data_3S1R
# 
_entry.id   3S1R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3S1R         
NDB   NA1124       
RCSB  RCSB065651   
WWPDB D_1000065651 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3S1M . unspecified 
PDB 3RZO . unspecified 
PDB 3S1N . unspecified 
PDB 3S1Q . unspecified 
PDB 3S2D . unspecified 
PDB 3S2H . unspecified 
PDB 3RZD . unspecified 
PDB 3S14 . unspecified 
PDB 3S15 . unspecified 
PDB 3S16 . unspecified 
PDB 3S17 . unspecified 
# 
_pdbx_database_status.entry_id                        3S1R 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-16 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, X.'        1 
'Bushnell, D.A.' 2 
'Silva, D.A.'    3 
'Huang, X.'      4 
'Kornberg, R.D.' 5 
# 
_citation.id                        primary 
_citation.title                     'Initiation complex structure and promoter proofreading.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            333 
_citation.page_first                633 
_citation.page_last                 637 
_citation.year                      2011 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21798951 
_citation.pdbx_database_id_DOI      10.1126/science.1206629 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, X.'        1 
primary 'Bushnell, D.A.' 2 
primary 'Silva, D.A.'    3 
primary 'Huang, X.'      4 
primary 'Kornberg, R.D.' 5 
# 
_cell.entry_id           3S1R 
_cell.length_a           160.670 
_cell.length_b           221.320 
_cell.length_c           193.210 
_cell.angle_alpha        90.000 
_cell.angle_beta         98.310 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3S1R 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.Int_Tables_number                5 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                                                           
191821.578 1 2.7.7.6 ? ? ?                     
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                                                           
138937.297 1 2.7.7.6 ? ? ?                     
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                                                           
35330.457  1 ?       ? ? ?                     
4  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1'                                            
25117.094  1 ?       ? ? ?                     
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2'                                            
17931.834  1 ?       ? ? ?                     
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3'                                            
16525.363  1 ?       ? ? ?                     
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                                                           
14308.161  1 ?       ? ? ?                     
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5'                                            
8290.732   1 ?       ? ? ?                     
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'                                                          
13633.493  1 ?       ? ? ?                     
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4'                                            
7729.969   1 ?       ? ? ?                     
11 polymer     syn 
;RNA (5'-R(*AP*GP*AP*GP*G*)-3')
;
1649.072   1 ?       ? ? 
;3'-deoxy RNA (5-nt)
;
12 polymer     syn 
;DNA (5'-D(*CP*TP*AP*CP*CP*GP*AP*TP*AP*AP*GP*CP*AP*GP*AP*CP*GP*AP*TP*CP*CP*TP*CP*TP*CP*GP*AP*TP*G)-3')
;
8863.724   1 ?       ? ? 'Template DNA'        
13 non-polymer syn 'ZINC ION'                                                                                              65.409 
8 ?       ? ? ?                     
14 non-polymer syn 'MAGNESIUM ION'                                                                                         24.305 
1 ?       ? ? ?                     
15 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                                                             523.180 
1 ?       ? ? ?                     
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA polymerase II subunit 1, RNA polymerase II subunit B1, DNA-directed RNA polymerase III largest subunit, RNA polymerase II subunit B220
;
2  'RNA polymerase II subunit 2, B150, DNA-directed RNA polymerase II 140 kDa polypeptide' 
3  'RNA polymerase II subunit 3, RNA polymerase II subunit B3, B44.5, DNA-directed RNA polymerase II 45 kDa polypeptide' 
4  'RNA polymerases I, II, and III subunit ABC1, ABC27, DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide' 
5  'RNA polymerases I, II, and III subunit ABC2, ABC23, DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide' 
6  
'RNA polymerases I, II, and III subunit ABC3, ABC14.4, ABC14.5, DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide' 
7  
'RNA polymerase II subunit B9, B12.6, DNA-directed RNA polymerase II 14.2 kDa polypeptide, DNA-directed RNA polymerase II subunit 9' 
8  
'RNA polymerases I, II, and III subunit ABC5, ABC10-beta, ABC8, DNA-directed RNA polymerases I, II, and III 8.3 kDa polypeptide' 
9  'RNA polymerase II subunit B11, B13.6, DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
10 'RNA polymerases I, II, and III subunit ABC4, ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no 
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no 
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
5  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
6  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
7  'polypeptide(L)'        no no 
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
8  'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
9  'polypeptide(L)'        no no 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
10 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
11 polyribonucleotide      no no AGAGG AGAGG R ? 
12 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DC)(DC)(DG)(DA)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DA)(DC)(DG)(DA)(DT)(DC)
(DC)(DT)(DC)(DT)(DC)(DG)(DA)(DT)(DG)
;
CTACCGATAAGCAGACGATCCTCTCGATG T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASP n 
4  3    GLN n 
4  4    GLU n 
4  5    ASN n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ILE n 
4  10   SER n 
4  11   ARG n 
4  12   LEU n 
4  13   TRP n 
4  14   ARG n 
4  15   ALA n 
4  16   PHE n 
4  17   ARG n 
4  18   THR n 
4  19   VAL n 
4  20   LYS n 
4  21   GLU n 
4  22   MET n 
4  23   VAL n 
4  24   LYS n 
4  25   ASP n 
4  26   ARG n 
4  27   GLY n 
4  28   TYR n 
4  29   PHE n 
4  30   ILE n 
4  31   THR n 
4  32   GLN n 
4  33   GLU n 
4  34   GLU n 
4  35   VAL n 
4  36   GLU n 
4  37   LEU n 
4  38   PRO n 
4  39   LEU n 
4  40   GLU n 
4  41   ASP n 
4  42   PHE n 
4  43   LYS n 
4  44   ALA n 
4  45   LYS n 
4  46   TYR n 
4  47   CYS n 
4  48   ASP n 
4  49   SER n 
4  50   MET n 
4  51   GLY n 
4  52   ARG n 
4  53   PRO n 
4  54   GLN n 
4  55   ARG n 
4  56   LYS n 
4  57   MET n 
4  58   MET n 
4  59   SER n 
4  60   PHE n 
4  61   GLN n 
4  62   ALA n 
4  63   ASN n 
4  64   PRO n 
4  65   THR n 
4  66   GLU n 
4  67   GLU n 
4  68   SER n 
4  69   ILE n 
4  70   SER n 
4  71   LYS n 
4  72   PHE n 
4  73   PRO n 
4  74   ASP n 
4  75   MET n 
4  76   GLY n 
4  77   SER n 
4  78   LEU n 
4  79   TRP n 
4  80   VAL n 
4  81   GLU n 
4  82   PHE n 
4  83   CYS n 
4  84   ASP n 
4  85   GLU n 
4  86   PRO n 
4  87   SER n 
4  88   VAL n 
4  89   GLY n 
4  90   VAL n 
4  91   LYS n 
4  92   THR n 
4  93   MET n 
4  94   LYS n 
4  95   THR n 
4  96   PHE n 
4  97   VAL n 
4  98   ILE n 
4  99   HIS n 
4  100  ILE n 
4  101  GLN n 
4  102  GLU n 
4  103  LYS n 
4  104  ASN n 
4  105  PHE n 
4  106  GLN n 
4  107  THR n 
4  108  GLY n 
4  109  ILE n 
4  110  PHE n 
4  111  VAL n 
4  112  TYR n 
4  113  GLN n 
4  114  ASN n 
4  115  ASN n 
4  116  ILE n 
4  117  THR n 
4  118  PRO n 
4  119  SER n 
4  120  ALA n 
4  121  MET n 
4  122  LYS n 
4  123  LEU n 
4  124  VAL n 
4  125  PRO n 
4  126  SER n 
4  127  ILE n 
4  128  PRO n 
4  129  PRO n 
4  130  ALA n 
4  131  THR n 
4  132  ILE n 
4  133  GLU n 
4  134  THR n 
4  135  PHE n 
4  136  ASN n 
4  137  GLU n 
4  138  ALA n 
4  139  ALA n 
4  140  LEU n 
4  141  VAL n 
4  142  VAL n 
4  143  ASN n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  HIS n 
4  148  GLU n 
4  149  LEU n 
4  150  VAL n 
4  151  PRO n 
4  152  LYS n 
4  153  HIS n 
4  154  ILE n 
4  155  ARG n 
4  156  LEU n 
4  157  SER n 
4  158  SER n 
4  159  ASP n 
4  160  GLU n 
4  161  LYS n 
4  162  ARG n 
4  163  GLU n 
4  164  LEU n 
4  165  LEU n 
4  166  LYS n 
4  167  ARG n 
4  168  TYR n 
4  169  ARG n 
4  170  LEU n 
4  171  LYS n 
4  172  GLU n 
4  173  SER n 
4  174  GLN n 
4  175  LEU n 
4  176  PRO n 
4  177  ARG n 
4  178  ILE n 
4  179  GLN n 
4  180  ARG n 
4  181  ALA n 
4  182  ASP n 
4  183  PRO n 
4  184  VAL n 
4  185  ALA n 
4  186  LEU n 
4  187  TYR n 
4  188  LEU n 
4  189  GLY n 
4  190  LEU n 
4  191  LYS n 
4  192  ARG n 
4  193  GLY n 
4  194  GLU n 
4  195  VAL n 
4  196  VAL n 
4  197  LYS n 
4  198  ILE n 
4  199  ILE n 
4  200  ARG n 
4  201  LYS n 
4  202  SER n 
4  203  GLU n 
4  204  THR n 
4  205  SER n 
4  206  GLY n 
4  207  ARG n 
4  208  TYR n 
4  209  ALA n 
4  210  SER n 
4  211  TYR n 
4  212  ARG n 
4  213  ILE n 
4  214  CYS n 
4  215  MET n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    TYR n 
5  5    GLU n 
5  6    GLU n 
5  7    ALA n 
5  8    PHE n 
5  9    ASN n 
5  10   ASP n 
5  11   GLY n 
5  12   ASN n 
5  13   GLU n 
5  14   ASN n 
5  15   PHE n 
5  16   GLU n 
5  17   ASP n 
5  18   PHE n 
5  19   ASP n 
5  20   VAL n 
5  21   GLU n 
5  22   HIS n 
5  23   PHE n 
5  24   SER n 
5  25   ASP n 
5  26   GLU n 
5  27   GLU n 
5  28   THR n 
5  29   TYR n 
5  30   GLU n 
5  31   GLU n 
5  32   LYS n 
5  33   PRO n 
5  34   GLN n 
5  35   PHE n 
5  36   LYS n 
5  37   ASP n 
5  38   GLY n 
5  39   GLU n 
5  40   THR n 
5  41   THR n 
5  42   ASP n 
5  43   ALA n 
5  44   ASN n 
5  45   GLY n 
5  46   LYS n 
5  47   THR n 
5  48   ILE n 
5  49   VAL n 
5  50   THR n 
5  51   GLY n 
5  52   GLY n 
5  53   ASN n 
5  54   GLY n 
5  55   PRO n 
5  56   GLU n 
5  57   ASP n 
5  58   PHE n 
5  59   GLN n 
5  60   GLN n 
5  61   HIS n 
5  62   GLU n 
5  63   GLN n 
5  64   ILE n 
5  65   ARG n 
5  66   ARG n 
5  67   LYS n 
5  68   THR n 
5  69   LEU n 
5  70   LYS n 
5  71   GLU n 
5  72   LYS n 
5  73   ALA n 
5  74   ILE n 
5  75   PRO n 
5  76   LYS n 
5  77   ASP n 
5  78   GLN n 
5  79   ARG n 
5  80   ALA n 
5  81   THR n 
5  82   THR n 
5  83   PRO n 
5  84   TYR n 
5  85   MET n 
5  86   THR n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ARG n 
5  91   ALA n 
5  92   ARG n 
5  93   ILE n 
5  94   LEU n 
5  95   GLY n 
5  96   THR n 
5  97   ARG n 
5  98   ALA n 
5  99   LEU n 
5  100  GLN n 
5  101  ILE n 
5  102  SER n 
5  103  MET n 
5  104  ASN n 
5  105  ALA n 
5  106  PRO n 
5  107  VAL n 
5  108  PHE n 
5  109  VAL n 
5  110  ASP n 
5  111  LEU n 
5  112  GLU n 
5  113  GLY n 
5  114  GLU n 
5  115  THR n 
5  116  ASP n 
5  117  PRO n 
5  118  LEU n 
5  119  ARG n 
5  120  ILE n 
5  121  ALA n 
5  122  MET n 
5  123  LYS n 
5  124  GLU n 
5  125  LEU n 
5  126  ALA n 
5  127  GLU n 
5  128  LYS n 
5  129  LYS n 
5  130  ILE n 
5  131  PRO n 
5  132  LEU n 
5  133  VAL n 
5  134  ILE n 
5  135  ARG n 
5  136  ARG n 
5  137  TYR n 
5  138  LEU n 
5  139  PRO n 
5  140  ASP n 
5  141  GLY n 
5  142  SER n 
5  143  PHE n 
5  144  GLU n 
5  145  ASP n 
5  146  TRP n 
5  147  SER n 
5  148  VAL n 
5  149  GLU n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  VAL n 
5  154  ASP n 
5  155  LEU n 
6  1    MET n 
6  2    SER n 
6  3    ASN n 
6  4    THR n 
6  5    LEU n 
6  6    PHE n 
6  7    ASP n 
6  8    ASP n 
6  9    ILE n 
6  10   PHE n 
6  11   GLN n 
6  12   VAL n 
6  13   SER n 
6  14   GLU n 
6  15   VAL n 
6  16   ASP n 
6  17   PRO n 
6  18   GLY n 
6  19   ARG n 
6  20   TYR n 
6  21   ASN n 
6  22   LYS n 
6  23   VAL n 
6  24   CYS n 
6  25   ARG n 
6  26   ILE n 
6  27   GLU n 
6  28   ALA n 
6  29   ALA n 
6  30   SER n 
6  31   THR n 
6  32   THR n 
6  33   GLN n 
6  34   ASP n 
6  35   GLN n 
6  36   CYS n 
6  37   LYS n 
6  38   LEU n 
6  39   THR n 
6  40   LEU n 
6  41   ASP n 
6  42   ILE n 
6  43   ASN n 
6  44   VAL n 
6  45   GLU n 
6  46   LEU n 
6  47   PHE n 
6  48   PRO n 
6  49   VAL n 
6  50   ALA n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   SER n 
6  55   LEU n 
6  56   THR n 
6  57   VAL n 
6  58   THR n 
6  59   ILE n 
6  60   ALA n 
6  61   SER n 
6  62   SER n 
6  63   LEU n 
6  64   ASN n 
6  65   LEU n 
6  66   GLU n 
6  67   ASP n 
6  68   THR n 
6  69   PRO n 
6  70   ALA n 
6  71   ASN n 
6  72   ASP n 
6  73   SER n 
6  74   SER n 
6  75   ALA n 
6  76   THR n 
6  77   ARG n 
6  78   SER n 
6  79   TRP n 
6  80   ARG n 
6  81   PRO n 
6  82   PRO n 
6  83   GLN n 
6  84   ALA n 
6  85   GLY n 
6  86   ASP n 
6  87   ARG n 
6  88   SER n 
6  89   LEU n 
6  90   ALA n 
6  91   ASP n 
6  92   ASP n 
6  93   TYR n 
6  94   ASP n 
6  95   TYR n 
6  96   VAL n 
6  97   MET n 
6  98   TYR n 
6  99   GLY n 
6  100  THR n 
6  101  ALA n 
6  102  TYR n 
6  103  LYS n 
6  104  PHE n 
6  105  GLU n 
6  106  GLU n 
6  107  VAL n 
6  108  SER n 
6  109  LYS n 
6  110  ASP n 
6  111  LEU n 
6  112  ILE n 
6  113  ALA n 
6  114  VAL n 
6  115  TYR n 
6  116  TYR n 
6  117  SER n 
6  118  PHE n 
6  119  GLY n 
6  120  GLY n 
6  121  LEU n 
6  122  LEU n 
6  123  MET n 
6  124  ARG n 
6  125  LEU n 
6  126  GLU n 
6  127  GLY n 
6  128  ASN n 
6  129  TYR n 
6  130  ARG n 
6  131  ASN n 
6  132  LEU n 
6  133  ASN n 
6  134  ASN n 
6  135  LEU n 
6  136  LYS n 
6  137  GLN n 
6  138  GLU n 
6  139  ASN n 
6  140  ALA n 
6  141  TYR n 
6  142  LEU n 
6  143  LEU n 
6  144  ILE n 
6  145  ARG n 
6  146  ARG n 
7  1    MET n 
7  2    THR n 
7  3    THR n 
7  4    PHE n 
7  5    ARG n 
7  6    PHE n 
7  7    CYS n 
7  8    ARG n 
7  9    ASP n 
7  10   CYS n 
7  11   ASN n 
7  12   ASN n 
7  13   MET n 
7  14   LEU n 
7  15   TYR n 
7  16   PRO n 
7  17   ARG n 
7  18   GLU n 
7  19   ASP n 
7  20   LYS n 
7  21   GLU n 
7  22   ASN n 
7  23   ASN n 
7  24   ARG n 
7  25   LEU n 
7  26   LEU n 
7  27   PHE n 
7  28   GLU n 
7  29   CYS n 
7  30   ARG n 
7  31   THR n 
7  32   CYS n 
7  33   SER n 
7  34   TYR n 
7  35   VAL n 
7  36   GLU n 
7  37   GLU n 
7  38   ALA n 
7  39   GLY n 
7  40   SER n 
7  41   PRO n 
7  42   LEU n 
7  43   VAL n 
7  44   TYR n 
7  45   ARG n 
7  46   HIS n 
7  47   GLU n 
7  48   LEU n 
7  49   ILE n 
7  50   THR n 
7  51   ASN n 
7  52   ILE n 
7  53   GLY n 
7  54   GLU n 
7  55   THR n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   VAL n 
7  60   GLN n 
7  61   ASP n 
7  62   ILE n 
7  63   GLY n 
7  64   SER n 
7  65   ASP n 
7  66   PRO n 
7  67   THR n 
7  68   LEU n 
7  69   PRO n 
7  70   ARG n 
7  71   SER n 
7  72   ASP n 
7  73   ARG n 
7  74   GLU n 
7  75   CYS n 
7  76   PRO n 
7  77   LYS n 
7  78   CYS n 
7  79   HIS n 
7  80   SER n 
7  81   ARG n 
7  82   GLU n 
7  83   ASN n 
7  84   VAL n 
7  85   PHE n 
7  86   PHE n 
7  87   GLN n 
7  88   SER n 
7  89   GLN n 
7  90   GLN n 
7  91   ARG n 
7  92   ARG n 
7  93   LYS n 
7  94   ASP n 
7  95   THR n 
7  96   SER n 
7  97   MET n 
7  98   VAL n 
7  99   LEU n 
7  100  PHE n 
7  101  PHE n 
7  102  VAL n 
7  103  CYS n 
7  104  LEU n 
7  105  SER n 
7  106  CYS n 
7  107  SER n 
7  108  HIS n 
7  109  ILE n 
7  110  PHE n 
7  111  THR n 
7  112  SER n 
7  113  ASP n 
7  114  GLN n 
7  115  LYS n 
7  116  ASN n 
7  117  LYS n 
7  118  ARG n 
7  119  THR n 
7  120  GLN n 
7  121  PHE n 
7  122  SER n 
8  1    MET n 
8  2    ILE n 
8  3    VAL n 
8  4    PRO n 
8  5    VAL n 
8  6    ARG n 
8  7    CYS n 
8  8    PHE n 
8  9    SER n 
8  10   CYS n 
8  11   GLY n 
8  12   LYS n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   ASP n 
8  17   LYS n 
8  18   TRP n 
8  19   GLU n 
8  20   SER n 
8  21   TYR n 
8  22   LEU n 
8  23   ASN n 
8  24   LEU n 
8  25   LEU n 
8  26   GLN n 
8  27   GLU n 
8  28   ASP n 
8  29   GLU n 
8  30   LEU n 
8  31   ASP n 
8  32   GLU n 
8  33   GLY n 
8  34   THR n 
8  35   ALA n 
8  36   LEU n 
8  37   SER n 
8  38   ARG n 
8  39   LEU n 
8  40   GLY n 
8  41   LEU n 
8  42   LYS n 
8  43   ARG n 
8  44   TYR n 
8  45   CYS n 
8  46   CYS n 
8  47   ARG n 
8  48   ARG n 
8  49   MET n 
8  50   ILE n 
8  51   LEU n 
8  52   THR n 
8  53   HIS n 
8  54   VAL n 
8  55   ASP n 
8  56   LEU n 
8  57   ILE n 
8  58   GLU n 
8  59   LYS n 
8  60   PHE n 
8  61   LEU n 
8  62   ARG n 
8  63   TYR n 
8  64   ASN n 
8  65   PRO n 
8  66   LEU n 
8  67   GLU n 
8  68   LYS n 
8  69   ARG n 
8  70   ASP n 
9  1    MET n 
9  2    ASN n 
9  3    ALA n 
9  4    PRO n 
9  5    ASP n 
9  6    ARG n 
9  7    PHE n 
9  8    GLU n 
9  9    LEU n 
9  10   PHE n 
9  11   LEU n 
9  12   LEU n 
9  13   GLY n 
9  14   GLU n 
9  15   GLY n 
9  16   GLU n 
9  17   SER n 
9  18   LYS n 
9  19   LEU n 
9  20   LYS n 
9  21   ILE n 
9  22   ASP n 
9  23   PRO n 
9  24   ASP n 
9  25   THR n 
9  26   LYS n 
9  27   ALA n 
9  28   PRO n 
9  29   ASN n 
9  30   ALA n 
9  31   VAL n 
9  32   VAL n 
9  33   ILE n 
9  34   THR n 
9  35   PHE n 
9  36   GLU n 
9  37   LYS n 
9  38   GLU n 
9  39   ASP n 
9  40   HIS n 
9  41   THR n 
9  42   LEU n 
9  43   GLY n 
9  44   ASN n 
9  45   LEU n 
9  46   ILE n 
9  47   ARG n 
9  48   ALA n 
9  49   GLU n 
9  50   LEU n 
9  51   LEU n 
9  52   ASN n 
9  53   ASP n 
9  54   ARG n 
9  55   LYS n 
9  56   VAL n 
9  57   LEU n 
9  58   PHE n 
9  59   ALA n 
9  60   ALA n 
9  61   TYR n 
9  62   LYS n 
9  63   VAL n 
9  64   GLU n 
9  65   HIS n 
9  66   PRO n 
9  67   PHE n 
9  68   PHE n 
9  69   ALA n 
9  70   ARG n 
9  71   PHE n 
9  72   LYS n 
9  73   LEU n 
9  74   ARG n 
9  75   ILE n 
9  76   GLN n 
9  77   THR n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TYR n 
9  82   ASP n 
9  83   PRO n 
9  84   LYS n 
9  85   ASP n 
9  86   ALA n 
9  87   LEU n 
9  88   LYS n 
9  89   ASN n 
9  90   ALA n 
9  91   CYS n 
9  92   ASN n 
9  93   SER n 
9  94   ILE n 
9  95   ILE n 
9  96   ASN n 
9  97   LYS n 
9  98   LEU n 
9  99   GLY n 
9  100  ALA n 
9  101  LEU n 
9  102  LYS n 
9  103  THR n 
9  104  ASN n 
9  105  PHE n 
9  106  GLU n 
9  107  THR n 
9  108  GLU n 
9  109  TRP n 
9  110  ASN n 
9  111  LEU n 
9  112  GLN n 
9  113  THR n 
9  114  LEU n 
9  115  ALA n 
9  116  ALA n 
9  117  ASP n 
9  118  ASP n 
9  119  ALA n 
9  120  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ARG n 
10 4    GLU n 
10 5    GLY n 
10 6    PHE n 
10 7    GLN n 
10 8    ILE n 
10 9    PRO n 
10 10   THR n 
10 11   ASN n 
10 12   LEU n 
10 13   ASP n 
10 14   ALA n 
10 15   ALA n 
10 16   ALA n 
10 17   ALA n 
10 18   GLY n 
10 19   THR n 
10 20   SER n 
10 21   GLN n 
10 22   ALA n 
10 23   ARG n 
10 24   THR n 
10 25   ALA n 
10 26   THR n 
10 27   LEU n 
10 28   LYS n 
10 29   TYR n 
10 30   ILE n 
10 31   CYS n 
10 32   ALA n 
10 33   GLU n 
10 34   CYS n 
10 35   SER n 
10 36   SER n 
10 37   LYS n 
10 38   LEU n 
10 39   SER n 
10 40   LEU n 
10 41   SER n 
10 42   ARG n 
10 43   THR n 
10 44   ASP n 
10 45   ALA n 
10 46   VAL n 
10 47   ARG n 
10 48   CYS n 
10 49   LYS n 
10 50   ASP n 
10 51   CYS n 
10 52   GLY n 
10 53   HIS n 
10 54   ARG n 
10 55   ILE n 
10 56   LEU n 
10 57   LEU n 
10 58   LYS n 
10 59   ALA n 
10 60   ARG n 
10 61   THR n 
10 62   LYS n 
10 63   ARG n 
10 64   LEU n 
10 65   VAL n 
10 66   GLN n 
10 67   PHE n 
10 68   GLU n 
10 69   ALA n 
10 70   ARG n 
11 1    A   n 
11 2    G   n 
11 3    A   n 
11 4    G   n 
11 5    G   n 
12 1    DC  n 
12 2    DT  n 
12 3    DA  n 
12 4    DC  n 
12 5    DC  n 
12 6    DG  n 
12 7    DA  n 
12 8    DT  n 
12 9    DA  n 
12 10   DA  n 
12 11   DG  n 
12 12   DC  n 
12 13   DA  n 
12 14   DG  n 
12 15   DA  n 
12 16   DC  n 
12 17   DG  n 
12 18   DA  n 
12 19   DT  n 
12 20   DC  n 
12 21   DC  n 
12 22   DT  n 
12 23   DC  n 
12 24   DT  n 
12 25   DC  n 
12 26   DG  n 
12 27   DA  n 
12 28   DT  n 
12 29   DG  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? CB010 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  P04050 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 ? 
2  UNP RPB2_YEAST  P08518 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 ? 
3  UNP RPB3_YEAST  P16370 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 ? 
4  UNP RPAB1_YEAST P20434 4  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 ? 
5  UNP RPAB2_YEAST P20435 5  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 ? 
6  UNP RPAB3_YEAST P20436 6  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 ? 
7  UNP RPB9_YEAST  P27999 7  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 ? 
8  UNP RPAB5_YEAST P22139 8  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 ? 
9  UNP RPB11_YEAST P38902 9  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 ? 
10 UNP RPAB4_YEAST P40422 10 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 ? 
11 PDB 3S1R        3S1R   11 AGAGG 1 ? 
12 PDB 3S1R        3S1R   12 CTACCGATAAGCAGACGATCCTCTCGATG 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3S1R A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  3S1R B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  3S1R C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  3S1R E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  3S1R F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  3S1R H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  3S1R I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  3S1R J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  3S1R K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 3S1R L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 3S1R R 1 ? 5    ? 3S1R   6 ? 10   ? 6 10   
12 12 3S1R T 1 ? 29   ? 3S1R   1 ? 29   ? 1 29   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"          ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          3S1R 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.54 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   65.25 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'390mM (NH4)2HPO4/NaH2PO4, pH 6.0, 50mM dioxane, 9-11% PEG 6.000, 15mM DTT, vapor diffusion, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
# 
_reflns.entry_id                     3S1R 
_reflns.d_resolution_high            3.200 
_reflns.number_obs                   108840 
_reflns.pdbx_Rmerge_I_obs            0.164 
_reflns.pdbx_netI_over_sigmaI        9.260 
_reflns.percent_possible_obs         99.400 
_reflns.B_iso_Wilson_estimate        61.680 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.973 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
3.200  3.290  28762 ? 7741 0.011 1.7  ? ? ? ? ? 95.500  1  1 
3.290  3.380  30067 ? 7852 0.011 2.2  ? ? ? ? ? 99.800  2  1 
3.380  3.470  29150 ? 7628 0.011 2.6  ? ? ? ? ? 99.800  3  1 
3.470  3.580  28577 ? 7469 0.011 3.3  ? ? ? ? ? 99.900  4  1 
3.580  3.700  27465 ? 7189 0.011 4.1  ? ? ? ? ? 99.800  5  1 
3.700  3.830  26680 ? 6960 0.011 5.0  ? ? ? ? ? 99.700  6  1 
3.830  3.970  25673 ? 6710 0.011 6.0  ? ? ? ? ? 99.900  7  1 
3.970  4.140  24881 ? 6486 0.011 7.6  ? ? ? ? ? 99.900  8  1 
4.140  4.320  23711 ? 6186 0.011 9.1  ? ? ? ? ? 99.800  9  1 
4.320  4.530  22739 ? 5938 0.011 10.8 ? ? ? ? ? 99.800  10 1 
4.530  4.770  21641 ? 5643 0.011 11.8 ? ? ? ? ? 99.900  11 1 
4.770  5.060  20616 ? 5375 0.011 11.8 ? ? ? ? ? 99.800  12 1 
5.060  5.410  19165 ? 5006 0.011 11.1 ? ? ? ? ? 99.800  13 1 
5.410  5.850  17982 ? 4692 0.011 11.2 ? ? ? ? ? 100.000 14 1 
5.850  6.410  16487 ? 4296 0.011 11.8 ? ? ? ? ? 99.700  15 1 
6.410  7.160  15003 ? 3923 0.011 14.8 ? ? ? ? ? 99.700  16 1 
7.160  8.270  13077 ? 3433 0.011 22.5 ? ? ? ? ? 99.800  17 1 
8.270  10.130 11061 ? 2922 0.011 32.8 ? ? ? ? ? 99.800  18 1 
10.130 14.320 8503  ? 2262 0.011 39.8 ? ? ? ? ? 99.600  19 1 
14.320 ?      4104  ? 1129 0.011 42.6 ? ? ? ? ? 88.100  20 1 
# 
_refine.entry_id                                 3S1R 
_refine.ls_d_res_high                            3.2000 
_refine.ls_d_res_low                             29.9700 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_number_reflns_obs                     108690 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1793 
_refine.ls_R_factor_R_work                       0.1768 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2259 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_number_reflns_R_free                  5435 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               104.7597 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -36.3201 
_refine.aniso_B[2][2]                            14.8017 
_refine.aniso_B[3][3]                            21.5184 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            32.9215 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8933 
_refine.correlation_coeff_Fo_to_Fc_free          0.8638 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                289.070 
_refine.B_iso_min                                19.180 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3S1R 
_refine_analyze.Luzzati_coordinate_error_obs    0.659 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28292 
_refine_hist.pdbx_number_atoms_nucleic_acid   268 
_refine_hist.pdbx_number_atoms_ligand         41 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               28601 
_refine_hist.d_res_high                       3.2000 
_refine_hist.d_res_low                        29.9700 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
t_dihedral_angle_d        10541 ?      ? 2.000  SINUSOIDAL   'X-RAY DIFFRACTION' 
t_trig_c_planes           767   ?      ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_gen_planes              4131  ?      ? 5.000  HARMONIC     'X-RAY DIFFRACTION' 
t_it                      29146 ?      ? 20.000 HARMONIC     'X-RAY DIFFRACTION' 
t_nbd                     0     ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_improper_torsion        ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_pseud_angle             ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_chiral_improper_torsion 3839  ?      ? 5.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_sum_occupancies         ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_utility_distance        32    ?      ? 1.000  HARMONIC     'X-RAY DIFFRACTION' 
t_utility_angle           45    ?      ? 1.000  HARMONIC     'X-RAY DIFFRACTION' 
t_utility_torsion         ?     ?      ? ?      ?            'X-RAY DIFFRACTION' 
t_ideal_dist_contact      34128 ?      ? 4.000  SEMIHARMONIC 'X-RAY DIFFRACTION' 
t_bond_d                  29146 0.010  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_angle_deg               39419 1.300  ? 2.000  HARMONIC     'X-RAY DIFFRACTION' 
t_omega_torsion           ?     2.680  ? ?      ?            'X-RAY DIFFRACTION' 
t_other_torsion           ?     23.810 ? ?      ?            'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       3.2000 
_refine_ls_shell.d_res_low                        3.2800 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.number_reflns_R_work             6960 
_refine_ls_shell.R_factor_all                     0.2608 
_refine_ls_shell.R_factor_R_work                  0.2581 
_refine_ls_shell.R_factor_R_free                  0.3117 
_refine_ls_shell.percent_reflns_R_free            5.0100 
_refine_ls_shell.number_reflns_R_free             367 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                7327 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3S1R 
_struct.title                     
;RNA Polymerase II Initiation Complex with a 5-nt 3'-deoxy RNA soaked with GTP
;
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase II subunit RPB1 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB2 (E.C.2.7.7.6), DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/DNA/RNA complex
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3S1R 
_struct_keywords.text            'RNA polymerase II, initiation complex, TRANSCRIPTION-RNA-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/RNA/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 13 ? 
O N N 14 ? 
P N N 13 ? 
Q N N 13 ? 
R N N 13 ? 
S N N 13 ? 
T N N 13 ? 
U N N 13 ? 
V N N 15 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? GLU A 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   3   ASN A 119  ? ARG A 123  ? ASN A 119  ARG A 123  5 ? 5  
HELX_P HELX_P4   4   LYS A 132  ? LYS A 143  ? LYS A 132  LYS A 143  1 ? 12 
HELX_P HELX_P5   5   THR A 204  ? LYS A 212  ? THR A 204  LYS A 212  1 ? 9  
HELX_P HELX_P6   6   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P7   7   ASP A 260  ? HIS A 281  ? ASP A 260  HIS A 281  1 ? 22 
HELX_P HELX_P8   8   ILE A 289  ? TYR A 303  ? ILE A 289  TYR A 303  1 ? 15 
HELX_P HELX_P9   9   SER A 324  ? LEU A 329  ? SER A 324  LEU A 329  1 ? 6  
HELX_P HELX_P10  10  LYS A 368  ? LEU A 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P11  11  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P12  12  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P13  13  ASN A 471  ? SER A 473  ? ASN A 471  SER A 473  5 ? 3  
HELX_P HELX_P14  14  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P15  15  SER A 494  ? LEU A 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P16  16  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P17  17  VAL A 524  ? LEU A 536  ? VAL A 524  LEU A 536  1 ? 13 
HELX_P HELX_P18  18  LEU A 543  ? VAL A 553  ? LEU A 543  VAL A 553  1 ? 11 
HELX_P HELX_P19  19  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P20  20  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P21  21  GLY A 628  ? LYS A 637  ? GLY A 628  LYS A 637  1 ? 10 
HELX_P HELX_P22  22  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P23  23  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P24  24  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P25  25  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P26  26  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P27  27  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P28  28  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P29  29  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P30  30  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P31  31  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P32  32  ASP A 909  ? LEU A 913  ? ASP A 909  LEU A 913  5 ? 5  
HELX_P HELX_P33  33  GLY A 916  ? LEU A 920  ? GLY A 916  LEU A 920  5 ? 5  
HELX_P HELX_P34  34  LEU A 925  ? PHE A 947  ? LEU A 925  PHE A 947  1 ? 23 
HELX_P HELX_P35  35  ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P36  36  THR A 982  ? LEU A 997  ? THR A 982  LEU A 997  1 ? 16 
HELX_P HELX_P37  37  ASN A 1004 ? VAL A 1015 ? ASN A 1004 VAL A 1015 1 ? 12 
HELX_P HELX_P38  38  VAL A 1015 ? LEU A 1026 ? VAL A 1015 LEU A 1026 1 ? 12 
HELX_P HELX_P39  39  ALA A 1027 ? GLN A 1033 ? ALA A 1027 GLN A 1033 1 ? 7  
HELX_P HELX_P40  40  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P41  41  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P42  42  SER A 1096 ? VAL A 1107 ? SER A 1096 VAL A 1107 1 ? 12 
HELX_P HELX_P43  43  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  44  ASP A 1166 ? LEU A 1172 ? ASP A 1166 LEU A 1172 1 ? 7  
HELX_P HELX_P45  45  ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P46  46  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P47  47  GLU A 1256 ? ASN A 1270 ? GLU A 1256 ASN A 1270 1 ? 15 
HELX_P HELX_P48  48  ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P49  49  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P50  50  GLY A 1340 ? GLY A 1360 ? GLY A 1340 GLY A 1360 1 ? 21 
HELX_P HELX_P51  51  ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P52  52  GLY A 1395 ? CYS A 1400 ? GLY A 1395 CYS A 1400 1 ? 6  
HELX_P HELX_P53  53  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P54  54  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P55  55  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P56  56  ASP B 29   ? GLU B 40   ? ASP B 29   GLU B 40   1 ? 12 
HELX_P HELX_P57  57  VAL B 44   ? CYS B 64   ? VAL B 44   CYS B 64   1 ? 21 
HELX_P HELX_P58  58  TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P59  59  CYS B 179  ? ALA B 184  ? CYS B 179  ALA B 184  5 ? 6  
HELX_P HELX_P60  60  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P61  61  ILE B 282  ? ALA B 288  ? ILE B 282  ALA B 288  1 ? 7  
HELX_P HELX_P62  62  PRO B 293  ? HIS B 300  ? PRO B 293  HIS B 300  1 ? 8  
HELX_P HELX_P63  63  ASP B 307  ? GLY B 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P64  64  ASP B 326  ? ILE B 334  ? ASP B 326  ILE B 334  1 ? 9  
HELX_P HELX_P65  65  GLU B 346  ? GLU B 359  ? GLU B 346  GLU B 359  1 ? 14 
HELX_P HELX_P66  66  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P67  67  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P68  68  LEU B 408  ? THR B 435  ? LEU B 408  THR B 435  1 ? 28 
HELX_P HELX_P69  69  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P70  70  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P71  71  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P72  72  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P73  73  GLU B 567  ? TYR B 569  ? GLU B 567  TYR B 569  5 ? 3  
HELX_P HELX_P74  74  VAL B 570  ? SER B 574  ? VAL B 570  SER B 574  5 ? 5  
HELX_P HELX_P75  75  ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P76  76  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P77  77  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P78  78  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P79  79  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P80  80  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P81  81  PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P82  82  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P83  83  ARG B 807  ? TYR B 811  ? ARG B 807  TYR B 811  5 ? 5  
HELX_P HELX_P84  84  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P85  85  ARG B 995  ? MET B 999  ? ARG B 995  MET B 999  5 ? 5  
HELX_P HELX_P86  86  PRO B 1014 ? ILE B 1017 ? PRO B 1014 ILE B 1017 5 ? 4  
HELX_P HELX_P87  87  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P88  88  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P89  89  MET B 1098 ? ILE B 1103 ? MET B 1098 ILE B 1103 1 ? 6  
HELX_P HELX_P90  90  GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P91  91  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P92  92  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P93  93  PRO B 1197 ? ALA B 1209 ? PRO B 1197 ALA B 1209 1 ? 13 
HELX_P HELX_P94  94  ASP C 26   ? ALA C 39   ? ASP C 26   ALA C 39   1 ? 14 
HELX_P HELX_P95  95  ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P96  96  ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P97  97  LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P98  98  HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P99  99  ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P100 100 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P101 101 PRO C 239  ? ASP C 268  ? PRO C 239  ASP C 268  1 ? 30 
HELX_P HELX_P102 102 GLU D 4    ? GLY D 27   ? GLU E 4    GLY E 27   1 ? 24 
HELX_P HELX_P103 103 THR D 31   ? LEU D 37   ? THR E 31   LEU E 37   1 ? 7  
HELX_P HELX_P104 104 PRO D 38   ? CYS D 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P105 105 GLN D 54   ? SER D 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P106 106 THR D 65   ? PHE D 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P107 107 VAL D 90   ? GLN D 101  ? VAL E 90   GLN E 101  1 ? 12 
HELX_P HELX_P108 108 THR D 117  ? LYS D 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P109 109 GLU D 137  ? VAL D 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P110 110 ASN D 143  ? HIS D 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P111 111 SER D 157  ? TYR D 168  ? SER E 157  TYR E 168  1 ? 12 
HELX_P HELX_P112 112 LYS D 171  ? LEU D 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P113 113 ASP D 182  ? LEU D 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P114 114 THR E 86   ? SER E 102  ? THR F 86   SER F 102  1 ? 17 
HELX_P HELX_P115 115 ASP E 116  ? GLU E 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P116 116 VAL G 59   ? ASP G 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P117 117 ASP H 16   ? GLU H 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P118 118 ASP H 31   ? LEU H 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P119 119 ARG H 43   ? THR H 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P120 120 LEU H 56   ? LEU H 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P121 121 ASP I 5    ? PHE I 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P122 122 ASP I 39   ? LEU I 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P123 123 ASP I 82   ? GLN I 112  ? ASP K 82   GLN K 112  1 ? 31 
HELX_P HELX_P124 124 SER J 41   ? ALA J 45   ? SER L 41   ALA L 45   5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 80   NE2 ? ? ? 1_555 N ZN .  ZN ? ? A HIS 80   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.165 ? 
metalc2  metalc ? ? A ASP 485  OD1 ? ? ? 1_555 O MG .  MG ? ? A ASP 485  A MG 2001 1_555 ? ? ? ? ? ? ?              2.244 ? 
metalc3  metalc ? ? G CYS 29   SG  ? ? ? 1_555 R ZN .  ZN ? ? I CYS 29   I ZN 203  1_555 ? ? ? ? ? ? ?              2.247 ? 
metalc4  metalc ? ? G CYS 103  SG  ? ? ? 1_555 S ZN .  ZN ? ? I CYS 103  I ZN 204  1_555 ? ? ? ? ? ? ?              2.248 ? 
metalc5  metalc ? ? C CYS 86   SG  ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 86   C ZN 319  1_555 ? ? ? ? ? ? ?              2.251 ? 
metalc6  metalc ? ? C CYS 92   SG  ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 92   C ZN 319  1_555 ? ? ? ? ? ? ?              2.260 ? 
metalc7  metalc ? ? G CYS 106  SG  ? ? ? 1_555 S ZN .  ZN ? ? I CYS 106  I ZN 204  1_555 ? ? ? ? ? ? ?              2.268 ? 
metalc8  metalc ? ? H CYS 10   SG  ? ? ? 1_555 T ZN .  ZN ? ? J CYS 10   J ZN 101  1_555 ? ? ? ? ? ? ?              2.275 ? 
metalc9  metalc ? ? H CYS 45   SG  ? ? ? 1_555 T ZN .  ZN ? ? J CYS 45   J ZN 101  1_555 ? ? ? ? ? ? ?              2.289 ? 
metalc10 metalc ? ? C CYS 95   SG  ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 95   C ZN 319  1_555 ? ? ? ? ? ? ?              2.294 ? 
metalc11 metalc ? ? C CYS 88   SG  ? ? ? 1_555 Q ZN .  ZN ? ? C CYS 88   C ZN 319  1_555 ? ? ? ? ? ? ?              2.298 ? 
metalc12 metalc ? ? J CYS 34   SG  ? ? ? 1_555 U ZN .  ZN ? ? L CYS 34   L ZN 105  1_555 ? ? ? ? ? ? ?              2.300 ? 
metalc13 metalc ? ? G CYS 78   SG  ? ? ? 1_555 S ZN .  ZN ? ? I CYS 78   I ZN 204  1_555 ? ? ? ? ? ? ?              2.303 ? 
metalc14 metalc ? ? G CYS 10   SG  ? ? ? 1_555 R ZN .  ZN ? ? I CYS 10   I ZN 203  1_555 ? ? ? ? ? ? ?              2.310 ? 
metalc15 metalc ? ? H CYS 7    SG  ? ? ? 1_555 T ZN .  ZN ? ? J CYS 7    J ZN 101  1_555 ? ? ? ? ? ? ?              2.316 ? 
metalc16 metalc ? ? A CYS 77   SG  ? ? ? 1_555 N ZN .  ZN ? ? A CYS 77   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.317 ? 
metalc17 metalc ? ? A CYS 107  SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 107  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.321 ? 
metalc18 metalc ? ? A CYS 167  SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 167  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.324 ? 
metalc19 metalc ? ? G CYS 7    SG  ? ? ? 1_555 R ZN .  ZN ? ? I CYS 7    I ZN 203  1_555 ? ? ? ? ? ? ?              2.335 ? 
metalc20 metalc ? ? B CYS 1166 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1166 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.343 ? 
metalc21 metalc ? ? H CYS 46   SG  ? ? ? 1_555 T ZN .  ZN ? ? J CYS 46   J ZN 101  1_555 ? ? ? ? ? ? ?              2.350 ? 
metalc22 metalc ? ? A CYS 110  SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 110  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.352 ? 
metalc23 metalc ? ? B CYS 1163 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1163 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.359 ? 
metalc24 metalc ? ? G CYS 75   SG  ? ? ? 1_555 S ZN .  ZN ? ? I CYS 75   I ZN 204  1_555 ? ? ? ? ? ? ?              2.393 ? 
metalc25 metalc ? ? A CYS 67   SG  ? ? ? 1_555 N ZN .  ZN ? ? A CYS 67   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.399 ? 
metalc26 metalc ? ? A CYS 148  SG  ? ? ? 1_555 M ZN .  ZN ? ? A CYS 148  A ZN 1734 1_555 ? ? ? ? ? ? ?              2.402 ? 
metalc27 metalc ? ? B CYS 1185 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1185 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.409 ? 
metalc28 metalc ? ? B CYS 1182 SG  ? ? ? 1_555 P ZN .  ZN ? ? B CYS 1182 B ZN 1307 1_555 ? ? ? ? ? ? ?              2.433 ? 
metalc29 metalc ? ? J CYS 51   SG  ? ? ? 1_555 U ZN .  ZN ? ? L CYS 51   L ZN 105  1_555 ? ? ? ? ? ? ?              2.440 ? 
metalc30 metalc ? ? J CYS 48   SG  ? ? ? 1_555 U ZN .  ZN ? ? L CYS 48   L ZN 105  1_555 ? ? ? ? ? ? ?              2.449 ? 
metalc31 metalc ? ? G CYS 32   SG  ? ? ? 1_555 R ZN .  ZN ? ? I CYS 32   I ZN 203  1_555 ? ? ? ? ? ? ?              2.465 ? 
metalc32 metalc ? ? J CYS 31   SG  ? ? ? 1_555 U ZN .  ZN ? ? L CYS 31   L ZN 105  1_555 ? ? ? ? ? ? ?              2.471 ? 
metalc33 metalc ? ? A ASP 481  OD1 ? ? ? 1_555 O MG .  MG ? ? A ASP 481  A MG 2001 1_555 ? ? ? ? ? ? ?              2.491 ? 
metalc34 metalc ? ? A CYS 70   SG  ? ? ? 1_555 N ZN .  ZN ? ? A CYS 70   A ZN 1735 1_555 ? ? ? ? ? ? ?              2.522 ? 
metalc35 metalc ? ? A ASP 483  OD2 ? ? ? 1_555 O MG .  MG ? ? A ASP 483  A MG 2001 1_555 ? ? ? ? ? ? ?              2.717 ? 
hydrog1  hydrog ? ? K A   1    N6  ? ? ? 1_555 L DC 23 N3 ? ? R A   6    T DC 23   1_555 ? ? ? ? ? ? 'A-DC MISPAIR' ?     ? 
hydrog2  hydrog ? ? K G   2    N1  ? ? ? 1_555 L DT 22 O2 ? ? R G   7    T DT 22   1_555 ? ? ? ? ? ? TYPE_28_PAIR   ?     ? 
hydrog3  hydrog ? ? K G   2    O6  ? ? ? 1_555 L DT 22 N3 ? ? R G   7    T DT 22   1_555 ? ? ? ? ? ? TYPE_28_PAIR   ?     ? 
hydrog4  hydrog ? ? K G   4    N1  ? ? ? 1_555 L DC 20 N3 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog5  hydrog ? ? K G   4    N2  ? ? ? 1_555 L DC 20 O2 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog6  hydrog ? ? K G   4    O6  ? ? ? 1_555 L DC 20 N4 ? ? R G   9    T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     ? 
hydrog7  hydrog ? ? K G   5    N2  ? ? ? 1_555 L DT 19 O2 ? ? R G   10   T DT 19   1_555 ? ? ? ? ? ? 'G-DT MISPAIR' ?     ? 
hydrog8  hydrog ? ? K G   5    N1  ? ? ? 1_555 L DC 20 N3 ? ? R G   10   T DC 20   1_555 ? ? ? ? ? ? 'G-DC PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASP 116  A . ? ASP 116  A GLU 117  A ? GLU 117  A 1 -0.68 
2  ARG 320  A . ? ARG 320  A PRO 321  A ? PRO 321  A 1 4.77  
3  GLN 447  A . ? GLN 447  A PRO 448  A ? PRO 448  A 1 2.23  
4  GLY 1123 A . ? GLY 1123 A HIS 1124 A ? HIS 1124 A 1 0.29  
5  ILE 140  B . ? ILE 140  B ASP 141  B ? ASP 141  B 1 -1.29 
6  LYS 345  B . ? LYS 345  B GLU 346  B ? GLU 346  B 1 2.67  
7  GLY 647  B . ? GLY 647  B HIS 648  B ? HIS 648  B 1 -8.86 
8  HIS 887  B . ? HIS 887  B GLY 888  B ? GLY 888  B 1 2.70  
9  PRO 128  D . ? PRO 128  E PRO 129  D ? PRO 129  E 1 0.96  
10 GLU 71   E . ? GLU 71   F LYS 72   E ? LYS 72   F 1 -0.27 
11 SER 2    F . ? SER 2    H ASN 3    F ? ASN 3    H 1 -3.21 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 8 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 3 ? 
