0594 1.0545 0.8657 -0.0269 -0.0746 0.0302  216  ALA A N   
1486 C CA  . ALA A 197 ? 1.0676 1.0533 0.8704 -0.0285 -0.0840 0.0252  216  ALA A CA  
1487 C C   . ALA A 197 ? 1.1419 1.1399 0.9490 -0.0150 -0.0911 0.0243  216  ALA A C   
1488 O O   . ALA A 197 ? 1.1380 1.1478 0.9514 -0.0168 -0.0983 0.0203  216  ALA A O   
1489 C CB  . ALA A 197 ? 1.0873 1.0366 0.8682 -0.0270 -0.0852 0.0250  216  ALA A CB  
1490 N N   . VAL A 198 ? 1.1232 1.1158 0.9237 -0.0029 -0.0897 0.0284  217  VAL A N   
1491 C CA  . VAL A 198 ? 1.1258 1.1220 0.9241 0.0077  -0.0971 0.0296  217  VAL A CA  
1492 C C   . VAL A 198 ? 1.2058 1.2146 1.0084 0.0187  -0.0948 0.0316  217  VAL A C   
1493 O O   . VAL A 198 ? 1.2097 1.2028 0.9982 0.0282  -0.0979 0.0346  217  VAL A O   
1494 C CB  . VAL A 198 ? 1.1728 1.1473 0.9525 0.0109  -0.1014 0.0330  217  VAL A CB  
1495 C CG1 . VAL A 198 ? 1.1687 1.1433 0.9457 0.0075  -0.1069 0.0307  217  VAL A CG1 
1496 C CG2 . VAL A 198 ? 1.1759 1.1298 0.9417 0.0109  -0.0948 0.0362  217  VAL A CG2 
1497 N N   . ARG A 199 ? 1.1752 1.2129 0.9950 0.0177  -0.0906 0.0301  218  ARG A N   
1498 C CA  . ARG A 199 ? 1.1818 1.2371 1.0050 0.0330  -0.0876 0.0318  218  ARG A CA  
1499 C C   . ARG A 199 ? 1.2350 1.3289 1.0763 0.0386  -0.0913 0.0309  218  ARG A C   
1500 O O   . ARG A 199 ? 1.2409 1.3718 1.1002 0.0336  -0.0864 0.0306  218  ARG A O   
1501 C CB  . ARG A 199 ? 1.1857 1.2493 1.0102 0.0332  -0.0762 0.0333  218  ARG A CB  
1502 C CG  . ARG A 199 ? 1.3278 1.4201 1.1573 0.0516  -0.0715 0.0344  218  ARG A CG  
1503 C CD  . ARG A 199 ? 1.4875 1.6183 1.3334 0.0438  -0.0613 0.0364  218  ARG A CD  
1504 N NE  . ARG A 199 ? 1.6176 1.7436 1.4508 0.0573  -0.0520 0.0383  218  ARG A NE  
1505 C CZ  . ARG A 199 ? 1.7607 1.9087 1.6007 0.0483  -0.0418 0.0415  218  ARG A CZ  
1506 N NH1 . ARG A 199 ? 1.5773 1.7494 1.4352 0.0233  -0.0405 0.0436  218  ARG A NH1 
1507 N NH2 . ARG A 199 ? 1.5810 1.7250 1.4073 0.0633  -0.0336 0.0427  218  ARG A NH2 
1508 N N   . GLN A 200 ? 1.1724 1.2570 1.0061 0.0488  -0.1000 0.0318  219  GLN A N   
1509 C CA  . GLN A 200 ? 1.1541 1.2672 0.9980 0.0597  -0.1053 0.0324  219  GLN A CA  
1510 C C   . GLN A 200 ? 1.1860 1.2750 1.0082 0.0819  -0.1084 0.0360  219  GLN A C   
1511 O O   . GLN A 200 ? 1.1984 1.2987 1.0179 0.1002  -0.1034 0.0368  219  GLN A O   
1512 C CB  . GLN A 200 ? 1.1567 1.2732 1.0060 0.0491  -0.1147 0.0307  219  GLN A CB  
1513 C CG  . GLN A 200 ? 1.2856 1.4382 1.1490 0.0562  -0.1203 0.0310  219  GLN A CG  
1514 C CD  . GLN A 200 ? 1.4718 1.6573 1.3451 0.0706  -0.1143 0.0326  219  GLN A CD  
1515 O OE1 . GLN A 200 ? 1.3869 1.5556 1.2459 0.0872  -0.1096 0.0350  219  GLN A OE1 
1516 N NE2 . GLN A 200 ? 1.3744 1.6095 1.2709 0.0647  -0.1144 0.0311  219  GLN A NE2 
1517 N N   . HIS A 201 ? 1.1055 1.1602 0.9091 0.0798  -0.1168 0.0385  220  HIS A N   
1518 C CA  . HIS A 201 ? 1.0970 1.1162 0.8723 0.0947  -0.1234 0.0430  220  HIS A CA  
1519 C C   . HIS A 201 ? 1.0397 1.0750 0.8158 0.1130  -0.1285 0.0454  220  HIS A C   
1520 O O   . HIS A 201 ? 1.0552 1.0668 0.8082 0.1333  -0.1308 0.0480  220  HIS A O   
1521 C CB  . HIS A 201 ? 1.1377 1.1201 0.8877 0.1025  -0.1188 0.0430  220  HIS A CB  
1522 C CG  . HIS A 201 ? 1.1805 1.1414 0.9238 0.0839  -0.1174 0.0429  220  HIS A CG  
1523 N ND1 . HIS A 201 ? 1.2267 1.1463 0.9422 0.0788  -0.1210 0.0455  220  HIS A ND1 
1524 C CD2 . HIS A 201 ? 1.1805 1.1635 0.9453 0.0680  -0.1125 0.0403  220  HIS A CD2 
1525 C CE1 . HIS A 201 ? 1.2060 1.1297 0.9295 0.0622  -0.1175 0.0449  220  HIS A CE1 
1526 N NE2 . HIS A 201 ? 1.1759 1.1347 0.9275 0.0572  -0.1124 0.0415  220  HIS A NE2 
1527 N N   . CYS A 202 ? 0.8902 0.9648 0.6912 0.1056  -0.1309 0.0442  221  CYS A N   
1528 C CA  . CYS A 202 ? 0.8534 0.9462 0.6567 0.1187  -0.1383 0.0475  221  CYS A CA  
1529 C C   . CYS A 202 ? 0.8056 0.8947 0.5937 0.1488  -0.1376 0.0503  221  CYS A C   
1530 O O   . CYS A 202 ? 0.8119 0.8810 0.5844 0.1619  -0.1313 0.0491  221  CYS A O   
1531 C CB  . CYS A 202 ? 0.8626 0.9290 0.6504 0.1099  -0.1496 0.0526  221  CYS A CB  
1532 S SG  . CYS A 202 ? 0.8813 0.9905 0.6952 0.0945  -0.1554 0.0507  221  CYS A SG  
1533 N N   . ASN A 203 ? 0.6020 0.5143 0.6235 -0.1289 -0.0250 0.0165  1002 ASN A N   
1534 C CA  . ASN A 203 ? 0.5653 0.4666 0.5766 -0.1288 -0.0052 -0.0047 1002 ASN A CA  
1535 C C   . ASN A 203 ? 0.5236 0.4176 0.5607 -0.1048 -0.0026 -0.0094 1002 ASN A C   
1536 O O   . ASN A 203 ? 0.5146 0.4131 0.5694 -0.0943 -0.0144 0.0011  1002 ASN A O   
1537 C CB  . ASN A 203 ? 0.5596 0.4588 0.5635 -0.1331 0.0076  -0.0136 1002 ASN A CB  
1538 C CG  . ASN A 203 ? 0.7131 0.6160 0.7360 -0.1206 0.0009  -0.0030 1002 ASN A CG  
1539 O OD1 . ASN A 203 ? 0.5737 0.4718 0.6174 -0.1016 0.0066  -0.0083 1002 ASN A OD1 
1540 N ND2 . ASN A 203 ? 0.6449 0.5566 0.6595 -0.1335 -0.0107 0.0120  1002 ASN A ND2 
1541 N N   . ILE A 204 ? 0.4073 0.2910 0.4477 -0.0973 0.0135  -0.0253 1003 ILE A N   
1542 C CA  . ILE A 204 ? 0.3468 0.2237 0.4089 -0.0776 0.0170  -0.0299 1003 ILE A CA  
1543 C C   . ILE A 204 ? 0.3648 0.2461 0.4503 -0.0606 0.0129  -0.0235 1003 ILE A C   
1544 O O   . ILE A 204 ? 0.3651 0.2477 0.4682 -0.0475 0.0072  -0.0196 1003 ILE A O   
1545 C CB  . ILE A 204 ? 0.3734 0.2373 0.4341 -0.0767 0.0350  -0.0469 1003 ILE A CB  
1546 C CG1 . ILE A 204 ? 0.3414 0.1994 0.4231 -0.0595 0.0350  -0.0475 1003 ILE A CG1 
1547 C CG2 . ILE A 204 ? 0.3901 0.2513 0.4518 -0.0776 0.0500  -0.0571 1003 ILE A CG2 
1548 C CD1 . ILE A 204 ? 0.4035 0.2477 0.4844 -0.0608 0.0487  -0.0602 1003 ILE A CD1 
1549 N N   . PHE A 205 ? 0.2914 0.1757 0.3761 -0.0624 0.0163  -0.0231 1004 PHE A N   
1550 C CA  . PHE A 205 ? 0.2533 0.1421 0.3583 -0.0487 0.0131  -0.0177 1004 PHE A CA  
1551 C C   . PHE A 205 ? 0.2856 0.1803 0.4001 -0.0461 -0.0023 -0.0041 1004 PHE A C   
1552 O O   . PHE A 205 ? 0.2536 0.1502 0.3878 -0.0333 -0.0054 -0.0022 1004 PHE A O   
1553 C CB  . PHE A 205 ? 0.2722 0.1634 0.3724 -0.0536 0.0200  -0.0200 1004 PHE A CB  
1554 C CG  . PHE A 205 ? 0.2587 0.1552 0.3752 -0.0444 0.0149  -0.0128 1004 PHE A CG  
1555 C CD1 . PHE A 205 ? 0.2715 0.1695 0.4070 -0.0303 0.0200  -0.0168 1004 PHE A CD1 
1556 C CD2 . PHE A 205 ? 0.2740 0.1744 0.3873 -0.0514 0.0049  -0.0014 1004 PHE A CD2 
1557 C CE1 . PHE A 205 ? 0.2624 0.1658 0.4105 -0.0246 0.0163  -0.0117 1004 PHE A CE1 
1558 C CE2 . PHE A 205 ? 0.2939 0.1970 0.4226 -0.0440 0.0017  0.0037  1004 PHE A CE2 
1559 C CZ  . PHE A 205 ? 0.2482 0.1529 0.3928 -0.0312 0.0080  -0.0026 1004 PHE A CZ  
1560 N N   . GLU A 206 ? 0.2538 0.1524 0.3559 -0.0596 -0.0116 0.0054  1005 GLU A N   
1561 C CA  . GLU A 206 ? 0.2434 0.1480 0.3593 -0.0579 -0.0265 0.0200  1005 GLU A CA  
1562 C C   . GLU A 206 ? 0.2662 0.1718 0.3949 -0.0496 -0.0306 0.0195  1005 GLU A C   
1563 O O   . GLU A 206 ? 0.2584 0.1670 0.4100 -0.0390 -0.0358 0.0241  1005 GLU A O   
1564 C CB  . GLU A 206 ? 0.2873 0.1978 0.3879 -0.0760 -0.0365 0.0330  1005 GLU A CB  
1565 C CG  . GLU A 206 ? 0.4681 0.3792 0.5574 -0.0854 -0.0338 0.0355  1005 GLU A CG  
1566 C CD  . GLU A 206 ? 0.7872 0.6969 0.8977 -0.0737 -0.0355 0.0403  1005 GLU A CD  
1567 O OE1 . GLU A 206 ? 0.7796 0.6903 0.9142 -0.0644 -0.0450 0.0501  1005 GLU A OE1 
1568 O OE2 . GLU A 206 ? 0.6874 0.5952 0.7912 -0.0748 -0.0262 0.0334  1005 GLU A OE2 
1569 N N   . MET A 207 ? 0.2198 0.1222 0.3344 -0.0545 -0.0259 0.0118  1006 MET A N   
1570 C CA  . MET A 207 ? 0.1944 0.0974 0.3167 -0.0490 -0.0281 0.0095  1006 MET A CA  
1571 C C   . MET A 207 ? 0.1966 0.0977 0.3387 -0.0325 -0.0233 0.0034  1006 MET A C   
1572 O O   . MET A 207 ? 0.2036 0.1105 0.3638 -0.0255 -0.0292 0.0070  1006 MET A O   
1573 C CB  . MET A 207 ? 0.2354 0.1318 0.3354 -0.0594 -0.0208 0.0001  1006 MET A CB  
1574 C CG  . MET A 207 ? 0.2810 0.1788 0.3834 -0.0590 -0.0249 -0.0002 1006 MET A CG  
1575 S SD  . MET A 207 ? 0.3504 0.2338 0.4384 -0.0617 -0.0108 -0.0158 1006 MET A SD  
1576 C CE  . MET A 207 ? 0.3178 0.2067 0.3968 -0.0725 -0.0195 -0.0119 1006 MET A CE  
1577 N N   . LEU A 208 ? 0.1072 0.0423 0.2449 -0.0168 -0.0120 -0.0040 1007 LEU A N   
1578 C CA  . LEU A 208 ? 0.0658 0.0388 0.2214 -0.0037 -0.0086 -0.0059 1007 LEU A CA  
1579 C C   . LEU A 208 ? 0.1093 0.0387 0.2821 -0.0065 -0.0120 -0.0044 1007 LEU A C   
1580 O O   . LEU A 208 ? 0.0903 0.0382 0.2768 -0.0010 -0.0113 -0.0060 1007 LEU A O   
1581 C CB  . LEU A 208 ? 0.0537 0.0388 0.2082 -0.0018 0.0025  -0.0107 1007 LEU A CB  
1582 C CG  . LEU A 208 ? 0.1012 0.0401 0.2500 -0.0073 0.0053  -0.0168 1007 LEU A CG  
1583 C CD1 . LEU A 208 ? 0.1342 0.0426 0.2700 -0.0151 0.0160  -0.0252 1007 LEU A CD1 
1584 C CD2 . LEU A 208 ? 0.0691 0.0392 0.2329 -0.0016 0.0060  -0.0147 1007 LEU A CD2 
1585 N N   . ARG A 209 ? 0.0753 0.0387 0.2447 -0.0052 -0.0156 0.0013  1008 ARG A N   
1586 C CA  . ARG A 209 ? 0.0549 0.0382 0.2408 -0.0019 -0.0186 0.0042  1008 ARG A CA  
1587 C C   . ARG A 209 ? 0.0813 0.0384 0.2850 -0.0035 -0.0259 0.0079  1008 ARG A C   
1588 O O   . ARG A 209 ? 0.0610 0.0381 0.2816 -0.0003 -0.0237 0.0040  1008 ARG A O   
1589 C CB  . ARG A 209 ? 0.0507 0.0388 0.2279 -0.0028 -0.0215 0.0095  1008 ARG A CB  
1590 C CG  . ARG A 209 ? 0.1130 0.0398 0.3056 -0.0102 -0.0201 0.0127  1008 ARG A CG  
1591 C CD  . ARG A 209 ? 0.3606 0.2652 0.5492 -0.0214 -0.0260 0.0242  1008 ARG A CD  
1592 N NE  . ARG A 209 ? 0.6905 0.5938 0.8959 -0.0176 -0.0263 0.0268  1008 ARG A NE  
1593 C CZ  . ARG A 209 ? 1.0321 0.9331 1.2354 -0.0242 -0.0296 0.0353  1008 ARG A CZ  
1594 N NH1 . ARG A 209 ? 0.9458 0.8475 1.1290 -0.0364 -0.0333 0.0424  1008 ARG A NH1 
1595 N NH2 . ARG A 209 ? 0.8822 0.7803 1.1022 -0.0208 -0.0288 0.0364  1008 ARG A NH2 
1596 N N   . ILE A 210 ? 0.0436 0.0387 0.2409 -0.0020 -0.0336 0.0124  1009 ILE A N   
1597 C CA  . ILE A 210 ? 0.0449 0.0391 0.2535 -0.0027 -0.0386 0.0153  1009 ILE A CA  
1598 C C   . ILE A 210 ? 0.1339 0.0556 0.3602 -0.0035 -0.0347 0.0095  1009 ILE A C   
1599 O O   . ILE A 210 ? 0.1379 0.0646 0.3860 0.0018  -0.0338 0.0067  1009 ILE A O   
1600 C CB  . ILE A 210 ? 0.0666 0.0415 0.2763 -0.0089 -0.0504 0.0260  1009 ILE A CB  
1601 C CG1 . ILE A 210 ? 0.0830 0.0466 0.2797 -0.0180 -0.0581 0.0385  1009 ILE A CG1 
1602 C CG2 . ILE A 210 ? 0.0539 0.0414 0.2868 -0.0070 -0.0566 0.0289  1009 ILE A CG2 
1603 C CD1 . ILE A 210 ? 0.2631 0.1846 0.4756 -0.0283 -0.0594 0.0502  1009 ILE A CD1 
1604 N N   . ASP A 211 ? 0.0848 0.0382 0.2929 -0.0031 -0.0301 0.0033  1010 ASP A N   
1605 C CA  . ASP A 211 ? 0.0801 0.0381 0.2911 -0.0010 -0.0267 -0.0030 1010 ASP A CA  
1606 C C   . ASP A 211 ? 0.1658 0.0892 0.3834 0.0027  -0.0204 -0.0098 1010 ASP A C   
1607 O O   . ASP A 211 ? 0.1717 0.1022 0.3990 0.0035  -0.0194 -0.0141 1010 ASP A O   
1608 C CB  . ASP A 211 ? 0.1182 0.0387 0.3103 -0.0066 -0.0253 -0.0054 1010 ASP A CB  
1609 C CG  . ASP A 211 ? 0.2895 0.2069 0.4753 -0.0145 -0.0321 -0.0007 1010 ASP A CG  
1610 O OD1 . ASP A 211 ? 0.2909 0.2177 0.4931 -0.0136 -0.0384 0.0035  1010 ASP A OD1 
1611 O OD2 . ASP A 211 ? 0.3484 0.2589 0.5144 -0.0220 -0.0304 -0.0019 1010 ASP A OD2 
1612 N N   . GLU A 212 ? 0.1414 0.0610 0.3531 0.0040  -0.0160 -0.0103 1011 GLU A N   
1613 C CA  . GLU A 212 ? 0.1248 0.0493 0.3420 0.0068  -0.0112 -0.0139 1011 GLU A CA  
1614 C C   . GLU A 212 ? 0.1725 0.1003 0.3999 0.0078  -0.0096 -0.0145 1011 GLU A C   
1615 O O   . GLU A 212 ? 0.1819 0.1172 0.4160 0.0074  -0.0065 -0.0183 1011 GLU A O   
1616 C CB  . GLU A 212 ? 0.1412 0.0615 0.3492 0.0080  -0.0068 -0.0137 1011 GLU A CB  
1617 C CG  . GLU A 212 ? 0.3085 0.2254 0.5110 0.0071  -0.0070 -0.0141 1011 GLU A CG  
1618 C CD  . GLU A 212 ? 0.6368 0.5493 0.8387 0.0096  -0.0022 -0.0131 1011 GLU A CD  
1619 O OE1 . GLU A 212 ? 0.4457 0.3491 0.6413 0.0084  -0.0008 -0.0139 1011 GLU A OE1 
1620 O OE2 . GLU A 212 ? 0.6061 0.5245 0.8162 0.0126  0.0000  -0.0110 1011 GLU A OE2 
1621 N N   . GLY A 213 ? 0.1319 0.0546 0.3594 0.0071  -0.0117 -0.0103 1012 GLY A N   
1622 C CA  . GLY A 213 ? 0.1379 0.0612 0.3751 0.0074  -0.0101 -0.0102 1012 GLY A CA  
1623 C C   . GLY A 213 ? 0.2049 0.1281 0.4336 0.0069  -0.0056 -0.0103 1012 GLY A C   
1624 O O   . GLY A 213 ? 0.2140 0.1405 0.4370 0.0081  -0.0024 -0.0122 1012 GLY A O   
1625 N N   . LEU A 214 ? 0.1529 0.0732 0.3838 0.0052  -0.0056 -0.0074 1013 LEU A N   
1626 C CA  . LEU A 214 ? 0.1545 0.0762 0.3788 0.0038  -0.0011 -0.0076 1013 LEU A CA  
1627 C C   . LEU A 214 ? 0.2111 0.1386 0.4454 0.0030  0.0024  -0.0112 1013 LEU A C   
1628 O O   . LEU A 214 ? 0.2317 0.1549 0.4744 0.0011  0.0017  -0.0103 1013 LEU A O   
1629 C CB  . LEU A 214 ? 0.1697 0.0846 0.3850 -0.0007 -0.0036 -0.0014 1013 LEU A CB  
1630 C CG  . LEU A 214 ? 0.2396 0.1558 0.4469 -0.0040 0.0012  -0.0014 1013 LEU A CG  
1631 C CD1 . LEU A 214 ? 0.2560 0.1695 0.4467 -0.0086 0.0035  -0.0011 1013 LEU A CD1 
1632 C CD2 . LEU A 214 ? 0.2838 0.1960 0.4947 -0.0087 -0.0020 0.0044  1013 LEU A CD2 
1633 N N   . ARG A 215 ? 0.1433 0.0809 0.3778 0.0032  0.0061  -0.0146 1014 ARG A N   
1634 C CA  . ARG A 215 ? 0.1288 0.0755 0.3693 -0.0008 0.0096  -0.0182 1014 ARG A CA  
1635 C C   . ARG A 215 ? 0.1945 0.1442 0.4307 -0.0025 0.0125  -0.0154 1014 ARG A C   
1636 O O   . ARG A 215 ? 0.2007 0.1541 0.4326 0.0002  0.0138  -0.0127 1014 ARG A O   
1637 C CB  . ARG A 215 ? 0.0888 0.0489 0.3310 -0.0027 0.0102  -0.0203 1014 ARG A CB  
1638 C CG  . ARG A 215 ? 0.1138 0.0743 0.3606 -0.0043 0.0092  -0.0253 1014 ARG A CG  
1639 C CD  . ARG A 215 ? 0.1291 0.1055 0.3756 -0.0106 0.0097  -0.0270 1014 ARG A CD  
1640 N NE  . ARG A 215 ? 0.3319 0.3095 0.5808 -0.0132 0.0094  -0.0323 1014 ARG A NE  
1641 C CZ  . ARG A 215 ? 0.6489 0.6309 0.9043 -0.0206 0.0142  -0.0424 1014 ARG A CZ  
1642 N NH1 . ARG A 215 ? 0.5159 0.4998 0.7755 -0.0266 0.0197  -0.0483 1014 ARG A NH1 
1643 N NH2 . ARG A 215 ? 0.5994 0.5838 0.8580 -0.0231 0.0149  -0.0479 1014 ARG A NH2 
1644 N N   . LEU A 216 ? 0.1497 0.0974 0.3888 -0.0070 0.0143  -0.0167 1015 LEU A N   
1645 C CA  . LEU A 216 ? 0.1389 0.0909 0.3735 -0.0099 0.0172  -0.0144 1015 LEU A CA  
1646 C C   . LEU A 216 ? 0.1989 0.1670 0.4373 -0.0150 0.0205  -0.0167 1015 LEU A C   
1647 O O   . LEU A 216 ? 0.2016 0.1769 0.4384 -0.0173 0.0230  -0.0146 1015 LEU A O   
1648 C CB  . LEU A 216 ? 0.1380 0.0779 0.3697 -0.0132 0.0162  -0.0112 1015 LEU A CB  
1649 C CG  . LEU A 216 ? 0.1933 0.1222 0.4180 -0.0112 0.0116  -0.0058 1015 LEU A CG  
1650 C CD1 . LEU A 216 ? 0.1935 0.1116 0.4180 -0.0162 0.0079  0.0006  1015 LEU A CD1 
1651 C CD2 . LEU A 216 ? 0.2483 0.1811 0.4618 -0.0101 0.0143  -0.0055 1015 LEU A CD2 
1652 N N   . LYS A 217 ? 0.1552 0.1315 0.3983 -0.0183 0.0204  -0.0209 1016 LYS A N   
1653 C CA  . LYS A 217 ? 0.1467 0.1416 0.3916 -0.0267 0.0221  -0.0224 1016 LYS A CA  
1654 C C   . LYS A 217 ? 0.1954 0.2027 0.4416 -0.0267 0.0187  -0.0200 1016 LYS A C   
1655 O O   . LYS A 217 ? 0.2103 0.2097 0.4566 -0.0243 0.0175  -0.0233 1016 LYS A O   
1656 C CB  . LYS A 217 ? 0.1702 0.1626 0.4173 -0.0369 0.0268  -0.0316 1016 LYS A CB  
1657 C CG  . LYS A 217 ? 0.2640 0.2777 0.5094 -0.0499 0.0289  -0.0342 1016 LYS A CG  
1658 C CD  . LYS A 217 ? 0.4361 0.4460 0.6829 -0.0620 0.0361  -0.0462 1016 LYS A CD  
1659 C CE  . LYS A 217 ? 0.6724 0.7040 0.9138 -0.0771 0.0380  -0.0470 1016 LYS A CE  
1660 N NZ  . LYS A 217 ? 0.7990 0.8254 1.0408 -0.0912 0.0473  -0.0611 1016 LYS A NZ  
1661 N N   . ILE A 218 ? 0.1254 0.1530 0.3745 -0.0299 0.0164  -0.0128 1017 ILE A N   
1662 C CA  . ILE A 218 ? 0.1099 0.1509 0.3616 -0.0314 0.0114  -0.0067 1017 ILE A CA  
1663 C C   . ILE A 218 ? 0.1756 0.2194 0.4220 -0.0422 0.0122  -0.0152 1017 ILE A C   
1664 O O   . ILE A 218 ? 0.1788 0.2292 0.4221 -0.0545 0.0164  -0.0230 1017 ILE A O   
1665 C CB  . ILE A 218 ? 0.1336 0.1994 0.3937 -0.0352 0.0073  0.0055  1017 ILE A CB  
1666 C CG1 . ILE A 218 ? 0.1387 0.2023 0.4096 -0.0230 0.0081  0.0131  1017 ILE A CG1 
1667 C CG2 . ILE A 218 ? 0.1180 0.1983 0.3806 -0.0402 0.0005  0.0138  1017 ILE A CG2 
1668 C CD1 . ILE A 218 ? 0.2992 0.3889 0.5843 -0.0265 0.0046  0.0255  1017 ILE A CD1 
1669 N N   . TYR A 219 ? 0.1250 0.1635 0.3706 -0.0385 0.0096  -0.0152 1018 TYR A N   
1670 C CA  . TYR A 219 ? 0.1270 0.1698 0.3686 -0.0489 0.0112  -0.0237 1018 TYR A CA  
1671 C C   . TYR A 219 ? 0.1525 0.2153 0.3920 -0.0567 0.0045  -0.0139 1018 TYR A C   
1672 O O   . TYR A 219 ? 0.1375 0.1984 0.3814 -0.0472 -0.0012 -0.0025 1018 TYR A O   
1673 C CB  . TYR A 219 ? 0.1538 0.1767 0.3970 -0.0400 0.0129  -0.0305 1018 TYR A CB  
1674 C CG  . TYR A 219 ? 0.1961 0.2249 0.4379 -0.0498 0.0152  -0.0396 1018 TYR A CG  
1675 C CD1 . TYR A 219 ? 0.2339 0.2682 0.4767 -0.0630 0.0233  -0.0533 1018 TYR A CD1 
1676 C CD2 . TYR A 219 ? 0.2145 0.2445 0.4537 -0.0478 0.0105  -0.0354 1018 TYR A CD2 
1677 C CE1 . TYR A 219 ? 0.2590 0.3013 0.5005 -0.0745 0.0277  -0.0639 1018 TYR A CE1 
1678 C CE2 . TYR A 219 ? 0.2402 0.2787 0.4770 -0.0590 0.0132  -0.0440 1018 TYR A CE2 
1679 C CZ  . TYR A 219 ? 0.3978 0.4431 0.6359 -0.0726 0.0223  -0.0589 1018 TYR A CZ  
1680 O OH  . TYR A 219 ? 0.4917 0.5461 0.7281 -0.0853 0.0274  -0.0703 1018 TYR A OH  
1681 N N   . LYS A 220 ? 0.1167 0.1985 0.3498 -0.0755 0.0054  -0.0180 1019 LYS A N   
1682 C CA  . LYS A 220 ? 0.1171 0.2208 0.3462 -0.0875 -0.0023 -0.0073 1019 LYS A CA  
1683 C C   . LYS A 220 ? 0.1928 0.2939 0.4149 -0.0951 0.0010  -0.0185 1019 LYS A C   
1684 O O   . LYS A 220 ? 0.2072 0.3095 0.4246 -0.1073 0.0102  -0.0356 1019 LYS A O   
1685 C CB  . LYS A 220 ? 0.1441 0.2757 0.3680 -0.1080 -0.0043 -0.0032 1019 LYS A CB  
1686 C CG  . LYS A 220 ? 0.2785 0.4359 0.4960 -0.1256 -0.0132 0.0087  1019 LYS A CG  
1687 C CD  . LYS A 220 ? 0.4922 0.6758 0.6968 -0.1538 -0.0107 0.0030  1019 LYS A CD  
1688 C CE  . LYS A 220 ? 0.6649 0.8803 0.8630 -0.1745 -0.0226 0.0206  1019 LYS A CE  
1689 N NZ  . LYS A 220 ? 0.7972 1.0351 0.9758 -0.2068 -0.0168 0.0077  1019 LYS A NZ  
1690 N N   . ASP A 221 ? 0.1434 0.2403 0.3663 -0.0885 -0.0052 -0.0102 1020 ASP A N   
1691 C CA  . ASP A 221 ? 0.1481 0.2436 0.3649 -0.0957 -0.0021 -0.0206 1020 ASP A CA  
1692 C C   . ASP A 221 ? 0.2465 0.3687 0.4512 -0.1218 -0.0034 -0.0212 1020 ASP A C   
1693 O O   . ASP A 221 ? 0.2555 0.3984 0.4557 -0.1360 -0.0067 -0.0143 1020 ASP A O   
1694 C CB  . ASP A 221 ? 0.1576 0.2357 0.3781 -0.0799 -0.0062 -0.0152 1020 ASP A CB  
1695 C CG  . ASP A 221 ? 0.3033 0.3893 0.5234 -0.0807 -0.0169 0.0032  1020 ASP A CG  
1696 O OD1 . ASP A 221 ? 0.3253 0.4344 0.5410 -0.0969 -0.0228 0.0131  1020 ASP A OD1 
1697 O OD2 . ASP A 221 ? 0.3787 0.4481 0.6028 -0.0669 -0.0194 0.0080  1020 ASP A OD2 
1698 N N   . THR A 222 ? 0.2109 0.3348 0.4096 -0.1300 -0.0008 -0.0298 1021 THR A N   
1699 C CA  . THR A 222 ? 0.2146 0.3644 0.3990 -0.1577 -0.0008 -0.0323 1021 THR A CA  
1700 C C   . THR A 222 ? 0.2581 0.4281 0.4368 -0.1676 -0.0161 -0.0073 1021 THR A C   
1701 O O   . THR A 222 ? 0.2654 0.4623 0.4316 -0.1935 -0.0183 -0.0048 1021 THR A O   
1702 C CB  . THR A 222 ? 0.2935 0.4409 0.4744 -0.1659 0.0093  -0.0520 1021 THR A CB  
1703 O OG1 . THR A 222 ? 0.3317 0.4602 0.5201 -0.1466 0.0055  -0.0477 1021 THR A OG1 
1704 C CG2 . THR A 222 ? 0.2314 0.3708 0.4193 -0.1680 0.0261  -0.0775 1021 THR A CG2 
1705 N N   . GLU A 223 ? 0.2077 0.3659 0.3969 -0.1486 -0.0264 0.0116  1022 GLU A N   
1706 C CA  . GLU A 223 ? 0.2184 0.3939 0.4096 -0.1553 -0.0416 0.0385  1022 GLU A CA  
1707 C C   . GLU A 223 ? 0.3048 0.4859 0.5107 -0.1462 -0.0483 0.0557  1022 GLU A C   
1708 O O   . GLU A 223 ? 0.3093 0.4995 0.5272 -0.1438 -0.0611 0.0807  1022 GLU A O   
1709 C CB  . GLU A 223 ? 0.2314 0.3926 0.4273 -0.1440 -0.0483 0.0493  1022 GLU A CB  
1710 C CG  . GLU A 223 ? 0.3870 0.5458 0.5695 -0.1540 -0.0428 0.0345  1022 GLU A CG  
1711 C CD  . GLU A 223 ? 0.6131 0.7998 0.7770 -0.1859 -0.0405 0.0265  1022 GLU A CD  
1712 O OE1 . GLU A 223 ? 0.5190 0.7312 0.6767 -0.2052 -0.0515 0.0451  1022 GLU A OE1 
1713 O OE2 . GLU A 223 ? 0.4882 0.6721 0.6450 -0.1925 -0.0275 0.0021  1022 GLU A OE2 
1714 N N   . GLY A 224 ? 0.2660 0.4425 0.4731 -0.1419 -0.0393 0.0423  1023 GLY A N   
1715 C CA  . GLY A 224 ? 0.2630 0.4461 0.4827 -0.1350 -0.0427 0.0536  1023 GLY A CA  
1716 C C   . GLY A 224 ? 0.3007 0.4619 0.5404 -0.1069 -0.0440 0.0624  1023 GLY A C   
1717 O O   . GLY A 224 ? 0.3233 0.4948 0.5799 -0.1016 -0.0521 0.0821  1023 GLY A O   
1718 N N   . TYR A 225 ? 0.2208 0.3534 0.4600 -0.0902 -0.0356 0.0477  1024 TYR A N   
1719 C CA  . TYR A 225 ? 0.2073 0.3182 0.4614 -0.0666 -0.0346 0.0522  1024 TYR A CA  
1720 C C   . TYR A 225 ? 0.2424 0.3386 0.4963 -0.0566 -0.0248 0.0379  1024 TYR A C   
1721 O O   . TYR A 225 ? 0.2536 0.3407 0.4969 -0.0597 -0.0175 0.0207  1024 TYR A O   
1722 C CB  . TYR A 225 ? 0.2279 0.3189 0.4803 -0.0576 -0.0347 0.0504  1024 TYR A CB  
1723 C CG  . TYR A 225 ? 0.2778 0.3792 0.5353 -0.0636 -0.0453 0.0690  1024 TYR A CG  
1724 C CD1 . TYR A 225 ? 0.3083 0.4016 0.5858 -0.0499 -0.0498 0.0852  1024 TYR A CD1 
1725 C CD2 . TYR A 225 ? 0.3027 0.4220 0.5464 -0.0843 -0.0502 0.0706  1024 TYR A CD2 
1726 C CE1 . TYR A 225 ? 0.3034 0.4044 0.5892 -0.0551 -0.0602 0.1044  1024 TYR A CE1 
1727 C CE2 . TYR A 225 ? 0.3266 0.4565 0.5748 -0.0917 -0.0615 0.0905  1024 TYR A CE2 
1728 C CZ  . TYR A 225 ? 0.4153 0.5352 0.6855 -0.0764 -0.0672 0.1085  1024 TYR A CZ  
1729 O OH  . TYR A 225 ? 0.5030 0.6316 0.7811 -0.0834 -0.0789 0.1302  1024 TYR A OH  
1730 N N   . TYR A 226 ? 0.1549 0.2491 0.4231 -0.0448 -0.0246 0.0456  1025 TYR A N   
1731 C CA  . TYR A 226 ? 0.1247 0.2076 0.3934 -0.0366 -0.0167 0.0357  1025 TYR A CA  
1732 C C   . TYR A 226 ? 0.1502 0.2056 0.4205 -0.0195 -0.0112 0.0293  1025 TYR A C   
1733 O O   . TYR A 226 ? 0.1369 0.1858 0.4194 -0.0085 -0.0115 0.0370  1025 TYR A O   
1734 C CB  . TYR A 226 ? 0.1425 0.2447 0.4237 -0.0384 -0.0188 0.0463  1025 TYR A CB  
1735 C CG  . TYR A 226 ? 0.1781 0.3092 0.4539 -0.0591 -0.0242 0.0517  1025 TYR A CG  
1736 C CD1 . TYR A 226 ? 0.2178 0.3535 0.4799 -0.0720 -0.0184 0.0381  1025 TYR A CD1 
1737 C CD2 . TYR A 226 ? 0.1888 0.3425 0.4728 -0.0678 -0.0351 0.0706  1025 TYR A CD2 
1738 C CE1 . TYR A 226 ? 0.2502 0.4131 0.5044 -0.0945 -0.0220 0.0409  1025 TYR A CE1 
1739 C CE2 . TYR A 226 ? 0.2058 0.3887 0.4812 -0.0908 -0.0408 0.0761  1025 TYR A CE2 
1740 C CZ  . TYR A 226 ? 0.3378 0.5255 0.5970 -0.1048 -0.0336 0.0600  1025 TYR A CZ  
1741 O OH  . TYR A 226 ? 0.4240 0.6414 0.6724 -0.1307 -0.0378 0.0635  1025 TYR A OH  
1742 N N   . THR A 227 ? 0.1151 0.1551 0.3740 -0.0188 -0.0060 0.0151  1026 THR A N   
1743 C CA  . THR A 227 ? 0.1029 0.1197 0.3589 -0.0073 -0.0020 0.0090  1026 THR A CA  
1744 C C   . THR A 227 ? 0.1311 0.1412 0.3848 -0.0054 0.0033  0.0025  1026 THR A C   
1745 O O   . THR A 227 ? 0.1453 0.1615 0.3959 -0.0135 0.0050  -0.0031 1026 THR A O   
1746 C CB  . THR A 227 ? 0.2144 0.2218 0.4615 -0.0098 -0.0024 0.0010  1026 THR A CB  
1747 O OG1 . THR A 227 ? 0.2882 0.3003 0.5361 -0.0117 -0.0073 0.0076  1026 THR A OG1 
1748 C CG2 . THR A 227 ? 0.1786 0.1654 0.4214 -0.0015 0.0003  -0.0049 1026 THR A CG2 
1749 N N   . ILE A 228 ? 0.0450 0.0416 0.2992 0.0035  0.0066  0.0023  1027 ILE A N   
1750 C CA  . ILE A 228 ? 0.0385 0.0380 0.2837 -0.0001 0.0108  -0.0022 1027 ILE A CA  
1751 C C   . ILE A 228 ? 0.1008 0.0710 0.3442 0.0106  0.0131  -0.0050 1027 ILE A C   
1752 O O   . ILE A 228 ? 0.0979 0.0641 0.3439 0.0151  0.0134  -0.0028 1027 ILE A O   
1753 C CB  . ILE A 228 ? 0.0656 0.0664 0.3234 0.0042  0.0139  0.0015  1027 ILE A CB  
1754 C CG1 . ILE A 228 ? 0.0587 0.0525 0.3099 0.0022  0.0180  -0.0034 1027 ILE A CG1 
1755 C CG2 . ILE A 228 ? 0.0868 0.0900 0.3571 0.0119  0.0163  0.0075  1027 ILE A CG2 
1756 C CD1 . ILE A 228 ? 0.1386 0.1419 0.3896 -0.0057 0.0180  -0.0049 1027 ILE A CD1 
1757 N N   . GLY A 229 ? 0.0657 0.0396 0.3002 0.0056  0.0141  -0.0082 1028 GLY A N   
1758 C CA  . GLY A 229 ? 0.0836 0.0401 0.3091 0.0082  0.0152  -0.0098 1028 GLY A CA  
1759 C C   . GLY A 229 ? 0.1642 0.1023 0.3858 0.0109  0.0109  -0.0111 1028 GLY A C   
1760 O O   . GLY A 229 ? 0.1563 0.0966 0.3814 0.0093  0.0071  -0.0121 1028 GLY A O   
1761 N N   . ILE A 230 ? 0.1509 0.0801 0.3655 0.0121  0.0127  -0.0119 1029 ILE A N   
1762 C CA  . ILE A 230 ? 0.1544 0.0767 0.3636 0.0116  0.0089  -0.0125 1029 ILE A CA  
1763 C C   . ILE A 230 ? 0.2413 0.1677 0.4581 0.0152  0.0092  -0.0113 1029 ILE A C   
1764 O O   . ILE A 230 ? 0.2563 0.1762 0.4726 0.0172  0.0130  -0.0119 1029 ILE A O   
1765 C CB  . ILE A 230 ? 0.2021 0.1135 0.3975 0.0077  0.0113  -0.0144 1029 ILE A CB  
1766 C CG1 . ILE A 230 ? 0.2126 0.1224 0.3995 0.0018  0.0115  -0.0133 1029 ILE A CG1 
1767 C CG2 . ILE A 230 ? 0.2116 0.1179 0.4008 0.0055  0.0063  -0.0142 1029 ILE A CG2 
1768 C CD1 . ILE A 230 ? 0.2661 0.1739 0.4492 -0.0029 0.0032  -0.0082 1029 ILE A CD1 
1769 N N   . GLY A 231 ? 0.1912 0.1288 0.4158 0.0145  0.0058  -0.0096 1030 GLY A N   
1770 C CA  . GLY A 231 ? 0.1788 0.1241 0.4101 0.0148  0.0036  -0.0058 1030 GLY A CA  
1771 C C   . GLY A 231 ? 0.2265 0.1736 0.4675 0.0192  0.0068  -0.0004 1030 GLY A C   
1772 O O   . GLY A 231 ? 0.2373 0.1804 0.4823 0.0212  0.0061  0.0031  1030 GLY A O   
1773 N N   . HIS A 232 ? 0.1787 0.1313 0.4261 0.0209  0.0107  0.0005  1031 HIS A N   
1774 C CA  . HIS A 232 ? 0.1748 0.1317 0.4384 0.0261  0.0143  0.0062  1031 HIS A CA  
1775 C C   . HIS A 232 ? 0.1969 0.1730 0.4710 0.0230  0.0077  0.0157  1031 HIS A C   
1776 O O   . HIS A 232 ? 0.2075 0.1955 0.4791 0.0177  0.0060  0.0151  1031 HIS A O   
1777 C CB  . HIS A 232 ? 0.1898 0.1465 0.4570 0.0284  0.0222  0.0026  1031 HIS A CB  
1778 C CG  . HIS A 232 ? 0.2376 0.2023 0.5283 0.0344  0.0266  0.0088  1031 HIS A CG  
1779 N ND1 . HIS A 232 ? 0.2701 0.2228 0.5710 0.0402  0.0357  0.0052  1031 HIS A ND1 
1780 C CD2 . HIS A 232 ? 0.2548 0.2391 0.5628 0.0349  0.0233  0.0183  1031 HIS A CD2 
1781 C CE1 . HIS A 232 ? 0.2636 0.2284 0.5916 0.0459  0.0379  0.0132  1031 HIS A CE1 
1782 N NE2 . HIS A 232 ? 0.2573 0.2426 0.5901 0.0427  0.0295  0.0225  1031 HIS A NE2 
1783 N N   . LEU A 233 ? 0.1344 0.1137 0.4190 0.0241  0.0035  0.0246  1032 LEU A N   
1784 C CA  . LEU A 233 ? 0.1249 0.1255 0.4190 0.0181  -0.0046 0.0368  1032 LEU A CA  
1785 C C   . LEU A 233 ? 0.2047 0.2182 0.5211 0.0226  -0.0033 0.0464  1032 LEU A C   
1786 O O   . LEU A 233 ? 0.2174 0.2208 0.5481 0.0323  0.0040  0.0455  1032 LEU A O   
1787 C CB  . LEU A 233 ? 0.1251 0.1239 0.4230 0.0168  -0.0107 0.0455  1032 LEU A CB  
1788 C CG  . LEU A 233 ? 0.1774 0.1977 0.4739 0.0045  -0.0207 0.0558  1032 LEU A CG  
1789 C CD1 . LEU A 233 ? 0.1729 0.1920 0.4472 -0.0052 -0.0218 0.0448  1032 LEU A CD1 
1790 C CD2 . LEU A 233 ? 0.2238 0.2462 0.5361 0.0056  -0.0273 0.0722  1032 LEU A CD2 
1791 N N   . LEU A 234 ? 0.1799 0.2165 0.5004 0.0146  -0.0093 0.0545  1033 LEU A N   
1792 C CA  . LEU A 234 ? 0.1854 0.2380 0.5299 0.0183  -0.0092 0.0654  1033 LEU A CA  
1793 C C   . LEU A 234 ? 0.3291 0.3987 0.6928 0.0153  -0.0199 0.0858  1033 LEU A C   
1794 O O   . LEU A 234 ? 0.3323 0.4246 0.6913 0.0018  -0.0292 0.0950  1033 LEU A O   
1795 C CB  . LEU A 234 ? 0.1673 0.2346 0.5042 0.0109  -0.0080 0.0609  1033 LEU A CB  
1796 C CG  . LEU A 234 ? 0.1976 0.2468 0.5161 0.0130  0.0011  0.0431  1033 LEU A CG  
1797 C CD1 . LEU A 234 ? 0.1955 0.2553 0.5001 0.0017  0.0002  0.0376  1033 LEU A CD1 
1798 C CD2 . LEU A 234 ? 0.2054 0.2465 0.5360 0.0231  0.0105  0.0396  1033 LEU A CD2 
1799 N N   . THR A 235 ? 0.3538 0.4102 0.7371 0.0260  -0.0182 0.0922  1034 THR A N   
1800 C CA  . THR A 235 ? 0.3791 0.4446 0.7856 0.0260  -0.0280 0.1135  1034 THR A CA  
1801 C C   . THR A 235 ? 0.4610 0.5579 0.8936 0.0220  -0.0371 0.1347  1034 THR A C   
1802 O O   . THR A 235 ? 0.4455 0.5496 0.8984 0.0295  -0.0313 0.1351  1034 THR A O   
1803 C CB  . THR A 235 ? 0.5560 0.5972 0.9847 0.0409  -0.0202 0.1133  1034 THR A CB  
1804 O OG1 . THR A 235 ? 0.5889 0.6288 1.0451 0.0530  -0.0094 0.1109  1034 THR A OG1 
1805 C CG2 . THR A 235 ? 0.5485 0.5608 0.9503 0.0421  -0.0126 0.0943  1034 THR A CG2 
1806 N N   . LYS A 236 ? 0.4564 0.5735 0.8893 0.0090  -0.0518 0.1535  1035 LYS A N   
1807 C CA  . LYS A 236 ? 0.4673 0.6192 0.9233 0.0005  -0.0646 0.1786  1035 LYS A CA  
1808 C C   . LYS A 236 ? 0.5191 0.6950 0.9640 -0.0102 -0.0647 0.1744  1035 LYS A C   
1809 O O   . LYS A 236 ? 0.5204 0.7139 0.9930 -0.0054 -0.0653 0.1852  1035 LYS A O   
1810 C CB  . LYS A 236 ? 0.5037 0.6574 1.0108 0.0162  -0.0663 0.1995  1035 LYS A CB  
1811 C CG  . LYS A 236 ? 0.6784 0.8127 1.1990 0.0223  -0.0695 0.2093  1035 LYS A CG  
1812 C CD  . LYS A 236 ? 0.8407 0.9889 1.4138 0.0295  -0.0790 0.2405  1035 LYS A CD  
1813 C CE  . LYS A 236 ? 1.0007 1.1309 1.6168 0.0528  -0.0640 0.2359  1035 LYS A CE  
1814 N NZ  . LYS A 236 ? 1.1453 1.2918 1.8187 0.0595  -0.0745 0.2690  1035 LYS A NZ  
1815 N N   . SER A 237 ? 0.4541 0.6281 0.8599 -0.0238 -0.0622 0.1563  1036 SER A N   
1816 C CA  . SER A 237 ? 0.4350 0.6270 0.8249 -0.0364 -0.0606 0.1483  1036 SER A CA  
1817 C C   . SER A 237 ? 0.4640 0.6797 0.8300 -0.0623 -0.0700 0.1523  1036 SER A C   
1818 O O   . SER A 237 ? 0.4674 0.6719 0.8032 -0.0711 -0.0642 0.1327  1036 SER A O   
1819 C CB  . SER A 237 ? 0.4666 0.6313 0.8349 -0.0287 -0.0459 0.1205  1036 SER A CB  
1820 O OG  . SER A 237 ? 0.5783 0.7269 0.9671 -0.0092 -0.0366 0.1169  1036 SER A OG  
1821 N N   . PRO A 238 ? 0.3972 0.6466 0.7777 -0.0760 -0.0845 0.1780  1037 PRO A N   
1822 C CA  . PRO A 238 ? 0.3919 0.6674 0.7463 -0.1057 -0.0930 0.1813  1037 PRO A CA  
1823 C C   . PRO A 238 ? 0.4051 0.6827 0.7292 -0.1200 -0.0828 0.1566  1037 PRO A C   
1824 O O   . PRO A 238 ? 0.4213 0.6896 0.7171 -0.1317 -0.0771 0.1382  1037 PRO A O   
1825 C CB  . PRO A 238 ? 0.4262 0.7406 0.8059 -0.1168 -0.1100 0.2147  1037 PRO A CB  
1826 C CG  . PRO A 238 ? 0.4829 0.7928 0.9026 -0.0922 -0.1071 0.2238  1037 PRO A CG  
1827 C CD  . PRO A 238 ? 0.4193 0.6868 0.8424 -0.0668 -0.0935 0.2057  1037 PRO A CD  
1828 N N   . SER A 239 ? 0.3088 0.5953 0.6413 -0.1174 -0.0787 0.1544  1038 SER A N   
1829 C CA  . SER A 239 ? 0.2944 0.5820 0.6026 -0.1303 -0.0687 0.1326  1038 SER A CA  
1830 C C   . SER A 239 ? 0.3028 0.5559 0.6090 -0.1096 -0.0536 0.1102  1038 SER A C   
1831 O O   . SER A 239 ? 0.3014 0.5354 0.6269 -0.0864 -0.0513 0.1135  1038 SER A O   
1832 C CB  . SER A 239 ? 0.3570 0.6796 0.6748 -0.1439 -0.0752 0.1467  1038 SER A CB  
1833 O OG  . SER A 239 ? 0.4692 0.7894 0.8184 -0.1220 -0.0743 0.1563  1038 SER A OG  
1834 N N   . LEU A 240 ? 0.2197 0.4659 0.5045 -0.1192 -0.0433 0.0886  1039 LEU A N   
1835 C CA  . LEU A 240 ? 0.1925 0.4089 0.4760 -0.1022 -0.0309 0.0706  1039 LEU A CA  
1836 C C   . LEU A 240 ? 0.2525 0.4757 0.5578 -0.0899 -0.0308 0.0805  1039 LEU A C   
1837 O O   . LEU A 240 ? 0.2577 0.4575 0.5715 -0.0702 -0.0242 0.0749  1039 LEU A O   
1838 C CB  . LEU A 240 ? 0.1929 0.4001 0.4535 -0.1155 -0.0203 0.0476  1039 LEU A CB  
1839 C CG  . LEU A 240 ? 0.2446 0.4278 0.5044 -0.1034 -0.0096 0.0332  1039 LEU A CG  
1840 C CD1 . LEU A 240 ? 0.2452 0.3962 0.5096 -0.0805 -0.0055 0.0278  1039 LEU A CD1 
1841 C CD2 . LEU A 240 ? 0.2663 0.4432 0.5083 -0.1191 -0.0002 0.0133  1039 LEU A CD2 
1842 N N   . ASN A 241 ? 0.2120 0.4687 0.5274 -0.1024 -0.0383 0.0958  1040 ASN A N   
1843 C CA  . ASN A 241 ? 0.2095 0.4761 0.5495 -0.0911 -0.0378 0.1056  1040 ASN A CA  
1844 C C   . ASN A 241 ? 0.2478 0.5084 0.6198 -0.0687 -0.0404 0.1199  1040 ASN A C   
1845 O O   . ASN A 241 ? 0.2496 0.5035 0.6395 -0.0536 -0.0334 0.1181  1040 ASN A O   
1846 C CB  . ASN A 241 ? 0.2550 0.5606 0.5993 -0.1107 -0.0450 0.1183  1040 ASN A CB  
1847 C CG  . ASN A 241 ? 0.6322 0.9349 0.9550 -0.1230 -0.0355 0.0998  1040 ASN A CG  
1848 O OD1 . ASN A 241 ? 0.5514 0.8446 0.8465 -0.1381 -0.0303 0.0828  1040 ASN A OD1 
1849 N ND2 . ASN A 241 ? 0.5664 0.8755 0.9035 -0.1163 -0.0318 0.1017  1040 ASN A ND2 
1850 N N   . ALA A 242 ? 0.1888 0.4494 0.5673 -0.0672 -0.0487 0.1319  1041 ALA A N   
1851 C CA  . ALA A 242 ? 0.1823 0.4328 0.5921 -0.0464 -0.0499 0.1442  1041 ALA A CA  
1852 C C   . ALA A 242 ? 0.2346 0.4450 0.6344 -0.0291 -0.0365 0.1230  1041 ALA A C   
1853 O O   . ALA A 242 ? 0.2318 0.4304 0.6535 -0.0116 -0.0289 0.1218  1041 ALA A O   
1854 C CB  . ALA A 242 ? 0.1971 0.4577 0.6131 -0.0527 -0.0631 0.1630  1041 ALA A CB  
1855 N N   . ALA A 243 ? 0.1895 0.3808 0.5565 -0.0358 -0.0331 0.1057  1042 ALA A N   
1856 C CA  . ALA A 243 ? 0.1772 0.3336 0.5297 -0.0240 -0.0226 0.0864  1042 ALA A CA  
1857 C C   . ALA A 243 ? 0.2337 0.3806 0.5840 -0.0180 -0.0119 0.0737  1042 ALA A C   
1858 O O   . ALA A 243 ? 0.2404 0.3651 0.5941 -0.0042 -0.0036 0.0657  1042 ALA A O   
1859 C CB  . ALA A 243 ? 0.1816 0.3281 0.5047 -0.0356 -0.0225 0.0734  1042 ALA A CB  
1860 N N   . LYS A 244 ? 0.1655 0.3301 0.5092 -0.0304 -0.0120 0.0722  1043 LYS A N   
1861 C CA  . LYS A 244 ? 0.1475 0.3064 0.4884 -0.0278 -0.0031 0.0622  1043 LYS A CA  
1862 C C   . LYS A 244 ? 0.1978 0.3644 0.5684 -0.0148 0.0002  0.0710  1043 LYS A C   
1863 O O   . LYS A 244 ? 0.1989 0.3474 0.5695 -0.0048 0.0101  0.0607  1043 LYS A O   
1864 C CB  . LYS A 244 ? 0.1670 0.3444 0.4954 -0.0458 -0.0043 0.0597  1043 LYS A CB  
1865 C CG  . LYS A 244 ? 0.2130 0.3724 0.5136 -0.0555 0.0000  0.0425  1043 LYS A CG  
1866 C CD  . LYS A 244 ? 0.2991 0.4779 0.5890 -0.0759 -0.0005 0.0399  1043 LYS A CD  
1867 C CE  . LYS A 244 ? 0.4439 0.6012 0.7136 -0.0826 0.0079  0.0209  1043 LYS A CE  
1868 N NZ  . LYS A 244 ? 0.5244 0.6997 0.7832 -0.1050 0.0089  0.0162  1043 LYS A NZ  
1869 N N   . SER A 245 ? 0.1633 0.3568 0.5614 -0.0150 -0.0080 0.0905  1044 SER A N   
1870 C CA  . SER A 245 ? 0.1610 0.3644 0.5962 -0.0015 -0.0042 0.1001  1044 SER A CA  
1871 C C   . SER A 245 ? 0.2067 0.3849 0.6573 0.0166  0.0035  0.0960  1044 SER A C   
1872 O O   . SER A 245 ? 0.2206 0.3977 0.6964 0.0281  0.0134  0.0941  1044 SER A O   
1873 C CB  . SER A 245 ? 0.2088 0.4491 0.6740 -0.0068 -0.0165 0.1249  1044 SER A CB  
1874 O OG  . SER A 245 ? 0.3937 0.6450 0.8993 0.0065  -0.0109 0.1326  1044 SER A OG  
1875 N N   . GLU A 246 ? 0.1372 0.2963 0.5736 0.0178  0.0002  0.0938  1045 GLU A N   
1876 C CA  . GLU A 246 ? 0.1366 0.2711 0.5843 0.0323  0.0077  0.0890  1045 GLU A CA  
1877 C C   . GLU A 246 ? 0.1672 0.2755 0.5899 0.0347  0.0204  0.0667  1045 GLU A C   
1878 O O   . GLU A 246 ? 0.1573 0.2528 0.5930 0.0445  0.0324  0.0587  1045 GLU A O   
1879 C CB  . GLU A 246 ? 0.1621 0.2881 0.6019 0.0303  -0.0015 0.0958  1045 GLU A CB  
1880 C CG  . GLU A 246 ? 0.3625 0.4646 0.8164 0.0436  0.0046  0.0937  1045 GLU A CG  
1881 C CD  . GLU A 246 ? 0.7909 0.8802 1.2269 0.0396  -0.0030 0.0954  1045 GLU A CD  
1882 O OE1 . GLU A 246 ? 0.7578 0.8625 1.1791 0.0266  -0.0147 0.1032  1045 GLU A OE1 
1883 O OE2 . GLU A 246 ? 0.7880 0.8523 1.2237 0.0478  0.0037  0.0878  1045 GLU A OE2 
1884 N N   . LEU A 247 ? 0.1234 0.2249 0.5115 0.0241  0.0181  0.0568  1046 LEU A N   
1885 C CA  . LEU A 247 ? 0.1119 0.1909 0.4741 0.0233  0.0265  0.0392  1046 LEU A CA  
1886 C C   . LEU A 247 ? 0.1639 0.2483 0.5331 0.0242  0.0362  0.0336  1046 LEU A C   
1887 O O   . LEU A 247 ? 0.1607 0.2280 0.5235 0.0280  0.0464  0.0223  1046 LEU A O   
1888 C CB  . LEU A 247 ? 0.0991 0.1749 0.4327 0.0116  0.0207  0.0338  1046 LEU A CB  
1889 C CG  . LEU A 247 ? 0.1467 0.2032 0.4569 0.0088  0.0264  0.0200  1046 LEU A CG  
1890 C CD1 . LEU A 247 ? 0.1542 0.1870 0.4540 0.0145  0.0288  0.0133  1046 LEU A CD1 
1891 C CD2 . LEU A 247 ? 0.1643 0.2222 0.4572 -0.0024 0.0219  0.0164  1046 LEU A CD2 
1892 N N   . ASP A 248 ? 0.1260 0.2362 0.5076 0.0189  0.0332  0.0417  1047 ASP A N   
1893 C CA  . ASP A 248 ? 0.1281 0.2493 0.5192 0.0183  0.0417  0.0383  1047 ASP A CA  
1894 C C   . ASP A 248 ? 0.1581 0.2787 0.5798 0.0308  0.0528  0.0372  1047 ASP A C   
1895 O O   . ASP A 248 ? 0.1581 0.2736 0.5779 0.0310  0.0650  0.0257  1047 ASP A O   
1896 C CB  . ASP A 248 ? 0.1549 0.3072 0.5551 0.0089  0.0343  0.0494  1047 ASP A CB  
1897 C CG  . ASP A 248 ? 0.3329 0.4831 0.7013 -0.0060 0.0300  0.0434  1047 ASP A CG  
1898 O OD1 . ASP A 248 ? 0.3460 0.4708 0.6888 -0.0074 0.0320  0.0320  1047 ASP A OD1 
1899 O OD2 . ASP A 248 ? 0.3859 0.5604 0.7571 -0.0168 0.0248  0.0504  1047 ASP A OD2 
1900 N N   . LYS A 249 ? 0.0967 0.2209 0.5465 0.0403  0.0494  0.0484  1048 LYS A N   
1901 C CA  . LYS A 249 ? 0.0891 0.2091 0.5735 0.0533  0.0612  0.0470  1048 LYS A CA  
1902 C C   . LYS A 249 ? 0.1500 0.2375 0.6130 0.0556  0.0729  0.0283  1048 LYS A C   
1903 O O   . LYS A 249 ? 0.1754 0.2571 0.6463 0.0581  0.0887  0.0155  1048 LYS A O   
1904 C CB  . LYS A 249 ? 0.1016 0.2328 0.6227 0.0617  0.0526  0.0665  1048 LYS A CB  
1905 C CG  . LYS A 249 ? 0.2224 0.3568 0.7925 0.0757  0.0651  0.0682  1048 LYS A CG  
1906 C CD  . LYS A 249 ? 0.4195 0.5718 1.0337 0.0831  0.0538  0.0935  1048 LYS A CD  
1907 C CE  . LYS A 249 ? 0.6146 0.7644 1.2831 0.0992  0.0682  0.0940  1048 LYS A CE  
1908 N NZ  . LYS A 249 ? 0.7253 0.9002 1.4461 0.1063  0.0558  0.1233  1048 LYS A NZ  
1909 N N   . ALA A 250 ? 0.0808 0.1495 0.5152 0.0523  0.0656  0.0261  1049 ALA A N   
1910 C CA  . ALA A 250 ? 0.0800 0.1197 0.4898 0.0512  0.0735  0.0107  1049 ALA A CA  
1911 C C   . ALA A 250 ? 0.1387 0.1714 0.5218 0.0429  0.0820  -0.0041 1049 ALA A C   
1912 O O   . ALA A 250 ? 0.1399 0.1603 0.5211 0.0427  0.0960  -0.0172 1049 ALA A O   
1913 C CB  . ALA A 250 ? 0.0818 0.1093 0.4682 0.0485  0.0617  0.0137  1049 ALA A CB  
1914 N N   . ILE A 251 ? 0.0964 0.1357 0.4573 0.0339  0.0737  -0.0020 1050 ILE A N   
1915 C CA  . ILE A 251 ? 0.0898 0.1219 0.4238 0.0240  0.0785  -0.0123 1050 ILE A CA  
1916 C C   . ILE A 251 ? 0.1545 0.2001 0.5020 0.0221  0.0905  -0.0175 1050 ILE A C   
1917 O O   . ILE A 251 ? 0.1868 0.2232 0.5178 0.0151  0.1003  -0.0291 1050 ILE A O   
1918 C CB  . ILE A 251 ? 0.1141 0.1443 0.4231 0.0157  0.0662  -0.0086 1050 ILE A CB  
1919 C CG1 . ILE A 251 ? 0.1237 0.1336 0.4133 0.0155  0.0604  -0.0106 1050 ILE A CG1 
1920 C CG2 . ILE A 251 ? 0.1345 0.1639 0.4247 0.0053  0.0693  -0.0139 1050 ILE A CG2 
1921 C CD1 . ILE A 251 ? 0.2675 0.2806 0.5649 0.0197  0.0514  -0.0030 1050 ILE A CD1 
1922 N N   . GLY A 252 ? 0.0850 0.1540 0.4625 0.0269  0.0894  -0.0083 1051 GLY A N   
1923 C CA  . GLY A 252 ? 0.0808 0.1676 0.4778 0.0261  0.1006  -0.0117 1051 GLY A CA  
1924 C C   . GLY A 252 ? 0.1223 0.2217 0.5024 0.0146  0.0962  -0.0101 1051 GLY A C   
1925 O O   . GLY A 252 ? 0.1500 0.2543 0.5272 0.0085  0.1069  -0.0187 1051 GLY A O   
1926 N N   . ARG A 253 ? 0.0552 0.1427 0.4074 0.0087  0.0780  0.0001  1052 ARG A N   
1927 C CA  . ARG A 253 ? 0.0527 0.1376 0.3774 -0.0011 0.0705  0.0017  1052 ARG A CA  
1928 C C   . ARG A 253 ? 0.0814 0.2085 0.4353 -0.0050 0.0631  0.0129  1052 ARG A C   
1929 O O   . ARG A 253 ? 0.0677 0.1935 0.4300 0.0011  0.0565  0.0195  1052 ARG A O   
1930 C CB  . ARG A 253 ? 0.0535 0.0903 0.3171 -0.0065 0.0650  -0.0087 1052 ARG A CB  
1931 C CG  . ARG A 253 ? 0.0699 0.1411 0.3660 -0.0122 0.0704  -0.0084 1052 ARG A CG  
1932 C CD  . ARG A 253 ? 0.0704 0.1258 0.3381 -0.0232 0.0705  -0.0135 1052 ARG A CD  
1933 N NE  . ARG A 253 ? 0.0923 0.1281 0.3426 -0.0243 0.0616  -0.0123 1052 ARG A NE  
1934 C CZ  . ARG A 253 ? 0.3089 0.3441 0.5553 -0.0282 0.0538  -0.0088 1052 ARG A CZ  
1935 N NH1 . ARG A 253 ? 0.1742 0.2277 0.4290 -0.0329 0.0531  -0.0059 1052 ARG A NH1 
1936 N NH2 . ARG A 253 ? 0.2161 0.2337 0.4516 -0.0283 0.0475  -0.0089 1052 ARG A NH2 
1937 N N   . ASN A 254 ? 0.0501 0.1808 0.3854 -0.0161 0.0582  0.0140  1053 ASN A N   
1938 C CA  . ASN A 254 ? 0.0490 0.1851 0.3737 -0.0227 0.0466  0.0211  1053 ASN A CA  
1939 C C   . ASN A 254 ? 0.1177 0.2404 0.4253 -0.0308 0.0451  0.0139  1053 ASN A C   
1940 O O   . ASN A 254 ? 0.1209 0.2383 0.4118 -0.0414 0.0456  0.0091  1053 ASN A O   
1941 C CB  . ASN A 254 ? 0.0509 0.2023 0.3700 -0.0306 0.0439  0.0255  1053 ASN A CB  
1942 C CG  . ASN A 254 ? 0.4188 0.6113 0.7598 -0.0468 0.0374  0.0340  1053 ASN A CG  
1943 O OD1 . ASN A 254 ? 0.4067 0.6270 0.7566 -0.0566 0.0347  0.0410  1053 ASN A OD1 
1944 N ND2 . ASN A 254 ? 0.4039 0.5819 0.7322 -0.0471 0.0321  0.0325  1053 ASN A ND2 
1945 N N   . THR A 255 ? 0.1079 0.2145 0.4120 -0.0235 0.0420  0.0131  1054 THR A N   
1946 C CA  . THR A 255 ? 0.1164 0.1984 0.3992 -0.0257 0.0393  0.0066  1054 THR A CA  
1947 C C   . THR A 255 ? 0.1974 0.2828 0.4713 -0.0364 0.0341  0.0058  1054 THR A C   
1948 O O   . THR A 255 ? 0.2210 0.2882 0.4802 -0.0413 0.0348  -0.0011 1054 THR A O   
1949 C CB  . THR A 255 ? 0.1166 0.1841 0.4008 -0.0152 0.0378  0.0065  1054 THR A CB  
1950 O OG1 . THR A 255 ? 0.0947 0.1776 0.3934 -0.0129 0.0318  0.0149  1054 THR A OG1 
1951 C CG2 . THR A 255 ? 0.0456 0.0997 0.3300 -0.0063 0.0448  0.0032  1054 THR A CG2 
1952 N N   . ASN A 256 ? 0.1576 0.2662 0.4415 -0.0413 0.0291  0.0129  1055 ASN A N   
1953 C CA  . ASN A 256 ? 0.1706 0.2845 0.4444 -0.0548 0.0257  0.0100  1055 ASN A CA  
1954 C C   . ASN A 256 ? 0.2370 0.3323 0.5021 -0.0524 0.0239  0.0043  1055 ASN A C   
1955 O O   . ASN A 256 ? 0.2691 0.3562 0.5237 -0.0618 0.0255  -0.0044 1055 ASN A O   
1956 C CB  . ASN A 256 ? 0.2243 0.3328 0.4862 -0.0664 0.0304  0.0020  1055 ASN A CB  
1957 C CG  . ASN A 256 ? 0.6816 0.7983 0.9350 -0.0833 0.0297  -0.0032 1055 ASN A CG  
1958 O OD1 . ASN A 256 ? 0.6996 0.8343 0.9557 -0.0892 0.0248  0.0015  1055 ASN A OD1 
1959 N ND2 . ASN A 256 ? 0.6248 0.7283 0.8680 -0.0927 0.0352  -0.0129 1055 ASN A ND2 
1960 N N   . GLY A 257 ? 0.1702 0.2588 0.4419 -0.0401 0.0216  0.0085  1056 GLY A N   
1961 C CA  . GLY A 257 ? 0.1548 0.2273 0.4196 -0.0370 0.0197  0.0039  1056 GLY A CA  
1962 C C   . GLY A 257 ? 0.1752 0.2204 0.4302 -0.0323 0.0234  -0.0047 1056 GLY A C   
1963 O O   . GLY A 257 ? 0.1757 0.2074 0.4267 -0.0296 0.0221  -0.0087 1056 GLY A O   
1964 N N   . VAL A 258 ? 0.0971 0.1353 0.3490 -0.0321 0.0274  -0.0063 1057 VAL A N   
1965 C CA  . VAL A 258 ? 0.0764 0.0907 0.3196 -0.0297 0.0290  -0.0110 1057 VAL A CA  
1966 C C   . VAL A 258 ? 0.1310 0.1386 0.3719 -0.0232 0.0313  -0.0086 1057 VAL A C   
1967 O O   . VAL A 258 ? 0.1378 0.1536 0.3796 -0.0259 0.0352  -0.0074 1057 VAL A O   
1968 C CB  . VAL A 258 ? 0.1118 0.1184 0.3503 -0.0393 0.0313  -0.0159 1057 VAL A CB  
1969 C CG1 . VAL A 258 ? 0.1088 0.0915 0.3425 -0.0364 0.0305  -0.0164 1057 VAL A CG1 
1970 C CG2 . VAL A 258 ? 0.1078 0.1197 0.3482 -0.0481 0.0320  -0.0221 1057 VAL A CG2 
1971 N N   . ILE A 259 ? 0.0850 0.0785 0.3220 -0.0167 0.0298  -0.0090 1058 ILE A N   
1972 C CA  . ILE A 259 ? 0.0902 0.0754 0.3213 -0.0135 0.0329  -0.0089 1058 ILE A CA  
1973 C C   . ILE A 259 ? 0.2054 0.1722 0.4241 -0.0175 0.0300  -0.0089 1058 ILE A C   
1974 O O   . ILE A 259 ? 0.2167 0.1768 0.4369 -0.0199 0.0261  -0.0088 1058 ILE A O   
1975 C CB  . ILE A 259 ? 0.1074 0.0928 0.3440 -0.0050 0.0344  -0.0088 1058 ILE A CB  
1976 C CG1 . ILE A 259 ? 0.0964 0.0739 0.3321 -0.0016 0.0287  -0.0086 1058 ILE A CG1 
1977 C CG2 . ILE A 259 ? 0.0938 0.0978 0.3476 -0.0011 0.0377  -0.0058 1058 ILE A CG2 
1978 C CD1 . ILE A 259 ? 0.1226 0.0885 0.3526 0.0021  0.0295  -0.0100 1058 ILE A CD1 
1979 N N   . THR A 260 ? 0.1942 0.1543 0.4025 -0.0196 0.0324  -0.0086 1059 THR A N   
1980 C CA  . THR A 260 ? 0.2087 0.1547 0.4043 -0.0259 0.0281  -0.0050 1059 THR A CA  
1981 C C   . THR A 260 ? 0.2892 0.2272 0.4779 -0.0235 0.0260  -0.0051 1059 THR A C   
1982 O O   . THR A 260 ? 0.2970 0.2393 0.4897 -0.0175 0.0304  -0.0095 1059 THR A O   
1983 C CB  . THR A 260 ? 0.2887 0.2374 0.4737 -0.0354 0.0326  -0.0044 1059 THR A CB  
1984 O OG1 . THR A 260 ? 0.2538 0.2066 0.4331 -0.0358 0.0403  -0.0096 1059 THR A OG1 
1985 C CG2 . THR A 260 ? 0.2851 0.2453 0.4772 -0.0379 0.0365  -0.0056 1059 THR A CG2 
1986 N N   . LYS A 261 ? 0.2574 0.1846 0.4372 -0.0289 0.0190  0.0009  1060 LYS A N   
1987 C CA  . LYS A 261 ? 0.2591 0.1804 0.4307 -0.0291 0.0161  0.0014  1060 LYS A CA  
1988 C C   . LYS A 261 ? 0.3277 0.2520 0.4882 -0.0324 0.0255  -0.0058 1060 LYS A C   
1989 O O   . LYS A 261 ? 0.3299 0.2523 0.4911 -0.0277 0.0280  -0.0104 1060 LYS A O   
1990 C CB  . LYS A 261 ? 0.2986 0.2120 0.4623 -0.0377 0.0062  0.0119  1060 LYS A CB  
1991 C CG  . LYS A 261 ? 0.3913 0.3010 0.5461 -0.0401 0.0018  0.0138  1060 LYS A CG  
1992 C CD  . LYS A 261 ? 0.5814 0.4911 0.7135 -0.0562 0.0005  0.0182  1060 LYS A CD  
1993 C CE  . LYS A 261 ? 0.7824 0.6955 0.8991 -0.0617 0.0134  0.0059  1060 LYS A CE  
1994 N NZ  . LYS A 261 ? 0.9097 0.8241 1.0014 -0.0816 0.0129  0.0089  1060 LYS A NZ  
1995 N N   . ASP A 262 ? 0.2877 0.2163 0.4389 -0.0414 0.0317  -0.0077 1061 ASP A N   
1996 C CA  . ASP A 262 ? 0.2995 0.2312 0.4413 -0.0471 0.0437  -0.0170 1061 ASP A CA  
1997 C C   . ASP A 262 ? 0.3108 0.2488 0.4712 -0.0350 0.0538  -0.0256 1061 ASP A C   
1998 O O   . ASP A 262 ? 0.3188 0.2546 0.4780 -0.0353 0.0634  -0.0342 1061 ASP A O   
1999 C CB  . ASP A 262 ? 0.3575 0.2942 0.4863 -0.0611 0.0480  -0.0169 1061 ASP A CB  
2000 C CG  . ASP A 262 ? 0.6948 0.6257 0.8057 -0.0750 0.0363  -0.0050 1061 ASP A CG  
2001 O OD1 . ASP A 262 ? 0.7313 0.6580 0.8510 -0.0715 0.0252  0.0057  1061 ASP A OD1 
2002 O OD2 . ASP A 262 ? 0.8191 0.7500 0.9087 -0.0907 0.0385  -0.0061 1061 ASP A OD2 
2003 N N   . GLU A 263 ? 0.2183 0.1641 0.3971 -0.0254 0.0514  -0.0224 1062 GLU A N   
2004 C CA  . GLU A 263 ? 0.1782 0.1330 0.3785 -0.0142 0.0573  -0.0255 1062 GLU A CA  
2005 C C   . GLU A 263 ? 0.1917 0.1391 0.3962 -0.0066 0.0523  -0.0243 1062 GLU A C   
2006 O O   . GLU A 263 ? 0.1808 0.1264 0.3935 -0.0017 0.0592  -0.0289 1062 GLU A O   
2007 C CB  . GLU A 263 ? 0.1727 0.1412 0.3875 -0.0109 0.0545  -0.0207 1062 GLU A CB  
2008 C CG  . GLU A 263 ? 0.2693 0.2451 0.4791 -0.0194 0.0592  -0.0217 1062 GLU A CG  
2009 C CD  . GLU A 263 ? 0.6158 0.6077 0.8391 -0.0186 0.0588  -0.0184 1062 GLU A CD  
2010 O OE1 . GLU A 263 ? 0.4456 0.4409 0.6758 -0.0154 0.0514  -0.0138 1062 GLU A OE1 
2011 O OE2 . GLU A 263 ? 0.6784 0.6806 0.9041 -0.0233 0.0664  -0.0211 1062 GLU A OE2 
2012 N N   . ALA A 264 ? 0.1319 0.0739 0.3312 -0.0066 0.0414  -0.0188 1063 ALA A N   
2013 C CA  . ALA A 264 ? 0.1252 0.0611 0.3264 -0.0014 0.0360  -0.0177 1063 ALA A CA  
2014 C C   . ALA A 264 ? 0.2338 0.1594 0.4235 -0.0046 0.0403  -0.0226 1063 ALA A C   
2015 O O   . ALA A 264 ? 0.2393 0.1615 0.4350 0.0009  0.0413  -0.0243 1063 ALA A O   
2016 C CB  . ALA A 264 ? 0.1265 0.0583 0.3243 -0.0033 0.0257  -0.0127 1063 ALA A CB  
2017 N N   . GLU A 265 ? 0.2245 0.1460 0.3968 -0.0156 0.0431  -0.0248 1064 GLU A N   
2018 C CA  . GLU A 265 ? 0.2474 0.1607 0.4049 -0.0232 0.0486  -0.0311 1064 GLU A CA  
2019 C C   . GLU A 265 ? 0.3016 0.2154 0.4685 -0.0205 0.0645  -0.0422 1064 GLU A C   
2020 O O   . GLU A 265 ? 0.3057 0.2113 0.4718 -0.0200 0.0700  -0.0484 1064 GLU A O   
2021 C CB  . GLU A 265 ? 0.2852 0.1966 0.4192 -0.0395 0.0454  -0.0285 1064 GLU A CB  
2022 C CG  . GLU A 265 ? 0.4599 0.3641 0.5754 -0.0499 0.0461  -0.0320 1064 GLU A CG  
2023 C CD  . GLU A 265 ? 0.9338 0.8392 1.0236 -0.0702 0.0436  -0.0290 1064 GLU A CD  
2024 O OE1 . GLU A 265 ? 0.9751 0.8782 1.0477 -0.0832 0.0534  -0.0390 1064 GLU A OE1 
2025 O OE2 . GLU A 265 ? 0.9496 0.8582 1.0367 -0.0745 0.0317  -0.0163 1064 GLU A OE2 
2026 N N   . LYS A 266 ? 0.2572 0.1806 0.4363 -0.0182 0.0722  -0.0446 1065 LYS A N   
2027 C CA  . LYS A 266 ? 0.2644 0.1906 0.4615 -0.0136 0.0882  -0.0543 1065 LYS A CA  
2028 C C   . LYS A 266 ? 0.3099 0.2337 0.5302 0.0006  0.0870  -0.0514 1065 LYS A C   
2029 O O   . LYS A 266 ? 0.3212 0.2358 0.5482 0.0024  0.0969  -0.0593 1065 LYS A O   
2030 C CB  . LYS A 266 ? 0.3077 0.2487 0.5184 -0.0120 0.0932  -0.0537 1065 LYS A CB  
2031 C CG  . LYS A 266 ? 0.6316 0.5783 0.8674 -0.0067 0.1107  -0.0634 1065 LYS A CG  
2032 C CD  . LYS A 266 ? 0.7293 0.6921 0.9979 0.0066  0.1084  -0.0547 1065 LYS A CD  
2033 C CE  . LYS A 266 ? 0.8331 0.8042 1.1309 0.0114  0.1260  -0.0631 1065 LYS A CE  
2034 N NZ  . LYS A 266 ? 0.8835 0.8728 1.2166 0.0239  0.1219  -0.0515 1065 LYS A NZ  
2035 N N   . LEU A 267 ? 0.2464 0.1781 0.4776 0.0087  0.0748  -0.0400 1066 LEU A N   
2036 C CA  . LEU A 267 ? 0.2260 0.1589 0.4765 0.0195  0.0697  -0.0333 1066 LEU A CA  
2037 C C   . LEU A 267 ? 0.2707 0.1886 0.5089 0.0180  0.0668  -0.0355 1066 LEU A C   
2038 O O   . LEU A 267 ? 0.2752 0.1882 0.5286 0.0247  0.0696  -0.0350 1066 LEU A O   
2039 C CB  . LEU A 267 ? 0.2043 0.1488 0.4575 0.0216  0.0562  -0.0225 1066 LEU A CB  
2040 C CG  . LEU A 267 ? 0.2381 0.2009 0.5143 0.0270  0.0551  -0.0150 1066 LEU A CG  
2041 C CD1 . LEU A 267 ? 0.2106 0.1826 0.4811 0.0238  0.0433  -0.0081 1066 LEU A CD1 
2042 C CD2 . LEU A 267 ? 0.2565 0.2224 0.5586 0.0361  0.0567  -0.0096 1066 LEU A CD2 
2043 N N   . PHE A 268 ? 0.2052 0.1167 0.4181 0.0091  0.0601  -0.0361 1067 PHE A N   
2044 C CA  . PHE A 268 ? 0.1996 0.0996 0.4001 0.0061  0.0563  -0.0374 1067 PHE A CA  
2045 C C   . PHE A 268 ? 0.2865 0.1754 0.4851 0.0025  0.0702  -0.0486 1067 PHE A C   
2046 O O   . PHE A 268 ? 0.2999 0.1815 0.5102 0.0084  0.0731  -0.0496 1067 PHE A O   
2047 C CB  . PHE A 268 ? 0.2158 0.1139 0.3940 -0.0034 0.0465  -0.0342 1067 PHE A CB  
2048 C CG  . PHE A 268 ? 0.2311 0.1198 0.3965 -0.0081 0.0427  -0.0353 1067 PHE A CG  
2049 C CD1 . PHE A 268 ? 0.2455 0.1336 0.4190 -0.0014 0.0357  -0.0310 1067 PHE A CD1 
2050 C CD2 . PHE A 268 ? 0.2701 0.1527 0.4142 -0.0214 0.0461  -0.0405 1067 PHE A CD2 