J  ? 2 ? 
K  ? 2 ? 
L  ? 3 ? 
M  ? 2 ? 
N  ? 4 ? 
O  ? 2 ? 
P  ? 5 ? 
Q  ? 2 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 3 ? 
V  ? 4 ? 
W  ? 5 ? 
X  ? 3 ? 
Y  ? 4 ? 
Z  ? 5 ? 
AA ? 5 ? 
AB ? 2 ? 
AC ? 9 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 4 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 4 ? 
AM ? 9 ? 
AN ? 3 ? 
AO ? 3 ? 
AP ? 4 ? 
AQ ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? parallel      
F  6 7 ? anti-parallel 
F  7 8 ? parallel      
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? parallel      
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? parallel      
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? parallel      
Z  4 5 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? parallel      
AC 6 7 ? anti-parallel 
AC 7 8 ? parallel      
AC 8 9 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? parallel      
AJ 3 4 ? parallel      
AK 1 2 ? parallel      
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? anti-parallel 
AM 5 6 ? anti-parallel 
AM 6 7 ? anti-parallel 
AM 7 8 ? anti-parallel 
AM 8 9 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
A  2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
A  3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
B  1 GLY A 82   ? VAL A 90   ? GLY A 82   VAL A 90   
B  2 LEU A 236  ? VAL A 241  ? LEU A 236  VAL A 241  
C  1 ASP A 151  ? VAL A 152  ? ASP A 151  VAL A 152  
C  2 VAL A 162  ? SER A 163  ? VAL A 162  SER A 163  
D  1 THR A 173  ? ASP A 177  ? THR A 173  ASP A 177  
D  2 LYS A 180  ? SER A 184  ? LYS A 180  SER A 184  
E  1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
E  2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
F  1 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
F  2 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
F  3 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
F  4 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
F  5 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
F  6 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
F  7 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
F  8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
G  1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
G  2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
G  3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
G  4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
H  1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
H  2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
I  1 LEU A 588  ? GLN A 589  ? LEU A 588  GLN A 589  
I  2 LEU A 606  ? ILE A 607  ? LEU A 606  ILE A 607  
I  3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
J  1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
J  2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
K  1 SER A 769  ? VAL A 770  ? SER A 769  VAL A 770  
K  2 LYS A 773  ? ARG A 774  ? LYS A 773  ARG A 774  
L  1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
L  2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
L  3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
M  1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
M  2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
N  1 ARG A 1281 ? TYR A 1287 ? ARG A 1281 TYR A 1287 
N  2 GLU A 1303 ? ASP A 1309 ? GLU A 1303 ASP A 1309 
N  3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
N  4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
O  1 THR A 1141 ? THR A 1142 ? THR A 1141 THR A 1142 
O  2 THR A 1272 ? ARG A 1274 ? THR A 1272 ARG A 1274 
P  1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
P  2 LEU A 1236 ? VAL A 1242 ? LEU A 1236 VAL A 1242 
P  3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
P  4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
P  5 LEU G 42   ? ARG G 45   ? LEU I 42   ARG I 45   
Q  1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
Q  2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
R  1 ASP A 1442 ? MET A 1444 ? ASP A 1442 MET A 1444 
R  2 VAL E 133  ? TYR E 137  ? VAL F 133  TYR F 137  
R  3 PHE E 143  ? SER E 147  ? PHE F 143  SER F 147  
S  1 ILE B 90   ? VAL B 97   ? ILE B 90   VAL B 97   
S  2 SER B 125  ? LYS B 134  ? SER B 125  LYS B 134  
S  3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
T  1 MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
T  2 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
U  1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
U  2 SER B 208  ? VAL B 211  ? SER B 208  VAL B 211  
U  3 GLN B 481  ? VAL B 482  ? GLN B 481  VAL B 482  
V  1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
V  2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
V  3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
V  4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
W  1 GLN B 224  ? LYS B 227  ? GLN B 224  LYS B 227  
W  2 ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
W  3 SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
W  4 ILE B 269  ? LEU B 273  ? ILE B 269  LEU B 273  
W  5 ILE B 276  ? PRO B 281  ? ILE B 276  PRO B 281  
X  1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
X  2 VAL B 633  ? ASP B 642  ? VAL B 633  ASP B 642  
X  3 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
Y  1 LYS B 649  ? LEU B 651  ? LYS B 649  LEU B 651  
Y  2 VAL B 633  ? ASP B 642  ? VAL B 633  ASP B 642  
Y  3 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
Y  4 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
Z  1 GLU B 564  ? PRO B 565  ? GLU B 564  PRO B 565  
Z  2 VAL B 585  ? HIS B 590  ? VAL B 585  HIS B 590  
Z  3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
Z  4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
Z  5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
AA 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
AA 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AA 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
AA 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
AA 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
AB 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
AB 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
AC 1 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
AC 2 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
AC 3 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
AC 4 LYS B 979  ? SER B 982  ? LYS B 979  SER B 982  
AC 5 GLN B 986  ? TYR B 994  ? GLN B 986  TYR B 994  
AC 6 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
AC 7 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
AC 8 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
AC 9 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
AD 1 THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
AD 2 LYS B 914  ? THR B 915  ? LYS B 914  THR B 915  
AE 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
AE 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
AF 1 PHE B 1158 ? CYS B 1163 ? PHE B 1158 CYS B 1163 
AF 2 ILE B 1191 ? ILE B 1196 ? ILE B 1191 ILE B 1196 
AG 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
AG 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
AG 3 PHE C 228  ? GLU C 233  ? PHE C 228  GLU C 233  
AG 4 ILE C 176  ? TYR C 180  ? ILE C 176  TYR C 180  
AH 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AH 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
AH 3 GLU C 152  ? ILE C 163  ? GLU C 152  ILE C 163  
AH 4 PRO C 42   ? ASN C 54   ? PRO C 42   ASN C 54   
AH 5 VAL J 65   ? PHE J 67   ? VAL L 65   PHE L 67   
AI 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
AI 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
AJ 1 PHE D 60   ? ALA D 62   ? PHE E 60   ALA E 62   
AJ 2 LEU D 78   ? PHE D 82   ? LEU E 78   PHE E 82   
AJ 3 THR D 107  ? TYR D 112  ? THR E 107  TYR E 112  
AJ 4 THR D 131  ? ASN D 136  ? THR E 131  ASN E 136  
AK 1 SER D 87   ? VAL D 88   ? SER E 87   VAL E 88   
AK 2 ASN D 115  ? ILE D 116  ? ASN E 115  ILE E 116  
AL 1 LYS D 152  ? ARG D 155  ? LYS E 152  ARG E 155  
AL 2 VAL D 195  ? SER D 202  ? VAL E 195  SER E 202  
AL 3 GLY D 206  ? CYS D 214  ? GLY E 206  CYS E 214  
AL 4 ARG D 177  ? ILE D 178  ? ARG E 177  ILE E 178  
AM 1 TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
AM 2 TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
AM 3 SER F 54   ? ALA F 60   ? SER H 54   ALA H 60   
AM 4 PHE F 6    ? ASP F 16   ? PHE H 6    ASP H 16   
AM 5 VAL F 23   ? SER F 30   ? VAL H 23   SER H 30   
AM 6 LYS F 37   ? ASN F 43   ? LYS H 37   ASN H 43   
AM 7 LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
AM 8 ILE F 112  ? PHE F 118  ? ILE H 112  PHE H 118  
AM 9 THR F 100  ? LYS F 103  ? THR H 100  LYS H 103  
AN 1 TYR G 15   ? GLU G 18   ? TYR I 15   GLU I 18   
AN 2 LEU G 25   ? GLU G 28   ? LEU I 25   GLU I 28   
AN 3 VAL G 35   ? GLU G 37   ? VAL I 35   GLU I 37   
AO 1 ASN G 83   ? GLN G 87   ? ASN I 83   GLN I 87   
AO 2 LEU G 99   ? CYS G 103  ? LEU I 99   CYS I 103  
AO 3 ILE G 109  ? THR G 111  ? ILE I 109  THR I 111  
AP 1 LEU I 19   ? PRO I 23   ? LEU K 19   PRO K 23   
AP 2 ALA I 30   ? GLU I 36   ? ALA K 30   GLU K 36   
AP 3 ARG I 70   ? THR I 77   ? ARG K 70   THR K 77   
AP 4 VAL I 56   ? LYS I 62   ? VAL K 56   LYS K 62   
AQ 1 TYR J 29   ? ILE J 30   ? TYR L 29   ILE L 30   
AQ 2 LYS J 37   ? LEU J 38   ? LYS L 37   LEU L 38   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ASP A 1419 ? O ASP A 1419 N VAL A 17   ? N VAL A 17   
A  2 3 N GLU A 16   ? N GLU A 16   O TYR B 1217 ? O TYR B 1217 
B  1 2 N GLY A 82   ? N GLY A 82   O VAL A 241  ? O VAL A 241  
C  1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
D  1 2 N THR A 173  ? N THR A 173  O SER A 184  ? O SER A 184  
E  1 2 N LYS A 343  ? N LYS A 343  O PHE B 1130 ? O PHE B 1130 
F  1 2 O HIS B 1104 ? O HIS B 1104 N ARG A 350  ? N ARG A 350  
F  2 3 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
F  3 4 O HIS A 490  ? O HIS A 490  N LEU A 443  ? N LEU A 443  
F  4 5 N VAL A 442  ? N VAL A 442  O HIS A 458  ? O HIS A 458  
F  5 6 O LYS A 461  ? O LYS A 461  N VAL A 366  ? N VAL A 366  
F  6 7 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
F  7 8 O PHE A 468  ? O PHE A 468  N VAL A 352  ? N VAL A 352  
G  1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
G  2 3 O LYS A 431  ? O LYS A 431  N ILE A 406  ? N ILE A 406  
G  3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
H  1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
I  1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
I  2 3 N LEU A 606  ? N LEU A 606  O ILE A 613  ? O ILE A 613  
J  1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
K  1 2 N VAL A 770  ? N VAL A 770  O LYS A 773  ? O LYS A 773  
L  1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
L  2 3 N THR A 856  ? N THR A 856  O ILE A 864  ? O ILE A 864  
M  1 2 N GLU A 879  ? N GLU A 879  O LEU A 956  ? O LEU A 956  
N  1 2 N TYR A 1287 ? N TYR A 1287 O GLU A 1303 ? O GLU A 1303 
N  2 3 O THR A 1308 ? O THR A 1308 N LEU A 1116 ? N LEU A 1116 
N  3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
O  1 2 N THR A 1141 ? N THR A 1141 O LEU A 1273 ? O LEU A 1273 
P  1 2 N PHE A 1225 ? N PHE A 1225 O ARG A 1241 ? O ARG A 1241 
P  2 3 O CYS A 1240 ? O CYS A 1240 N LEU A 1193 ? N LEU A 1193 
P  3 4 O ARG A 1194 ? O ARG A 1194 N GLU A 1151 ? N GLU A 1151 
P  4 5 N ILE A 1152 ? N ILE A 1152 O VAL G 43   ? O VAL I 43   
Q  1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
R  1 2 N ASP A 1442 ? N ASP A 1442 O ARG E 135  ? O ARG F 135  
R  2 3 N ARG E 136  ? N ARG F 136  O GLU E 144  ? O GLU F 144  
S  1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
S  2 3 N SER B 126  ? N SER B 126  O LEU B 170  ? O LEU B 170  
T  1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
U  1 2 N ILE B 205  ? N ILE B 205  O SER B 208  ? O SER B 208  
U  2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
V  1 2 O ASP B 407  ? O ASP B 407  N GLN B 215  ? N GLN B 215  
V  2 3 N GLU B 216  ? N GLU B 216  O ASN B 499  ? O ASN B 499  
V  3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
W  1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
W  2 3 N ALA B 238  ? N ALA B 238  O VAL B 256  ? O VAL B 256  
W  3 4 N GLN B 255  ? N GLN B 255  O THR B 272  ? O THR B 272  
W  4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
X  1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
X  2 3 N ARG B 635  ? N ARG B 635  O ILE B 693  ? O ILE B 693  
Y  1 2 O GLU B 650  ? O GLU B 650  N GLU B 641  ? N GLU B 641  
Y  2 3 N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
Y  3 4 O HIS B 740  ? O HIS B 740  N ALA B 704  ? N ALA B 704  
Z  1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
Z  2 3 O HIS B 587  ? O HIS B 587  N VAL B 580  ? N VAL B 580  
Z  3 4 N ARG B 579  ? N ARG B 579  O LEU B 624  ? O LEU B 624  
Z  4 5 O GLU B 623  ? O GLU B 623  N ASP B 618  ? N ASP B 618  
AA 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AA 2 3 N TYR B 859  ? N TYR B 859  O VAL B 966  ? O VAL B 966  
AA 3 4 O ARG B 967  ? O ARG B 967  N GLN B 951  ? N GLN B 951  
AA 4 5 O GLY B 947  ? O GLY B 947  N VAL B 905  ? N VAL B 905  
AB 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
AC 1 2 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
AC 2 3 N GLU B 1070 ? N GLU B 1070 O ILE B 1085 ? O ILE B 1085 
AC 3 4 O GLN B 1093 ? O GLN B 1093 N ALA B 981  ? N ALA B 981  
AC 4 5 N PHE B 980  ? N PHE B 980  O GLY B 988  ? O GLY B 988  
AC 5 6 O GLY B 991  ? O GLY B 991  N MET B 839  ? N MET B 839  
AC 6 7 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
AC 7 8 O LEU B 1010 ? O LEU B 1010 N ALA B 826  ? N ALA B 826  
AC 8 9 N VAL B 825  ? N VAL B 825  O GLY B 1088 ? O GLY B 1088 
AD 1 2 N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
AE 1 2 N ILE B 912  ? N ILE B 912  O THR B 939  ? O THR B 939  
AF 1 2 N VAL B 1160 ? N VAL B 1160 O ILE B 1194 ? O ILE B 1194 
AG 1 2 N GLU C 12   ? N GLU C 12   O ASP C 19   ? O ASP C 19   
AG 2 3 N PHE C 20   ? N PHE C 20   O MET C 230  ? O MET C 230  
AG 3 4 O TYR C 229  ? O TYR C 229  N GLU C 179  ? N GLU C 179  
AH 1 2 O VAL C 119  ? O VAL C 119  N THR C 100  ? N THR C 100  
AH 2 3 N VAL C 97   ? N VAL C 97   O ALA C 159  ? O ALA C 159  
AH 3 4 O GLY C 162  ? O GLY C 162  N THR C 43   ? N THR C 43   
AH 4 5 N VAL C 49   ? N VAL C 49   O PHE J 67   ? O PHE L 67   
AI 1 2 N THR C 111  ? N THR C 111  O LEU C 147  ? O LEU C 147  
AJ 1 2 N PHE D 60   ? N PHE E 60   O VAL D 80   ? O VAL E 80   
AJ 2 3 N GLU D 81   ? N GLU E 81   O ILE D 109  ? O ILE E 109  
AJ 3 4 N GLY D 108  ? N GLY E 108  O GLU D 133  ? O GLU E 133  
AK 1 2 N VAL D 88   ? N VAL E 88   O ASN D 115  ? O ASN E 115  
AL 1 2 N ILE D 154  ? N ILE E 154  O LYS D 197  ? O LYS E 197  
AL 2 3 N VAL D 196  ? N VAL E 196  O ARG D 212  ? O ARG E 212  
AL 3 4 O ILE D 213  ? O ILE E 213  N ILE D 178  ? N ILE E 178  
AM 1 2 N TYR F 95   ? N TYR H 95   O ILE F 144  ? O ILE H 144  
AM 2 3 O LEU F 143  ? O LEU H 143  N THR F 58   ? N THR H 58   
AM 3 4 O LEU F 55   ? O LEU H 55   N PHE F 10   ? N PHE H 10   
AM 4 5 N SER F 13   ? N SER H 13   O GLU F 27   ? O GLU H 27   
AM 5 6 N ILE F 26   ? N ILE H 26   O LEU F 40   ? O LEU H 40   
AM 6 7 N THR F 39   ? N THR H 39   O ARG F 124  ? O ARG H 124  
AM 7 8 O LEU F 121  ? O LEU H 121  N PHE F 118  ? N PHE H 118  
AM 8 9 O TYR F 115  ? O TYR H 115  N TYR F 102  ? N TYR H 102  
AN 1 2 N ARG G 17   ? N ARG I 17   O LEU G 26   ? O LEU I 26   
AN 2 3 N PHE G 27   ? N PHE I 27   O GLU G 36   ? O GLU I 36   
AO 1 2 N VAL G 84   ? N VAL I 84   O VAL G 102  ? O VAL I 102  
AO 2 3 N PHE G 101  ? N PHE I 101  O PHE G 110  ? O PHE I 110  
AP 1 2 N ASP I 22   ? N ASP K 22   O VAL I 32   ? O VAL K 32   
AP 2 3 N PHE I 35   ? N PHE K 35   O PHE I 71   ? O PHE K 71   
AP 3 4 O LYS I 72   ? O LYS K 72   N LYS I 62   ? N LYS K 62   
AQ 1 2 N TYR J 29   ? N TYR L 29   O LEU J 38   ? O LEU L 38   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE GTP R 100' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1734' 
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN A 1735' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 2001' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN B 1307' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN C 319'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 203'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN I 204'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN J 101'  
BC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN L 105'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ASP A 481  ? ASP A 481  . ? 1_555 ? 
2  AC1 10 ASP A 483  ? ASP A 483  . ? 1_555 ? 
3  AC1 10 LYS A 752  ? LYS A 752  . ? 1_555 ? 
4  AC1 10 MG  O .    ? MG  A 2001 . ? 1_555 ? 
5  AC1 10 GLU B 529  ? GLU B 529  . ? 1_555 ? 
6  AC1 10 ARG B 766  ? ARG B 766  . ? 1_555 ? 
7  AC1 10 TYR B 769  ? TYR B 769  . ? 1_555 ? 
8  AC1 10 SER B 1019 ? SER B 1019 . ? 1_555 ? 
9  AC1 10 ARG B 1020 ? ARG B 1020 . ? 1_555 ? 
10 AC1 10 G   K 5    ? G   R 10   . ? 1_555 ? 
11 AC2 4  CYS A 107  ? CYS A 107  . ? 1_555 ? 
12 AC2 4  CYS A 110  ? CYS A 110  . ? 1_555 ? 
13 AC2 4  CYS A 148  ? CYS A 148  . ? 1_555 ? 
14 AC2 4  CYS A 167  ? CYS A 167  . ? 1_555 ? 
15 AC3 4  CYS A 67   ? CYS A 67   . ? 1_555 ? 
16 AC3 4  CYS A 70   ? CYS A 70   . ? 1_555 ? 
17 AC3 4  CYS A 77   ? CYS A 77   . ? 1_555 ? 
18 AC3 4  HIS A 80   ? HIS A 80   . ? 1_555 ? 
19 AC4 6  ARG A 446  ? ARG A 446  . ? 1_555 ? 
20 AC4 6  ASP A 481  ? ASP A 481  . ? 1_555 ? 
21 AC4 6  ASP A 483  ? ASP A 483  . ? 1_555 ? 
22 AC4 6  ASP A 485  ? ASP A 485  . ? 1_555 ? 
23 AC4 6  G   K 5    ? G   R 10   . ? 1_555 ? 
24 AC4 6  GTP V .    ? GTP R 100  . ? 1_555 ? 
25 AC5 4  CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
26 AC5 4  CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
27 AC5 4  CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
28 AC5 4  CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
29 AC6 4  CYS C 86   ? CYS C 86   . ? 1_555 ? 
30 AC6 4  CYS C 88   ? CYS C 88   . ? 1_555 ? 
31 AC6 4  CYS C 92   ? CYS C 92   . ? 1_555 ? 
32 AC6 4  CYS C 95   ? CYS C 95   . ? 1_555 ? 
33 AC7 4  CYS G 7    ? CYS I 7    . ? 1_555 ? 
34 AC7 4  CYS G 10   ? CYS I 10   . ? 1_555 ? 
35 AC7 4  CYS G 29   ? CYS I 29   . ? 1_555 ? 
36 AC7 4  CYS G 32   ? CYS I 32   . ? 1_555 ? 
37 AC8 4  CYS G 75   ? CYS I 75   . ? 1_555 ? 
38 AC8 4  CYS G 78   ? CYS I 78   . ? 1_555 ? 
39 AC8 4  CYS G 103  ? CYS I 103  . ? 1_555 ? 
40 AC8 4  CYS G 106  ? CYS I 106  . ? 1_555 ? 
41 AC9 4  CYS H 7    ? CYS J 7    . ? 1_555 ? 
42 AC9 4  CYS H 10   ? CYS J 10   . ? 1_555 ? 
43 AC9 4  CYS H 45   ? CYS J 45   . ? 1_555 ? 
44 AC9 4  CYS H 46   ? CYS J 46   . ? 1_555 ? 
45 BC1 4  CYS J 31   ? CYS L 31   . ? 1_555 ? 
46 BC1 4  CYS J 34   ? CYS L 34   . ? 1_555 ? 
47 BC1 4  CYS J 48   ? CYS L 48   . ? 1_555 ? 
48 BC1 4  CYS J 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    3S1R 
_atom_sites.fract_transf_matrix[1][1]   0.006224 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000909 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004518 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005231 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 32.082  -49.168  16.070  1.00 138.32 ? 3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 31.621  -47.791  15.920  1.00 138.03 ? 3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 32.646  -46.841  15.328  1.00 141.66 ? 3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 32.289  -45.771  14.823  1.00 141.08 ? 3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 33.929  -47.232  15.398  1.00 138.10 ? 4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 35.073  -46.471  14.898  1.00 138.47 ? 4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 35.845  -47.338  13.901  1.00 144.59 ? 4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 35.563  -48.536  13.794  1.00 144.00 ? 4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 35.985  -46.063  16.074  1.00 139.40 ? 4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 35.334  -45.122  17.093  1.00 146.84 ? 4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 36.019  -45.165  18.440  1.00 157.02 ? 4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 37.007  -44.464  18.689  1.00 149.04 ? 4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 35.494  -45.977  19.349  1.00 147.96 ? 4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 36.817  -46.737  13.176  1.00 143.33 ? 5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 37.668  -47.414  12.185  1.00 144.65 ? 5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 38.574  -48.488  12.845  1.00 150.81 ? 5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 38.976  -48.317  14.002  1.00 150.68 ? 5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 38.528  -46.378  11.437  1.00 146.46 ? 5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 38.869  -46.768  10.000  1.00 156.82 ? 5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 40.120  -46.082  9.497   1.00 168.17 ? 5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 41.225  -46.634  9.565   1.00 163.90 ? 5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 39.977  -44.872  8.965   1.00 153.72 ? 5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 38.888  -49.585  12.106  1.00 148.33 ? 6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 39.737  -50.703  12.559  1.00 148.54 ? 6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 41.179  -50.286  12.900  1.00 152.64 ? 6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 41.793  -49.505  12.167  1.00 152.53 ? 6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 39.737  -51.856  11.524  1.00 150.64 ? 6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 40.808  -52.907  11.751  1.00 153.27 ? 6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 42.054  -52.810  11.134  1.00 156.08 ? 6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 40.587  -53.982  12.607  1.00 154.01 ? 6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 43.054  -53.754  11.366  1.00 157.66 ? 6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 41.577  -54.937  12.841  1.00 155.70 ? 6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 42.810  -54.820  12.218  1.00 163.84 ? 6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 43.792  -55.754  12.457  1.00 164.64 ? 6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 41.731  -50.882  13.974  1.00 149.26 ? 7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 43.100  -50.646  14.436  1.00 149.68 ? 7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 43.930  -51.938  14.525  1.00 153.58 ? 7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 43.401  -53.010  14.838  1.00 152.35 ? 7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 43.103  -49.875  15.756  1.00 152.89 ? 7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 44.292  -50.058  16.512  1.00 161.56 ? 7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 45.243  -51.804  14.253  1.00 150.99 ? 8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 46.242  -52.879  14.248  1.00 151.40 ? 8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 46.900  -53.118  15.628  1.00 154.15 ? 8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 47.552  -54.150  15.823  1.00 154.42 ? 8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 47.307  -52.605  13.190  1.00 156.08 ? 8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 46.747  -52.115  11.981  1.00 164.28 ? 8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 46.730  -52.169  16.576  1.00 148.82 ? 9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 47.249  -52.266  17.944  1.00 147.93 ? 9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 46.472  -53.366  18.699  1.00 149.79 ? 9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 45.288  -53.549  18.403  1.00 148.98 ? 9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 47.085  -50.931  18.655  1.00 148.13 ? 9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 47.082  -54.138  19.635  1.00 145.06 ? 10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 46.308  -55.197  20.310  1.00 143.63 ? 10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 45.335  -54.636  21.338  1.00 144.14 ? 10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 45.741  -53.812  22.165  1.00 143.39 ? 10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 47.383  -56.082  20.963  1.00 146.06 ? 10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 48.707  -55.506  20.558  1.00 151.55 ? 10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 48.472  -54.104  20.127  1.00 146.99 ? 10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 44.047  -55.052  21.270  1.00 138.37 ? 11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 43.041  -54.591  22.234  1.00 136.28 ? 11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 43.325  -55.232  23.582  1.00 139.21 ? 11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 43.362  -56.461  23.710  1.00 139.17 ? 11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 41.577  -54.827  21.787  1.00 135.33 ? 11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 40.473  -54.325  22.752  1.00 138.15 ? 11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 40.181  -52.847  22.564  1.00 137.82 ? 11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 39.204  -55.105  22.575  1.00 139.23 ? 11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 43.580  -54.380  24.569  1.00 134.26 ? 12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 43.900  -54.813  25.912  1.00 133.35 ? 12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 43.107  -54.028  26.952  1.00 135.36 ? 12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 42.581  -52.956  26.651  1.00 134.31 ? 12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 45.410  -54.696  26.140  1.00 133.71 ? 12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 46.086  -56.033  26.375  1.00 143.75 ? 12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 46.931  -56.480  25.197  1.00 151.91 ? 12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 47.459  -57.829  25.413  1.00 160.94 ? 12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 48.612  -58.104  26.018  1.00 176.22 ? 12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 49.390  -57.123  26.461  1.00 162.86 ? 12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 48.999  -59.362  26.179  1.00 164.75 ? 12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 42.973  -54.605  28.157  1.00 131.09 ? 13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 42.293  -54.015  29.310  1.00 129.75 ? 13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 43.363  -53.449  30.228  1.00 133.46 ? 13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 44.485  -53.962  30.255  1.00 133.56 ? 13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 41.458  -55.060  30.067  1.00 136.66 ? 13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 41.918  -56.379  29.752  1.00 138.88 ? 13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 39.964  -54.924  29.805  1.00 132.47 ? 13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 43.020  -52.395  30.977  1.00 129.35 ? 14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 43.952  -51.760  31.907  1.00 129.21 ? 14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 44.079  -52.594  33.195  1.00 132.73 ? 14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 43.072  -52.927  33.827  1.00 132.13 ? 14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 43.604  -50.268  32.158  1.00 132.38 ? 14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 44.522  -49.643  33.211  1.00 132.40 ? 14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 43.660  -49.472  30.857  1.00 132.30 ? 14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 45.318  -52.962  33.550  1.00 128.73 ? 15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 45.588  -53.751  34.747  1.00 127.95 ? 15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 46.277  -52.884  35.798  1.00 131.71 ? 15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 46.325  -53.279  36.964  1.00 131.37 ? 15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 46.432  -55.016  34.441  1.00 130.40 ? 15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 46.229  -55.686  33.077  1.00 133.66 ? 15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 44.869  -56.343  32.876  1.00 137.77 ? 15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 44.861  -57.266  31.676  1.00 146.12 ? 15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 45.085  -56.562  30.379  1.00 150.37 ? 15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 46.802  -51.704  35.393  1.00 128.06 ? 16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 47.506  -50.796  36.297  1.00 128.03 ? 16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 47.464  -49.346  35.858  1.00 131.77 ? 16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 47.576  -49.061  34.666  1.00 131.15 ? 16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 48.975  -51.230  36.445  1.00 130.50 ? 16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 49.286  -51.917  37.766  1.00 142.78 ? 16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 50.693  -52.463  37.927  1.00 165.48 ? 16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 51.598  -52.026  37.179  1.00 161.60 ? 16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 50.898  -53.306  38.832  1.00 158.72 ? 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 47.332  -48.426  36.835  1.00 128.92 ? 17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 47.388  -46.971  36.626  1.00 129.27 ? 17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 48.453  -46.389  37.584  1.00 135.26 ? 17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 48.273  -46.415  38.805  1.00 134.16 ? 17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 46.026  -46.201  36.666  1.00 132.04 ? 17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 46.222  -44.712  36.376  1.00 131.67 ? 17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 45.019  -46.788  35.684  1.00 131.56 ? 17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 49.579  -45.914  37.016  1.00 133.99 ? 18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 50.681  -45.338  37.779  1.00 135.02 ? 18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 50.580  -43.823  37.759  1.00 140.68 ? 18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 50.983  -43.191  36.782  1.00 140.16 ? 18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 52.043  -45.791  37.217  1.00 137.44 ? 18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 53.039  -46.321  38.261  1.00 153.50 ? 18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 53.261  -45.445  39.479  1.00 173.93 ? 18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 53.461  -44.227  39.397  1.00 170.50 ? 18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 53.290  -46.068  40.641  1.00 165.75 ? 18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 50.022  -43.241  38.832  1.00 139.05 ? 19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 49.864  -41.793  38.974  1.00 139.96 ? 19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 51.207  -41.139  39.266  1.00 145.92 ? 19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 52.040  -41.728  39.955  1.00 146.13 ? 19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 48.851  -41.455  40.079  1.00 141.44 ? 19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 47.426  -41.850  39.772  1.00 142.75 ? 19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 46.912  -43.063  40.216  1.00 145.88 ? 19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 46.594  -41.007  39.043  1.00 144.81 ? 19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 45.592  -43.429  39.927  1.00 146.16 ? 19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 45.277  -41.376  38.752  1.00 146.91 ? 19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 44.784  -42.581  39.200  1.00 144.71 ? 19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 51.413  -39.944  38.728  1.00 143.36 ? 20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 52.657  -39.215  38.929  1.00 144.44 ? 20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 52.577  -37.743  38.590  1.00 149.06 ? 20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 51.520  -37.117  38.716  1.00 147.72 ? 20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 53.714  -37.185  38.165  1.00 147.13 ? 21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 53.840  -35.782  37.791  1.00 147.43 ? 21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 54.586  -35.619  36.471  1.00 152.99 ? 21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 55.474  -36.417  36.144  1.00 152.83 ? 21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 54.525  -34.980  38.908  1.00 147.79 ? 21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 53.616  -34.499  40.031  1.00 151.45 ? 21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 54.226  -34.782  41.376  1.00 151.85 ? 21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 53.320  -33.021  39.896  1.00 153.61 ? 21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 54.189  -34.590  35.703  1.00 150.59 ? 22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 54.782  -34.247  34.416  1.00 151.62 ? 22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 56.058  -33.433  34.617  1.00 157.34 ? 22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 56.031  -32.394  35.290  1.00 157.40 ? 22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 53.794  -33.438  33.548  1.00 153.06 ? 22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 52.958  -34.225  32.566  1.00 154.17 ? 22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 51.571  -34.203  32.636  1.00 156.24 ? 22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 53.557  -34.959  31.546  1.00 156.88 ? 22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 50.799  -34.932  31.729  1.00 156.72 ? 22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 52.782  -35.686  30.637  1.00 159.19 ? 22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 51.407  -35.667  30.735  1.00 156.30 ? 22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 57.174  -33.906  34.033  1.00 154.35 ? 23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 58.444  -33.187  34.070  1.00 154.71 ? 23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 58.393  -32.171  32.923  1.00 158.52 ? 23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 57.936  -32.547  31.839  1.00 158.06 ? 23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 59.616  -34.146  33.877  1.00 158.29 ? 23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 59.619  -34.784  32.612  1.00 165.48 ? 23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 58.835  -30.899  33.103  1.00 155.01 ? 24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 58.793  -29.935  31.981  1.00 154.97 ? 24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 59.466  -30.442  30.698  1.00 159.19 ? 24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 59.163  -29.949  29.608  1.00 158.71 ? 24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 59.491  -28.701  32.556  1.00 157.36 ? 24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 59.264  -28.805  34.015  1.00 161.39 ? 24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 59.391  -30.268  34.315  1.00 156.78 ? 24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 60.343  -31.467  30.840  1.00 156.07 ? 25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 61.051  -32.169  29.765  1.00 156.33 ? 25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 60.025  -32.979  28.951  1.00 160.83 ? 25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 59.975  -32.847  27.726  1.00 160.36 ? 25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 62.140  -33.105  30.346  1.00 157.83 ? 25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 63.251  -32.408  31.126  1.00 161.88 ? 25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 63.201  -32.502  32.643  1.00 158.98 ? 25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 62.833  -33.574  33.176  1.00 135.92 ? 25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 63.594  -31.513  33.302  1.00 140.69 ? 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 59.187  -33.785  29.655  1.00 157.91 ? 