2051 C CE1 . PHE A 268 ? 0.2574 0.1384 0.4194 -0.0065 0.0321  -0.0320 1067 PHE A CE1 
2052 C CE2 . PHE A 268 ? 0.3090 0.1851 0.4407 -0.0274 0.0420  -0.0409 1067 PHE A CE2 
2053 C CZ  . PHE A 268 ? 0.2679 0.1429 0.4095 -0.0191 0.0350  -0.0366 1067 PHE A CZ  
2054 N N   . ASN A 269 ? 0.2510 0.1390 0.4368 -0.0079 0.0802  -0.0575 1068 ASN A N   
2055 C CA  . ASN A 269 ? 0.2648 0.1428 0.4473 -0.0149 0.0974  -0.0723 1068 ASN A CA  
2056 C C   . ASN A 269 ? 0.3384 0.2120 0.5536 -0.0017 0.1086  -0.0760 1068 ASN A C   
2057 O O   . ASN A 269 ? 0.3696 0.2295 0.5857 -0.0042 0.1191  -0.0858 1068 ASN A O   
2058 C CB  . ASN A 269 ? 0.2347 0.1178 0.4032 -0.0281 0.1075  -0.0810 1068 ASN A CB  
2059 C CG  . ASN A 269 ? 0.5342 0.4198 0.6703 -0.0441 0.0967  -0.0759 1068 ASN A CG  
2060 O OD1 . ASN A 269 ? 0.4590 0.3423 0.5841 -0.0453 0.0822  -0.0665 1068 ASN A OD1 
2061 N ND2 . ASN A 269 ? 0.4635 0.3551 0.5855 -0.0575 0.1032  -0.0808 1068 ASN A ND2 
2062 N N   . GLN A 270 ? 0.2704 0.1559 0.5135 0.0117  0.1052  -0.0668 1069 GLN A N   
2063 C CA  . GLN A 270 ? 0.2587 0.1424 0.5378 0.0247  0.1126  -0.0653 1069 GLN A CA  
2064 C C   . GLN A 270 ? 0.2951 0.1688 0.5760 0.0292  0.1039  -0.0585 1069 GLN A C   
2065 O O   . GLN A 270 ? 0.3162 0.1747 0.6057 0.0299  0.1145  -0.0662 1069 GLN A O   
2066 C CB  . GLN A 270 ? 0.2586 0.1615 0.5657 0.0352  0.1084  -0.0540 1069 GLN A CB  
2067 C CG  . GLN A 270 ? 0.4255 0.3382 0.7379 0.0318  0.1208  -0.0624 1069 GLN A CG  
2068 C CD  . GLN A 270 ? 0.7023 0.6367 1.0331 0.0382  0.1133  -0.0502 1069 GLN A CD  
2069 O OE1 . GLN A 270 ? 0.6194 0.5634 0.9715 0.0475  0.1028  -0.0356 1069 GLN A OE1 
2070 N NE2 . GLN A 270 ? 0.6172 0.5610 0.9390 0.0311  0.1186  -0.0557 1069 GLN A NE2 
2071 N N   . ASP A 271 ? 0.2410 0.1220 0.5114 0.0301  0.0860  -0.0461 1070 ASP A N   
2072 C CA  . ASP A 271 ? 0.2301 0.1050 0.4986 0.0323  0.0758  -0.0387 1070 ASP A CA  
2073 C C   . ASP A 271 ? 0.2748 0.1312 0.5238 0.0240  0.0811  -0.0490 1070 ASP A C   
2074 O O   . ASP A 271 ? 0.2677 0.1147 0.5250 0.0272  0.0801  -0.0464 1070 ASP A O   
2075 C CB  . ASP A 271 ? 0.2331 0.1203 0.4893 0.0310  0.0587  -0.0282 1070 ASP A CB  
2076 C CG  . ASP A 271 ? 0.4226 0.3280 0.6991 0.0378  0.0514  -0.0161 1070 ASP A CG  
2077 O OD1 . ASP A 271 ? 0.4434 0.3597 0.7099 0.0346  0.0418  -0.0117 1070 ASP A OD1 
2078 O OD2 . ASP A 271 ? 0.5125 0.4215 0.8166 0.0454  0.0552  -0.0105 1070 ASP A OD2 
2079 N N   . VAL A 272 ? 0.2404 0.0925 0.4638 0.0117  0.0868  -0.0599 1071 VAL A N   
2080 C CA  . VAL A 272 ? 0.2641 0.1014 0.4649 -0.0004 0.0922  -0.0704 1071 VAL A CA  
2081 C C   . VAL A 272 ? 0.3540 0.1752 0.5698 -0.0003 0.1122  -0.0841 1071 VAL A C   
2082 O O   . VAL A 272 ? 0.3485 0.1549 0.5603 -0.0037 0.1153  -0.0886 1071 VAL A O   
2083 C CB  . VAL A 272 ? 0.3182 0.1596 0.4871 -0.0164 0.0905  -0.0751 1071 VAL A CB  
2084 C CG1 . VAL A 272 ? 0.3342 0.1638 0.4779 -0.0317 0.0943  -0.0842 1071 VAL A CG1 
2085 C CG2 . VAL A 272 ? 0.2974 0.1521 0.4588 -0.0148 0.0720  -0.0614 1071 VAL A CG2 
2086 N N   . ASP A 273 ? 0.3307 0.1545 0.5646 0.0028  0.1268  -0.0918 1072 ASP A N   
2087 C CA  . ASP A 273 ? 0.3576 0.1671 0.6144 0.0047  0.1485  -0.1060 1072 ASP A CA  
2088 C C   . ASP A 273 ? 0.4034 0.2070 0.6942 0.0209  0.1436  -0.0937 1072 ASP A C   
2089 O O   . ASP A 273 ? 0.4128 0.1977 0.7077 0.0194  0.1506  -0.0996 1072 ASP A O   
2090 C CB  . ASP A 273 ? 0.3926 0.2112 0.6678 0.0068  0.1633  -0.1142 1072 ASP A CB  
2091 C CG  . ASP A 273 ? 0.6866 0.5139 0.9283 -0.0103 0.1665  -0.1236 1072 ASP A CG  
2092 O OD1 . ASP A 273 ? 0.7378 0.5577 0.9440 -0.0283 0.1675  -0.1323 1072 ASP A OD1 
2093 O OD2 . ASP A 273 ? 0.8014 0.6438 1.0522 -0.0073 0.1675  -0.1213 1072 ASP A OD2 
2094 N N   . ALA A 274 ? 0.3238 0.1441 0.6339 0.0334  0.1289  -0.0751 1073 ALA A N   
2095 C CA  . ALA A 274 ? 0.3037 0.1236 0.6429 0.0459  0.1199  -0.0589 1073 ALA A CA  
2096 C C   . ALA A 274 ? 0.3484 0.1551 0.6687 0.0407  0.1113  -0.0562 1073 ALA A C   
2097 O O   . ALA A 274 ? 0.3355 0.1308 0.6787 0.0469  0.1126  -0.0505 1073 ALA A O   
2098 C CB  . ALA A 274 ? 0.2858 0.1294 0.6346 0.0531  0.1030  -0.0402 1073 ALA A CB  
2099 N N   . ALA A 275 ? 0.3069 0.1154 0.5881 0.0289  0.1026  -0.0596 1074 ALA A N   
2100 C CA  . ALA A 275 ? 0.2987 0.0981 0.5608 0.0227  0.0941  -0.0575 1074 ALA A CA  
2101 C C   . ALA A 275 ? 0.3931 0.1699 0.6464 0.0134  0.1099  -0.0740 1074 ALA A C   
2102 O O   . ALA A 275 ? 0.4088 0.1723 0.6697 0.0147  0.1094  -0.0713 1074 ALA A O   
2103 C CB  . ALA A 275 ? 0.2856 0.0974 0.5159 0.0145  0.0793  -0.0539 1074 ALA A CB  
2104 N N   . VAL A 276 ? 0.3604 0.1329 0.5975 0.0024  0.1244  -0.0914 1075 VAL A N   
2105 C CA  . VAL A 276 ? 0.3883 0.1394 0.6154 -0.0099 0.1425  -0.1104 1075 VAL A CA  
2106 C C   . VAL A 276 ? 0.4615 0.1946 0.7295 0.0011  0.1592  -0.1151 1075 VAL A C   
2107 O O   . VAL A 276 ? 0.4853 0.1991 0.7545 -0.0024 0.1642  -0.1195 1075 VAL A O   
2108 C CB  . VAL A 276 ? 0.4554 0.2077 0.6511 -0.0291 0.1541  -0.1282 1075 VAL A CB  
2109 C CG1 . VAL A 276 ? 0.4383 0.2065 0.5980 -0.0399 0.1353  -0.1195 1075 VAL A CG1 
2110 C CG2 . VAL A 276 ? 0.4618 0.2208 0.6745 -0.0256 0.1683  -0.1363 1075 VAL A CG2 
2111 N N   . ARG A 277 ? 0.3994 0.1398 0.7044 0.0152  0.1655  -0.1113 1076 ARG A N   
2112 C CA  . ARG A 277 ? 0.4098 0.1363 0.7638 0.0287  0.1792  -0.1112 1076 ARG A CA  
2113 C C   . ARG A 277 ? 0.4661 0.1842 0.8337 0.0363  0.1654  -0.0934 1076 ARG A C   
2114 O O   . ARG A 277 ? 0.4887 0.1831 0.8705 0.0354  0.1771  -0.1004 1076 ARG A O   
2115 C CB  . ARG A 277 ? 0.4021 0.1460 0.7949 0.0441  0.1804  -0.1020 1076 ARG A CB  
2116 C CG  . ARG A 277 ? 0.5704 0.3161 0.9673 0.0389  0.2031  -0.1233 1076 ARG A CG  
2117 C CD  . ARG A 277 ? 0.6099 0.3807 1.0284 0.0494  0.1984  -0.1130 1076 ARG A CD  
2118 N NE  . ARG A 277 ? 0.7540 0.5335 1.2178 0.0683  0.1866  -0.0890 1076 ARG A NE  
2119 C CZ  . ARG A 277 ? 0.9915 0.7962 1.4609 0.0754  0.1679  -0.0689 1076 ARG A CZ  
2120 N NH1 . ARG A 277 ? 0.8594 0.6807 1.2949 0.0672  0.1601  -0.0706 1076 ARG A NH1 
2121 N NH2 . ARG A 277 ? 0.8490 0.6628 1.3584 0.0894  0.1568  -0.0462 1076 ARG A NH2 
2122 N N   . GLY A 278 ? 0.4030 0.1400 0.7626 0.0408  0.1414  -0.0723 1077 GLY A N   
2123 C CA  . GLY A 278 ? 0.3949 0.1289 0.7619 0.0448  0.1260  -0.0542 1077 GLY A CA  
2124 C C   . GLY A 278 ? 0.4353 0.1516 0.7721 0.0318  0.1261  -0.0627 1077 GLY A C   
2125 O O   . GLY A 278 ? 0.4492 0.1520 0.8008 0.0342  0.1233  -0.0542 1077 GLY A O   
2126 N N   . ILE A 279 ? 0.3621 0.0796 0.6569 0.0167  0.1283  -0.0778 1078 ILE A N   
2127 C CA  . ILE A 279 ? 0.3619 0.0663 0.6256 0.0020  0.1279  -0.0860 1078 ILE A CA  
2128 C C   . ILE A 279 ? 0.4670 0.1423 0.7459 -0.0016 0.1502  -0.1021 1078 ILE A C   
2129 O O   . ILE A 279 ? 0.4802 0.1392 0.7614 -0.0040 0.1491  -0.0993 1078 ILE A O   
2130 C CB  . ILE A 279 ? 0.3859 0.1018 0.6050 -0.0141 0.1240  -0.0956 1078 ILE A CB  
2131 C CG1 . ILE A 279 ? 0.3500 0.0894 0.5546 -0.0119 0.1005  -0.0789 1078 ILE A CG1 
2132 C CG2 . ILE A 279 ? 0.4128 0.1124 0.6027 -0.0330 0.1322  -0.1108 1078 ILE A CG2 
2133 C CD1 . ILE A 279 ? 0.4008 0.1563 0.5790 -0.0205 0.0964  -0.0830 1078 ILE A CD1 
2134 N N   . LEU A 280 ? 0.4331 0.1016 0.7238 -0.0026 0.1718  -0.1198 1079 LEU A N   
2135 C CA  . LEU A 280 ? 0.4620 0.1018 0.7698 -0.0073 0.1982  -0.1403 1079 LEU A CA  
2136 C C   . LEU A 280 ? 0.5183 0.1412 0.8796 0.0102  0.2022  -0.1287 1079 LEU A C   
2137 O O   . LEU A 280 ? 0.5426 0.1380 0.9138 0.0054  0.2167  -0.1395 1079 LEU A O   
2138 C CB  . LEU A 280 ? 0.4764 0.1160 0.7821 -0.0152 0.2214  -0.1640 1079 LEU A CB  
2139 C CG  . LEU A 280 ? 0.5209 0.1763 0.7740 -0.0359 0.2185  -0.1749 1079 LEU A CG  
2140 C CD1 . LEU A 280 ? 0.5354 0.1921 0.7912 -0.0434 0.2417  -0.1965 1079 LEU A CD1 
2141 C CD2 . LEU A 280 ? 0.5491 0.1939 0.7597 -0.0585 0.2183  -0.1853 1079 LEU A CD2 
2142 N N   . ARG A 281 ? 0.4492 0.0892 0.8439 0.0289  0.1876  -0.1048 1080 ARG A N   
2143 C CA  . ARG A 281 ? 0.4449 0.0744 0.8916 0.0451  0.1856  -0.0866 1080 ARG A CA  
2144 C C   . ARG A 281 ? 0.4702 0.0922 0.9022 0.0405  0.1682  -0.0713 1080 ARG A C   
2145 O O   . ARG A 281 ? 0.4426 0.0562 0.9119 0.0508  0.1623  -0.0524 1080 ARG A O   
2146 C CB  . ARG A 281 ? 0.3992 0.0593 0.8790 0.0613  0.1708  -0.0620 1080 ARG A CB  
2147 C CG  . ARG A 281 ? 0.4412 0.1054 0.9495 0.0703  0.1875  -0.0727 1080 ARG A CG  
2148 C CD  . ARG A 281 ? 0.5664 0.2547 1.1158 0.0873  0.1723  -0.0452 1080 ARG A CD  
2149 N NE  . ARG A 281 ? 0.7362 0.4473 1.2864 0.0901  0.1762  -0.0507 1080 ARG A NE  
2150 C CZ  . ARG A 281 ? 0.9470 0.6557 1.5332 0.0971  0.1981  -0.0638 1080 ARG A CZ  
2151 N NH1 . ARG A 281 ? 0.8176 0.5007 1.4454 0.1028  0.2198  -0.0741 1080 ARG A NH1 
2152 N NH2 . ARG A 281 ? 0.7647 0.4961 1.3470 0.0978  0.1995  -0.0676 1080 ARG A NH2 
2153 N N   . ASN A 282 ? 0.4417 0.0695 0.8210 0.0247  0.1586  -0.0774 1081 ASN A N   
2154 C CA  . ASN A 282 ? 0.4497 0.0747 0.8099 0.0181  0.1421  -0.0651 1081 ASN A CA  
2155 C C   . ASN A 282 ? 0.5631 0.1602 0.9034 0.0028  0.1561  -0.0838 1081 ASN A C   
2156 O O   . ASN A 282 ? 0.5802 0.1734 0.8884 -0.0119 0.1686  -0.1066 1081 ASN A O   
2157 C CB  . ASN A 282 ? 0.3887 0.0440 0.7113 0.0126  0.1196  -0.0551 1081 ASN A CB  
2158 C CG  . ASN A 282 ? 0.7133 0.3740 1.0343 0.0126  0.0994  -0.0340 1081 ASN A CG  
2159 O OD1 . ASN A 282 ? 0.6266 0.2783 0.9234 0.0008  0.0962  -0.0373 1081 ASN A OD1 
2160 N ND2 . ASN A 282 ? 0.6430 0.3216 0.9889 0.0239  0.0854  -0.0118 1081 ASN A ND2 
2161 N N   . ALA A 283 ? 0.5442 0.1225 0.9028 0.0044  0.1533  -0.0730 1082 ALA A N   
2162 C CA  . ALA A 283 ? 0.5821 0.1308 0.9272 -0.0097 0.1662  -0.0883 1082 ALA A CA  
2163 C C   . ALA A 283 ? 0.6371 0.1950 0.9265 -0.0293 0.1562  -0.0952 1082 ALA A C   
2164 O O   . ALA A 283 ? 0.6593 0.2023 0.9232 -0.0461 0.1716  -0.1180 1082 ALA A O   
2165 C CB  . ALA A 283 ? 0.6091 0.1376 0.9909 -0.0020 0.1625  -0.0703 1082 ALA A CB  
2166 N N   . LYS A 284 ? 0.5807 0.1643 0.8526 -0.0285 0.1313  -0.0761 1083 LYS A N   
2167 C CA  . LYS A 284 ? 0.5757 0.1719 0.8010 -0.0452 0.1204  -0.0801 1083 LYS A CA  
2168 C C   . LYS A 284 ? 0.6259 0.2421 0.8217 -0.0522 0.1214  -0.0927 1083 LYS A C   
2169 O O   . LYS A 284 ? 0.6356 0.2574 0.7944 -0.0692 0.1191  -0.1020 1083 LYS A O   
2170 C CB  . LYS A 284 ? 0.5778 0.1957 0.7995 -0.0416 0.0954  -0.0564 1083 LYS A CB  
2171 C CG  . LYS A 284 ? 0.7722 0.3725 1.0079 -0.0432 0.0911  -0.0442 1083 LYS A CG  
2172 C CD  . LYS A 284 ? 0.8469 0.4711 1.0688 -0.0462 0.0680  -0.0253 1083 LYS A CD  
2173 C CE  . LYS A 284 ? 0.9569 0.5819 1.1425 -0.0642 0.0639  -0.0329 1083 LYS A CE  
2174 N NZ  . LYS A 284 ? 1.0506 0.6953 1.2301 -0.0672 0.0443  -0.0148 1083 LYS A NZ  
2175 N N   . LEU A 285 ? 0.5591 0.1868 0.7722 -0.0401 0.1238  -0.0913 1084 LEU A N   
2176 C CA  . LEU A 285 ? 0.5388 0.1865 0.7271 -0.0458 0.1228  -0.0996 1084 LEU A CA  
2177 C C   . LEU A 285 ? 0.6134 0.2464 0.7892 -0.0589 0.1458  -0.1247 1084 LEU A C   
2178 O O   . LEU A 285 ? 0.6244 0.2637 0.7630 -0.0774 0.1459  -0.1354 1084 LEU A O   
2179 C CB  . LEU A 285 ? 0.5105 0.1792 0.7197 -0.0290 0.1142  -0.0865 1084 LEU A CB  
2180 C CG  . LEU A 285 ? 0.5301 0.2248 0.7330 -0.0238 0.0903  -0.0668 1084 LEU A CG  
2181 C CD1 . LEU A 285 ? 0.5272 0.2392 0.7540 -0.0085 0.0847  -0.0552 1084 LEU A CD1 
2182 C CD2 . LEU A 285 ? 0.5062 0.2172 0.6715 -0.0369 0.0811  -0.0711 1084 LEU A CD2 
2183 N N   . LYS A 286 ? 0.5692 0.1847 0.7774 -0.0505 0.1653  -0.1338 1085 LYS A N   
2184 C CA  . LYS A 286 ? 0.5769 0.1802 0.7762 -0.0636 0.1905  -0.1604 1085 LYS A CA  
2185 C C   . LYS A 286 ? 0.6026 0.1991 0.7559 -0.0916 0.1969  -0.1784 1085 LYS A C   
2186 O O   . LYS A 286 ? 0.5763 0.1871 0.6994 -0.1064 0.1991  -0.1885 1085 LYS A O   
2187 C CB  . LYS A 286 ? 0.6300 0.2084 0.8760 -0.0524 0.2148  -0.1709 1085 LYS A CB  
2188 C CG  . LYS A 286 ? 0.8332 0.4048 1.0757 -0.0635 0.2420  -0.1988 1085 LYS A CG  
2189 C CD  . LYS A 286 ? 0.9312 0.4855 1.2310 -0.0466 0.2640  -0.2054 1085 LYS A CD  
2190 C CE  . LYS A 286 ? 1.0712 0.6062 1.3709 -0.0622 0.2989  -0.2401 1085 LYS A CE  
2191 N NZ  . LYS A 286 ? 1.2098 0.7665 1.4838 -0.0735 0.3049  -0.2531 1085 LYS A NZ  
2192 N N   . PRO A 287 ? 0.5716 0.1511 0.7156 -0.1009 0.1964  -0.1796 1086 PRO A N   
2193 C CA  . PRO A 287 ? 0.5971 0.1739 0.6962 -0.1296 0.2016  -0.1959 1086 PRO A CA  
2194 C C   . PRO A 287 ? 0.6576 0.2662 0.7162 -0.1421 0.1800  -0.1865 1086 PRO A C   
2195 O O   . PRO A 287 ? 0.6826 0.2953 0.7050 -0.1673 0.1864  -0.2009 1086 PRO A O   
2196 C CB  . PRO A 287 ? 0.6295 0.1827 0.7338 -0.1329 0.2029  -0.1948 1086 PRO A CB  
2197 C CG  . PRO A 287 ? 0.6508 0.2077 0.7896 -0.1077 0.1859  -0.1693 1086 PRO A CG  
2198 C CD  . PRO A 287 ? 0.5836 0.1449 0.7575 -0.0883 0.1925  -0.1669 1086 PRO A CD  
2199 N N   . VAL A 288 ? 0.5745 0.2060 0.6398 -0.1262 0.1549  -0.1623 1087 VAL A N   
2200 C CA  . VAL A 288 ? 0.5485 0.2095 0.5834 -0.1356 0.1347  -0.1521 1087 VAL A CA  
2201 C C   . VAL A 288 ? 0.6060 0.2836 0.6319 -0.1384 0.1363  -0.1554 1087 VAL A C   
2202 O O   . VAL A 288 ? 0.6334 0.3219 0.6266 -0.1602 0.1358  -0.1620 1087 VAL A O   
2203 C CB  . VAL A 288 ? 0.5556 0.2349 0.6000 -0.1210 0.1103  -0.1289 1087 VAL A CB  
2204 C CG1 . VAL A 288 ? 0.5408 0.2463 0.5559 -0.1343 0.0928  -0.1215 1087 VAL A CG1 
2205 C CG2 . VAL A 288 ? 0.5593 0.2212 0.6171 -0.1168 0.1096  -0.1243 1087 VAL A CG2 
2206 N N   . TYR A 289 ? 0.5290 0.2095 0.5840 -0.1178 0.1377  -0.1498 1088 TYR A N   
2207 C CA  . TYR A 289 ? 0.5087 0.2033 0.5605 -0.1178 0.1403  -0.1523 1088 TYR A CA  
2208 C C   . TYR A 289 ? 0.5881 0.2747 0.6137 -0.1431 0.1605  -0.1755 1088 TYR A C   
2209 O O   . TYR A 289 ? 0.5877 0.2924 0.5821 -0.1609 0.1532  -0.1748 1088 TYR A O   
2210 C CB  . TYR A 289 ? 0.5029 0.1938 0.5950 -0.0935 0.1460  -0.1479 1088 TYR A CB  
2211 C CG  . TYR A 289 ? 0.5188 0.2234 0.6112 -0.0923 0.1502  -0.1510 1088 TYR A CG  
2212 C CD1 . TYR A 289 ? 0.5153 0.2447 0.5989 -0.0881 0.1310  -0.1356 1088 TYR A CD1 
2213 C CD2 . TYR A 289 ? 0.5515 0.2438 0.6553 -0.0952 0.1745  -0.1698 1088 TYR A CD2 
2214 C CE1 . TYR A 289 ? 0.5134 0.2546 0.5965 -0.0881 0.1345  -0.1377 1088 TYR A CE1 
2215 C CE2 . TYR A 289 ? 0.5627 0.2688 0.6661 -0.0953 0.1787  -0.1728 1088 TYR A CE2 
2216 C CZ  . TYR A 289 ? 0.6441 0.3745 0.7357 -0.0922 0.1579  -0.1560 1088 TYR A CZ  
2217 O OH  . TYR A 289 ? 0.6713 0.4147 0.7607 -0.0939 0.1615  -0.1584 1088 TYR A OH  
2218 N N   . ASP A 290 ? 0.5558 0.2151 0.5940 -0.1469 0.1857  -0.1958 1089 ASP A N   
2219 C CA  . ASP A 290 ? 0.5754 0.2232 0.5918 -0.1726 0.2105  -0.2229 1089 ASP A CA  
2220 C C   . ASP A 290 ? 0.6299 0.2890 0.5974 -0.2037 0.2033  -0.2263 1089 ASP A C   
2221 O O   . ASP A 290 ? 0.6430 0.3134 0.5822 -0.2260 0.2096  -0.2366 1089 ASP A O   
2222 C CB  . ASP A 290 ? 0.6254 0.2390 0.6679 -0.1703 0.2375  -0.2427 1089 ASP A CB  
2223 C CG  . ASP A 290 ? 0.7303 0.3330 0.8229 -0.1453 0.2517  -0.2447 1089 ASP A CG  
2224 O OD1 . ASP A 290 ? 0.6893 0.3112 0.7906 -0.1344 0.2455  -0.2366 1089 ASP A OD1 
2225 O OD2 . ASP A 290 ? 0.8790 0.4539 1.0042 -0.1372 0.2694  -0.2542 1089 ASP A OD2 
2226 N N   . SER A 291 ? 0.5855 0.2445 0.5431 -0.2064 0.1887  -0.2158 1090 SER A N   
2227 C CA  . SER A 291 ? 0.6003 0.2732 0.5147 -0.2356 0.1792  -0.2158 1090 SER A CA  
2228 C C   . SER A 291 ? 0.6406 0.3480 0.5365 -0.2400 0.1557  -0.1968 1090 SER A C   
2229 O O   . SER A 291 ? 0.6575 0.3802 0.5169 -0.2687 0.1515  -0.1987 1090 SER A O   
2230 C CB  . SER A 291 ? 0.6246 0.2917 0.5391 -0.2336 0.1675  -0.2065 1090 SER A CB  
2231 O OG  . SER A 291 ? 0.6916 0.3877 0.5881 -0.2383 0.1403  -0.1857 1090 SER A OG  
2232 N N   . LEU A 292 ? 0.5556 0.2756 0.4780 -0.2125 0.1394  -0.1770 1091 LEU A N   
2233 C CA  . LEU A 292 ? 0.5233 0.2732 0.4380 -0.2108 0.1160  -0.1563 1091 LEU A CA  
2234 C C   . LEU A 292 ? 0.6111 0.3728 0.5116 -0.2226 0.1205  -0.1602 1091 LEU A C   
2235 O O   . LEU A 292 ? 0.6132 0.3633 0.5271 -0.2160 0.1388  -0.1735 1091 LEU A O   
2236 C CB  . LEU A 292 ? 0.4701 0.2277 0.4177 -0.1792 0.0989  -0.1360 1091 LEU A CB  
2237 C CG  . LEU A 292 ? 0.4967 0.2523 0.4543 -0.1699 0.0873  -0.1262 1091 LEU A CG  
2238 C CD1 . LEU A 292 ? 0.4494 0.2098 0.4390 -0.1417 0.0767  -0.1117 1091 LEU A CD1 
2239 C CD2 . LEU A 292 ? 0.5327 0.3085 0.4673 -0.1867 0.0698  -0.1157 1091 LEU A CD2 
2240 N N   . ASP A 293 ? 0.5844 0.3714 0.4612 -0.2391 0.1023  -0.1460 1092 ASP A N   
2241 C CA  . ASP A 293 ? 0.5960 0.3996 0.4563 -0.2530 0.1004  -0.1432 1092 ASP A CA  
2242 C C   . ASP A 293 ? 0.6119 0.4223 0.5006 -0.2261 0.0924  -0.1303 1092 ASP A C   
2243 O O   . ASP A 293 ? 0.5825 0.3879 0.5020 -0.1980 0.0863  -0.1219 1092 ASP A O   
2244 C CB  . ASP A 293 ? 0.6342 0.4638 0.4663 -0.2770 0.0791  -0.1262 1092 ASP A CB  
2245 C CG  . ASP A 293 ? 0.7601 0.6052 0.6114 -0.2592 0.0529  -0.1008 1092 ASP A CG  
2246 O OD1 . ASP A 293 ? 0.7683 0.6143 0.6144 -0.2649 0.0466  -0.0983 1092 ASP A OD1 
2247 O OD2 . ASP A 293 ? 0.8016 0.6584 0.6728 -0.2414 0.0394  -0.0843 1092 ASP A OD2 
2248 N N   . ALA A 294 ? 0.5656 0.3894 0.4411 -0.2378 0.0914  -0.1277 1093 ALA A N   
2249 C CA  . ALA A 294 ? 0.5249 0.3576 0.4199 -0.2196 0.0841  -0.1159 1093 ALA A CA  
2250 C C   . ALA A 294 ? 0.5172 0.3595 0.4382 -0.1944 0.0615  -0.0928 1093 ALA A C   
2251 O O   . ALA A 294 ? 0.4927 0.3282 0.4430 -0.1685 0.0638  -0.0918 1093 ALA A O   
2252 C CB  . ALA A 294 ? 0.5543 0.4051 0.4221 -0.2444 0.0791  -0.1105 1093 ALA A CB  
2253 N N   . VAL A 295 ? 0.4570 0.3160 0.3693 -0.2029 0.0408  -0.0751 1094 VAL A N   
2254 C CA  . VAL A 295 ? 0.4164 0.2856 0.3549 -0.1811 0.0212  -0.0552 1094 VAL A CA  
2255 C C   . VAL A 295 ? 0.4433 0.3014 0.4016 -0.1627 0.0227  -0.0586 1094 VAL A C   
2256 O O   . VAL A 295 ? 0.4073 0.2658 0.3927 -0.1393 0.0170  -0.0514 1094 VAL A O   
2257 C CB  . VAL A 295 ? 0.4732 0.3650 0.4025 -0.1955 -0.0009 -0.0344 1094 VAL A CB  
2258 C CG1 . VAL A 295 ? 0.5080 0.4099 0.4039 -0.2269 -0.0004 -0.0341 1094 VAL A CG1 
2259 C CG2 . VAL A 295 ? 0.4775 0.3717 0.4056 -0.1988 -0.0078 -0.0321 1094 VAL A CG2 
2260 N N   . ARG A 296 ? 0.4138 0.2623 0.3568 -0.1754 0.0305  -0.0696 1095 ARG A N   
2261 C CA  . ARG A 296 ? 0.3917 0.2296 0.3499 -0.1619 0.0312  -0.0719 1095 ARG A CA  
2262 C C   . ARG A 296 ? 0.4297 0.2489 0.4111 -0.1410 0.0453  -0.0815 1095 ARG A C   
2263 O O   . ARG A 296 ? 0.4122 0.2289 0.4145 -0.1236 0.0402  -0.0758 1095 ARG A O   
2264 C CB  . ARG A 296 ? 0.4025 0.2352 0.3376 -0.1829 0.0351  -0.0802 1095 ARG A CB  
2265 C CG  . ARG A 296 ? 0.4253 0.2816 0.3485 -0.1972 0.0149  -0.0640 1095 ARG A CG  
2266 C CD  . ARG A 296 ? 0.4272 0.2792 0.3309 -0.2156 0.0176  -0.0712 1095 ARG A CD  
2267 N NE  . ARG A 296 ? 0.4812 0.3585 0.3799 -0.2267 -0.0030 -0.0537 1095 ARG A NE  
2268 C CZ  . ARG A 296 ? 0.6448 0.5385 0.5164 -0.2551 -0.0097 -0.0487 1095 ARG A CZ  
2269 N NH1 . ARG A 296 ? 0.4901 0.3770 0.3334 -0.2772 0.0038  -0.0619 1095 ARG A NH1 
2270 N NH2 . ARG A 296 ? 0.4647 0.3834 0.3384 -0.2629 -0.0299 -0.0300 1095 ARG A NH2 
2271 N N   . ARG A 297 ? 0.3868 0.1959 0.3668 -0.1430 0.0621  -0.0943 1096 ARG A N   
2272 C CA  . ARG A 297 ? 0.3640 0.1586 0.3712 -0.1228 0.0749  -0.1011 1096 ARG A CA  
2273 C C   . ARG A 297 ? 0.3808 0.1885 0.4110 -0.1018 0.0617  -0.0856 1096 ARG A C   
2274 O O   . ARG A 297 ? 0.3665 0.1690 0.4214 -0.0831 0.0615  -0.0821 1096 ARG A O   
2275 C CB  . ARG A 297 ? 0.3550 0.1396 0.3573 -0.1313 0.0962  -0.1187 1096 ARG A CB  
2276 C CG  . ARG A 297 ? 0.5139 0.2789 0.5032 -0.1477 0.1161  -0.1392 1096 ARG A CG  
2277 C CD  . ARG A 297 ? 0.6906 0.4509 0.6689 -0.1627 0.1371  -0.1581 1096 ARG A CD  
2278 N NE  . ARG A 297 ? 0.8133 0.5489 0.8118 -0.1576 0.1623  -0.1780 1096 ARG A NE  
2279 C CZ  . ARG A 297 ? 1.0468 0.7674 1.0287 -0.1792 0.1841  -0.2011 1096 ARG A CZ  
2280 N NH1 . ARG A 297 ? 0.9166 0.6463 0.8569 -0.2098 0.1827  -0.2068 1096 ARG A NH1 
2281 N NH2 . ARG A 297 ? 0.8987 0.5954 0.9069 -0.1714 0.2077  -0.2185 1096 ARG A NH2 
2282 N N   . ALA A 298 ? 0.3187 0.1439 0.3405 -0.1067 0.0500  -0.0754 1097 ALA A N   
2283 C CA  . ALA A 298 ? 0.2756 0.1131 0.3170 -0.0900 0.0381  -0.0618 1097 ALA A CA  
2284 C C   . ALA A 298 ? 0.3152 0.1574 0.3727 -0.0772 0.0258  -0.0519 1097 ALA A C   
2285 O O   . ALA A 298 ? 0.3039 0.1452 0.3835 -0.0600 0.0260  -0.0493 1097 ALA A O   
2286 C CB  . ALA A 298 ? 0.2794 0.1324 0.3083 -0.1007 0.0273  -0.0518 1097 ALA A CB  
2287 N N   . ALA A 299 ? 0.2479 0.0957 0.2941 -0.0873 0.0165  -0.0475 1098 ALA A N   
2288 C CA  . ALA A 299 ? 0.2215 0.0764 0.2804 -0.0775 0.0068  -0.0401 1098 ALA A CA  
2289 C C   . ALA A 299 ? 0.2995 0.1383 0.3712 -0.0678 0.0153  -0.0467 1098 ALA A C   
2290 O O   . ALA A 299 ? 0.2856 0.1300 0.3749 -0.0554 0.0091  -0.0404 1098 ALA A O   
2291 C CB  . ALA A 299 ? 0.2402 0.1000 0.2838 -0.0938 -0.0012 -0.0375 1098 ALA A CB  
2292 N N   . LEU A 300 ? 0.2864 0.1069 0.3507 -0.0734 0.0302  -0.0589 1099 LEU A N   
2293 C CA  . LEU A 300 ? 0.2761 0.0817 0.3570 -0.0629 0.0382  -0.0623 1099 LEU A CA  
2294 C C   . LEU A 300 ? 0.3077 0.1147 0.4123 -0.0462 0.0411  -0.0589 1099 LEU A C   
2295 O O   . LEU A 300 ? 0.2919 0.1015 0.4143 -0.0348 0.0359  -0.0512 1099 LEU A O   
2296 C CB  . LEU A 300 ? 0.3009 0.0850 0.3721 -0.0735 0.0543  -0.0766 1099 LEU A CB  
2297 C CG  . LEU A 300 ? 0.3562 0.1236 0.4468 -0.0639 0.0604  -0.0772 1099 LEU A CG  
2298 C CD1 . LEU A 300 ? 0.3728 0.1357 0.4516 -0.0732 0.0555  -0.0766 1099 LEU A CD1 
2299 C CD2 . LEU A 300 ? 0.3907 0.1373 0.4922 -0.0629 0.0807  -0.0903 1099 LEU A CD2 
2300 N N   . ILE A 301 ? 0.2720 0.0799 0.3759 -0.0466 0.0485  -0.0636 1100 ILE A N   
2301 C CA  . ILE A 301 ? 0.2652 0.0779 0.3909 -0.0323 0.0506  -0.0597 1100 ILE A CA  
2302 C C   . ILE A 301 ? 0.3167 0.1467 0.4525 -0.0229 0.0349  -0.0463 1100 ILE A C   
2303 O O   . ILE A 301 ? 0.2879 0.1213 0.4434 -0.0115 0.0330  -0.0402 1100 ILE A O   
2304 C CB  . ILE A 301 ? 0.3042 0.1189 0.4219 -0.0381 0.0591  -0.0667 1100 ILE A CB  
2305 C CG1 . ILE A 301 ? 0.3268 0.1241 0.4423 -0.0454 0.0792  -0.0830 1100 ILE A CG1 
2306 C CG2 . ILE A 301 ? 0.2675 0.0936 0.4037 -0.0253 0.0565  -0.0599 1100 ILE A CG2 
2307 C CD1 . ILE A 301 ? 0.3685 0.1669 0.4580 -0.0640 0.0867  -0.0933 1100 ILE A CD1 
2308 N N   . ASN A 302 ? 0.2735 0.1149 0.3965 -0.0295 0.0242  -0.0419 1101 ASN A N   
2309 C CA  . ASN A 302 ? 0.2466 0.1032 0.3792 -0.0232 0.0118  -0.0324 1101 ASN A CA  
2310 C C   . ASN A 302 ? 0.2964 0.1540 0.4404 -0.0174 0.0081  -0.0289 1101 ASN A C   
2311 O O   . ASN A 302 ? 0.3002 0.1672 0.4584 -0.0096 0.0041  -0.0238 1101 ASN A O   
2312 C CB  . ASN A 302 ? 0.2033 0.0688 0.3239 -0.0325 0.0024  -0.0286 1101 ASN A CB  
2313 C CG  . ASN A 302 ? 0.2600 0.1403 0.3940 -0.0266 -0.0078 -0.0205 1101 ASN A CG  
2314 O OD1 . ASN A 302 ? 0.0411 0.0387 0.1865 0.0002  -0.0093 -0.0098 1101 ASN A OD1 
2315 N ND2 . ASN A 302 ? 0.2487 0.1354 0.3790 -0.0316 -0.0131 -0.0156 1101 ASN A ND2 
2316 N N   . MET A 303 ? 0.2270 0.0753 0.3629 -0.0234 0.0096  -0.0318 1102 MET A N   
2317 C CA  . MET A 303 ? 0.2004 0.0493 0.3443 -0.0207 0.0058  -0.0277 1102 MET A CA  
2318 C C   . MET A 303 ? 0.2397 0.0831 0.4007 -0.0117 0.0108  -0.0247 1102 MET A C   
2319 O O   . MET A 303 ? 0.2255 0.0800 0.3982 -0.0068 0.0049  -0.0174 1102 MET A O   
2320 C CB  . MET A 303 ? 0.2393 0.0777 0.3701 -0.0305 0.0071  -0.0316 1102 MET A CB  
2321 C CG  . MET A 303 ? 0.2795 0.1288 0.3971 -0.0398 -0.0009 -0.0312 1102 MET A CG  
2322 S SD  . MET A 303 ? 0.3497 0.1898 0.4499 -0.0539 -0.0002 -0.0356 1102 MET A SD  
2323 C CE  . MET A 303 ? 0.2926 0.1353 0.4048 -0.0493 -0.0048 -0.0301 1102 MET A CE  
2324 N N   . VAL A 304 ? 0.2145 0.0427 0.3787 -0.0104 0.0222  -0.0302 1103 VAL A N   
2325 C CA  . VAL A 304 ? 0.2227 0.0460 0.4094 -0.0007 0.0278  -0.0261 1103 VAL A CA  
2326 C C   . VAL A 304 ? 0.2444 0.0859 0.4441 0.0071  0.0218  -0.0182 1103 VAL A C   
2327 O O   . VAL A 304 ? 0.2191 0.0674 0.4354 0.0122  0.0174  -0.0082 1103 VAL A O   
2328 C CB  . VAL A 304 ? 0.3036 0.1091 0.4935 -0.0011 0.0436  -0.0367 1103 VAL A CB  
2329 C CG1 . VAL A 304 ? 0.3006 0.1040 0.5205 0.0106  0.0498  -0.0317 1103 VAL A CG1 
2330 C CG2 . VAL A 304 ? 0.3269 0.1132 0.5059 -0.0101 0.0506  -0.0449 1103 VAL A CG2 
2331 N N   . PHE A 305 ? 0.1856 0.0397 0.3763 0.0056  0.0209  -0.0215 1104 PHE A N   
2332 C CA  . PHE A 305 ? 0.1410 0.0395 0.3398 0.0078  0.0159  -0.0150 1104 PHE A CA  
2333 C C   . PHE A 305 ? 0.1785 0.0596 0.3803 0.0098  0.0055  -0.0098 1104 PHE A C   
2334 O O   . PHE A 305 ? 0.1898 0.0831 0.4030 0.0130  0.0028  -0.0041 1104 PHE A O   
2335 C CB  . PHE A 305 ? 0.1539 0.0398 0.3405 0.0058  0.0165  -0.0205 1104 PHE A CB  
2336 C CG  . PHE A 305 ? 0.1770 0.0445 0.3674 0.0092  0.0253  -0.0254 1104 PHE A CG  
2337 C CD1 . PHE A 305 ? 0.2068 0.0862 0.4037 0.0126  0.0229  -0.0220 1104 PHE A CD1 
2338 C CD2 . PHE A 305 ? 0.2218 0.0757 0.4088 0.0062  0.0371  -0.0338 1104 PHE A CD2 
2339 C CE1 . PHE A 305 ? 0.2246 0.1038 0.4249 0.0137  0.0311  -0.0256 1104 PHE A CE1 
2340 C CE2 . PHE A 305 ? 0.2638 0.1176 0.4551 0.0072  0.0467  -0.0388 1104 PHE A CE2 
2341 C CZ  . PHE A 305 ? 0.2314 0.0984 0.4292 0.0111  0.0431  -0.0340 1104 PHE A CZ  
2342 N N   . GLN A 306 ? 0.1110 0.0384 0.3029 0.0024  0.0004  -0.0093 1105 GLN A N   
2343 C CA  . GLN A 306 ? 0.0860 0.0381 0.2801 0.0005  -0.0072 -0.0059 1105 GLN A CA  
2344 C C   . GLN A 306 ? 0.1824 0.0782 0.3815 -0.0012 -0.0101 -0.0003 1105 GLN A C   
2345 O O   . GLN A 306 ? 0.1812 0.0917 0.3862 -0.0036 -0.0148 0.0050  1105 GLN A O   
2346 C CB  . GLN A 306 ? 0.0895 0.0385 0.2741 -0.0020 -0.0109 -0.0098 1105 GLN A CB  
2347 C CG  . GLN A 306 ? 0.0710 0.0387 0.2591 -0.0027 -0.0160 -0.0090 1105 GLN A CG  
2348 C CD  . GLN A 306 ? 0.2440 0.1617 0.4278 -0.0132 -0.0193 -0.0154 1105 GLN A CD  
2349 O OE1 . GLN A 306 ? 0.2684 0.1768 0.4429 -0.0154 -0.0191 -0.0165 1105 GLN A OE1 
2350 N NE2 . GLN A 306 ? 0.1415 0.0738 0.3322 -0.0165 -0.0216 -0.0177 1105 GLN A NE2 
2351 N N   . MET A 307 ? 0.1766 0.0568 0.3728 -0.0024 -0.0073 -0.0002 1106 MET A N   
2352 C CA  . MET A 307 ? 0.1931 0.0717 0.3946 -0.0055 -0.0110 0.0082  1106 MET A CA  
2353 C C   . MET A 307 ? 0.2708 0.1368 0.4893 0.0005  -0.0068 0.0158  1106 MET A C   
2354 O O   . MET A 307 ? 0.2838 0.1527 0.5122 -0.0014 -0.0123 0.0276  1106 MET A O   
2355 C CB  . MET A 307 ? 0.2432 0.1140 0.4307 -0.0132 -0.0120 0.0038  1106 MET A CB  
2356 C CG  . MET A 307 ? 0.2953 0.1814 0.4731 -0.0191 -0.0170 -0.0012 1106 MET A CG  
2357 S SD  . MET A 307 ? 0.3836 0.2599 0.5455 -0.0275 -0.0169 -0.0071 1106 MET A SD  
2358 C CE  . MET A 307 ? 0.3502 0.2198 0.5039 -0.0257 -0.0122 -0.0152 1106 MET A CE  
2359 N N   . GLY A 308 ? 0.2419 0.0941 0.4652 0.0066  0.0030  0.0093  1107 GLY A N   
2360 C CA  . GLY A 308 ? 0.2529 0.0918 0.4984 0.0137  0.0099  0.0142  1107 GLY A CA  
2361 C C   . GLY A 308 ? 0.3201 0.1340 0.5637 0.0113  0.0186  0.0076  1107 GLY A C   
2362 O O   . GLY A 308 ? 0.3117 0.1214 0.5371 0.0028  0.0155  0.0041  1107 GLY A O   
2363 N N   . GLU A 309 ? 0.3008 0.0983 0.5646 0.0181  0.0309  0.0047  1108 GLU A N   
2364 C CA  . GLU A 309 ? 0.3376 0.1081 0.6054 0.0160  0.0428  -0.0033 1108 GLU A CA  
2365 C C   . GLU A 309 ? 0.4144 0.1785 0.6790 0.0099  0.0346  0.0057  1108 GLU A C   
2366 O O   . GLU A 309 ? 0.4323 0.1839 0.6759 0.0004  0.0379  -0.0043 1108 GLU A O   
2367 C CB  . GLU A 309 ? 0.3745 0.1327 0.6795 0.0271  0.0545  -0.0009 1108 GLU A CB  
2368 C CG  . GLU A 309 ? 0.5756 0.3284 0.8824 0.0295  0.0709  -0.0176 1108 GLU A CG  
2369 C CD  . GLU A 309 ? 0.9080 0.6839 1.2122 0.0333  0.0664  -0.0160 1108 GLU A CD  
2370 O OE1 . GLU A 309 ? 0.6667 0.4628 0.9797 0.0377  0.0525  0.0002  1108 GLU A OE1 
2371 O OE2 . GLU A 309 ? 0.9686 0.7424 1.2609 0.0302  0.0774  -0.0312 1108 GLU A OE2 
2372 N N   . THR A 310 ? 0.3623 0.1369 0.6461 0.0134  0.0232  0.0254  1109 THR A N   
2373 C CA  . THR A 310 ? 0.3683 0.1395 0.6510 0.0065  0.0139  0.0373  1109 THR A CA  
2374 C C   . THR A 310 ? 0.4177 0.1999 0.6664 -0.0059 0.0057  0.0318  1109 THR A C   
2375 O O   . THR A 310 ? 0.4609 0.2299 0.6984 -0.0141 0.0061  0.0294  1109 THR A O   
2376 C CB  . THR A 310 ? 0.4368 0.2221 0.7463 0.0105  0.0020  0.0615  1109 THR A CB  
2377 O OG1 . THR A 310 ? 0.5206 0.2954 0.8666 0.0230  0.0105  0.0667  1109 THR A OG1 
2378 C CG2 . THR A 310 ? 0.3621 0.1433 0.6720 0.0020  -0.0078 0.0761  1109 THR A CG2 
2379 N N   . GLY A 311 ? 0.3140 0.1202 0.5497 -0.0072 -0.0010 0.0300  1110 GLY A N   
2380 C CA  . GLY A 311 ? 0.2770 0.0969 0.4873 -0.0172 -0.0078 0.0244  1110 GLY A CA  
2381 C C   . GLY A 311 ? 0.2923 0.0994 0.4825 -0.0224 -0.0006 0.0086  1110 GLY A C   
2382 O O   . GLY A 311 ? 0.2851 0.0915 0.4604 -0.0320 -0.0040 0.0065  1110 GLY A O   
2383 N N   . VAL A 312 ? 0.2343 0.0395 0.4236 -0.0173 0.0093  -0.0021 1111 VAL A N   
2384 C CA  . VAL A 312 ? 0.2329 0.0413 0.4015 -0.0231 0.0165  -0.0157 1111 VAL A CA  
2385 C C   . VAL A 312 ? 0.3407 0.1049 0.5066 -0.0322 0.0237  -0.0208 1111 VAL A C   
2386 O O   . VAL A 312 ? 0.3594 0.1230 0.5050 -0.0435 0.0217  -0.0262 1111 VAL A O   
2387 C CB  . VAL A 312 ? 0.2747 0.0611 0.4420 -0.0219 0.0253  -0.0261 1111 VAL A CB  
2388 C CG1 . VAL A 312 ? 0.2793 0.0595 0.4218 -0.0340 0.0304  -0.0389 1111 VAL A CG1 
2389 C CG2 . VAL A 312 ? 0.2525 0.0613 0.4235 -0.0158 0.0178  -0.0212 1111 VAL A CG2 
2390 N N   . ALA A 313 ? 0.3166 0.0618 0.5057 -0.0254 0.0318  -0.0171 1112 ALA A N   
2391 C CA  . ALA A 313 ? 0.3404 0.0581 0.5334 -0.0306 0.0409  -0.0209 1112 ALA A CA  
2392 C C   . ALA A 313 ? 0.4262 0.1435 0.6129 -0.0387 0.0307  -0.0112 1112 ALA A C   
2393 O O   . ALA A 313 ? 0.4769 0.1706 0.6647 -0.0445 0.0378  -0.0144 1112 ALA A O   
2394 C CB  . ALA A 313 ? 0.3599 0.0609 0.5890 -0.0190 0.0489  -0.0140 1112 ALA A CB  
2395 N N   . GLY A 314 ? 0.3629 0.1060 0.5415 -0.0406 0.0158  -0.0016 1113 GLY A N   
2396 C CA  . GLY A 314 ? 0.3665 0.1153 0.5359 -0.0504 0.0057  0.0067  1113 GLY A CA  
2397 C C   . GLY A 314 ? 0.4249 0.1883 0.5671 -0.0604 0.0024  -0.0041 1113 GLY A C   
2398 O O   . GLY A 314 ? 0.4460 0.2302 0.5811 -0.0657 -0.0080 0.0011  1113 GLY A O   
2399 N N   . PHE A 315 ? 0.3642 0.1185 0.4936 -0.0635 0.0115  -0.0183 1114 PHE A N   
2400 C CA  . PHE A 315 ? 0.3514 0.1182 0.4573 -0.0742 0.0084  -0.0268 1114 PHE A CA  
2401 C C   . PHE A 315 ? 0.4488 0.1926 0.5397 -0.0863 0.0186  -0.0380 1114 PHE A C   
2402 O O   . PHE A 315 ? 0.4599 0.2011 0.5364 -0.0928 0.0252  -0.0493 1114 PHE A O   
2403 C CB  . PHE A 315 ? 0.3546 0.1362 0.4580 -0.0691 0.0082  -0.0314 1114 PHE A CB  
2404 C CG  . PHE A 315 ? 0.3387 0.1484 0.4471 -0.0645 -0.0032 -0.0246 1114 PHE A CG  
2405 C CD1 . PHE A 315 ? 0.3654 0.1927 0.4649 -0.0726 -0.0114 -0.0242 1114 PHE A CD1 
2406 C CD2 . PHE A 315 ? 0.3421 0.1609 0.4659 -0.0527 -0.0046 -0.0196 1114 PHE A CD2 
2407 C CE1 . PHE A 315 ? 0.3546 0.2064 0.4624 -0.0686 -0.0191 -0.0204 1114 PHE A CE1 
2408 C CE2 . PHE A 315 ? 0.3575 0.2002 0.4862 -0.0500 -0.0129 -0.0158 1114 PHE A CE2 
2409 C CZ  . PHE A 315 ? 0.3270 0.1855 0.4487 -0.0577 -0.0193 -0.0169 1114 PHE A CZ  
2410 N N   . THR A 316 ? 0.4272 0.1546 0.5212 -0.0911 0.0199  -0.0343 1115 THR A N   
2411 C CA  . THR A 316 ? 0.4498 0.1483 0.5352 -0.1020 0.0322  -0.0447 1115 THR A CA  
2412 C C   . THR A 316 ? 0.4890 0.1934 0.5442 -0.1197 0.0332  -0.0568 1115 THR A C   
2413 O O   . THR A 316 ? 0.4976 0.1893 0.5419 -0.1268 0.0454  -0.0706 1115 THR A O   
2414 C CB  . THR A 316 ? 0.5613 0.2439 0.6574 -0.1040 0.0303  -0.0350 1115 THR A CB  
2415 O OG1 . THR A 316 ? 0.5049 0.1921 0.6279 -0.0896 0.0241  -0.0190 1115 THR A OG1 
2416 C CG2 . THR A 316 ? 0.6067 0.2531 0.7035 -0.1114 0.0463  -0.0457 1115 THR A CG2 
2417 N N   . ASN A 317 ? 0.4213 0.1465 0.4638 -0.1281 0.0209  -0.0517 1116 ASN A N   
2418 C CA  . ASN A 317 ? 0.4165 0.1512 0.4334 -0.1455 0.0196  -0.0600 1116 ASN A CA  
2419 C C   . ASN A 317 ? 0.4617 0.2109 0.4701 -0.1463 0.0199  -0.0653 1116 ASN A C   
2420 O O   . ASN A 317 ? 0.4907 0.2285 0.4814 -0.1597 0.0294  -0.0770 1116 ASN A O   
2421 C CB  . ASN A 317 ? 0.3623 0.1190 0.3724 -0.1534 0.0067  -0.0530 1116 ASN A CB  
2422 C CG  . ASN A 317 ? 0.7931 0.5335 0.8037 -0.1597 0.0074  -0.0493 1116 ASN A CG  
2423 O OD1 . ASN A 317 ? 0.8461 0.5547 0.8586 -0.1621 0.0186  -0.0537 1116 ASN A OD1 
2424 N ND2 . ASN A 317 ? 0.6730 0.4345 0.6834 -0.1632 -0.0039 -0.0414 1116 ASN A ND2 
2425 N N   . SER A 318 ? 0.3673 0.1400 0.3881 -0.1335 0.0104  -0.0572 1117 SER A N   
2426 C CA  . SER A 318 ? 0.3465 0.1338 0.3619 -0.1336 0.0087  -0.0590 1117 SER A CA  
2427 C C   . SER A 318 ? 0.4168 0.1830 0.4266 -0.1356 0.0236  -0.0702 1117 SER A C   
2428 O O   . SER A 318 ? 0.4384 0.2072 0.4280 -0.1505 0.0266  -0.0773 1117 SER A O   
2429 C CB  . SER A 318 ? 0.3566 0.1659 0.3912 -0.1175 -0.0011 -0.0492 1117 SER A CB  
2430 O OG  . SER A 318 ? 0.4765 0.3081 0.5164 -0.1181 -0.0127 -0.0419 1117 SER A OG  
2431 N N   . LEU A 319 ? 0.3478 0.0959 0.3755 -0.1217 0.0336  -0.0713 1118 LEU A N   
2432 C CA  . LEU A 319 ? 0.3504 0.0922 0.3785 -0.1159 0.0514  -0.0801 1118 LEU A CA  
2433 C C   . LEU A 319 ? 0.4781 0.1835 0.4856 -0.1432 0.0637  -0.0994 1118 LEU A C   
2434 O O   . LEU A 319 ? 0.4849 0.1831 0.4811 -0.1523 0.0762  -0.1125 1118 LEU A O   
2435 C CB  . LEU A 319 ? 0.3390 0.0773 0.3962 -0.0955 0.0588  -0.0745 1118 LEU A CB  
2436 C CG  . LEU A 319 ? 0.3450 0.0699 0.4254 -0.0860 0.0493  -0.0682 1118 LEU A CG  
2437 C CD1 . LEU A 319 ? 0.3358 0.0596 0.4448 -0.0698 0.0504  -0.0573 1118 LEU A CD1 
2438 C CD2 . LEU A 319 ? 0.3628 0.0884 0.4429 -0.0838 0.0574  -0.0761 1118 LEU A CD2 
2439 N N   . ARG A 320 ? 0.4950 0.1924 0.4947 -0.1529 0.0618  -0.0992 1119 ARG A N   
2440 C CA  . ARG A 320 ? 0.5362 0.2154 0.5126 -0.1755 0.0742  -0.1145 1119 ARG A CA  
2441 C C   . ARG A 320 ? 0.5892 0.2922 0.5350 -0.1957 0.0668  -0.1168 1119 ARG A C   
2442 O O   . ARG A 320 ? 0.6067 0.3013 0.5321 -0.2136 0.0794  -0.1316 1119 ARG A O   
2443 C CB  . ARG A 320 ? 0.5379 0.2032 0.5157 -0.1800 0.0727  -0.1116 1119 ARG A CB  
2444 C CG  . ARG A 320 ? 0.7582 0.3898 0.7260 -0.1962 0.0925  -0.1293 1119 ARG A CG  
2445 C CD  . ARG A 320 ? 0.9985 0.6248 0.9536 -0.2102 0.0877  -0.1272 1119 ARG A CD  
2446 N NE  . ARG A 320 ? 1.1310 0.7703 1.1023 -0.1967 0.0706  -0.1078 1119 ARG A NE  
2447 C CZ  . ARG A 320 ? 1.3913 1.0138 1.3904 -0.1810 0.0715  -0.0985 1119 ARG A CZ  
2448 N NH1 . ARG A 320 ? 1.2919 0.8832 1.3113 -0.1736 0.0884  -0.1057 1119 ARG A NH1 
2449 N NH2 . ARG A 320 ? 1.2614 0.8998 1.2699 -0.1734 0.0555  -0.0813 1119 ARG A NH2 
2450 N N   . MET A 321 ? 0.5262 0.2597 0.4712 -0.1933 0.0471  -0.1021 1120 MET A N   
2451 C CA  . MET A 321 ? 0.5329 0.2929 0.4558 -0.2104 0.0371  -0.0994 1120 MET A CA  
2452 C C   . MET A 321 ? 0.5855 0.3510 0.5020 -0.2126 0.0414  -0.1032 1120 MET A C   
2453 O O   . MET A 321 ? 0.5861 0.3618 0.4771 -0.2350 0.0413  -0.1074 1120 MET A O   
2454 C CB  . MET A 321 ? 0.5336 0.3254 0.4682 -0.2020 0.0161  -0.0819 1120 MET A CB  
2455 C CG  . MET A 321 ? 0.5788 0.3696 0.5181 -0.2019 0.0112  -0.0779 1120 MET A CG  
2456 S SD  . MET A 321 ? 0.5896 0.4172 0.5496 -0.1893 -0.0092 -0.0607 1120 MET A SD  
2457 C CE  . MET A 321 ? 0.5366 0.3506 0.5082 -0.1821 -0.0077 -0.0591 1120 MET A CE  
2458 N N   . LEU A 322 ? 0.5438 0.3044 0.4827 -0.1914 0.0445  -0.1009 1121 LEU A N   
2459 C CA  . LEU A 322 ? 0.5433 0.3092 0.4784 -0.1919 0.0487  -0.1039 1121 LEU A CA  
2460 C C   . LEU A 322 ? 0.6330 0.3754 0.5502 -0.2093 0.0707  -0.1248 1121 LEU A C   
2461 O O   . LEU A 322 ? 0.6564 0.4086 0.5471 -0.2316 0.0722  -0.1302 1121 LEU A O   
2462 C CB  . LEU A 322 ? 0.5130 0.2799 0.4775 -0.1651 0.0470  -0.0965 1121 LEU A CB  
2463 C CG  . LEU A 322 ? 0.5342 0.3260 0.5165 -0.1493 0.0275  -0.0783 1121 LEU A CG  
2464 C CD1 . LEU A 322 ? 0.5202 0.3081 0.5295 -0.1258 0.0292  -0.0740 1121 LEU A CD1 
2465 C CD2 . LEU A 322 ? 0.5541 0.3725 0.5270 -0.1574 0.0144  -0.0691 1121 LEU A CD2 
2466 N N   . GLN A 323 ? 0.5989 0.3106 0.5311 -0.2014 0.0878  -0.1363 1122 GLN A N   
2467 C CA  . GLN A 323 ? 0.6356 0.3184 0.5587 -0.2159 0.1133  -0.1596 1122 GLN A CA  
2468 C C   . GLN A 323 ? 0.7100 0.3956 0.5944 -0.2495 0.1165  -0.1704 1122 GLN A C   
2469 O O   . GLN A 323 ? 0.7319 0.4150 0.5940 -0.2704 0.1303  -0.1862 1122 GLN A O   
2470 C CB  . GLN A 323 ? 0.6596 0.3119 0.6096 -0.2017 0.1246  -0.1634 1122 GLN A CB  
2471 C CG  . GLN A 323 ? 0.8910 0.5101 0.8488 -0.2070 0.1533  -0.1864 1122 GLN A CG  
2472 C CD  . GLN A 323 ? 1.2390 0.8346 1.2378 -0.1832 0.1583  -0.1806 1122 GLN A CD  
2473 O OE1 . GLN A 323 ? 1.2256 0.8215 1.2551 -0.1611 0.1592  -0.1739 1122 GLN A OE1 
2474 N NE2 . GLN A 323 ? 1.1038 0.6821 1.1048 -0.1869 0.1583  -0.1792 1122 GLN A NE2 
2475 N N   . GLN A 324 ? 0.6602 0.3552 0.5356 -0.2560 0.1023  -0.1607 1123 GLN A N   
2476 C CA  . GLN A 324 ? 0.6761 0.3787 0.5168 -0.2872 0.1003  -0.1661 1123 GLN A CA  
2477 C C   . GLN A 324 ? 0.7081 0.4480 0.5250 -0.3046 0.0831  -0.1549 1123 GLN A C   
2478 O O   . GLN A 324 ? 0.7264 0.4780 0.5143 -0.3324 0.0791  -0.1567 1123 GLN A O   
2479 C CB  . GLN A 324 ? 0.6842 0.3848 0.5301 -0.2844 0.0905  -0.1577 1123 GLN A CB  
2480 C CG  . GLN A 324 ? 0.9263 0.5880 0.7859 -0.2795 0.1087  -0.1703 1123 GLN A CG  
2481 C CD  . GLN A 324 ? 1.2514 0.9131 1.1032 -0.2884 0.1001  -0.1648 1123 GLN A CD  
2482 O OE1 . GLN A 324 ? 1.2821 0.9564 1.1039 -0.3149 0.0964  -0.1682 1123 GLN A OE1 
2483 N NE2 . GLN A 324 ? 1.1029 0.7520 0.9810 -0.2685 0.0966  -0.1556 1123 GLN A NE2 
2484 N N   . LYS A 325 ? 0.6310 0.3897 0.4613 -0.2892 0.0725  -0.1422 1124 LYS A N   
2485 C CA  . LYS A 325 ? 0.6124 0.4055 0.4280 -0.3017 0.0552  -0.1279 1124 LYS A CA  
2486 C C   . LYS A 325 ? 0.6433 0.4665 0.4568 -0.3075 0.0312  -0.1082 1124 LYS A C   
2487 O O   . LYS A 325 ? 0.6432 0.4918 0.4352 -0.3310 0.0198  -0.0999 1124 LYS A O   
2488 C CB  . LYS A 325 ? 0.6683 0.4608 0.4508 -0.3320 0.0685  -0.1429 1124 LYS A CB  
2489 C CG  . LYS A 325 ? 0.7603 0.5245 0.5527 -0.3223 0.0932  -0.1627 1124 LYS A CG  
2490 C CD  . LYS A 325 ? 0.9142 0.6796 0.6757 -0.3516 0.1081  -0.1790 1124 LYS A CD  
2491 C CE  . LYS A 325 ? 1.0786 0.8194 0.8578 -0.3379 0.1321  -0.1972 1124 LYS A CE  
2492 N NZ  . LYS A 325 ? 1.1508 0.8998 0.9631 -0.3044 0.1206  -0.1805 1124 LYS A NZ  
2493 N N   . ARG A 326 ? 0.5842 0.4046 0.4220 -0.2866 0.0246  -0.1009 1125 ARG A N   
2494 C CA  . ARG A 326 ? 0.5648 0.4132 0.4120 -0.2845 0.0035  -0.0827 1125 ARG A CA  
2495 C C   . ARG A 326 ? 0.5894 0.4540 0.4692 -0.2566 -0.0097 -0.0663 1125 ARG A C   
2496 O O   . ARG A 326 ? 0.5748 0.4304 0.4793 -0.2330 -0.0088 -0.0649 1125 ARG A O   
2497 C CB  . ARG A 326 ? 0.5707 0.4054 0.4223 -0.2819 0.0066  -0.0872 1125 ARG A CB  
2498 C CG  . ARG A 326 ? 0.7568 0.5579 0.5871 -0.2984 0.0281  -0.1089 1125 ARG A CG  
2499 C CD  . ARG A 326 ? 0.9236 0.7081 0.7639 -0.2915 0.0306  -0.1108 1125 ARG A CD  
2500 N NE  . ARG A 326 ? 1.1581 0.9130 0.9764 -0.3123 0.0492  -0.1302 1125 ARG A NE  
2501 C CZ  . ARG A 326 ? 1.3768 1.1383 1.1686 -0.3399 0.0477  -0.1342 1125 ARG A CZ  
2502 N NH1 . ARG A 326 ? 1.1947 0.9934 0.9807 -0.3490 0.0273  -0.1186 1125 ARG A NH1 
2503 N NH2 . ARG A 326 ? 1.2246 0.9556 0.9979 -0.3587 0.0672  -0.1540 1125 ARG A NH2 
2504 N N   . TRP A 327 ? 0.5374 0.4262 0.4163 -0.2618 -0.0217 -0.0538 1126 TRP A N   
2505 C CA  . TRP A 327 ? 0.5001 0.4022 0.4070 -0.2391 -0.0318 -0.0402 1126 TRP A CA  
2506 C C   . TRP A 327 ? 0.5148 0.4402 0.4490 -0.2261 -0.0485 -0.0245 1126 TRP A C   
2507 O O   . TRP A 327 ? 0.4860 0.4105 0.4480 -0.2017 -0.0499 -0.0209 1126 TRP A O   
2508 C CB  . TRP A 327 ? 0.4914 0.4076 0.3887 -0.2496 -0.0374 -0.0322 1126 TRP A CB  
2509 C CG  . TRP A 327 ? 0.5325 0.4292 0.4006 -0.2668 -0.0197 -0.0496 1126 TRP A CG  
2510 C CD1 . TRP A 327 ? 0.5989 0.5051 0.4342 -0.2983 -0.0194 -0.0514 1126 TRP A CD1 
2511 C CD2 . TRP A 327 ? 0.5363 0.4019 0.4065 -0.2556 0.0016  -0.0685 1126 TRP A CD2 
2512 N NE1 . TRP A 327 ? 0.6114 0.4936 0.4273 -0.3077 0.0026  -0.0728 1126 TRP A NE1 
2513 C CE2 . TRP A 327 ? 0.6113 0.4683 0.4508 -0.2806 0.0158  -0.0832 1126 TRP A CE2 
2514 C CE3 . TRP A 327 ? 0.5337 0.3797 0.4302 -0.2279 0.0099  -0.0736 1126 TRP A CE3 
2515 C CZ2 . TRP A 327 ? 0.6161 0.4453 0.4547 -0.2764 0.0390  -0.1036 1126 TRP A CZ2 
2516 C CZ3 . TRP A 327 ? 0.5645 0.3837 0.4605 -0.2237 0.0307  -0.0911 1126 TRP A CZ3 
2517 C CH2 . TRP A 327 ? 0.6064 0.4169 0.4756 -0.2468 0.0457  -0.1065 1126 TRP A CH2 
2518 N N   . ASP A 328 ? 0.4836 0.4307 0.4113 -0.2428 -0.0600 -0.0160 1127 ASP A N   
2519 C CA  . ASP A 328 ? 0.4657 0.4367 0.4233 -0.2308 -0.0741 -0.0026 1127 ASP A CA  
2520 C C   . ASP A 328 ? 0.4987 0.4557 0.4654 -0.2188 -0.0666 -0.0121 1127 ASP A C   
2521 O O   . ASP A 328 ? 0.4578 0.4234 0.4543 -0.1989 -0.0709 -0.0071 1127 ASP A O   
2522 C CB  . ASP A 328 ? 0.5130 0.5161 0.4664 -0.2516 -0.0904 0.0124  1127 ASP A CB  
2523 C CG  . ASP A 328 ? 0.7195 0.7455 0.6827 -0.2548 -0.1046 0.0309  1127 ASP A CG  
2524 O OD1 . ASP A 328 ? 0.7440 0.7719 0.6773 -0.2784 -0.1051 0.0319  1127 ASP A OD1 
2525 O OD2 . ASP A 328 ? 0.8370 0.8787 0.8380 -0.2348 -0.1145 0.0442  1127 ASP A OD2 
2526 N N   . GLU A 329 ? 0.4785 0.4124 0.4195 -0.2320 -0.0543 -0.0265 1128 GLU A N   
2527 C CA  . GLU A 329 ? 0.4713 0.3881 0.4175 -0.2236 -0.0468 -0.0347 1128 GLU A CA  
2528 C C   . GLU A 329 ? 0.4900 0.3926 0.4582 -0.1978 -0.0410 -0.0363 1128 GLU A C   
2529 O O   . GLU A 329 ? 0.4924 0.4028 0.4820 -0.1839 -0.0450 -0.0323 1128 GLU A O   
2530 C CB  . GLU A 329 ? 0.5269 0.4148 0.4438 -0.2410 -0.0320 -0.0504 1128 GLU A CB  
2531 C CG  . GLU A 329 ? 0.7616 0.6599 0.6578 -0.2660 -0.0361 -0.0511 1128 GLU A CG  
2532 C CD  . GLU A 329 ? 0.9934 0.8606 0.8598 -0.2856 -0.0193 -0.0688 1128 GLU A CD  
2533 O OE1 . GLU A 329 ? 0.7033 0.5444 0.5739 -0.2782 -0.0092 -0.0769 1128 GLU A OE1 
2534 O OE2 . GLU A 329 ? 0.8262 0.6950 0.6657 -0.3092 -0.0159 -0.0744 1128 GLU A OE2 
2535 N N   . ALA A 330 ? 0.4029 0.2882 0.3664 -0.1928 -0.0318 -0.0420 1129 ALA A N   
2536 C CA  . ALA A 330 ? 0.3647 0.2381 0.3486 -0.1698 -0.0265 -0.0428 1129 ALA A CA  
2537 C C   . ALA A 330 ? 0.3923 0.2901 0.4031 -0.1538 -0.0385 -0.0306 1129 ALA A C   
2538 O O   . ALA A 330 ? 0.3643 0.2623 0.3944 -0.1385 -0.0386 -0.0294 1129 ALA A O   
2539 C CB  . ALA A 330 ? 0.3819 0.2349 0.3560 -0.1699 -0.0140 -0.0516 1129 ALA A CB  
2540 N N   . ALA A 331 ? 0.3454 0.2650 0.3585 -0.1593 -0.0489 -0.0210 1130 ALA A N   
2541 C CA  . ALA A 331 ? 0.3163 0.2581 0.3590 -0.1448 -0.0595 -0.0095 1130 ALA A CA  
2542 C C   . ALA A 331 ? 0.3675 0.3260 0.4310 -0.1391 -0.0653 -0.0064 1130 ALA A C   
2543 O O   . ALA A 331 ? 0.3408 0.3095 0.4315 -0.1235 -0.0677 -0.0031 1130 ALA A O   
2544 C CB  . ALA A 331 ? 0.3285 0.2901 0.3714 -0.1542 -0.0708 0.0028  1130 ALA A CB  
2545 N N   . VAL A 332 ? 0.3362 0.2977 0.3868 -0.1531 -0.0664 -0.0087 1131 VAL A N   
2546 C CA  . VAL A 332 ? 0.3191 0.2969 0.3880 -0.1496 -0.0703 -0.0074 1131 VAL A CA  
2547 C C   . VAL A 332 ? 0.3675 0.3271 0.4366 -0.1405 -0.0610 -0.0161 1131 VAL A C   
2548 O O   . VAL A 332 ? 0.3506 0.3215 0.4415 -0.1298 -0.0617 -0.0157 1131 VAL A O   
2549 C CB  . VAL A 332 ? 0.3802 0.3735 0.4384 -0.1685 -0.0768 -0.0046 1131 VAL A CB  
2550 C CG1 . VAL A 332 ? 0.3648 0.3717 0.4386 -0.1662 -0.0779 -0.0062 1131 VAL A CG1 
2551 C CG2 . VAL A 332 ? 0.3827 0.4026 0.4506 -0.1757 -0.0898 0.0091  1131 VAL A CG2 
2552 N N   . ASN A 333 ? 0.3413 0.2730 0.3877 -0.1456 -0.0517 -0.0236 1132 ASN A N   
2553 C CA  . ASN A 333 ? 0.3331 0.2462 0.3802 -0.1387 -0.0442 -0.0285 1132 ASN A CA  
2554 C C   . ASN A 333 ? 0.3486 0.2611 0.4151 -0.1204 -0.0424 -0.0269 1132 ASN A C   
2555 O O   . ASN A 333 ? 0.3184 0.2396 0.3989 -0.1140 -0.0435 -0.0258 1132 ASN A O   
2556 C CB  . ASN A 333 ? 0.3462 0.2288 0.3709 -0.1475 -0.0341 -0.0360 1132 ASN A CB  
2557 C CG  . ASN A 333 ? 0.6185 0.4858 0.6437 -0.1465 -0.0298 -0.0375 1132 ASN A CG  
2558 O OD1 . ASN A 333 ? 0.5075 0.3868 0.5337 -0.1527 -0.0346 -0.0355 1132 ASN A OD1 
2559 N ND2 . ASN A 333 ? 0.5161 0.3579 0.5426 -0.1391 -0.0209 -0.0401 1132 ASN A ND2 
2560 N N   . LEU A 334 ? 0.3003 0.2056 0.3670 -0.1140 -0.0398 -0.0267 1133 LEU A N   
2561 C CA  . LEU A 334 ? 0.2729 0.1784 0.3566 -0.0981 -0.0382 -0.0251 1133 LEU A CA  
2562 C C   . LEU A 334 ? 0.2924 0.2236 0.4001 -0.0906 -0.0449 -0.0210 1133 LEU A C   
2563 O O   . LEU A 334 ? 0.2717 0.2053 0.3923 -0.0815 -0.0428 -0.0218 1133 LEU A O   
2564 C CB  . LEU A 334 ? 0.2742 0.1707 0.3523 -0.0957 -0.0349 -0.0257 1133 LEU A CB  
2565 C CG  . LEU A 334 ? 0.3334 0.2027 0.3987 -0.0964 -0.0236 -0.0324 1133 LEU A CG  
2566 C CD1 . LEU A 334 ? 0.3273 0.1914 0.3843 -0.0983 -0.0197 -0.0346 1133 LEU A CD1 
2567 C CD2 . LEU A 334 ? 0.3665 0.2274 0.4462 -0.0832 -0.0196 -0.0316 1133 LEU A CD2 
2568 N N   . ALA A 335 ? 0.2393 0.1907 0.3541 -0.0960 -0.0524 -0.0170 1134 ALA A N   
2569 C CA  . ALA A 335 ? 0.2109 0.1865 0.3538 -0.0892 -0.0570 -0.0145 1134 ALA A CA  
2570 C C   . ALA A 335 ? 0.2765 0.2600 0.4257 -0.0907 -0.0544 -0.0196 1134 ALA A C   
2571 O O   . ALA A 335 ? 0.2709 0.2712 0.4437 -0.0845 -0.0538 -0.0215 1134 ALA A O   
2572 C CB  . ALA A 335 ? 0.2189 0.2143 0.3711 -0.0955 -0.0660 -0.0070 1134 ALA A CB  
2573 N N   . LYS A 336 ? 0.2287 0.1998 0.3571 -0.1003 -0.0520 -0.0223 1135 LYS A N   
2574 C CA  . LYS A 336 ? 0.2052 0.1830 0.3349 -0.1053 -0.0502 -0.0257 1135 LYS A CA  
2575 C C   . LYS A 336 ? 0.2751 0.2399 0.4024 -0.0998 -0.0452 -0.0266 1135 LYS A C   
2576 O O   . LYS A 336 ? 0.2535 0.2265 0.3826 -0.1046 -0.0443 -0.0282 1135 LYS A O   
2577 C CB  . LYS A 336 ? 0.2166 0.1880 0.3258 -0.1201 -0.0513 -0.0261 1135 LYS A CB  
2578 C CG  . LYS A 336 ? 0.1643 0.1548 0.2602 -0.1105 -0.0517 -0.0184 1135 LYS A CG  
2579 C CD  . LYS A 336 ? 0.2083 0.1870 0.2948 -0.1445 -0.0580 -0.0246 1135 LYS A CD  
2580 C CE  . LYS A 336 ? 0.3723 0.3769 0.4649 -0.1547 -0.0654 -0.0213 1135 LYS A CE  
2581 N NZ  . LYS A 336 ? 0.4657 0.4604 0.5309 -0.1726 -0.0662 -0.0220 1135 LYS A NZ  
2582 N N   . SER A 337 ? 0.2633 0.2097 0.3864 -0.0916 -0.0424 -0.0248 1136 SER A N   
2583 C CA  . SER A 337 ? 0.2671 0.2017 0.3901 -0.0861 -0.0389 -0.0229 1136 SER A CA  
2584 C C   . SER A 337 ? 0.3213 0.2740 0.4606 -0.0815 -0.0386 -0.0243 1136 SER A C   
2585 O O   . SER A 337 ? 0.3225 0.2930 0.4772 -0.0785 -0.0391 -0.0280 1136 SER A O   
2586 C CB  . SER A 337 ? 0.3151 0.2293 0.4339 -0.0782 -0.0353 -0.0215 1136 SER A CB  
2587 O OG  . SER A 337 ? 0.4292 0.3514 0.5582 -0.0701 -0.0359 -0.0222 1136 SER A OG  
2588 N N   . ARG A 338 ? 0.2657 0.2141 0.4034 -0.0821 -0.0375 -0.0208 1137 ARG A N   
2589 C CA  . ARG A 338 ? 0.2376 0.2025 0.3861 -0.0814 -0.0363 -0.0223 1137 ARG A CA  
2590 C C   . ARG A 338 ? 0.2422 0.2056 0.4015 -0.0693 -0.0341 -0.0235 1137 ARG A C   
2591 O O   . ARG A 338 ? 0.2355 0.2149 0.4080 -0.0677 -0.0318 -0.0289 1137 ARG A O   
2592 C CB  . ARG A 338 ? 0.2608 0.2210 0.4025 -0.0872 -0.0379 -0.0144 1137 ARG A CB  
2593 C CG  . ARG A 338 ? 0.5068 0.4902 0.6512 -0.0980 -0.0377 -0.0170 1137 ARG A CG  
2594 C CD  . ARG A 338 ? 0.6805 0.6617 0.8190 -0.1045 -0.0415 -0.0054 1137 ARG A CD  
2595 N NE  . ARG A 338 ? 0.7706 0.7544 0.8977 -0.1196 -0.0454 0.0000  1137 ARG A NE  
2596 C CZ  . ARG A 338 ? 0.9361 0.8993 1.0556 -0.1207 -0.0487 0.0088  1137 ARG A CZ  
2597 N NH1 . ARG A 338 ? 0.6667 0.6056 0.7888 -0.1081 -0.0470 0.0111  1137 ARG A NH1 
2598 N NH2 . ARG A 338 ? 0.8429 0.8092 0.9523 -0.1357 -0.0526 0.0145  1137 ARG A NH2 
2599 N N   . TRP A 339 ? 0.1736 0.1178 0.3278 -0.0619 -0.0336 -0.0199 1138 TRP A N   
2600 C CA  . TRP A 339 ? 0.1610 0.1016 0.3226 -0.0515 -0.0316 -0.0201 1138 TRP A CA  
2601 C C   . TRP A 339 ? 0.1836 0.1373 0.3567 -0.0491 -0.0325 -0.0247 1138 TRP A C   
2602 O O   . TRP A 339 ? 0.1436 0.1063 0.3305 -0.0438 -0.0308 -0.0272 1138 TRP A O   
2603 C CB  . TRP A 339 ? 0.1645 0.0827 0.3162 -0.0478 -0.0296 -0.0173 1138 TRP A CB  
2604 C CG  . TRP A 339 ? 0.1781 0.0923 0.3325 -0.0405 -0.0278 -0.0186 1138 TRP A CG  
2605 C CD1 . TRP A 339 ? 0.2044 0.1212 0.3682 -0.0327 -0.0260 -0.0178 1138 TRP A CD1 
2606 C CD2 . TRP A 339 ? 0.1912 0.0981 0.3365 -0.0428 -0.0279 -0.0200 1138 TRP A CD2 
2607 N NE1 . TRP A 339 ? 0.1999 0.1112 0.3617 -0.0294 -0.0251 -0.0186 1138 TRP A NE1 
2608 C CE2 . TRP A 339 ? 0.2281 0.1340 0.3780 -0.0362 -0.0264 -0.0195 1138 TRP A CE2 
2609 C CE3 . TRP A 339 ? 0.2227 0.1256 0.3550 -0.0521 -0.0293 -0.0212 1138 TRP A CE3 
2610 C CZ2 . TRP A 339 ? 0.2253 0.1267 0.3665 -0.0393 -0.0268 -0.0195 1138 TRP A CZ2 
2611 C CZ3 . TRP A 339 ? 0.2471 0.1463 0.3703 -0.0558 -0.0296 -0.0216 1138 TRP A CZ3 
2612 C CH2 . TRP A 339 ? 0.2487 0.1475 0.3761 -0.0498 -0.0286 -0.0203 1138 TRP A CH2 
2613 N N   . TYR A 340 ? 0.1598 0.1159 0.3293 -0.0541 -0.0355 -0.0251 1139 TYR A N   
2614 C CA  . TYR A 340 ? 0.1532 0.1239 0.3385 -0.0524 -0.0382 -0.0262 1139 TYR A CA  
2615 C C   . TYR A 340 ? 0.1757 0.1667 0.3818 -0.0525 -0.0355 -0.0325 1139 TYR A C   
2616 O O   . TYR A 340 ? 0.1610 0.1612 0.3884 -0.0463 -0.0346 -0.0342 1139 TYR A O   
2617 C CB  . TYR A 340 ? 0.1849 0.1569 0.3620 -0.0600 -0.0431 -0.0235 1139 TYR A CB  