26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 58.116  -34.639  29.113  1.00 157.42 ? 26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 57.037  -33.796  28.439  1.00 160.56 ? 26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 56.531  -34.198  27.391  1.00 160.04 ? 26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 57.486  -35.484  30.239  1.00 158.16 ? 26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 57.134  -36.912  29.851  1.00 169.77 ? 26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 56.520  -37.755  30.956  1.00 190.76 ? 26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 57.062  -37.759  32.087  1.00 182.36 ? 26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 55.512  -38.444  30.677  1.00 186.06 ? 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 56.694  -32.630  29.042  1.00 156.76 ? 27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 55.699  -31.661  28.552  1.00 156.21 ? 27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 56.125  -31.133  27.165  1.00 161.29 ? 27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 55.288  -31.026  26.265  1.00 160.35 ? 27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 55.444  -30.516  29.580  1.00 159.76 ? 27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 54.418  -29.509  29.063  1.00 159.17 ? 27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 55.005  -31.070  30.935  1.00 158.74 ? 27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 57.432  -30.846  26.997  1.00 159.34 ? 28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 58.021  -30.384  25.737  1.00 160.14 ? 28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 58.156  -31.542  24.734  1.00 164.56 ? 28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 57.921  -31.342  23.541  1.00 164.35 ? 28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 59.389  -29.720  25.984  1.00 161.10 ? 28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 59.297  -28.280  26.471  1.00 168.86 ? 28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 60.663  -27.709  26.799  1.00 175.11 ? 28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 60.594  -26.294  27.168  1.00 179.48 ? 28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 60.421  -25.847  28.409  1.00 190.19 ? 28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 60.284  -26.701  29.416  1.00 175.71 ? 28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 60.376  -24.544  28.650  1.00 175.53 ? 28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 58.530  -32.747  25.220  1.00 161.30 ? 29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 58.701  -33.952  24.401  1.00 161.39 ? 29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 57.384  -34.448  23.800  1.00 164.50 ? 29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 57.388  -34.965  22.683  1.00 163.94 ? 29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 59.345  -35.057  25.225  1.00 162.24 ? 29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 56.269  -34.290  24.544  1.00 160.60 ? 30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 54.920  -34.715  24.154  1.00 159.74 ? 30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 54.190  -33.694  23.246  1.00 164.12 ? 30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 53.579  -34.102  22.249  1.00 163.50 ? 30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 54.112  -35.179  25.413  1.00 161.69 ? 30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 54.456  -36.642  25.770  1.00 162.07 ? 30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 52.593  -34.982  25.279  1.00 161.40 ? 30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 54.333  -37.005  27.252  1.00 169.03 ? 30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 54.276  -32.381  23.584  1.00 160.85 ? 31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 53.624  -31.269  22.874  1.00 160.52 ? 31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 53.737  -31.303  21.361  1.00 165.18 ? 31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 54.791  -31.646  20.823  1.00 165.67 ? 31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 54.110  -29.924  23.394  1.00 164.03 ? 31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 55.378  -29.575  22.864  1.00 172.86 ? 31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 52.647  -30.925  20.684  1.00 161.46 ? 32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 52.561  -30.893  19.223  1.00 161.80 ? 32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 52.667  -29.470  18.651  1.00 167.44 ? 32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 52.864  -29.311  17.443  1.00 167.17 ? 32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 51.331  -31.672  18.681  1.00 164.50 ? 32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 51.411  -33.149  19.047  1.00 163.81 ? 32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 50.017  -31.063  19.161  1.00 163.36 ? 32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 52.557  -28.445  19.527  1.00 165.37 ? 33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 52.608  -27.027  19.157  1.00 166.39 ? 33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 53.544  -26.182  20.047  1.00 172.23 ? 33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 54.360  -26.737  20.784  1.00 171.84 ? 33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 51.201  -26.446  19.168  1.00 166.40 ? 33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 53.429  -24.835  19.941  1.00 170.39 ? 34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 54.191  -23.815  20.680  1.00 171.11 ? 34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 53.247  -22.914  21.516  1.00 175.01 ? 34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 53.634  -22.491  22.607  1.00 174.63 ? 34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 55.029  -22.948  19.709  1.00 174.65 ? 34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 56.179  -23.689  19.016  1.00 182.76 ? 34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 56.542  -23.075  17.658  1.00 185.26 ? 34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 56.024  -23.876  16.483  1.00 183.60 ? 34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 56.803  -25.125  16.260  1.00 185.47 ? 34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 52.018  -22.626  20.987  1.00 171.17 ? 35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 50.947  -21.796  21.578  1.00 170.23 ? 35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 51.494  -20.435  22.036  1.00 175.44 ? 35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 51.778  -20.223  23.219  1.00 174.44 ? 35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 50.064  -22.568  22.622  1.00 171.87 ? 35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 49.414  -23.813  21.989  1.00 171.41 ? 35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 48.972  -21.688  23.225  1.00 171.93 ? 35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 49.958  -25.092  22.452  1.00 177.23 ? 35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 51.694  -19.537  21.067  1.00 174.00 ? 36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 52.292  -18.229  21.323  1.00 175.29 ? 36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 51.318  -17.056  21.376  1.00 180.48 ? 36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 51.698  -15.995  21.873  1.00 180.37 ? 36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 53.444  -17.955  20.336  1.00 176.79 ? 36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 54.602  -18.957  20.442  1.00 185.42 ? 36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 55.579  -18.886  19.279  1.00 190.83 ? 36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 54.952  -19.237  18.003  1.00 193.45 ? 36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 54.743  -18.379  17.010  1.00 204.13 ? 36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 55.128  -17.114  17.122  1.00 189.98 ? 36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 54.157  -18.782  15.892  1.00 189.66 ? 36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 50.080  -17.224  20.869  1.00 177.77 ? 37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 49.106  -16.126  20.849  1.00 178.24 ? 37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 47.827  -16.419  21.644  1.00 183.25 ? 37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 47.299  -17.525  21.523  1.00 182.30 ? 37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 48.772  -15.694  19.402  1.00 180.41 ? 37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 49.885  -15.876  18.396  1.00 182.71 ? 37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 49.745  -16.761  17.336  1.00 185.68 ? 37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 51.076  -15.169  18.513  1.00 185.79 ? 37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 50.779  -16.942  16.415  1.00 187.51 ? 37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 52.117  -15.366  17.604  1.00 189.55 ? 37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 51.957  -16.246  16.557  1.00 187.58 ? 37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 47.283  -15.446  22.428  1.00 181.25 ? 38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 46.032  -15.709  23.168  1.00 180.77 ? 38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 44.779  -15.677  22.283  1.00 186.39 ? 38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 43.675  -15.942  22.767  1.00 185.28 ? 38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 46.001  -14.604  24.239  1.00 182.59 ? 38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 47.248  -13.794  24.049  1.00 187.77 ? 38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 47.757  -14.072  22.677  1.00 183.76 ? 38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 44.956  -15.355  20.986  1.00 185.10 ? 39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 43.893  -15.283  19.983  1.00 185.51 ? 39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 43.605  -16.657  19.383  1.00 190.92 ? 39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 44.509  -17.485  19.243  1.00 190.25 ? 39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 44.257  -14.283  18.872  1.00 187.78 ? 39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 44.226  -12.826  19.304  1.00 195.43 ? 39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 45.257  -11.947  18.625  1.00 205.10 ? 39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 46.037  -11.288  19.349  1.00 185.64 ? 39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 45.297  -11.926  17.373  1.00 198.29 ? 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 42.341  -16.879  19.013  1.00 189.00 ? 40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 41.856  -18.126  18.433  1.00 189.16 ? 40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 41.649  -17.907  16.919  1.00 195.57 ? 40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 42.626  -17.873  16.165  1.00 195.33 ? 40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 40.601  -18.572  19.218  1.00 197.70 ? 40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 40.832  -18.406  20.617  1.00 197.74 ? 40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 40.205  -20.003  18.941  1.00 196.10 ? 40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 40.386  -17.696  16.500  1.00 194.13 ? 41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 39.946  -17.435  15.125  1.00 195.44 ? 41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 40.289  -15.997  14.697  1.00 202.20 ? 41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 40.177  -15.661  13.515  1.00 202.54 ? 41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 38.424  -17.697  15.008  1.00 197.31 ? 41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 37.555  -16.733  15.830  1.00 201.03 ? 41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 36.183  -17.507  16.726  1.00 204.22 ? 41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 36.999  -17.964  18.235  1.00 200.27 ? 41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 40.677  -15.156  15.680  1.00 200.11 ? 42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 41.019  -13.738  15.549  1.00 201.19 ? 42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 42.224  -13.496  14.601  1.00 206.12 ? 42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 43.385  -13.511  15.035  1.00 206.08 ? 42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 41.210  -13.094  16.950  1.00 202.88 ? 42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 40.097  -13.385  17.958  1.00 210.35 ? 42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 39.355  -12.441  18.317  1.00 210.62 ? 42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 39.987  -14.552  18.406  1.00 214.53 ? 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 41.918  -13.309  13.289  1.00 202.75 ? 43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 42.872  -13.066  12.193  1.00 203.15 ? 43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 42.201  -12.375  10.977  1.00 206.08 ? 43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 42.185  -12.926  9.872   1.00 205.77 ? 43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 43.656  -14.351  11.796  1.00 204.38 ? 43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 42.810  -15.591  11.521  1.00 213.81 ? 43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 43.418  -16.621  10.588  1.00 232.62 ? 43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 42.731  -17.017  9.619   1.00 225.73 ? 43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 44.568  -17.051  10.832  1.00 225.34 ? 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 41.666  -11.148  11.197  1.00 201.93 ? 44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 40.965  -10.306  10.201  1.00 201.97 ? 44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 39.731  -11.026  9.594   1.00 203.45 ? 44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 39.545  -11.030  8.370   1.00 203.56 ? 44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 41.944  -9.651   9.176   1.00 212.23 ? 44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 43.193  -9.355   9.806   1.00 214.05 ? 44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 41.376  -8.379   8.537   1.00 210.82 ? 44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 38.907  -11.656  10.478  1.00 197.16 ? 45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 37.677  -12.421  10.174  1.00 195.31 ? 45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 37.903  -13.732  9.364   1.00 197.63 ? 45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 36.973  -14.540  9.259   1.00 196.76 ? 45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 36.564  -11.523  9.560   1.00 196.75 ? 45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 35.128  -11.893  9.971   1.00 194.80 ? 45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 34.062  -11.069  9.274   1.00 197.85 ? 45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 33.430  -10.190  9.867   1.00 189.77 ? 45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 33.798  -11.366  8.013   1.00 185.10 ? 45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 39.139  -13.953  8.827   1.00 193.18 ? 46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 39.529  -15.127  8.022   1.00 191.94 ? 46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 39.255  -16.428  8.785   1.00 193.20 ? 46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 39.530  -16.499  9.987   1.00 192.17 ? 46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 41.008  -15.021  7.555   1.00 196.77 ? 46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 41.293  -13.696  7.103   1.00 195.11 ? 46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 41.363  -16.023  6.457   1.00 194.16 ? 46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 38.693  -17.441  8.090   1.00 188.21 ? 47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 38.393  -18.745  8.688   1.00 186.44 ? 47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 39.670  -19.491  9.081   1.00 188.66 ? 47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 40.757  -19.131  8.618   1.00 189.11 ? 47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 37.454  -19.585  7.811   1.00 186.33 ? 47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 35.987  -19.195  7.979   1.00 194.60 ? 47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 35.067  -20.401  8.087   1.00 200.59 ? 47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 35.034  -20.963  9.441   1.00 203.94 ? 47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 34.159  -21.874  9.858   1.00 212.24 ? 47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 33.225  -22.336  9.033   1.00 197.57 ? 47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 34.204  -22.324  11.104  1.00 193.99 ? 47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 39.532  -20.499  9.969   1.00 182.84 ? 48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 40.599  -21.279  10.611  1.00 181.85 ? 48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 41.191  -20.422  11.748  1.00 185.30 ? 48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 40.698  -19.315  11.987  1.00 185.16 ? 48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 41.674  -21.716  9.613   1.00 183.16 ? 48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 42.182  -20.946  12.495  1.00 181.18 ? 49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 42.777  -20.228  13.633  1.00 180.67 ? 49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 44.290  -20.065  13.464  1.00 184.71 ? 49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 44.918  -20.891  12.798  1.00 184.73 ? 49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 42.465  -20.934  14.974  1.00 181.96 ? 49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 41.212  -21.824  15.013  1.00 191.14 ? 49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 39.946  -21.088  15.425  1.00 197.35 ? 49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 38.871  -22.040  15.886  1.00 205.33 ? 49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 37.882  -21.382  16.780  1.00 213.10 ? 49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 44.878  -19.011  14.078  1.00 180.94 ? 50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 46.326  -18.731  14.004  1.00 181.18 ? 50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 47.223  -19.768  14.730  1.00 182.96 ? 50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 46.711  -20.655  15.422  1.00 181.39 ? 50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 46.731  -17.239  14.283  1.00 185.05 ? 50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 45.719  -16.477  15.184  1.00 184.83 ? 50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 47.005  -16.495  12.971  1.00 186.82 ? 50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 46.277  -15.187  15.853  1.00 190.01 ? 50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 48.543  -19.646  14.548  1.00 179.06 ? 51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 49.538  -20.520  15.164  1.00 178.24 ? 51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 49.763  -20.227  16.636  1.00 180.63 ? 51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 50.907  -20.133  17.090  1.00 180.59 ? 51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 48.664  -20.072  17.368  1.00 175.69 ? 52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 48.654  -19.778  18.793  1.00 174.69 ? 52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 47.695  -20.662  19.556  1.00 176.52 ? 52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 47.702  -21.881  19.364  1.00 175.77 ? 52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 46.839  -20.034  20.395  1.00 171.74 ? 53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 45.861  -20.646  21.308  1.00 170.04 ? 53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 45.384  -22.071  21.043  1.00 173.15 ? 53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 45.610  -22.921  21.905  1.00 172.43 ? 53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 44.703  -19.706  21.691  1.00 169.60 ? 53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 44.097  -19.913  23.091  1.00 173.10 ? 53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 45.012  -19.382  24.188  1.00 173.29 ? 53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 42.754  -19.237  23.205  1.00 175.26 ? 53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 44.739  -22.346  19.881  1.00 169.49 ? 54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 44.237  -23.696  19.580  1.00 168.57 ? 54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 44.048  -24.048  18.103  1.00 172.03 ? 54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 42.962  -23.839  17.560  1.00 171.12 ? 54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 42.968  -24.024  20.394  1.00 169.41 ? 54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 41.891  -22.971  20.306  1.00 195.43 ? 54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 41.931  -21.944  20.991  1.00 192.36 ? 54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 40.919  -23.201  19.444  1.00 185.57 ? 54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 45.092  -24.629  17.473  1.00 169.27 ? 55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 45.094  -25.109  16.081  1.00 170.00 ? 55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 46.404  -25.708  15.561  1.00 175.22 ? 55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 46.302  -26.733  14.874  1.00 174.53 ? 55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 44.556  -24.077  15.062  1.00 172.61 ? 55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 44.307  -24.630  13.661  1.00 183.37 ? 55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 43.919  -25.822  13.545  1.00 182.96 ? 55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 44.478  -23.868  12.686  1.00 190.85 ? 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 47.610  -25.081  15.759  1.00 173.13 ? 56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 48.836  -25.638  15.148  1.00 174.00 ? 56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 49.133  -27.115  15.437  1.00 179.09 ? 56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 49.902  -27.418  16.352  1.00 179.40 ? 56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 49.945  -24.676  15.615  1.00 176.15 ? 56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 49.381  -23.971  16.788  1.00 179.68 ? 56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 47.920  -23.836  16.496  1.00 174.67 ? 56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 48.524  -28.037  14.624  1.00 175.34 ? 57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 48.625  -29.516  14.680  1.00 174.57 ? 57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 47.815  -30.174  15.846  1.00 177.33 ? 57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 47.843  -31.400  16.007  1.00 176.35 ? 57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 50.105  -30.009  14.661  1.00 174.60 ? 57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 51.005  -29.393  13.575  1.00 181.66 ? 57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 52.357  -28.923  14.117  1.00 184.69 ? 57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 52.295  -27.590  14.732  1.00 185.31 ? 57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 53.355  -26.861  15.078  1.00 194.48 ? 57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 54.583  -27.321  14.872  1.00 183.28 ? 57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 53.194  -25.665  15.627  1.00 175.27 ? 57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 47.086  -29.345  16.632  1.00 173.35 ? 58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 46.312  -29.704  17.833  1.00 171.83 ? 58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 44.985  -30.429  17.559  1.00 174.46 ? 58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 44.832  -31.592  17.946  1.00 173.22 ? 58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 46.074  -28.432  18.676  1.00 171.55 ? 58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 46.299  -28.523  20.181  1.00 175.33 ? 58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 47.766  -28.344  20.530  1.00 176.01 ? 58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 45.522  -27.447  20.889  1.00 177.15 ? 58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 44.044  -29.721  16.925  1.00 170.79 ? 59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 42.717  -30.229  16.593  1.00 169.68 ? 59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 41.961  -29.405  15.568  1.00 172.60 ? 59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 42.470  -28.393  15.072  1.00 173.10 ? 59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 40.728  -29.840  15.252  1.00 167.32 ? 60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 39.867  -29.191  14.267  1.00 166.92 ? 60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 38.512  -28.773  14.831  1.00 169.89 ? 60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 37.670  -29.632  15.103  1.00 168.85 ? 60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 39.692  -30.094  13.043  1.00 169.83 ? 60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 38.535  -29.822  12.266  1.00 175.65 ? 60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 38.283  -27.452  14.961  1.00 166.52 ? 61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 36.985  -26.913  15.391  1.00 165.91 ? 61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 36.142  -26.735  14.097  1.00 170.01 ? 61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 35.799  -25.613  13.705  1.00 169.90 ? 61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 37.120  -25.627  16.275  1.00 169.08 ? 61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 38.058  -25.890  17.485  1.00 169.32 ? 61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 35.734  -25.114  16.736  1.00 169.33 ? 61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 38.220  -24.749  18.499  1.00 177.57 ? 61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 35.858  -27.867  13.409  1.00 166.34 ? 62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 35.145  -27.859  12.135  1.00 166.54 ? 62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 34.177  -29.016  11.910  1.00 170.19 ? 62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 33.167  -28.809  11.235  1.00 170.17 ? 62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 36.146  -27.786  10.979  1.00 169.09 ? 62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 35.638  -26.998  9.797   1.00 178.43 ? 62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 35.160  -27.623  8.832   1.00 179.13 ? 62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 35.733  -25.753  9.829   1.00 183.93 ? 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 34.496  -30.227  12.431  1.00 166.22 ? 63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 33.732  -31.489  12.307  1.00 165.66 ? 63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 34.095  -32.290  11.048  1.00 170.63 ? 63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 33.864  -33.502  11.013  1.00 169.83 ? 63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 32.199  -31.299  12.451  1.00 165.01 ? 63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 31.463  -32.436  13.169  1.00 171.69 ? 63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 29.946  -32.265  13.146  1.00 175.96 ? 63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 29.468  -31.247  14.087  1.00 180.46 ? 63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 29.126  -30.004  13.751  1.00 191.48 ? 63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 29.206  -29.603  12.488  1.00 176.40 ? 63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 28.704  -29.153  14.677  1.00 176.72 ? 63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 34.685  -31.615  10.031  1.00 168.45 ? 64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 35.098  -32.209  8.751   1.00 168.88 ? 64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 36.340  -33.100  8.894   1.00 172.80 ? 64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 37.188  -32.815  9.748   1.00 172.41 ? 64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 35.346  -31.116  7.703   1.00 169.57 ? 64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 34.138  -30.292  7.313   1.00 186.34 ? 64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 32.978  -30.649  7.564   1.00 177.56 ? 64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 34.389  -29.171  6.652   1.00 178.26 ? 64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 36.442  -34.166  8.034   1.00 168.91 ? 65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 37.510  -35.196  7.954   1.00 168.32 ? 65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 38.948  -34.629  7.798   1.00 171.44 ? 65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 39.637  -34.916  6.811   1.00 171.99 ? 65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 37.195  -36.216  6.833   1.00 168.55 ? 65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 36.380  -37.438  7.236   1.00 172.26 ? 65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 35.081  -37.506  6.457   1.00 172.46 ? 65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 37.183  -38.709  7.044   1.00 174.28 ? 65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 39.400  -33.855  8.804   1.00 165.94 ? 66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 40.695  -33.186  8.822   1.00 165.47 ? 66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 41.210  -32.959  10.236  1.00 169.59 ? 66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 40.437  -32.616  11.131  1.00 168.64 ? 66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 40.598  -31.838  8.077   1.00 167.25 ? 66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 39.604  -30.841  8.683   1.00 164.32 ? 66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 38.905  -30.039  7.633   1.00 164.95 ? 66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 38.249  -28.846  8.251   1.00 165.41 ? 66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 37.368  -28.156  7.282   1.00 173.06 ? 66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 42.524  -33.139  10.419  1.00 167.19 ? 67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 43.299  -32.906  11.643  1.00 167.17 ? 67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 44.761  -33.053  11.260  1.00 171.88 ? 67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 45.184  -34.170  10.953  1.00 171.72 ? 67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 42.914  -33.865  12.771  1.00 166.84 ? 67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 43.856  -33.625  14.308  1.00 170.68 ? 67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 45.524  -31.922  11.255  1.00 168.87 ? 68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 46.960  -31.825  10.921  1.00 169.55 ? 68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 47.421  -32.716  9.744   1.00 177.11 ? 68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 47.447  -32.249  8.602   1.00 177.34 ? 68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 47.869  -31.976  12.168  1.00 169.85 ? 68   GLN A CB    1 
ATOM   514   C  CG    . GLN A 1  68   ? 47.395  -32.978  13.226  1.00 155.29 ? 68   GLN A CG    1 
ATOM   515   C  CD    . GLN A 1  68   ? 48.474  -33.918  13.670  1.00 146.08 ? 68   GLN A CD    1 
ATOM   516   O  OE1   . GLN A 1  68   ? 48.746  -34.939  13.032  1.00 132.18 ? 68   GLN A OE1   1 
ATOM   517   N  NE2   . GLN A 1  68   ? 49.073  -33.615  14.806  1.00 134.91 ? 68   GLN A NE2   1 
ATOM   518   N  N     . THR A 1  69   ? 47.764  -34.000  10.038  1.00 175.64 ? 69   THR A N     1 
ATOM   519   C  CA    . THR A 1  69   ? 48.187  -35.056  9.100   1.00 176.67 ? 69   THR A CA    1 
ATOM   520   C  C     . THR A 1  69   ? 47.542  -36.416  9.514   1.00 180.38 ? 69   THR A C     1 
ATOM   521   O  O     . THR A 1  69   ? 47.094  -37.163  8.629   1.00 180.23 ? 69   THR A O     1 
ATOM   522   C  CB    . THR A 1  69   ? 49.739  -35.125  8.976   1.00 186.25 ? 69   THR A CB    1 
ATOM   523   O  OG1   . THR A 1  69   ? 50.278  -33.814  8.781   1.00 186.20 ? 69   THR A OG1   1 
ATOM   524   C  CG2   . THR A 1  69   ? 50.207  -36.034  7.834   1.00 185.58 ? 69   THR A CG2   1 
ATOM   525   N  N     . CYS A 1  70   ? 47.461  -36.700  10.863  1.00 175.60 ? 70   CYS A N     1 
ATOM   526   C  CA    . CYS A 1  70   ? 46.899  -37.922  11.484  1.00 173.99 ? 70   CYS A CA    1 
ATOM   527   C  C     . CYS A 1  70   ? 45.470  -38.304  11.037  1.00 176.51 ? 70   CYS A C     1 
ATOM   528   O  O     . CYS A 1  70   ? 45.003  -39.405  11.351  1.00 175.12 ? 70   CYS A O     1 
ATOM   529   C  CB    . CYS A 1  70   ? 47.046  -37.901  13.010  1.00 173.33 ? 70   CYS A CB    1 
ATOM   530   S  SG    . CYS A 1  70   ? 45.652  -37.151  13.908  1.00 176.04 ? 70   CYS A SG    1 
ATOM   531   N  N     . GLN A 1  71   ? 44.807  -37.396  10.275  1.00 173.16 ? 71   GLN A N     1 
ATOM   532   C  CA    . GLN A 1  71   ? 43.450  -37.511  9.737   1.00 172.65 ? 71   GLN A CA    1 
ATOM   533   C  C     . GLN A 1  71   ? 42.441  -37.829  10.872  1.00 175.73 ? 71   GLN A C     1 
ATOM   534   O  O     . GLN A 1  71   ? 42.589  -37.261  11.959  1.00 175.12 ? 71   GLN A O     1 
ATOM   535   C  CB    . GLN A 1  71   ? 43.404  -38.474  8.516   1.00 174.47 ? 71   GLN A CB    1 
ATOM   536   C  CG    . GLN A 1  71   ? 42.193  -38.307  7.566   1.00 188.32 ? 71   GLN A CG    1 
ATOM   537   C  CD    . GLN A 1  71   ? 42.156  -37.069  6.682   1.00 205.74 ? 71   GLN A CD    1 
ATOM   538   O  OE1   . GLN A 1  71   ? 43.007  -36.167  6.746   1.00 201.24 ? 71   GLN A OE1   1 
ATOM   539   N  NE2   . GLN A 1  71   ? 41.145  -37.006  5.823   1.00 195.84 ? 71   GLN A NE2   1 
ATOM   540   N  N     . GLU A 1  72   ? 41.426  -38.702  10.629  1.00 171.50 ? 72   GLU A N     1 
ATOM   541   C  CA    . GLU A 1  72   ? 40.366  -39.123  11.569  1.00 169.76 ? 72   GLU A CA    1 
ATOM   542   C  C     . GLU A 1  72   ? 39.354  -38.020  11.966  1.00 170.57 ? 72   GLU A C     1 
ATOM   543   O  O     . GLU A 1  72   ? 38.230  -38.332  12.375  1.00 169.01 ? 72   GLU A O     1 
ATOM   544   C  CB    . GLU A 1  72   ? 40.928  -39.907  12.778  1.00 170.94 ? 72   GLU A CB    1 
ATOM   545   C  CG    . GLU A 1  72   ? 41.814  -41.094  12.409  1.00 183.77 ? 72   GLU A CG    1 
ATOM   546   C  CD    . GLU A 1  72   ? 41.203  -42.110  11.460  1.00 212.03 ? 72   GLU A CD    1 
ATOM   547   O  OE1   . GLU A 1  72   ? 41.565  -42.093  10.261  1.00 209.32 ? 72   GLU A OE1   1 
ATOM   548   O  OE2   . GLU A 1  72   ? 40.361  -42.919  11.912  1.00 210.75 ? 72   GLU A OE2   1 
ATOM   549   N  N     . GLY A 1  73   ? 39.769  -36.759  11.792  1.00 166.16 ? 73   GLY A N     1 
ATOM   550   C  CA    . GLY A 1  73   ? 39.002  -35.542  12.042  1.00 165.03 ? 73   GLY A CA    1 
ATOM   551   C  C     . GLY A 1  73   ? 38.462  -35.400  13.445  1.00 166.14 ? 73   GLY A C     1 
ATOM   552   O  O     . GLY A 1  73   ? 39.164  -34.946  14.356  1.00 165.85 ? 73   GLY A O     1 
ATOM   553   N  N     . MET A 1  74   ? 37.189  -35.767  13.605  1.00 159.99 ? 74   MET A N     1 
ATOM   554   C  CA    . MET A 1  74   ? 36.490  -35.733  14.879  1.00 157.83 ? 74   MET A CA    1 
ATOM   555   C  C     . MET A 1  74   ? 35.823  -37.072  15.144  1.00 159.87 ? 74   MET A C     1 
ATOM   556   O  O     . MET A 1  74   ? 35.880  -37.965  14.289  1.00 159.44 ? 74   MET A O     1 
ATOM   557   C  CB    . MET A 1  74   ? 35.508  -34.558  14.935  1.00 159.65 ? 74   MET A CB    1 
ATOM   558   C  CG    . MET A 1  74   ? 36.103  -33.346  15.606  1.00 162.84 ? 74   MET A CG    1 
ATOM   559   S  SD    . MET A 1  74   ? 35.040  -31.895  15.555  1.00 166.46 ? 74   MET A SD    1 
ATOM   560   C  CE    . MET A 1  74   ? 33.740  -32.393  16.685  1.00 162.11 ? 74   MET A CE    1 
ATOM   561   N  N     . ASN A 1  75   ? 35.247  -37.235  16.351  1.00 155.08 ? 75   ASN A N     1 
ATOM   562   C  CA    . ASN A 1  75   ? 34.598  -38.459  16.834  1.00 153.97 ? 75   ASN A CA    1 
ATOM   563   C  C     . ASN A 1  75   ? 35.577  -39.620  17.040  1.00 157.18 ? 75   ASN A C     1 
ATOM   564   O  O     . ASN A 1  75   ? 35.316  -40.491  17.873  1.00 156.31 ? 75   ASN A O     1 
ATOM   565   C  CB    . ASN A 1  75   ? 33.368  -38.859  16.006  1.00 153.16 ? 75   ASN A CB    1 
ATOM   566   C  CG    . ASN A 1  75   ? 32.103  -38.915  16.820  1.00 166.03 ? 75   ASN A CG    1 
ATOM   567   O  OD1   . ASN A 1  75   ? 31.738  -39.960  17.370  1.00 157.22 ? 75   ASN A OD1   1 
ATOM   568   N  ND2   . ASN A 1  75   ? 31.420  -37.783  16.937  1.00 154.94 ? 75   ASN A ND2   1 
ATOM   569   N  N     . GLU A 1  76   ? 36.712  -39.605  16.309  1.00 153.44 ? 76   GLU A N     1 
ATOM   570   C  CA    . GLU A 1  76   ? 37.789  -40.588  16.384  1.00 153.00 ? 76   GLU A CA    1 
ATOM   571   C  C     . GLU A 1  76   ? 39.055  -39.966  16.993  1.00 156.69 ? 76   GLU A C     1 
ATOM   572   O  O     . GLU A 1  76   ? 39.666  -40.600  17.858  1.00 156.63 ? 76   GLU A O     1 
ATOM   573   C  CB    . GLU A 1  76   ? 38.064  -41.209  15.003  1.00 154.88 ? 76   GLU A CB    1 
ATOM   574   C  CG    . GLU A 1  76   ? 39.225  -42.192  14.963  1.00 163.55 ? 76   GLU A CG    1 
ATOM   575   C  CD    . GLU A 1  76   ? 38.974  -43.565  15.547  1.00 175.72 ? 76   GLU A CD    1 
ATOM   576   O  OE1   . GLU A 1  76   ? 38.650  -44.489  14.767  1.00 169.27 ? 76   GLU A OE1   1 
ATOM   577   O  OE2   . GLU A 1  76   ? 39.152  -43.727  16.776  1.00 161.47 ? 76   GLU A OE2   1 
ATOM   578   N  N     . CYS A 1  77   ? 39.446  -38.738  16.561  1.00 152.68 ? 77   CYS A N     1 
ATOM   579   C  CA    . CYS A 1  77   ? 40.641  -38.065  17.091  1.00 152.39 ? 77   CYS A CA    1 
ATOM   580   C  C     . CYS A 1  77   ? 40.441  -37.568  18.525  1.00 156.01 ? 77   CYS A C     1 
ATOM   581   O  O     . CYS A 1  77   ? 39.542  -36.758  18.762  1.00 155.17 ? 77   CYS A O     1 
ATOM   582   C  CB    . CYS A 1  77   ? 41.132  -36.950  16.173  1.00 153.01 ? 77   CYS A CB    1 
ATOM   583   S  SG    . CYS A 1  77   ? 42.679  -36.177  16.719  1.00 157.19 ? 77   CYS A SG    1 
ATOM   584   N  N     . PRO A 1  78   ? 41.278  -38.025  19.490  1.00 153.09 ? 78   PRO A N     1 
ATOM   585   C  CA    . PRO A 1  78   ? 41.092  -37.602  20.890  1.00 152.55 ? 78   PRO A CA    1 
ATOM   586   C  C     . PRO A 1  78   ? 41.596  -36.200  21.233  1.00 156.89 ? 78   PRO A C     1 
ATOM   587   O  O     . PRO A 1  78   ? 41.120  -35.605  22.202  1.00 156.03 ? 78   PRO A O     1 
ATOM   588   C  CB    . PRO A 1  78   ? 41.838  -38.682  21.693  1.00 154.21 ? 78   PRO A CB    1 
ATOM   589   C  CG    . PRO A 1  78   ? 42.276  -39.732  20.682  1.00 158.99 ? 78   PRO A CG    1 
ATOM   590   C  CD    . PRO A 1  78   ? 42.372  -39.007  19.384  1.00 155.11 ? 78   PRO A CD    1 
ATOM   591   N  N     . GLY A 1  79   ? 42.550  -35.697  20.450  1.00 154.12 ? 79   GLY A N     1 
ATOM   592   C  CA    . GLY A 1  79   ? 43.172  -34.394  20.648  1.00 154.09 ? 79   GLY A CA    1 
ATOM   593   C  C     . GLY A 1  79   ? 44.603  -34.561  21.109  1.00 158.00 ? 79   GLY A C     1 
ATOM   594   O  O     . GLY A 1  79   ? 44.864  -35.327  22.042  1.00 157.36 ? 79   GLY A O     1 
ATOM   595   N  N     . HIS A 1  80   ? 45.541  -33.856  20.454  1.00 155.00 ? 80   HIS A N     1 
ATOM   596   C  CA    . HIS A 1  80   ? 46.975  -33.940  20.763  1.00 155.13 ? 80   HIS A CA    1 
ATOM   597   C  C     . HIS A 1  80   ? 47.444  -32.738  21.593  1.00 157.36 ? 80   HIS A C     1 
ATOM   598   O  O     . HIS A 1  80   ? 47.329  -31.595  21.145  1.00 157.62 ? 80   HIS A O     1 
ATOM   599   C  CB    . HIS A 1  80   ? 47.799  -34.108  19.475  1.00 156.89 ? 80   HIS A CB    1 
ATOM   600   C  CG    . HIS A 1  80   ? 47.212  -35.101  18.524  1.00 160.17 ? 80   HIS A CG    1 
ATOM   601   N  ND1   . HIS A 1  80   ? 47.440  -36.457  18.668  1.00 161.77 ? 80   HIS A ND1   1 
ATOM   602   C  CD2   . HIS A 1  80   ? 46.381  -34.902  17.474  1.00 162.00 ? 80   HIS A CD2   1 
ATOM   603   C  CE1   . HIS A 1  80   ? 46.760  -37.038  17.694  1.00 161.23 ? 80   HIS A CE1   1 
ATOM   604   N  NE2   . HIS A 1  80   ? 46.104  -36.142  16.951  1.00 161.68 ? 80   HIS A NE2   1 
ATOM   605   N  N     . PHE A 1  81   ? 47.920  -33.004  22.822  1.00 151.52 ? 81   PHE A N     1 
ATOM   606   C  CA    . PHE A 1  81   ? 48.360  -31.993  23.784  1.00 150.54 ? 81   PHE A CA    1 
ATOM   607   C  C     . PHE A 1  81   ? 49.444  -31.061  23.276  1.00 155.22 ? 81   PHE A C     1 
ATOM   608   O  O     . PHE A 1  81   ? 50.325  -31.483  22.529  1.00 154.95 ? 81   PHE A O     1 
ATOM   609   C  CB    . PHE A 1  81   ? 48.796  -32.653  25.102  1.00 151.52 ? 81   PHE A CB    1 
ATOM   610   C  CG    . PHE A 1  81   ? 47.776  -32.571  26.212  1.00 151.44 ? 81   PHE A CG    1 
ATOM   611   C  CD1   . PHE A 1  81   ? 46.756  -33.508  26.313  1.00 153.22 ? 81   PHE A CD1   1 
ATOM   612   C  CD2   . PHE A 1  81   ? 47.846  -31.567  27.167  1.00 152.98 ? 81   PHE A CD2   1 
ATOM   613   C  CE1   . PHE A 1  81   ? 45.814  -33.431  27.340  1.00 153.12 ? 81   PHE A CE1   1 
ATOM   614   C  CE2   . PHE A 1  81   ? 46.908  -31.496  28.198  1.00 154.77 ? 81   PHE A CE2   1 
ATOM   615   C  CZ    . PHE A 1  81   ? 45.893  -32.420  28.270  1.00 152.04 ? 81   PHE A CZ    1 
ATOM   616   N  N     . GLY A 1  82   ? 49.342  -29.799  23.681  1.00 152.78 ? 82   GLY A N     1 
ATOM   617   C  CA    . GLY A 1  82   ? 50.296  -28.746  23.362  1.00 154.17 ? 82   GLY A CA    1 
ATOM   618   C  C     . GLY A 1  82   ? 50.987  -28.248  24.614  1.00 160.20 ? 82   GLY A C     1 
ATOM   619   O  O     . GLY A 1  82   ? 50.762  -28.790  25.701  1.00 159.11 ? 82   GLY A O     1 
ATOM   620   N  N     . HIS A 1  83   ? 51.839  -27.219  24.481  1.00 159.38 ? 83   HIS A N     1 
ATOM   621   C  CA    . HIS A 1  83   ? 52.555  -26.660  25.633  1.00 160.24 ? 83   HIS A CA    1 
ATOM   622   C  C     . HIS A 1  83   ? 52.705  -25.134  25.586  1.00 165.39 ? 83   HIS A C     1 
ATOM   623   O  O     . HIS A 1  83   ? 52.534  -24.521  24.531  1.00 165.07 ? 83   HIS A O     1 
ATOM   624   C  CB    . HIS A 1  83   ? 53.917  -27.357  25.840  1.00 161.88 ? 83   HIS A CB    1 
ATOM   625   C  CG    . HIS A 1  83   ? 55.025  -26.796  25.003  1.00 166.65 ? 83   HIS A CG    1 
ATOM   626   N  ND1   . HIS A 1  83   ? 56.202  -26.353  25.574  1.00 169.34 ? 83   HIS A ND1   1 
ATOM   627   C  CD2   . HIS A 1  83   ? 55.079  -26.579  23.668  1.00 169.04 ? 83   HIS A CD2   1 
ATOM   628   C  CE1   . HIS A 1  83   ? 56.942  -25.907  24.572  1.00 169.81 ? 83   HIS A CE1   1 
ATOM   629   N  NE2   . HIS A 1  83   ? 56.307  -26.026  23.405  1.00 170.00 ? 83   HIS A NE2   1 
ATOM   630   N  N     . ILE A 1  84   ? 53.032  -24.538  26.744  1.00 162.87 ? 84   ILE A N     1 
ATOM   631   C  CA    . ILE A 1  84   ? 53.247  -23.103  26.932  1.00 163.68 ? 84   ILE A CA    1 
ATOM   632   C  C     . ILE A 1  84   ? 54.442  -22.862  27.890  1.00 168.86 ? 84   ILE A C     1 
ATOM   633   O  O     . ILE A 1  84   ? 54.478  -23.401  29.002  1.00 167.74 ? 84   ILE A O     1 
ATOM   634   C  CB    . ILE A 1  84   ? 51.923  -22.336  27.281  1.00 166.26 ? 84   ILE A CB    1 
ATOM   635   C  CG1   . ILE A 1  84   ? 52.131  -20.803  27.382  1.00 167.41 ? 84   ILE A CG1   1 
ATOM   636   C  CG2   . ILE A 1  84   ? 51.203  -22.911  28.507  1.00 166.17 ? 84   ILE A CG2   1 
ATOM   637   C  CD1   . ILE A 1  84   ? 50.847  -19.966  27.545  1.00 173.51 ? 84   ILE A CD1   1 
ATOM   638   N  N     . ASP A 1  85   ? 55.444  -22.107  27.412  1.00 167.22 ? 85   ASP A N     1 
ATOM   639   C  CA    . ASP A 1  85   ? 56.657  -21.809  28.169  1.00 168.08 ? 85   ASP A CA    1 
ATOM   640   C  C     . ASP A 1  85   ? 56.455  -20.588  29.059  1.00 173.57 ? 85   ASP A C     1 
ATOM   641   O  O     . ASP A 1  85   ? 56.334  -19.462  28.563  1.00 173.16 ? 85   ASP A O     1 
ATOM   642   C  CB    . ASP A 1  85   ? 57.864  -21.634  27.228  1.00 170.86 ? 85   ASP A CB    1 
ATOM   643   C  CG    . ASP A 1  85   ? 58.112  -22.816  26.308  1.00 178.33 ? 85   ASP A CG    1 
ATOM   644   O  OD1   . ASP A 1  85   ? 58.475  -23.897  26.816  1.00 178.03 ? 85   ASP A OD1   1 
ATOM   645   O  OD2   . ASP A 1  85   ? 57.962  -22.652  25.079  1.00 183.33 ? 85   ASP A OD2   1 
ATOM   646   N  N     . LEU A 1  86   ? 56.386  -20.832  30.381  1.00 171.55 ? 86   LEU A N     1 
ATOM   647   C  CA    . LEU A 1  86   ? 56.199  -19.808  31.417  1.00 172.26 ? 86   LEU A CA    1 
ATOM   648   C  C     . LEU A 1  86   ? 57.502  -19.021  31.633  1.00 179.03 ? 86   LEU A C     1 
ATOM   649   O  O     . LEU A 1  86   ? 58.571  -19.633  31.706  1.00 179.03 ? 86   LEU A O     1 
ATOM   650   C  CB    . LEU A 1  86   ? 55.736  -20.458  32.742  1.00 171.46 ? 86   LEU A CB    1 
ATOM   651   C  CG    . LEU A 1  86   ? 54.313  -21.035  32.779  1.00 174.97 ? 86   LEU A CG    1 
ATOM   652   C  CD1   . LEU A 1  86   ? 54.256  -22.306  33.603  1.00 174.27 ? 86   LEU A CD1   1 
ATOM   653   C  CD2   . LEU A 1  86   ? 53.325  -20.021  33.325  1.00 177.35 ? 86   LEU A CD2   1 
ATOM   654   N  N     . ALA A 1  87   ? 57.415  -17.672  31.726  1.00 177.42 ? 87   ALA A N     1 
ATOM   655   C  CA    . ALA A 1  87   ? 58.580  -16.796  31.922  1.00 178.89 ? 87   ALA A CA    1 
ATOM   656   C  C     . ALA A 1  87   ? 59.240  -16.981  33.306  1.00 184.12 ? 87   ALA A C     1 
ATOM   657   O  O     . ALA A 1  87   ? 60.425  -17.327  33.368  1.00 184.55 ? 87   ALA A O     1 
ATOM   658   C  CB    . ALA A 1  87   ? 58.203  -15.341  31.681  1.00 180.01 ? 87   ALA A CB    1 
ATOM   659   N  N     . LYS A 1  88   ? 58.472  -16.789  34.402  1.00 180.46 ? 88   LYS A N     1 
ATOM   660   C  CA    . LYS A 1  88   ? 58.954  -16.984  35.773  1.00 180.38 ? 88   LYS A CA    1 
ATOM   661   C  C     . LYS A 1  88   ? 58.206  -18.193  36.380  1.00 184.23 ? 88   LYS A C     1 
ATOM   662   O  O     . LYS A 1  88   ? 56.972  -18.155  36.421  1.00 183.03 ? 88   LYS A O     1 
ATOM   663   C  CB    . LYS A 1  88   ? 58.773  -15.704  36.617  1.00 182.68 ? 88   LYS A CB    1 
ATOM   664   C  CG    . LYS A 1  88   ? 59.526  -15.738  37.943  1.00 192.19 ? 88   LYS A CG    1 
ATOM   665   C  CD    . LYS A 1  88   ? 59.678  -14.362  38.556  1.00 199.19 ? 88   LYS A CD    1 
ATOM   666   C  CE    . LYS A 1  88   ? 60.068  -14.453  40.012  1.00 206.16 ? 88   LYS A CE    1 
ATOM   667   N  NZ    . LYS A 1  88   ? 59.847  -13.169  40.722  1.00 213.11 ? 88   LYS A NZ    1 
ATOM   668   N  N     . PRO A 1  89   ? 58.918  -19.283  36.805  1.00 181.55 ? 89   PRO A N     1 
ATOM   669   C  CA    . PRO A 1  89   ? 58.214  -20.472  37.342  1.00 180.39 ? 89   PRO A CA    1 
ATOM   670   C  C     . PRO A 1  89   ? 57.281  -20.223  38.532  1.00 183.34 ? 89   PRO A C     1 
ATOM   671   O  O     . PRO A 1  89   ? 57.690  -19.639  39.540  1.00 183.09 ? 89   PRO A O     1 
ATOM   672   C  CB    . PRO A 1  89   ? 59.345  -21.459  37.665  1.00 182.57 ? 89   PRO A CB    1 
ATOM   673   C  CG    . PRO A 1  89   ? 60.579  -20.641  37.727  1.00 188.29 ? 89   PRO A CG    1 
ATOM   674   C  CD    . PRO A 1  89   ? 60.380  -19.498  36.779  1.00 184.28 ? 89   PRO A CD    1 
ATOM   675   N  N     . VAL A 1  90   ? 56.007  -20.658  38.375  1.00 178.60 ? 90   VAL A N     1 
ATOM   676   C  CA    . VAL A 1  90   ? 54.907  -20.495  39.340  1.00 177.17 ? 90   VAL A CA    1 
ATOM   677   C  C     . VAL A 1  90   ? 54.500  -21.789  40.077  1.00 178.78 ? 90   VAL A C     1 
ATOM   678   O  O     . VAL A 1  90   ? 54.842  -22.891  39.641  1.00 178.11 ? 90   VAL A O     1 
ATOM   679   C  CB    . VAL A 1  90   ? 53.685  -19.720  38.756  1.00 180.50 ? 90   VAL A CB    1 
ATOM   680   C  CG1   . VAL A 1  90   ? 54.034  -18.258  38.493  1.00 181.14 ? 90   VAL A CG1   1 
ATOM   681   C  CG2   . VAL A 1  90   ? 53.133  -20.387  37.496  1.00 179.81 ? 90   VAL A CG2   1 
ATOM   682   N  N     . PHE A 1  91   ? 53.756  -21.632  41.194  1.00 173.47 ? 91   PHE A N     1 
ATOM   683   C  CA    . PHE A 1  91   ? 53.275  -22.713  42.058  1.00 171.61 ? 91   PHE A CA    1 
ATOM   684   C  C     . PHE A 1  91   ? 52.099  -23.524  41.456  1.00 171.47 ? 91   PHE A C     1 
ATOM   685   O  O     . PHE A 1  91   ? 51.820  -23.435  40.261  1.00 170.85 ? 91   PHE A O     1 
ATOM   686   C  CB    . PHE A 1  91   ? 52.893  -22.153  43.449  1.00 173.42 ? 91   PHE A CB    1 
ATOM   687   C  CG    . PHE A 1  91   ? 53.980  -21.571  44.330  1.00 175.90 ? 91   PHE A CG    1 
ATOM   688   C  CD1   . PHE A 1  91   ? 55.068  -22.345  44.728  1.00 179.34 ? 91   PHE A CD1   1 
ATOM   689   C  CD2   . PHE A 1  91   ? 53.847  -20.297  44.873  1.00 178.51 ? 91   PHE A CD2   1 
ATOM   690   C  CE1   . PHE A 1  91   ? 56.041  -21.823  45.588  1.00 181.14 ? 91   PHE A CE1   1 
ATOM   691   C  CE2   . PHE A 1  91   ? 54.815  -19.779  45.739  1.00 182.20 ? 91   PHE A CE2   1 
ATOM   692   C  CZ    . PHE A 1  91   ? 55.905  -20.545  46.091  1.00 180.69 ? 91   PHE A CZ    1 
ATOM   693   N  N     . HIS A 1  92   ? 51.422  -24.317  42.310  1.00 165.32 ? 92   HIS A N     1 
ATOM   694   C  CA    . HIS A 1  92   ? 50.289  -25.183  41.993  1.00 163.23 ? 92   HIS A CA    1 
ATOM   695   C  C     . HIS A 1  92   ? 49.336  -25.183  43.199  1.00 166.21 ? 92   HIS A C     1 
ATOM   696   O  O     . HIS A 1  92   ? 49.775  -25.439  44.323  1.00 166.04 ? 92   HIS A O     1 
ATOM   697   C  CB    . HIS A 1  92   ? 50.815  -26.600  41.746  1.00 163.30 ? 92   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1  92   ? 49.874  -27.501  41.022  1.00 165.47 ? 92   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1  92   ? 50.259  -28.150  39.869  1.00 167.18 ? 92   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1  92   ? 48.616  -27.884  41.341  1.00 165.93 ? 92   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1  92   ? 49.222  -28.882  39.508  1.00 165.63 ? 92   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1  92   ? 48.206  -28.743  40.355  1.00 165.27 ? 92   HIS A NE2   1 
ATOM   703   N  N     . VAL A 1  93   ? 48.044  -24.890  42.964  1.00 161.78 ? 93   VAL A N     1 
ATOM   704   C  CA    . VAL A 1  93   ? 46.985  -24.820  43.990  1.00 160.81 ? 93   VAL A CA    1 
ATOM   705   C  C     . VAL A 1  93   ? 46.887  -26.035  44.909  1.00 163.26 ? 93   VAL A C     1 
ATOM   706   O  O     . VAL A 1  93   ? 46.693  -25.874  46.115  1.00 162.30 ? 93   VAL A O     1 
ATOM   707   C  CB    . VAL A 1  93   ? 45.597  -24.475  43.405  1.00 164.37 ? 93   VAL A CB    1 
ATOM   708   C  CG1   . VAL A 1  93   ? 45.316  -22.981  43.480  1.00 164.56 ? 93   VAL A CG1   1 
ATOM   709   C  CG2   . VAL A 1  93   ? 45.435  -25.012  41.986  1.00 164.03 ? 93   VAL A CG2   1 
ATOM   710   N  N     . GLY A 1  94   ? 46.980  -27.227  44.324  1.00 159.26 ? 94   GLY A N     1 
ATOM   711   C  CA    . GLY A 1  94   ? 46.902  -28.488  45.051  1.00 158.42 ? 94   GLY A CA    1 
ATOM   712   C  C     . GLY A 1  94   ? 48.137  -28.779  45.876  1.00 162.30 ? 94   GLY A C     1 
ATOM   713   O  O     . GLY A 1  94   ? 48.041  -29.408  46.934  1.00 161.20 ? 94   GLY A O     1 
ATOM   714   N  N     . PHE A 1  95   ? 49.308  -28.323  45.390  1.00 159.86 ? 95   PHE A N     1 
ATOM   715   C  CA    . PHE A 1  95   ? 50.597  -28.517  46.057  1.00 160.58 ? 95   PHE A CA    1 
ATOM   716   C  C     . PHE A 1  95   ? 51.053  -27.292  46.882  1.00 166.39 ? 95   PHE A C     1 
ATOM   717   O  O     . PHE A 1  95   ? 52.211  -27.241  47.311  1.00 166.72 ? 95   PHE A O     1 
ATOM   718   C  CB    . PHE A 1  95   ? 51.678  -28.961  45.047  1.00 162.76 ? 95   PHE A CB    1 
ATOM   719   C  CG    . PHE A 1  95   ? 51.322  -30.159  44.195  1.00 163.61 ? 95   PHE A CG    1 
ATOM   720   C  CD1   . PHE A 1  95   ? 51.178  -30.035  42.820  1.00 166.34 ? 95   PHE A CD1   1 
ATOM   721   C  CD2   . PHE A 1  95   ? 51.138  -31.413  44.768  1.00 165.23 ? 95   PHE A CD2   1 
ATOM   722   C  CE1   . PHE A 1  95   ? 50.853  -31.140  42.031  1.00 166.68 ? 95   PHE A CE1   1 
ATOM   723   C  CE2   . PHE A 1  95   ? 50.807  -32.518  43.978  1.00 167.45 ? 95   PHE A CE2   1 
ATOM   724   C  CZ    . PHE A 1  95   ? 50.675  -32.375  42.615  1.00 165.43 ? 95   PHE A CZ    1 
ATOM   725   N  N     . ILE A 1  96   ? 50.131  -26.329  47.136  1.00 163.52 ? 96   ILE A N     1 
ATOM   726   C  CA    . ILE A 1  96   ? 50.398  -25.116  47.922  1.00 164.22 ? 96   ILE A CA    1 
ATOM   727   C  C     . ILE A 1  96   ? 50.743  -25.454  49.385  1.00 168.65 ? 96   ILE A C     1 
ATOM   728   O  O     . ILE A 1  96   ? 51.549  -24.754  50.001  1.00 169.03 ? 96   ILE A O     1 
ATOM   729   C  CB    . ILE A 1  96   ? 49.262  -24.055  47.770  1.00 167.27 ? 96   ILE A CB    1 
ATOM   730   C  CG1   . ILE A 1  96   ? 49.792  -22.617  47.968  1.00 168.55 ? 96   ILE A CG1   1 
ATOM   731   C  CG2   . ILE A 1  96   ? 48.036  -24.351  48.659  1.00 167.41 ? 96   ILE A CG2   1 
ATOM   732   C  CD1   . ILE A 1  96   ? 49.076  -21.532  47.114  1.00 175.81 ? 96   ILE A CD1   1 
ATOM   733   N  N     . ALA A 1  97   ? 50.145  -26.545  49.915  1.00 164.68 ? 97   ALA A N     1 
ATOM   734   C  CA    . ALA A 1  97   ? 50.365  -27.046  51.271  1.00 164.51 ? 97   ALA A CA    1 
ATOM   735   C  C     . ALA A 1  97   ? 51.519  -28.047  51.295  1.00 168.92 ? 97   ALA A C     1 
ATOM   736   O  O     . ALA A 1  97   ? 52.207  -28.146  52.315  1.00 169.06 ? 97   ALA A O     1 
ATOM   737   C  CB    . ALA A 1  97   ? 49.097  -27.696  51.803  1.00 164.33 ? 97   ALA A CB    1 
ATOM   738   N  N     . LYS A 1  98   ? 51.727  -28.791  50.173  1.00 165.25 ? 98   LYS A N     1 
ATOM   739   C  CA    . LYS A 1  98   ? 52.806  -29.778  50.036  1.00 165.36 ? 98   LYS A CA    1 
ATOM   740   C  C     . LYS A 1  98   ? 54.173  -29.114  49.892  1.00 170.68 ? 98   LYS A C     1 
ATOM   741   O  O     . LYS A 1  98   ? 55.149  -29.648  50.419  1.00 171.27 ? 98   LYS A O     1 
ATOM   742   C  CB    . LYS A 1  98   ? 52.538  -30.801  48.914  1.00 166.91 ? 98   LYS A CB    1 
ATOM   743   C  CG    . LYS A 1  98   ? 53.310  -32.132  49.060  1.00 172.35 ? 98   LYS A CG    1 
ATOM   744   C  CD    . LYS A 1  98   ? 52.911  -32.976  50.294  1.00 177.46 ? 98   LYS A CD    1 
ATOM   745   C  CE    . LYS A 1  98   ? 51.661  -33.802  50.099  1.00 183.59 ? 98   LYS A CE    1 
ATOM   746   N  NZ    . LYS A 1  98   ? 51.268  -34.519  51.339  1.00 189.67 ? 98   LYS A NZ    1 
ATOM   747   N  N     . ILE A 1  99   ? 54.247  -27.943  49.218  1.00 167.12 ? 99   ILE A N     1 
ATOM   748   C  CA    . ILE A 1  99   ? 55.495  -27.181  49.107  1.00 167.80 ? 99   ILE A CA    1 
ATOM   749   C  C     . ILE A 1  99   ? 55.912  -26.732  50.530  1.00 172.56 ? 99   ILE A C     1 
ATOM   750   O  O     . ILE A 1  99   ? 57.054  -26.976  50.922  1.00 172.84 ? 99   ILE A O     1 
ATOM   751   C  CB    . ILE A 1  99   ? 55.385  -26.032  48.057  1.00 170.91 ? 99   ILE A CB    1 
ATOM   752   C  CG1   . ILE A 1  99   ? 55.365  -26.589  46.611  1.00 171.03 ? 99   ILE A CG1   1 
ATOM   753   C  CG2   . ILE A 1  99   ? 56.473  -24.960  48.220  1.00 172.77 ? 99   ILE A CG2   1 
ATOM   754   C  CD1   . ILE A 1  99   ? 56.654  -27.369  46.112  1.00 178.52 ? 99   ILE A CD1   1 
ATOM   755   N  N     . LYS A 1  100  ? 54.943  -26.198  51.323  1.00 168.81 ? 100  LYS A N     1 
ATOM   756   C  CA    . LYS A 1  100  ? 55.092  -25.760  52.722  1.00 168.81 ? 100  LYS A CA    1 
ATOM   757   C  C     . LYS A 1  100  ? 55.667  -26.875  53.615  1.00 172.49 ? 100  LYS A C     1 
ATOM   758   O  O     . LYS A 1  100  ? 56.580  -26.609  54.398  1.00 172.82 ? 100  LYS A O     1 
ATOM   759   C  CB    . LYS A 1  100  ? 53.733  -25.277  53.276  1.00 170.55 ? 100  LYS A CB    1 
ATOM   760   C  CG    . LYS A 1  100  ? 53.813  -24.416  54.539  1.00 184.21 ? 100  LYS A CG    1 
ATOM   761   C  CD    . LYS A 1  100  ? 53.414  -25.164  55.810  1.00 192.02 ? 100  LYS A CD    1 
ATOM   762   C  CE    . LYS A 1  100  ? 53.185  -24.217  56.966  1.00 197.32 ? 100  LYS A CE    1 
ATOM   763   N  NZ    . LYS A 1  100  ? 53.292  -24.905  58.282  1.00 200.76 ? 100  LYS A NZ    1 
ATOM   764   N  N     . LYS A 1  101  ? 55.130  -28.112  53.489  1.00 168.02 ? 101  LYS A N     1 
ATOM   765   C  CA    . LYS A 1  101  ? 55.557  -29.288  54.255  1.00 167.72 ? 101  LYS A CA    1 
ATOM   766   C  C     . LYS A 1  101  ? 56.982  -29.742  53.913  1.00 173.55 ? 101  LYS A C     1 
ATOM   767   O  O     . LYS A 1  101  ? 57.699  -30.166  54.819  1.00 173.69 ? 101  LYS A O     1 
ATOM   768   C  CB    . LYS A 1  101  ? 54.561  -30.453  54.103  1.00 168.39 ? 101  LYS A CB    1 
ATOM   769   C  CG    . LYS A 1  101  ? 53.309  -30.324  54.975  1.00 171.58 ? 101  LYS A CG    1 
ATOM   770   C  CD    . LYS A 1  101  ? 52.386  -31.545  54.881  1.00 174.98 ? 101  LYS A CD    1 
ATOM   771   C  CE    . LYS A 1  101  ? 51.426  -31.483  53.711  1.00 179.38 ? 101  LYS A CE    1 
ATOM   772   N  NZ    . LYS A 1  101  ? 50.510  -32.651  53.683  1.00 183.40 ? 101  LYS A NZ    1 
ATOM   773   N  N     . VAL A 1  102  ? 57.391  -29.654  52.624  1.00 171.20 ? 102  VAL A N     1 
ATOM   774   C  CA    . VAL A 1  102  ? 58.731  -30.057  52.154  1.00 172.46 ? 102  VAL A CA    1 
ATOM   775   C  C     . VAL A 1  102  ? 59.785  -28.945  52.402  1.00 178.03 ? 102  VAL A C     1 
ATOM   776   O  O     . VAL A 1  102  ? 60.981  -29.239  52.502  1.00 178.26 ? 102  VAL A O     1 
ATOM   777   C  CB    . VAL A 1  102  ? 58.738  -30.640  50.702  1.00 176.53 ? 102  VAL A CB    1 
ATOM   778   C  CG1   . VAL A 1  102  ? 60.097  -31.235  50.335  1.00 177.37 ? 102  VAL A CG1   1 
ATOM   779   C  CG2   . VAL A 1  102  ? 57.658  -31.708  50.532  1.00 175.38 ? 102  VAL A CG2   1 
ATOM   780   N  N     . CYS A 1  103  ? 59.328  -27.683  52.553  1.00 175.39 ? 103  CYS A N     1 
ATOM   781   C  CA    . CYS A 1  103  ? 60.190  -26.539  52.871  1.00 176.64 ? 103  CYS A CA    1 
ATOM   782   C  C     . CYS A 1  103  ? 60.657  -26.657  54.315  1.00 180.83 ? 103  CYS A C     1 
ATOM   783   O  O     . CYS A 1  103  ? 61.817  -26.386  54.611  1.00 181.45 ? 103  CYS A O     1 
ATOM   784   C  CB    . CYS A 1  103  ? 59.457  -25.222  52.638  1.00 177.05 ? 103  CYS A CB    1 
ATOM   785   S  SG    . CYS A 1  103  ? 59.293  -24.762  50.896  1.00 181.12 ? 103  CYS A SG    1 
ATOM   786   N  N     . GLU A 1  104  ? 59.747  -27.096  55.199  1.00 176.60 ? 104  GLU A N     1 
ATOM   787   C  CA    . GLU A 1  104  ? 59.971  -27.293  56.629  1.00 176.68 ? 104  GLU A CA    1 
ATOM   788   C  C     . GLU A 1  104  ? 60.786  -28.566  56.948  1.00 181.86 ? 104  GLU A C     1 
ATOM   789   O  O     . GLU A 1  104  ? 61.231  -28.728  58.084  1.00 181.79 ? 104  GLU A O     1 
ATOM   790   C  CB    . GLU A 1  104  ? 58.626  -27.271  57.380  1.00 176.92 ? 104  GLU A CB    1 
ATOM   791   C  CG    . GLU A 1  104  ? 57.936  -25.914  57.315  1.00 185.64 ? 104  GLU A CG    1 
ATOM   792   C  CD    . GLU A 1  104  ? 56.493  -25.844  57.778  1.00 199.69 ? 104  GLU A CD    1 
ATOM   793   O  OE1   . GLU A 1  104  ? 55.754  -26.841  57.611  1.00 190.49 ? 104  GLU A OE1   1 
ATOM   794   O  OE2   . GLU A 1  104  ? 56.092  -24.768  58.278  1.00 190.45 ? 104  GLU A OE2   1 
ATOM   795   N  N     . CYS A 1  105  ? 61.002  -29.445  55.941  1.00 179.34 ? 105  CYS A N     1 
ATOM   796   C  CA    . CYS A 1  105  ? 61.747  -30.710  56.045  1.00 179.99 ? 105  CYS A CA    1 
ATOM   797   C  C     . CYS A 1  105  ? 63.201  -30.594  55.555  1.00 186.16 ? 105  CYS A C     1 
ATOM   798   O  O     . CYS A 1  105  ? 64.085  -31.263  56.091  1.00 186.66 ? 105  CYS A O     1 
ATOM   799   C  CB    . CYS A 1  105  ? 61.013  -31.830  55.305  1.00 179.39 ? 105  CYS A CB    1 
ATOM   800   S  SG    . CYS A 1  105  ? 59.580  -32.513  56.184  1.00 181.98 ? 105  CYS A SG    1 
ATOM   801   N  N     . VAL A 1  106  ? 63.428  -29.782  54.509  1.00 183.62 ? 106  VAL A N     1 
ATOM   802   C  CA    . VAL A 1  106  ? 64.713  -29.590  53.825  1.00 184.92 ? 106  VAL A CA    1 
ATOM   803   C  C     . VAL A 1  106  ? 65.423  -28.281  54.266  1.00 190.99 ? 106  VAL A C     1 
ATOM   804   O  O     . VAL A 1  106  ? 64.745  -27.320  54.638  1.00 190.44 ? 106  VAL A O     1 
ATOM   805   C  CB    . VAL A 1  106  ? 64.441  -29.646  52.287  1.00 188.34 ? 106  VAL A CB    1 
ATOM   806   C  CG1   . VAL A 1  106  ? 65.672  -29.297  51.462  1.00 189.33 ? 106  VAL A CG1   1 
ATOM   807   C  CG2   . VAL A 1  106  ? 63.890  -31.007  51.868  1.00 187.31 ? 106  VAL A CG2   1 
ATOM   808   N  N     . CYS A 1  107  ? 66.784  -28.253  54.223  1.00 189.47 ? 107  CYS A N     1 
ATOM   809   C  CA    . CYS A 1  107  ? 67.591  -27.062  54.539  1.00 190.68 ? 107  CYS A CA    1 
ATOM   810   C  C     . CYS A 1  107  ? 67.460  -26.011  53.421  1.00 194.38 ? 107  CYS A C     1 
ATOM   811   O  O     . CYS A 1  107  ? 67.245  -26.368  52.260  1.00 193.65 ? 107  CYS A O     1 
ATOM   812   C  CB    . CYS A 1  107  ? 69.053  -27.425  54.797  1.00 192.56 ? 107  CYS A CB    1 
ATOM   813   S  SG    . CYS A 1  107  ? 70.151  -25.992  55.018  1.00 197.94 ? 107  CYS A SG    1 
ATOM   814   N  N     . MET A 1  108  ? 67.629  -24.724  53.781  1.00 191.09 ? 108  MET A N     1 
ATOM   815   C  CA    . MET A 1  108  ? 67.488  -23.561  52.895  1.00 190.85 ? 108  MET A CA    1 
ATOM   816   C  C     . MET A 1  108  ? 68.617  -23.338  51.866  1.00 195.07 ? 108  MET A C     1 
ATOM   817   O  O     . MET A 1  108  ? 68.323  -23.176  50.678  1.00 194.11 ? 108  MET A O     1 
ATOM   818   C  CB    . MET A 1  108  ? 67.189  -22.282  53.708  1.00 193.22 ? 108  MET A CB    1 
ATOM   819   C  CG    . MET A 1  108  ? 66.096  -22.460  54.761  1.00 195.74 ? 108  MET A CG    1 
ATOM   820   S  SD    . MET A 1  108  ? 64.442  -22.792  54.087  1.00 198.24 ? 108  MET A SD    1 
ATOM   821   C  CE    . MET A 1  108  ? 63.846  -23.956  55.267  1.00 194.02 ? 108  MET A CE    1 
ATOM   822   N  N     . HIS A 1  109  ? 69.893  -23.309  52.314  1.00 192.36 ? 109  HIS A N     1 
ATOM   823   C  CA    . HIS A 1  109  ? 71.044  -23.098  51.427  1.00 192.93 ? 109  HIS A CA    1 
ATOM   824   C  C     . HIS A 1  109  ? 71.345  -24.326  50.560  1.00 196.20 ? 109  HIS A C     1 
ATOM   825   O  O     . HIS A 1  109  ? 71.327  -24.211  49.332  1.00 195.43 ? 109  HIS A O     1 
ATOM   826   C  CB    . HIS A 1  109  ? 72.282  -22.622  52.206  1.00 194.90 ? 109  HIS A CB    1 
ATOM   827   C  CG    . HIS A 1  109  ? 72.320  -21.142  52.435  1.00 198.64 ? 109  HIS A CG    1 
ATOM   828   N  ND1   . HIS A 1  109  ? 72.696  -20.267  51.432  1.00 201.05 ? 109  HIS A ND1   1 
ATOM   829   C  CD2   . HIS A 1  109  ? 72.046  -20.431  53.553  1.00 200.16 ? 109  HIS A CD2   1 
ATOM   830   C  CE1   . HIS A 1  109  ? 72.631  -19.058  51.966  1.00 200.71 ? 109  HIS A CE1   1 
ATOM   831   N  NE2   . HIS A 1  109  ? 72.248  -19.107  53.242  1.00 200.56 ? 109  HIS A NE2   1 
ATOM   832   N  N     . CYS A 1  110  ? 71.600  -25.499  51.192  1.00 192.65 ? 110  CYS A N     1 
ATOM   833   C  CA    . CYS A 1  110  ? 71.871  -26.749  50.473  1.00 192.24 ? 110  CYS A CA    1 
ATOM   834   C  C     . CYS A 1  110  ? 70.573  -27.503  50.095  1.00 193.76 ? 110  CYS A C     1 
ATOM   835   O  O     . CYS A 1  110  ? 69.773  -26.941  49.343  1.00 192.51 ? 110  CYS A O     1 
ATOM   836   C  CB    . CYS A 1  110  ? 72.906  -27.630  51.181  1.00 193.44 ? 110  CYS A CB    1 
ATOM   837   S  SG    . CYS A 1  110  ? 72.513  -28.046  52.904  1.00 196.74 ? 110  CYS A SG    1 
ATOM   838   N  N     . GLY A 1  111  ? 70.361  -28.721  50.606  1.00 189.56 ? 111  GLY A N     1 
ATOM   839   C  CA    . GLY A 1  111  ? 69.164  -29.499  50.286  1.00 188.02 ? 111  GLY A CA    1 
ATOM   840   C  C     . GLY A 1  111  ? 68.980  -30.843  50.972  1.00 191.15 ? 111  GLY A C     1 
ATOM   841   O  O     . GLY A 1  111  ? 68.048  -31.579  50.631  1.00 189.84 ? 111  GLY A O     1 
ATOM   842   N  N     . LYS A 1  112  ? 69.855  -31.183  51.941  1.00 187.87 ? 112  LYS A N     1 
ATOM   843   C  CA    . LYS A 1  112  ? 69.773  -32.441  52.693  1.00 186.97 ? 112  LYS A CA    1 
ATOM   844   C  C     . LYS A 1  112  ? 68.666  -32.338  53.752  1.00 189.94 ? 112  LYS A C     1 
ATOM   845   O  O     . LYS A 1  112  ? 68.233  -31.230  54.087  1.00 188.88 ? 112  LYS A O     1 
ATOM   846   C  CB    . LYS A 1  112  ? 71.127  -32.755  53.366  1.00 189.99 ? 112  LYS A CB    1 
ATOM   847   C  CG    . LYS A 1  112  ? 71.425  -34.245  53.511  1.00 191.75 ? 112  LYS A CG    1 
ATOM   848   C  CD    . LYS A 1  112  ? 72.204  -34.550  54.780  1.00 193.21 ? 112  LYS A CD    1 
ATOM   849   C  CE    . LYS A 1  112  ? 72.994  -35.829  54.662  1.00 194.77 ? 112  LYS A CE    1 
ATOM   850   N  NZ    . LYS A 1  112  ? 73.808  -36.090  55.877  1.00 199.46 ? 112  LYS A NZ    1 
ATOM   851   N  N     . LEU A 1  113  ? 68.208  -33.491  54.274  1.00 186.62 ? 113  LEU A N     1 
ATOM   852   C  CA    . LEU A 1  113  ? 67.200  -33.547  55.334  1.00 185.90 ? 113  LEU A CA    1 
ATOM   853   C  C     . LEU A 1  113  ? 67.831  -33.015  56.630  1.00 192.44 ? 113  LEU A C     1 
ATOM   854   O  O     . LEU A 1  113  ? 68.967  -33.384  56.952  1.00 193.47 ? 113  LEU A O     1 
ATOM   855   C  CB    . LEU A 1  113  ? 66.687  -34.995  55.518  1.00 185.05 ? 113  LEU A CB    1 
ATOM   856   C  CG    . LEU A 1  113  ? 65.183  -35.278  55.318  1.00 187.63 ? 113  LEU A CG    1 
ATOM   857   C  CD1   . LEU A 1  113  ? 64.341  -34.676  56.425  1.00 186.82 ? 113  LEU A CD1   1 
ATOM   858   C  CD2   . LEU A 1  113  ? 64.696  -34.873  53.932  1.00 189.15 ? 113  LEU A CD2   1 
ATOM   859   N  N     . LEU A 1  114  ? 67.114  -32.111  57.335  1.00 189.35 ? 114  LEU A N     1 
ATOM   860   C  CA    . LEU A 1  114  ? 67.548  -31.424  58.567  1.00 190.04 ? 114  LEU A CA    1 
ATOM   861   C  C     . LEU A 1  114  ? 68.041  -32.320  59.720  1.00 194.88 ? 114  LEU A C     1 
ATOM   862   O  O     . LEU A 1  114  ? 68.937  -31.904  60.464  1.00 195.48 ? 114  LEU A O     1 
ATOM   863   C  CB    . LEU A 1  114  ? 66.468  -30.445  59.073  1.00 189.19 ? 114  LEU A CB    1 
ATOM   864   C  CG    . LEU A 1  114  ? 66.058  -29.300  58.141  1.00 193.38 ? 114  LEU A CG    1 
ATOM   865   C  CD1   . LEU A 1  114  ? 64.663  -28.837  58.454  1.00 192.30 ? 114  LEU A CD1   1 
ATOM   866   C  CD2   . LEU A 1  114  ? 67.029  -28.131  58.223  1.00 196.76 ? 114  LEU A CD2   1 
ATOM   867   N  N     . LEU A 1  115  ? 67.448  -33.525  59.882  1.00 190.81 ? 115  LEU A N     1 
ATOM   868   C  CA    . LEU A 1  115  ? 67.820  -34.460  60.952  1.00 190.97 ? 115  LEU A CA    1 
ATOM   869   C  C     . LEU A 1  115  ? 68.242  -35.860  60.457  1.00 195.46 ? 115  LEU A C     1 
ATOM   870   O  O     . LEU A 1  115  ? 68.115  -36.848  61.187  1.00 194.51 ? 115  LEU A O     1 
ATOM   871   C  CB    . LEU A 1  115  ? 66.729  -34.524  62.044  1.00 189.97 ? 115  LEU A CB    1 
ATOM   872   C  CG    . LEU A 1  115  ? 66.376  -33.207  62.756  1.00 194.33 ? 115  LEU A CG    1 
ATOM   873   C  CD1   . LEU A 1  115  ? 65.133  -33.363  63.593  1.00 193.33 ? 115  LEU A CD1   1 
ATOM   874   C  CD2   . LEU A 1  115  ? 67.535  -32.698  63.608  1.00 197.88 ? 115  LEU A CD2   1 
ATOM   875   N  N     . ASP A 1  116  ? 68.795  -35.924  59.230  1.00 193.38 ? 116  ASP A N     1 
ATOM   876   C  CA    . ASP A 1  116  ? 69.281  -37.156  58.606  1.00 194.07 ? 116  ASP A CA    1 
ATOM   877   C  C     . ASP A 1  116  ? 70.563  -37.644  59.309  1.00 200.13 ? 116  ASP A C     1 
ATOM   878   O  O     . ASP A 1  116  ? 71.513  -36.874  59.421  1.00 200.76 ? 116  ASP A O     1 
ATOM   879   C  CB    . ASP A 1  116  ? 69.533  -36.942  57.100  1.00 196.13 ? 116  ASP A CB    1 
ATOM   880   C  CG    . ASP A 1  116  ? 69.966  -38.191  56.356  1.00 206.48 ? 116  ASP A CG    1 
ATOM   881   O  OD1   . ASP A 1  116  ? 69.092  -39.031  56.045  1.00 206.08 ? 116  ASP A OD1   1 
ATOM   882   O  OD2   . ASP A 1  116  ? 71.179  -38.325  56.076  1.00 213.09 ? 116  ASP A OD2   1 
ATOM   883   N  N     . GLU A 1  117  ? 70.612  -38.904  59.780  1.00 197.26 ? 117  GLU A N     1 
ATOM   884   C  CA    . GLU A 1  117  ? 69.534  -39.894  59.706  1.00 196.15 ? 117  GLU A CA    1 
ATOM   885   C  C     . GLU A 1  117  ? 69.278  -40.443  61.109  1.00 200.55 ? 117  GLU A C     1 
ATOM   886   O  O     . GLU A 1  117  ? 68.150  -40.369  61.597  1.00 199.41 ? 117  GLU A O     1 
ATOM   887   C  CB    . GLU A 1  117  ? 69.903  -41.027  58.722  1.00 197.75 ? 117  GLU A CB    1 
ATOM   888   C  CG    . GLU A 1  117  ? 68.721  -41.872  58.266  1.00 205.43 ? 117  GLU A CG    1 
ATOM   889   C  CD    . GLU A 1  117  ? 68.893  -43.377  58.361  1.00 220.68 ? 117  GLU A CD    1 
ATOM   890   O  OE1   . GLU A 1  117  ? 68.006  -44.035  58.951  1.00 207.86 ? 117  GLU A OE1   1 
ATOM   891   O  OE2   . GLU A 1  117  ? 69.898  -43.904  57.830  1.00 214.32 ? 117  GLU A OE2   1 
ATOM   892   N  N     . HIS A 1  118  ? 70.349  -40.951  61.761  1.00 198.19 ? 118  HIS A N     1 
ATOM   893   C  CA    . HIS A 1  118  ? 70.405  -41.548  63.103  1.00 198.21 ? 118  HIS A CA    1 
ATOM   894   C  C     . HIS A 1  118  ? 69.763  -40.705  64.214  1.00 200.62 ? 118  HIS A C     1 
ATOM   895   O  O     . HIS A 1  118  ? 69.273  -41.274  65.193  1.00 199.76 ? 118  HIS A O     1 
ATOM   896   C  CB    . HIS A 1  118  ? 71.871  -41.842  63.470  1.00 200.82 ? 118  HIS A CB    1 
ATOM   897   C  CG    . HIS A 1  118  ? 72.720  -40.608  63.572  1.00 205.23 ? 118  HIS A CG    1 
ATOM   898   N  ND1   . HIS A 1  118  ? 73.199  -39.964  62.442  1.00 207.37 ? 118  HIS A ND1   1 
ATOM   899   C  CD2   . HIS A 1  118  ? 73.116  -39.919  64.667  1.00 207.51 ? 118  HIS A CD2   1 
ATOM   900   C  CE1   . HIS A 1  118  ? 73.877  -38.921  62.886  1.00 207.56 ? 118  HIS A CE1   1 
ATOM   901   N  NE2   . HIS A 1  118  ? 73.856  -38.852  64.218  1.00 208.03 ? 118  HIS A NE2   1 
ATOM   902   N  N     . ASN A 1  119  ? 69.803  -39.357  64.062  1.00 196.48 ? 119  ASN A N     1 
ATOM   903   C  CA    . ASN A 1  119  ? 69.314  -38.326  64.982  1.00 195.60 ? 119  ASN A CA    1 
ATOM   904   C  C     . ASN A 1  119  ? 68.001  -38.650  65.712  1.00 197.74 ? 119  ASN A C     1 
ATOM   905   O  O     . ASN A 1  119  ? 66.920  -38.208  65.310  1.00 196.01 ? 119  ASN A O     1 
ATOM   906   C  CB    . ASN A 1  119  ? 69.285  -36.962  64.296  1.00 195.52 ? 119  ASN A CB    1 
ATOM   907   C  CG    . ASN A 1  119  ? 69.142  -35.818  65.256  1.00 216.80 ? 119  ASN A CG    1 
ATOM   908   O  OD1   . ASN A 1  119  ? 68.032  -35.407  65.601  1.00 209.54 ? 119  ASN A OD1   1 
ATOM   909   N  ND2   . ASN A 1  119  ? 70.264  -35.300  65.736  1.00 209.93 ? 119  ASN A ND2   1 
ATOM   910   N  N     . GLU A 1  120  ? 68.134  -39.431  66.802  1.00 194.51 ? 120  GLU A N     1 
ATOM   911   C  CA    . GLU A 1  120  ? 67.077  -39.910  67.695  1.00 193.38 ? 120  GLU A CA    1 
ATOM   912   C  C     . GLU A 1  120  ? 65.878  -40.570  66.984  1.00 194.83 ? 120  GLU A C     1 
ATOM   913   O  O     . GLU A 1  120  ? 66.030  -41.668  66.440  1.00 194.48 ? 120  GLU A O     1 
ATOM   914   C  CB    . GLU A 1  120  ? 66.694  -38.848  68.766  1.00 194.76 ? 120  GLU A CB    1 
ATOM   915   C  CG    . GLU A 1  120  ? 65.797  -39.326  69.910  1.00 205.21 ? 120  GLU A CG    1 
ATOM   916   C  CD    . GLU A 1  120  ? 66.272  -40.502  70.746  1.00 227.00 ? 120  GLU A CD    1 
ATOM   917   O  OE1   . GLU A 1  120  ? 67.327  -40.376  71.408  1.00 226.16 ? 120  GLU A OE1   1 
ATOM   918   O  OE2   . GLU A 1  120  ? 65.560  -41.532  70.777  1.00 219.07 ? 120  GLU A OE2   1 
ATOM   919   N  N     . LEU A 1  121  ? 64.710  -39.898  66.975  1.00 189.30 ? 121  LEU A N     1 
ATOM   920   C  CA    . LEU A 1  121  ? 63.466  -40.411  66.410  1.00 187.39 ? 121  LEU A CA    1 
ATOM   921   C  C     . LEU A 1  121  ? 63.340  -40.283  64.888  1.00 190.68 ? 121  LEU A C     1 
ATOM   922   O  O     . LEU A 1  121  ? 62.391  -40.828  64.322  1.00 189.30 ? 121  LEU A O     1 
ATOM   923   C  CB    . LEU A 1  121  ? 62.243  -39.814  67.142  1.00 186.22 ? 121  LEU A CB    1 
ATOM   924   C  CG    . LEU A 1  121  ? 62.106  -40.145  68.636  1.00 190.40 ? 121  LEU A CG    1 
ATOM   925   C  CD1   . LEU A 1  121  ? 61.381  -39.042  69.371  1.00 189.81 ? 121  LEU A CD1   1 
ATOM   926   C  CD2   . LEU A 1  121  ? 61.417  -41.487  68.854  1.00 191.67 ? 121  LEU A CD2   1 
ATOM   927   N  N     . MET A 1  122  ? 64.293  -39.593  64.221  1.00 187.82 ? 122  MET A N     1 
ATOM   928   C  CA    . MET A 1  122  ? 64.276  -39.432  62.764  1.00 187.35 ? 122  MET A CA    1 