2618 C CG  . TYR A 340 ? 0.2027 0.1922 0.4005 -0.0583 -0.0479 -0.0209 1139 TYR A CG  
2619 C CD1 . TYR A 340 ? 0.2278 0.2142 0.4256 -0.0564 -0.0527 -0.0139 1139 TYR A CD1 
2620 C CD2 . TYR A 340 ? 0.2077 0.2181 0.4273 -0.0595 -0.0477 -0.0246 1139 TYR A CD2 
2621 C CE1 . TYR A 340 ? 0.2395 0.2432 0.4602 -0.0552 -0.0592 -0.0076 1139 TYR A CE1 
2622 C CE2 . TYR A 340 ? 0.2118 0.2389 0.4577 -0.0566 -0.0522 -0.0205 1139 TYR A CE2 
2623 C CZ  . TYR A 340 ? 0.3118 0.3355 0.5592 -0.0541 -0.0590 -0.0105 1139 TYR A CZ  
2624 O OH  . TYR A 340 ? 0.3172 0.3586 0.5943 -0.0514 -0.0652 -0.0030 1139 TYR A OH  
2625 N N   . ASN A 341 ? 0.1452 0.1432 0.3464 -0.0607 -0.0333 -0.0364 1140 ASN A N   
2626 C CA  . ASN A 341 ? 0.1406 0.1590 0.3594 -0.0642 -0.0283 -0.0453 1140 ASN A CA  
2627 C C   . ASN A 341 ? 0.1333 0.1530 0.3608 -0.0595 -0.0229 -0.0493 1140 ASN A C   
2628 O O   . ASN A 341 ? 0.1184 0.1513 0.3682 -0.0577 -0.0173 -0.0577 1140 ASN A O   
2629 C CB  . ASN A 341 ? 0.2620 0.2888 0.4691 -0.0778 -0.0276 -0.0481 1140 ASN A CB  
2630 C CG  . ASN A 341 ? 0.8712 0.9143 1.0830 -0.0865 -0.0210 -0.0567 1140 ASN A CG  
2631 O OD1 . ASN A 341 ? 0.9305 0.9703 1.1261 -0.0938 -0.0217 -0.0531 1140 ASN A OD1 
2632 N ND2 . ASN A 341 ? 0.7585 0.8202 0.9946 -0.0866 -0.0141 -0.0682 1140 ASN A ND2 
2633 N N   . GLN A 342 ? 0.0805 0.0859 0.2747 -0.0381 -0.0193 -0.0388 1141 GLN A N   
2634 C CA  . GLN A 342 ? 0.0649 0.0716 0.2531 -0.0241 -0.0126 -0.0386 1141 GLN A CA  
2635 C C   . GLN A 342 ? 0.0873 0.0885 0.3173 -0.0424 -0.0188 -0.0454 1141 GLN A C   
2636 O O   . GLN A 342 ? 0.0927 0.1032 0.3399 -0.0419 -0.0133 -0.0531 1141 GLN A O   
2637 C CB  . GLN A 342 ? 0.0707 0.0727 0.2428 -0.0284 -0.0153 -0.0312 1141 GLN A CB  
2638 C CG  . GLN A 342 ? 0.1207 0.1319 0.3118 -0.0730 -0.0230 -0.0388 1141 GLN A CG  
2639 C CD  . GLN A 342 ? 0.4176 0.4248 0.5950 -0.0796 -0.0272 -0.0282 1141 GLN A CD  
2640 O OE1 . GLN A 342 ? 0.4648 0.4630 0.6417 -0.0733 -0.0288 -0.0205 1141 GLN A OE1 
2641 N NE2 . GLN A 342 ? 0.1658 0.1820 0.3341 -0.0935 -0.0291 -0.0268 1141 GLN A NE2 
2642 N N   . THR A 343 ? 0.0572 0.0538 0.2622 -0.0116 -0.0185 -0.0314 1142 THR A N   
2643 C CA  . THR A 343 ? 0.0526 0.0482 0.2729 -0.0065 -0.0200 -0.0301 1142 THR A CA  
2644 C C   . THR A 343 ? 0.1421 0.1231 0.3790 -0.0268 -0.0294 -0.0313 1142 THR A C   
2645 O O   . THR A 343 ? 0.1845 0.1547 0.4034 -0.0291 -0.0331 -0.0259 1142 THR A O   
2646 C CB  . THR A 343 ? 0.1568 0.1231 0.3772 -0.0226 -0.0237 -0.0303 1142 THR A CB  
2647 O OG1 . THR A 343 ? 0.1858 0.1392 0.3882 -0.0244 -0.0262 -0.0251 1142 THR A OG1 
2648 C CG2 . THR A 343 ? 0.1872 0.1582 0.4066 -0.0248 -0.0200 -0.0324 1142 THR A CG2 
2649 N N   . PRO A 344 ? 0.0983 0.0921 0.3593 -0.0251 -0.0295 -0.0335 1143 PRO A N   
2650 C CA  . PRO A 344 ? 0.0922 0.0913 0.3598 -0.0264 -0.0365 -0.0271 1143 PRO A CA  
2651 C C   . PRO A 344 ? 0.1915 0.1843 0.4626 -0.0218 -0.0428 -0.0168 1143 PRO A C   
2652 O O   . PRO A 344 ? 0.2246 0.2151 0.4828 -0.0268 -0.0498 -0.0088 1143 PRO A O   
2653 C CB  . PRO A 344 ? 0.1002 0.1182 0.3994 -0.0259 -0.0330 -0.0337 1143 PRO A CB  
2654 C CG  . PRO A 344 ? 0.1675 0.1860 0.4805 -0.0219 -0.0241 -0.0426 1143 PRO A CG  
2655 C CD  . PRO A 344 ? 0.1216 0.1286 0.4059 -0.0248 -0.0220 -0.0437 1143 PRO A CD  
2656 N N   . ASN A 345 ? 0.1421 0.1329 0.4291 -0.0147 -0.0401 -0.0169 1144 ASN A N   
2657 C CA  . ASN A 345 ? 0.1402 0.1263 0.4330 -0.0113 -0.0465 -0.0059 1144 ASN A CA  
2658 C C   . ASN A 345 ? 0.1882 0.1593 0.4497 -0.0144 -0.0479 -0.0018 1144 ASN A C   
2659 O O   . ASN A 345 ? 0.2079 0.1776 0.4616 -0.0189 -0.0552 0.0081  1144 ASN A O   
2660 C CB  . ASN A 345 ? 0.1698 0.1576 0.4922 -0.0034 -0.0427 -0.0073 1144 ASN A CB  
2661 C CG  . ASN A 345 ? 0.4634 0.4649 0.8205 -0.0004 -0.0366 -0.0161 1144 ASN A CG  
2662 O OD1 . ASN A 345 ? 0.3242 0.3382 0.6941 -0.0027 -0.0397 -0.0148 1144 ASN A OD1 
2663 N ND2 . ASN A 345 ? 0.4339 0.4345 0.8075 0.0033  -0.0267 -0.0265 1144 ASN A ND2 
2664 N N   . ARG A 346 ? 0.1308 0.0923 0.3747 -0.0139 -0.0410 -0.0091 1145 ARG A N   
2665 C CA  . ARG A 346 ? 0.1352 0.0822 0.3532 -0.0164 -0.0400 -0.0072 1145 ARG A CA  
2666 C C   . ARG A 346 ? 0.1977 0.1412 0.3961 -0.0250 -0.0423 -0.0064 1145 ARG A C   
2667 O O   . ARG A 346 ? 0.2179 0.1557 0.4012 -0.0311 -0.0450 -0.0020 1145 ARG A O   
2668 C CB  . ARG A 346 ? 0.0981 0.0417 0.3089 -0.0116 -0.0324 -0.0128 1145 ARG A CB  
2669 C CG  . ARG A 346 ? 0.1087 0.0410 0.3013 -0.0117 -0.0294 -0.0113 1145 ARG A CG  
2670 C CD  . ARG A 346 ? 0.1747 0.0973 0.3682 -0.0084 -0.0234 -0.0152 1145 ARG A CD  
2671 N NE  . ARG A 346 ? 0.1561 0.0671 0.3389 -0.0071 -0.0187 -0.0150 1145 ARG A NE  
2672 C CZ  . ARG A 346 ? 0.2915 0.2015 0.4783 -0.0026 -0.0143 -0.0156 1145 ARG A CZ  
2673 N NH1 . ARG A 346 ? 0.1814 0.1015 0.3785 -0.0010 -0.0148 -0.0159 1145 ARG A NH1 
2674 N NH2 . ARG A 346 ? 0.0797 0.0387 0.2610 -0.0001 -0.0088 -0.0126 1145 ARG A NH2 
2675 N N   . ALA A 347 ? 0.1246 0.0724 0.3226 -0.0276 -0.0411 -0.0110 1146 ALA A N   
2676 C CA  . ALA A 347 ? 0.1157 0.0596 0.2958 -0.0367 -0.0426 -0.0112 1146 ALA A CA  
2677 C C   . ALA A 347 ? 0.1730 0.1247 0.3521 -0.0440 -0.0506 -0.0040 1146 ALA A C   
2678 O O   . ALA A 347 ? 0.1978 0.1407 0.3548 -0.0530 -0.0509 -0.0030 1146 ALA A O   
2679 C CB  . ALA A 347 ? 0.1132 0.0638 0.2962 -0.0387 -0.0411 -0.0158 1146 ALA A CB  
2680 N N   . LYS A 348 ? 0.0958 0.0662 0.2968 -0.0364 -0.0559 0.0025  1147 LYS A N   
2681 C CA  . LYS A 348 ? 0.0949 0.0749 0.2975 -0.0417 -0.0656 0.0139  1147 LYS A CA  
2682 C C   . LYS A 348 ? 0.1699 0.1404 0.3610 -0.0531 -0.0694 0.0193  1147 LYS A C   
2683 O O   . LYS A 348 ? 0.2063 0.1760 0.3751 -0.0665 -0.0730 0.0227  1147 LYS A O   
2684 C CB  . LYS A 348 ? 0.0973 0.0953 0.3440 -0.0414 -0.0724 0.0191  1147 LYS A CB  
2685 C CG  . LYS A 348 ? 0.2717 0.2836 0.5360 -0.0406 -0.0703 0.0128  1147 LYS A CG  
2686 C CD  . LYS A 348 ? 0.3576 0.3887 0.6660 -0.0340 -0.0742 0.0184  1147 LYS A CD  
2687 C CE  . LYS A 348 ? 0.4837 0.5212 0.8150 -0.0272 -0.0637 0.0046  1147 LYS A CE  
2688 N NZ  . LYS A 348 ? 0.7088 0.7597 1.0875 -0.0185 -0.0638 0.0076  1147 LYS A NZ  
2689 N N   . ARG A 349 ? 0.0946 0.0630 0.2860 -0.0358 -0.0652 0.0210  1148 ARG A N   
2690 C CA  . ARG A 349 ? 0.0942 0.0608 0.2646 -0.0348 -0.0663 0.0272  1148 ARG A CA  
2691 C C   . ARG A 349 ? 0.1788 0.1208 0.3262 -0.0604 -0.0605 0.0169  1148 ARG A C   
2692 O O   . ARG A 349 ? 0.2095 0.1517 0.3371 -0.0744 -0.0638 0.0214  1148 ARG A O   
2693 C CB  . ARG A 349 ? 0.0574 0.0418 0.2278 -0.0085 -0.0606 0.0267  1148 ARG A CB  
2694 C CG  . ARG A 349 ? 0.1112 0.0733 0.3401 -0.0323 -0.0707 0.0340  1148 ARG A CG  
2695 C CD  . ARG A 349 ? 0.1699 0.1247 0.4078 -0.0244 -0.0667 0.0337  1148 ARG A CD  
2696 N NE  . ARG A 349 ? 0.1520 0.0994 0.3893 -0.0162 -0.0554 0.0198  1148 ARG A NE  
2697 C CZ  . ARG A 349 ? 0.3852 0.3364 0.6467 -0.0075 -0.0509 0.0140  1148 ARG A CZ  
2698 N NH1 . ARG A 349 ? 0.0844 0.0444 0.3773 -0.0036 -0.0551 0.0195  1148 ARG A NH1 
2699 N NH2 . ARG A 349 ? 0.4397 0.3866 0.6957 -0.0039 -0.0419 0.0029  1148 ARG A NH2 
2700 N N   . VAL A 350 ? 0.1324 0.0673 0.2716 -0.0507 -0.0500 0.0059  1149 VAL A N   
2701 C CA  . VAL A 350 ? 0.1438 0.0680 0.2557 -0.0539 -0.0403 -0.0023 1149 VAL A CA  
2702 C C   . VAL A 350 ? 0.2483 0.1637 0.3473 -0.0769 -0.0439 -0.0045 1149 VAL A C   
2703 O O   . VAL A 350 ? 0.2683 0.1774 0.3444 -0.0908 -0.0410 -0.0069 1149 VAL A O   
2704 C CB  . VAL A 350 ? 0.1588 0.0621 0.2797 -0.0507 -0.0317 -0.0121 1149 VAL A CB  
2705 C CG1 . VAL A 350 ? 0.1620 0.0617 0.2621 -0.0502 -0.0217 -0.0185 1149 VAL A CG1 
2706 C CG2 . VAL A 350 ? 0.1505 0.0541 0.2794 -0.0398 -0.0274 -0.0120 1149 VAL A CG2 
2707 N N   . ILE A 351 ? 0.2131 0.1386 0.3227 -0.0760 -0.0490 -0.0027 1150 ILE A N   
2708 C CA  . ILE A 351 ? 0.2253 0.1559 0.3214 -0.0904 -0.0529 -0.0022 1150 ILE A CA  
2709 C C   . ILE A 351 ? 0.3153 0.2586 0.4013 -0.1056 -0.0625 0.0080  1150 ILE A C   
2710 O O   . ILE A 351 ? 0.3380 0.2771 0.3979 -0.1231 -0.0607 0.0047  1150 ILE A O   
2711 C CB  . ILE A 351 ? 0.2389 0.1827 0.3541 -0.0851 -0.0574 -0.0010 1150 ILE A CB  
2712 C CG1 . ILE A 351 ? 0.2254 0.1552 0.3382 -0.0791 -0.0483 -0.0106 1150 ILE A CG1 
2713 C CG2 . ILE A 351 ? 0.2637 0.2216 0.3729 -0.0995 -0.0655 0.0041  1150 ILE A CG2 
2714 C CD1 . ILE A 351 ? 0.1826 0.1250 0.3150 -0.0726 -0.0503 -0.0109 1150 ILE A CD1 
2715 N N   . THR A 352 ? 0.2668 0.2255 0.3737 -0.1003 -0.0724 0.0206  1151 THR A N   
2716 C CA  . THR A 352 ? 0.2779 0.2511 0.3793 -0.1146 -0.0841 0.0348  1151 THR A CA  
2717 C C   . THR A 352 ? 0.3424 0.3026 0.4109 -0.1288 -0.0773 0.0296  1151 THR A C   
2718 O O   . THR A 352 ? 0.3658 0.3327 0.4109 -0.1502 -0.0818 0.0337  1151 THR A O   
2719 C CB  . THR A 352 ? 0.3518 0.3407 0.4883 -0.1036 -0.0951 0.0501  1151 THR A CB  
2720 O OG1 . THR A 352 ? 0.4237 0.4318 0.5855 -0.1014 -0.1040 0.0578  1151 THR A OG1 
2721 C CG2 . THR A 352 ? 0.2984 0.2954 0.4279 -0.1158 -0.1051 0.0656  1151 THR A CG2 
2722 N N   . THR A 353 ? 0.2851 0.2278 0.3515 -0.1183 -0.0656 0.0195  1152 THR A N   
2723 C CA  . THR A 353 ? 0.3002 0.2300 0.3397 -0.1296 -0.0559 0.0115  1152 THR A CA  
2724 C C   . THR A 353 ? 0.3963 0.3128 0.4081 -0.1445 -0.0445 -0.0032 1152 THR A C   
2725 O O   . THR A 353 ? 0.4282 0.3435 0.4128 -0.1652 -0.0410 -0.0067 1152 THR A O   
2726 C CB  . THR A 353 ? 0.2828 0.2020 0.3345 -0.1132 -0.0480 0.0070  1152 THR A CB  
2727 O OG1 . THR A 353 ? 0.2855 0.2185 0.3556 -0.1084 -0.0599 0.0223  1152 THR A OG1 
2728 C CG2 . THR A 353 ? 0.2353 0.1392 0.2635 -0.1221 -0.0336 -0.0056 1152 THR A CG2 
2729 N N   . PHE A 354 ? 0.3416 0.2488 0.3595 -0.1363 -0.0391 -0.0114 1153 PHE A N   
2730 C CA  . PHE A 354 ? 0.3487 0.2407 0.3440 -0.1495 -0.0280 -0.0251 1153 PHE A CA  
2731 C C   . PHE A 354 ? 0.4380 0.3450 0.4154 -0.1718 -0.0374 -0.0192 1153 PHE A C   
2732 O O   . PHE A 354 ? 0.4763 0.3749 0.4250 -0.1928 -0.0290 -0.0292 1153 PHE A O   
2733 C CB  . PHE A 354 ? 0.3491 0.2286 0.3577 -0.1356 -0.0222 -0.0318 1153 PHE A CB  
2734 C CG  . PHE A 354 ? 0.3643 0.2226 0.3816 -0.1212 -0.0083 -0.0417 1153 PHE A CG  
2735 C CD1 . PHE A 354 ? 0.4378 0.2795 0.4417 -0.1277 0.0062  -0.0534 1153 PHE A CD1 
2736 C CD2 . PHE A 354 ? 0.3565 0.2130 0.3962 -0.1030 -0.0092 -0.0394 1153 PHE A CD2 
2737 C CE1 . PHE A 354 ? 0.4413 0.2654 0.4591 -0.1135 0.0187  -0.0609 1153 PHE A CE1 
2738 C CE2 . PHE A 354 ? 0.3846 0.2245 0.4346 -0.0909 0.0016  -0.0453 1153 PHE A CE2 
2739 C CZ  . PHE A 354 ? 0.3848 0.2087 0.4261 -0.0950 0.0152  -0.0554 1153 PHE A CZ  
2740 N N   . ARG A 355 ? 0.3746 0.3048 0.3705 -0.1683 -0.0541 -0.0033 1154 ARG A N   
2741 C CA  . ARG A 355 ? 0.3826 0.3330 0.3680 -0.1882 -0.0662 0.0065  1154 ARG A CA  
2742 C C   . ARG A 355 ? 0.4712 0.4310 0.4311 -0.2124 -0.0706 0.0126  1154 ARG A C   
2743 O O   . ARG A 355 ? 0.5120 0.4676 0.4397 -0.2367 -0.0645 0.0039  1154 ARG A O   
2744 C CB  . ARG A 355 ? 0.3308 0.3054 0.3506 -0.1758 -0.0824 0.0232  1154 ARG A CB  
2745 C CG  . ARG A 355 ? 0.3832 0.3813 0.4004 -0.1929 -0.0955 0.0343  1154 ARG A CG  
2746 C CD  . ARG A 355 ? 0.5529 0.5738 0.6118 -0.1774 -0.1083 0.0485  1154 ARG A CD  
2747 N NE  . ARG A 355 ? 0.7440 0.7801 0.8269 -0.1713 -0.1202 0.0664  1154 ARG A NE  
2748 C CZ  . ARG A 355 ? 0.9825 1.0429 1.0693 -0.1862 -0.1367 0.0868  1154 ARG A CZ  
2749 N NH1 . ARG A 355 ? 0.8611 0.9356 0.9274 -0.2094 -0.1433 0.0911  1154 ARG A NH1 
2750 N NH2 . ARG A 355 ? 0.8036 0.8750 0.9155 -0.1792 -0.1473 0.1041  1154 ARG A NH2 
2751 N N   . THR A 356 ? 0.3985 0.3692 0.3713 -0.2072 -0.0794 0.0263  1155 THR A N   
2752 C CA  . THR A 356 ? 0.4076 0.3918 0.3605 -0.2298 -0.0873 0.0373  1155 THR A CA  
2753 C C   . THR A 356 ? 0.4838 0.4510 0.4068 -0.2422 -0.0716 0.0223  1155 THR A C   
2754 O O   . THR A 356 ? 0.5304 0.5086 0.4258 -0.2696 -0.0753 0.0270  1155 THR A O   
2755 C CB  . THR A 356 ? 0.4754 0.4796 0.4597 -0.2190 -0.1055 0.0615  1155 THR A CB  
2756 O OG1 . THR A 356 ? 0.4188 0.4082 0.4196 -0.1971 -0.0976 0.0564  1155 THR A OG1 
2757 C CG2 . THR A 356 ? 0.4411 0.4647 0.4610 -0.2070 -0.1200 0.0763  1155 THR A CG2 
2758 N N   . GLY A 357 ? 0.4246 0.3685 0.3548 -0.2235 -0.0553 0.0063  1156 GLY A N   
2759 C CA  . GLY A 357 ? 0.4539 0.3829 0.3625 -0.2326 -0.0391 -0.0083 1156 GLY A CA  
2760 C C   . GLY A 357 ? 0.5395 0.4813 0.4490 -0.2365 -0.0480 0.0058  1156 GLY A C   
2761 O O   . GLY A 357 ? 0.5681 0.5059 0.4520 -0.2544 -0.0380 -0.0030 1156 GLY A O   
2762 N N   . THR A 358 ? 0.4745 0.4311 0.4152 -0.2198 -0.0657 0.0270  1157 THR A N   
2763 C CA  . THR A 358 ? 0.4728 0.4415 0.4225 -0.2201 -0.0774 0.0448  1157 THR A CA  
2764 C C   . THR A 358 ? 0.4941 0.4549 0.4799 -0.1885 -0.0767 0.0466  1157 THR A C   
2765 O O   . THR A 358 ? 0.4849 0.4380 0.4914 -0.1682 -0.0725 0.0395  1157 THR A O   
2766 C CB  . THR A 358 ? 0.6095 0.6060 0.5686 -0.2322 -0.1020 0.0729  1157 THR A CB  
2767 O OG1 . THR A 358 ? 0.5968 0.5997 0.5947 -0.2096 -0.1116 0.0820  1157 THR A OG1 
2768 C CG2 . THR A 358 ? 0.6071 0.6172 0.5310 -0.2664 -0.1064 0.0749  1157 THR A CG2 
2769 N N   . TRP A 359 ? 0.4348 0.4000 0.4287 -0.1863 -0.0825 0.0581  1158 TRP A N   
2770 C CA  . TRP A 359 ? 0.3995 0.3588 0.4268 -0.1595 -0.0825 0.0608  1158 TRP A CA  
2771 C C   . TRP A 359 ? 0.4603 0.4345 0.5245 -0.1478 -0.1006 0.0820  1158 TRP A C   
2772 O O   . TRP A 359 ? 0.4229 0.3935 0.5150 -0.1291 -0.1012 0.0855  1158 TRP A O   
2773 C CB  . TRP A 359 ? 0.3820 0.3363 0.4009 -0.1625 -0.0777 0.0606  1158 TRP A CB  
2774 C CG  . TRP A 359 ? 0.4061 0.3452 0.3986 -0.1689 -0.0571 0.0377  1158 TRP A CG  
2775 C CD1 . TRP A 359 ? 0.4759 0.4161 0.4333 -0.1951 -0.0502 0.0311  1158 TRP A CD1 
2776 C CD2 . TRP A 359 ? 0.3848 0.3063 0.3868 -0.1497 -0.0401 0.0187  1158 TRP A CD2 
2777 N NE1 . TRP A 359 ? 0.4765 0.3996 0.4242 -0.1917 -0.0282 0.0074  1158 TRP A NE1 
2778 C CE2 . TRP A 359 ? 0.4569 0.3687 0.4330 -0.1633 -0.0228 0.0011  1158 TRP A CE2 
2779 C CE3 . TRP A 359 ? 0.3702 0.2848 0.4007 -0.1240 -0.0378 0.0151  1158 TRP A CE3 
2780 C CZ2 . TRP A 359 ? 0.4344 0.3297 0.4173 -0.1495 -0.0042 -0.0177 1158 TRP A CZ2 
2781 C CZ3 . TRP A 359 ? 0.3829 0.2825 0.4157 -0.1125 -0.0211 -0.0021 1158 TRP A CZ3 
2782 C CH2 . TRP A 359 ? 0.4069 0.2971 0.4187 -0.1240 -0.0050 -0.0172 1158 TRP A CH2 
2783 N N   . ASP A 360 ? 0.4594 0.4504 0.5264 -0.1587 -0.1139 0.0950  1159 ASP A N   
2784 C CA  . ASP A 360 ? 0.4623 0.4701 0.5690 -0.1490 -0.1308 0.1158  1159 ASP A CA  
2785 C C   . ASP A 360 ? 0.4717 0.4725 0.6194 -0.1198 -0.1261 0.1106  1159 ASP A C   
2786 O O   . ASP A 360 ? 0.4645 0.4713 0.6462 -0.1097 -0.1351 0.1255  1159 ASP A O   
2787 C CB  . ASP A 360 ? 0.5153 0.5407 0.6193 -0.1623 -0.1410 0.1237  1159 ASP A CB  
2788 C CG  . ASP A 360 ? 0.8303 0.8783 0.9243 -0.1878 -0.1600 0.1490  1159 ASP A CG  
2789 O OD1 . ASP A 360 ? 0.8916 0.9382 0.9452 -0.2115 -0.1574 0.1466  1159 ASP A OD1 
2790 O OD2 . ASP A 360 ? 0.9232 0.9918 1.0505 -0.1856 -0.1775 0.1713  1159 ASP A OD2 
2791 N N   . ALA A 361 ? 0.4007 0.3889 0.5452 -0.1081 -0.1119 0.0895  1160 ALA A N   
2792 C CA  . ALA A 361 ? 0.3702 0.3530 0.5464 -0.0848 -0.1054 0.0812  1160 ALA A CA  
2793 C C   . ALA A 361 ? 0.4042 0.3768 0.5932 -0.0726 -0.1003 0.0797  1160 ALA A C   
2794 O O   . ALA A 361 ? 0.3846 0.3579 0.6070 -0.0567 -0.0995 0.0796  1160 ALA A O   
2795 C CB  . ALA A 361 ? 0.3749 0.3464 0.5364 -0.0805 -0.0920 0.0609  1160 ALA A CB  
2796 N N   . TYR A 362 ? 0.3579 0.3218 0.5197 -0.0818 -0.0959 0.0774  1161 TYR A N   
2797 C CA  . TYR A 362 ? 0.3448 0.2993 0.5113 -0.0741 -0.0904 0.0753  1161 TYR A CA  
2798 C C   . TYR A 362 ? 0.4403 0.4019 0.6110 -0.0837 -0.1029 0.0956  1161 TYR A C   
2799 O O   . TYR A 362 ? 0.4325 0.3867 0.5985 -0.0830 -0.0989 0.0949  1161 TYR A O   
2800 C CB  . TYR A 362 ? 0.3534 0.2935 0.4904 -0.0763 -0.0747 0.0569  1161 TYR A CB  
2801 C CG  . TYR A 362 ? 0.3481 0.2808 0.4872 -0.0654 -0.0641 0.0407  1161 TYR A CG  
2802 C CD1 . TYR A 362 ? 0.3461 0.2750 0.5072 -0.0481 -0.0585 0.0341  1161 TYR A CD1 
2803 C CD2 . TYR A 362 ? 0.3681 0.2987 0.4876 -0.0742 -0.0606 0.0332  1161 TYR A CD2 
2804 C CE1 . TYR A 362 ? 0.3291 0.2542 0.4926 -0.0404 -0.0513 0.0224  1161 TYR A CE1 
2805 C CE2 . TYR A 362 ? 0.3677 0.2921 0.4912 -0.0649 -0.0529 0.0214  1161 TYR A CE2 
2806 C CZ  . TYR A 362 ? 0.3982 0.3205 0.5433 -0.0483 -0.0488 0.0169  1161 TYR A CZ  
2807 O OH  . TYR A 362 ? 0.3339 0.2517 0.4814 -0.0418 -0.0425 0.0073  1161 TYR A OH  
2808 N N   . LEU A 363 ? 0.5022 0.5627 0.2854 0.0387  -0.1670 0.0572  405  LEU A N   
2809 C CA  . LEU A 363 ? 0.5239 0.5811 0.3144 0.0343  -0.1579 0.0498  405  LEU A CA  
2810 C C   . LEU A 363 ? 0.7104 0.7750 0.5004 0.0252  -0.1585 0.0480  405  LEU A C   
2811 O O   . LEU A 363 ? 0.7109 0.7788 0.4902 0.0212  -0.1650 0.0549  405  LEU A O   
2812 C CB  . LEU A 363 ? 0.5259 0.5507 0.3009 0.0362  -0.1529 0.0522  405  LEU A CB  
2813 C CG  . LEU A 363 ? 0.5851 0.5972 0.3545 0.0502  -0.1507 0.0529  405  LEU A CG  
2814 C CD1 . LEU A 363 ? 0.6028 0.5761 0.3479 0.0510  -0.1487 0.0558  405  LEU A CD1 
2815 C CD2 . LEU A 363 ? 0.5947 0.6341 0.3870 0.0564  -0.1426 0.0456  405  LEU A CD2 
2816 N N   . HIS A 364 ? 0.7680 0.8352 0.5671 0.0225  -0.1518 0.0395  406  HIS A N   
2817 C CA  . HIS A 364 ? 0.8095 0.8780 0.6040 0.0187  -0.1511 0.0360  406  HIS A CA  
2818 C C   . HIS A 364 ? 0.9385 0.9840 0.7236 0.0169  -0.1441 0.0367  406  HIS A C   
2819 O O   . HIS A 364 ? 0.9448 0.9759 0.7302 0.0173  -0.1390 0.0377  406  HIS A O   
2820 C CB  . HIS A 364 ? 0.8294 0.9105 0.6345 0.0172  -0.1507 0.0253  406  HIS A CB  
2821 C CG  . HIS A 364 ? 0.8819 0.9886 0.6962 0.0188  -0.1578 0.0240  406  HIS A CG  
2822 N ND1 . HIS A 364 ? 0.9130 1.0337 0.7418 0.0192  -0.1579 0.0225  406  HIS A ND1 
2823 C CD2 . HIS A 364 ? 0.9147 1.0390 0.7250 0.0211  -0.1648 0.0247  406  HIS A CD2 
2824 C CE1 . HIS A 364 ? 0.9086 1.0524 0.7416 0.0212  -0.1653 0.0222  406  HIS A CE1 
2825 N NE2 . HIS A 364 ? 0.9131 1.0590 0.7351 0.0221  -0.1696 0.0233  406  HIS A NE2 
2826 N N   . MET A 365 ? 0.9493 0.9935 0.7246 0.0171  -0.1438 0.0364  407  MET A N   
2827 C CA  . MET A 365 ? 0.9799 1.0058 0.7444 0.0168  -0.1379 0.0379  407  MET A CA  
2828 C C   . MET A 365 ? 1.0468 1.0615 0.8021 0.0135  -0.1384 0.0467  407  MET A C   
2829 O O   . MET A 365 ? 1.0511 1.0468 0.8027 0.0128  -0.1322 0.0464  407  MET A O   
2830 C CB  . MET A 365 ? 1.0296 1.0381 0.7988 0.0150  -0.1297 0.0307  407  MET A CB  
2831 C CG  . MET A 365 ? 1.0999 1.1100 0.8730 0.0139  -0.1302 0.0213  407  MET A CG  
2832 S SD  . MET A 365 ? 1.1800 1.1742 0.9603 0.0043  -0.1221 0.0163  407  MET A SD  
2833 C CE  . MET A 365 ? 1.1456 1.1513 0.9331 -0.0024 -0.1279 0.0063  407  MET A CE  
2834 N N   . ASN A 366 ? 1.0136 1.0371 0.7626 0.0104  -0.1463 0.0547  408  ASN A N   
2835 C CA  . ASN A 366 ? 1.0333 1.0379 0.7671 0.0047  -0.1489 0.0628  408  ASN A CA  
2836 C C   . ASN A 366 ? 1.1016 1.0999 0.8216 -0.0001 -0.1468 0.0672  408  ASN A C   
2837 O O   . ASN A 366 ? 1.1058 1.0801 0.8132 -0.0038 -0.1457 0.0696  408  ASN A O   
2838 C CB  . ASN A 366 ? 1.0648 1.0731 0.7904 -0.0006 -0.1590 0.0713  408  ASN A CB  
2839 C CG  . ASN A 366 ? 1.4074 1.4056 1.1382 0.0061  -0.1602 0.0688  408  ASN A CG  
2840 O OD1 . ASN A 366 ? 1.3580 1.3356 1.0877 0.0125  -0.1551 0.0649  408  ASN A OD1 
2841 N ND2 . ASN A 366 ? 1.3034 1.3188 1.0382 0.0064  -0.1672 0.0721  408  ASN A ND2 
2842 N N   . ARG A 367 ? 1.0547 1.0744 0.7755 0.0025  -0.1460 0.0673  409  ARG A N   
2843 C CA  . ARG A 367 ? 1.0524 1.0744 0.7613 0.0011  -0.1439 0.0718  409  ARG A CA  
2844 C C   . ARG A 367 ? 1.0759 1.0727 0.7846 0.0056  -0.1344 0.0658  409  ARG A C   
2845 O O   . ARG A 367 ? 1.0796 1.0655 0.7762 0.0011  -0.1331 0.0702  409  ARG A O   
2846 C CB  . ARG A 367 ? 1.0793 1.1345 0.7874 0.0082  -0.1454 0.0737  409  ARG A CB  
2847 C CG  . ARG A 367 ? 1.2850 1.3734 0.9877 -0.0005 -0.1548 0.0850  409  ARG A CG  
2848 C CD  . ARG A 367 ? 1.5103 1.6392 1.2117 0.0106  -0.1554 0.0870  409  ARG A CD  
2849 N NE  . ARG A 367 ? 1.7243 1.8930 1.4230 0.0013  -0.1642 0.0987  409  ARG A NE  
2850 C CZ  . ARG A 367 ? 1.9683 2.1627 1.6733 0.0069  -0.1675 0.0977  409  ARG A CZ  
2851 N NH1 . ARG A 367 ? 1.8403 2.0230 1.5535 0.0218  -0.1635 0.0844  409  ARG A NH1 
2852 N NH2 . ARG A 367 ? 1.8143 2.0474 1.5158 -0.0040 -0.1753 0.1105  409  ARG A NH2 
2853 N N   . GLU A 368 ? 1.0127 1.0009 0.7333 0.0122  -0.1284 0.0565  410  GLU A N   
2854 C CA  . GLU A 368 ? 1.0083 0.9743 0.7296 0.0139  -0.1192 0.0517  410  GLU A CA  
2855 C C   . GLU A 368 ? 1.0341 0.9843 0.7553 0.0101  -0.1171 0.0525  410  GLU A C   
2856 O O   . GLU A 368 ? 1.0328 0.9678 0.7446 0.0093  -0.1123 0.0541  410  GLU A O   
2857 C CB  . GLU A 368 ? 1.0281 0.9910 0.7605 0.0168  -0.1155 0.0429  410  GLU A CB  
2858 C CG  . GLU A 368 ? 1.2109 1.1733 0.9343 0.0241  -0.1154 0.0400  410  GLU A CG  
2859 C CD  . GLU A 368 ? 1.5971 1.5759 1.3241 0.0284  -0.1216 0.0353  410  GLU A CD  
2860 O OE1 . GLU A 368 ? 1.6569 1.6231 1.3830 0.0297  -0.1205 0.0270  410  GLU A OE1 
2861 O OE2 . GLU A 368 ? 1.5254 1.5285 1.2536 0.0293  -0.1280 0.0401  410  GLU A OE2 
2862 N N   . ARG A 369 ? 0.9705 0.9246 0.6995 0.0101  -0.1210 0.0514  411  ARG A N   
2863 C CA  . ARG A 369 ? 0.9709 0.9105 0.6965 0.0119  -0.1204 0.0516  411  ARG A CA  
2864 C C   . ARG A 369 ? 1.0290 0.9482 0.7315 0.0075  -0.1233 0.0575  411  ARG A C   
2865 O O   . ARG A 369 ? 1.0321 0.9329 0.7261 0.0105  -0.1178 0.0559  411  ARG A O   
2866 C CB  . ARG A 369 ? 0.9724 0.9215 0.7040 0.0141  -0.1276 0.0522  411  ARG A CB  
2867 C CG  . ARG A 369 ? 1.0884 1.0264 0.8187 0.0226  -0.1261 0.0506  411  ARG A CG  
2868 C CD  . ARG A 369 ? 1.1370 1.0898 0.8762 0.0269  -0.1326 0.0510  411  ARG A CD  
2869 N NE  . ARG A 369 ? 1.2125 1.1944 0.9750 0.0257  -0.1307 0.0456  411  ARG A NE  
2870 C CZ  . ARG A 369 ? 1.4541 1.4514 1.2339 0.0292  -0.1244 0.0400  411  ARG A CZ  
2871 N NH1 . ARG A 369 ? 1.2953 1.2879 1.0742 0.0372  -0.1184 0.0394  411  ARG A NH1 
2872 N NH2 . ARG A 369 ? 1.3217 1.3409 1.1179 0.0241  -0.1246 0.0351  411  ARG A NH2 
2873 N N   . LYS A 370 ? 0.9909 0.9164 0.6820 -0.0007 -0.1322 0.0647  412  LYS A N   
2874 C CA  . LYS A 370 ? 1.0102 0.9200 0.6771 -0.0105 -0.1377 0.0716  412  LYS A CA  
2875 C C   . LYS A 370 ? 1.0580 0.9643 0.7196 -0.0102 -0.1305 0.0709  412  LYS A C   
2876 O O   . LYS A 370 ? 1.0743 0.9556 0.7203 -0.0109 -0.1285 0.0700  412  LYS A O   
2877 C CB  . LYS A 370 ? 1.0458 0.9764 0.7059 -0.0224 -0.1483 0.0810  412  LYS A CB  
2878 C CG  . LYS A 370 ? 1.3251 1.2350 0.9654 -0.0326 -0.1593 0.0875  412  LYS A CG  
2879 C CD  . LYS A 370 ? 1.5208 1.4312 1.1372 -0.0526 -0.1686 0.0984  412  LYS A CD  
2880 C CE  . LYS A 370 ? 1.6671 1.5376 1.2525 -0.0657 -0.1797 0.1042  412  LYS A CE  
2881 N NZ  . LYS A 370 ? 1.7100 1.5801 1.2697 -0.0900 -0.1895 0.1149  412  LYS A NZ  
2882 N N   . ALA A 371 ? 0.9892 0.9179 0.6616 -0.0066 -0.1265 0.0706  413  ALA A N   
2883 C CA  . ALA A 371 ? 0.9848 0.9122 0.6523 -0.0038 -0.1198 0.0709  413  ALA A CA  
2884 C C   . ALA A 371 ? 1.0162 0.9214 0.6857 0.0017  -0.1095 0.0649  413  ALA A C   
2885 O O   . ALA A 371 ? 1.0160 0.9123 0.6741 0.0013  -0.1054 0.0668  413  ALA A O   
2886 C CB  . ALA A 371 ? 0.9847 0.9342 0.6603 0.0039  -0.1179 0.0706  413  ALA A CB  
2887 N N   . ALA A 372 ? 0.9553 0.8569 0.6395 0.0063  -0.1056 0.0588  414  ALA A N   
2888 C CA  . ALA A 372 ? 0.9530 0.8435 0.6419 0.0107  -0.0958 0.0543  414  ALA A CA  
2889 C C   . ALA A 372 ? 1.0211 0.8919 0.6933 0.0124  -0.0957 0.0545  414  ALA A C   
2890 O O   . ALA A 372 ? 1.0247 0.8864 0.6907 0.0152  -0.0879 0.0535  414  ALA A O   
2891 C CB  . ALA A 372 ? 0.9527 0.8548 0.6623 0.0136  -0.0932 0.0491  414  ALA A CB  
2892 N N   . LYS A 373 ? 0.9868 0.8481 0.6480 0.0112  -0.1048 0.0558  415  LYS A N   
2893 C CA  . LYS A 373 ? 1.0120 0.8444 0.6484 0.0138  -0.1072 0.0552  415  LYS A CA  
2894 C C   . LYS A 373 ? 1.0729 0.8933 0.6878 0.0050  -0.1089 0.0589  415  LYS A C   
2895 O O   . LYS A 373 ? 1.0836 0.8846 0.6823 0.0094  -0.1044 0.0562  415  LYS A O   
2896 C CB  . LYS A 373 ? 1.0604 0.8788 0.6843 0.0119  -0.1187 0.0573  415  LYS A CB  
2897 C CG  . LYS A 373 ? 1.3302 1.1073 0.9200 0.0160  -0.1233 0.0559  415  LYS A CG  
2898 C CD  . LYS A 373 ? 1.4946 1.2492 1.0578 0.0008  -0.1384 0.0628  415  LYS A CD  
2899 C CE  . LYS A 373 ? 1.6600 1.3635 1.1799 0.0002  -0.1447 0.0614  415  LYS A CE  
2900 N NZ  . LYS A 373 ? 1.7613 1.4534 1.2563 -0.0243 -0.1554 0.0687  415  LYS A NZ  