ATOM   929   C  C     . MET A 1  122  ? 64.554  -40.763  62.045  1.00 190.73 ? 122  MET A C     1 
ATOM   930   O  O     . MET A 1  122  ? 63.953  -41.035  61.003  1.00 189.76 ? 122  MET A O     1 
ATOM   931   C  CB    . MET A 1  122  ? 65.213  -38.298  62.309  1.00 190.65 ? 122  MET A CB    1 
ATOM   932   C  CG    . MET A 1  122  ? 64.954  -37.817  60.879  1.00 194.01 ? 122  MET A CG    1 
ATOM   933   S  SD    . MET A 1  122  ? 63.256  -37.276  60.524  1.00 196.66 ? 122  MET A SD    1 
ATOM   934   C  CE    . MET A 1  122  ? 63.327  -35.620  61.079  1.00 193.68 ? 122  MET A CE    1 
ATOM   935   N  N     . ARG A 1  123  ? 65.429  -41.601  62.632  1.00 187.49 ? 123  ARG A N     1 
ATOM   936   C  CA    . ARG A 1  123  ? 65.764  -42.941  62.142  1.00 187.23 ? 123  ARG A CA    1 
ATOM   937   C  C     . ARG A 1  123  ? 64.625  -43.875  62.570  1.00 189.32 ? 123  ARG A C     1 
ATOM   938   O  O     . ARG A 1  123  ? 64.278  -44.809  61.842  1.00 187.87 ? 123  ARG A O     1 
ATOM   939   C  CB    . ARG A 1  123  ? 67.092  -43.397  62.766  1.00 188.68 ? 123  ARG A CB    1 
ATOM   940   C  CG    . ARG A 1  123  ? 67.630  -44.729  62.248  1.00 198.18 ? 123  ARG A CG    1 
ATOM   941   C  CD    . ARG A 1  123  ? 68.822  -45.202  63.060  1.00 205.63 ? 123  ARG A CD    1 
ATOM   942   N  NE    . ARG A 1  123  ? 68.480  -45.397  64.470  1.00 209.39 ? 123  ARG A NE    1 
ATOM   943   C  CZ    . ARG A 1  123  ? 69.269  -45.065  65.484  1.00 222.92 ? 123  ARG A CZ    1 
ATOM   944   N  NH1   . ARG A 1  123  ? 70.464  -44.530  65.257  1.00 210.55 ? 123  ARG A NH1   1 
ATOM   945   N  NH2   . ARG A 1  123  ? 68.874  -45.268  66.733  1.00 209.40 ? 123  ARG A NH2   1 
ATOM   946   N  N     . GLN A 1  124  ? 64.033  -43.582  63.752  1.00 185.62 ? 124  GLN A N     1 
ATOM   947   C  CA    . GLN A 1  124  ? 62.920  -44.298  64.383  1.00 184.47 ? 124  GLN A CA    1 
ATOM   948   C  C     . GLN A 1  124  ? 61.557  -43.818  63.822  1.00 186.44 ? 124  GLN A C     1 
ATOM   949   O  O     . GLN A 1  124  ? 60.561  -43.748  64.548  1.00 185.16 ? 124  GLN A O     1 
ATOM   950   C  CB    . GLN A 1  124  ? 63.006  -44.165  65.925  1.00 186.15 ? 124  GLN A CB    1 
ATOM   951   C  CG    . GLN A 1  124  ? 64.166  -44.961  66.552  1.00 200.95 ? 124  GLN A CG    1 
ATOM   952   C  CD    . GLN A 1  124  ? 64.621  -44.483  67.919  1.00 216.69 ? 124  GLN A CD    1 
ATOM   953   O  OE1   . GLN A 1  124  ? 63.842  -43.983  68.741  1.00 211.35 ? 124  GLN A OE1   1 
ATOM   954   N  NE2   . GLN A 1  124  ? 65.900  -44.681  68.211  1.00 207.09 ? 124  GLN A NE2   1 
ATOM   955   N  N     . ALA A 1  125  ? 61.541  -43.485  62.515  1.00 182.59 ? 125  ALA A N     1 
ATOM   956   C  CA    . ALA A 1  125  ? 60.391  -43.019  61.730  1.00 181.25 ? 125  ALA A CA    1 
ATOM   957   C  C     . ALA A 1  125  ? 60.607  -43.335  60.238  1.00 184.87 ? 125  ALA A C     1 
ATOM   958   O  O     . ALA A 1  125  ? 59.643  -43.354  59.465  1.00 183.51 ? 125  ALA A O     1 
ATOM   959   C  CB    . ALA A 1  125  ? 60.189  -41.522  61.923  1.00 181.80 ? 125  ALA A CB    1 
ATOM   960   N  N     . LEU A 1  126  ? 61.878  -43.584  59.848  1.00 182.15 ? 126  LEU A N     1 
ATOM   961   C  CA    . LEU A 1  126  ? 62.308  -43.921  58.489  1.00 181.97 ? 126  LEU A CA    1 
ATOM   962   C  C     . LEU A 1  126  ? 62.069  -45.405  58.191  1.00 185.41 ? 126  LEU A C     1 
ATOM   963   O  O     . LEU A 1  126  ? 62.009  -45.796  57.022  1.00 184.52 ? 126  LEU A O     1 
ATOM   964   C  CB    . LEU A 1  126  ? 63.798  -43.587  58.322  1.00 183.33 ? 126  LEU A CB    1 
ATOM   965   C  CG    . LEU A 1  126  ? 64.194  -42.983  56.982  1.00 188.26 ? 126  LEU A CG    1 
ATOM   966   C  CD1   . LEU A 1  126  ? 65.163  -41.834  57.172  1.00 189.25 ? 126  LEU A CD1   1 
ATOM   967   C  CD2   . LEU A 1  126  ? 64.761  -44.037  56.041  1.00 191.27 ? 126  LEU A CD2   1 
ATOM   968   N  N     . ALA A 1  127  ? 61.933  -46.221  59.259  1.00 182.31 ? 127  ALA A N     1 
ATOM   969   C  CA    . ALA A 1  127  ? 61.703  -47.668  59.210  1.00 182.18 ? 127  ALA A CA    1 
ATOM   970   C  C     . ALA A 1  127  ? 60.384  -48.053  58.534  1.00 184.97 ? 127  ALA A C     1 
ATOM   971   O  O     . ALA A 1  127  ? 60.346  -49.060  57.825  1.00 184.52 ? 127  ALA A O     1 
ATOM   972   C  CB    . ALA A 1  127  ? 61.766  -48.253  60.612  1.00 183.22 ? 127  ALA A CB    1 
ATOM   973   N  N     . ILE A 1  128  ? 59.311  -47.257  58.753  1.00 180.61 ? 128  ILE A N     1 
ATOM   974   C  CA    . ILE A 1  128  ? 57.991  -47.497  58.159  1.00 179.21 ? 128  ILE A CA    1 
ATOM   975   C  C     . ILE A 1  128  ? 58.010  -47.225  56.651  1.00 183.15 ? 128  ILE A C     1 
ATOM   976   O  O     . ILE A 1  128  ? 58.565  -46.215  56.216  1.00 183.15 ? 128  ILE A O     1 
ATOM   977   C  CB    . ILE A 1  128  ? 56.825  -46.803  58.940  1.00 181.16 ? 128  ILE A CB    1 
ATOM   978   C  CG1   . ILE A 1  128  ? 55.436  -47.363  58.555  1.00 180.41 ? 128  ILE A CG1   1 
ATOM   979   C  CG2   . ILE A 1  128  ? 56.872  -45.271  58.888  1.00 181.33 ? 128  ILE A CG2   1 
ATOM   980   C  CD1   . ILE A 1  128  ? 54.998  -48.607  59.349  1.00 186.10 ? 128  ILE A CD1   1 
ATOM   981   N  N     . LYS A 1  129  ? 57.463  -48.162  55.859  1.00 179.29 ? 129  LYS A N     1 
ATOM   982   C  CA    . LYS A 1  129  ? 57.446  -48.054  54.403  1.00 179.04 ? 129  LYS A CA    1 
ATOM   983   C  C     . LYS A 1  129  ? 56.089  -47.605  53.863  1.00 182.45 ? 129  LYS A C     1 
ATOM   984   O  O     . LYS A 1  129  ? 55.108  -48.346  53.966  1.00 181.54 ? 129  LYS A O     1 
ATOM   985   C  CB    . LYS A 1  129  ? 57.909  -49.370  53.746  1.00 181.72 ? 129  LYS A CB    1 
ATOM   986   C  CG    . LYS A 1  129  ? 59.201  -49.243  52.938  1.00 190.70 ? 129  LYS A CG    1 
ATOM   987   C  CD    . LYS A 1  129  ? 59.667  -50.591  52.379  1.00 194.86 ? 129  LYS A CD    1 
ATOM   988   C  CE    . LYS A 1  129  ? 59.456  -50.722  50.890  1.00 196.63 ? 129  LYS A CE    1 
ATOM   989   N  NZ    . LYS A 1  129  ? 59.899  -52.049  50.385  1.00 201.22 ? 129  LYS A NZ    1 
ATOM   990   N  N     . ASP A 1  130  ? 56.047  -46.371  53.309  1.00 179.13 ? 130  ASP A N     1 
ATOM   991   C  CA    . ASP A 1  130  ? 54.906  -45.697  52.662  1.00 178.09 ? 130  ASP A CA    1 
ATOM   992   C  C     . ASP A 1  130  ? 55.276  -44.275  52.191  1.00 182.16 ? 130  ASP A C     1 
ATOM   993   O  O     . ASP A 1  130  ? 56.457  -43.920  52.199  1.00 182.38 ? 130  ASP A O     1 
ATOM   994   C  CB    . ASP A 1  130  ? 53.604  -45.737  53.502  1.00 179.01 ? 130  ASP A CB    1 
ATOM   995   C  CG    . ASP A 1  130  ? 53.626  -44.926  54.775  1.00 189.21 ? 130  ASP A CG    1 
ATOM   996   O  OD1   . ASP A 1  130  ? 52.867  -43.944  54.857  1.00 189.14 ? 130  ASP A OD1   1 
ATOM   997   O  OD2   . ASP A 1  130  ? 54.368  -45.304  55.709  1.00 195.81 ? 130  ASP A OD2   1 
ATOM   998   N  N     . SER A 1  131  ? 54.279  -43.482  51.751  1.00 178.38 ? 131  SER A N     1 
ATOM   999   C  CA    . SER A 1  131  ? 54.483  -42.125  51.233  1.00 178.55 ? 131  SER A CA    1 
ATOM   1000  C  C     . SER A 1  131  ? 53.493  -41.082  51.804  1.00 181.09 ? 131  SER A C     1 
ATOM   1001  O  O     . SER A 1  131  ? 53.323  -40.001  51.223  1.00 180.90 ? 131  SER A O     1 
ATOM   1002  C  CB    . SER A 1  131  ? 54.444  -42.137  49.704  1.00 182.79 ? 131  SER A CB    1 
ATOM   1003  O  OG    . SER A 1  131  ? 53.237  -42.688  49.205  1.00 191.85 ? 131  SER A OG    1 
ATOM   1004  N  N     . LYS A 1  132  ? 52.862  -41.397  52.949  1.00 175.92 ? 132  LYS A N     1 
ATOM   1005  C  CA    . LYS A 1  132  ? 51.887  -40.513  53.580  1.00 174.34 ? 132  LYS A CA    1 
ATOM   1006  C  C     . LYS A 1  132  ? 52.147  -40.375  55.077  1.00 176.71 ? 132  LYS A C     1 
ATOM   1007  O  O     . LYS A 1  132  ? 52.367  -39.260  55.540  1.00 176.21 ? 132  LYS A O     1 
ATOM   1008  C  CB    . LYS A 1  132  ? 50.453  -41.001  53.291  1.00 175.73 ? 132  LYS A CB    1 
ATOM   1009  C  CG    . LYS A 1  132  ? 49.376  -39.943  53.500  1.00 186.34 ? 132  LYS A CG    1 
ATOM   1010  C  CD    . LYS A 1  132  ? 47.980  -40.516  53.278  1.00 190.84 ? 132  LYS A CD    1 
ATOM   1011  C  CE    . LYS A 1  132  ? 46.892  -39.474  53.372  1.00 193.58 ? 132  LYS A CE    1 
ATOM   1012  N  NZ    . LYS A 1  132  ? 46.632  -39.057  54.774  1.00 198.84 ? 132  LYS A NZ    1 
ATOM   1013  N  N     . LYS A 1  133  ? 52.124  -41.501  55.823  1.00 172.36 ? 133  LYS A N     1 
ATOM   1014  C  CA    . LYS A 1  133  ? 52.347  -41.555  57.274  1.00 171.96 ? 133  LYS A CA    1 
ATOM   1015  C  C     . LYS A 1  133  ? 53.833  -41.373  57.610  1.00 176.72 ? 133  LYS A C     1 
ATOM   1016  O  O     . LYS A 1  133  ? 54.158  -40.621  58.533  1.00 176.70 ? 133  LYS A O     1 
ATOM   1017  C  CB    . LYS A 1  133  ? 51.812  -42.871  57.875  1.00 173.63 ? 133  LYS A CB    1 
ATOM   1018  C  CG    . LYS A 1  133  ? 50.307  -43.084  57.717  1.00 181.01 ? 133  LYS A CG    1 
ATOM   1019  C  CD    . LYS A 1  133  ? 50.002  -44.173  56.695  1.00 186.43 ? 133  LYS A CD    1 
ATOM   1020  C  CE    . LYS A 1  133  ? 49.086  -43.689  55.601  1.00 190.47 ? 133  LYS A CE    1 
ATOM   1021  N  NZ    . LYS A 1  133  ? 49.198  -44.533  54.385  1.00 195.34 ? 133  LYS A NZ    1 
ATOM   1022  N  N     . ARG A 1  134  ? 54.727  -42.064  56.857  1.00 173.31 ? 134  ARG A N     1 
ATOM   1023  C  CA    . ARG A 1  134  ? 56.191  -42.012  56.979  1.00 173.66 ? 134  ARG A CA    1 
ATOM   1024  C  C     . ARG A 1  134  ? 56.680  -40.574  56.748  1.00 177.85 ? 134  ARG A C     1 
ATOM   1025  O  O     . ARG A 1  134  ? 57.516  -40.088  57.510  1.00 178.15 ? 134  ARG A O     1 
ATOM   1026  C  CB    . ARG A 1  134  ? 56.826  -42.982  55.967  1.00 172.23 ? 134  ARG A CB    1 
ATOM   1027  C  CG    . ARG A 1  134  ? 58.342  -42.975  55.904  1.00 176.33 ? 134  ARG A CG    1 
ATOM   1028  C  CD    . ARG A 1  134  ? 58.766  -43.232  54.477  1.00 177.90 ? 134  ARG A CD    1 
ATOM   1029  N  NE    . ARG A 1  134  ? 59.787  -44.271  54.359  1.00 181.07 ? 134  ARG A NE    1 
ATOM   1030  C  CZ    . ARG A 1  134  ? 60.165  -44.819  53.208  1.00 190.15 ? 134  ARG A CZ    1 
ATOM   1031  N  NH1   . ARG A 1  134  ? 59.603  -44.440  52.068  1.00 173.50 ? 134  ARG A NH1   1 
ATOM   1032  N  NH2   . ARG A 1  134  ? 61.103  -45.756  53.190  1.00 176.42 ? 134  ARG A NH2   1 
ATOM   1033  N  N     . PHE A 1  135  ? 56.133  -39.903  55.711  1.00 173.89 ? 135  PHE A N     1 
ATOM   1034  C  CA    . PHE A 1  135  ? 56.429  -38.514  55.363  1.00 174.07 ? 135  PHE A CA    1 
ATOM   1035  C  C     . PHE A 1  135  ? 55.868  -37.562  56.430  1.00 177.56 ? 135  PHE A C     1 
ATOM   1036  O  O     . PHE A 1  135  ? 56.505  -36.551  56.725  1.00 177.57 ? 135  PHE A O     1 
ATOM   1037  C  CB    . PHE A 1  135  ? 55.896  -38.179  53.950  1.00 175.60 ? 135  PHE A CB    1 
ATOM   1038  C  CG    . PHE A 1  135  ? 55.564  -36.727  53.665  1.00 177.19 ? 135  PHE A CG    1 
ATOM   1039  C  CD1   . PHE A 1  135  ? 56.572  -35.780  53.512  1.00 181.10 ? 135  PHE A CD1   1 
ATOM   1040  C  CD2   . PHE A 1  135  ? 54.244  -36.312  53.531  1.00 178.58 ? 135  PHE A CD2   1 
ATOM   1041  C  CE1   . PHE A 1  135  ? 56.263  -34.440  53.250  1.00 181.89 ? 135  PHE A CE1   1 
ATOM   1042  C  CE2   . PHE A 1  135  ? 53.937  -34.970  53.271  1.00 181.27 ? 135  PHE A CE2   1 
ATOM   1043  C  CZ    . PHE A 1  135  ? 54.949  -34.045  53.133  1.00 180.08 ? 135  PHE A CZ    1 
ATOM   1044  N  N     . ALA A 1  136  ? 54.686  -37.889  57.006  1.00 173.60 ? 136  ALA A N     1 
ATOM   1045  C  CA    . ALA A 1  136  ? 54.033  -37.091  58.053  1.00 173.37 ? 136  ALA A CA    1 
ATOM   1046  C  C     . ALA A 1  136  ? 54.809  -37.153  59.369  1.00 178.84 ? 136  ALA A C     1 
ATOM   1047  O  O     . ALA A 1  136  ? 54.776  -36.188  60.138  1.00 178.80 ? 136  ALA A O     1 
ATOM   1048  C  CB    . ALA A 1  136  ? 52.602  -37.556  58.269  1.00 173.07 ? 136  ALA A CB    1 
ATOM   1049  N  N     . ALA A 1  137  ? 55.505  -38.290  59.620  1.00 176.10 ? 137  ALA A N     1 
ATOM   1050  C  CA    . ALA A 1  137  ? 56.338  -38.523  60.805  1.00 176.62 ? 137  ALA A CA    1 
ATOM   1051  C  C     . ALA A 1  137  ? 57.555  -37.591  60.793  1.00 181.26 ? 137  ALA A C     1 
ATOM   1052  O  O     . ALA A 1  137  ? 57.897  -37.023  61.832  1.00 181.23 ? 137  ALA A O     1 
ATOM   1053  C  CB    . ALA A 1  137  ? 56.788  -39.976  60.851  1.00 177.58 ? 137  ALA A CB    1 
ATOM   1054  N  N     . ILE A 1  138  ? 58.177  -37.416  59.602  1.00 178.06 ? 138  ILE A N     1 
ATOM   1055  C  CA    . ILE A 1  138  ? 59.338  -36.555  59.349  1.00 178.81 ? 138  ILE A CA    1 
ATOM   1056  C  C     . ILE A 1  138  ? 58.972  -35.072  59.568  1.00 183.30 ? 138  ILE A C     1 
ATOM   1057  O  O     . ILE A 1  138  ? 59.700  -34.362  60.266  1.00 183.23 ? 138  ILE A O     1 
ATOM   1058  C  CB    . ILE A 1  138  ? 59.936  -36.830  57.929  1.00 181.91 ? 138  ILE A CB    1 
ATOM   1059  C  CG1   . ILE A 1  138  ? 60.365  -38.310  57.774  1.00 182.11 ? 138  ILE A CG1   1 
ATOM   1060  C  CG2   . ILE A 1  138  ? 61.106  -35.888  57.621  1.00 183.78 ? 138  ILE A CG2   1 
ATOM   1061  C  CD1   . ILE A 1  138  ? 60.480  -38.813  56.347  1.00 187.30 ? 138  ILE A CD1   1 
ATOM   1062  N  N     . TRP A 1  139  ? 57.838  -34.624  58.979  1.00 180.12 ? 139  TRP A N     1 
ATOM   1063  C  CA    . TRP A 1  139  ? 57.321  -33.254  59.072  1.00 180.27 ? 139  TRP A CA    1 
ATOM   1064  C  C     . TRP A 1  139  ? 57.048  -32.825  60.514  1.00 183.47 ? 139  TRP A C     1 
ATOM   1065  O  O     . TRP A 1  139  ? 57.528  -31.766  60.911  1.00 183.85 ? 139  TRP A O     1 
ATOM   1066  C  CB    . TRP A 1  139  ? 56.096  -33.056  58.160  1.00 178.55 ? 139  TRP A CB    1 
ATOM   1067  C  CG    . TRP A 1  139  ? 55.337  -31.775  58.382  1.00 179.75 ? 139  TRP A CG    1 
ATOM   1068  C  CD1   . TRP A 1  139  ? 55.719  -30.517  58.016  1.00 183.20 ? 139  TRP A CD1   1 
ATOM   1069  C  CD2   . TRP A 1  139  ? 54.042  -31.642  58.991  1.00 179.02 ? 139  TRP A CD2   1 
ATOM   1070  N  NE1   . TRP A 1  139  ? 54.755  -29.604  58.379  1.00 182.39 ? 139  TRP A NE1   1 
ATOM   1071  C  CE2   . TRP A 1  139  ? 53.711  -30.268  58.975  1.00 183.17 ? 139  TRP A CE2   1 
ATOM   1072  C  CE3   . TRP A 1  139  ? 53.125  -32.553  59.550  1.00 179.66 ? 139  TRP A CE3   1 
ATOM   1073  C  CZ2   . TRP A 1  139  ? 52.505  -29.783  59.501  1.00 181.98 ? 139  TRP A CZ2   1 
ATOM   1074  C  CZ3   . TRP A 1  139  ? 51.934  -32.071  60.074  1.00 180.56 ? 139  TRP A CZ3   1 
ATOM   1075  C  CH2   . TRP A 1  139  ? 51.629  -30.704  60.042  1.00 181.35 ? 139  TRP A CH2   1 
ATOM   1076  N  N     . THR A 1  140  ? 56.331  -33.650  61.308  1.00 178.62 ? 140  THR A N     1 
ATOM   1077  C  CA    . THR A 1  140  ? 56.056  -33.332  62.718  1.00 178.11 ? 140  THR A CA    1 
ATOM   1078  C  C     . THR A 1  140  ? 57.346  -33.300  63.551  1.00 182.31 ? 140  THR A C     1 
ATOM   1079  O  O     . THR A 1  140  ? 57.380  -32.653  64.600  1.00 182.15 ? 140  THR A O     1 
ATOM   1080  C  CB    . THR A 1  140  ? 54.996  -34.268  63.327  1.00 184.63 ? 140  THR A CB    1 
ATOM   1081  O  OG1   . THR A 1  140  ? 55.351  -35.631  63.085  1.00 183.84 ? 140  THR A OG1   1 
ATOM   1082  C  CG2   . THR A 1  140  ? 53.589  -33.976  62.824  1.00 181.77 ? 140  THR A CG2   1 
ATOM   1083  N  N     . LEU A 1  141  ? 58.410  -33.968  63.059  1.00 178.99 ? 141  LEU A N     1 
ATOM   1084  C  CA    . LEU A 1  141  ? 59.707  -34.051  63.723  1.00 179.76 ? 141  LEU A CA    1 
ATOM   1085  C  C     . LEU A 1  141  ? 60.631  -32.846  63.484  1.00 185.77 ? 141  LEU A C     1 
ATOM   1086  O  O     . LEU A 1  141  ? 61.035  -32.209  64.462  1.00 186.35 ? 141  LEU A O     1 
ATOM   1087  C  CB    . LEU A 1  141  ? 60.409  -35.375  63.390  1.00 179.80 ? 141  LEU A CB    1 
ATOM   1088  C  CG    . LEU A 1  141  ? 60.699  -36.283  64.576  1.00 184.20 ? 141  LEU A CG    1 
ATOM   1089  C  CD1   . LEU A 1  141  ? 59.648  -37.369  64.712  1.00 183.18 ? 141  LEU A CD1   1 
ATOM   1090  C  CD2   . LEU A 1  141  ? 62.064  -36.899  64.453  1.00 186.95 ? 141  LEU A CD2   1 
ATOM   1091  N  N     . CYS A 1  142  ? 60.971  -32.530  62.210  1.00 182.81 ? 142  CYS A N     1 
ATOM   1092  C  CA    . CYS A 1  142  ? 61.875  -31.409  61.899  1.00 183.57 ? 142  CYS A CA    1 
ATOM   1093  C  C     . CYS A 1  142  ? 61.225  -30.051  61.535  1.00 187.12 ? 142  CYS A C     1 
ATOM   1094  O  O     . CYS A 1  142  ? 61.878  -29.207  60.909  1.00 187.39 ? 142  CYS A O     1 
ATOM   1095  C  CB    . CYS A 1  142  ? 62.985  -31.812  60.925  1.00 184.49 ? 142  CYS A CB    1 
ATOM   1096  S  SG    . CYS A 1  142  ? 62.403  -32.494  59.350  1.00 187.43 ? 142  CYS A SG    1 
ATOM   1097  N  N     . LYS A 1  143  ? 59.967  -29.822  61.984  1.00 182.61 ? 143  LYS A N     1 
ATOM   1098  C  CA    . LYS A 1  143  ? 59.238  -28.568  61.738  1.00 182.01 ? 143  LYS A CA    1 
ATOM   1099  C  C     . LYS A 1  143  ? 59.783  -27.384  62.542  1.00 187.73 ? 143  LYS A C     1 
ATOM   1100  O  O     . LYS A 1  143  ? 59.922  -26.286  61.995  1.00 187.52 ? 143  LYS A O     1 
ATOM   1101  C  CB    . LYS A 1  143  ? 57.707  -28.716  61.926  1.00 182.53 ? 143  LYS A CB    1 
ATOM   1102  C  CG    . LYS A 1  143  ? 57.234  -29.290  63.272  1.00 184.48 ? 143  LYS A CG    1 
ATOM   1103  C  CD    . LYS A 1  143  ? 55.785  -28.908  63.602  1.00 184.82 ? 143  LYS A CD    1 
ATOM   1104  C  CE    . LYS A 1  143  ? 54.754  -29.808  62.964  1.00 184.74 ? 143  LYS A CE    1 
ATOM   1105  N  NZ    . LYS A 1  143  ? 53.374  -29.409  63.331  1.00 188.69 ? 143  LYS A NZ    1 
ATOM   1106  N  N     . THR A 1  144  ? 60.098  -27.616  63.831  1.00 185.46 ? 144  THR A N     1 
ATOM   1107  C  CA    . THR A 1  144  ? 60.606  -26.597  64.754  1.00 186.55 ? 144  THR A CA    1 
ATOM   1108  C  C     . THR A 1  144  ? 62.154  -26.513  64.761  1.00 192.47 ? 144  THR A C     1 
ATOM   1109  O  O     . THR A 1  144  ? 62.707  -25.516  65.239  1.00 192.66 ? 144  THR A O     1 
ATOM   1110  C  CB    . THR A 1  144  ? 59.952  -26.763  66.145  1.00 193.83 ? 144  THR A CB    1 
ATOM   1111  O  OG1   . THR A 1  144  ? 58.631  -27.292  65.992  1.00 191.03 ? 144  THR A OG1   1 
ATOM   1112  C  CG2   . THR A 1  144  ? 59.889  -25.452  66.929  1.00 192.92 ? 144  THR A CG2   1 
ATOM   1113  N  N     . LYS A 1  145  ? 62.841  -27.542  64.205  1.00 189.81 ? 145  LYS A N     1 
ATOM   1114  C  CA    . LYS A 1  145  ? 64.304  -27.596  64.118  1.00 191.07 ? 145  LYS A CA    1 
ATOM   1115  C  C     . LYS A 1  145  ? 64.833  -26.481  63.227  1.00 196.82 ? 145  LYS A C     1 
ATOM   1116  O  O     . LYS A 1  145  ? 64.566  -26.471  62.022  1.00 196.17 ? 145  LYS A O     1 
ATOM   1117  C  CB    . LYS A 1  145  ? 64.790  -28.973  63.633  1.00 193.13 ? 145  LYS A CB    1 
ATOM   1118  C  CG    . LYS A 1  145  ? 65.526  -29.766  64.702  1.00 201.96 ? 145  LYS A CG    1 
ATOM   1119  C  CD    . LYS A 1  145  ? 66.908  -29.201  65.017  1.00 209.54 ? 145  LYS A CD    1 
ATOM   1120  C  CE    . LYS A 1  145  ? 67.437  -29.777  66.300  1.00 217.41 ? 145  LYS A CE    1 
ATOM   1121  N  NZ    . LYS A 1  145  ? 68.489  -28.917  66.893  1.00 226.00 ? 145  LYS A NZ    1 
ATOM   1122  N  N     . MET A 1  146  ? 65.539  -25.516  63.832  1.00 195.18 ? 146  MET A N     1 
ATOM   1123  C  CA    . MET A 1  146  ? 66.050  -24.357  63.105  1.00 196.23 ? 146  MET A CA    1 
ATOM   1124  C  C     . MET A 1  146  ? 67.585  -24.297  63.006  1.00 202.32 ? 146  MET A C     1 
ATOM   1125  O  O     . MET A 1  146  ? 68.199  -23.267  63.299  1.00 202.91 ? 146  MET A O     1 
ATOM   1126  C  CB    . MET A 1  146  ? 65.403  -23.057  63.621  1.00 198.59 ? 146  MET A CB    1 
ATOM   1127  C  CG    . MET A 1  146  ? 63.900  -23.006  63.377  1.00 200.97 ? 146  MET A CG    1 
ATOM   1128  S  SD    . MET A 1  146  ? 63.056  -21.632  64.189  1.00 205.22 ? 146  MET A SD    1 
ATOM   1129  C  CE    . MET A 1  146  ? 62.999  -22.224  65.873  1.00 201.80 ? 146  MET A CE    1 
ATOM   1130  N  N     . VAL A 1  147  ? 68.187  -25.428  62.560  1.00 199.44 ? 147  VAL A N     1 
ATOM   1131  C  CA    . VAL A 1  147  ? 69.628  -25.666  62.339  1.00 200.66 ? 147  VAL A CA    1 
ATOM   1132  C  C     . VAL A 1  147  ? 69.848  -26.878  61.407  1.00 204.46 ? 147  VAL A C     1 
ATOM   1133  O  O     . VAL A 1  147  ? 69.157  -27.891  61.554  1.00 203.44 ? 147  VAL A O     1 
ATOM   1134  C  CB    . VAL A 1  147  ? 70.472  -25.833  63.644  1.00 205.51 ? 147  VAL A CB    1 
ATOM   1135  C  CG1   . VAL A 1  147  ? 71.056  -24.509  64.121  1.00 206.28 ? 147  VAL A CG1   1 
ATOM   1136  C  CG2   . VAL A 1  147  ? 69.700  -26.542  64.757  1.00 204.54 ? 147  VAL A CG2   1 
ATOM   1137  N  N     . CYS A 1  148  ? 70.826  -26.783  60.475  1.00 201.45 ? 148  CYS A N     1 
ATOM   1138  C  CA    . CYS A 1  148  ? 71.203  -27.873  59.558  1.00 200.99 ? 148  CYS A CA    1 
ATOM   1139  C  C     . CYS A 1  148  ? 72.329  -28.701  60.208  1.00 204.48 ? 148  CYS A C     1 
ATOM   1140  O  O     . CYS A 1  148  ? 72.223  -29.928  60.286  1.00 203.48 ? 148  CYS A O     1 
ATOM   1141  C  CB    . CYS A 1  148  ? 71.615  -27.326  58.191  1.00 201.79 ? 148  CYS A CB    1 
ATOM   1142  S  SG    . CYS A 1  148  ? 71.922  -28.598  56.933  1.00 205.64 ? 148  CYS A SG    1 
ATOM   1143  N  N     . GLU A 1  149  ? 73.391  -28.001  60.693  1.00 201.42 ? 149  GLU A N     1 
ATOM   1144  C  CA    . GLU A 1  149  ? 74.574  -28.489  61.423  1.00 201.95 ? 149  GLU A CA    1 
ATOM   1145  C  C     . GLU A 1  149  ? 75.501  -29.508  60.721  1.00 205.96 ? 149  GLU A C     1 
ATOM   1146  O  O     . GLU A 1  149  ? 75.089  -30.208  59.791  1.00 204.67 ? 149  GLU A O     1 
ATOM   1147  C  CB    . GLU A 1  149  ? 74.216  -28.896  62.876  1.00 202.79 ? 149  GLU A CB    1 
ATOM   1148  C  CG    . GLU A 1  149  ? 75.299  -28.645  63.923  1.00 209.99 ? 149  GLU A CG    1 
ATOM   1149  C  CD    . GLU A 1  149  ? 75.726  -27.205  64.143  1.00 217.55 ? 149  GLU A CD    1 
ATOM   1150  O  OE1   . GLU A 1  149  ? 76.918  -26.902  63.912  1.00 202.63 ? 149  GLU A OE1   1 
ATOM   1151  O  OE2   . GLU A 1  149  ? 74.875  -26.381  64.550  1.00 204.78 ? 149  GLU A OE2   1 
ATOM   1152  N  N     . THR A 1  150  ? 76.775  -29.542  61.170  1.00 203.41 ? 150  THR A N     1 
ATOM   1153  C  CA    . THR A 1  150  ? 77.840  -30.426  60.694  1.00 203.82 ? 150  THR A CA    1 
ATOM   1154  C  C     . THR A 1  150  ? 78.025  -31.602  61.662  1.00 207.64 ? 150  THR A C     1 
ATOM   1155  O  O     . THR A 1  150  ? 77.882  -32.751  61.248  1.00 206.72 ? 150  THR A O     1 
ATOM   1156  C  CB    . THR A 1  150  ? 79.155  -29.646  60.488  1.00 210.00 ? 150  THR A CB    1 
ATOM   1157  O  OG1   . THR A 1  150  ? 79.366  -28.759  61.590  1.00 208.21 ? 150  THR A OG1   1 
ATOM   1158  C  CG2   . THR A 1  150  ? 79.182  -28.871  59.184  1.00 207.79 ? 150  THR A CG2   1 
ATOM   1159  N  N     . ASP A 1  151  ? 78.311  -31.312  62.950  1.00 204.73 ? 151  ASP A N     1 
ATOM   1160  C  CA    . ASP A 1  151  ? 78.552  -32.315  63.990  1.00 204.83 ? 151  ASP A CA    1 
ATOM   1161  C  C     . ASP A 1  151  ? 77.295  -32.778  64.741  1.00 206.66 ? 151  ASP A C     1 
ATOM   1162  O  O     . ASP A 1  151  ? 76.429  -31.960  65.065  1.00 205.05 ? 151  ASP A O     1 
ATOM   1163  C  CB    . ASP A 1  151  ? 79.644  -31.839  64.967  1.00 208.23 ? 151  ASP A CB    1 
ATOM   1164  C  CG    . ASP A 1  151  ? 81.064  -31.924  64.423  1.00 219.25 ? 151  ASP A CG    1 
ATOM   1165  O  OD1   . ASP A 1  151  ? 81.912  -32.572  65.077  1.00 220.67 ? 151  ASP A OD1   1 
ATOM   1166  O  OD2   . ASP A 1  151  ? 81.331  -31.326  63.354  1.00 225.83 ? 151  ASP A OD2   1 
ATOM   1167  N  N     . VAL A 1  152  ? 77.224  -34.100  65.028  1.00 202.85 ? 152  VAL A N     1 
ATOM   1168  C  CA    . VAL A 1  152  ? 76.126  -34.790  65.729  1.00 201.28 ? 152  VAL A CA    1 
ATOM   1169  C  C     . VAL A 1  152  ? 76.637  -35.843  66.750  1.00 205.18 ? 152  VAL A C     1 
ATOM   1170  O  O     . VAL A 1  152  ? 77.694  -36.438  66.517  1.00 205.56 ? 152  VAL A O     1 
ATOM   1171  C  CB    . VAL A 1  152  ? 75.053  -35.377  64.766  1.00 203.83 ? 152  VAL A CB    1 
ATOM   1172  C  CG1   . VAL A 1  152  ? 73.977  -34.347  64.450  1.00 202.47 ? 152  VAL A CG1   1 
ATOM   1173  C  CG2   . VAL A 1  152  ? 75.672  -35.937  63.487  1.00 204.15 ? 152  VAL A CG2   1 
ATOM   1174  N  N     . PRO A 1  153  ? 75.919  -36.096  67.878  1.00 201.04 ? 153  PRO A N     1 
ATOM   1175  C  CA    . PRO A 1  153  ? 76.423  -37.076  68.861  1.00 201.50 ? 153  PRO A CA    1 
ATOM   1176  C  C     . PRO A 1  153  ? 76.165  -38.551  68.518  1.00 204.19 ? 153  PRO A C     1 
ATOM   1177  O  O     . PRO A 1  153  ? 75.470  -38.846  67.542  1.00 202.87 ? 153  PRO A O     1 
ATOM   1178  C  CB    . PRO A 1  153  ? 75.736  -36.649  70.161  1.00 202.74 ? 153  PRO A CB    1 
ATOM   1179  C  CG    . PRO A 1  153  ? 74.454  -36.036  69.724  1.00 205.73 ? 153  PRO A CG    1 
ATOM   1180  C  CD    . PRO A 1  153  ? 74.652  -35.482  68.336  1.00 201.32 ? 153  PRO A CD    1 
ATOM   1181  N  N     . SER A 1  154  ? 76.733  -39.474  69.334  1.00 200.74 ? 154  SER A N     1 
ATOM   1182  C  CA    . SER A 1  154  ? 76.615  -40.930  69.187  1.00 216.57 ? 154  SER A CA    1 
ATOM   1183  C  C     . SER A 1  154  ? 75.206  -41.410  69.528  1.00 228.29 ? 154  SER A C     1 
ATOM   1184  O  O     . SER A 1  154  ? 74.805  -42.494  69.112  1.00 186.18 ? 154  SER A O     1 
ATOM   1185  C  CB    . SER A 1  154  ? 77.639  -41.638  70.070  1.00 220.80 ? 154  SER A CB    1 
ATOM   1186  O  OG    . SER A 1  154  ? 77.627  -43.043  69.873  1.00 229.75 ? 154  SER A OG    1 
ATOM   1187  N  N     . LEU A 1  161  ? 82.164  -35.794  68.827  1.00 197.11 ? 161  LEU A N     1 
ATOM   1188  C  CA    . LEU A 1  161  ? 81.020  -35.644  67.926  1.00 195.42 ? 161  LEU A CA    1 
ATOM   1189  C  C     . LEU A 1  161  ? 81.432  -35.875  66.457  1.00 199.99 ? 161  LEU A C     1 
ATOM   1190  O  O     . LEU A 1  161  ? 82.500  -35.411  66.045  1.00 200.96 ? 161  LEU A O     1 
ATOM   1191  C  CB    . LEU A 1  161  ? 80.349  -34.268  68.114  1.00 194.75 ? 161  LEU A CB    1 
ATOM   1192  C  CG    . LEU A 1  161  ? 79.614  -34.048  69.444  1.00 198.43 ? 161  LEU A CG    1 
ATOM   1193  C  CD1   . LEU A 1  161  ? 80.452  -33.224  70.408  1.00 199.82 ? 161  LEU A CD1   1 
ATOM   1194  C  CD2   . LEU A 1  161  ? 78.276  -33.372  69.221  1.00 198.82 ? 161  LEU A CD2   1 
ATOM   1195  N  N     . VAL A 1  162  ? 80.589  -36.605  65.679  1.00 195.30 ? 162  VAL A N     1 
ATOM   1196  C  CA    . VAL A 1  162  ? 80.849  -36.966  64.272  1.00 195.11 ? 162  VAL A CA    1 
ATOM   1197  C  C     . VAL A 1  162  ? 80.227  -35.970  63.275  1.00 198.68 ? 162  VAL A C     1 
ATOM   1198  O  O     . VAL A 1  162  ? 79.040  -35.657  63.382  1.00 196.73 ? 162  VAL A O     1 
ATOM   1199  C  CB    . VAL A 1  162  ? 80.455  -38.436  63.947  1.00 198.11 ? 162  VAL A CB    1 
ATOM   1200  C  CG1   . VAL A 1  162  ? 81.111  -38.908  62.651  1.00 198.44 ? 162  VAL A CG1   1 
ATOM   1201  C  CG2   . VAL A 1  162  ? 80.809  -39.380  65.096  1.00 198.56 ? 162  VAL A CG2   1 
ATOM   1202  N  N     . SER A 1  163  ? 81.032  -35.496  62.296  1.00 196.64 ? 163  SER A N     1 
ATOM   1203  C  CA    . SER A 1  163  ? 80.608  -34.539  61.271  1.00 195.95 ? 163  SER A CA    1 
ATOM   1204  C  C     . SER A 1  163  ? 79.979  -35.221  60.056  1.00 200.23 ? 163  SER A C     1 
ATOM   1205  O  O     . SER A 1  163  ? 80.637  -36.025  59.392  1.00 200.11 ? 163  SER A O     1 
ATOM   1206  C  CB    . SER A 1  163  ? 81.768  -33.640  60.851  1.00 200.29 ? 163  SER A CB    1 
ATOM   1207  O  OG    . SER A 1  163  ? 82.809  -34.382  60.239  1.00 208.86 ? 163  SER A OG    1 
ATOM   1208  N  N     . ARG A 1  164  ? 78.698  -34.896  59.779  1.00 197.02 ? 164  ARG A N     1 
ATOM   1209  C  CA    . ARG A 1  164  ? 77.906  -35.424  58.654  1.00 196.50 ? 164  ARG A CA    1 
ATOM   1210  C  C     . ARG A 1  164  ? 77.834  -34.431  57.475  1.00 202.27 ? 164  ARG A C     1 
ATOM   1211  O  O     . ARG A 1  164  ? 78.201  -33.262  57.634  1.00 202.74 ? 164  ARG A O     1 
ATOM   1212  C  CB    . ARG A 1  164  ? 76.494  -35.861  59.115  1.00 194.17 ? 164  ARG A CB    1 
ATOM   1213  C  CG    . ARG A 1  164  ? 75.555  -34.719  59.505  1.00 199.13 ? 164  ARG A CG    1 
ATOM   1214  C  CD    . ARG A 1  164  ? 74.215  -35.242  59.967  1.00 200.33 ? 164  ARG A CD    1 
ATOM   1215  N  NE    . ARG A 1  164  ? 73.293  -34.160  60.314  1.00 200.64 ? 164  ARG A NE    1 
ATOM   1216  C  CZ    . ARG A 1  164  ? 72.280  -33.755  59.553  1.00 207.26 ? 164  ARG A CZ    1 
ATOM   1217  N  NH1   . ARG A 1  164  ? 72.035  -34.348  58.390  1.00 192.53 ? 164  ARG A NH1   1 
ATOM   1218  N  NH2   . ARG A 1  164  ? 71.499  -32.761  59.952  1.00 188.59 ? 164  ARG A NH2   1 
ATOM   1219  N  N     . GLY A 1  165  ? 77.350  -34.909  56.324  1.00 199.15 ? 165  GLY A N     1 
ATOM   1220  C  CA    . GLY A 1  165  ? 77.218  -34.119  55.103  1.00 199.31 ? 165  GLY A CA    1 
ATOM   1221  C  C     . GLY A 1  165  ? 76.198  -33.000  55.188  1.00 203.32 ? 165  GLY A C     1 
ATOM   1222  O  O     . GLY A 1  165  ? 75.084  -33.136  54.676  1.00 201.85 ? 165  GLY A O     1 
ATOM   1223  N  N     . GLY A 1  166  ? 76.595  -31.891  55.817  1.00 200.93 ? 166  GLY A N     1 
ATOM   1224  C  CA    . GLY A 1  166  ? 75.748  -30.715  55.995  1.00 200.09 ? 166  GLY A CA    1 
ATOM   1225  C  C     . GLY A 1  166  ? 76.489  -29.406  56.191  1.00 205.33 ? 166  GLY A C     1 
ATOM   1226  O  O     . GLY A 1  166  ? 77.722  -29.383  56.267  1.00 206.21 ? 166  GLY A O     1 
ATOM   1227  N  N     . CYS A 1  167  ? 75.722  -28.300  56.264  1.00 201.61 ? 167  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1  167  ? 76.240  -26.945  56.464  1.00 202.40 ? 167  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1  167  ? 75.901  -26.431  57.878  1.00 205.04 ? 167  CYS A C     1 
ATOM   1230  O  O     . CYS A 1  167  ? 76.339  -27.036  58.855  1.00 204.78 ? 167  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1  167  ? 75.770  -25.993  55.358  1.00 202.60 ? 167  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1  167  ? 73.978  -25.698  55.315  1.00 204.69 ? 167  CYS A SG    1 
ATOM   1233  N  N     . GLY A 1  168  ? 75.129  -25.350  57.967  1.00 200.58 ? 168  GLY A N     1 
ATOM   1234  C  CA    . GLY A 1  168  ? 74.709  -24.737  59.217  1.00 200.07 ? 168  GLY A CA    1 
ATOM   1235  C  C     . GLY A 1  168  ? 74.042  -23.401  58.980  1.00 203.50 ? 168  GLY A C     1 
ATOM   1236  O  O     . GLY A 1  168  ? 74.726  -22.386  58.814  1.00 204.00 ? 168  GLY A O     1 
ATOM   1237  N  N     . ASN A 1  169  ? 72.700  -23.401  58.935  1.00 198.73 ? 169  ASN A N     1 
ATOM   1238  C  CA    . ASN A 1  169  ? 71.886  -22.202  58.733  1.00 198.11 ? 169  ASN A CA    1 
ATOM   1239  C  C     . ASN A 1  169  ? 70.523  -22.345  59.418  1.00 200.50 ? 169  ASN A C     1 
ATOM   1240  O  O     . ASN A 1  169  ? 69.994  -23.458  59.516  1.00 198.96 ? 169  ASN A O     1 
ATOM   1241  C  CB    . ASN A 1  169  ? 71.727  -21.887  57.242  1.00 199.17 ? 169  ASN A CB    1 
ATOM   1242  C  CG    . ASN A 1  169  ? 71.576  -20.414  56.943  1.00 223.79 ? 169  ASN A CG    1 
ATOM   1243  O  OD1   . ASN A 1  169  ? 70.465  -19.882  56.856  1.00 217.80 ? 169  ASN A OD1   1 
ATOM   1244  N  ND2   . ASN A 1  169  ? 72.693  -19.726  56.746  1.00 216.88 ? 169  ASN A ND2   1 
ATOM   1245  N  N     . THR A 1  170  ? 69.969  -21.215  59.906  1.00 197.03 ? 170  THR A N     1 
ATOM   1246  C  CA    . THR A 1  170  ? 68.675  -21.150  60.598  1.00 195.70 ? 170  THR A CA    1 
ATOM   1247  C  C     . THR A 1  170  ? 67.508  -21.418  59.626  1.00 199.03 ? 170  THR A C     1 
ATOM   1248  O  O     . THR A 1  170  ? 67.611  -21.111  58.433  1.00 198.79 ? 170  THR A O     1 
ATOM   1249  C  CB    . THR A 1  170  ? 68.512  -19.806  61.350  1.00 200.98 ? 170  THR A CB    1 
ATOM   1250  O  OG1   . THR A 1  170  ? 69.790  -19.270  61.699  1.00 200.71 ? 170  THR A OG1   1 
ATOM   1251  C  CG2   . THR A 1  170  ? 67.656  -19.935  62.604  1.00 197.82 ? 170  THR A CG2   1 
ATOM   1252  N  N     . GLN A 1  171  ? 66.412  -22.008  60.138  1.00 194.78 ? 171  GLN A N     1 
ATOM   1253  C  CA    . GLN A 1  171  ? 65.214  -22.305  59.354  1.00 193.41 ? 171  GLN A CA    1 
ATOM   1254  C  C     . GLN A 1  171  ? 64.135  -21.224  59.579  1.00 196.98 ? 171  GLN A C     1 
ATOM   1255  O  O     . GLN A 1  171  ? 63.772  -20.966  60.731  1.00 196.55 ? 171  GLN A O     1 
ATOM   1256  C  CB    . GLN A 1  171  ? 64.669  -23.717  59.671  1.00 193.85 ? 171  GLN A CB    1 
ATOM   1257  C  CG    . GLN A 1  171  ? 63.297  -24.013  59.044  1.00 207.17 ? 171  GLN A CG    1 
ATOM   1258  C  CD    . GLN A 1  171  ? 62.813  -25.426  59.241  1.00 221.39 ? 171  GLN A CD    1 
ATOM   1259  O  OE1   . GLN A 1  171  ? 62.748  -26.211  58.296  1.00 214.47 ? 171  GLN A OE1   1 
ATOM   1260  N  NE2   . GLN A 1  171  ? 62.387  -25.759  60.452  1.00 212.80 ? 171  GLN A NE2   1 
ATOM   1261  N  N     . PRO A 1  172  ? 63.591  -20.609  58.497  1.00 193.04 ? 172  PRO A N     1 
ATOM   1262  C  CA    . PRO A 1  172  ? 62.527  -19.608  58.681  1.00 192.23 ? 172  PRO A CA    1 
ATOM   1263  C  C     . PRO A 1  172  ? 61.190  -20.241  59.063  1.00 194.09 ? 172  PRO A C     1 
ATOM   1264  O  O     . PRO A 1  172  ? 60.892  -21.363  58.640  1.00 192.80 ? 172  PRO A O     1 
ATOM   1265  C  CB    . PRO A 1  172  ? 62.437  -18.932  57.312  1.00 193.98 ? 172  PRO A CB    1 
ATOM   1266  C  CG    . PRO A 1  172  ? 62.904  -19.953  56.352  1.00 198.26 ? 172  PRO A CG    1 
ATOM   1267  C  CD    . PRO A 1  172  ? 63.907  -20.801  57.068  1.00 194.49 ? 172  PRO A CD    1 
ATOM   1268  N  N     . THR A 1  173  ? 60.388  -19.516  59.861  1.00 189.95 ? 173  THR A N     1 
ATOM   1269  C  CA    . THR A 1  173  ? 59.061  -19.961  60.285  1.00 188.35 ? 173  THR A CA    1 
ATOM   1270  C  C     . THR A 1  173  ? 58.120  -19.733  59.083  1.00 191.10 ? 173  THR A C     1 
ATOM   1271  O  O     . THR A 1  173  ? 57.542  -18.650  58.942  1.00 190.98 ? 173  THR A O     1 
ATOM   1272  C  CB    . THR A 1  173  ? 58.643  -19.258  61.601  1.00 194.66 ? 173  THR A CB    1 
ATOM   1273  O  OG1   . THR A 1  173  ? 59.732  -19.278  62.533  1.00 193.94 ? 173  THR A OG1   1 
ATOM   1274  C  CG2   . THR A 1  173  ? 57.409  -19.886  62.235  1.00 191.56 ? 173  THR A CG2   1 
ATOM   1275  N  N     . ILE A 1  174  ? 58.041  -20.745  58.183  1.00 186.13 ? 174  ILE A N     1 
ATOM   1276  C  CA    . ILE A 1  174  ? 57.256  -20.746  56.936  1.00 184.51 ? 174  ILE A CA    1 
ATOM   1277  C  C     . ILE A 1  174  ? 55.764  -20.457  57.204  1.00 185.72 ? 174  ILE A C     1 
ATOM   1278  O  O     . ILE A 1  174  ? 55.164  -21.075  58.088  1.00 184.93 ? 174  ILE A O     1 
ATOM   1279  C  CB    . ILE A 1  174  ? 57.490  -22.057  56.105  1.00 187.14 ? 174  ILE A CB    1 
ATOM   1280  C  CG1   . ILE A 1  174  ? 59.003  -22.404  55.902  1.00 188.16 ? 174  ILE A CG1   1 
ATOM   1281  C  CG2   . ILE A 1  174  ? 56.711  -22.061  54.779  1.00 187.53 ? 174  ILE A CG2   1 
ATOM   1282  C  CD1   . ILE A 1  174  ? 59.817  -21.595  54.820  1.00 193.16 ? 174  ILE A CD1   1 
ATOM   1283  N  N     . ARG A 1  175  ? 55.191  -19.498  56.449  1.00 180.46 ? 175  ARG A N     1 
ATOM   1284  C  CA    . ARG A 1  175  ? 53.795  -19.065  56.557  1.00 178.82 ? 175  ARG A CA    1 
ATOM   1285  C  C     . ARG A 1  175  ? 53.120  -18.951  55.181  1.00 182.00 ? 175  ARG A C     1 
ATOM   1286  O  O     . ARG A 1  175  ? 53.783  -18.591  54.205  1.00 182.33 ? 175  ARG A O     1 
ATOM   1287  C  CB    . ARG A 1  175  ? 53.727  -17.706  57.268  1.00 177.47 ? 175  ARG A CB    1 
ATOM   1288  C  CG    . ARG A 1  175  ? 53.377  -17.784  58.747  1.00 179.90 ? 175  ARG A CG    1 
ATOM   1289  C  CD    . ARG A 1  175  ? 53.180  -16.404  59.356  1.00 180.55 ? 175  ARG A CD    1 
ATOM   1290  N  NE    . ARG A 1  175  ? 51.952  -15.746  58.892  1.00 180.77 ? 175  ARG A NE    1 
ATOM   1291  C  CZ    . ARG A 1  175  ? 51.918  -14.700  58.071  1.00 190.02 ? 175  ARG A CZ    1 
ATOM   1292  N  NH1   . ARG A 1  175  ? 53.045  -14.169  57.611  1.00 175.80 ? 175  ARG A NH1   1 
ATOM   1293  N  NH2   . ARG A 1  175  ? 50.756  -14.174  57.706  1.00 172.88 ? 175  ARG A NH2   1 
ATOM   1294  N  N     . LYS A 1  176  ? 51.799  -19.224  55.110  1.00 177.02 ? 176  LYS A N     1 
ATOM   1295  C  CA    . LYS A 1  176  ? 51.030  -19.116  53.864  1.00 176.09 ? 176  LYS A CA    1 
ATOM   1296  C  C     . LYS A 1  176  ? 50.443  -17.707  53.752  1.00 180.06 ? 176  LYS A C     1 
ATOM   1297  O  O     . LYS A 1  176  ? 49.700  -17.288  54.645  1.00 179.61 ? 176  LYS A O     1 
ATOM   1298  C  CB    . LYS A 1  176  ? 49.913  -20.181  53.798  1.00 177.09 ? 176  LYS A CB    1 
ATOM   1299  C  CG    . LYS A 1  176  ? 49.527  -20.587  52.370  1.00 183.17 ? 176  LYS A CG    1 
ATOM   1300  C  CD    . LYS A 1  176  ? 48.136  -20.102  51.943  1.00 186.19 ? 176  LYS A CD    1 
ATOM   1301  C  CE    . LYS A 1  176  ? 47.841  -20.476  50.506  1.00 187.53 ? 176  LYS A CE    1 
ATOM   1302  N  NZ    . LYS A 1  176  ? 46.520  -19.975  50.038  1.00 189.32 ? 176  LYS A NZ    1 
ATOM   1303  N  N     . ASP A 1  177  ? 50.794  -16.969  52.675  1.00 176.68 ? 177  ASP A N     1 
ATOM   1304  C  CA    . ASP A 1  177  ? 50.287  -15.611  52.445  1.00 176.66 ? 177  ASP A CA    1 
ATOM   1305  C  C     . ASP A 1  177  ? 49.833  -15.394  50.998  1.00 179.30 ? 177  ASP A C     1 
ATOM   1306  O  O     . ASP A 1  177  ? 50.655  -15.183  50.099  1.00 179.05 ? 177  ASP A O     1 
ATOM   1307  C  CB    . ASP A 1  177  ? 51.285  -14.533  52.911  1.00 179.71 ? 177  ASP A CB    1 
ATOM   1308  C  CG    . ASP A 1  177  ? 50.639  -13.203  53.260  1.00 190.09 ? 177  ASP A CG    1 
ATOM   1309  O  OD1   . ASP A 1  177  ? 50.245  -12.466  52.323  1.00 190.62 ? 177  ASP A OD1   1 
ATOM   1310  O  OD2   . ASP A 1  177  ? 50.551  -12.885  54.468  1.00 195.90 ? 177  ASP A OD2   1 
ATOM   1311  N  N     . GLY A 1  178  ? 48.518  -15.459  50.805  1.00 174.77 ? 178  GLY A N     1 
ATOM   1312  C  CA    . GLY A 1  178  ? 47.869  -15.293  49.512  1.00 174.21 ? 178  GLY A CA    1 
ATOM   1313  C  C     . GLY A 1  178  ? 48.140  -16.451  48.577  1.00 177.44 ? 178  GLY A C     1 
ATOM   1314  O  O     . GLY A 1  178  ? 47.576  -17.539  48.743  1.00 176.43 ? 178  GLY A O     1 
ATOM   1315  N  N     . LEU A 1  179  ? 49.029  -16.223  47.602  1.00 174.09 ? 179  LEU A N     1 
ATOM   1316  C  CA    . LEU A 1  179  ? 49.408  -17.217  46.599  1.00 173.43 ? 179  LEU A CA    1 
ATOM   1317  C  C     . LEU A 1  179  ? 50.877  -17.657  46.744  1.00 177.06 ? 179  LEU A C     1 
ATOM   1318  O  O     . LEU A 1  179  ? 51.307  -18.574  46.040  1.00 175.95 ? 179  LEU A O     1 
ATOM   1319  C  CB    . LEU A 1  179  ? 49.133  -16.674  45.170  1.00 173.74 ? 179  LEU A CB    1 
ATOM   1320  C  CG    . LEU A 1  179  ? 47.669  -16.390  44.707  1.00 177.86 ? 179  LEU A CG    1 
ATOM   1321  C  CD1   . LEU A 1  179  ? 46.698  -17.507  45.095  1.00 176.90 ? 179  LEU A CD1   1 
ATOM   1322  C  CD2   . LEU A 1  179  ? 47.172  -15.007  45.143  1.00 180.63 ? 179  LEU A CD2   1 
ATOM   1323  N  N     . LYS A 1  180  ? 51.629  -17.016  47.675  1.00 174.28 ? 180  LYS A N     1 
ATOM   1324  C  CA    . LYS A 1  180  ? 53.057  -17.268  47.929  1.00 174.50 ? 180  LYS A CA    1 
ATOM   1325  C  C     . LYS A 1  180  ? 53.376  -17.643  49.382  1.00 178.67 ? 180  LYS A C     1 
ATOM   1326  O  O     . LYS A 1  180  ? 52.616  -17.308  50.291  1.00 177.58 ? 180  LYS A O     1 
ATOM   1327  C  CB    . LYS A 1  180  ? 53.896  -16.045  47.508  1.00 177.29 ? 180  LYS A CB    1 
ATOM   1328  C  CG    . LYS A 1  180  ? 53.914  -15.803  46.003  1.00 183.89 ? 180  LYS A CG    1 
ATOM   1329  C  CD    . LYS A 1  180  ? 53.775  -14.329  45.659  1.00 187.85 ? 180  LYS A CD    1 
ATOM   1330  C  CE    . LYS A 1  180  ? 53.279  -14.123  44.248  1.00 187.68 ? 180  LYS A CE    1 
ATOM   1331  N  NZ    . LYS A 1  180  ? 53.374  -12.701  43.842  1.00 189.98 ? 180  LYS A NZ    1 
ATOM   1332  N  N     . LEU A 1  181  ? 54.515  -18.334  49.589  1.00 176.49 ? 181  LEU A N     1 
ATOM   1333  C  CA    . LEU A 1  181  ? 55.012  -18.733  50.911  1.00 176.95 ? 181  LEU A CA    1 
ATOM   1334  C  C     . LEU A 1  181  ? 56.187  -17.830  51.312  1.00 183.72 ? 181  LEU A C     1 
ATOM   1335  O  O     . LEU A 1  181  ? 57.122  -17.662  50.521  1.00 184.57 ? 181  LEU A O     1 
ATOM   1336  C  CB    . LEU A 1  181  ? 55.461  -20.207  50.920  1.00 176.52 ? 181  LEU A CB    1 
ATOM   1337  C  CG    . LEU A 1  181  ? 54.376  -21.278  50.986  1.00 179.79 ? 181  LEU A CG    1 
ATOM   1338  C  CD1   . LEU A 1  181  ? 54.934  -22.619  50.602  1.00 179.58 ? 181  LEU A CD1   1 
ATOM   1339  C  CD2   . LEU A 1  181  ? 53.775  -21.380  52.371  1.00 181.80 ? 181  LEU A CD2   1 
ATOM   1340  N  N     . VAL A 1  182  ? 56.124  -17.231  52.525  1.00 180.87 ? 182  VAL A N     1 
ATOM   1341  C  CA    . VAL A 1  182  ? 57.144  -16.326  53.086  1.00 181.92 ? 182  VAL A CA    1 
ATOM   1342  C  C     . VAL A 1  182  ? 57.399  -16.699  54.559  1.00 186.19 ? 182  VAL A C     1 
ATOM   1343  O  O     . VAL A 1  182  ? 56.462  -16.747  55.360  1.00 184.99 ? 182  VAL A O     1 
ATOM   1344  C  CB    . VAL A 1  182  ? 56.763  -14.820  52.907  1.00 186.31 ? 182  VAL A CB    1 
ATOM   1345  C  CG1   . VAL A 1  182  ? 57.628  -13.899  53.767  1.00 187.19 ? 182  VAL A CG1   1 
ATOM   1346  C  CG2   . VAL A 1  182  ? 56.823  -14.396  51.441  1.00 186.27 ? 182  VAL A CG2   1 
ATOM   1347  N  N     . GLY A 1  183  ? 58.664  -16.954  54.888  1.00 183.95 ? 183  GLY A N     1 
ATOM   1348  C  CA    . GLY A 1  183  ? 59.086  -17.327  56.232  1.00 184.12 ? 183  GLY A CA    1 
ATOM   1349  C  C     . GLY A 1  183  ? 60.004  -16.327  56.903  1.00 189.33 ? 183  GLY A C     1 
ATOM   1350  O  O     . GLY A 1  183  ? 60.791  -15.651  56.232  1.00 189.55 ? 183  GLY A O     1 
ATOM   1351  N  N     . SER A 1  184  ? 59.912  -16.247  58.248  1.00 186.38 ? 184  SER A N     1 
ATOM   1352  C  CA    . SER A 1  184  ? 60.724  -15.358  59.084  1.00 187.41 ? 184  SER A CA    1 
ATOM   1353  C  C     . SER A 1  184  ? 61.622  -16.170  60.023  1.00 192.01 ? 184  SER A C     1 
ATOM   1354  O  O     . SER A 1  184  ? 61.126  -16.963  60.831  1.00 191.17 ? 184  SER A O     1 
ATOM   1355  C  CB    . SER A 1  184  ? 59.846  -14.386  59.871  1.00 190.62 ? 184  SER A CB    1 
ATOM   1356  O  OG    . SER A 1  184  ? 60.613  -13.361  60.482  1.00 199.61 ? 184  SER A OG    1 
ATOM   1357  N  N     . TRP A 1  185  ? 62.947  -15.979  59.888  1.00 189.49 ? 185  TRP A N     1 
ATOM   1358  C  CA    . TRP A 1  185  ? 63.980  -16.651  60.676  1.00 189.79 ? 185  TRP A CA    1 
ATOM   1359  C  C     . TRP A 1  185  ? 63.916  -16.180  62.142  1.00 193.48 ? 185  TRP A C     1 
ATOM   1360  O  O     . TRP A 1  185  ? 64.428  -15.106  62.486  1.00 193.81 ? 185  TRP A O     1 
ATOM   1361  C  CB    . TRP A 1  185  ? 65.371  -16.422  60.048  1.00 189.71 ? 185  TRP A CB    1 
ATOM   1362  C  CG    . TRP A 1  185  ? 65.591  -17.103  58.723  1.00 190.38 ? 185  TRP A CG    1 
ATOM   1363  C  CD1   . TRP A 1  185  ? 66.336  -18.223  58.496  1.00 193.42 ? 185  TRP A CD1   1 
ATOM   1364  C  CD2   . TRP A 1  185  ? 65.130  -16.661  57.435  1.00 189.80 ? 185  TRP A CD2   1 
ATOM   1365  N  NE1   . TRP A 1  185  ? 66.353  -18.519  57.152  1.00 192.57 ? 185  TRP A NE1   1 
ATOM   1366  C  CE2   . TRP A 1  185  ? 65.616  -17.581  56.478  1.00 193.61 ? 185  TRP A CE2   1 
ATOM   1367  C  CE3   . TRP A 1  185  ? 64.331  -15.590  56.997  1.00 190.78 ? 185  TRP A CE3   1 
ATOM   1368  C  CZ2   . TRP A 1  185  ? 65.325  -17.465  55.114  1.00 192.59 ? 185  TRP A CZ2   1 
ATOM   1369  C  CZ3   . TRP A 1  185  ? 64.039  -15.481  55.646  1.00 191.87 ? 185  TRP A CZ3   1 
ATOM   1370  C  CH2   . TRP A 1  185  ? 64.533  -16.409  54.722  1.00 192.41 ? 185  TRP A CH2   1 
ATOM   1371  N  N     . LYS A 1  186  ? 63.224  -16.981  62.984  1.00 188.80 ? 186  LYS A N     1 
ATOM   1372  C  CA    . LYS A 1  186  ? 62.990  -16.740  64.412  1.00 202.95 ? 186  LYS A CA    1 
ATOM   1373  C  C     . LYS A 1  186  ? 64.293  -16.773  65.218  1.00 232.73 ? 186  LYS A C     1 
ATOM   1374  O  O     . LYS A 1  186  ? 64.554  -15.866  66.008  1.00 193.77 ? 186  LYS A O     1 
ATOM   1375  C  CB    . LYS A 1  186  ? 61.986  -17.774  64.963  1.00 203.49 ? 186  LYS A CB    1 
ATOM   1376  C  CG    . LYS A 1  186  ? 61.237  -17.331  66.215  1.00 206.70 ? 186  LYS A CG    1 
ATOM   1377  C  CD    . LYS A 1  186  ? 59.945  -16.592  65.881  1.00 208.53 ? 186  LYS A CD    1 
ATOM   1378  C  CE    . LYS A 1  186  ? 59.264  -16.050  67.112  1.00 210.05 ? 186  LYS A CE    1 
ATOM   1379  N  NZ    . LYS A 1  186  ? 60.013  -14.913  67.709  1.00 214.18 ? 186  LYS A NZ    1 
ATOM   1380  N  N     . LEU A 1  199  ? 62.870  -12.769  58.471  1.00 188.59 ? 199  LEU A N     1 
ATOM   1381  C  CA    . LEU A 1  199  ? 62.715  -11.342  58.203  1.00 189.05 ? 199  LEU A CA    1 
ATOM   1382  C  C     . LEU A 1  199  ? 63.059  -11.030  56.721  1.00 194.94 ? 199  LEU A C     1 
ATOM   1383  O  O     . LEU A 1  199  ? 63.894  -10.158  56.445  1.00 195.96 ? 199  LEU A O     1 
ATOM   1384  C  CB    . LEU A 1  199  ? 63.585  -10.507  59.182  1.00 189.95 ? 199  LEU A CB    1 
ATOM   1385  C  CG    . LEU A 1  199  ? 63.459  -10.801  60.683  1.00 193.76 ? 199  LEU A CG    1 
ATOM   1386  C  CD1   . LEU A 1  199  ? 64.720  -10.413  61.412  1.00 194.97 ? 199  LEU A CD1   1 
ATOM   1387  C  CD2   . LEU A 1  199  ? 62.261  -10.099  61.294  1.00 194.99 ? 199  LEU A CD2   1 
ATOM   1388  N  N     . ARG A 1  200  ? 62.406  -11.761  55.769  1.00 191.07 ? 200  ARG A N     1 
ATOM   1389  C  CA    . ARG A 1  200  ? 62.603  -11.633  54.311  1.00 191.10 ? 200  ARG A CA    1 
ATOM   1390  C  C     . ARG A 1  200  ? 61.460  -12.288  53.509  1.00 193.41 ? 200  ARG A C     1 
ATOM   1391  O  O     . ARG A 1  200  ? 60.928  -13.320  53.926  1.00 191.83 ? 200  ARG A O     1 
ATOM   1392  C  CB    . ARG A 1  200  ? 63.958  -12.243  53.890  1.00 192.66 ? 200  ARG A CB    1 
ATOM   1393  C  CG    . ARG A 1  200  ? 64.451  -11.845  52.496  1.00 203.71 ? 200  ARG A CG    1 
ATOM   1394  C  CD    . ARG A 1  200  ? 65.312  -12.933  51.878  1.00 212.69 ? 200  ARG A CD    1 
ATOM   1395  N  NE    . ARG A 1  200  ? 64.537  -14.134  51.555  1.00 216.34 ? 200  ARG A NE    1 
ATOM   1396  C  CZ    . ARG A 1  200  ? 65.036  -15.365  51.516  1.00 226.91 ? 200  ARG A CZ    1 
ATOM   1397  N  NH1   . ARG A 1  200  ? 66.316  -15.580  51.796  1.00 213.72 ? 200  ARG A NH1   1 
ATOM   1398  N  NH2   . ARG A 1  200  ? 64.254  -16.393  51.224  1.00 210.98 ? 200  ARG A NH2   1 
ATOM   1399  N  N     . VAL A 1  201  ? 61.126  -11.698  52.338  1.00 190.01 ? 201  VAL A N     1 
ATOM   1400  C  CA    . VAL A 1  201  ? 60.084  -12.161  51.408  1.00 188.64 ? 201  VAL A CA    1 
ATOM   1401  C  C     . VAL A 1  201  ? 60.629  -13.331  50.543  1.00 192.06 ? 201  VAL A C     1 
ATOM   1402  O  O     . VAL A 1  201  ? 61.455  -13.108  49.649  1.00 192.43 ? 201  VAL A O     1 
ATOM   1403  C  CB    . VAL A 1  201  ? 59.502  -10.993  50.546  1.00 192.44 ? 201  VAL A CB    1 
ATOM   1404  C  CG1   . VAL A 1  201  ? 58.339  -11.462  49.673  1.00 190.99 ? 201  VAL A CG1   1 
ATOM   1405  C  CG2   . VAL A 1  201  ? 59.074  -9.811   51.417  1.00 192.61 ? 201  VAL A CG2   1 
ATOM   1406  N  N     . LEU A 1  202  ? 60.171  -14.572  50.834  1.00 186.89 ? 202  LEU A N     1 
ATOM   1407  C  CA    . LEU A 1  202  ? 60.569  -15.795  50.123  1.00 185.79 ? 202  LEU A CA    1 
ATOM   1408  C  C     . LEU A 1  202  ? 59.907  -15.888  48.741  1.00 187.40 ? 202  LEU A C     1 
ATOM   1409  O  O     . LEU A 1  202  ? 58.692  -15.705  48.616  1.00 185.92 ? 202  LEU A O     1 
ATOM   1410  C  CB    . LEU A 1  202  ? 60.299  -17.050  50.983  1.00 185.03 ? 202  LEU A CB    1 
ATOM   1411  C  CG    . LEU A 1  202  ? 60.515  -18.441  50.353  1.00 189.19 ? 202  LEU A CG    1 
ATOM   1412  C  CD1   . LEU A 1  202  ? 61.990  -18.723  50.097  1.00 190.32 ? 202  LEU A CD1   1 
ATOM   1413  C  CD2   . LEU A 1  202  ? 59.946  -19.522  51.244  1.00 190.57 ? 202  LEU A CD2   1 
ATOM   1414  N  N     . SER A 1  203  ? 60.729  -16.173  47.713  1.00 183.25 ? 203  SER A N     1 
ATOM   1415  C  CA    . SER A 1  203  ? 60.349  -16.250  46.302  1.00 182.15 ? 203  SER A CA    1 
ATOM   1416  C  C     . SER A 1  203  ? 59.872  -17.630  45.835  1.00 183.68 ? 203  SER A C     1 
ATOM   1417  O  O     . SER A 1  203  ? 60.073  -18.624  46.532  1.00 182.62 ? 203  SER A O     1 
ATOM   1418  C  CB    . SER A 1  203  ? 61.508  -15.765  45.433  1.00 186.68 ? 203  SER A CB    1 
ATOM   1419  O  OG    . SER A 1  203  ? 61.243  -15.883  44.045  1.00 195.13 ? 203  SER A OG    1 
ATOM   1420  N  N     . THR A 1  204  ? 59.239  -17.666  44.634  1.00 179.20 ? 204  THR A N     1 
ATOM   1421  C  CA    . THR A 1  204  ? 58.740  -18.867  43.945  1.00 177.76 ? 204  THR A CA    1 
ATOM   1422  C  C     . THR A 1  204  ? 59.928  -19.613  43.289  1.00 180.98 ? 204  THR A C     1 
ATOM   1423  O  O     . THR A 1  204  ? 59.951  -20.845  43.297  1.00 180.40 ? 204  THR A O     1 
ATOM   1424  C  CB    . THR A 1  204  ? 57.631  -18.515  42.910  1.00 184.12 ? 204  THR A CB    1 
ATOM   1425  O  OG1   . THR A 1  204  ? 56.815  -17.440  43.383  1.00 183.75 ? 204  THR A OG1   1 
ATOM   1426  C  CG2   . THR A 1  204  ? 56.743  -19.704  42.580  1.00 180.38 ? 204  THR A CG2   1 
ATOM   1427  N  N     . GLU A 1  205  ? 60.904  -18.858  42.725  1.00 176.92 ? 205  GLU A N     1 
ATOM   1428  C  CA    . GLU A 1  205  ? 62.123  -19.393  42.101  1.00 176.48 ? 205  GLU A CA    1 
ATOM   1429  C  C     . GLU A 1  205  ? 63.108  -19.829  43.190  1.00 179.36 ? 205  GLU A C     1 
ATOM   1430  O  O     . GLU A 1  205  ? 63.835  -20.809  43.001  1.00 178.61 ? 205  GLU A O     1 
ATOM   1431  C  CB    . GLU A 1  205  ? 62.780  -18.355  41.171  1.00 178.63 ? 205  GLU A CB    1 
ATOM   1432  C  CG    . GLU A 1  205  ? 61.942  -17.987  39.958  1.00 185.91 ? 205  GLU A CG    1 
ATOM   1433  C  CD    . GLU A 1  205  ? 62.693  -17.276  38.850  1.00 198.20 ? 205  GLU A CD    1 
ATOM   1434  O  OE1   . GLU A 1  205  ? 62.795  -16.030  38.902  1.00 184.03 ? 205  GLU A OE1   1 
ATOM   1435  O  OE2   . GLU A 1  205  ? 63.159  -17.965  37.914  1.00 189.63 ? 205  GLU A OE2   1 
ATOM   1436  N  N     . GLU A 1  206  ? 63.100  -19.112  44.345  1.00 175.65 ? 206  GLU A N     1 
ATOM   1437  C  CA    . GLU A 1  206  ? 63.932  -19.392  45.522  1.00 175.84 ? 206  GLU A CA    1 
ATOM   1438  C  C     . GLU A 1  206  ? 63.305  -20.514  46.386  1.00 179.32 ? 206  GLU A C     1 
ATOM   1439  O  O     . GLU A 1  206  ? 63.394  -20.494  47.616  1.00 179.16 ? 206  GLU A O     1 
ATOM   1440  C  CB    . GLU A 1  206  ? 64.180  -18.108  46.342  1.00 177.70 ? 206  GLU A CB    1 
ATOM   1441  C  CG    . GLU A 1  206  ? 65.531  -18.079  47.038  1.00 186.67 ? 206  GLU A CG    1 
ATOM   1442  C  CD    . GLU A 1  206  ? 65.541  -17.371  48.377  1.00 198.82 ? 206  GLU A CD    1 
ATOM   1443  O  OE1   . GLU A 1  206  ? 65.516  -18.067  49.418  1.00 185.17 ? 206  GLU A OE1   1 
ATOM   1444  O  OE2   . GLU A 1  206  ? 65.575  -16.119  48.388  1.00 190.74 ? 206  GLU A OE2   1 
ATOM   1445  N  N     . ILE A 1  207  ? 62.663  -21.488  45.710  1.00 175.08 ? 207  ILE A N     1 
ATOM   1446  C  CA    . ILE A 1  207  ? 62.014  -22.693  46.243  1.00 173.80 ? 207  ILE A CA    1 
ATOM   1447  C  C     . ILE A 1  207  ? 62.345  -23.836  45.255  1.00 178.11 ? 207  ILE A C     1 
ATOM   1448  O  O     . ILE A 1  207  ? 62.617  -24.964  45.675  1.00 177.08 ? 207  ILE A O     1 
ATOM   1449  C  CB    . ILE A 1  207  ? 60.475  -22.467  46.480  1.00 175.37 ? 207  ILE A CB    1 
ATOM   1450  C  CG1   . ILE A 1  207  ? 60.223  -21.728  47.822  1.00 175.48 ? 207  ILE A CG1   1 
ATOM   1451  C  CG2   . ILE A 1  207  ? 59.664  -23.774  46.419  1.00 174.67 ? 207  ILE A CG2   1 
ATOM   1452  C  CD1   . ILE A 1  207  ? 58.776  -21.267  48.106  1.00 179.47 ? 207  ILE A CD1   1 
ATOM   1453  N  N     . LEU A 1  208  ? 62.377  -23.499  43.945  1.00 175.78 ? 208  LEU A N     1 
ATOM   1454  C  CA    . LEU A 1  208  ? 62.666  -24.391  42.820  1.00 175.93 ? 208  LEU A CA    1 
ATOM   1455  C  C     . LEU A 1  208  ? 64.095  -24.949  42.852  1.00 181.84 ? 208  LEU A C     1 
ATOM   1456  O  O     . LEU A 1  208  ? 64.265  -26.161  42.711  1.00 180.95 ? 208  LEU A O     1 
ATOM   1457  C  CB    . LEU A 1  208  ? 62.380  -23.660  41.492  1.00 175.98 ? 208  LEU A CB    1 
ATOM   1458  C  CG    . LEU A 1  208  ? 62.542  -24.458  40.203  1.00 180.47 ? 208  LEU A CG    1 
ATOM   1459  C  CD1   . LEU A 1  208  ? 61.362  -24.249  39.296  1.00 179.79 ? 208  LEU A CD1   1 
ATOM   1460  C  CD2   . LEU A 1  208  ? 63.799  -24.046  39.474  1.00 184.72 ? 208  LEU A CD2   1 
ATOM   1461  N  N     . ASN A 1  209  ? 65.112  -24.076  43.018  1.00 180.56 ? 209  ASN A N     1 
ATOM   1462  C  CA    . ASN A 1  209  ? 66.518  -24.492  43.036  1.00 182.03 ? 209  ASN A CA    1 
ATOM   1463  C  C     . ASN A 1  209  ? 66.924  -25.387  44.221  1.00 186.78 ? 209  ASN A C     1 
ATOM   1464  O  O     . ASN A 1  209  ? 67.886  -26.146  44.087  1.00 187.28 ? 209  ASN A O     1 
ATOM   1465  C  CB    . ASN A 1  209  ? 67.472  -23.301  42.851  1.00 184.74 ? 209  ASN A CB    1 
ATOM   1466  C  CG    . ASN A 1  209  ? 67.468  -22.293  43.974  1.00 209.00 ? 209  ASN A CG    1 
ATOM   1467  O  OD1   . ASN A 1  209  ? 66.431  -21.715  44.325  1.00 204.61 ? 209  ASN A OD1   1 
ATOM   1468  N  ND2   . ASN A 1  209  ? 68.648  -22.012  44.519  1.00 199.97 ? 209  ASN A ND2   1 
ATOM   1469  N  N     . ILE A 1  210  ? 66.188  -25.317  45.359  1.00 182.85 ? 210  ILE A N     1 
ATOM   1470  C  CA    . ILE A 1  210  ? 66.446  -26.126  46.568  1.00 182.55 ? 210  ILE A CA    1 
ATOM   1471  C  C     . ILE A 1  210  ? 66.014  -27.585  46.338  1.00 185.53 ? 210  ILE A C     1 
ATOM   1472  O  O     . ILE A 1  210  ? 66.767  -28.509  46.669  1.00 185.11 ? 210  ILE A O     1 
ATOM   1473  C  CB    . ILE A 1  210  ? 65.783  -25.516  47.843  1.00 185.01 ? 210  ILE A CB    1 
ATOM   1474  C  CG1   . ILE A 1  210  ? 66.135  -24.024  48.010  1.00 186.18 ? 210  ILE A CG1   1 
ATOM   1475  C  CG2   . ILE A 1  210  ? 66.155  -26.313  49.103  1.00 185.53 ? 210  ILE A CG2   1 
ATOM   1476  C  CD1   . ILE A 1  210  ? 65.035  -23.191  48.604  1.00 192.24 ? 210  ILE A CD1   1 
ATOM   1477  N  N     . PHE A 1  211  ? 64.799  -27.773  45.770  1.00 181.27 ? 211  PHE A N     1 
ATOM   1478  C  CA    . PHE A 1  211  ? 64.215  -29.079  45.458  1.00 180.30 ? 211  PHE A CA    1 
ATOM   1479  C  C     . PHE A 1  211  ? 64.860  -29.743  44.246  1.00 184.26 ? 211  PHE A C     1 
ATOM   1480  O  O     . PHE A 1  211  ? 64.789  -30.969  44.113  1.00 183.58 ? 211  PHE A O     1 
ATOM   1481  C  CB    . PHE A 1  211  ? 62.685  -28.999  45.309  1.00 180.90 ? 211  PHE A CB    1 
ATOM   1482  C  CG    . PHE A 1  211  ? 61.937  -28.485  46.519  1.00 182.01 ? 211  PHE A CG    1 
ATOM   1483  C  CD1   . PHE A 1  211  ? 62.297  -28.882  47.804  1.00 185.46 ? 211  PHE A CD1   1 
ATOM   1484  C  CD2   . PHE A 1  211  ? 60.841  -27.644  46.372  1.00 183.50 ? 211  PHE A CD2   1 
ATOM   1485  C  CE1   . PHE A 1  211  ? 61.610  -28.399  48.919  1.00 185.94 ? 211  PHE A CE1   1 
ATOM   1486  C  CE2   . PHE A 1  211  ? 60.140  -27.181  47.488  1.00 185.89 ? 211  PHE A CE2   1 
ATOM   1487  C  CZ    . PHE A 1  211  ? 60.527  -27.563  48.753  1.00 184.28 ? 211  PHE A CZ    1 
ATOM   1488  N  N     . LYS A 1  212  ? 65.515  -28.940  43.377  1.00 181.18 ? 212  LYS A N     1 
ATOM   1489  C  CA    . LYS A 1  212  ? 66.229  -29.431  42.196  1.00 181.37 ? 212  LYS A CA    1 
ATOM   1490  C  C     . LYS A 1  212  ? 67.524  -30.182  42.577  1.00 186.48 ? 212  LYS A C     1 
ATOM   1491  O  O     . LYS A 1  212  ? 68.137  -30.821  41.714  1.00 186.38 ? 212  LYS A O     1 
ATOM   1492  C  CB    . LYS A 1  212  ? 66.483  -28.298  41.185  1.00 183.87 ? 212  LYS A CB    1 
ATOM   1493  C  CG    . LYS A 1  212  ? 65.325  -28.118  40.208  1.00 189.79 ? 212  LYS A CG    1 
ATOM   1494  C  CD    . LYS A 1  212  ? 65.681  -27.233  39.017  1.00 193.40 ? 212  LYS A CD    1 
ATOM   1495  C  CE    . LYS A 1  212  ? 64.809  -27.495  37.805  1.00 192.34 ? 212  LYS A CE    1 
ATOM   1496  N  NZ    . LYS A 1  212  ? 63.385  -27.131  38.029  1.00 193.01 ? 212  LYS A NZ    1 
ATOM   1497  N  N     . HIS A 1  213  ? 67.906  -30.129  43.881  1.00 183.63 ? 213  HIS A N     1 
ATOM   1498  C  CA    . HIS A 1  213  ? 69.070  -30.808  44.454  1.00 184.33 ? 213  HIS A CA    1 
ATOM   1499  C  C     . HIS A 1  213  ? 68.672  -32.097  45.211  1.00 187.55 ? 213  HIS A C     1 
ATOM   1500  O  O     . HIS A 1  213  ? 68.633  -33.157  44.583  1.00 186.94 ? 213  HIS A O     1 
ATOM   1501  C  CB    . HIS A 1  213  ? 69.938  -29.847  45.297  1.00 185.94 ? 213  HIS A CB    1 
ATOM   1502  C  CG    . HIS A 1  213  ? 70.871  -29.006  44.474  1.00 190.38 ? 213  HIS A CG    1 
ATOM   1503  N  ND1   . HIS A 1  213  ? 72.091  -29.496  44.037  1.00 193.29 ? 213  HIS A ND1   1 
ATOM   1504  C  CD2   . HIS A 1  213  ? 70.729  -27.735  44.030  1.00 192.16 ? 213  HIS A CD2   1 
ATOM   1505  C  CE1   . HIS A 1  213  ? 72.648  -28.514  43.346  1.00 193.38 ? 213  HIS A CE1   1 
ATOM   1506  N  NE2   . HIS A 1  213  ? 71.868  -27.434  43.315  1.00 193.09 ? 213  HIS A NE2   1 
ATOM   1507  N  N     . ILE A 1  214  ? 68.344  -32.004  46.527  1.00 183.67 ? 214  ILE A N     1 
ATOM   1508  C  CA    . ILE A 1  214  ? 67.973  -33.126  47.419  1.00 182.75 ? 214  ILE A CA    1 
ATOM   1509  C  C     . ILE A 1  214  ? 68.890  -34.369  47.250  1.00 187.07 ? 214  ILE A C     1 
ATOM   1510  O  O     . ILE A 1  214  ? 70.110  -34.197  47.177  1.00 188.19 ? 214  ILE A O     1 
ATOM   1511  C  CB    . ILE A 1  214  ? 66.439  -33.447  47.505  1.00 184.23 ? 214  ILE A CB    1 
ATOM   1512  C  CG1   . ILE A 1  214  ? 65.527  -32.231  47.169  1.00 183.86 ? 214  ILE A CG1   1 
ATOM   1513  C  CG2   . ILE A 1  214  ? 66.077  -34.084  48.863  1.00 184.49 ? 214  ILE A CG2   1 
ATOM   1514  C  CD1   . ILE A 1  214  ? 65.400  -31.105  48.253  1.00 190.38 ? 214  ILE A CD1   1 
ATOM   1515  N  N     . SER A 1  215  ? 68.312  -35.593  47.168  1.00 182.20 ? 215  SER A N     1 
ATOM   1516  C  CA    . SER A 1  215  ? 69.006  -36.876  47.005  1.00 182.37 ? 215  SER A CA    1 
ATOM   1517  C  C     . SER A 1  215  ? 68.000  -38.012  46.914  1.00 184.62 ? 215  SER A C     1 
ATOM   1518  O  O     . SER A 1  215  ? 67.016  -38.018  47.658  1.00 182.63 ? 215  SER A O     1 
ATOM   1519  C  CB    . SER A 1  215  ? 69.953  -37.147  48.174  1.00 186.77 ? 215  SER A CB    1 
ATOM   1520  O  OG    . SER A 1  215  ? 69.288  -37.011  49.419  1.00 194.81 ? 215  SER A OG    1 
ATOM   1521  N  N     . VAL A 1  216  ? 68.277  -39.001  46.038  1.00 181.67 ? 216  VAL A N     1 
ATOM   1522  C  CA    . VAL A 1  216  ? 67.447  -40.200  45.850  1.00 180.54 ? 216  VAL A CA    1 
ATOM   1523  C  C     . VAL A 1  216  ? 67.769  -41.198  47.000  1.00 185.55 ? 216  VAL A C     1 
ATOM   1524  O  O     . VAL A 1  216  ? 68.303  -42.290  46.772  1.00 186.09 ? 216  VAL A O     1 
ATOM   1525  C  CB    . VAL A 1  216  ? 67.571  -40.816  44.420  1.00 184.16 ? 216  VAL A CB    1 
ATOM   1526  C  CG1   . VAL A 1  216  ? 66.443  -41.805  44.147  1.00 182.77 ? 216  VAL A CG1   1 
ATOM   1527  C  CG2   . VAL A 1  216  ? 67.599  -39.737  43.340  1.00 183.92 ? 216  VAL A CG2   1 
ATOM   1528  N  N     . LYS A 1  217  ? 67.465  -40.768  48.248  1.00 181.59 ? 217  LYS A N     1 
ATOM   1529  C  CA    . LYS A 1  217  ? 67.677  -41.473  49.523  1.00 181.35 ? 217  LYS A CA    1 
ATOM   1530  C  C     . LYS A 1  217  ? 66.794  -40.784  50.575  1.00 184.37 ? 217  LYS A C     1 
ATOM   1531  O  O     . LYS A 1  217  ? 66.009  -41.448  51.257  1.00 182.83 ? 217  LYS A O     1 
ATOM   1532  C  CB    . LYS A 1  217  ? 69.166  -41.408  49.936  1.00 184.81 ? 217  LYS A CB    1 
ATOM   1533  C  CG    . LYS A 1  217  ? 69.627  -42.545  50.836  1.00 190.74 ? 217  LYS A CG    1 
ATOM   1534  C  CD    . LYS A 1  217  ? 71.143  -42.620  50.868  1.00 197.89 ? 217  LYS A CD    1 
ATOM   1535  C  CE    . LYS A 1  217  ? 71.634  -43.949  51.379  1.00 207.00 ? 217  LYS A CE    1 
ATOM   1536  N  NZ    . LYS A 1  217  ? 73.090  -44.121  51.138  1.00 217.17 ? 217  LYS A NZ    1 
ATOM   1537  N  N     . ASP A 1  218  ? 66.916  -39.441  50.673  1.00 181.49 ? 218  ASP A N     1 
ATOM   1538  C  CA    . ASP A 1  218  ? 66.143  -38.583  51.569  1.00 180.58 ? 218  ASP A CA    1 
ATOM   1539  C  C     . ASP A 1  218  ? 64.787  -38.292  50.930  1.00 182.57 ? 218  ASP A C     1 
ATOM   1540  O  O     . ASP A 1  218  ? 63.758  -38.497  51.575  1.00 181.22 ? 218  ASP A O     1 
ATOM   1541  C  CB    . ASP A 1  218  ? 66.890  -37.256  51.849  1.00 183.24 ? 218  ASP A CB    1 
ATOM   1542  C  CG    . ASP A 1  218  ? 68.148  -37.347  52.699  1.00 193.98 ? 218  ASP A CG    1 
ATOM   1543  O  OD1   . ASP A 1  218  ? 68.517  -38.475  53.108  1.00 194.72 ? 218  ASP A OD1   1 
ATOM   1544  O  OD2   . ASP A 1  218  ? 68.763  -36.290  52.959  1.00 200.13 ? 218  ASP A OD2   1 
ATOM   1545  N  N     . PHE A 1  219  ? 64.791  -37.832  49.658  1.00 178.55 ? 219  PHE A N     1 
ATOM   1546  C  CA    . PHE A 1  219  ? 63.586  -37.502  48.901  1.00 177.12 ? 219  PHE A CA    1 
ATOM   1547  C  C     . PHE A 1  219  ? 62.695  -38.722  48.618  1.00 178.42 ? 219  PHE A C     1 
ATOM   1548  O  O     . PHE A 1  219  ? 61.473  -38.567  48.586  1.00 177.04 ? 219  PHE A O     1 
ATOM   1549  C  CB    . PHE A 1  219  ? 63.933  -36.705  47.629  1.00 179.71 ? 219  PHE A CB    1 
ATOM   1550  C  CG    . PHE A 1  219  ? 63.625  -37.357  46.303  1.00 181.53 ? 219  PHE A CG    1 
ATOM   1551  C  CD1   . PHE A 1  219  ? 64.489  -38.296  45.752  1.00 185.90 ? 219  PHE A CD1   1 
ATOM   1552  C  CD2   . PHE A 1  219  ? 62.488  -37.010  45.589  1.00 183.09 ? 219  PHE A CD2   1 
ATOM   1553  C  CE1   . PHE A 1  219  ? 64.200  -38.902  44.527  1.00 186.80 ? 219  PHE A CE1   1 
ATOM   1554  C  CE2   . PHE A 1  219  ? 62.207  -37.606  44.357  1.00 185.94 ? 219  PHE A CE2   1 
ATOM   1555  C  CZ    . PHE A 1  219  ? 63.065  -38.547  43.835  1.00 184.90 ? 219  PHE A CZ    1 
ATOM   1556  N  N     . THR A 1  220  ? 63.299  -39.918  48.399  1.00 173.98 ? 220  THR A N     1 
ATOM   1557  C  CA    . THR A 1  220  ? 62.555  -41.165  48.151  1.00 172.42 ? 220  THR A CA    1 
ATOM   1558  C  C     . THR A 1  220  ? 61.833  -41.643  49.420  1.00 174.57 ? 220  THR A C     1 
ATOM   1559  O  O     . THR A 1  220  ? 60.721  -42.174  49.330  1.00 173.12 ? 220  THR A O     1 
ATOM   1560  C  CB    . THR A 1  220  ? 63.412  -42.249  47.467  1.00 178.84 ? 220  THR A CB    1 
ATOM   1561  O  OG1   . THR A 1  220  ? 64.788  -42.066  47.789  1.00 179.15 ? 220  THR A OG1   1 
ATOM   1562  C  CG2   . THR A 1  220  ? 63.230  -42.271  45.957  1.00 176.43 ? 220  THR A CG2   1 
ATOM   1563  N  N     . SER A 1  221  ? 62.451  -41.410  50.601  1.00 170.68 ? 221  SER A N     1 
ATOM   1564  C  CA    . SER A 1  221  ? 61.884  -41.732  51.915  1.00 169.30 ? 221  SER A CA    1 
ATOM   1565  C  C     . SER A 1  221  ? 60.980  -40.580  52.422  1.00 170.18 ? 221  SER A C     1 
ATOM   1566  O  O     . SER A 1  221  ? 60.353  -40.698  53.476  1.00 169.06 ? 221  SER A O     1 
ATOM   1567  C  CB    . SER A 1  221  ? 62.988  -42.071  52.916  1.00 173.96 ? 221  SER A CB    1 
ATOM   1568  O  OG    . SER A 1  221  ? 63.428  -43.412  52.769  1.00 182.54 ? 221  SER A OG    1 
ATOM   1569  N  N     . LEU A 1  222  ? 60.893  -39.483  51.642  1.00 165.17 ? 222  LEU A N     1 
ATOM   1570  C  CA    . LEU A 1  222  ? 60.039  -38.326  51.919  1.00 163.62 ? 222  LEU A CA    1 
ATOM   1571  C  C     . LEU A 1  222  ? 58.686  -38.471  51.180  1.00 165.01 ? 222  LEU A C     1 
ATOM   1572  O  O     . LEU A 1  222  ? 57.850  -37.567  51.229  1.00 163.50 ? 222  LEU A O     1 
ATOM   1573  C  CB    . LEU A 1  222  ? 60.765  -37.026  51.529  1.00 164.28 ? 222  LEU A CB    1 
ATOM   1574  C  CG    . LEU A 1  222  ? 60.535  -35.804  52.416  1.00 168.80 ? 222  LEU A CG    1 
ATOM   1575  C  CD1   . LEU A 1  222  ? 61.097  -36.012  53.815  1.00 169.67 ? 222  LEU A CD1   1 
ATOM   1576  C  CD2   . LEU A 1  222  ? 61.176  -34.580  51.810  1.00 171.57 ? 222  LEU A CD2   1 
ATOM   1577  N  N     . GLY A 1  223  ? 58.499  -39.620  50.518  1.00 160.82 ? 223  GLY A N     1 
ATOM   1578  C  CA    . GLY A 1  223  ? 57.283  -40.004  49.807  1.00 159.20 ? 223  GLY A CA    1 
ATOM   1579  C  C     . GLY A 1  223  ? 57.199  -39.662  48.334  1.00 161.86 ? 223  GLY A C     1 
ATOM   1580  O  O     . GLY A 1  223  ? 56.135  -39.246  47.868  1.00 160.35 ? 223  GLY A O     1 
ATOM   1581  N  N     . PHE A 1  224  ? 58.302  -39.860  47.587  1.00 158.94 ? 224  PHE A N     1 
ATOM   1582  C  CA    . PHE A 1  224  ? 58.390  -39.546  46.156  1.00 158.85 ? 224  PHE A CA    1 
ATOM   1583  C  C     . PHE A 1  224  ? 59.121  -40.635  45.348  1.00 163.33 ? 224  PHE A C     1 
ATOM   1584  O  O     . PHE A 1  224  ? 59.963  -41.342  45.901  1.00 163.46 ? 224  PHE A O     1 
ATOM   1585  C  CB    . PHE A 1  224  ? 59.086  -38.189  45.959  1.00 161.32 ? 224  PHE A CB    1 
ATOM   1586  C  CG    . PHE A 1  224  ? 58.377  -36.975  46.513  1.00 162.40 ? 224  PHE A CG    1 
ATOM   1587  C  CD1   . PHE A 1  224  ? 58.649  -36.516  47.799  1.00 165.48 ? 224  PHE A CD1   1 
ATOM   1588  C  CD2   . PHE A 1  224  ? 57.487  -36.251  45.728  1.00 164.06 ? 224  PHE A CD2   1 
ATOM   1589  C  CE1   . PHE A 1  224  ? 58.007  -35.381  48.307  1.00 165.92 ? 224  PHE A CE1   1 
ATOM   1590  C  CE2   . PHE A 1  224  ? 56.847  -35.114  46.236  1.00 166.48 ? 224  PHE A CE2   1 
ATOM   1591  C  CZ    . PHE A 1  224  ? 57.111  -34.687  47.522  1.00 164.61 ? 224  PHE A CZ    1 
ATOM   1592  N  N     . ASN A 1  225  ? 58.807  -40.757  44.037  1.00 160.04 ? 225  ASN A N     1 
ATOM   1593  C  CA    . ASN A 1  225  ? 59.410  -41.747  43.130  1.00 160.57 ? 225  ASN A CA    1 
ATOM   1594  C  C     . ASN A 1  225  ? 60.262  -41.067  42.050  1.00 166.09 ? 225  ASN A C     1 
ATOM   1595  O  O     . ASN A 1  225  ? 59.720  -40.347  41.208  1.00 165.15 ? 225  ASN A O     1 
ATOM   1596  C  CB    . ASN A 1  225  ? 58.321  -42.630  42.491  1.00 158.83 ? 225  ASN A CB    1 
ATOM   1597  C  CG    . ASN A 1  225  ? 58.824  -43.870  41.787  1.00 175.62 ? 225  ASN A CG    1 
ATOM   1598  O  OD1   . ASN A 1  225  ? 58.741  -44.985  42.306  1.00 170.38 ? 225  ASN A OD1   1 
ATOM   1599  N  ND2   . ASN A 1  225  ? 59.299  -43.721  40.566  1.00 164.62 ? 225  ASN A ND2   1 
ATOM   1600  N  N     . GLU A 1  226  ? 61.590  -41.331  42.053  1.00 164.36 ? 226  GLU A N     1 
ATOM   1601  C  CA    . GLU A 1  226  ? 62.562  -40.768  41.098  1.00 165.14 ? 226  GLU A CA    1 
ATOM   1602  C  C     . GLU A 1  226  ? 62.155  -40.858  39.619  1.00 168.37 ? 226  GLU A C     1 
ATOM   1603  O  O     . GLU A 1  226  ? 62.415  -39.929  38.852  1.00 168.14 ? 226  GLU A O     1 
ATOM   1604  C  CB    . GLU A 1  226  ? 63.996  -41.297  41.344  1.00 167.81 ? 226  GLU A CB    1 
ATOM   1605  C  CG    . GLU A 1  226  ? 64.170  -42.807  41.249  1.00 177.69 ? 226  GLU A CG    1 
ATOM   1606  C  CD    . GLU A 1  226  ? 65.423  -43.265  40.527  1.00 192.92 ? 226  GLU A CD    1 
ATOM   1607  O  OE1   . GLU A 1  226  ? 65.290  -43.970  39.499  1.00 184.08 ? 226  GLU A OE1   1 
ATOM   1608  O  OE2   . GLU A 1  226  ? 66.537  -42.919  40.983  1.00 181.76 ? 226  GLU A OE2   1 
ATOM   1609  N  N     . VAL A 1  227  ? 61.481  -41.952  39.244  1.00 164.37 ? 227  VAL A N     1 
ATOM   1610  C  CA    . VAL A 1  227  ? 61.016  -42.189  37.880  1.00 164.29 ? 227  VAL A CA    1 
ATOM   1611  C  C     . VAL A 1  227  ? 59.726  -41.382  37.587  1.00 167.98 ? 227  VAL A C     1 
ATOM   1612  O  O     . VAL A 1  227  ? 59.687  -40.656  36.589  1.00 167.37 ? 227  VAL A O     1 
ATOM   1613  C  CB    . VAL A 1  227  ? 60.851  -43.712  37.567  1.00 168.06 ? 227  VAL A CB    1 
ATOM   1614  C  CG1   . VAL A 1  227  ? 60.746  -43.966  36.066  1.00 167.91 ? 227  VAL A CG1   1 
ATOM   1615  C  CG2   . VAL A 1  227  ? 61.986  -44.541  38.170  1.00 168.88 ? 227  VAL A CG2   1 
ATOM   1616  N  N     . PHE A 1  228  ? 58.695  -41.492  38.475  1.00 164.29 ? 228  PHE A N     1 
ATOM   1617  C  CA    . PHE A 1  228  ? 57.360  -40.879  38.328  1.00 163.04 ? 228  PHE A CA    1 
ATOM   1618  C  C     . PHE A 1  228  ? 57.087  -39.510  38.980  1.00 168.18 ? 228  PHE A C     1 
ATOM   1619  O  O     . PHE A 1  228  ? 56.558  -38.634  38.289  1.00 167.85 ? 228  PHE A O     1 
ATOM   1620  C  CB    . PHE A 1  228  ? 56.242  -41.879  38.687  1.00 163.37 ? 228  PHE A CB    1 
ATOM   1621  C  CG    . PHE A 1  228  ? 56.226  -43.148  37.868  1.00 164.32 ? 228  PHE A CG    1 
ATOM   1622  C  CD1   . PHE A 1  228  ? 56.887  -44.288  38.307  1.00 167.49 ? 228  PHE A CD1   1 
ATOM   1623  C  CD2   . PHE A 1  228  ? 55.527  -43.212  36.671  1.00 165.38 ? 228  PHE A CD2   1 
ATOM   1624  C  CE1   . PHE A 1  228  ? 56.868  -45.464  37.552  1.00 168.28 ? 228  PHE A CE1   1 
ATOM   1625  C  CE2   . PHE A 1  228  ? 55.506  -44.390  35.919  1.00 168.14 ? 228  PHE A CE2   1 
ATOM   1626  C  CZ    . PHE A 1  228  ? 56.174  -45.507  36.365  1.00 166.71 ? 228  PHE A CZ    1 
ATOM   1627  N  N     . SER A 1  229  ? 57.370  -39.338  40.298  1.00 165.42 ? 229  SER A N     1 
ATOM   1628  C  CA    . SER A 1  229  ? 57.099  -38.076  41.012  1.00 165.28 ? 229  SER A CA    1 
ATOM   1629  C  C     . SER A 1  229  ? 58.255  -37.504  41.855  1.00 170.10 ? 229  SER A C     1 
ATOM   1630  O  O     . SER A 1  229  ? 58.739  -38.155  42.784  1.00 169.92 ? 229  SER A O     1 
ATOM   1631  C  CB    . SER A 1  229  ? 55.830  -38.185  41.853  1.00 167.98 ? 229  SER A CB    1 
ATOM   1632  O  OG    . SER A 1  229  ? 56.085  -38.710  43.146  1.00 177.07 ? 229  SER A OG    1 
ATOM   1633  N  N     . ARG A 1  230  ? 58.645  -36.256  41.554  1.00 166.79 ? 230  ARG A N     1 
ATOM   1634  C  CA    . ARG A 1  230  ? 59.715  -35.524  42.234  1.00 167.16 ? 230  ARG A CA    1 
ATOM   1635  C  C     . ARG A 1  230  ? 59.193  -34.151  42.701  1.00 170.75 ? 230  ARG A C     1 
ATOM   1636  O  O     . ARG A 1  230  ? 58.326  -33.581  42.029  1.00 169.83 ? 230  ARG A O     1 
ATOM   1637  C  CB    . ARG A 1  230  ? 60.927  -35.339  41.295  1.00 167.50 ? 230  ARG A CB    1 
ATOM   1638  C  CG    . ARG A 1  230  ? 61.640  -36.632  40.903  1.00 174.82 ? 230  ARG A CG    1 
ATOM   1639  C  CD    . ARG A 1  230  ? 62.992  -36.359  40.273  1.00 181.96 ? 230  ARG A CD    1 
ATOM   1640  N  NE    . ARG A 1  230  ? 63.686  -37.595  39.903  1.00 187.85 ? 230  ARG A NE    1 
ATOM   1641  C  CZ    . ARG A 1  230  ? 64.999  -37.693  39.704  1.00 199.17 ? 230  ARG A CZ    1 
ATOM   1642  N  NH1   . ARG A 1  230  ? 65.782  -36.630  39.849  1.00 184.02 ? 230  ARG A NH1   1 
ATOM   1643  N  NH2   . ARG A 1  230  ? 65.540  -38.857  39.370  1.00 184.53 ? 230  ARG A NH2   1 
ATOM   1644  N  N     . PRO A 1  231  ? 59.719  -33.574  43.813  1.00 167.70 ? 231  PRO A N     1 
ATOM   1645  C  CA    . PRO A 1  231  ? 59.237  -32.253  44.260  1.00 167.27 ? 231  PRO A CA    1 
ATOM   1646  C  C     . PRO A 1  231  ? 59.631  -31.090  43.345  1.00 171.16 ? 231  PRO A C     1 
ATOM   1647  O  O     . PRO A 1  231  ? 59.074  -30.001  43.483  1.00 170.75 ? 231  PRO A O     1 
ATOM   1648  C  CB    . PRO A 1  231  ? 59.849  -32.100  45.661  1.00 169.55 ? 231  PRO A CB    1 
ATOM   1649  C  CG    . PRO A 1  231  ? 60.360  -33.460  46.032  1.00 174.30 ? 231  PRO A CG    1 
ATOM   1650  C  CD    . PRO A 1  231  ? 60.744  -34.090  44.736  1.00 170.10 ? 231  PRO A CD    1 
ATOM   1651  N  N     . GLU A 1  232  ? 60.574  -31.324  42.409  1.00 167.76 ? 232  GLU A N     1 
ATOM   1652  C  CA    . GLU A 1  232  ? 61.057  -30.344  41.422  1.00 167.85 ? 232  GLU A CA    1 
ATOM   1653  C  C     . GLU A 1  232  ? 60.068  -30.133  40.250  1.00 170.45 ? 232  GLU A C     1 
ATOM   1654  O  O     . GLU A 1  232  ? 60.310  -29.281  39.388  1.00 170.48 ? 232  GLU A O     1 
ATOM   1655  C  CB    . GLU A 1  232  ? 62.477  -30.696  40.910  1.00 170.35 ? 232  GLU A CB    1 
ATOM   1656  C  CG    . GLU A 1  232  ? 62.904  -32.146  41.092  1.00 180.30 ? 232  GLU A CG    1 
ATOM   1657  C  CD    . GLU A 1  232  ? 63.567  -32.787  39.888  1.00 198.37 ? 232  GLU A CD    1 
ATOM   1658  O  OE1   . GLU A 1  232  ? 64.804  -32.984  39.923  1.00 191.18 ? 232  GLU A OE1   1 
ATOM   1659  O  OE2   . GLU A 1  232  ? 62.846  -33.119  38.920  1.00 190.15 ? 232  GLU A OE2   1 
ATOM   1660  N  N     . TRP A 1  233  ? 58.954  -30.899  40.234  1.00 165.19 ? 233  TRP A N     1 
ATOM   1661  C  CA    . TRP A 1  233  ? 57.910  -30.821  39.210  1.00 163.80 ? 233  TRP A CA    1 
ATOM   1662  C  C     . TRP A 1  233  ? 56.622  -30.183  39.734  1.00 164.38 ? 233  TRP A C     1 