2901 N N   . GLN A 374 ? 1.0220 0.8590 0.6369 -0.0063 -0.1150 0.0652  416  GLN A N   
2902 C CA  . GLN A 374 ? 1.0306 0.8670 0.6275 -0.0155 -0.1175 0.0703  416  GLN A CA  
2903 C C   . GLN A 374 ? 1.0765 0.9151 0.6781 -0.0079 -0.1057 0.0681  416  GLN A C   
2904 O O   . GLN A 374 ? 1.0928 0.9155 0.6743 -0.0101 -0.1048 0.0682  416  GLN A O   
2905 C CB  . GLN A 374 ? 1.0358 0.9025 0.6366 -0.0253 -0.1250 0.0784  416  GLN A CB  
2906 C CG  . GLN A 374 ? 1.2349 1.1066 0.8142 -0.0380 -0.1308 0.0855  416  GLN A CG  
2907 C CD  . GLN A 374 ? 1.4526 1.3666 1.0413 -0.0389 -0.1322 0.0929  416  GLN A CD  
2908 O OE1 . GLN A 374 ? 1.4070 1.3347 1.0104 -0.0250 -0.1236 0.0909  416  GLN A OE1 
2909 N NE2 . GLN A 374 ? 1.3036 1.2386 0.8804 -0.0550 -0.1433 0.1023  416  GLN A NE2 
2910 N N   . LEU A 375 ? 1.0121 0.8667 0.6365 -0.0001 -0.0974 0.0661  417  LEU A N   
2911 C CA  . LEU A 375 ? 1.0107 0.8640 0.6379 0.0055  -0.0864 0.0654  417  LEU A CA  
2912 C C   . LEU A 375 ? 1.0915 0.9277 0.7126 0.0105  -0.0791 0.0609  417  LEU A C   
2913 O O   . LEU A 375 ? 1.0991 0.9275 0.7068 0.0113  -0.0742 0.0622  417  LEU A O   
2914 C CB  . LEU A 375 ? 0.9925 0.8577 0.6397 0.0099  -0.0809 0.0642  417  LEU A CB  
2915 C CG  . LEU A 375 ? 1.0551 0.9132 0.7044 0.0131  -0.0696 0.0640  417  LEU A CG  
2916 C CD1 . LEU A 375 ? 1.0635 0.9178 0.6955 0.0143  -0.0676 0.0699  417  LEU A CD1 
2917 C CD2 . LEU A 375 ? 1.0794 0.9409 0.7431 0.0137  -0.0671 0.0621  417  LEU A CD2 
2918 N N   . GLY A 376 ? 1.0528 0.8863 0.6820 0.0156  -0.0788 0.0561  418  GLY A N   
2919 C CA  . GLY A 376 ? 1.0678 0.8907 0.6905 0.0250  -0.0723 0.0515  418  GLY A CA  
2920 C C   . GLY A 376 ? 1.1497 0.9455 0.7399 0.0255  -0.0767 0.0506  418  GLY A C   
2921 O O   . GLY A 376 ? 1.1585 0.9466 0.7375 0.0326  -0.0691 0.0482  418  GLY A O   
2922 N N   . PHE A 377 ? 1.1274 0.9086 0.7001 0.0162  -0.0894 0.0529  419  PHE A N   
2923 C CA  . PHE A 377 ? 1.1692 0.9191 0.7055 0.0112  -0.0970 0.0523  419  PHE A CA  
2924 C C   . PHE A 377 ? 1.2130 0.9684 0.7402 0.0054  -0.0932 0.0555  419  PHE A C   
2925 O O   . PHE A 377 ? 1.2308 0.9660 0.7351 0.0101  -0.0902 0.0517  419  PHE A O   
2926 C CB  . PHE A 377 ? 1.2131 0.9524 0.7350 -0.0039 -0.1125 0.0570  419  PHE A CB  
2927 C CG  . PHE A 377 ? 1.2913 0.9857 0.7774 -0.0039 -0.1222 0.0536  419  PHE A CG  
2928 C CD1 . PHE A 377 ? 1.3782 1.0382 0.8249 -0.0112 -0.1282 0.0521  419  PHE A CD1 
2929 C CD2 . PHE A 377 ? 1.3399 1.0228 0.8277 0.0031  -0.1268 0.0522  419  PHE A CD2 
2930 C CE1 . PHE A 377 ? 1.4477 1.0558 0.8536 -0.0114 -0.1388 0.0485  419  PHE A CE1 
2931 C CE2 . PHE A 377 ? 1.4303 1.0634 0.8785 0.0046  -0.1369 0.0496  419  PHE A CE2 
2932 C CZ  . PHE A 377 ? 1.4503 1.0429 0.8560 -0.0026 -0.1430 0.0474  419  PHE A CZ  
2933 N N   . ILE A 378 ? 1.1412 0.9247 0.6852 -0.0018 -0.0927 0.0621  420  ILE A N   
2934 C CA  . ILE A 378 ? 1.1316 0.9259 0.6696 -0.0048 -0.0891 0.0668  420  ILE A CA  
2935 C C   . ILE A 378 ? 1.2000 0.9908 0.7410 0.0068  -0.0751 0.0636  420  ILE A C   
2936 O O   . ILE A 378 ? 1.2087 0.9875 0.7280 0.0070  -0.0734 0.0629  420  ILE A O   
2937 C CB  . ILE A 378 ? 1.1342 0.9595 0.6887 -0.0085 -0.0910 0.0742  420  ILE A CB  
2938 C CG1 . ILE A 378 ? 1.1350 0.9712 0.6764 -0.0233 -0.1051 0.0804  420  ILE A CG1 
2939 C CG2 . ILE A 378 ? 1.1308 0.9672 0.6866 -0.0027 -0.0824 0.0784  420  ILE A CG2 
2940 C CD1 . ILE A 378 ? 1.1302 1.0031 0.6880 -0.0236 -0.1083 0.0874  420  ILE A CD1 
2941 N N   . MET A 379 ? 1.1672 0.9692 0.7333 0.0147  -0.0659 0.0618  421  MET A N   
2942 C CA  . MET A 379 ? 1.1815 0.9868 0.7537 0.0227  -0.0525 0.0606  421  MET A CA  
2943 C C   . MET A 379 ? 1.2650 1.0546 0.8191 0.0317  -0.0497 0.0543  421  MET A C   
2944 O O   . MET A 379 ? 1.2777 1.0668 0.8217 0.0364  -0.0414 0.0546  421  MET A O   
2945 C CB  . MET A 379 ? 1.1987 1.0207 0.7999 0.0245  -0.0460 0.0604  421  MET A CB  
2946 C CG  . MET A 379 ? 1.2458 1.0760 0.8575 0.0195  -0.0438 0.0663  421  MET A CG  
2947 S SD  . MET A 379 ? 1.3002 1.1429 0.9399 0.0168  -0.0393 0.0651  421  MET A SD  
2948 C CE  . MET A 379 ? 1.2740 1.1241 0.9169 0.0171  -0.0253 0.0667  421  MET A CE  
2949 N N   . ALA A 380 ? 1.2378 1.0128 0.7841 0.0359  -0.0569 0.0488  422  ALA A N   
2950 C CA  . ALA A 380 ? 1.2717 1.0252 0.7941 0.0493  -0.0557 0.0416  422  ALA A CA  
2951 C C   . ALA A 380 ? 1.3619 1.0881 0.8467 0.0458  -0.0605 0.0401  422  ALA A C   
2952 O O   . ALA A 380 ? 1.3856 1.0986 0.8498 0.0588  -0.0550 0.0344  422  ALA A O   
2953 C CB  . ALA A 380 ? 1.2927 1.0298 0.8097 0.0550  -0.0644 0.0373  422  ALA A CB  
2954 N N   . ALA A 381 ? 1.3231 1.0446 0.7982 0.0285  -0.0708 0.0451  423  ALA A N   
2955 C CA  . ALA A 381 ? 1.3530 1.0529 0.7925 0.0203  -0.0773 0.0446  423  ALA A CA  
2956 C C   . ALA A 381 ? 1.4040 1.1212 0.8455 0.0234  -0.0664 0.0477  423  ALA A C   
2957 O O   . ALA A 381 ? 1.4332 1.1330 0.8476 0.0297  -0.0637 0.0429  423  ALA A O   
2958 C CB  . ALA A 381 ? 1.3600 1.0611 0.7922 -0.0010 -0.0920 0.0511  423  ALA A CB  
2959 N N   . PHE A 382 ? 1.3307 1.0790 0.8012 0.0202  -0.0602 0.0557  424  PHE A N   
2960 C CA  . PHE A 382 ? 1.3273 1.0916 0.8010 0.0222  -0.0502 0.0613  424  PHE A CA  
2961 C C   . PHE A 382 ? 1.3958 1.1632 0.8718 0.0356  -0.0358 0.0584  424  PHE A C   
2962 O O   . PHE A 382 ? 1.3982 1.1702 0.8639 0.0373  -0.0290 0.0618  424  PHE A O   
2963 C CB  . PHE A 382 ? 1.3194 1.1075 0.8190 0.0181  -0.0484 0.0700  424  PHE A CB  
2964 C CG  . PHE A 382 ? 1.3399 1.1389 0.8330 0.0174  -0.0443 0.0782  424  PHE A CG  
2965 C CD1 . PHE A 382 ? 1.3828 1.1888 0.8605 0.0098  -0.0539 0.0831  424  PHE A CD1 
2966 C CD2 . PHE A 382 ? 1.3660 1.1707 0.8680 0.0237  -0.0314 0.0824  424  PHE A CD2 
2967 C CE1 . PHE A 382 ? 1.3973 1.2161 0.8682 0.0122  -0.0503 0.0914  424  PHE A CE1 
2968 C CE2 . PHE A 382 ? 1.4077 1.2187 0.9005 0.0246  -0.0280 0.0910  424  PHE A CE2 
2969 C CZ  . PHE A 382 ? 1.3869 1.2052 0.8644 0.0207  -0.0373 0.0952  424  PHE A CZ  
2970 N N   . ILE A 383 ? 1.3581 1.1279 0.8477 0.0452  -0.0309 0.0532  425  ILE A N   
2971 C CA  . ILE A 383 ? 1.3674 1.1498 0.8602 0.0582  -0.0171 0.0514  425  ILE A CA  
2972 C C   . ILE A 383 ? 1.4959 1.2539 0.9535 0.0718  -0.0189 0.0416  425  ILE A C   
2973 O O   . ILE A 383 ? 1.5101 1.2741 0.9552 0.0820  -0.0092 0.0404  425  ILE A O   
2974 C CB  . ILE A 383 ? 1.3759 1.1837 0.9025 0.0616  -0.0098 0.0525  425  ILE A CB  
2975 C CG1 . ILE A 383 ? 1.3441 1.1653 0.8981 0.0475  -0.0106 0.0604  425  ILE A CG1 
2976 C CG2 . ILE A 383 ? 1.3909 1.2231 0.9228 0.0728  0.0049  0.0530  425  ILE A CG2 
2977 C CD1 . ILE A 383 ? 1.4136 1.2351 0.9639 0.0387  -0.0080 0.0694  425  ILE A CD1 
2978 N N   . LEU A 384 ? 1.4956 1.2225 0.9328 0.0712  -0.0322 0.0350  426  LEU A N   
2979 C CA  . LEU A 384 ? 1.5497 1.2387 0.9443 0.0831  -0.0378 0.0247  426  LEU A CA  
2980 C C   . LEU A 384 ? 1.6490 1.3195 1.0094 0.0754  -0.0416 0.0240  426  LEU A C   
2981 O O   . LEU A 384 ? 1.6841 1.3306 1.0090 0.0889  -0.0405 0.0154  426  LEU A O   
2982 C CB  . LEU A 384 ? 1.5640 1.2199 0.9444 0.0777  -0.0534 0.0208  426  LEU A CB  
2983 C CG  . LEU A 384 ? 1.6729 1.2843 1.0123 0.0957  -0.0589 0.0094  426  LEU A CG  
2984 C CD1 . LEU A 384 ? 1.6658 1.2796 1.0217 0.1083  -0.0596 0.0076  426  LEU A CD1 
2985 C CD2 . LEU A 384 ? 1.7411 1.3010 1.0340 0.0794  -0.0765 0.0062  426  LEU A CD2 
2986 N N   . CYS A 385 ? 1.6057 1.2886 0.9749 0.0554  -0.0466 0.0327  427  CYS A N   
2987 C CA  . CYS A 385 ? 1.6359 1.3091 0.9763 0.0446  -0.0521 0.0341  427  CYS A CA  
2988 C C   . CYS A 385 ? 1.6777 1.3773 1.0245 0.0496  -0.0387 0.0398  427  CYS A C   
2989 O O   . CYS A 385 ? 1.7009 1.3883 1.0159 0.0498  -0.0399 0.0369  427  CYS A O   
2990 C CB  . CYS A 385 ? 1.6327 1.3095 0.9754 0.0216  -0.0662 0.0412  427  CYS A CB  
2991 S SG  . CYS A 385 ? 1.7130 1.3500 1.0310 0.0091  -0.0855 0.0357  427  CYS A SG  
2992 N N   . TRP A 386 ? 1.5978 1.3307 0.9824 0.0514  -0.0273 0.0485  428  TRP A N   
2993 C CA  . TRP A 386 ? 1.5872 1.3432 0.9786 0.0534  -0.0152 0.0568  428  TRP A CA  
2994 C C   . TRP A 386 ? 1.6603 1.4333 1.0606 0.0680  0.0011  0.0563  428  TRP A C   
2995 O O   . TRP A 386 ? 1.6710 1.4531 1.0590 0.0715  0.0093  0.0599  428  TRP A O   
2996 C CB  . TRP A 386 ? 1.5348 1.3109 0.9524 0.0427  -0.0151 0.0689  428  TRP A CB  
2997 C CG  . TRP A 386 ? 1.5454 1.3195 0.9497 0.0307  -0.0279 0.0730  428  TRP A CG  
2998 C CD1 . TRP A 386 ? 1.5657 1.3415 0.9790 0.0208  -0.0396 0.0746  428  TRP A CD1 
2999 C CD2 . TRP A 386 ? 1.5592 1.3369 0.9400 0.0272  -0.0300 0.0774  428  TRP A CD2 
3000 N NE1 . TRP A 386 ? 1.5640 1.3483 0.9619 0.0112  -0.0487 0.0803  428  TRP A NE1 
3001 C CE2 . TRP A 386 ? 1.6012 1.3866 0.9792 0.0148  -0.0433 0.0820  428  TRP A CE2 
3002 C CE3 . TRP A 386 ? 1.5935 1.3730 0.9553 0.0334  -0.0218 0.0785  428  TRP A CE3 
3003 C CZ2 . TRP A 386 ? 1.6048 1.4017 0.9622 0.0083  -0.0491 0.0877  428  TRP A CZ2 
3004 C CZ3 . TRP A 386 ? 1.6266 1.4126 0.9670 0.0272  -0.0277 0.0835  428  TRP A CZ3 
3005 C CH2 . TRP A 386 ? 1.6259 1.4214 0.9645 0.0146  -0.0415 0.0881  428  TRP A CH2 
3006 N N   . ILE A 387 ? 1.6190 1.3993 1.0382 0.0762  0.0051  0.0523  429  ILE A N   
3007 C CA  . ILE A 387 ? 1.6253 1.4311 1.0544 0.0900  0.0201  0.0524  429  ILE A CA  
3008 C C   . ILE A 387 ? 1.7170 1.5180 1.1122 0.1048  0.0260  0.0468  429  ILE A C   
3009 O O   . ILE A 387 ? 1.7127 1.5388 1.1110 0.1063  0.0383  0.0541  429  ILE A O   
3010 C CB  . ILE A 387 ? 1.6621 1.4741 1.1064 0.1010  0.0204  0.0459  429  ILE A CB  
3011 C CG1 . ILE A 387 ? 1.6467 1.5031 1.1253 0.1011  0.0344  0.0539  429  ILE A CG1 
3012 C CG2 . ILE A 387 ? 1.7165 1.5072 1.1265 0.1232  0.0188  0.0329  429  ILE A CG2 
3013 C CD1 . ILE A 387 ? 1.7127 1.5790 1.2258 0.0851  0.0309  0.0601  429  ILE A CD1 
3014 N N   . PRO A 388 ? 1.7113 1.4776 1.0710 0.1154  0.0169  0.0340  430  PRO A N   
3015 C CA  . PRO A 388 ? 1.7545 1.5119 1.0767 0.1331  0.0221  0.0261  430  PRO A CA  
3016 C C   . PRO A 388 ? 1.8204 1.5890 1.1323 0.1245  0.0270  0.0338  430  PRO A C   
3017 O O   . PRO A 388 ? 1.8319 1.6201 1.1336 0.1381  0.0393  0.0340  430  PRO A O   
3018 C CB  . PRO A 388 ? 1.8155 1.5184 1.0948 0.1372  0.0060  0.0122  430  PRO A CB  
3019 C CG  . PRO A 388 ? 1.8415 1.5304 1.1351 0.1136  -0.0082 0.0168  430  PRO A CG  
3020 C CD  . PRO A 388 ? 1.7364 1.4638 1.0811 0.1092  -0.0002 0.0265  430  PRO A CD  
3021 N N   . TYR A 389 ? 1.7704 1.5314 1.0860 0.1034  0.0179  0.0412  431  TYR A N   
3022 C CA  . TYR A 389 ? 1.7742 1.5463 1.0811 0.0948  0.0207  0.0503  431  TYR A CA  
3023 C C   . TYR A 389 ? 1.8086 1.6189 1.1465 0.0931  0.0364  0.0649  431  TYR A C   
3024 O O   . TYR A 389 ? 1.8217 1.6462 1.1474 0.0964  0.0453  0.0705  431  TYR A O   
3025 C CB  . TYR A 389 ? 1.7789 1.5376 1.0821 0.0753  0.0057  0.0546  431  TYR A CB  
3026 C CG  . TYR A 389 ? 1.7908 1.5685 1.0952 0.0671  0.0088  0.0677  431  TYR A CG  
3027 C CD1 . TYR A 389 ? 1.8453 1.6201 1.1165 0.0692  0.0087  0.0665  431  TYR A CD1 
3028 C CD2 . TYR A 389 ? 1.7664 1.5621 1.1013 0.0587  0.0110  0.0811  431  TYR A CD2 
3029 C CE1 . TYR A 389 ? 1.8504 1.6439 1.1214 0.0635  0.0114  0.0795  431  TYR A CE1 
3030 C CE2 . TYR A 389 ? 1.7749 1.5841 1.1067 0.0547  0.0134  0.0937  431  TYR A CE2 
3031 C CZ  . TYR A 389 ? 1.8918 1.7016 1.1927 0.0572  0.0136  0.0934  431  TYR A CZ  
3032 O OH  . TYR A 389 ? 1.8937 1.7181 1.1903 0.0551  0.0158  0.1066  431  TYR A OH  
3033 N N   . PHE A 390 ? 1.7370 1.5614 1.1119 0.0861  0.0388  0.0714  432  PHE A N   
3034 C CA  . PHE A 390 ? 1.7210 1.5745 1.1224 0.0800  0.0517  0.0856  432  PHE A CA  
3035 C C   . PHE A 390 ? 1.7980 1.6817 1.2047 0.0916  0.0665  0.0857  432  PHE A C   
3036 O O   . PHE A 390 ? 1.7911 1.6997 1.2062 0.0862  0.0783  0.0983  432  PHE A O   
3037 C CB  . PHE A 390 ? 1.7117 1.5655 1.1450 0.0669  0.0476  0.0918  432  PHE A CB  
3038 C CG  . PHE A 390 ? 1.7209 1.5607 1.1512 0.0562  0.0394  0.0997  432  PHE A CG  
3039 C CD1 . PHE A 390 ? 1.7500 1.5720 1.1742 0.0529  0.0247  0.0939  432  PHE A CD1 
3040 C CD2 . PHE A 390 ? 1.7492 1.5952 1.1803 0.0503  0.0462  0.1140  432  PHE A CD2 
3041 C CE1 . PHE A 390 ? 1.7533 1.5715 1.1748 0.0460  0.0177  0.1019  432  PHE A CE1 
3042 C CE2 . PHE A 390 ? 1.7802 1.6147 1.2055 0.0456  0.0388  0.1214  432  PHE A CE2 
3043 C CZ  . PHE A 390 ? 1.7453 1.5697 1.1671 0.0446  0.0249  0.1152  432  PHE A CZ  
3044 N N   . ILE A 391 ? 1.7849 1.6674 1.1840 0.1085  0.0659  0.0725  433  ILE A N   
3045 C CA  . ILE A 391 ? 1.8050 1.7228 1.2059 0.1251  0.0800  0.0714  433  ILE A CA  
3046 C C   . ILE A 391 ? 1.9172 1.8334 1.2803 0.1397  0.0853  0.0672  433  ILE A C   
3047 O O   . ILE A 391 ? 1.9268 1.8802 1.2893 0.1520  0.0994  0.0703  433  ILE A O   
3048 C CB  . ILE A 391 ? 1.8423 1.7655 1.2526 0.1409  0.0784  0.0607  433  ILE A CB  
3049 C CG1 . ILE A 391 ? 1.8422 1.8230 1.2766 0.1487  0.0942  0.0674  433  ILE A CG1 
3050 C CG2 . ILE A 391 ? 1.8849 1.7697 1.2552 0.1628  0.0696  0.0429  433  ILE A CG2 
3051 C CD1 . ILE A 391 ? 1.9031 1.9094 1.3803 0.1278  0.0958  0.0786  433  ILE A CD1 
3052 N N   . PHE A 392 ? 1.9069 1.7840 1.2388 0.1367  0.0737  0.0611  434  PHE A N   
3053 C CA  . PHE A 392 ? 1.9473 1.8154 1.2391 0.1466  0.0753  0.0564  434  PHE A CA  
3054 C C   . PHE A 392 ? 1.9954 1.8859 1.2944 0.1326  0.0832  0.0735  434  PHE A C   
3055 O O   . PHE A 392 ? 2.0173 1.9187 1.2921 0.1411  0.0905  0.0744  434  PHE A O   
3056 C CB  . PHE A 392 ? 1.9960 1.8130 1.2519 0.1437  0.0571  0.0437  434  PHE A CB  
3057 C CG  . PHE A 392 ? 2.0706 1.8672 1.2761 0.1593  0.0558  0.0314  434  PHE A CG  
3058 C CD1 . PHE A 392 ? 2.1486 1.9343 1.3281 0.1862  0.0588  0.0165  434  PHE A CD1 
3059 C CD2 . PHE A 392 ? 2.1187 1.9047 1.2990 0.1487  0.0503  0.0340  434  PHE A CD2 
3060 C CE1 . PHE A 392 ? 2.2146 1.9752 1.3415 0.2023  0.0567  0.0035  434  PHE A CE1 
3061 C CE2 . PHE A 392 ? 2.2058 1.9701 1.3358 0.1620  0.0478  0.0214  434  PHE A CE2 
3062 C CZ  . PHE A 392 ? 2.2188 1.9671 1.3208 0.1886  0.0507  0.0056  434  PHE A CZ  
3063 N N   . PHE A 393 ? 1.9258 1.8199 1.2548 0.1126  0.0813  0.0868  435  PHE A N   
3064 C CA  . PHE A 393 ? 1.9202 1.8285 1.2570 0.0990  0.0877  0.1049  435  PHE A CA  
3065 C C   . PHE A 393 ? 1.9789 1.9278 1.3359 0.0981  0.1046  0.1165  435  PHE A C   
3066 O O   . PHE A 393 ? 1.9818 1.9480 1.3323 0.0935  0.1140  0.1299  435  PHE A O   
3067 C CB  . PHE A 393 ? 1.9169 1.8078 1.2738 0.0819  0.0781  0.1126  435  PHE A CB  
3068 C CG  . PHE A 393 ? 1.9431 1.8184 1.2817 0.0757  0.0703  0.1190  435  PHE A CG  
3069 C CD1 . PHE A 393 ? 1.9773 1.8558 1.3240 0.0661  0.0741  0.1364  435  PHE A CD1 
3070 C CD2 . PHE A 393 ? 1.9869 1.8437 1.2974 0.0793  0.0584  0.1081  435  PHE A CD2 
3071 C CE1 . PHE A 393 ? 1.9970 1.8657 1.3260 0.0643  0.0670  0.1430  435  PHE A CE1 
3072 C CE2 . PHE A 393 ? 2.0291 1.8808 1.3239 0.0734  0.0511  0.1151  435  PHE A CE2 
3073 C CZ  . PHE A 393 ? 1.9967 1.8567 1.3019 0.0679  0.0558  0.1326  435  PHE A CZ  
3074 N N   . MET A 394 ? 1.9407 1.9077 1.3213 0.1017  0.1080  0.1122  436  MET A N   
3075 C CA  . MET A 394 ? 1.9446 1.9595 1.3471 0.1000  0.1230  0.1221  436  MET A CA  
3076 C C   . MET A 394 ? 2.0289 2.0738 1.4078 0.1214  0.1346  0.1181  436  MET A C   
3077 O O   . MET A 394 ? 2.0284 2.1188 1.4167 0.1178  0.1489  0.1311  436  MET A O   
3078 C CB  . MET A 394 ? 1.9587 1.9852 1.3890 0.1018  0.1207  0.1155  436  MET A CB  
3079 C CG  . MET A 394 ? 1.9998 2.0809 1.4590 0.0933  0.1340  0.1278  436  MET A CG  
3080 S SD  . MET A 394 ? 2.0328 2.1349 1.5220 0.0998  0.1310  0.1187  436  MET A SD  
3081 C CE  . MET A 394 ? 2.0172 2.1437 1.4826 0.1397  0.1377  0.1032  436  MET A CE  
3082 N N   . VAL A 395 ? 2.0156 2.0337 1.3610 0.1427  0.1278  0.1002  437  VAL A N   
3083 C CA  . VAL A 395 ? 2.0524 2.0883 1.3666 0.1669  0.1366  0.0929  437  VAL A CA  
3084 C C   . VAL A 395 ? 2.1294 2.1678 1.4174 0.1648  0.1415  0.1003  437  VAL A C   
3085 O O   . VAL A 395 ? 2.1396 2.2217 1.4230 0.1735  0.1563  0.1075  437  VAL A O   
3086 C CB  . VAL A 395 ? 2.1322 2.1252 1.4098 0.1916  0.1251  0.0684  437  VAL A CB  
3087 C CG1 . VAL A 395 ? 2.1760 2.1771 1.4119 0.2185  0.1325  0.0588  437  VAL A CG1 
3088 C CG2 . VAL A 395 ? 2.1197 2.1137 1.4144 0.2034  0.1222  0.0590  437  VAL A CG2 
3089 N N   . ILE A 396 ? 2.0904 2.0880 1.3634 0.1519  0.1292  0.1007  438  ILE A N   
3090 C CA  . ILE A 396 ? 2.1082 2.1016 1.3554 0.1474  0.1301  0.1082  438  ILE A CA  
3091 C C   . ILE A 396 ? 2.1742 2.1997 1.4415 0.1305  0.1422  0.1325  438  ILE A C   
3092 O O   . ILE A 396 ? 2.1885 2.2343 1.4366 0.1343  0.1513  0.1405  438  ILE A O   
3093 C CB  . ILE A 396 ? 2.1432 2.0881 1.3705 0.1393  0.1113  0.1004  438  ILE A CB  
3094 C CG1 . ILE A 396 ? 2.1679 2.0775 1.3624 0.1549  0.0995  0.0765  438  ILE A CG1 
3095 C CG2 . ILE A 396 ? 2.1656 2.1112 1.3717 0.1324  0.1114  0.1113  438  ILE A CG2 
3096 C CD1 . ILE A 396 ? 2.2216 2.0881 1.4061 0.1411  0.0793  0.0696  438  ILE A CD1 
3097 N N   . ALA A 397 ? 2.1263 2.1539 1.4289 0.1113  0.1420  0.1446  439  ALA A N   
3098 C CA  . ALA A 397 ? 2.1311 2.1768 1.4509 0.0905  0.1509  0.1685  439  ALA A CA  
3099 C C   . ALA A 397 ? 2.2311 2.3265 1.5457 0.0931  0.1686  0.1807  439  ALA A C   
3100 O O   . ALA A 397 ? 2.2448 2.3438 1.5461 0.0843  0.1738  0.1968  439  ALA A O   
3101 C CB  . ALA A 397 ? 2.1142 2.1581 1.4697 0.0735  0.1487  0.1740  439  ALA A CB  
3102 N N   . PHE A 398 ? 2.2080 2.3436 1.5296 0.1078  0.1777  0.1730  440  PHE A N   
3103 C CA  . PHE A 398 ? 2.2353 2.4286 1.5526 0.1123  0.1952  0.1845  440  PHE A CA  
3104 C C   . PHE A 398 ? 2.3484 2.5567 1.6311 0.1444  0.2002  0.1691  440  PHE A C   
3105 O O   . PHE A 398 ? 2.3714 2.6242 1.6428 0.1500  0.2141  0.1789  440  PHE A O   
3106 C CB  . PHE A 398 ? 2.2421 2.4872 1.5939 0.1040  0.2050  0.1927  440  PHE A CB  
3107 C CG  . PHE A 398 ? 2.2762 2.5829 1.6320 0.0930  0.2222  0.2144  440  PHE A CG  
3108 C CD1 . PHE A 398 ? 2.3254 2.6224 1.6746 0.0678  0.2249  0.2368  440  PHE A CD1 
3109 C CD2 . PHE A 398 ? 2.3080 2.6844 1.6726 0.1085  0.2356  0.2136  440  PHE A CD2 
3110 C CE1 . PHE A 398 ? 2.3534 2.7066 1.7044 0.0544  0.2403  0.2587  440  PHE A CE1 
3111 C CE2 . PHE A 398 ? 2.3566 2.7974 1.7257 0.0962  0.2515  0.2354  440  PHE A CE2 
3112 C CZ  . PHE A 398 ? 2.3438 2.7718 1.7060 0.0671  0.2537  0.2583  440  PHE A CZ  
3113 N N   . CYS A 399 ? 2.3252 2.4938 1.5871 0.1646  0.1883  0.1453  441  CYS A N   
3114 C CA  . CYS A 399 ? 2.3655 2.5382 1.5882 0.1966  0.1912  0.1278  441  CYS A CA  
3115 C C   . CYS A 399 ? 2.4428 2.5922 1.6256 0.1992  0.1877  0.1264  441  CYS A C   
3116 O O   . CYS A 399 ? 2.4689 2.6452 1.6239 0.2184  0.1976  0.1236  441  CYS A O   
3117 C CB  . CYS A 399 ? 2.3759 2.5113 1.5863 0.2177  0.1794  0.1024  441  CYS A CB  
3118 S SG  . CYS A 399 ? 2.4414 2.6274 1.6570 0.2511  0.1919  0.0924  441  CYS A SG  
3119 N N   . LYS A 400 ? 2.3904 2.4939 1.5701 0.1810  0.1737  0.1285  442  LYS A N   
3120 C CA  . LYS A 400 ? 2.4146 2.4984 1.5589 0.1807  0.1686  0.1285  442  LYS A CA  
3121 C C   . LYS A 400 ? 2.4990 2.5366 1.6041 0.1961  0.1534  0.1028  442  LYS A C   
3122 O O   . LYS A 400 ? 2.5264 2.5537 1.5929 0.2028  0.1503  0.0972  442  LYS A O   
3123 C CB  . LYS A 400 ? 2.4718 2.6026 1.5996 0.1899  0.1855  0.1395  442  LYS A CB  
3124 N N   . ASN A 401 ? 2.4498 2.4581 1.5624 0.1999  0.1433  0.0877  443  ASN A N   
3125 C CA  . ASN A 401 ? 2.4788 2.4357 1.5519 0.2104  0.1270  0.0639  443  ASN A CA  
3126 C C   . ASN A 401 ? 2.5550 2.5088 1.6044 0.2418  0.1310  0.0441  443  ASN A C   
3127 O O   . ASN A 401 ? 2.6009 2.5344 1.6008 0.2612  0.1283  0.0281  443  ASN A O   
3128 C CB  . ASN A 401 ? 2.5324 2.4725 1.5641 0.2074  0.1201  0.0615  443  ASN A CB  
3129 C CG  . ASN A 401 ? 2.8030 2.7148 1.8403 0.1816  0.1035  0.0672  443  ASN A CG  
3130 O OD1 . ASN A 401 ? 2.6892 2.5869 1.7564 0.1680  0.0957  0.0698  443  ASN A OD1 
3131 N ND2 . ASN A 401 ? 2.7241 2.6320 1.7321 0.1759  0.0981  0.0697  443  ASN A ND2 
3132 N N   . CYS A 402 ? 2.4770 2.4502 1.5591 0.2482  0.1370  0.0450  444  CYS A N   
3133 C CA  . CYS A 402 ? 2.5001 2.4743 1.5623 0.2820  0.1413  0.0276  444  CYS A CA  
3134 C C   . CYS A 402 ? 2.5687 2.4724 1.5838 0.2977  0.1238  0.0016  444  CYS A C   
3135 O O   . CYS A 402 ? 2.6042 2.5009 1.5887 0.3315  0.1271  -0.0144 444  CYS A O   
3136 C CB  . CYS A 402 ? 2.4653 2.4835 1.5766 0.2835  0.1515  0.0368  444  CYS A CB  
3137 S SG  . CYS A 402 ? 2.5024 2.6149 1.6449 0.2858  0.1773  0.0592  444  CYS A SG  
3138 N N   . CYS A 403 ? 2.5040 2.3559 1.5109 0.2732  0.1049  -0.0015 445  CYS A N   
3139 C CA  . CYS A 403 ? 2.5390 2.3186 1.5007 0.2782  0.0855  -0.0231 445  CYS A CA  
3140 C C   . CYS A 403 ? 2.5857 2.3247 1.5207 0.2513  0.0678  -0.0247 445  CYS A C   
3141 O O   . CYS A 403 ? 2.5388 2.3056 1.5001 0.2277  0.0695  -0.0075 445  CYS A O   
3142 C CB  . CYS A 403 ? 2.5191 2.2790 1.5062 0.2764  0.0782  -0.0264 445  CYS A CB  
3143 S SG  . CYS A 403 ? 2.6311 2.3500 1.5721 0.3190  0.0756  -0.0509 445  CYS A SG  
3144 N N   . ASN A 404 ? 2.5940 2.2665 1.4736 0.2553  0.0503  -0.0451 446  ASN A N   
3145 C CA  . ASN A 404 ? 2.6140 2.2428 1.4578 0.2297  0.0304  -0.0500 446  ASN A CA  
3146 C C   . ASN A 404 ? 2.5980 2.2294 1.4822 0.1936  0.0187  -0.0362 446  ASN A C   
3147 O O   . ASN A 404 ? 2.5416 2.1935 1.4750 0.1897  0.0235  -0.0267 446  ASN A O   
3148 C CB  . ASN A 404 ? 2.7056 2.2560 1.4812 0.2411  0.0133  -0.0751 446  ASN A CB  
3149 C CG  . ASN A 404 ? 3.0609 2.5826 1.7691 0.2520  0.0090  -0.0899 446  ASN A CG  
3150 O OD1 . ASN A 404 ? 3.0137 2.5599 1.7057 0.2835  0.0249  -0.0945 446  ASN A OD1 
3151 N ND2 . ASN A 404 ? 2.9839 2.4585 1.6519 0.2247  -0.0124 -0.0965 446  ASN A ND2 
3152 N N   . GLU A 405 ? 2.5628 2.1753 1.4239 0.1677  0.0028  -0.0354 447  GLU A N   
3153 C CA  . GLU A 405 ? 2.5185 2.1350 1.4094 0.1347  -0.0102 -0.0234 447  GLU A CA  
3154 C C   . GLU A 405 ? 2.6007 2.1543 1.4576 0.1202  -0.0328 -0.0376 447  GLU A C   
3155 O O   . GLU A 405 ? 2.5753 2.1267 1.4420 0.0904  -0.0478 -0.0305 447  GLU A O   
3156 C CB  . GLU A 405 ? 2.5254 2.1716 1.4156 0.1151  -0.0134 -0.0107 447  GLU A CB  
3157 C CG  . GLU A 405 ? 2.6215 2.3246 1.5417 0.1265  0.0075  0.0058  447  GLU A CG  
3158 C CD  . GLU A 405 ? 2.7812 2.5232 1.7645 0.1254  0.0205  0.0238  447  GLU A CD  
3159 O OE1 . GLU A 405 ? 2.7063 2.4605 1.7085 0.1440  0.0349  0.0227  447  GLU A OE1 
3160 O OE2 . GLU A 405 ? 2.6561 2.4174 1.6678 0.1065  0.0161  0.0391  447  GLU A OE2 
3161 N N   . HIS A 406 ? 2.6111 2.1140 1.4256 0.1425  -0.0352 -0.0571 448  HIS A N   
3162 C CA  . HIS A 406 ? 2.6539 2.0864 1.4281 0.1321  -0.0562 -0.0713 448  HIS A CA  
3163 C C   . HIS A 406 ? 2.6624 2.0979 1.4812 0.1323  -0.0549 -0.0657 448  HIS A C   
3164 O O   . HIS A 406 ? 2.6652 2.0645 1.4756 0.1091  -0.0729 -0.0669 448  HIS A O   
3165 C CB  . HIS A 406 ? 2.7522 2.1181 1.4489 0.1566  -0.0618 -0.0954 448  HIS A CB  
3166 C CG  . HIS A 406 ? 2.8135 2.1628 1.5040 0.1977  -0.0502 -0.1064 448  HIS A CG  
3167 N ND1 . HIS A 406 ? 2.7948 2.1998 1.5276 0.2280  -0.0268 -0.1002 448  HIS A ND1 
3168 C CD2 . HIS A 406 ? 2.9098 2.1774 1.5395 0.2111  -0.0640 -0.1260 448  HIS A CD2 
3169 C CE1 . HIS A 406 ? 2.8327 2.1981 1.5353 0.2621  -0.0256 -0.1155 448  HIS A CE1 
3170 N NE2 . HIS A 406 ? 2.9069 2.1867 1.5465 0.2521  -0.0482 -0.1308 448  HIS A NE2 
3171 N N   . LEU A 407 ? 2.5724 2.0559 1.4396 0.1558  -0.0339 -0.0581 449  LEU A N   
3172 C CA  . LEU A 407 ? 2.5226 2.0209 1.4380 0.1581  -0.0298 -0.0515 449  LEU A CA  
3173 C C   . LEU A 407 ? 2.4887 2.0456 1.4692 0.1358  -0.0238 -0.0301 449  LEU A C   
3174 O O   . LEU A 407 ? 2.4519 2.0097 1.4640 0.1218  -0.0300 -0.0240 449  LEU A O   
3175 C CB  . LEU A 407 ? 2.5291 2.0406 1.4515 0.1973  -0.0128 -0.0579 449  LEU A CB  
3176 C CG  . LEU A 407 ? 2.5514 2.1332 1.5100 0.2151  0.0114  -0.0472 449  LEU A CG  
3177 C CD1 . LEU A 407 ? 2.5263 2.1388 1.5203 0.2383  0.0249  -0.0453 449  LEU A CD1 
3178 C CD2 . LEU A 407 ? 2.6366 2.2142 1.5471 0.2374  0.0182  -0.0574 449  LEU A CD2 
3179 N N   . HIS A 408 ? 2.4155 2.0171 1.4112 0.1333  -0.0127 -0.0188 450  HIS A N   
3180 C CA  . HIS A 408 ? 2.3495 2.0001 1.3962 0.1154  -0.0072 0.0015  450  HIS A CA  
3181 C C   . HIS A 408 ? 2.3795 2.0168 1.4248 0.0850  -0.0265 0.0061  450  HIS A C   
3182 O O   . HIS A 408 ? 2.3217 1.9867 1.4096 0.0719  -0.0263 0.0198  450  HIS A O   
3183 C CB  . HIS A 408 ? 2.3580 2.0460 1.4042 0.1203  0.0058  0.0109  450  HIS A CB  