ATOM   1663  O  O     . TRP A 1  233  ? 55.811  -29.719  38.928  1.00 163.54 ? 233  TRP A O     1 
ATOM   1664  C  CB    . TRP A 1  233  ? 57.645  -32.202  38.581  1.00 162.41 ? 233  TRP A CB    1 
ATOM   1665  C  CG    . TRP A 1  233  ? 58.852  -32.822  37.936  1.00 164.53 ? 233  TRP A CG    1 
ATOM   1666  C  CD1   . TRP A 1  233  ? 59.851  -32.175  37.269  1.00 168.48 ? 233  TRP A CD1   1 
ATOM   1667  C  CD2   . TRP A 1  233  ? 59.172  -34.220  37.877  1.00 164.65 ? 233  TRP A CD2   1 
ATOM   1668  N  NE1   . TRP A 1  233  ? 60.786  -33.077  36.822  1.00 168.80 ? 233  TRP A NE1   1 
ATOM   1669  C  CE2   . TRP A 1  233  ? 60.396  -34.341  37.182  1.00 169.79 ? 233  TRP A CE2   1 
ATOM   1670  C  CE3   . TRP A 1  233  ? 58.546  -35.386  38.351  1.00 165.31 ? 233  TRP A CE3   1 
ATOM   1671  C  CZ2   . TRP A 1  233  ? 60.998  -35.583  36.931  1.00 169.60 ? 233  TRP A CZ2   1 
ATOM   1672  C  CZ3   . TRP A 1  233  ? 59.150  -36.615  38.113  1.00 167.26 ? 233  TRP A CZ3   1 
ATOM   1673  C  CH2   . TRP A 1  233  ? 60.357  -36.706  37.406  1.00 169.00 ? 233  TRP A CH2   1 
ATOM   1674  N  N     . MET A 1  234  ? 56.454  -30.130  41.085  1.00 158.53 ? 234  MET A N     1 
ATOM   1675  C  CA    . MET A 1  234  ? 55.300  -29.533  41.780  1.00 156.51 ? 234  MET A CA    1 
ATOM   1676  C  C     . MET A 1  234  ? 55.115  -28.064  41.391  1.00 160.02 ? 234  MET A C     1 
ATOM   1677  O  O     . MET A 1  234  ? 53.985  -27.584  41.312  1.00 158.54 ? 234  MET A O     1 
ATOM   1678  C  CB    . MET A 1  234  ? 55.434  -29.672  43.305  1.00 158.33 ? 234  MET A CB    1 
ATOM   1679  C  CG    . MET A 1  234  ? 55.267  -31.089  43.807  1.00 160.93 ? 234  MET A CG    1 
ATOM   1680  S  SD    . MET A 1  234  ? 54.699  -31.146  45.522  1.00 164.15 ? 234  MET A SD    1 
ATOM   1681  C  CE    . MET A 1  234  ? 56.231  -31.161  46.373  1.00 161.79 ? 234  MET A CE    1 
ATOM   1682  N  N     . ILE A 1  235  ? 56.236  -27.369  41.136  1.00 157.88 ? 235  ILE A N     1 
ATOM   1683  C  CA    . ILE A 1  235  ? 56.284  -25.979  40.683  1.00 158.28 ? 235  ILE A CA    1 
ATOM   1684  C  C     . ILE A 1  235  ? 56.233  -26.007  39.165  1.00 162.27 ? 235  ILE A C     1 
ATOM   1685  O  O     . ILE A 1  235  ? 57.083  -26.631  38.522  1.00 161.75 ? 235  ILE A O     1 
ATOM   1686  C  CB    . ILE A 1  235  ? 57.504  -25.169  41.224  1.00 162.54 ? 235  ILE A CB    1 
ATOM   1687  C  CG1   . ILE A 1  235  ? 58.500  -26.029  42.043  1.00 163.42 ? 235  ILE A CG1   1 
ATOM   1688  C  CG2   . ILE A 1  235  ? 57.034  -23.961  42.033  1.00 163.22 ? 235  ILE A CG2   1 
ATOM   1689  C  CD1   . ILE A 1  235  ? 59.599  -26.680  41.258  1.00 170.25 ? 235  ILE A CD1   1 
ATOM   1690  N  N     . LEU A 1  236  ? 55.198  -25.379  38.603  1.00 159.50 ? 236  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1  236  ? 54.937  -25.352  37.166  1.00 159.91 ? 236  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1  236  ? 55.873  -24.451  36.360  1.00 166.51 ? 236  LEU A C     1 
ATOM   1693  O  O     . LEU A 1  236  ? 55.868  -23.227  36.524  1.00 165.87 ? 236  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1  236  ? 53.451  -25.061  36.871  1.00 158.99 ? 236  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1  236  ? 52.457  -26.146  37.307  1.00 162.21 ? 236  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1  236  ? 51.132  -25.540  37.707  1.00 161.54 ? 236  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1  236  ? 52.272  -27.201  36.226  1.00 163.98 ? 236  LEU A CD2   1 
ATOM   1698  N  N     . THR A 1  237  ? 56.673  -25.089  35.479  1.00 165.48 ? 237  THR A N     1 
ATOM   1699  C  CA    . THR A 1  237  ? 57.655  -24.466  34.580  1.00 167.05 ? 237  THR A CA    1 
ATOM   1700  C  C     . THR A 1  237  ? 57.160  -24.520  33.125  1.00 172.07 ? 237  THR A C     1 
ATOM   1701  O  O     . THR A 1  237  ? 57.165  -23.499  32.435  1.00 171.73 ? 237  THR A O     1 
ATOM   1702  C  CB    . THR A 1  237  ? 59.041  -25.108  34.758  1.00 176.51 ? 237  THR A CB    1 
ATOM   1703  O  OG1   . THR A 1  237  ? 59.028  -26.004  35.876  1.00 175.11 ? 237  THR A OG1   1 
ATOM   1704  C  CG2   . THR A 1  237  ? 60.141  -24.071  34.928  1.00 177.03 ? 237  THR A CG2   1 
ATOM   1705  N  N     . CYS A 1  238  ? 56.729  -25.713  32.670  1.00 169.52 ? 238  CYS A N     1 
ATOM   1706  C  CA    . CYS A 1  238  ? 56.153  -25.927  31.343  1.00 169.60 ? 238  CYS A CA    1 
ATOM   1707  C  C     . CYS A 1  238  ? 54.733  -26.454  31.554  1.00 172.76 ? 238  CYS A C     1 
ATOM   1708  O  O     . CYS A 1  238  ? 54.543  -27.595  31.999  1.00 171.86 ? 238  CYS A O     1 
ATOM   1709  C  CB    . CYS A 1  238  ? 57.002  -26.884  30.511  1.00 170.51 ? 238  CYS A CB    1 
ATOM   1710  S  SG    . CYS A 1  238  ? 56.821  -26.669  28.722  1.00 174.66 ? 238  CYS A SG    1 
ATOM   1711  N  N     . LEU A 1  239  ? 53.742  -25.578  31.310  1.00 168.98 ? 239  LEU A N     1 
ATOM   1712  C  CA    . LEU A 1  239  ? 52.318  -25.850  31.500  1.00 167.70 ? 239  LEU A CA    1 
ATOM   1713  C  C     . LEU A 1  239  ? 51.692  -26.612  30.308  1.00 171.70 ? 239  LEU A C     1 
ATOM   1714  O  O     . LEU A 1  239  ? 51.849  -26.175  29.164  1.00 172.29 ? 239  LEU A O     1 
ATOM   1715  C  CB    . LEU A 1  239  ? 51.579  -24.526  31.767  1.00 167.45 ? 239  LEU A CB    1 
ATOM   1716  C  CG    . LEU A 1  239  ? 50.177  -24.627  32.341  1.00 170.92 ? 239  LEU A CG    1 
ATOM   1717  C  CD1   . LEU A 1  239  ? 50.019  -23.702  33.510  1.00 170.93 ? 239  LEU A CD1   1 
ATOM   1718  C  CD2   . LEU A 1  239  ? 49.121  -24.349  31.281  1.00 172.81 ? 239  LEU A CD2   1 
ATOM   1719  N  N     . PRO A 1  240  ? 50.954  -27.728  30.548  1.00 166.88 ? 240  PRO A N     1 
ATOM   1720  C  CA    . PRO A 1  240  ? 50.345  -28.461  29.424  1.00 166.09 ? 240  PRO A CA    1 
ATOM   1721  C  C     . PRO A 1  240  ? 49.098  -27.769  28.880  1.00 168.64 ? 240  PRO A C     1 
ATOM   1722  O  O     . PRO A 1  240  ? 48.239  -27.338  29.658  1.00 167.41 ? 240  PRO A O     1 
ATOM   1723  C  CB    . PRO A 1  240  ? 50.013  -29.836  30.027  1.00 167.18 ? 240  PRO A CB    1 
ATOM   1724  C  CG    . PRO A 1  240  ? 50.607  -29.831  31.426  1.00 171.77 ? 240  PRO A CG    1 
ATOM   1725  C  CD    . PRO A 1  240  ? 50.668  -28.401  31.828  1.00 167.67 ? 240  PRO A CD    1 
ATOM   1726  N  N     . VAL A 1  241  ? 49.008  -27.656  27.540  1.00 165.09 ? 241  VAL A N     1 
ATOM   1727  C  CA    . VAL A 1  241  ? 47.870  -27.034  26.852  1.00 164.36 ? 241  VAL A CA    1 
ATOM   1728  C  C     . VAL A 1  241  ? 46.863  -28.113  26.396  1.00 167.08 ? 241  VAL A C     1 
ATOM   1729  O  O     . VAL A 1  241  ? 47.156  -28.854  25.446  1.00 166.92 ? 241  VAL A O     1 
ATOM   1730  C  CB    . VAL A 1  241  ? 48.289  -26.074  25.701  1.00 168.89 ? 241  VAL A CB    1 
ATOM   1731  C  CG1   . VAL A 1  241  ? 47.072  -25.483  24.995  1.00 168.30 ? 241  VAL A CG1   1 
ATOM   1732  C  CG2   . VAL A 1  241  ? 49.182  -24.957  26.217  1.00 169.49 ? 241  VAL A CG2   1 
ATOM   1733  N  N     . PRO A 1  242  ? 45.678  -28.213  27.060  1.00 162.02 ? 242  PRO A N     1 
ATOM   1734  C  CA    . PRO A 1  242  ? 44.679  -29.207  26.628  1.00 160.71 ? 242  PRO A CA    1 
ATOM   1735  C  C     . PRO A 1  242  ? 44.042  -28.843  25.280  1.00 163.74 ? 242  PRO A C     1 
ATOM   1736  O  O     . PRO A 1  242  ? 43.701  -27.676  25.055  1.00 163.82 ? 242  PRO A O     1 
ATOM   1737  C  CB    . PRO A 1  242  ? 43.662  -29.219  27.770  1.00 161.63 ? 242  PRO A CB    1 
ATOM   1738  C  CG    . PRO A 1  242  ? 43.780  -27.882  28.403  1.00 166.45 ? 242  PRO A CG    1 
ATOM   1739  C  CD    . PRO A 1  242  ? 45.187  -27.409  28.201  1.00 163.02 ? 242  PRO A CD    1 
ATOM   1740  N  N     . PRO A 1  243  ? 43.892  -29.822  24.357  1.00 158.80 ? 243  PRO A N     1 
ATOM   1741  C  CA    . PRO A 1  243  ? 43.313  -29.512  23.036  1.00 158.25 ? 243  PRO A CA    1 
ATOM   1742  C  C     . PRO A 1  243  ? 41.817  -29.166  23.070  1.00 160.18 ? 243  PRO A C     1 
ATOM   1743  O  O     . PRO A 1  243  ? 41.188  -29.370  24.113  1.00 158.99 ? 243  PRO A O     1 
ATOM   1744  C  CB    . PRO A 1  243  ? 43.593  -30.786  22.216  1.00 160.09 ? 243  PRO A CB    1 
ATOM   1745  C  CG    . PRO A 1  243  ? 44.505  -31.610  23.043  1.00 164.70 ? 243  PRO A CG    1 
ATOM   1746  C  CD    . PRO A 1  243  ? 44.257  -31.246  24.455  1.00 159.89 ? 243  PRO A CD    1 
ATOM   1747  N  N     . PRO A 1  244  ? 41.210  -28.677  21.950  1.00 156.24 ? 244  PRO A N     1 
ATOM   1748  C  CA    . PRO A 1  244  ? 39.761  -28.374  21.964  1.00 155.13 ? 244  PRO A CA    1 
ATOM   1749  C  C     . PRO A 1  244  ? 38.773  -29.442  22.496  1.00 155.93 ? 244  PRO A C     1 
ATOM   1750  O  O     . PRO A 1  244  ? 37.855  -28.998  23.180  1.00 155.03 ? 244  PRO A O     1 
ATOM   1751  C  CB    . PRO A 1  244  ? 39.470  -27.932  20.525  1.00 157.57 ? 244  PRO A CB    1 
ATOM   1752  C  CG    . PRO A 1  244  ? 40.780  -27.431  20.022  1.00 163.00 ? 244  PRO A CG    1 
ATOM   1753  C  CD    . PRO A 1  244  ? 41.796  -28.353  20.631  1.00 158.51 ? 244  PRO A CD    1 
ATOM   1754  N  N     . PRO A 1  245  ? 38.907  -30.799  22.314  1.00 150.30 ? 245  PRO A N     1 
ATOM   1755  C  CA    . PRO A 1  245  ? 37.917  -31.721  22.920  1.00 148.74 ? 245  PRO A CA    1 
ATOM   1756  C  C     . PRO A 1  245  ? 37.696  -31.575  24.439  1.00 151.30 ? 245  PRO A C     1 
ATOM   1757  O  O     . PRO A 1  245  ? 36.694  -32.082  24.954  1.00 150.41 ? 245  PRO A O     1 
ATOM   1758  C  CB    . PRO A 1  245  ? 38.452  -33.108  22.549  1.00 150.30 ? 245  PRO A CB    1 
ATOM   1759  C  CG    . PRO A 1  245  ? 39.242  -32.891  21.329  1.00 155.42 ? 245  PRO A CG    1 
ATOM   1760  C  CD    . PRO A 1  245  ? 39.904  -31.563  21.532  1.00 151.77 ? 245  PRO A CD    1 
ATOM   1761  N  N     . VAL A 1  246  ? 38.610  -30.859  25.142  1.00 147.05 ? 246  VAL A N     1 
ATOM   1762  C  CA    . VAL A 1  246  ? 38.537  -30.575  26.578  1.00 146.07 ? 246  VAL A CA    1 
ATOM   1763  C  C     . VAL A 1  246  ? 37.751  -29.273  26.806  1.00 151.50 ? 246  VAL A C     1 
ATOM   1764  O  O     . VAL A 1  246  ? 37.058  -29.155  27.809  1.00 150.35 ? 246  VAL A O     1 
ATOM   1765  C  CB    . VAL A 1  246  ? 39.936  -30.556  27.252  1.00 149.59 ? 246  VAL A CB    1 
ATOM   1766  C  CG1   . VAL A 1  246  ? 39.822  -30.449  28.768  1.00 148.83 ? 246  VAL A CG1   1 
ATOM   1767  C  CG2   . VAL A 1  246  ? 40.742  -31.796  26.882  1.00 149.39 ? 246  VAL A CG2   1 
ATOM   1768  N  N     . ARG A 1  247  ? 37.827  -28.326  25.854  1.00 150.70 ? 247  ARG A N     1 
ATOM   1769  C  CA    . ARG A 1  247  ? 37.147  -27.015  25.892  1.00 151.74 ? 247  ARG A CA    1 
ATOM   1770  C  C     . ARG A 1  247  ? 36.478  -26.696  24.525  1.00 158.81 ? 247  ARG A C     1 
ATOM   1771  O  O     . ARG A 1  247  ? 37.055  -25.958  23.719  1.00 159.32 ? 247  ARG A O     1 
ATOM   1772  C  CB    . ARG A 1  247  ? 38.135  -25.906  26.309  1.00 151.74 ? 247  ARG A CB    1 
ATOM   1773  C  CG    . ARG A 1  247  ? 39.574  -26.188  25.890  1.00 157.53 ? 247  ARG A CG    1 
ATOM   1774  C  CD    . ARG A 1  247  ? 40.484  -24.992  26.011  1.00 159.35 ? 247  ARG A CD    1 
ATOM   1775  N  NE    . ARG A 1  247  ? 41.758  -25.266  25.354  1.00 158.58 ? 247  ARG A NE    1 
ATOM   1776  C  CZ    . ARG A 1  247  ? 42.005  -25.029  24.070  1.00 166.99 ? 247  ARG A CZ    1 
ATOM   1777  N  NH1   . ARG A 1  247  ? 41.076  -24.478  23.298  1.00 149.20 ? 247  ARG A NH1   1 
ATOM   1778  N  NH2   . ARG A 1  247  ? 43.184  -25.334  23.551  1.00 154.61 ? 247  ARG A NH2   1 
ATOM   1779  N  N     . PRO A 1  248  ? 35.281  -27.263  24.230  1.00 156.93 ? 248  PRO A N     1 
ATOM   1780  C  CA    . PRO A 1  248  ? 34.675  -27.069  22.896  1.00 158.13 ? 248  PRO A CA    1 
ATOM   1781  C  C     . PRO A 1  248  ? 34.038  -25.710  22.555  1.00 166.23 ? 248  PRO A C     1 
ATOM   1782  O  O     . PRO A 1  248  ? 34.010  -24.797  23.384  1.00 165.78 ? 248  PRO A O     1 
ATOM   1783  C  CB    . PRO A 1  248  ? 33.669  -28.230  22.794  1.00 158.90 ? 248  PRO A CB    1 
ATOM   1784  C  CG    . PRO A 1  248  ? 33.918  -29.105  23.997  1.00 162.09 ? 248  PRO A CG    1 
ATOM   1785  C  CD    . PRO A 1  248  ? 34.479  -28.205  25.032  1.00 157.60 ? 248  PRO A CD    1 
ATOM   1786  N  N     . SER A 1  249  ? 33.536  -25.588  21.302  1.00 166.35 ? 249  SER A N     1 
ATOM   1787  C  CA    . SER A 1  249  ? 32.854  -24.408  20.760  1.00 168.34 ? 249  SER A CA    1 
ATOM   1788  C  C     . SER A 1  249  ? 31.368  -24.737  20.408  1.00 176.41 ? 249  SER A C     1 
ATOM   1789  O  O     . SER A 1  249  ? 30.682  -25.308  21.261  1.00 175.26 ? 249  SER A O     1 
ATOM   1790  C  CB    . SER A 1  249  ? 33.622  -23.846  19.565  1.00 172.39 ? 249  SER A CB    1 
ATOM   1791  O  OG    . SER A 1  249  ? 34.959  -23.519  19.906  1.00 180.87 ? 249  SER A OG    1 
ATOM   1792  N  N     . ILE A 1  250  ? 30.887  -24.400  19.163  1.00 176.83 ? 250  ILE A N     1 
ATOM   1793  C  CA    . ILE A 1  250  ? 29.515  -24.587  18.615  1.00 177.79 ? 250  ILE A CA    1 
ATOM   1794  C  C     . ILE A 1  250  ? 28.356  -24.245  19.587  1.00 184.99 ? 250  ILE A C     1 
ATOM   1795  O  O     . ILE A 1  250  ? 27.904  -25.106  20.354  1.00 184.20 ? 250  ILE A O     1 
ATOM   1796  C  CB    . ILE A 1  250  ? 29.282  -25.863  17.742  1.00 180.35 ? 250  ILE A CB    1 
ATOM   1797  C  CG1   . ILE A 1  250  ? 29.749  -27.166  18.444  1.00 179.68 ? 250  ILE A CG1   1 
ATOM   1798  C  CG2   . ILE A 1  250  ? 29.913  -25.693  16.353  1.00 181.61 ? 250  ILE A CG2   1 
ATOM   1799  C  CD1   . ILE A 1  250  ? 28.925  -28.403  18.120  1.00 184.16 ? 250  ILE A CD1   1 
ATOM   1800  N  N     . SER A 1  251  ? 27.889  -22.972  19.540  1.00 184.21 ? 251  SER A N     1 
ATOM   1801  C  CA    . SER A 1  251  ? 26.876  -22.407  20.444  1.00 184.70 ? 251  SER A CA    1 
ATOM   1802  C  C     . SER A 1  251  ? 25.381  -22.385  20.000  1.00 190.78 ? 251  SER A C     1 
ATOM   1803  O  O     . SER A 1  251  ? 24.927  -23.269  19.266  1.00 190.16 ? 251  SER A O     1 
ATOM   1804  C  CB    . SER A 1  251  ? 27.346  -21.056  20.997  1.00 188.23 ? 251  SER A CB    1 
ATOM   1805  O  OG    . SER A 1  251  ? 27.695  -20.130  19.979  1.00 195.71 ? 251  SER A OG    1 
ATOM   1806  N  N     . PHE A 1  252  ? 24.628  -21.387  20.525  1.00 189.07 ? 252  PHE A N     1 
ATOM   1807  C  CA    . PHE A 1  252  ? 23.201  -21.063  20.361  1.00 189.66 ? 252  PHE A CA    1 
ATOM   1808  C  C     . PHE A 1  252  ? 22.850  -20.536  18.944  1.00 195.26 ? 252  PHE A C     1 
ATOM   1809  O  O     . PHE A 1  252  ? 21.977  -21.105  18.281  1.00 194.87 ? 252  PHE A O     1 
ATOM   1810  C  CB    . PHE A 1  252  ? 22.767  -20.048  21.457  1.00 191.65 ? 252  PHE A CB    1 
ATOM   1811  C  CG    . PHE A 1  252  ? 23.911  -19.335  22.157  1.00 193.36 ? 252  PHE A CG    1 
ATOM   1812  C  CD1   . PHE A 1  252  ? 24.516  -18.221  21.585  1.00 197.32 ? 252  PHE A CD1   1 
ATOM   1813  C  CD2   . PHE A 1  252  ? 24.408  -19.804  23.371  1.00 194.69 ? 252  PHE A CD2   1 
ATOM   1814  C  CE1   . PHE A 1  252  ? 25.592  -17.586  22.214  1.00 198.38 ? 252  PHE A CE1   1 
ATOM   1815  C  CE2   . PHE A 1  252  ? 25.484  -19.166  24.000  1.00 197.56 ? 252  PHE A CE2   1 
ATOM   1816  C  CZ    . PHE A 1  252  ? 26.067  -18.061  23.419  1.00 196.54 ? 252  PHE A CZ    1 
ATOM   1817  N  N     . ASN A 1  253  ? 23.523  -19.445  18.500  1.00 192.74 ? 253  ASN A N     1 
ATOM   1818  C  CA    . ASN A 1  253  ? 23.360  -18.828  17.176  1.00 193.21 ? 253  ASN A CA    1 
ATOM   1819  C  C     . ASN A 1  253  ? 24.706  -18.838  16.434  1.00 197.38 ? 253  ASN A C     1 
ATOM   1820  O  O     . ASN A 1  253  ? 25.743  -18.556  17.047  1.00 197.07 ? 253  ASN A O     1 
ATOM   1821  C  CB    . ASN A 1  253  ? 22.793  -17.399  17.285  1.00 193.79 ? 253  ASN A CB    1 
ATOM   1822  C  CG    . ASN A 1  253  ? 23.699  -16.389  17.958  1.00 211.19 ? 253  ASN A CG    1 
ATOM   1823  O  OD1   . ASN A 1  253  ? 24.546  -15.748  17.323  1.00 202.61 ? 253  ASN A OD1   1 
ATOM   1824  N  ND2   . ASN A 1  253  ? 23.528  -16.210  19.253  1.00 202.75 ? 253  ASN A ND2   1 
ATOM   1825  N  N     . GLU A 1  254  ? 24.695  -19.176  15.127  1.00 193.94 ? 254  GLU A N     1 
ATOM   1826  C  CA    . GLU A 1  254  ? 25.922  -19.234  14.321  1.00 193.79 ? 254  GLU A CA    1 
ATOM   1827  C  C     . GLU A 1  254  ? 26.171  -17.945  13.494  1.00 197.64 ? 254  GLU A C     1 
ATOM   1828  O  O     . GLU A 1  254  ? 25.835  -17.881  12.306  1.00 197.32 ? 254  GLU A O     1 
ATOM   1829  C  CB    . GLU A 1  254  ? 25.987  -20.532  13.485  1.00 194.81 ? 254  GLU A CB    1 
ATOM   1830  C  CG    . GLU A 1  254  ? 27.336  -21.238  13.539  1.00 202.33 ? 254  GLU A CG    1 
ATOM   1831  C  CD    . GLU A 1  254  ? 27.386  -22.519  14.352  1.00 210.02 ? 254  GLU A CD    1 
ATOM   1832  O  OE1   . GLU A 1  254  ? 27.243  -23.609  13.753  1.00 196.39 ? 254  GLU A OE1   1 
ATOM   1833  O  OE2   . GLU A 1  254  ? 27.608  -22.435  15.582  1.00 197.68 ? 254  GLU A OE2   1 
ATOM   1834  N  N     . SER A 1  255  ? 26.765  -16.919  14.158  1.00 193.87 ? 255  SER A N     1 
ATOM   1835  C  CA    . SER A 1  255  ? 27.098  -15.599  13.601  1.00 194.16 ? 255  SER A CA    1 
ATOM   1836  C  C     . SER A 1  255  ? 28.501  -15.118  14.033  1.00 195.75 ? 255  SER A C     1 
ATOM   1837  O  O     . SER A 1  255  ? 29.279  -14.670  13.183  1.00 195.94 ? 255  SER A O     1 
ATOM   1838  C  CB    . SER A 1  255  ? 26.044  -14.569  14.005  1.00 198.54 ? 255  SER A CB    1 
ATOM   1839  O  OG    . SER A 1  255  ? 26.262  -13.312  13.384  1.00 208.82 ? 255  SER A OG    1 
ATOM   1840  N  N     . GLN A 1  256  ? 28.813  -15.202  15.347  1.00 189.59 ? 256  GLN A N     1 
ATOM   1841  C  CA    . GLN A 1  256  ? 30.101  -14.773  15.891  1.00 188.43 ? 256  GLN A CA    1 
ATOM   1842  C  C     . GLN A 1  256  ? 30.941  -15.928  16.488  1.00 188.58 ? 256  GLN A C     1 
ATOM   1843  O  O     . GLN A 1  256  ? 31.585  -16.653  15.725  1.00 187.87 ? 256  GLN A O     1 
ATOM   1844  C  CB    . GLN A 1  256  ? 29.930  -13.586  16.861  1.00 190.09 ? 256  GLN A CB    1 
ATOM   1845  C  CG    . GLN A 1  256  ? 31.165  -12.694  16.946  1.00 204.43 ? 256  GLN A CG    1 
ATOM   1846  C  CD    . GLN A 1  256  ? 31.097  -11.730  18.101  1.00 220.23 ? 256  GLN A CD    1 
ATOM   1847  O  OE1   . GLN A 1  256  ? 30.665  -10.581  17.962  1.00 215.28 ? 256  GLN A OE1   1 
ATOM   1848  N  NE2   . GLN A 1  256  ? 31.546  -12.174  19.266  1.00 210.64 ? 256  GLN A NE2   1 
ATOM   1849  N  N     . ARG A 1  257  ? 30.942  -16.092  17.832  1.00 182.60 ? 257  ARG A N     1 
ATOM   1850  C  CA    . ARG A 1  257  ? 31.737  -17.114  18.533  1.00 180.82 ? 257  ARG A CA    1 
ATOM   1851  C  C     . ARG A 1  257  ? 30.882  -18.080  19.406  1.00 181.40 ? 257  ARG A C     1 
ATOM   1852  O  O     . ARG A 1  257  ? 29.838  -18.567  18.957  1.00 180.65 ? 257  ARG A O     1 
ATOM   1853  C  CB    . ARG A 1  257  ? 32.864  -16.458  19.374  1.00 180.96 ? 257  ARG A CB    1 
ATOM   1854  C  CG    . ARG A 1  257  ? 33.753  -15.444  18.656  1.00 190.82 ? 257  ARG A CG    1 
ATOM   1855  C  CD    . ARG A 1  257  ? 34.910  -15.055  19.555  1.00 198.96 ? 257  ARG A CD    1 
ATOM   1856  N  NE    . ARG A 1  257  ? 35.641  -13.880  19.077  1.00 205.09 ? 257  ARG A NE    1 
ATOM   1857  C  CZ    . ARG A 1  257  ? 35.438  -12.640  19.512  1.00 215.70 ? 257  ARG A CZ    1 
ATOM   1858  N  NH1   . ARG A 1  257  ? 34.507  -12.393  20.426  1.00 200.66 ? 257  ARG A NH1   1 
ATOM   1859  N  NH2   . ARG A 1  257  ? 36.161  -11.636  19.035  1.00 201.30 ? 257  ARG A NH2   1 
ATOM   1860  N  N     . GLY A 1  258  ? 31.361  -18.342  20.629  1.00 175.41 ? 258  GLY A N     1 
ATOM   1861  C  CA    . GLY A 1  258  ? 30.755  -19.222  21.624  1.00 173.36 ? 258  GLY A CA    1 
ATOM   1862  C  C     . GLY A 1  258  ? 31.805  -20.041  22.353  1.00 174.25 ? 258  GLY A C     1 
ATOM   1863  O  O     . GLY A 1  258  ? 31.637  -21.252  22.523  1.00 172.79 ? 258  GLY A O     1 
ATOM   1864  N  N     . GLU A 1  259  ? 32.906  -19.377  22.778  1.00 169.72 ? 259  GLU A N     1 
ATOM   1865  C  CA    . GLU A 1  259  ? 34.053  -20.000  23.450  1.00 168.45 ? 259  GLU A CA    1 
ATOM   1866  C  C     . GLU A 1  259  ? 33.864  -20.296  24.937  1.00 169.80 ? 259  GLU A C     1 
ATOM   1867  O  O     . GLU A 1  259  ? 33.234  -19.524  25.669  1.00 168.80 ? 259  GLU A O     1 
ATOM   1868  C  CB    . GLU A 1  259  ? 35.365  -19.234  23.186  1.00 170.48 ? 259  GLU A CB    1 
ATOM   1869  C  CG    . GLU A 1  259  ? 35.898  -19.357  21.760  1.00 179.52 ? 259  GLU A CG    1 
ATOM   1870  C  CD    . GLU A 1  259  ? 36.578  -20.653  21.348  1.00 190.93 ? 259  GLU A CD    1 
ATOM   1871  O  OE1   . GLU A 1  259  ? 36.729  -20.872  20.123  1.00 176.51 ? 259  GLU A OE1   1 
ATOM   1872  O  OE2   . GLU A 1  259  ? 36.978  -21.439  22.237  1.00 181.34 ? 259  GLU A OE2   1 
ATOM   1873  N  N     . ASP A 1  260  ? 34.447  -21.431  25.361  1.00 165.04 ? 260  ASP A N     1 
ATOM   1874  C  CA    . ASP A 1  260  ? 34.418  -22.008  26.704  1.00 163.88 ? 260  ASP A CA    1 
ATOM   1875  C  C     . ASP A 1  260  ? 35.138  -21.163  27.767  1.00 167.37 ? 260  ASP A C     1 
ATOM   1876  O  O     . ASP A 1  260  ? 35.911  -20.268  27.423  1.00 167.85 ? 260  ASP A O     1 
ATOM   1877  C  CB    . ASP A 1  260  ? 35.015  -23.428  26.645  1.00 165.20 ? 260  ASP A CB    1 
ATOM   1878  C  CG    . ASP A 1  260  ? 34.669  -24.322  27.820  1.00 174.25 ? 260  ASP A CG    1 
ATOM   1879  O  OD1   . ASP A 1  260  ? 35.590  -24.950  28.376  1.00 174.57 ? 260  ASP A OD1   1 
ATOM   1880  O  OD2   . ASP A 1  260  ? 33.475  -24.391  28.185  1.00 179.81 ? 260  ASP A OD2   1 
ATOM   1881  N  N     . ASP A 1  261  ? 34.873  -21.453  29.059  1.00 162.69 ? 261  ASP A N     1 
ATOM   1882  C  CA    . ASP A 1  261  ? 35.490  -20.788  30.215  1.00 162.37 ? 261  ASP A CA    1 
ATOM   1883  C  C     . ASP A 1  261  ? 36.974  -21.199  30.394  1.00 164.96 ? 261  ASP A C     1 
ATOM   1884  O  O     . ASP A 1  261  ? 37.768  -20.411  30.916  1.00 165.17 ? 261  ASP A O     1 
ATOM   1885  C  CB    . ASP A 1  261  ? 34.680  -21.069  31.507  1.00 163.60 ? 261  ASP A CB    1 
ATOM   1886  C  CG    . ASP A 1  261  ? 33.469  -20.175  31.768  1.00 172.74 ? 261  ASP A CG    1 
ATOM   1887  O  OD1   . ASP A 1  261  ? 32.895  -19.638  30.787  1.00 173.87 ? 261  ASP A OD1   1 
ATOM   1888  O  OD2   . ASP A 1  261  ? 33.073  -20.041  32.951  1.00 176.10 ? 261  ASP A OD2   1 
ATOM   1889  N  N     . LEU A 1  262  ? 37.335  -22.429  29.964  1.00 159.61 ? 262  LEU A N     1 
ATOM   1890  C  CA    . LEU A 1  262  ? 38.693  -22.992  30.034  1.00 158.64 ? 262  LEU A CA    1 
ATOM   1891  C  C     . LEU A 1  262  ? 39.605  -22.327  28.993  1.00 160.87 ? 262  LEU A C     1 
ATOM   1892  O  O     . LEU A 1  262  ? 40.790  -22.115  29.259  1.00 159.81 ? 262  LEU A O     1 
ATOM   1893  C  CB    . LEU A 1  262  ? 38.620  -24.527  29.831  1.00 158.06 ? 262  LEU A CB    1 
ATOM   1894  C  CG    . LEU A 1  262  ? 39.892  -25.380  29.953  1.00 162.67 ? 262  LEU A CG    1 
ATOM   1895  C  CD1   . LEU A 1  262  ? 40.457  -25.350  31.348  1.00 162.73 ? 262  LEU A CD1   1 
ATOM   1896  C  CD2   . LEU A 1  262  ? 39.592  -26.818  29.624  1.00 164.31 ? 262  LEU A CD2   1 
ATOM   1897  N  N     . THR A 1  263  ? 39.031  -21.986  27.819  1.00 157.19 ? 263  THR A N     1 
ATOM   1898  C  CA    . THR A 1  263  ? 39.699  -21.312  26.699  1.00 157.49 ? 263  THR A CA    1 
ATOM   1899  C  C     . THR A 1  263  ? 39.960  -19.830  27.056  1.00 161.38 ? 263  THR A C     1 
ATOM   1900  O  O     . THR A 1  263  ? 41.004  -19.284  26.686  1.00 161.22 ? 263  THR A O     1 
ATOM   1901  C  CB    . THR A 1  263  ? 38.876  -21.457  25.392  1.00 163.49 ? 263  THR A CB    1 
ATOM   1902  O  OG1   . THR A 1  263  ? 38.125  -22.675  25.388  1.00 159.73 ? 263  THR A OG1   1 
ATOM   1903  C  CG2   . THR A 1  263  ? 39.741  -21.386  24.148  1.00 163.05 ? 263  THR A CG2   1 
ATOM   1904  N  N     . PHE A 1  264  ? 39.007  -19.192  27.778  1.00 157.67 ? 264  PHE A N     1 
ATOM   1905  C  CA    . PHE A 1  264  ? 39.096  -17.798  28.223  1.00 158.06 ? 264  PHE A CA    1 
ATOM   1906  C  C     . PHE A 1  264  ? 40.054  -17.619  29.394  1.00 160.85 ? 264  PHE A C     1 
ATOM   1907  O  O     . PHE A 1  264  ? 40.522  -16.508  29.641  1.00 160.99 ? 264  PHE A O     1 
ATOM   1908  C  CB    . PHE A 1  264  ? 37.708  -17.211  28.535  1.00 160.04 ? 264  PHE A CB    1 
ATOM   1909  C  CG    . PHE A 1  264  ? 37.135  -16.428  27.375  1.00 162.71 ? 264  PHE A CG    1 
ATOM   1910  C  CD1   . PHE A 1  264  ? 36.214  -17.009  26.509  1.00 165.73 ? 264  PHE A CD1   1 
ATOM   1911  C  CD2   . PHE A 1  264  ? 37.552  -15.124  27.120  1.00 166.07 ? 264  PHE A CD2   1 
ATOM   1912  C  CE1   . PHE A 1  264  ? 35.705  -16.293  25.421  1.00 167.28 ? 264  PHE A CE1   1 
ATOM   1913  C  CE2   . PHE A 1  264  ? 37.047  -14.411  26.028  1.00 169.52 ? 264  PHE A CE2   1 
ATOM   1914  C  CZ    . PHE A 1  264  ? 36.123  -14.998  25.190  1.00 167.33 ? 264  PHE A CZ    1 
ATOM   1915  N  N     . LYS A 1  265  ? 40.348  -18.712  30.105  1.00 156.23 ? 265  LYS A N     1 
ATOM   1916  C  CA    . LYS A 1  265  ? 41.288  -18.720  31.218  1.00 155.88 ? 265  LYS A CA    1 
ATOM   1917  C  C     . LYS A 1  265  ? 42.692  -19.045  30.693  1.00 159.94 ? 265  LYS A C     1 
ATOM   1918  O  O     . LYS A 1  265  ? 43.665  -18.463  31.177  1.00 159.84 ? 265  LYS A O     1 
ATOM   1919  C  CB    . LYS A 1  265  ? 40.820  -19.695  32.316  1.00 157.36 ? 265  LYS A CB    1 
ATOM   1920  C  CG    . LYS A 1  265  ? 41.760  -19.864  33.520  1.00 168.15 ? 265  LYS A CG    1 
ATOM   1921  C  CD    . LYS A 1  265  ? 42.275  -18.578  34.196  1.00 175.93 ? 265  LYS A CD    1 
ATOM   1922  C  CE    . LYS A 1  265  ? 41.232  -17.861  35.003  1.00 184.82 ? 265  LYS A CE    1 
ATOM   1923  N  NZ    . LYS A 1  265  ? 41.105  -16.435  34.599  1.00 193.75 ? 265  LYS A NZ    1 
ATOM   1924  N  N     . LEU A 1  266  ? 42.794  -19.945  29.683  1.00 156.26 ? 266  LEU A N     1 
ATOM   1925  C  CA    . LEU A 1  266  ? 44.070  -20.293  29.046  1.00 156.40 ? 266  LEU A CA    1 
ATOM   1926  C  C     . LEU A 1  266  ? 44.616  -19.084  28.264  1.00 161.66 ? 266  LEU A C     1 
ATOM   1927  O  O     . LEU A 1  266  ? 45.833  -18.925  28.157  1.00 162.10 ? 266  LEU A O     1 
ATOM   1928  C  CB    . LEU A 1  266  ? 43.941  -21.534  28.142  1.00 155.80 ? 266  LEU A CB    1 
ATOM   1929  C  CG    . LEU A 1  266  ? 44.257  -22.881  28.794  1.00 159.13 ? 266  LEU A CG    1 
ATOM   1930  C  CD1   . LEU A 1  266  ? 43.437  -23.986  28.187  1.00 158.59 ? 266  LEU A CD1   1 
ATOM   1931  C  CD2   . LEU A 1  266  ? 45.734  -23.221  28.696  1.00 161.15 ? 266  LEU A CD2   1 
ATOM   1932  N  N     . ALA A 1  267  ? 43.713  -18.215  27.762  1.00 158.26 ? 267  ALA A N     1 
ATOM   1933  C  CA    . ALA A 1  267  ? 44.065  -16.978  27.065  1.00 158.83 ? 267  ALA A CA    1 
ATOM   1934  C  C     . ALA A 1  267  ? 44.541  -15.935  28.088  1.00 162.86 ? 267  ALA A C     1 
ATOM   1935  O  O     . ALA A 1  267  ? 45.437  -15.154  27.779  1.00 163.10 ? 267  ALA A O     1 
ATOM   1936  C  CB    . ALA A 1  267  ? 42.865  -16.451  26.293  1.00 159.53 ? 267  ALA A CB    1 
ATOM   1937  N  N     . ASP A 1  268  ? 43.955  -15.946  29.309  1.00 159.17 ? 268  ASP A N     1 
ATOM   1938  C  CA    . ASP A 1  268  ? 44.295  -15.043  30.415  1.00 159.58 ? 268  ASP A CA    1 
ATOM   1939  C  C     . ASP A 1  268  ? 45.689  -15.298  30.980  1.00 164.07 ? 268  ASP A C     1 
ATOM   1940  O  O     . ASP A 1  268  ? 46.319  -14.356  31.467  1.00 164.12 ? 268  ASP A O     1 
ATOM   1941  C  CB    . ASP A 1  268  ? 43.250  -15.126  31.539  1.00 160.91 ? 268  ASP A CB    1 
ATOM   1942  C  CG    . ASP A 1  268  ? 42.129  -14.109  31.452  1.00 172.58 ? 268  ASP A CG    1 
ATOM   1943  O  OD1   . ASP A 1  268  ? 42.408  -12.942  31.081  1.00 174.13 ? 268  ASP A OD1   1 
ATOM   1944  O  OD2   . ASP A 1  268  ? 40.985  -14.457  31.821  1.00 178.09 ? 268  ASP A OD2   1 
ATOM   1945  N  N     . ILE A 1  269  ? 46.161  -16.570  30.943  1.00 160.77 ? 269  ILE A N     1 
ATOM   1946  C  CA    . ILE A 1  269  ? 47.510  -16.933  31.403  1.00 161.03 ? 269  ILE A CA    1 
ATOM   1947  C  C     . ILE A 1  269  ? 48.534  -16.501  30.334  1.00 166.05 ? 269  ILE A C     1 
ATOM   1948  O  O     . ILE A 1  269  ? 49.648  -16.101  30.684  1.00 166.40 ? 269  ILE A O     1 
ATOM   1949  C  CB    . ILE A 1  269  ? 47.694  -18.415  31.904  1.00 163.27 ? 269  ILE A CB    1 
ATOM   1950  C  CG1   . ILE A 1  269  ? 47.866  -19.439  30.763  1.00 163.40 ? 269  ILE A CG1   1 
ATOM   1951  C  CG2   . ILE A 1  269  ? 46.601  -18.846  32.874  1.00 162.89 ? 269  ILE A CG2   1 
ATOM   1952  C  CD1   . ILE A 1  269  ? 48.862  -20.554  31.064  1.00 168.86 ? 269  ILE A CD1   1 
ATOM   1953  N  N     . LEU A 1  270  ? 48.125  -16.551  29.036  1.00 162.42 ? 270  LEU A N     1 
ATOM   1954  C  CA    . LEU A 1  270  ? 48.932  -16.142  27.880  1.00 162.94 ? 270  LEU A CA    1 
ATOM   1955  C  C     . LEU A 1  270  ? 49.098  -14.620  27.848  1.00 167.92 ? 270  LEU A C     1 
ATOM   1956  O  O     . LEU A 1  270  ? 50.155  -14.140  27.441  1.00 168.30 ? 270  LEU A O     1 
ATOM   1957  C  CB    . LEU A 1  270  ? 48.318  -16.645  26.564  1.00 162.62 ? 270  LEU A CB    1 
ATOM   1958  C  CG    . LEU A 1  270  ? 49.294  -17.308  25.597  1.00 167.56 ? 270  LEU A CG    1 
ATOM   1959  C  CD1   . LEU A 1  270  ? 48.600  -18.318  24.737  1.00 166.99 ? 270  LEU A CD1   1 
ATOM   1960  C  CD2   . LEU A 1  270  ? 50.024  -16.292  24.746  1.00 171.49 ? 270  LEU A CD2   1 
ATOM   1961  N  N     . LYS A 1  271  ? 48.054  -13.869  28.290  1.00 164.40 ? 271  LYS A N     1 
ATOM   1962  C  CA    . LYS A 1  271  ? 48.031  -12.403  28.415  1.00 164.73 ? 271  LYS A CA    1 
ATOM   1963  C  C     . LYS A 1  271  ? 49.073  -11.999  29.468  1.00 169.35 ? 271  LYS A C     1 
ATOM   1964  O  O     . LYS A 1  271  ? 49.878  -11.096  29.225  1.00 169.89 ? 271  LYS A O     1 
ATOM   1965  C  CB    . LYS A 1  271  ? 46.629  -11.923  28.854  1.00 166.10 ? 271  LYS A CB    1 
ATOM   1966  C  CG    . LYS A 1  271  ? 45.805  -11.272  27.750  1.00 172.70 ? 271  LYS A CG    1 
ATOM   1967  C  CD    . LYS A 1  271  ? 44.404  -10.897  28.245  1.00 176.33 ? 271  LYS A CD    1 
ATOM   1968  C  CE    . LYS A 1  271  ? 43.633  -10.035  27.268  1.00 180.13 ? 271  LYS A CE    1 
ATOM   1969  N  NZ    . LYS A 1  271  ? 43.239  -10.775  26.038  1.00 183.28 ? 271  LYS A NZ    1 
ATOM   1970  N  N     . ALA A 1  272  ? 49.070  -12.709  30.620  1.00 165.39 ? 272  ALA A N     1 
ATOM   1971  C  CA    . ALA A 1  272  ? 49.991  -12.525  31.738  1.00 165.68 ? 272  ALA A CA    1 
ATOM   1972  C  C     . ALA A 1  272  ? 51.421  -12.923  31.357  1.00 171.04 ? 272  ALA A C     1 
ATOM   1973  O  O     . ALA A 1  272  ? 52.364  -12.322  31.872  1.00 171.66 ? 272  ALA A O     1 
ATOM   1974  C  CB    . ALA A 1  272  ? 49.524  -13.339  32.934  1.00 165.45 ? 272  ALA A CB    1 
ATOM   1975  N  N     . ASN A 1  273  ? 51.580  -13.922  30.453  1.00 167.77 ? 273  ASN A N     1 
ATOM   1976  C  CA    . ASN A 1  273  ? 52.886  -14.412  29.980  1.00 168.36 ? 273  ASN A CA    1 
ATOM   1977  C  C     . ASN A 1  273  ? 53.593  -13.450  29.007  1.00 174.07 ? 273  ASN A C     1 
ATOM   1978  O  O     . ASN A 1  273  ? 54.822  -13.500  28.891  1.00 174.47 ? 273  ASN A O     1 
ATOM   1979  C  CB    . ASN A 1  273  ? 52.786  -15.836  29.406  1.00 167.09 ? 273  ASN A CB    1 
ATOM   1980  C  CG    . ASN A 1  273  ? 54.062  -16.646  29.514  1.00 180.25 ? 273  ASN A CG    1 
ATOM   1981  O  OD1   . ASN A 1  273  ? 54.696  -16.735  30.574  1.00 168.76 ? 273  ASN A OD1   1 
ATOM   1982  N  ND2   . ASN A 1  273  ? 54.438  -17.303  28.427  1.00 172.41 ? 273  ASN A ND2   1 
ATOM   1983  N  N     . ILE A 1  274  ? 52.828  -12.568  28.324  1.00 171.11 ? 274  ILE A N     1 
ATOM   1984  C  CA    . ILE A 1  274  ? 53.395  -11.557  27.424  1.00 172.15 ? 274  ILE A CA    1 
ATOM   1985  C  C     . ILE A 1  274  ? 53.977  -10.442  28.298  1.00 177.90 ? 274  ILE A C     1 
ATOM   1986  O  O     . ILE A 1  274  ? 55.151  -10.109  28.142  1.00 178.39 ? 274  ILE A O     1 
ATOM   1987  C  CB    . ILE A 1  274  ? 52.374  -11.019  26.384  1.00 175.03 ? 274  ILE A CB    1 
ATOM   1988  C  CG1   . ILE A 1  274  ? 51.817  -12.153  25.508  1.00 174.87 ? 274  ILE A CG1   1 
ATOM   1989  C  CG2   . ILE A 1  274  ? 53.013  -9.932   25.513  1.00 176.72 ? 274  ILE A CG2   1 
ATOM   1990  C  CD1   . ILE A 1  274  ? 50.394  -11.920  24.994  1.00 182.59 ? 274  ILE A CD1   1 
ATOM   1991  N  N     . SER A 1  275  ? 53.176  -9.920   29.263  1.00 174.72 ? 275  SER A N     1 
ATOM   1992  C  CA    . SER A 1  275  ? 53.569  -8.874   30.216  1.00 175.33 ? 275  SER A CA    1 
ATOM   1993  C  C     . SER A 1  275  ? 54.624  -9.370   31.230  1.00 180.67 ? 275  SER A C     1 
ATOM   1994  O  O     . SER A 1  275  ? 54.672  -8.902   32.369  1.00 180.37 ? 275  SER A O     1 
ATOM   1995  C  CB    . SER A 1  275  ? 52.341  -8.307   30.924  1.00 177.64 ? 275  SER A CB    1 
ATOM   1996  O  OG    . SER A 1  275  ? 51.661  -7.374   30.101  1.00 185.73 ? 275  SER A OG    1 
ATOM   1997  N  N     . LEU A 1  276  ? 55.478  -10.307  30.785  1.00 178.36 ? 276  LEU A N     1 
ATOM   1998  C  CA    . LEU A 1  276  ? 56.587  -10.913  31.518  1.00 178.97 ? 276  LEU A CA    1 
ATOM   1999  C  C     . LEU A 1  276  ? 57.755  -11.123  30.551  1.00 184.41 ? 276  LEU A C     1 
ATOM   2000  O  O     . LEU A 1  276  ? 58.872  -10.703  30.848  1.00 184.88 ? 276  LEU A O     1 
ATOM   2001  C  CB    . LEU A 1  276  ? 56.165  -12.238  32.167  1.00 178.00 ? 276  LEU A CB    1 
ATOM   2002  C  CG    . LEU A 1  276  ? 56.078  -12.222  33.686  1.00 182.52 ? 276  LEU A CG    1 
ATOM   2003  C  CD1   . LEU A 1  276  ? 54.863  -12.961  34.159  1.00 181.66 ? 276  LEU A CD1   1 
ATOM   2004  C  CD2   . LEU A 1  276  ? 57.329  -12.806  34.321  1.00 185.43 ? 276  LEU A CD2   1 
ATOM   2005  N  N     . GLU A 1  277  ? 57.487  -11.730  29.377  1.00 181.11 ? 277  GLU A N     1 
ATOM   2006  C  CA    . GLU A 1  277  ? 58.498  -11.946  28.340  1.00 181.87 ? 277  GLU A CA    1 
ATOM   2007  C  C     . GLU A 1  277  ? 58.796  -10.618  27.604  1.00 186.93 ? 277  GLU A C     1 
ATOM   2008  O  O     . GLU A 1  277  ? 59.946  -10.373  27.222  1.00 187.36 ? 277  GLU A O     1 
ATOM   2009  C  CB    . GLU A 1  277  ? 58.069  -13.067  27.372  1.00 182.59 ? 277  GLU A CB    1 
ATOM   2010  C  CG    . GLU A 1  277  ? 58.131  -14.458  27.985  1.00 191.16 ? 277  GLU A CG    1 
ATOM   2011  C  CD    . GLU A 1  277  ? 57.786  -15.600  27.047  1.00 210.01 ? 277  GLU A CD    1 
ATOM   2012  O  OE1   . GLU A 1  277  ? 58.618  -15.922  26.170  1.00 203.03 ? 277  GLU A OE1   1 
ATOM   2013  O  OE2   . GLU A 1  277  ? 56.698  -16.197  27.213  1.00 204.06 ? 277  GLU A OE2   1 
ATOM   2014  N  N     . THR A 1  278  ? 57.764  -9.751   27.452  1.00 183.32 ? 278  THR A N     1 
ATOM   2015  C  CA    . THR A 1  278  ? 57.865  -8.426   26.829  1.00 184.11 ? 278  THR A CA    1 
ATOM   2016  C  C     . THR A 1  278  ? 58.217  -7.331   27.870  1.00 189.22 ? 278  THR A C     1 
ATOM   2017  O  O     . THR A 1  278  ? 58.672  -6.249   27.489  1.00 190.00 ? 278  THR A O     1 
ATOM   2018  C  CB    . THR A 1  278  ? 56.650  -8.147   25.901  1.00 188.91 ? 278  THR A CB    1 
ATOM   2019  O  OG1   . THR A 1  278  ? 57.099  -7.557   24.681  1.00 187.94 ? 278  THR A OG1   1 
ATOM   2020  C  CG2   . THR A 1  278  ? 55.565  -7.279   26.550  1.00 186.37 ? 278  THR A CG2   1 
ATOM   2021  N  N     . LEU A 1  279  ? 58.009  -7.626   29.175  1.00 185.35 ? 279  LEU A N     1 
ATOM   2022  C  CA    . LEU A 1  279  ? 58.311  -6.732   30.302  1.00 185.77 ? 279  LEU A CA    1 
ATOM   2023  C  C     . LEU A 1  279  ? 59.800  -6.808   30.653  1.00 191.66 ? 279  LEU A C     1 
ATOM   2024  O  O     . LEU A 1  279  ? 60.367  -5.819   31.123  1.00 192.27 ? 279  LEU A O     1 
ATOM   2025  C  CB    . LEU A 1  279  ? 57.458  -7.118   31.534  1.00 184.56 ? 279  LEU A CB    1 
ATOM   2026  C  CG    . LEU A 1  279  ? 56.953  -6.015   32.500  1.00 189.12 ? 279  LEU A CG    1 
ATOM   2027  C  CD1   . LEU A 1  279  ? 58.028  -5.541   33.470  1.00 190.00 ? 279  LEU A CD1   1 
ATOM   2028  C  CD2   . LEU A 1  279  ? 56.245  -4.874   31.776  1.00 191.87 ? 279  LEU A CD2   1 