3184 C CG  . HIS A 408 ? 2.3508 2.0807 1.4406 0.1051  0.0112  0.0317  450  HIS A CG  
3185 N ND1 . HIS A 408 ? 2.3338 2.0985 1.4687 0.1109  0.0270  0.0441  450  HIS A ND1 
3186 C CD2 . HIS A 408 ? 2.3619 2.1025 1.4519 0.0861  0.0025  0.0419  450  HIS A CD2 
3187 C CE1 . HIS A 408 ? 2.2969 2.0838 1.4544 0.0963  0.0269  0.0606  450  HIS A CE1 
3188 N NE2 . HIS A 408 ? 2.3153 2.0916 1.4482 0.0833  0.0130  0.0601  450  HIS A NE2 
3189 N N   . MET A 409 ? 2.3819 1.9774 1.3754 0.0737  -0.0436 -0.0054 451  MET A N   
3190 C CA  . MET A 409 ? 2.3767 1.9609 1.3610 0.0422  -0.0641 -0.0019 451  MET A CA  
3191 C C   . MET A 409 ? 2.4041 1.9630 1.4014 0.0336  -0.0740 -0.0044 451  MET A C   
3192 O O   . MET A 409 ? 2.3769 1.9459 1.3886 0.0085  -0.0865 0.0042  451  MET A O   
3193 C CB  . MET A 409 ? 2.4730 2.0163 1.3920 0.0309  -0.0799 -0.0145 451  MET A CB  
3194 C CG  . MET A 409 ? 2.5125 2.0858 1.4278 0.0043  -0.0903 -0.0034 451  MET A CG  
3195 S SD  . MET A 409 ? 2.5319 2.1243 1.4737 -0.0312 -0.1083 0.0097  451  MET A SD  
3196 C CE  . MET A 409 ? 2.5532 2.0672 1.4468 -0.0448 -0.1283 -0.0077 451  MET A CE  
3197 N N   . PHE A 410 ? 2.3682 1.8976 1.3593 0.0559  -0.0684 -0.0156 452  PHE A N   
3198 C CA  . PHE A 410 ? 2.3547 1.8582 1.3557 0.0514  -0.0769 -0.0182 452  PHE A CA  
3199 C C   . PHE A 410 ? 2.3043 1.8540 1.3710 0.0551  -0.0650 -0.0054 452  PHE A C   
3200 O O   . PHE A 410 ? 2.2751 1.8224 1.3604 0.0390  -0.0748 -0.0006 452  PHE A O   
3201 C CB  . PHE A 410 ? 2.4401 1.8848 1.3968 0.0742  -0.0793 -0.0364 452  PHE A CB  
3202 C CG  . PHE A 410 ? 2.4890 1.8828 1.4255 0.0589  -0.0980 -0.0412 452  PHE A CG  
3203 C CD1 . PHE A 410 ? 2.5820 1.9283 1.4682 0.0304  -0.1202 -0.0459 452  PHE A CD1 
3204 C CD2 . PHE A 410 ? 2.4926 1.8875 1.4596 0.0703  -0.0940 -0.0398 452  PHE A CD2 
3205 C CE1 . PHE A 410 ? 2.6227 1.9210 1.4883 0.0128  -0.1380 -0.0482 452  PHE A CE1 
3206 C CE2 . PHE A 410 ? 2.5558 1.9034 1.5030 0.0556  -0.1114 -0.0427 452  PHE A CE2 
3207 C CZ  . PHE A 410 ? 2.5859 1.8844 1.4820 0.0264  -0.1333 -0.0464 452  PHE A CZ  
3208 N N   . THR A 411 ? 2.2095 1.8008 1.3087 0.0743  -0.0448 0.0007  453  THR A N   
3209 C CA  . THR A 411 ? 2.1403 1.7728 1.2977 0.0762  -0.0336 0.0127  453  THR A CA  
3210 C C   . THR A 411 ? 2.1477 1.8106 1.3343 0.0536  -0.0383 0.0279  453  THR A C   
3211 O O   . THR A 411 ? 2.1046 1.7865 1.3306 0.0492  -0.0365 0.0356  453  THR A O   
3212 C CB  . THR A 411 ? 2.1800 1.8458 1.3594 0.0993  -0.0122 0.0154  453  THR A CB  
3213 O OG1 . THR A 411 ? 2.1521 1.8489 1.3361 0.0963  -0.0032 0.0256  453  THR A OG1 
3214 C CG2 . THR A 411 ? 2.1877 1.8306 1.3354 0.1264  -0.0071 0.0004  453  THR A CG2 
3215 N N   . ILE A 412 ? 2.1129 1.7816 1.2781 0.0409  -0.0446 0.0319  454  ILE A N   
3216 C CA  . ILE A 412 ? 2.0786 1.7781 1.2646 0.0227  -0.0504 0.0462  454  ILE A CA  
3217 C C   . ILE A 412 ? 2.1295 1.8122 1.3056 0.0009  -0.0702 0.0444  454  ILE A C   
3218 O O   . ILE A 412 ? 2.0899 1.7997 1.2950 -0.0098 -0.0741 0.0552  454  ILE A O   
3219 C CB  . ILE A 412 ? 2.1275 1.8503 1.2990 0.0196  -0.0484 0.0540  454  ILE A CB  
3220 C CG1 . ILE A 412 ? 2.1904 1.8854 1.3084 0.0112  -0.0606 0.0432  454  ILE A CG1 
3221 C CG2 . ILE A 412 ? 2.1212 1.8676 1.3098 0.0377  -0.0284 0.0608  454  ILE A CG2 
3222 C CD1 . ILE A 412 ? 2.3054 2.0185 1.4113 -0.0121 -0.0758 0.0511  454  ILE A CD1 
3223 N N   . TRP A 413 ? 2.1308 1.7671 1.2631 -0.0053 -0.0828 0.0310  455  TRP A N   
3224 C CA  . TRP A 413 ? 2.1433 1.7561 1.2583 -0.0295 -0.1028 0.0293  455  TRP A CA  
3225 C C   . TRP A 413 ? 2.1470 1.7441 1.2835 -0.0247 -0.1031 0.0268  455  TRP A C   
3226 O O   . TRP A 413 ? 2.1364 1.7333 1.2777 -0.0450 -0.1164 0.0316  455  TRP A O   
3227 C CB  . TRP A 413 ? 2.2021 1.7649 1.2541 -0.0422 -0.1183 0.0171  455  TRP A CB  
3228 C CG  . TRP A 413 ? 2.2283 1.8152 1.2633 -0.0669 -0.1297 0.0246  455  TRP A CG  
3229 C CD1 . TRP A 413 ? 2.2724 1.8815 1.2966 -0.0618 -0.1237 0.0267  455  TRP A CD1 
3230 C CD2 . TRP A 413 ? 2.2262 1.8293 1.2588 -0.1001 -0.1481 0.0337  455  TRP A CD2 
3231 N NE1 . TRP A 413 ? 2.2733 1.9091 1.2860 -0.0891 -0.1380 0.0354  455  TRP A NE1 
3232 C CE2 . TRP A 413 ? 2.2852 1.9207 1.3035 -0.1135 -0.1531 0.0402  455  TRP A CE2 
3233 C CE3 . TRP A 413 ? 2.2369 1.8334 1.2766 -0.1205 -0.1612 0.0376  455  TRP A CE3 
3234 C CZ2 . TRP A 413 ? 2.2780 1.9442 1.2904 -0.1464 -0.1706 0.0507  455  TRP A CZ2 
3235 C CZ3 . TRP A 413 ? 2.2581 1.8837 1.2914 -0.1543 -0.1784 0.0483  455  TRP A CZ3 
3236 C CH2 . TRP A 413 ? 2.2734 1.9359 1.2941 -0.1669 -0.1829 0.0549  455  TRP A CH2 
3237 N N   . LEU A 414 ? 2.0737 1.6646 1.2252 0.0018  -0.0882 0.0209  456  LEU A N   
3238 C CA  . LEU A 414 ? 2.0429 1.6261 1.2188 0.0099  -0.0865 0.0192  456  LEU A CA  
3239 C C   . LEU A 414 ? 2.0078 1.6392 1.2374 0.0037  -0.0814 0.0330  456  LEU A C   
3240 O O   . LEU A 414 ? 1.9874 1.6175 1.2349 -0.0026 -0.0874 0.0349  456  LEU A O   
3241 C CB  . LEU A 414 ? 2.0528 1.6264 1.2298 0.0405  -0.0716 0.0101  456  LEU A CB  
3242 C CG  . LEU A 414 ? 2.1196 1.6676 1.2995 0.0507  -0.0746 0.0036  456  LEU A CG  
3243 C CD1 . LEU A 414 ? 2.1929 1.6738 1.3130 0.0503  -0.0899 -0.0095 456  LEU A CD1 
3244 C CD2 . LEU A 414 ? 2.1315 1.7024 1.3369 0.0792  -0.0563 0.0014  456  LEU A CD2 
3245 N N   . GLY A 415 ? 1.9159 1.5861 1.1666 0.0062  -0.0711 0.0425  457  GLY A N   
3246 C CA  . GLY A 415 ? 1.8549 1.5654 1.1476 0.0022  -0.0670 0.0555  457  GLY A CA  
3247 C C   . GLY A 415 ? 1.8791 1.6027 1.1676 -0.0199 -0.0827 0.0627  457  GLY A C   
3248 O O   . GLY A 415 ? 1.8392 1.5857 1.1567 -0.0243 -0.0848 0.0701  457  GLY A O   
3249 N N   . TYR A 416 ? 1.8647 1.5758 1.1149 -0.0345 -0.0946 0.0605  458  TYR A N   
3250 C CA  . TYR A 416 ? 1.8647 1.5925 1.1053 -0.0597 -0.1115 0.0677  458  TYR A CA  
3251 C C   . TYR A 416 ? 1.9078 1.6051 1.1374 -0.0747 -0.1253 0.0628  458  TYR A C   
3252 O O   . TYR A 416 ? 1.8933 1.6108 1.1247 -0.0964 -0.1385 0.0708  458  TYR A O   
3253 C CB  . TYR A 416 ? 1.9262 1.6517 1.1269 -0.0733 -0.1202 0.0671  458  TYR A CB  
3254 C CG  . TYR A 416 ? 1.9466 1.7041 1.1533 -0.0609 -0.1088 0.0739  458  TYR A CG  
3255 C CD1 . TYR A 416 ? 1.9304 1.7305 1.1754 -0.0488 -0.0983 0.0864  458  TYR A CD1 
3256 C CD2 . TYR A 416 ? 1.9965 1.7399 1.1659 -0.0624 -0.1102 0.0684  458  TYR A CD2 
3257 C CE1 . TYR A 416 ? 1.9367 1.7614 1.1830 -0.0373 -0.0886 0.0940  458  TYR A CE1 
3258 C CE2 . TYR A 416 ? 1.9994 1.7730 1.1729 -0.0512 -0.1001 0.0759  458  TYR A CE2 
3259 C CZ  . TYR A 416 ? 2.0415 1.8551 1.2534 -0.0390 -0.0894 0.0894  458  TYR A CZ  
3260 O OH  . TYR A 416 ? 2.0288 1.8672 1.2408 -0.0277 -0.0800 0.0980  458  TYR A OH  
3261 N N   . ILE A 417 ? 1.8766 1.5278 1.0935 -0.0621 -0.1223 0.0505  459  ILE A N   
3262 C CA  . ILE A 417 ? 1.8920 1.5059 1.0956 -0.0712 -0.1339 0.0454  459  ILE A CA  
3263 C C   . ILE A 417 ? 1.8813 1.5270 1.1319 -0.0686 -0.1303 0.0533  459  ILE A C   
3264 O O   . ILE A 417 ? 1.8835 1.5242 1.1309 -0.0868 -0.1435 0.0570  459  ILE A O   
3265 C CB  . ILE A 417 ? 1.9790 1.5328 1.1479 -0.0533 -0.1318 0.0297  459  ILE A CB  
3266 C CG1 . ILE A 417 ? 2.0529 1.5579 1.1590 -0.0686 -0.1465 0.0215  459  ILE A CG1 
3267 C CG2 . ILE A 417 ? 1.9878 1.5146 1.1636 -0.0457 -0.1341 0.0256  459  ILE A CG2 
3268 C CD1 . ILE A 417 ? 2.1766 1.6305 1.2425 -0.0428 -0.1404 0.0051  459  ILE A CD1 
3269 N N   . ASN A 418 ? 1.7790 1.4578 1.0705 -0.0485 -0.1135 0.0568  460  ASN A N   
3270 C CA  . ASN A 418 ? 1.7219 1.4311 1.0567 -0.0443 -0.1090 0.0634  460  ASN A CA  
3271 C C   . ASN A 418 ? 1.7408 1.4883 1.0854 -0.0629 -0.1192 0.0754  460  ASN A C   
3272 O O   . ASN A 418 ? 1.7168 1.4783 1.0814 -0.0678 -0.1236 0.0795  460  ASN A O   
3273 C CB  . ASN A 418 ? 1.6898 1.4227 1.0568 -0.0235 -0.0905 0.0654  460  ASN A CB  
3274 C CG  . ASN A 418 ? 1.9362 1.6937 1.3427 -0.0188 -0.0862 0.0706  460  ASN A CG  
3275 O OD1 . ASN A 418 ? 1.8610 1.6075 1.2815 -0.0116 -0.0835 0.0655  460  ASN A OD1 
3276 N ND2 . ASN A 418 ? 1.8081 1.5997 1.2308 -0.0215 -0.0861 0.0806  460  ASN A ND2 
3277 N N   . SER A 419 ? 1.6978 1.4666 1.0281 -0.0719 -0.1226 0.0814  461  SER A N   
3278 C CA  . SER A 419 ? 1.6792 1.4936 1.0153 -0.0879 -0.1322 0.0939  461  SER A CA  
3279 C C   . SER A 419 ? 1.7384 1.5430 1.0525 -0.1165 -0.1512 0.0955  461  SER A C   
3280 O O   . SER A 419 ? 1.7118 1.5578 1.0396 -0.1293 -0.1590 0.1062  461  SER A O   
3281 C CB  . SER A 419 ? 1.7411 1.5786 1.0627 -0.0890 -0.1313 0.0991  461  SER A CB  
3282 O OG  . SER A 419 ? 1.8584 1.7475 1.1845 -0.1027 -0.1407 0.1120  461  SER A OG  
3283 N N   . THR A 420 ? 1.7316 1.4804 1.0087 -0.1260 -0.1588 0.0854  462  THR A N   
3284 C CA  . THR A 420 ? 1.7611 1.4828 1.0073 -0.1550 -0.1779 0.0859  462  THR A CA  
3285 C C   . THR A 420 ? 1.7979 1.4934 1.0571 -0.1481 -0.1775 0.0822  462  THR A C   
3286 O O   . THR A 420 ? 1.8048 1.5006 1.0576 -0.1704 -0.1911 0.0885  462  THR A O   
3287 C CB  . THR A 420 ? 1.8840 1.5473 1.0751 -0.1660 -0.1868 0.0755  462  THR A CB  
3288 O OG1 . THR A 420 ? 1.8594 1.5419 1.0437 -0.1600 -0.1807 0.0753  462  THR A OG1 
3289 C CG2 . THR A 420 ? 1.8969 1.5372 1.0475 -0.2050 -0.2098 0.0794  462  THR A CG2 
3290 N N   . LEU A 421 ? 1.7285 1.4050 1.0056 -0.1182 -0.1622 0.0730  463  LEU A N   
3291 C CA  . LEU A 421 ? 1.7142 1.3672 1.0042 -0.1065 -0.1599 0.0683  463  LEU A CA  
3292 C C   . LEU A 421 ? 1.7032 1.4022 1.0382 -0.1037 -0.1564 0.0768  463  LEU A C   
3293 O O   . LEU A 421 ? 1.6974 1.3832 1.0331 -0.1102 -0.1637 0.0777  463  LEU A O   
3294 C CB  . LEU A 421 ? 1.7208 1.3430 1.0104 -0.0766 -0.1456 0.0558  463  LEU A CB  
3295 C CG  . LEU A 421 ? 1.8407 1.3943 1.0810 -0.0718 -0.1518 0.0435  463  LEU A CG  
3296 C CD1 . LEU A 421 ? 1.8548 1.3771 1.0931 -0.0652 -0.1562 0.0401  463  LEU A CD1 
3297 C CD2 . LEU A 421 ? 1.9184 1.4390 1.1064 -0.0980 -0.1685 0.0428  463  LEU A CD2 
3298 N N   . ASN A 422 ? 1.6179 1.3665 0.9866 -0.0930 -0.1457 0.0828  464  ASN A N   
3299 C CA  . ASN A 422 ? 1.5724 1.3623 0.9796 -0.0876 -0.1423 0.0896  464  ASN A CA  
3300 C C   . ASN A 422 ? 1.6269 1.4434 1.0328 -0.1107 -0.1571 0.0999  464  ASN A C   
3301 O O   . ASN A 422 ? 1.6039 1.4234 1.0269 -0.1087 -0.1583 0.1005  464  ASN A O   
3302 C CB  . ASN A 422 ? 1.5301 1.3571 0.9650 -0.0697 -0.1288 0.0933  464  ASN A CB  
3303 C CG  . ASN A 422 ? 1.7103 1.5193 1.1611 -0.0471 -0.1131 0.0853  464  ASN A CG  
3304 O OD1 . ASN A 422 ? 1.6168 1.3981 1.0695 -0.0404 -0.1106 0.0774  464  ASN A OD1 
3305 N ND2 . ASN A 422 ? 1.5779 1.4047 1.0394 -0.0351 -0.1024 0.0883  464  ASN A ND2 
3306 N N   . PRO A 423 ? 1.6106 1.4475 0.9952 -0.1345 -0.1691 0.1084  465  PRO A N   
3307 C CA  . PRO A 423 ? 1.6109 1.4790 0.9947 -0.1591 -0.1834 0.1199  465  PRO A CA  
3308 C C   . PRO A 423 ? 1.6926 1.5143 1.0563 -0.1749 -0.1945 0.1173  465  PRO A C   
3309 O O   . PRO A 423 ? 1.6734 1.5199 1.0448 -0.1896 -0.2030 0.1264  465  PRO A O   
3310 C CB  . PRO A 423 ? 1.6545 1.5512 1.0152 -0.1830 -0.1939 0.1288  465  PRO A CB  
3311 C CG  . PRO A 423 ? 1.7361 1.5921 1.0727 -0.1762 -0.1892 0.1190  465  PRO A CG  
3312 C CD  . PRO A 423 ? 1.6523 1.4918 1.0137 -0.1413 -0.1706 0.1092  465  PRO A CD  
3313 N N   . LEU A 424 ? 1.6982 1.4529 1.0348 -0.1690 -0.1940 0.1053  466  LEU A N   
3314 C CA  . LEU A 424 ? 1.7411 1.4375 1.0510 -0.1767 -0.2034 0.1008  466  LEU A CA  
3315 C C   . LEU A 424 ? 1.7845 1.4791 1.1268 -0.1511 -0.1930 0.0959  466  LEU A C   
3316 O O   . LEU A 424 ? 1.8002 1.4693 1.1326 -0.1582 -0.2014 0.0973  466  LEU A O   
3317 C CB  . LEU A 424 ? 1.7957 1.4230 1.0602 -0.1737 -0.2057 0.0886  466  LEU A CB  
3318 C CG  . LEU A 424 ? 1.9181 1.4725 1.1332 -0.1888 -0.2211 0.0851  466  LEU A CG  
3319 C CD1 . LEU A 424 ? 1.9832 1.4909 1.1427 -0.2082 -0.2328 0.0808  466  LEU A CD1 
3320 C CD2 . LEU A 424 ? 1.9544 1.4631 1.1697 -0.1564 -0.2122 0.0730  466  LEU A CD2 
3321 N N   . ILE A 425 ? 1.7140 1.4347 1.0925 -0.1232 -0.1756 0.0909  467  ILE A N   
3322 C CA  . ILE A 425 ? 1.6878 1.4119 1.0982 -0.1001 -0.1652 0.0859  467  ILE A CA  
3323 C C   . ILE A 425 ? 1.7322 1.4987 1.1705 -0.1061 -0.1687 0.0948  467  ILE A C   
3324 O O   . ILE A 425 ? 1.7316 1.4833 1.1747 -0.1025 -0.1712 0.0933  467  ILE A O   
3325 C CB  . ILE A 425 ? 1.6976 1.4316 1.1322 -0.0733 -0.1469 0.0784  467  ILE A CB  
3326 C CG1 . ILE A 425 ? 1.7390 1.4301 1.1451 -0.0635 -0.1424 0.0686  467  ILE A CG1 
3327 C CG2 . ILE A 425 ? 1.6671 1.4152 1.1375 -0.0544 -0.1371 0.0750  467  ILE A CG2 
3328 C CD1 . ILE A 425 ? 1.8769 1.5083 1.2487 -0.0591 -0.1490 0.0603  467  ILE A CD1 
3329 N N   . TYR A 426 ? 1.6842 1.5045 1.1388 -0.1129 -0.1689 0.1040  468  TYR A N   
3330 C CA  . TYR A 426 ? 1.6634 1.5324 1.1434 -0.1154 -0.1713 0.1126  468  TYR A CA  
3331 C C   . TYR A 426 ? 1.7523 1.6134 1.2225 -0.1338 -0.1845 0.1186  468  TYR A C   
3332 O O   . TYR A 426 ? 1.7192 1.5910 1.2122 -0.1225 -0.1812 0.1173  468  TYR A O   
3333 C CB  . TYR A 426 ? 1.6615 1.5898 1.1512 -0.1190 -0.1713 0.1225  468  TYR A CB  
3334 C CG  . TYR A 426 ? 1.6848 1.6177 1.1756 -0.1049 -0.1611 0.1193  468  TYR A CG  
3335 C CD1 . TYR A 426 ? 1.6952 1.6106 1.2029 -0.0799 -0.1465 0.1099  468  TYR A CD1 
3336 C CD2 . TYR A 426 ? 1.7092 1.6701 1.1852 -0.1174 -0.1663 0.1274  468  TYR A CD2 
3337 C CE1 . TYR A 426 ? 1.7104 1.6285 1.2170 -0.0682 -0.1373 0.1086  468  TYR A CE1 
3338 C CE2 . TYR A 426 ? 1.7201 1.6867 1.1963 -0.1032 -0.1570 0.1256  468  TYR A CE2 
3339 C CZ  . TYR A 426 ? 1.8119 1.7545 1.3025 -0.0786 -0.1425 0.1164  468  TYR A CZ  
3340 O OH  . TYR A 426 ? 1.8328 1.7787 1.3209 -0.0662 -0.1337 0.1162  468  TYR A OH  
3341 N N   . PRO A 427 ? 1.7755 1.6137 1.2098 -0.1627 -0.1998 0.1251  469  PRO A N   
3342 C CA  . PRO A 427 ? 1.8001 1.6266 1.2229 -0.1808 -0.2123 0.1322  469  PRO A CA  
3343 C C   . PRO A 427 ? 1.8791 1.6481 1.2945 -0.1660 -0.2109 0.1228  469  PRO A C   
3344 O O   . PRO A 427 ? 1.8709 1.6453 1.2936 -0.1691 -0.2157 0.1278  469  PRO A O   
3345 C CB  . PRO A 427 ? 1.8702 1.6817 1.2513 -0.2180 -0.2294 0.1417  469  PRO A CB  
3346 C CG  . PRO A 427 ? 1.9424 1.7249 1.3037 -0.2136 -0.2256 0.1331  469  PRO A CG  
3347 C CD  . PRO A 427 ? 1.8331 1.6547 1.2332 -0.1827 -0.2075 0.1271  469  PRO A CD  
3348 N N   . LEU A 428 ? 1.8610 1.5798 1.2616 -0.1485 -0.2043 0.1100  470  LEU A N   
3349 C CA  . LEU A 428 ? 1.8816 1.5491 1.2728 -0.1292 -0.2019 0.1006  470  LEU A CA  
3350 C C   . LEU A 428 ? 1.8915 1.5912 1.3260 -0.1065 -0.1912 0.0977  470  LEU A C   
3351 O O   . LEU A 428 ? 1.9006 1.5759 1.3311 -0.0986 -0.1942 0.0962  470  LEU A O   
3352 C CB  . LEU A 428 ? 1.9075 1.5323 1.2795 -0.1107 -0.1940 0.0877  470  LEU A CB  
3353 C CG  . LEU A 428 ? 2.0164 1.5759 1.3579 -0.0943 -0.1962 0.0789  470  LEU A CG  
3354 C CD1 . LEU A 428 ? 2.0716 1.5779 1.3684 -0.0925 -0.1984 0.0707  470  LEU A CD1 
3355 C CD2 . LEU A 428 ? 2.0163 1.5920 1.3929 -0.0611 -0.1814 0.0709  470  LEU A CD2 
3356 N N   . CYS A 429 ? 1.8027 1.5541 1.2750 -0.0957 -0.1796 0.0969  471  CYS A N   
3357 C CA  . CYS A 429 ? 1.7582 1.5398 1.2696 -0.0762 -0.1696 0.0931  471  CYS A CA  
3358 C C   . CYS A 429 ? 1.7643 1.5975 1.2976 -0.0847 -0.1732 0.1022  471  CYS A C   
3359 O O   . CYS A 429 ? 1.7390 1.5840 1.2902 -0.0775 -0.1730 0.1017  471  CYS A O   
3360 C CB  . CYS A 429 ? 1.7409 1.5324 1.2732 -0.0560 -0.1540 0.0844  471  CYS A CB  
3361 S SG  . CYS A 429 ? 1.8255 1.5686 1.3302 -0.0464 -0.1488 0.0752  471  CYS A SG  
3362 N N   . ASN A 430 ? 1.7102 1.5777 1.2416 -0.0982 -0.1764 0.1104  472  ASN A N   
3363 C CA  . ASN A 430 ? 1.6817 1.6054 1.2313 -0.1034 -0.1793 0.1196  472  ASN A CA  
3364 C C   . ASN A 430 ? 1.7550 1.6859 1.2848 -0.1311 -0.1950 0.1327  472  ASN A C   
3365 O O   . ASN A 430 ? 1.7828 1.6947 1.2825 -0.1538 -0.2046 0.1386  472  ASN A O   
3366 C CB  . ASN A 430 ? 1.6617 1.6270 1.2213 -0.0980 -0.1734 0.1223  472  ASN A CB  
3367 C CG  . ASN A 430 ? 1.8395 1.8627 1.4210 -0.0905 -0.1722 0.1279  472  ASN A CG  
3368 O OD1 . ASN A 430 ? 1.7449 1.8118 1.3213 -0.1047 -0.1800 0.1399  472  ASN A OD1 
3369 N ND2 . ASN A 430 ? 1.7049 1.7315 1.3090 -0.0678 -0.1627 0.1193  472  ASN A ND2 
3370 N N   . GLU A 431 ? 1.6908 1.6489 1.2357 -0.1308 -0.1980 0.1375  473  GLU A N   
3371 C CA  . GLU A 431 ? 1.7019 1.6729 1.2315 -0.1568 -0.2122 0.1517  473  GLU A CA  
3372 C C   . GLU A 431 ? 1.7280 1.7598 1.2558 -0.1765 -0.2183 0.1659  473  GLU A C   
3373 O O   . GLU A 431 ? 1.7518 1.7775 1.2516 -0.2080 -0.2314 0.1775  473  GLU A O   
3374 C CB  . GLU A 431 ? 1.7014 1.6887 1.2510 -0.1463 -0.2116 0.1517  473  GLU A CB  
3375 C CG  . GLU A 431 ? 1.8750 1.8376 1.4011 -0.1683 -0.2254 0.1620  473  GLU A CG  
3376 C CD  . GLU A 431 ? 2.1509 2.0390 1.6560 -0.1617 -0.2274 0.1541  473  GLU A CD  
3377 O OE1 . GLU A 431 ? 2.0096 1.8867 1.5348 -0.1346 -0.2176 0.1421  473  GLU A OE1 
3378 O OE2 . GLU A 431 ? 2.1348 1.9757 1.6007 -0.1837 -0.2395 0.1605  473  GLU A OE2 
3379 N N   . ASN A 432 ? 1.6408 1.7309 1.1955 -0.1578 -0.2093 0.1653  474  ASN A N   
3380 C CA  . ASN A 432 ? 1.6286 1.7889 1.1857 -0.1676 -0.2126 0.1783  474  ASN A CA  
3381 C C   . ASN A 432 ? 1.7093 1.8642 1.2439 -0.1869 -0.2175 0.1831  474  ASN A C   
3382 O O   . ASN A 432 ? 1.7203 1.9249 1.2455 -0.2107 -0.2268 0.1983  474  ASN A O   
3383 C CB  . ASN A 432 ? 1.5999 1.8069 1.1844 -0.1348 -0.2004 0.1729  474  ASN A CB  
3384 C CG  . ASN A 432 ? 1.8940 2.1396 1.4962 -0.1241 -0.2000 0.1751  474  ASN A CG  
3385 O OD1 . ASN A 432 ? 1.8151 2.0306 1.4286 -0.1093 -0.1955 0.1646  474  ASN A OD1 
3386 N ND2 . ASN A 432 ? 1.7926 2.1104 1.3972 -0.1307 -0.2048 0.1890  474  ASN A ND2 
3387 N N   . PHE A 433 ? 1.6716 1.7709 1.1974 -0.1770 -0.2114 0.1707  475  PHE A N   
3388 C CA  . PHE A 433 ? 1.6890 1.7732 1.1909 -0.1928 -0.2154 0.1723  475  PHE A CA  
3389 C C   . PHE A 433 ? 1.7828 1.8221 1.2470 -0.2291 -0.2314 0.1786  475  PHE A C   
3390 O O   . PHE A 433 ? 1.7964 1.8552 1.2391 -0.2580 -0.2421 0.1894  475  PHE A O   
3391 C CB  . PHE A 433 ? 1.7073 1.7457 1.2115 -0.1682 -0.2028 0.1566  475  PHE A CB  
3392 C CG  . PHE A 433 ? 1.6993 1.7779 1.2191 -0.1481 -0.1925 0.1557  475  PHE A CG  
3393 C CD1 . PHE A 433 ? 1.7477 1.8376 1.2505 -0.1595 -0.1955 0.1603  475  PHE A CD1 
3394 C CD2 . PHE A 433 ? 1.6929 1.7939 1.2408 -0.1175 -0.1805 0.1503  475  PHE A CD2 
3395 C CE1 . PHE A 433 ? 1.7387 1.8643 1.2535 -0.1386 -0.1861 0.1606  475  PHE A CE1 
3396 C CE2 . PHE A 433 ? 1.7124 1.8421 1.2687 -0.0973 -0.1717 0.1500  475  PHE A CE2 
3397 C CZ  . PHE A 433 ? 1.6993 1.8422 1.2395 -0.1069 -0.1743 0.1556  475  PHE A CZ  
3398 N N   . LYS A 434 ? 1.7633 1.7418 1.2168 -0.2275 -0.2337 0.1721  476  LYS A N   
3399 C CA  . LYS A 434 ? 1.8204 1.7375 1.2318 -0.2564 -0.2489 0.1759  476  LYS A CA  
3400 C C   . LYS A 434 ? 1.9098 1.8633 1.3038 -0.2976 -0.2658 0.1962  476  LYS A C   
3401 O O   . LYS A 434 ? 1.9562 1.8725 1.3085 -0.3311 -0.2803 0.2023  476  LYS A O   
3402 C CB  . LYS A 434 ? 1.8525 1.7134 1.2630 -0.2386 -0.2464 0.1668  476  LYS A CB  
3403 C CG  . LYS A 434 ? 1.9961 1.7721 1.3564 -0.2565 -0.2595 0.1659  476  LYS A CG  
3404 C CD  . LYS A 434 ? 2.0770 1.8174 1.4358 -0.2451 -0.2611 0.1644  476  LYS A CD  
3405 C CE  . LYS A 434 ? 2.1749 1.9427 1.5283 -0.2736 -0.2742 0.1823  476  LYS A CE  
3406 N NZ  . LYS A 434 ? 2.2398 1.9900 1.6026 -0.2566 -0.2729 0.1809  476  LYS A NZ  
3407 N N   . LYS A 435 ? 1.8408 1.8670 1.2645 -0.2957 -0.2642 0.2066  477  LYS A N   
3408 C CA  . LYS A 435 ? 1.8553 1.9342 1.2698 -0.3327 -0.2783 0.2278  477  LYS A CA  
3409 C C   . LYS A 435 ? 1.9204 2.0723 1.3371 -0.3496 -0.2812 0.2391  477  LYS A C   
3410 O O   . LYS A 435 ? 1.9477 2.1160 1.3376 -0.3927 -0.2971 0.2553  477  LYS A O   
3411 C CB  . LYS A 435 ? 1.8413 1.9715 1.2867 -0.3190 -0.2741 0.2334  477  LYS A CB  
3412 C CG  . LYS A 435 ? 1.9038 2.0638 1.3328 -0.3583 -0.2899 0.2548  477  LYS A CG  
3413 C CD  . LYS A 435 ? 1.9298 2.1427 1.3903 -0.3400 -0.2841 0.2586  477  LYS A CD  
3414 C CE  . LYS A 435 ? 2.0435 2.2902 1.4885 -0.3791 -0.2991 0.2813  477  LYS A CE  
3415 N NZ  . LYS A 435 ? 2.1015 2.4116 1.5784 -0.3594 -0.2927 0.2853  477  LYS A NZ  
3416 N N   . THR A 436 ? 1.8570 2.0524 1.3034 -0.3164 -0.2666 0.2313  478  THR A N   
3417 C CA  . THR A 436 ? 1.8535 2.1222 1.3051 -0.3226 -0.2670 0.2407  478  THR A CA  
3418 C C   . THR A 436 ? 1.9656 2.1911 1.3811 -0.3496 -0.2761 0.2398  478  THR A C   
3419 O O   . THR A 436 ? 1.9736 2.2524 1.3772 -0.3790 -0.2861 0.2543  478  THR A O   
3420 C CB  . THR A 436 ? 1.9164 2.2291 1.4042 -0.2752 -0.2489 0.2316  478  THR A CB  
3421 O OG1 . THR A 436 ? 1.8807 2.2192 1.3949 -0.2521 -0.2421 0.2302  478  THR A OG1 
3422 C CG2 . THR A 436 ? 1.8882 2.2883 1.3828 -0.2756 -0.2489 0.2434  478  THR A CG2 
3423 N N   . PHE A 437 ? 1.9624 2.0941 1.3589 -0.3399 -0.2731 0.2231  479  PHE A N   
3424 C CA  . PHE A 437 ? 2.0156 2.0915 1.3726 -0.3613 -0.2814 0.2188  479  PHE A CA  
3425 C C   . PHE A 437 ? 2.1434 2.1806 1.4547 -0.4115 -0.3031 0.2303  479  PHE A C   
3426 O O   . PHE A 437 ? 2.1797 2.2114 1.4582 -0.4450 -0.3156 0.2361  479  PHE A O   
3427 C CB  . PHE A 437 ? 2.0455 2.0379 1.3971 -0.3298 -0.2701 0.1971  479  PHE A CB  
3428 C CG  . PHE A 437 ? 2.0299 2.0416 1.4053 -0.2951 -0.2535 0.1865  479  PHE A CG  
3429 C CD1 . PHE A 437 ? 2.0217 2.1168 1.4322 -0.2772 -0.2446 0.1930  479  PHE A CD1 
3430 C CD2 . PHE A 437 ? 2.0736 2.0188 1.4342 -0.2781 -0.2465 0.1705  479  PHE A CD2 
3431 C CE1 . PHE A 437 ? 2.0067 2.1122 1.4342 -0.2457 -0.2301 0.1843  479  PHE A CE1 
3432 C CE2 . PHE A 437 ? 2.0786 2.0410 1.4597 -0.2483 -0.2313 0.1625  479  PHE A CE2 
3433 C CZ  . PHE A 437 ? 2.0109 2.0502 1.4244 -0.2333 -0.2237 0.1698  479  PHE A CZ  
3434 N N   . LYS A 438 ? 2.1212 2.1303 1.4280 -0.4181 -0.3082 0.2341  480  LYS A N   
3435 C CA  . LYS A 438 ? 2.1869 2.1531 1.4479 -0.4655 -0.3293 0.2467  480  LYS A CA  
3436 C C   . LYS A 438 ? 2.2445 2.3033 1.5078 -0.5077 -0.3418 0.2714  480  LYS A C   
3437 O O   . LYS A 438 ? 2.2948 2.3362 1.5153 -0.5561 -0.3603 0.2826  480  LYS A O   
3438 C CB  . LYS A 438 ? 2.2269 2.1410 1.4854 -0.4548 -0.3295 0.2442  480  LYS A CB  
3439 C CG  . LYS A 438 ? 2.4350 2.2358 1.6636 -0.4339 -0.3275 0.2252  480  LYS A CG  
3440 C CD  . LYS A 438 ? 2.5627 2.3242 1.7913 -0.4218 -0.3280 0.2250  480  LYS A CD  
3441 C CE  . LYS A 438 ? 2.7004 2.3571 1.8996 -0.3964 -0.3255 0.2070  480  LYS A CE  
3442 N NZ  . LYS A 438 ? 2.7804 2.4003 1.9746 -0.3873 -0.3283 0.2093  480  LYS A NZ  
3443 N N   . ARG A 439 ? 2.1474 2.3055 1.4584 -0.4891 -0.3319 0.2799  481  ARG A N   
3444 C CA  . ARG A 439 ? 2.1385 2.4024 1.4590 -0.5211 -0.3408 0.3040  481  ARG A CA  
3445 C C   . ARG A 439 ? 2.1898 2.5138 1.5049 -0.5404 -0.3455 0.3118  481  ARG A C   
3446 O O   . ARG A 439 ? 2.2030 2.5847 1.5026 -0.5874 -0.3610 0.3333  481  ARG A O   
3447 C CB  . ARG A 439 ? 2.0852 2.4349 1.4552 -0.4884 -0.3278 0.3085  481  ARG A CB  
3448 N N   . ILE A 440 ? 2.1331 2.4457 1.4599 -0.5062 -0.3327 0.2955  482  ILE A N   
3449 C CA  . ILE A 440 ? 2.1381 2.5031 1.4600 -0.5180 -0.3356 0.3007  482  ILE A CA  
3450 C C   . ILE A 440 ? 2.2711 2.5644 1.5374 -0.5645 -0.3537 0.3004  482  ILE A C   
3451 O O   . ILE A 440 ? 2.2844 2.6327 1.5374 -0.5967 -0.3643 0.3129  482  ILE A O   
3452 C CB  . ILE A 440 ? 2.1257 2.5144 1.4818 -0.4626 -0.3148 0.2860  482  ILE A CB  
3453 C CG1 . ILE A 440 ? 2.1135 2.6054 1.4803 -0.4672 -0.3158 0.2990  482  ILE A CG1 
3454 C CG2 . ILE A 440 ? 2.1510 2.4342 1.4904 -0.4408 -0.3074 0.2629  482  ILE A CG2 
3455 C CD1 . ILE A 440 ? 2.1407 2.7217 1.5528 -0.4201 -0.2994 0.3011  482  ILE A CD1 
3456 N N   . LEU A 441 ? 2.2792 2.4508 1.5109 -0.5663 -0.3576 0.2860  483  LEU A N   
3457 C CA  . LEU A 441 ? 2.3571 2.4413 1.5276 -0.6060 -0.3752 0.2827  483  LEU A CA  
3458 C C   . LEU A 441 ? 2.4535 2.5452 1.5862 -0.6714 -0.3997 0.3051  483  LEU A C   
3459 O O   . LEU A 441 ? 2.4996 2.5847 1.5916 -0.7176 -0.4170 0.3126  483  LEU A O   
3460 C CB  . LEU A 441 ? 2.3922 2.3467 1.5363 -0.5803 -0.3706 0.2601  483  LEU A CB  
3461 C CG  . LEU A 441 ? 2.4291 2.3513 1.5856 -0.5335 -0.3531 0.2377  483  LEU A CG  
3462 C CD1 . LEU A 441 ? 2.4463 2.2669 1.5917 -0.5000 -0.3450 0.2184  483  LEU A CD1 
3463 C CD2 . LEU A 441 ? 2.5099 2.4105 1.6273 -0.5573 -0.3627 0.2343  483  LEU A CD2 
3464 N N   . HIS A 442 ? 2.3907 2.5011 1.5368 -0.6770 -0.4014 0.3168  484  HIS A N   
3465 C CA  . HIS A 442 ? 2.4346 2.5583 1.5488 -0.7386 -0.4234 0.3408  484  HIS A CA  
3466 C C   . HIS A 442 ? 2.4188 2.6962 1.5716 -0.7566 -0.4240 0.3653  484  HIS A C   
3467 O O   . HIS A 442 ? 2.4311 2.7514 1.5767 -0.7972 -0.4367 0.3878  484  HIS A O   
3468 C CB  . HIS A 442 ? 2.4700 2.5180 1.5698 -0.7355 -0.4261 0.3401  484  HIS A CB  
3469 C CG  . HIS A 442 ? 2.5593 2.4656 1.6213 -0.7125 -0.4248 0.3165  484  HIS A CG  
3470 N ND1 . HIS A 442 ? 2.5325 2.4102 1.6285 -0.6495 -0.4033 0.2951  484  HIS A ND1 
3471 C CD2 . HIS A 442 ? 2.6734 2.4662 1.6658 -0.7432 -0.4422 0.3111  484  HIS A CD2 
3472 C CE1 . HIS A 442 ? 2.5848 2.3400 1.6338 -0.6424 -0.4076 0.2785  484  HIS A CE1 
3473 N NE2 . HIS A 442 ? 2.6770 2.3737 1.6612 -0.6956 -0.4307 0.2865  484  HIS A NE2 
3474 N N   . ILE A 443 ? 2.3070 2.6668 1.4978 -0.7255 -0.4103 0.3611  485  ILE A N   
3475 C CA  . ILE A 443 ? 2.3457 2.8563 1.5752 -0.7270 -0.4070 0.3798  485  ILE A CA  
3476 C C   . ILE A 443 ? 2.2663 2.8642 1.5325 -0.7191 -0.4020 0.3959  485  ILE A C   
3477 O O   . ILE A 443 ? 1.5101 2.1424 0.8209 -0.6627 -0.3821 0.3863  485  ILE A O   
3478 C CB  . ILE A 443 ? 2.4261 2.9847 1.6234 -0.7865 -0.4269 0.3970  485  ILE A CB  
3479 C CG1 . ILE A 443 ? 2.4502 2.9379 1.6210 -0.7792 -0.4268 0.3778  485  ILE A CG1 
3480 C CG2 . ILE A 443 ? 2.3858 3.1120 1.6232 -0.7874 -0.4240 0.4188  485  ILE A CG2 
3481 C CD1 . ILE A 443 ? 2.5906 2.9946 1.7048 -0.8270 -0.4461 0.3743  485  ILE A CD1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   20   ?    ?   ?   A . n 
A 1 2   THR 2   21   ?    ?   ?   A . n 
A 1 3   MET 3   22   ?    ?   ?   A . n 
A 1 4   ALA 4   23   ?    ?   ?   A . n 
A 1 5   SER 5   24   ?    ?   ?   A . n 
A 1 6   PRO 6   25   ?    ?   ?   A . n 
A 1 7   GLN 7   26   ?    ?   ?   A . n 
A 1 8   LEU 8   27   ?    ?   ?   A . n 
A 1 9   MET 9   28   28   MET MET A . n 
A 1 10  PRO 10  29   29   PRO PRO A . n 
A 1 11  LEU 11  30   30   LEU LEU A . n 
A 1 12  VAL 12  31   31   VAL VAL A . n 
A 1 13  VAL 13  32   32   VAL VAL A . n 
A 1 14  VAL 14  33   33   VAL VAL A . n 
A 1 15  LEU 15  34   34   LEU LEU A . n 
A 1 16  SER 16  35   35   SER SER A . n 
A 1 17  THR 17  36   36   THR THR A . n 
A 1 18  ILE 18  37   37   ILE ILE A . n 
A 1 19  CYS 19  38   38   CYS CYS A . n 
A 1 20  LEU 20  39   39   LEU LEU A . n 
A 1 21  VAL 21  40   40   VAL VAL A . n 
A 1 22  THR 22  41   41   THR THR A . n 
A 1 23  VAL 23  42   42   VAL VAL A . n 
A 1 24  GLY 24  43   43   GLY GLY A . n 
A 1 25  LEU 25  44   44   LEU LEU A . n 
A 1 26  ASN 26  45   45   ASN ASN A . n 
A 1 27  LEU 27  46   46   LEU LEU A . n 
A 1 28  LEU 28  47   47   LEU LEU A . n 
A 1 29  VAL 29  48   48   VAL VAL A . n 
A 1 30  LEU 30  49   49   LEU LEU A . n 
A 1 31  TYR 31  50   50   TYR TYR A . n 
A 1 32  ALA 32  51   51   ALA ALA A . n 
A 1 33  VAL 33  52   52   VAL VAL A . n 
A 1 34  ARG 34  53   53   ARG ARG A . n 
A 1 35  SER 35  54   54   SER SER A . n 
A 1 36  GLU 36  55   55   GLU GLU A . n 
A 1 37  ARG 37  56   56   ARG ARG A . n 
A 1 38  LYS 38  57   57   LYS LYS A . n 
A 1 39  LEU 39  58   58   LEU LEU A . n 
A 1 40  HIS 40  59   59   HIS HIS A . n 
A 1 41  THR 41  60   60   THR THR A . n 
A 1 42  VAL 42  61   61   VAL VAL A . n 
A 1 43  GLY 43  62   62   GLY GLY A . n 
A 1 44  ASN 44  63   63   ASN ASN A . n 
A 1 45  LEU 45  64   64   LEU LEU A . n 
A 1 46  TYR 46  65   65   TYR TYR A . n 
A 1 47  ILE 47  66   66   ILE ILE A . n 
A 1 48  VAL 48  67   67   VAL VAL A . n 
A 1 49  SER 49  68   68   SER SER A . n 
A 1 50  LEU 50  69   69   LEU LEU A . n 
A 1 51  SER 51  70   70   SER SER A . n 
A 1 52  VAL 52  71   71   VAL VAL A . n 
A 1 53  ALA 53  72   72   ALA ALA A . n 
A 1 54  ASP 54  73   73   ASP ASP A . n 
A 1 55  LEU 55  74   74   LEU LEU A . n 
A 1 56  ILE 56  75   75   ILE ILE A . n 
A 1 57  VAL 57  76   76   VAL VAL A . n 
A 1 58  GLY 58  77   77   GLY GLY A . n 
A 1 59  ALA 59  78   78   ALA ALA A . n 
A 1 60  VAL 60  79   79   VAL VAL A . n 
A 1 61  VAL 61  80   80   VAL VAL A . n 
A 1 62  MET 62  81   81   MET MET A . n 
A 1 63  PRO 63  82   82   PRO PRO A . n 
A 1 64  MET 64  83   83   MET MET A . n 
A 1 65  ASN 65  84   84   ASN ASN A . n 
A 1 66  ILE 66  85   85   ILE ILE A . n 
A 1 67  LEU 67  86   86   LEU LEU A . n 
A 1 68  TYR 68  87   87   TYR TYR A . n 
A 1 69  LEU 69  88   88   LEU LEU A . n 
A 1 70  LEU 70  89   89   LEU LEU A . n 
A 1 71  MET 71  90   90   MET MET A . n 
A 1 72  SER 72  91   91   SER SER A . n 
A 1 73  LYS 73  92   92   LYS LYS A . n 
A 1 74  TRP 74  93   93   TRP TRP A . n 
A 1 75  SER 75  94   94   SER SER A . n 
A 1 76  LEU 76  95   95   LEU LEU A . n 
A 1 77  GLY 77  96   96   GLY GLY A . n 
A 1 78  ARG 78  97   97   ARG ARG A . n 
A 1 79  PRO 79  98   98   PRO PRO A . n 
A 1 80  LEU 80  99   99   LEU LEU A . n 
A 1 81  CYS 81  100  100  CYS CYS A . n 
A 1 82  LEU 82  101  101  LEU LEU A . n 
A 1 83  PHE 83  102  102  PHE PHE A . n 
A 1 84  TRP 84  103  103  TRP TRP A . n 
A 1 85  LEU 85  104  104  LEU LEU A . n 
A 1 86  SER 86  105  105  SER SER A . n 
A 1 87  MET 87  106  106  MET MET A . n 
A 1 88  ASP 88  107  107  ASP ASP A . n 
A 1 89  TYR 89  108  108  TYR TYR A . n 
A 1 90  VAL 90  109  109  VAL VAL A . n 
A 1 91  ALA 91  110  110  ALA ALA A . n 
A 1 92  SER 92  111  111  SER SER A . n 
A 1 93  THR 93  112  112  THR THR A . n 
A 1 94  ALA 94  113  113  ALA ALA A . n 
A 1 95  SER 95  114  114  SER SER A . n 
A 1 96  ILE 96  115  115  ILE ILE A . n 
A 1 97  PHE 97  116  116  PHE PHE A . n 
A 1 98  SER 98  117  117  SER SER A . n 
A 1 99  VAL 99  118  118  VAL VAL A . n 
A 1 100 PHE 100 119  119  PHE PHE A . n 
A 1 101 ILE 101 120  120  ILE ILE A . n 
A 1 102 LEU 102 121  121  LEU LEU A . n 
A 1 103 CYS 103 122  122  CYS CYS A . n 
A 1 104 ILE 104 123  123  ILE ILE A . n 
A 1 105 ASP 105 124  124  ASP ASP A . n 
A 1 106 ARG 106 125  125  ARG ARG A . n 
A 1 107 TYR 107 126  126  TYR TYR A . n 
A 1 108 ARG 108 127  127  ARG ARG A . n 
A 1 109 SER 109 128  128  SER SER A . n 
A 1 110 VAL 110 129  129  VAL VAL A . n 
A 1 111 GLN 111 130  130  GLN GLN A . n 
A 1 112 GLN 112 131  131  GLN GLN A . n 
A 1 113 PRO 113 132  132  PRO PRO A . n 
A 1 114 LEU 114 133  133  LEU LEU A . n 
A 1 115 ARG 115 134  134  ARG ARG A . n 
A 1 116 TYR 116 135  135  TYR TYR A . n 
A 1 117 LEU 117 136  136  LEU LEU A . n 
A 1 118 LYS 118 137  137  LYS LYS A . n 
A 1 119 TYR 119 138  138  TYR TYR A . n 
A 1 120 ARG 120 139  139  ARG ARG A . n 
A 1 121 THR 121 140  140  THR THR A . n 
A 1 122 LYS 122 141  141  LYS LYS A . n 
A 1 123 THR 123 142  142  THR THR A . n 
A 1 124 ARG 124 143  143  ARG ARG A . n 
A 1 125 ALA 125 144  144  ALA ALA A . n 
A 1 126 SER 126 145  145  SER SER A . n 
A 1 127 ALA 127 146  146  ALA ALA A . n 
A 1 128 THR 128 147  147  THR THR A . n 
A 1 129 ILE 129 148  148  ILE ILE A . n 
A 1 130 LEU 130 149  149  LEU LEU A . n 
A 1 131 GLY 131 150  150  GLY GLY A . n 
A 1 132 ALA 132 151  151  ALA ALA A . n 
A 1 133 TRP 133 152  152  TRP TRP A . n 
A 1 134 PHE 134 153  153  PHE PHE A . n 
A 1 135 LEU 135 154  154  LEU LEU A . n 
A 1 136 SER 136 155  155  SER SER A . n 
A 1 137 PHE 137 156  156  PHE PHE A . n 
A 1 138 LEU 138 157  157  LEU LEU A . n 
A 1 139 TRP 139 158  158  TRP TRP A . n 
A 1 140 VAL 140 159  159  VAL VAL A . n 
A 1 141 ILE 141 160  160  ILE ILE A . n 
A 1 142 PRO 142 161  161  PRO PRO A . n 
A 1 143 ILE 143 162  162  ILE ILE A . n 
A 1 144 LEU 144 163  163  LEU LEU A . n 
A 1 145 GLY 145 164  164  GLY GLY A . n 
A 1 146 TRP 146 165  165  TRP TRP A . n 
A 1 147 ASN 147 166  166  ASN ASN A . n 
A 1 148 HIS 148 167  167  HIS HIS A . n 
A 1 149 PHE 149 168  ?    ?   ?   A . n 
A 1 150 MET 150 169  ?    ?   ?   A . n 
A 1 151 GLN 151 170  ?    ?   ?   A . n 
A 1 152 GLN 152 171  ?    ?   ?   A . n 
A 1 153 THR 153 172  ?    ?   ?   A . n 
A 1 154 SER 154 173  ?    ?   ?   A . n 
A 1 155 VAL 155 174  ?    ?   ?   A . n 
A 1 156 ARG 156 175  175  ARG ARG A . n 
A 1 157 ARG 157 176  176  ARG ARG A . n 
A 1 158 GLU 158 177  177  GLU GLU A . n 
A 1 159 ASP 159 178  178  ASP ASP A . n 
A 1 160 LYS 160 179  179  LYS LYS A . n 
A 1 161 CYS 161 180  180  CYS CYS A . n 
A 1 162 GLU 162 181  181  GLU GLU A . n 
A 1 163 THR 163 182  182  THR THR A . n 
A 1 164 ASP 164 183  183  ASP ASP A . n 
A 1 165 PHE 165 184  184  PHE PHE A . n 
A 1 166 TYR 166 185  185  TYR TYR A . n 
A 1 167 ASP 167 186  186  ASP ASP A . n 
A 1 168 VAL 168 187  187  VAL VAL A . n 
A 1 169 THR 169 188  188  THR THR A . n 
A 1 170 TRP 170 189  189  TRP TRP A . n 
A 1 171 PHE 171 190  190  PHE PHE A . n 
A 1 172 LYS 172 191  191  LYS LYS A . n 
A 1 173 VAL 173 192  192  VAL VAL A . n 
A 1 174 MET 174 193  193  MET MET A . n 
A 1 175 THR 175 194  194  THR THR A . n 
A 1 176 ALA 176 195  195  ALA ALA A . n 
A 1 177 ILE 177 196  196  ILE ILE A . n 
A 1 178 ILE 178 197  197  ILE ILE A . n 
A 1 179 ASN 179 198  198  ASN ASN A . n 
A 1 180 PHE 180 199  199  PHE PHE A . n 
A 1 181 TYR 181 200  200  TYR TYR A . n 
A 1 182 LEU 182 201  201  LEU LEU A . n 
A 1 183 PRO 183 202  202  PRO PRO A . n 
A 1 184 THR 184 203  203  THR THR A . n 
A 1 185 LEU 185 204  204  LEU LEU A . n 
A 1 186 LEU 186 205  205  LEU LEU A . n 
A 1 187 MET 187 206  206  MET MET A . n 
A 1 188 LEU 188 207  207  LEU LEU A . n 
A 1 189 TRP 189 208  208  TRP TRP A . n 
A 1 190 PHE 190 209  209  PHE PHE A . n 
A 1 191 TYR 191 210  210  TYR TYR A . n 
A 1 192 ALA 192 211  211  ALA ALA A . n 
A 1 193 LYS 193 212  212  LYS LYS A . n 
A 1 194 ILE 194 213  213  ILE ILE A . n 
A 1 195 TYR 195 214  214  TYR TYR A . n 
A 1 196 LYS 196 215  215  LYS LYS A . n 
A 1 197 ALA 197 216  216  ALA ALA A . n 
A 1 198 VAL 198 217  217  VAL VAL A . n 
A 1 199 ARG 199 218  218  ARG ARG A . n 
A 1 200 GLN 200 219  219  GLN GLN A . n 
A 1 201 HIS 201 220  220  HIS HIS A . n 
A 1 202 CYS 202 221  221  CYS CYS A . n 
A 1 203 ASN 203 1002 1002 ASN ASN A . n 
A 1 204 ILE 204 1003 1003 ILE ILE A . n 
A 1 205 PHE 205 1004 1004 PHE PHE A . n 
A 1 206 GLU 206 1005 1005 GLU GLU A . n 
A 1 207 MET 207 1006 1006 MET MET A . n 
A 1 208 LEU 208 1007 1007 LEU LEU A . n 
A 1 209 ARG 209 1008 1008 ARG ARG A . n 
A 1 210 ILE 210 1009 1009 ILE ILE A . n 
A 1 211 ASP 211 1010 1010 ASP ASP A . n 
A 1 212 GLU 212 1011 1011 GLU GLU A . n 
A 1 213 GLY 213 1012 1012 GLY GLY A . n 
A 1 214 LEU 214 1013 1013 LEU LEU A . n 
A 1 215 ARG 215 1014 1014 ARG ARG A . n 
A 1 216 LEU 216 1015 1015 LEU LEU A . n 
A 1 217 LYS 217 1016 1016 LYS LYS A . n 
A 1 218 ILE 218 1017 1017 ILE ILE A . n 
A 1 219 TYR 219 1018 1018 TYR TYR A . n 
A 1 220 LYS 220 1019 1019 LYS LYS A . n 
A 1 221 ASP 221 1020 1020 ASP ASP A . n 
A 1 222 THR 222 1021 1021 THR THR A . n 
A 1 223 GLU 223 1022 1022 GLU GLU A . n 
A 1 224 GLY 224 1023 1023 GLY GLY A . n 
A 1 225 TYR 225 1024 1024 TYR TYR A . n 
A 1 226 TYR 226 1025 1025 TYR TYR A . n 
A 1 227 THR 227 1026 1026 THR THR A . n 
A 1 228 ILE 228 1027 1027 ILE ILE A . n 
A 1 229 GLY 229 1028 1028 GLY GLY A . n 
A 1 230 ILE 230 1029 1029 ILE ILE A . n 
A 1 231 GLY 231 1030 1030 GLY GLY A . n 
A 1 232 HIS 232 1031 1031 HIS HIS A . n 
A 1 233 LEU 233 1032 1032 LEU LEU A . n 
A 1 234 LEU 234 1033 1033 LEU LEU A . n 
A 1 235 THR 235 1034 1034 THR THR A . n 
A 1 236 LYS 236 1035 1035 LYS LYS A . n 
A 1 237 SER 237 1036 1036 SER SER A . n 
A 1 238 PRO 238 1037 1037 PRO PRO A . n 
A 1 239 SER 239 1038 1038 SER SER A . n 
A 1 240 LEU 240 1039 1039 LEU LEU A . n 
A 1 241 ASN 241 1040 1040 ASN ASN A . n 
A 1 242 ALA 242 1041 1041 ALA ALA A . n 
A 1 243 ALA 243 1042 1042 ALA ALA A . n 
A 1 244 LYS 244 1043 1043 LYS LYS A . n 
A 1 245 SER 245 1044 1044 SER SER A . n 
A 1 246 GLU 246 1045 1045 GLU GLU A . n 
A 1 247 LEU 247 1046 1046 LEU LEU A . n 
A 1 248 ASP 248 1047 1047 ASP ASP A . n 
A 1 249 LYS 249 1048 1048 LYS LYS A . n 
A 1 250 ALA 250 1049 1049 ALA ALA A . n 
A 1 251 ILE 251 1050 1050 ILE ILE A . n 
A 1 252 GLY 252 1051 1051 GLY GLY A . n 
A 1 253 ARG 253 1052 1052 ARG ARG A . n 
A 1 254 ASN 254 1053 1053 ASN ASN A . n 
A 1 255 THR 255 1054 1054 THR THR A . n 
A 1 256 ASN 256 1055 1055 ASN ASN A . n 
A 1 257 GLY 257 1056 1056 GLY GLY A . n 
A 1 258 VAL 258 1057 1057 VAL VAL A . n 
A 1 259 ILE 259 1058 1058 ILE ILE A . n 
A 1 260 THR 260 1059 1059 THR THR A . n 
A 1 261 LYS 261 1060 1060 LYS LYS A . n 
A 1 262 ASP 262 1061 1061 ASP ASP A . n 
A 1 263 GLU 263 1062 1062 GLU GLU A . n 
A 1 264 ALA 264 1063 1063 ALA ALA A . n 
A 1 265 GLU 265 1064 1064 GLU GLU A . n 
A 1 266 LYS 266 1065 1065 LYS LYS A . n 
A 1 267 LEU 267 1066 1066 LEU LEU A . n 
A 1 268 PHE 268 1067 1067 PHE PHE A . n 
A 1 269 ASN 269 1068 1068 ASN ASN A . n 
A 1 270 GLN 270 1069 1069 GLN GLN A . n 
A 1 271 ASP 271 1070 1070 ASP ASP A . n 
A 1 272 VAL 272 1071 1071 VAL VAL A . n 
A 1 273 ASP 273 1072 1072 ASP ASP A . n 
A 1 274 ALA 274 1073 1073 ALA ALA A . n 
A 1 275 ALA 275 1074 1074 ALA ALA A . n 
A 1 276 VAL 276 1075 1075 VAL VAL A . n 
A 1 277 ARG 277 1076 1076 ARG ARG A . n 
A 1 278 GLY 278 1077 1077 GLY GLY A . n 
A 1 279 ILE 279 1078 1078 ILE ILE A . n 
A 1 280 LEU 280 1079 1079 LEU LEU A . n 
A 1 281 ARG 281 1080 1080 ARG ARG A . n 
A 1 282 ASN 282 1081 1081 ASN ASN A . n 
A 1 283 ALA 283 1082 1082 ALA ALA A . n 
A 1 284 LYS 284 1083 1083 LYS LYS A . n 
A 1 285 LEU 285 1084 1084 LEU LEU A . n 
A 1 286 LYS 286 1085 1085 LYS LYS A . n 
A 1 287 PRO 287 1086 1086 PRO PRO A . n 
A 1 288 VAL 288 1087 1087 VAL VAL A . n 
A 1 289 TYR 289 1088 1088 TYR TYR A . n 
A 1 290 ASP 290 1089 1089 ASP ASP A . n 
A 1 291 SER 291 1090 1090 SER SER A . n 
A 1 292 LEU 292 1091 1091 LEU LEU A . n 
A 1 293 ASP 293 1092 1092 ASP ASP A . n 
A 1 294 ALA 294 1093 1093 ALA ALA A . n 
A 1 295 VAL 295 1094 1094 VAL VAL A . n 
A 1 296 ARG 296 1095 1095 ARG ARG A . n 
A 1 297 ARG 297 1096 1096 ARG ARG A . n 
A 1 298 ALA 298 1097 1097 ALA ALA A . n 
A 1 299 ALA 299 1098 1098 ALA ALA A . n 
A 1 300 LEU 300 1099 1099 LEU LEU A . n 
A 1 301 ILE 301 1100 1100 ILE ILE A . n 
A 1 302 ASN 302 1101 1101 ASN ASN A . n 
A 1 303 MET 303 1102 1102 MET MET A . n 
A 1 304 VAL 304 1103 1103 VAL VAL A . n 
A 1 305 PHE 305 1104 1104 PHE PHE A . n 
A 1 306 GLN 306 1105 1105 GLN GLN A . n 
A 1 307 MET 307 1106 1106 MET MET A . n 
A 1 308 GLY 308 1107 1107 GLY GLY A . n 
A 1 309 GLU 309 1108 1108 GLU GLU A . n 
A 1 310 THR 310 1109 1109 THR THR A . n 
A 1 311 GLY 311 1110 1110 GLY GLY A . n 
A 1 312 VAL 312 1111 1111 VAL VAL A . n 
A 1 313 ALA 313 1112 1112 ALA ALA A . n 
A 1 314 GLY 314 1113 1113 GLY GLY A . n 
A 1 315 PHE 315 1114 1114 PHE PHE A . n 
A 1 316 THR 316 1115 1115 THR THR A . n 
A 1 317 ASN 317 1116 1116 ASN ASN A . n 
A 1 318 SER 318 1117 1117 SER SER A . n 
A 1 319 LEU 319 1118 1118 LEU LEU A . n 
A 1 320 ARG 320 1119 1119 ARG ARG A . n 
A 1 321 MET 321 1120 1120 MET MET A . n 
A 1 322 LEU 322 1121 1121 LEU LEU A . n 
A 1 323 GLN 323 1122 1122 GLN GLN A . n 
A 1 324 GLN 324 1123 1123 GLN GLN A . n 
A 1 325 LYS 325 1124 1124 LYS LYS A . n 
A 1 326 ARG 326 1125 1125 ARG ARG A . n 
A 1 327 TRP 327 1126 1126 TRP TRP A . n 
A 1 328 ASP 328 1127 1127 ASP ASP A . n 
A 1 329 GLU 329 1128 1128 GLU GLU A . n 
A 1 330 ALA 330 1129 1129 ALA ALA A . n 
A 1 331 ALA 331 1130 1130 ALA ALA A . n 
A 1 332 VAL 332 1131 1131 VAL VAL A . n 
A 1 333 ASN 333 1132 1132 ASN ASN A . n 
A 1 334 LEU 334 1133 1133 LEU LEU A . n 
A 1 335 ALA 335 1134 1134 ALA ALA A . n 
A 1 336 LYS 336 1135 1135 LYS LYS A . n 
A 1 337 SER 337 1136 1136 SER SER A . n 
A 1 338 ARG 338 1137 1137 ARG ARG A . n 
A 1 339 TRP 339 1138 1138 TRP TRP A . n 
A 1 340 TYR 340 1139 1139 TYR TYR A . n 
A 1 341 ASN 341 1140 1140 ASN ASN A . n 
A 1 342 GLN 342 1141 1141 GLN GLN A . n 
A 1 343 THR 343 1142 1142 THR THR A . n 
A 1 344 PRO 344 1143 1143 PRO PRO A . n 
A 1 345 ASN 345 1144 1144 ASN ASN A . n 
A 1 346 ARG 346 1145 1145 ARG ARG A . n 
A 1 347 ALA 347 1146 1146 ALA ALA A . n 
A 1 348 LYS 348 1147 1147 LYS LYS A . n 
A 1 349 ARG 349 1148 1148 ARG ARG A . n 
A 1 350 VAL 350 1149 1149 VAL VAL A . n 
A 1 351 ILE 351 1150 1150 ILE ILE A . n 
A 1 352 THR 352 1151 1151 THR THR A . n 
A 1 353 THR 353 1152 1152 THR THR A . n 
A 1 354 PHE 354 1153 1153 PHE PHE A . n 
A 1 355 ARG 355 1154 1154 ARG ARG A . n 
A 1 356 THR 356 1155 1155 THR THR A . n 
A 1 357 GLY 357 1156 1156 GLY GLY A . n 
A 1 358 THR 358 1157 1157 THR THR A . n 
A 1 359 TRP 359 1158 1158 TRP TRP A . n 
A 1 360 ASP 360 1159 1159 ASP ASP A . n 
A 1 361 ALA 361 1160 1160 ALA ALA A . n 
A 1 362 TYR 362 1161 1161 TYR TYR A . n 
A 1 363 LEU 363 405  405  LEU LEU A . n 
A 1 364 HIS 364 406  406  HIS HIS A . n 
A 1 365 MET 365 407  407  MET MET A . n 
A 1 366 ASN 366 408  408  ASN ASN A . n 
A 1 367 ARG 367 409  409  ARG ARG A . n 
A 1 368 GLU 368 410  410  GLU GLU A . n 
A 1 369 ARG 369 411  411  ARG ARG A . n 
A 1 370 LYS 370 412  412  LYS LYS A . n 
A 1 371 ALA 371 413  413  ALA ALA A . n 
A 1 372 ALA 372 414  414  ALA ALA A . n 
A 1 373 LYS 373 415  415  LYS LYS A . n 
A 1 374 GLN 374 416  416  GLN GLN A . n 
A 1 375 LEU 375 417  417  LEU LEU A . n 
A 1 376 GLY 376 418  418  GLY GLY A . n 
A 1 377 PHE 377 419  419  PHE PHE A . n 
A 1 378 ILE 378 420  420  ILE ILE A . n 
A 1 379 MET 379 421  421  MET MET A . n 
A 1 380 ALA 380 422  422  ALA ALA A . n 
A 1 381 ALA 381 423  423  ALA ALA A . n 
A 1 382 PHE 382 424  424  PHE PHE A . n 
A 1 383 ILE 383 425  425  ILE ILE A . n 
A 1 384 LEU 384 426  426  LEU LEU A . n 
A 1 385 CYS 385 427  427  CYS CYS A . n 
A 1 386 TRP 386 428  428  TRP TRP A . n 
A 1 387 ILE 387 429  429  ILE ILE A . n 
A 1 388 PRO 388 430  430  PRO PRO A . n 
A 1 389 TYR 389 431  431  TYR TYR A . n 
A 1 390 PHE 390 432  432  PHE PHE A . n 
A 1 391 ILE 391 433  433  ILE ILE A . n 
A 1 392 PHE 392 434  434  PHE PHE A . n 
A 1 393 PHE 393 435  435  PHE PHE A . n 
A 1 394 MET 394 436  436  MET MET A . n 
A 1 395 VAL 395 437  437  VAL VAL A . n 
A 1 396 ILE 396 438  438  ILE ILE A . n 
A 1 397 ALA 397 439  439  ALA ALA A . n 
A 1 398 PHE 398 440  440  PHE PHE A . n 
A 1 399 CYS 399 441  441  CYS CYS A . n 
A 1 400 LYS 400 442  442  LYS LYS A . n 
A 1 401 ASN 401 443  443  ASN ASN A . n 
A 1 402 CYS 402 444  444  CYS CYS A . n 
A 1 403 CYS 403 445  445  CYS CYS A . n 
A 1 404 ASN 404 446  446  ASN ASN A . n 
A 1 405 GLU 405 447  447  GLU GLU A . n 
A 1 406 HIS 406 448  448  HIS HIS A . n 
A 1 407 LEU 407 449  449  LEU LEU A . n 
A 1 408 HIS 408 450  450  HIS HIS A . n 
A 1 409 MET 409 451  451  MET MET A . n 
A 1 410 PHE 410 452  452  PHE PHE A . n 
A 1 411 THR 411 453  453  THR THR A . n 
A 1 412 ILE 412 454  454  ILE ILE A . n 
A 1 413 TRP 413 455  455  TRP TRP A . n 
A 1 414 LEU 414 456  456  LEU LEU A . n 
A 1 415 GLY 415 457  457  GLY GLY A . n 
A 1 416 TYR 416 458  458  TYR TYR A . n 
A 1 417 ILE 417 459  459  ILE ILE A . n 
A 1 418 ASN 418 460  460  ASN ASN A . n 
A 1 419 SER 419 461  461  SER SER A . n 
A 1 420 THR 420 462  462  THR THR A . n 
A 1 421 LEU 421 463  463  LEU LEU A . n 
A 1 422 ASN 422 464  464  ASN ASN A . n 
A 1 423 PRO 423 465  465  PRO PRO A . n 
A 1 424 LEU 424 466  466  LEU LEU A . n 
A 1 425 ILE 425 467  467  ILE ILE A . n 
A 1 426 TYR 426 468  468  TYR TYR A . n 
A 1 427 PRO 427 469  469  PRO PRO A . n 
A 1 428 LEU 428 470  470  LEU LEU A . n 
A 1 429 CYS 429 471  471  CYS CYS A . n 
A 1 430 ASN 430 472  472  ASN ASN A . n 
A 1 431 GLU 431 473  473  GLU GLU A . n 
A 1 432 ASN 432 474  474  ASN ASN A . n 
A 1 433 PHE 433 475  475  PHE PHE A . n 
A 1 434 LYS 434 476  476  LYS LYS A . n 
A 1 435 LYS 435 477  477  LYS LYS A . n 
A 1 436 THR 436 478  478  THR THR A . n 
A 1 437 PHE 437 479  479  PHE PHE A . n 
A 1 438 LYS 438 480  480  LYS LYS A . n 
A 1 439 ARG 439 481  481  ARG ARG A . n 
A 1 440 ILE 440 482  482  ILE ILE A . n 
A 1 441 LEU 441 483  483  LEU LEU A . n 
A 1 442 HIS 442 484  484  HIS HIS A . n 
A 1 443 ILE 443 485  485  ILE ILE A . n 
A 1 444 ARG 444 486  ?    ?   ?   A . n 
A 1 445 SER 445 487  ?    ?   ?   A . n 
A 1 446 GLY 446 488  ?    ?   ?   A . n 
A 1 447 GLU 447 489  ?    ?   ?   A . n 
A 1 448 ASN 448 490  ?    ?   ?   A . n 
A 1 449 LEU 449 491  ?    ?   ?   A . n 
A 1 450 TYR 450 492  ?    ?   ?   A . n 
A 1 451 PHE 451 493  ?    ?   ?   A . n 
A 1 452 GLN 452 494  ?    ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'GPCR Network' 
_pdbx_SG_project.initial_of_center     GPCR 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 5EH 1 1200 1200 5EH 5EH A . 
C 3 D7V 1 1201 1201 D7V D7V A . 
D 4 PO4 1 1202 1202 PO4 PO4 A . 
E 4 PO4 1 1203 1203 PO4 PO4 A . 
F 4 PO4 1 1204 1204 PO4 PO4 A . 
G 5 OLC 1 1205 1205 OLC OLC A . 
H 6 HOH 1 1206 1206 HOH HOH A . 
H 6 HOH 2 1207 1207 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-15 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-07-20 
4 'Structure model' 1 3 2017-08-16 
5 'Structure model' 1 4 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Refinement description'    
4 4 'Structure model' 'Source and taxonomy'       
5 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
3 5 'Structure model' audit_author   
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 14.1334 33.5398 30.6388 0.2324  0.0944  -0.3040 0.0062 -0.0654 0.1063  1.4700 0.6106 5.2307 
-0.2457 0.6412  -0.6945 0.1370  0.2784 0.0552  -0.3949 0.0854 -0.1855 0.1989 -0.5442 -0.2223 
'X-RAY DIFFRACTION' 2 ? refined 35.9671 17.0318 70.5261 -0.1015 -0.2329 0.0710  0.0006 0.0152  -0.0250 2.8613 1.6343 1.3082 2.0242 
-0.4496 -0.2841 -0.1723 0.1254 -0.2560 -0.2881 0.0967 -0.2262 0.2478 -0.0164 0.0756  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 28   A 485  '{ A|28 - A|485 }'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 1002 A 1161 '{ A|1002 - A|1161 }' ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
GDA    'data collection' .     ? 1 
PHASER phasing           .     ? 2 
BUSTER refinement        2.8.0 ? 3 
MOSFLM 'data reduction'  .     ? 4 
SCALA  'data scaling'    .     ? 5 
# 
_pdbx_entry_details.entry_id             3RZE 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'THE PROTEIN IS A FUSION PROTEIN WITH RESIDUES ASN1002-TYR1161 OF T4 LYSOZYME INSERTED BETWEEN CYS221 AND LEU450 OF H1.' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 135 ? ? -65.24  6.02    
2  1 LYS A 137 ? ? 81.62   27.01   
3  1 ARG A 139 ? ? -104.15 77.73   
4  1 LYS A 179 ? ? -150.40 -148.77 
5  1 GLU A 181 ? ? 86.99   118.26  
6  1 ASP A 183 ? ? 73.98   -26.17  
7  1 PHE A 199 ? ? -135.84 -64.11  
8  1 GLN A 219 ? ? -125.61 -77.92  
9  1 CYS A 221 ? ? 38.12   176.98  
10 1 LYS A 442 ? ? 92.28   21.77   
11 1 ASN A 443 ? ? 107.27  56.01   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 442  ? CG  ? A LYS 400 CG  
2  1 Y 1 A LYS 442  ? CD  ? A LYS 400 CD  
3  1 Y 1 A LYS 442  ? CE  ? A LYS 400 CE  
4  1 Y 1 A LYS 442  ? NZ  ? A LYS 400 NZ  
5  1 Y 1 A ARG 481  ? CG  ? A ARG 439 CG  
6  1 Y 1 A ARG 481  ? CD  ? A ARG 439 CD  
7  1 Y 1 A ARG 481  ? NE  ? A ARG 439 NE  
8  1 Y 1 A ARG 481  ? CZ  ? A ARG 439 CZ  
9  1 Y 1 A ARG 481  ? NH1 ? A ARG 439 NH1 
10 1 Y 1 A ARG 481  ? NH2 ? A ARG 439 NH2 
11 1 N 1 A OLC 1205 ? C18 ? G OLC 1   C18 
12 1 N 1 A OLC 1205 ? C10 ? G OLC 1   C10 
13 1 N 1 A OLC 1205 ? C9  ? G OLC 1   C9  
14 1 N 1 A OLC 1205 ? C17 ? G OLC 1   C17 
15 1 N 1 A OLC 1205 ? C11 ? G OLC 1   C11 
16 1 N 1 A OLC 1205 ? C16 ? G OLC 1   C16 
17 1 N 1 A OLC 1205 ? C12 ? G OLC 1   C12 
18 1 N 1 A OLC 1205 ? C15 ? G OLC 1   C15 
19 1 N 1 A OLC 1205 ? C13 ? G OLC 1   C13 
20 1 N 1 A OLC 1205 ? C14 ? G OLC 1   C14 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 20  ? A THR 1   
2  1 Y 1 A THR 21  ? A THR 2   
3  1 Y 1 A MET 22  ? A MET 3   
4  1 Y 1 A ALA 23  ? A ALA 4   
5  1 Y 1 A SER 24  ? A SER 5   
6  1 Y 1 A PRO 25  ? A PRO 6   
7  1 Y 1 A GLN 26  ? A GLN 7   
8  1 Y 1 A LEU 27  ? A LEU 8   
9  1 Y 1 A PHE 168 ? A PHE 149 
10 1 Y 1 A MET 169 ? A MET 150 
11 1 Y 1 A GLN 170 ? A GLN 151 
12 1 Y 1 A GLN 171 ? A GLN 152 
13 1 Y 1 A THR 172 ? A THR 153 
14 1 Y 1 A SER 173 ? A SER 154 
15 1 Y 1 A VAL 174 ? A VAL 155 
16 1 Y 1 A ARG 486 ? A ARG 444 
17 1 Y 1 A SER 487 ? A SER 445 
18 1 Y 1 A GLY 488 ? A GLY 446 
19 1 Y 1 A GLU 489 ? A GLU 447 
20 1 Y 1 A ASN 490 ? A ASN 448 
21 1 Y 1 A LEU 491 ? A LEU 449 
22 1 Y 1 A TYR 492 ? A TYR 450 
23 1 Y 1 A PHE 493 ? A PHE 451 
24 1 Y 1 A GLN 494 ? A GLN 452 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(3E)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' 5EH 
3 '(3Z)-3-(dibenzo[b,e]oxepin-11(6H)-ylidene)-N,N-dimethylpropan-1-amine' D7V 
4 'PHOSPHATE ION'                                                         PO4 
5 '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate'                        OLC 
6 water                                                                   HOH 
#