ATOM   2029  N  N     . GLU A 1  280  ? 60.424  -7.986   30.432  1.00 188.73 ? 280  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1  280  ? 61.846  -8.236   30.696  1.00 189.69 ? 280  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1  280  ? 62.744  -7.842   29.507  1.00 195.34 ? 280  GLU A C     1 
ATOM   2032  O  O     . GLU A 1  280  ? 63.892  -7.440   29.718  1.00 195.80 ? 280  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1  280  ? 62.082  -9.684   31.161  1.00 190.28 ? 280  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1  280  ? 61.594  -9.937   32.582  1.00 198.51 ? 280  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1  280  ? 61.577  -11.385  33.033  1.00 211.83 ? 280  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1  280  ? 60.769  -12.175  32.492  1.00 198.44 ? 280  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1  280  ? 62.343  -11.721  33.964  1.00 205.20 ? 280  GLU A OE2   1 
ATOM   2038  N  N     . HIS A 1  281  ? 62.194  -7.901   28.267  1.00 192.24 ? 281  HIS A N     1 
ATOM   2039  C  CA    . HIS A 1  281  ? 62.854  -7.480   27.018  1.00 193.25 ? 281  HIS A CA    1 
ATOM   2040  C  C     . HIS A 1  281  ? 62.928  -5.931   27.003  1.00 198.78 ? 281  HIS A C     1 
ATOM   2041  O  O     . HIS A 1  281  ? 63.685  -5.347   26.223  1.00 199.34 ? 281  HIS A O     1 
ATOM   2042  C  CB    . HIS A 1  281  ? 62.049  -7.990   25.804  1.00 193.26 ? 281  HIS A CB    1 
ATOM   2043  C  CG    . HIS A 1  281  ? 62.876  -8.365   24.609  1.00 197.14 ? 281  HIS A CG    1 
ATOM   2044  N  ND1   . HIS A 1  281  ? 63.195  -7.440   23.631  1.00 199.76 ? 281  HIS A ND1   1 
ATOM   2045  C  CD2   . HIS A 1  281  ? 63.373  -9.571   24.247  1.00 198.46 ? 281  HIS A CD2   1 
ATOM   2046  C  CE1   . HIS A 1  281  ? 63.892  -8.104   22.722  1.00 199.48 ? 281  HIS A CE1   1 
ATOM   2047  N  NE2   . HIS A 1  281  ? 64.026  -9.388   23.049  1.00 199.10 ? 281  HIS A NE2   1 
ATOM   2048  N  N     . ASN A 1  282  ? 62.123  -5.291   27.887  1.00 195.47 ? 282  ASN A N     1 
ATOM   2049  C  CA    . ASN A 1  282  ? 61.993  -3.854   28.144  1.00 196.24 ? 282  ASN A CA    1 
ATOM   2050  C  C     . ASN A 1  282  ? 62.733  -3.519   29.469  1.00 200.78 ? 282  ASN A C     1 
ATOM   2051  O  O     . ASN A 1  282  ? 63.238  -4.429   30.138  1.00 199.77 ? 282  ASN A O     1 
ATOM   2052  C  CB    . ASN A 1  282  ? 60.493  -3.501   28.253  1.00 196.17 ? 282  ASN A CB    1 
ATOM   2053  C  CG    . ASN A 1  282  ? 60.165  -2.035   28.112  1.00 220.53 ? 282  ASN A CG    1 
ATOM   2054  O  OD1   . ASN A 1  282  ? 60.034  -1.305   29.099  1.00 214.33 ? 282  ASN A OD1   1 
ATOM   2055  N  ND2   . ASN A 1  282  ? 60.006  -1.576   26.880  1.00 213.76 ? 282  ASN A ND2   1 
ATOM   2056  N  N     . GLY A 1  283  ? 62.799  -2.228   29.816  1.00 198.46 ? 283  GLY A N     1 
ATOM   2057  C  CA    . GLY A 1  283  ? 63.439  -1.738   31.034  1.00 198.84 ? 283  GLY A CA    1 
ATOM   2058  C  C     . GLY A 1  283  ? 62.693  -2.159   32.282  1.00 201.65 ? 283  GLY A C     1 
ATOM   2059  O  O     . GLY A 1  283  ? 61.839  -1.420   32.776  1.00 200.72 ? 283  GLY A O     1 
ATOM   2060  N  N     . ALA A 1  284  ? 63.008  -3.371   32.778  1.00 197.97 ? 284  ALA A N     1 
ATOM   2061  C  CA    . ALA A 1  284  ? 62.394  -3.999   33.948  1.00 196.83 ? 284  ALA A CA    1 
ATOM   2062  C  C     . ALA A 1  284  ? 62.649  -3.222   35.257  1.00 201.60 ? 284  ALA A C     1 
ATOM   2063  O  O     . ALA A 1  284  ? 63.791  -3.176   35.728  1.00 201.86 ? 284  ALA A O     1 
ATOM   2064  C  CB    . ALA A 1  284  ? 62.867  -5.440   34.073  1.00 196.97 ? 284  ALA A CB    1 
ATOM   2065  N  N     . PRO A 1  285  ? 61.595  -2.612   35.862  1.00 198.07 ? 285  PRO A N     1 
ATOM   2066  C  CA    . PRO A 1  285  ? 61.796  -1.836   37.101  1.00 198.41 ? 285  PRO A CA    1 
ATOM   2067  C  C     . PRO A 1  285  ? 61.955  -2.693   38.367  1.00 201.56 ? 285  PRO A C     1 
ATOM   2068  O  O     . PRO A 1  285  ? 61.941  -3.922   38.282  1.00 200.25 ? 285  PRO A O     1 
ATOM   2069  C  CB    . PRO A 1  285  ? 60.557  -0.922   37.151  1.00 199.91 ? 285  PRO A CB    1 
ATOM   2070  C  CG    . PRO A 1  285  ? 59.833  -1.136   35.824  1.00 203.82 ? 285  PRO A CG    1 
ATOM   2071  C  CD    . PRO A 1  285  ? 60.189  -2.528   35.430  1.00 198.71 ? 285  PRO A CD    1 
ATOM   2072  N  N     . HIS A 1  286  ? 62.128  -2.032   39.539  1.00 198.54 ? 286  HIS A N     1 
ATOM   2073  C  CA    . HIS A 1  286  ? 62.338  -2.633   40.869  1.00 197.80 ? 286  HIS A CA    1 
ATOM   2074  C  C     . HIS A 1  286  ? 61.201  -3.579   41.309  1.00 199.76 ? 286  HIS A C     1 
ATOM   2075  O  O     . HIS A 1  286  ? 61.462  -4.756   41.577  1.00 198.68 ? 286  HIS A O     1 
ATOM   2076  C  CB    . HIS A 1  286  ? 62.586  -1.524   41.919  1.00 199.29 ? 286  HIS A CB    1 
ATOM   2077  C  CG    . HIS A 1  286  ? 63.428  -1.933   43.093  1.00 202.75 ? 286  HIS A CG    1 
ATOM   2078  N  ND1   . HIS A 1  286  ? 62.884  -2.069   44.360  1.00 203.71 ? 286  HIS A ND1   1 
ATOM   2079  C  CD2   . HIS A 1  286  ? 64.760  -2.168   43.165  1.00 205.20 ? 286  HIS A CD2   1 
ATOM   2080  C  CE1   . HIS A 1  286  ? 63.891  -2.403   45.150  1.00 203.50 ? 286  HIS A CE1   1 
ATOM   2081  N  NE2   . HIS A 1  286  ? 65.039  -2.476   44.477  1.00 204.76 ? 286  HIS A NE2   1 
ATOM   2082  N  N     . HIS A 1  287  ? 59.952  -3.069   41.372  1.00 195.20 ? 287  HIS A N     1 
ATOM   2083  C  CA    . HIS A 1  287  ? 58.786  -3.850   41.788  1.00 193.31 ? 287  HIS A CA    1 
ATOM   2084  C  C     . HIS A 1  287  ? 57.613  -3.842   40.812  1.00 195.83 ? 287  HIS A C     1 
ATOM   2085  O  O     . HIS A 1  287  ? 56.625  -4.545   41.044  1.00 194.16 ? 287  HIS A O     1 
ATOM   2086  C  CB    . HIS A 1  287  ? 58.358  -3.504   43.221  1.00 193.86 ? 287  HIS A CB    1 
ATOM   2087  C  CG    . HIS A 1  287  ? 59.148  -4.239   44.256  1.00 197.11 ? 287  HIS A CG    1 
ATOM   2088  N  ND1   . HIS A 1  287  ? 58.838  -5.541   44.608  1.00 197.72 ? 287  HIS A ND1   1 
ATOM   2089  C  CD2   . HIS A 1  287  ? 60.229  -3.840   44.964  1.00 199.65 ? 287  HIS A CD2   1 
ATOM   2090  C  CE1   . HIS A 1  287  ? 59.731  -5.886   45.521  1.00 197.40 ? 287  HIS A CE1   1 
ATOM   2091  N  NE2   . HIS A 1  287  ? 60.589  -4.894   45.767  1.00 198.92 ? 287  HIS A NE2   1 
ATOM   2092  N  N     . ALA A 1  288  ? 57.739  -3.105   39.689  1.00 192.87 ? 288  ALA A N     1 
ATOM   2093  C  CA    . ALA A 1  288  ? 56.714  -3.084   38.640  1.00 192.23 ? 288  ALA A CA    1 
ATOM   2094  C  C     . ALA A 1  288  ? 56.796  -4.394   37.824  1.00 195.29 ? 288  ALA A C     1 
ATOM   2095  O  O     . ALA A 1  288  ? 56.033  -4.601   36.874  1.00 194.24 ? 288  ALA A O     1 
ATOM   2096  C  CB    . ALA A 1  288  ? 56.895  -1.870   37.745  1.00 194.05 ? 288  ALA A CB    1 
ATOM   2097  N  N     . ILE A 1  289  ? 57.722  -5.283   38.249  1.00 191.64 ? 289  ILE A N     1 
ATOM   2098  C  CA    . ILE A 1  289  ? 58.010  -6.621   37.725  1.00 190.57 ? 289  ILE A CA    1 
ATOM   2099  C  C     . ILE A 1  289  ? 57.251  -7.696   38.527  1.00 192.67 ? 289  ILE A C     1 
ATOM   2100  O  O     . ILE A 1  289  ? 56.748  -8.655   37.938  1.00 191.43 ? 289  ILE A O     1 
ATOM   2101  C  CB    . ILE A 1  289  ? 59.540  -6.905   37.681  1.00 194.36 ? 289  ILE A CB    1 
ATOM   2102  C  CG1   . ILE A 1  289  ? 60.243  -6.560   39.025  1.00 195.04 ? 289  ILE A CG1   1 
ATOM   2103  C  CG2   . ILE A 1  289  ? 60.184  -6.186   36.498  1.00 196.07 ? 289  ILE A CG2   1 
ATOM   2104  C  CD1   . ILE A 1  289  ? 61.435  -7.424   39.387  1.00 201.06 ? 289  ILE A CD1   1 
ATOM   2105  N  N     . GLU A 1  290  ? 57.170  -7.525   39.868  1.00 188.59 ? 290  GLU A N     1 
ATOM   2106  C  CA    . GLU A 1  290  ? 56.476  -8.437   40.784  1.00 187.05 ? 290  GLU A CA    1 
ATOM   2107  C  C     . GLU A 1  290  ? 54.956  -8.345   40.642  1.00 189.02 ? 290  GLU A C     1 
ATOM   2108  O  O     . GLU A 1  290  ? 54.247  -9.277   41.035  1.00 187.20 ? 290  GLU A O     1 
ATOM   2109  C  CB    . GLU A 1  290  ? 56.925  -8.206   42.237  1.00 188.77 ? 290  GLU A CB    1 
ATOM   2110  C  CG    . GLU A 1  290  ? 57.786  -9.327   42.802  1.00 197.95 ? 290  GLU A CG    1 
ATOM   2111  C  CD    . GLU A 1  290  ? 59.138  -9.532   42.143  1.00 213.84 ? 290  GLU A CD    1 
ATOM   2112  O  OE1   . GLU A 1  290  ? 59.326  -10.590  41.501  1.00 200.49 ? 290  GLU A OE1   1 
ATOM   2113  O  OE2   . GLU A 1  290  ? 60.008  -8.639   42.268  1.00 207.18 ? 290  GLU A OE2   1 
ATOM   2114  N  N     . GLU A 1  291  ? 54.465  -7.226   40.059  1.00 185.74 ? 291  GLU A N     1 
ATOM   2115  C  CA    . GLU A 1  291  ? 53.055  -6.971   39.751  1.00 184.75 ? 291  GLU A CA    1 
ATOM   2116  C  C     . GLU A 1  291  ? 52.582  -8.018   38.723  1.00 187.96 ? 291  GLU A C     1 
ATOM   2117  O  O     . GLU A 1  291  ? 51.460  -8.521   38.824  1.00 186.79 ? 291  GLU A O     1 
ATOM   2118  C  CB    . GLU A 1  291  ? 52.880  -5.547   39.184  1.00 186.78 ? 291  GLU A CB    1 
ATOM   2119  C  CG    . GLU A 1  291  ? 52.201  -4.570   40.131  1.00 194.42 ? 291  GLU A CG    1 
ATOM   2120  C  CD    . GLU A 1  291  ? 53.107  -3.864   41.120  1.00 205.00 ? 291  GLU A CD    1 
ATOM   2121  O  OE1   . GLU A 1  291  ? 53.972  -3.073   40.681  1.00 193.33 ? 291  GLU A OE1   1 
ATOM   2122  O  OE2   . GLU A 1  291  ? 52.912  -4.057   42.341  1.00 193.55 ? 291  GLU A OE2   1 
ATOM   2123  N  N     . ALA A 1  292  ? 53.467  -8.361   37.758  1.00 184.53 ? 292  ALA A N     1 
ATOM   2124  C  CA    . ALA A 1  292  ? 53.238  -9.367   36.723  1.00 183.41 ? 292  ALA A CA    1 
ATOM   2125  C  C     . ALA A 1  292  ? 53.356  -10.780  37.306  1.00 186.49 ? 292  ALA A C     1 
ATOM   2126  O  O     . ALA A 1  292  ? 52.646  -11.676  36.845  1.00 185.43 ? 292  ALA A O     1 
ATOM   2127  C  CB    . ALA A 1  292  ? 54.236  -9.187   35.592  1.00 184.86 ? 292  ALA A CB    1 
ATOM   2128  N  N     . GLU A 1  293  ? 54.246  -10.979  38.317  1.00 182.99 ? 293  GLU A N     1 
ATOM   2129  C  CA    . GLU A 1  293  ? 54.463  -12.272  38.985  1.00 181.92 ? 293  GLU A CA    1 
ATOM   2130  C  C     . GLU A 1  293  ? 53.243  -12.718  39.787  1.00 184.42 ? 293  GLU A C     1 
ATOM   2131  O  O     . GLU A 1  293  ? 52.978  -13.917  39.862  1.00 183.15 ? 293  GLU A O     1 
ATOM   2132  C  CB    . GLU A 1  293  ? 55.708  -12.242  39.886  1.00 183.92 ? 293  GLU A CB    1 
ATOM   2133  C  CG    . GLU A 1  293  ? 56.467  -13.562  39.918  1.00 193.04 ? 293  GLU A CG    1 
ATOM   2134  C  CD    . GLU A 1  293  ? 55.913  -14.696  40.763  1.00 207.05 ? 293  GLU A CD    1 
ATOM   2135  O  OE1   . GLU A 1  293  ? 55.729  -14.497  41.985  1.00 202.41 ? 293  GLU A OE1   1 
ATOM   2136  O  OE2   . GLU A 1  293  ? 55.720  -15.805  40.213  1.00 193.26 ? 293  GLU A OE2   1 
ATOM   2137  N  N     . SER A 1  294  ? 52.502  -11.755  40.377  1.00 180.73 ? 294  SER A N     1 
ATOM   2138  C  CA    . SER A 1  294  ? 51.290  -12.020  41.158  1.00 179.40 ? 294  SER A CA    1 
ATOM   2139  C  C     . SER A 1  294  ? 50.059  -12.292  40.263  1.00 181.55 ? 294  SER A C     1 
ATOM   2140  O  O     . SER A 1  294  ? 49.048  -12.790  40.767  1.00 180.09 ? 294  SER A O     1 
ATOM   2141  C  CB    . SER A 1  294  ? 51.016  -10.877  42.131  1.00 183.40 ? 294  SER A CB    1 
ATOM   2142  O  OG    . SER A 1  294  ? 50.234  -11.324  43.226  1.00 191.24 ? 294  SER A OG    1 
ATOM   2143  N  N     . LEU A 1  295  ? 50.156  -11.975  38.941  1.00 177.60 ? 295  LEU A N     1 
ATOM   2144  C  CA    . LEU A 1  295  ? 49.104  -12.176  37.932  1.00 176.24 ? 295  LEU A CA    1 
ATOM   2145  C  C     . LEU A 1  295  ? 49.249  -13.525  37.212  1.00 178.41 ? 295  LEU A C     1 
ATOM   2146  O  O     . LEU A 1  295  ? 48.252  -14.234  37.063  1.00 177.05 ? 295  LEU A O     1 
ATOM   2147  C  CB    . LEU A 1  295  ? 49.076  -11.022  36.921  1.00 176.97 ? 295  LEU A CB    1 
ATOM   2148  C  CG    . LEU A 1  295  ? 47.714  -10.746  36.301  1.00 181.20 ? 295  LEU A CG    1 
ATOM   2149  C  CD1   . LEU A 1  295  ? 47.049  -9.557   36.962  1.00 181.73 ? 295  LEU A CD1   1 
ATOM   2150  C  CD2   . LEU A 1  295  ? 47.832  -10.515  34.811  1.00 184.02 ? 295  LEU A CD2   1 
ATOM   2151  N  N     . LEU A 1  296  ? 50.485  -13.878  36.773  1.00 174.72 ? 296  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  296  ? 50.802  -15.160  36.127  1.00 173.74 ? 296  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  296  ? 50.534  -16.297  37.130  1.00 177.45 ? 296  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  296  ? 49.950  -17.311  36.748  1.00 176.46 ? 296  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  296  ? 52.273  -15.186  35.652  1.00 174.29 ? 296  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  296  ? 52.730  -16.383  34.801  1.00 177.99 ? 296  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  296  ? 52.492  -16.135  33.331  1.00 178.19 ? 296  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  296  ? 54.199  -16.663  35.009  1.00 180.12 ? 296  LEU A CD2   1 
ATOM   2159  N  N     . GLN A 1  297  ? 50.925  -16.095  38.418  1.00 174.17 ? 297  GLN A N     1 
ATOM   2160  C  CA    . GLN A 1  297  ? 50.711  -17.027  39.534  1.00 173.15 ? 297  GLN A CA    1 
ATOM   2161  C  C     . GLN A 1  297  ? 49.209  -17.202  39.814  1.00 175.41 ? 297  GLN A C     1 
ATOM   2162  O  O     . GLN A 1  297  ? 48.767  -18.332  40.034  1.00 174.62 ? 297  GLN A O     1 
ATOM   2163  C  CB    . GLN A 1  297  ? 51.473  -16.548  40.795  1.00 175.05 ? 297  GLN A CB    1 
ATOM   2164  C  CG    . GLN A 1  297  ? 51.200  -17.314  42.100  1.00 190.56 ? 297  GLN A CG    1 
ATOM   2165  C  CD    . GLN A 1  297  ? 51.705  -18.737  42.098  1.00 208.62 ? 297  GLN A CD    1 
ATOM   2166  O  OE1   . GLN A 1  297  ? 52.911  -18.998  42.037  1.00 206.58 ? 297  GLN A OE1   1 
ATOM   2167  N  NE2   . GLN A 1  297  ? 50.789  -19.687  42.203  1.00 195.83 ? 297  GLN A NE2   1 
ATOM   2168  N  N     . PHE A 1  298  ? 48.434  -16.091  39.785  1.00 170.63 ? 298  PHE A N     1 
ATOM   2169  C  CA    . PHE A 1  298  ? 46.987  -16.095  40.022  1.00 168.77 ? 298  PHE A CA    1 
ATOM   2170  C  C     . PHE A 1  298  ? 46.213  -16.815  38.922  1.00 170.98 ? 298  PHE A C     1 
ATOM   2171  O  O     . PHE A 1  298  ? 45.374  -17.660  39.230  1.00 169.71 ? 298  PHE A O     1 
ATOM   2172  C  CB    . PHE A 1  298  ? 46.454  -14.664  40.226  1.00 170.61 ? 298  PHE A CB    1 
ATOM   2173  C  CG    . PHE A 1  298  ? 44.949  -14.518  40.235  1.00 171.00 ? 298  PHE A CG    1 
ATOM   2174  C  CD1   . PHE A 1  298  ? 44.283  -13.954  39.154  1.00 173.63 ? 298  PHE A CD1   1 
ATOM   2175  C  CD2   . PHE A 1  298  ? 44.199  -14.935  41.329  1.00 172.16 ? 298  PHE A CD2   1 
ATOM   2176  C  CE1   . PHE A 1  298  ? 42.897  -13.801  39.171  1.00 173.92 ? 298  PHE A CE1   1 
ATOM   2177  C  CE2   . PHE A 1  298  ? 42.810  -14.792  41.340  1.00 174.28 ? 298  PHE A CE2   1 
ATOM   2178  C  CZ    . PHE A 1  298  ? 42.169  -14.227  40.261  1.00 172.42 ? 298  PHE A CZ    1 
ATOM   2179  N  N     . HIS A 1  299  ? 46.484  -16.475  37.654  1.00 167.12 ? 299  HIS A N     1 
ATOM   2180  C  CA    . HIS A 1  299  ? 45.795  -17.058  36.512  1.00 166.21 ? 299  HIS A CA    1 
ATOM   2181  C  C     . HIS A 1  299  ? 46.061  -18.542  36.269  1.00 167.51 ? 299  HIS A C     1 
ATOM   2182  O  O     . HIS A 1  299  ? 45.129  -19.253  35.908  1.00 166.19 ? 299  HIS A O     1 
ATOM   2183  C  CB    . HIS A 1  299  ? 45.959  -16.191  35.264  1.00 168.11 ? 299  HIS A CB    1 
ATOM   2184  C  CG    . HIS A 1  299  ? 45.133  -14.947  35.329  1.00 172.20 ? 299  HIS A CG    1 
ATOM   2185  N  ND1   . HIS A 1  299  ? 43.806  -14.945  34.941  1.00 173.75 ? 299  HIS A ND1   1 
ATOM   2186  C  CD2   . HIS A 1  299  ? 45.454  -13.716  35.790  1.00 174.95 ? 299  HIS A CD2   1 
ATOM   2187  C  CE1   . HIS A 1  299  ? 43.370  -13.713  35.150  1.00 173.74 ? 299  HIS A CE1   1 
ATOM   2188  N  NE2   . HIS A 1  299  ? 44.327  -12.938  35.660  1.00 174.79 ? 299  HIS A NE2   1 
ATOM   2189  N  N     . VAL A 1  300  ? 47.304  -19.012  36.496  1.00 163.29 ? 300  VAL A N     1 
ATOM   2190  C  CA    . VAL A 1  300  ? 47.710  -20.420  36.342  1.00 162.31 ? 300  VAL A CA    1 
ATOM   2191  C  C     . VAL A 1  300  ? 47.041  -21.313  37.405  1.00 164.68 ? 300  VAL A C     1 
ATOM   2192  O  O     . VAL A 1  300  ? 46.575  -22.407  37.084  1.00 163.64 ? 300  VAL A O     1 
ATOM   2193  C  CB    . VAL A 1  300  ? 49.262  -20.557  36.324  1.00 166.89 ? 300  VAL A CB    1 
ATOM   2194  C  CG1   . VAL A 1  300  ? 49.736  -21.954  36.732  1.00 166.19 ? 300  VAL A CG1   1 
ATOM   2195  C  CG2   . VAL A 1  300  ? 49.828  -20.168  34.964  1.00 167.45 ? 300  VAL A CG2   1 
ATOM   2196  N  N     . ALA A 1  301  ? 47.004  -20.843  38.662  1.00 160.83 ? 301  ALA A N     1 
ATOM   2197  C  CA    . ALA A 1  301  ? 46.410  -21.560  39.790  1.00 159.61 ? 301  ALA A CA    1 
ATOM   2198  C  C     . ALA A 1  301  ? 44.875  -21.592  39.715  1.00 161.38 ? 301  ALA A C     1 
ATOM   2199  O  O     . ALA A 1  301  ? 44.298  -22.674  39.848  1.00 160.57 ? 301  ALA A O     1 
ATOM   2200  C  CB    . ALA A 1  301  ? 46.874  -20.946  41.101  1.00 160.75 ? 301  ALA A CB    1 
ATOM   2201  N  N     . THR A 1  302  ? 44.215  -20.423  39.463  1.00 156.32 ? 302  THR A N     1 
ATOM   2202  C  CA    . THR A 1  302  ? 42.746  -20.325  39.338  1.00 154.47 ? 302  THR A CA    1 
ATOM   2203  C  C     . THR A 1  302  ? 42.203  -21.045  38.099  1.00 155.46 ? 302  THR A C     1 
ATOM   2204  O  O     . THR A 1  302  ? 41.004  -21.320  38.024  1.00 154.04 ? 302  THR A O     1 
ATOM   2205  C  CB    . THR A 1  302  ? 42.223  -18.897  39.518  1.00 161.00 ? 302  THR A CB    1 
ATOM   2206  O  OG1   . THR A 1  302  ? 42.882  -18.033  38.595  1.00 161.73 ? 302  THR A OG1   1 
ATOM   2207  C  CG2   . THR A 1  302  ? 42.380  -18.386  40.941  1.00 158.11 ? 302  THR A CG2   1 
ATOM   2208  N  N     . TYR A 1  303  ? 43.106  -21.382  37.152  1.00 150.96 ? 303  TYR A N     1 
ATOM   2209  C  CA    . TYR A 1  303  ? 42.847  -22.167  35.947  1.00 150.07 ? 303  TYR A CA    1 
ATOM   2210  C  C     . TYR A 1  303  ? 42.468  -23.577  36.377  1.00 153.29 ? 303  TYR A C     1 
ATOM   2211  O  O     . TYR A 1  303  ? 41.618  -24.205  35.746  1.00 152.93 ? 303  TYR A O     1 
ATOM   2212  C  CB    . TYR A 1  303  ? 44.110  -22.177  35.063  1.00 151.48 ? 303  TYR A CB    1 
ATOM   2213  C  CG    . TYR A 1  303  ? 44.270  -23.330  34.092  1.00 152.26 ? 303  TYR A CG    1 
ATOM   2214  C  CD1   . TYR A 1  303  ? 43.584  -23.345  32.879  1.00 153.76 ? 303  TYR A CD1   1 
ATOM   2215  C  CD2   . TYR A 1  303  ? 45.209  -24.332  34.319  1.00 152.90 ? 303  TYR A CD2   1 
ATOM   2216  C  CE1   . TYR A 1  303  ? 43.780  -24.366  31.950  1.00 153.91 ? 303  TYR A CE1   1 
ATOM   2217  C  CE2   . TYR A 1  303  ? 45.417  -25.356  33.395  1.00 153.61 ? 303  TYR A CE2   1 
ATOM   2218  C  CZ    . TYR A 1  303  ? 44.694  -25.373  32.214  1.00 160.16 ? 303  TYR A CZ    1 
ATOM   2219  O  OH    . TYR A 1  303  ? 44.890  -26.381  31.300  1.00 160.11 ? 303  TYR A OH    1 
ATOM   2220  N  N     . MET A 1  304  ? 43.079  -24.048  37.476  1.00 148.98 ? 304  MET A N     1 
ATOM   2221  C  CA    . MET A 1  304  ? 42.844  -25.360  38.056  1.00 147.75 ? 304  MET A CA    1 
ATOM   2222  C  C     . MET A 1  304  ? 41.835  -25.293  39.207  1.00 150.31 ? 304  MET A C     1 
ATOM   2223  O  O     . MET A 1  304  ? 40.839  -26.009  39.155  1.00 149.29 ? 304  MET A O     1 
ATOM   2224  C  CB    . MET A 1  304  ? 44.162  -25.984  38.519  1.00 150.40 ? 304  MET A CB    1 
ATOM   2225  C  CG    . MET A 1  304  ? 45.188  -26.106  37.425  1.00 154.79 ? 304  MET A CG    1 
ATOM   2226  S  SD    . MET A 1  304  ? 46.759  -26.723  38.053  1.00 159.88 ? 304  MET A SD    1 
ATOM   2227  C  CE    . MET A 1  304  ? 47.422  -25.215  38.845  1.00 157.38 ? 304  MET A CE    1 
ATOM   2228  N  N     . ASP A 1  305  ? 42.075  -24.432  40.228  1.00 146.58 ? 305  ASP A N     1 
ATOM   2229  C  CA    . ASP A 1  305  ? 41.199  -24.291  41.397  1.00 145.94 ? 305  ASP A CA    1 
ATOM   2230  C  C     . ASP A 1  305  ? 40.850  -22.832  41.695  1.00 151.51 ? 305  ASP A C     1 
ATOM   2231  O  O     . ASP A 1  305  ? 41.745  -22.026  41.942  1.00 151.33 ? 305  ASP A O     1 
ATOM   2232  C  CB    . ASP A 1  305  ? 41.841  -24.978  42.624  1.00 147.42 ? 305  ASP A CB    1 
ATOM   2233  C  CG    . ASP A 1  305  ? 41.079  -24.943  43.945  1.00 155.84 ? 305  ASP A CG    1 
ATOM   2234  O  OD1   . ASP A 1  305  ? 39.869  -24.617  43.932  1.00 156.47 ? 305  ASP A OD1   1 
ATOM   2235  O  OD2   . ASP A 1  305  ? 41.674  -25.318  44.983  1.00 159.47 ? 305  ASP A OD2   1 
ATOM   2236  N  N     . ASN A 1  306  ? 39.539  -22.515  41.711  1.00 149.77 ? 306  ASN A N     1 
ATOM   2237  C  CA    . ASN A 1  306  ? 39.009  -21.180  42.008  1.00 151.14 ? 306  ASN A CA    1 
ATOM   2238  C  C     . ASN A 1  306  ? 38.761  -21.002  43.512  1.00 157.90 ? 306  ASN A C     1 
ATOM   2239  O  O     . ASN A 1  306  ? 38.984  -19.905  44.038  1.00 158.36 ? 306  ASN A O     1 
ATOM   2240  C  CB    . ASN A 1  306  ? 37.718  -20.905  41.219  1.00 151.61 ? 306  ASN A CB    1 
ATOM   2241  C  CG    . ASN A 1  306  ? 37.087  -19.552  41.496  1.00 174.73 ? 306  ASN A CG    1 
ATOM   2242  O  OD1   . ASN A 1  306  ? 37.694  -18.497  41.287  1.00 171.21 ? 306  ASN A OD1   1 
ATOM   2243  N  ND2   . ASN A 1  306  ? 35.856  -19.550  41.992  1.00 164.85 ? 306  ASN A ND2   1 
ATOM   2244  N  N     . ASP A 1  307  ? 38.285  -22.073  44.192  1.00 155.32 ? 307  ASP A N     1 
ATOM   2245  C  CA    . ASP A 1  307  ? 37.973  -22.074  45.627  1.00 155.56 ? 307  ASP A CA    1 
ATOM   2246  C  C     . ASP A 1  307  ? 39.208  -22.059  46.543  1.00 161.53 ? 307  ASP A C     1 
ATOM   2247  O  O     . ASP A 1  307  ? 39.763  -23.116  46.867  1.00 160.86 ? 307  ASP A O     1 
ATOM   2248  C  CB    . ASP A 1  307  ? 36.999  -23.209  45.979  1.00 156.41 ? 307  ASP A CB    1 
ATOM   2249  C  CG    . ASP A 1  307  ? 35.608  -22.965  45.442  1.00 166.59 ? 307  ASP A CG    1 
ATOM   2250  O  OD1   . ASP A 1  307  ? 35.427  -23.038  44.202  1.00 166.93 ? 307  ASP A OD1   1 
ATOM   2251  O  OD2   . ASP A 1  307  ? 34.701  -22.684  46.256  1.00 172.70 ? 307  ASP A OD2   1 
ATOM   2252  N  N     . ILE A 1  308  ? 39.632  -20.835  46.949  1.00 159.75 ? 308  ILE A N     1 
ATOM   2253  C  CA    . ILE A 1  308  ? 40.791  -20.581  47.821  1.00 160.25 ? 308  ILE A CA    1 
ATOM   2254  C  C     . ILE A 1  308  ? 40.325  -19.835  49.111  1.00 164.42 ? 308  ILE A C     1 
ATOM   2255  O  O     . ILE A 1  308  ? 39.465  -20.352  49.828  1.00 163.00 ? 308  ILE A O     1 
ATOM   2256  C  CB    . ILE A 1  308  ? 41.985  -19.871  47.066  1.00 164.08 ? 308  ILE A CB    1 
ATOM   2257  C  CG1   . ILE A 1  308  ? 42.033  -20.190  45.544  1.00 163.86 ? 308  ILE A CG1   1 
ATOM   2258  C  CG2   . ILE A 1  308  ? 43.341  -20.180  47.740  1.00 165.62 ? 308  ILE A CG2   1 
ATOM   2259  C  CD1   . ILE A 1  308  ? 42.247  -18.997  44.660  1.00 168.38 ? 308  ILE A CD1   1 
ATOM   2260  N  N     . ALA A 1  309  ? 40.883  -18.632  49.384  1.00 162.39 ? 309  ALA A N     1 
ATOM   2261  C  CA    . ALA A 1  309  ? 40.582  -17.768  50.530  1.00 162.70 ? 309  ALA A CA    1 
ATOM   2262  C  C     . ALA A 1  309  ? 40.594  -16.286  50.116  1.00 168.11 ? 309  ALA A C     1 
ATOM   2263  O  O     . ALA A 1  309  ? 39.886  -15.478  50.719  1.00 167.59 ? 309  ALA A O     1 
ATOM   2264  C  CB    . ALA A 1  309  ? 41.589  -18.007  51.643  1.00 163.65 ? 309  ALA A CB    1 
ATOM   2265  N  N     . GLY A 1  310  ? 41.381  -15.962  49.084  1.00 166.17 ? 310  GLY A N     1 
ATOM   2266  C  CA    . GLY A 1  310  ? 41.530  -14.616  48.539  1.00 167.26 ? 310  GLY A CA    1 
ATOM   2267  C  C     . GLY A 1  310  ? 40.393  -14.172  47.641  1.00 172.08 ? 310  GLY A C     1 
ATOM   2268  O  O     . GLY A 1  310  ? 39.224  -14.266  48.023  1.00 171.11 ? 310  GLY A O     1 
ATOM   2269  N  N     . GLN A 1  311  ? 40.733  -13.667  46.444  1.00 170.26 ? 311  GLN A N     1 
ATOM   2270  C  CA    . GLN A 1  311  ? 39.763  -13.165  45.467  1.00 170.90 ? 311  GLN A CA    1 
ATOM   2271  C  C     . GLN A 1  311  ? 39.195  -14.279  44.551  1.00 176.12 ? 311  GLN A C     1 
ATOM   2272  O  O     . GLN A 1  311  ? 39.895  -15.275  44.339  1.00 175.52 ? 311  GLN A O     1 
ATOM   2273  C  CB    . GLN A 1  311  ? 40.371  -12.003  44.656  1.00 173.20 ? 311  GLN A CB    1 
ATOM   2274  C  CG    . GLN A 1  311  ? 39.938  -10.613  45.154  1.00 189.07 ? 311  GLN A CG    1 
ATOM   2275  C  CD    . GLN A 1  311  ? 41.056  -9.748   45.717  1.00 205.19 ? 311  GLN A CD    1 
ATOM   2276  O  OE1   . GLN A 1  311  ? 42.140  -9.607   45.135  1.00 201.13 ? 311  GLN A OE1   1 
ATOM   2277  N  NE2   . GLN A 1  311  ? 40.782  -9.074   46.828  1.00 193.85 ? 311  GLN A NE2   1 
ATOM   2278  N  N     . PRO A 1  312  ? 37.939  -14.151  44.015  1.00 173.76 ? 312  PRO A N     1 
ATOM   2279  C  CA    . PRO A 1  312  ? 37.381  -15.226  43.160  1.00 173.10 ? 312  PRO A CA    1 
ATOM   2280  C  C     . PRO A 1  312  ? 37.888  -15.228  41.707  1.00 177.17 ? 312  PRO A C     1 
ATOM   2281  O  O     . PRO A 1  312  ? 39.084  -15.432  41.496  1.00 176.85 ? 312  PRO A O     1 
ATOM   2282  C  CB    . PRO A 1  312  ? 35.867  -15.014  43.273  1.00 174.63 ? 312  PRO A CB    1 
ATOM   2283  C  CG    . PRO A 1  312  ? 35.713  -13.547  43.494  1.00 179.84 ? 312  PRO A CG    1 
ATOM   2284  C  CD    . PRO A 1  312  ? 36.963  -13.049  44.188  1.00 175.92 ? 312  PRO A CD    1 
ATOM   2285  N  N     . GLN A 1  313  ? 36.991  -15.041  40.710  1.00 173.94 ? 313  GLN A N     1 
ATOM   2286  C  CA    . GLN A 1  313  ? 37.372  -15.007  39.300  1.00 174.45 ? 313  GLN A CA    1 
ATOM   2287  C  C     . GLN A 1  313  ? 36.608  -14.023  38.417  1.00 179.89 ? 313  GLN A C     1 
ATOM   2288  O  O     . GLN A 1  313  ? 35.467  -13.667  38.716  1.00 179.25 ? 313  GLN A O     1 
ATOM   2289  C  CB    . GLN A 1  313  ? 37.464  -16.405  38.671  1.00 175.20 ? 313  GLN A CB    1 
ATOM   2290  C  CG    . GLN A 1  313  ? 38.899  -16.915  38.508  1.00 195.00 ? 313  GLN A CG    1 
ATOM   2291  C  CD    . GLN A 1  313  ? 39.802  -16.046  37.648  1.00 220.94 ? 313  GLN A CD    1 
ATOM   2292  O  OE1   . GLN A 1  313  ? 39.379  -15.334  36.726  1.00 218.10 ? 313  GLN A OE1   1 
ATOM   2293  N  NE2   . GLN A 1  313  ? 41.090  -16.140  37.890  1.00 215.35 ? 313  GLN A NE2   1 
ATOM   2294  N  N     . ALA A 1  314  ? 37.266  -13.603  37.316  1.00 177.92 ? 314  ALA A N     1 
ATOM   2295  C  CA    . ALA A 1  314  ? 36.835  -12.613  36.324  1.00 178.67 ? 314  ALA A CA    1 
ATOM   2296  C  C     . ALA A 1  314  ? 35.760  -13.040  35.284  1.00 182.68 ? 314  ALA A C     1 
ATOM   2297  O  O     . ALA A 1  314  ? 35.267  -14.171  35.307  1.00 181.04 ? 314  ALA A O     1 
ATOM   2298  C  CB    . ALA A 1  314  ? 38.057  -12.018  35.632  1.00 180.14 ? 314  ALA A CB    1 
ATOM   2299  N  N     . LEU A 1  315  ? 35.416  -12.087  34.377  1.00 180.52 ? 315  LEU A N     1 
ATOM   2300  C  CA    . LEU A 1  315  ? 34.411  -12.138  33.308  1.00 180.35 ? 315  LEU A CA    1 
ATOM   2301  C  C     . LEU A 1  315  ? 35.065  -12.263  31.893  1.00 185.62 ? 315  LEU A C     1 
ATOM   2302  O  O     . LEU A 1  315  ? 35.268  -13.387  31.422  1.00 184.47 ? 315  LEU A O     1 
ATOM   2303  C  CB    . LEU A 1  315  ? 33.564  -10.839  33.409  1.00 180.82 ? 315  LEU A CB    1 
ATOM   2304  C  CG    . LEU A 1  315  ? 32.083  -10.855  33.033  1.00 184.74 ? 315  LEU A CG    1 
ATOM   2305  C  CD1   . LEU A 1  315  ? 31.322  -9.830   33.849  1.00 185.14 ? 315  LEU A CD1   1 
ATOM   2306  C  CD2   . LEU A 1  315  ? 31.875  -10.530  31.570  1.00 187.01 ? 315  LEU A CD2   1 
ATOM   2307  N  N     . GLN A 1  316  ? 35.403  -11.097  31.245  1.00 183.96 ? 316  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1  316  ? 35.958  -10.906  29.882  1.00 184.40 ? 316  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1  316  ? 35.014  -11.527  28.818  1.00 188.20 ? 316  GLN A C     1 
ATOM   2310  O  O     . GLN A 1  316  ? 35.364  -12.507  28.148  1.00 187.84 ? 316  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1  316  ? 37.446  -11.344  29.762  1.00 185.65 ? 316  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1  316  ? 38.153  -10.930  28.454  1.00 193.23 ? 316  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1  316  ? 38.649  -9.502   28.429  1.00 207.04 ? 316  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1  316  ? 39.546  -9.115   29.183  1.00 201.17 ? 316  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1  316  ? 38.135  -8.708   27.499  1.00 198.47 ? 316  GLN A NE2   1 
ATOM   2316  N  N     . LYS A 1  317  ? 33.779  -10.952  28.720  1.00 184.09 ? 317  LYS A N     1 
ATOM   2317  C  CA    . LYS A 1  317  ? 32.635  -11.348  27.870  1.00 182.87 ? 317  LYS A CA    1 
ATOM   2318  C  C     . LYS A 1  317  ? 31.947  -12.672  28.309  1.00 185.92 ? 317  LYS A C     1 
ATOM   2319  O  O     . LYS A 1  317  ? 30.720  -12.774  28.214  1.00 185.30 ? 317  LYS A O     1 
ATOM   2320  C  CB    . LYS A 1  317  ? 32.939  -11.269  26.349  1.00 184.22 ? 317  LYS A CB    1 
ATOM   2321  C  CG    . LYS A 1  317  ? 31.707  -11.188  25.438  1.00 178.92 ? 317  LYS A CG    1 
ATOM   2322  C  CD    . LYS A 1  317  ? 30.986  -9.846   25.507  1.00 178.62 ? 317  LYS A CD    1 
ATOM   2323  C  CE    . LYS A 1  317  ? 29.622  -9.919   24.875  1.00 178.31 ? 317  LYS A CE    1 
ATOM   2324  N  NZ    . LYS A 1  317  ? 28.831  -8.693   25.141  1.00 182.19 ? 317  LYS A NZ    1 
ATOM   2325  N  N     . SER A 1  318  ? 32.737  -13.650  28.833  1.00 181.79 ? 318  SER A N     1 
ATOM   2326  C  CA    . SER A 1  318  ? 32.280  -14.961  29.330  1.00 180.27 ? 318  SER A CA    1 
ATOM   2327  C  C     . SER A 1  318  ? 31.770  -14.896  30.798  1.00 182.33 ? 318  SER A C     1 
ATOM   2328  O  O     . SER A 1  318  ? 31.596  -13.800  31.344  1.00 182.43 ? 318  SER A O     1 
ATOM   2329  C  CB    . SER A 1  318  ? 33.370  -16.023  29.150  1.00 183.29 ? 318  SER A CB    1 
ATOM   2330  O  OG    . SER A 1  318  ? 34.548  -15.742  29.890  1.00 191.29 ? 318  SER A OG    1 
ATOM   2331  N  N     . GLY A 1  319  ? 31.511  -16.064  31.396  1.00 176.42 ? 319  GLY A N     1 
ATOM   2332  C  CA    . GLY A 1  319  ? 31.000  -16.191  32.758  1.00 174.84 ? 319  GLY A CA    1 
ATOM   2333  C  C     . GLY A 1  319  ? 31.917  -15.696  33.861  1.00 176.09 ? 319  GLY A C     1 
ATOM   2334  O  O     . GLY A 1  319  ? 33.136  -15.592  33.676  1.00 176.05 ? 319  GLY A O     1 
ATOM   2335  N  N     . ARG A 1  320  ? 31.314  -15.372  35.022  1.00 169.77 ? 320  ARG A N     1 
ATOM   2336  C  CA    . ARG A 1  320  ? 32.006  -14.928  36.229  1.00 168.16 ? 320  ARG A CA    1 
ATOM   2337  C  C     . ARG A 1  320  ? 31.388  -15.604  37.470  1.00 169.36 ? 320  ARG A C     1 
ATOM   2338  O  O     . ARG A 1  320  ? 30.186  -15.455  37.704  1.00 168.45 ? 320  ARG A O     1 
ATOM   2339  C  CB    . ARG A 1  320  ? 32.137  -13.380  36.317  1.00 166.79 ? 320  ARG A CB    1 
ATOM   2340  C  CG    . ARG A 1  320  ? 30.970  -12.553  36.900  1.00 169.31 ? 320  ARG A CG    1 
ATOM   2341  C  CD    . ARG A 1  320  ? 29.650  -12.586  36.132  1.00 169.50 ? 320  ARG A CD    1 
ATOM   2342  N  NE    . ARG A 1  320  ? 29.827  -12.628  34.681  1.00 167.78 ? 320  ARG A NE    1 
ATOM   2343  C  CZ    . ARG A 1  320  ? 28.855  -12.440  33.798  1.00 176.01 ? 320  ARG A CZ    1 
ATOM   2344  N  NH1   . ARG A 1  320  ? 27.619  -12.185  34.206  1.00 161.44 ? 320  ARG A NH1   1 
ATOM   2345  N  NH2   . ARG A 1  320  ? 29.112  -12.496  32.499  1.00 161.13 ? 320  ARG A NH2   1 
ATOM   2346  N  N     . PRO A 1  321  ? 32.144  -16.455  38.207  1.00 164.41 ? 321  PRO A N     1 
ATOM   2347  C  CA    . PRO A 1  321  ? 33.573  -16.782  38.047  1.00 163.81 ? 321  PRO A CA    1 
ATOM   2348  C  C     . PRO A 1  321  ? 33.865  -17.906  37.040  1.00 164.87 ? 321  PRO A C     1 
ATOM   2349  O  O     . PRO A 1  321  ? 32.937  -18.528  36.514  1.00 163.76 ? 321  PRO A O     1 
ATOM   2350  C  CB    . PRO A 1  321  ? 33.997  -17.119  39.484  1.00 165.53 ? 321  PRO A CB    1 
ATOM   2351  C  CG    . PRO A 1  321  ? 32.765  -17.725  40.110  1.00 169.50 ? 321  PRO A CG    1 
ATOM   2352  C  CD    . PRO A 1  321  ? 31.566  -17.143  39.382  1.00 165.20 ? 321  PRO A CD    1 
ATOM   2353  N  N     . VAL A 1  322  ? 35.166  -18.148  36.764  1.00 159.96 ? 322  VAL A N     1 
ATOM   2354  C  CA    . VAL A 1  322  ? 35.656  -19.192  35.850  1.00 158.70 ? 322  VAL A CA    1 
ATOM   2355  C  C     . VAL A 1  322  ? 35.375  -20.558  36.481  1.00 160.30 ? 322  VAL A C     1 
ATOM   2356  O  O     . VAL A 1  322  ? 35.397  -20.682  37.709  1.00 159.64 ? 322  VAL A O     1 
ATOM   2357  C  CB    . VAL A 1  322  ? 37.165  -19.005  35.508  1.00 163.01 ? 322  VAL A CB    1 
ATOM   2358  C  CG1   . VAL A 1  322  ? 37.640  -20.008  34.456  1.00 162.52 ? 322  VAL A CG1   1 
ATOM   2359  C  CG2   . VAL A 1  322  ? 37.448  -17.585  35.039  1.00 163.83 ? 322  VAL A CG2   1 
ATOM   2360  N  N     . LYS A 1  323  ? 35.096  -21.568  35.642  1.00 155.32 ? 323  LYS A N     1 
ATOM   2361  C  CA    . LYS A 1  323  ? 34.785  -22.929  36.072  1.00 153.72 ? 323  LYS A CA    1 
ATOM   2362  C  C     . LYS A 1  323  ? 35.852  -23.609  36.959  1.00 155.26 ? 323  LYS A C     1 
ATOM   2363  O  O     . LYS A 1  323  ? 35.481  -24.188  37.980  1.00 155.19 ? 323  LYS A O     1 
ATOM   2364  C  CB    . LYS A 1  323  ? 34.319  -23.811  34.881  1.00 156.21 ? 323  LYS A CB    1 
ATOM   2365  C  CG    . LYS A 1  323  ? 35.387  -24.640  34.136  1.00 172.47 ? 323  LYS A CG    1 
ATOM   2366  C  CD    . LYS A 1  323  ? 36.402  -23.810  33.345  1.00 181.93 ? 323  LYS A CD    1 
ATOM   2367  C  CE    . LYS A 1  323  ? 37.788  -24.380  33.490  1.00 189.34 ? 323  LYS A CE    1 
ATOM   2368  N  NZ    . LYS A 1  323  ? 38.814  -23.310  33.610  1.00 197.09 ? 323  LYS A NZ    1 
ATOM   2369  N  N     . SER A 1  324  ? 37.162  -23.481  36.605  1.00 149.00 ? 324  SER A N     1 
ATOM   2370  C  CA    . SER A 1  324  ? 38.334  -24.104  37.255  1.00 146.93 ? 324  SER A CA    1 
ATOM   2371  C  C     . SER A 1  324  ? 38.268  -25.643  37.183  1.00 145.34 ? 324  SER A C     1 
ATOM   2372  O  O     . SER A 1  324  ? 37.379  -26.241  37.798  1.00 144.17 ? 324  SER A O     1 
ATOM   2373  C  CB    . SER A 1  324  ? 38.539  -23.596  38.685  1.00 150.05 ? 324  SER A CB    1 
ATOM   2374  O  OG    . SER A 1  324  ? 37.577  -24.097  39.601  1.00 156.24 ? 324  SER A OG    1 
ATOM   2375  N  N     . ILE A 1  325  ? 39.206  -26.278  36.422  1.00 138.25 ? 325  ILE A N     1 
ATOM   2376  C  CA    . ILE A 1  325  ? 39.289  -27.738  36.195  1.00 135.77 ? 325  ILE A CA    1 
ATOM   2377  C  C     . ILE A 1  325  ? 38.859  -28.600  37.401  1.00 137.50 ? 325  ILE A C     1 
ATOM   2378  O  O     . ILE A 1  325  ? 38.227  -29.636  37.195  1.00 136.88 ? 325  ILE A O     1 
ATOM   2379  C  CB    . ILE A 1  325  ? 40.620  -28.239  35.554  1.00 138.49 ? 325  ILE A CB    1 
ATOM   2380  C  CG1   . ILE A 1  325  ? 41.271  -27.214  34.626  1.00 138.89 ? 325  ILE A CG1   1 
ATOM   2381  C  CG2   . ILE A 1  325  ? 40.424  -29.570  34.824  1.00 138.68 ? 325  ILE A CG2   1 
ATOM   2382  C  CD1   . ILE A 1  325  ? 42.756  -27.318  34.619  1.00 143.32 ? 325  ILE A CD1   1 
ATOM   2383  N  N     . ARG A 1  326  ? 39.170  -28.163  38.647  1.00 132.50 ? 326  ARG A N     1 
ATOM   2384  C  CA    . ARG A 1  326  ? 38.775  -28.851  39.884  1.00 131.05 ? 326  ARG A CA    1 
ATOM   2385  C  C     . ARG A 1  326  ? 37.246  -29.062  39.940  1.00 132.99 ? 326  ARG A C     1 
ATOM   2386  O  O     . ARG A 1  326  ? 36.800  -30.188  40.173  1.00 132.10 ? 326  ARG A O     1 
ATOM   2387  C  CB    . ARG A 1  326  ? 39.315  -28.110  41.134  1.00 131.09 ? 326  ARG A CB    1 
ATOM   2388  C  CG    . ARG A 1  326  ? 38.477  -28.278  42.399  1.00 138.96 ? 326  ARG A CG    1 
ATOM   2389  C  CD    . ARG A 1  326  ? 39.200  -27.933  43.679  1.00 145.61 ? 326  ARG A CD    1 
ATOM   2390  N  NE    . ARG A 1  326  ? 38.425  -28.390  44.831  1.00 151.60 ? 326  ARG A NE    1 
ATOM   2391  C  CZ    . ARG A 1  326  ? 38.823  -29.327  45.683  1.00 164.96 ? 326  ARG A CZ    1 
ATOM   2392  N  NH1   . ARG A 1  326  ? 40.026  -29.876  45.564  1.00 152.40 ? 326  ARG A NH1   1 
ATOM   2393  N  NH2   . ARG A 1  326  ? 38.034  -29.701  46.682  1.00 150.41 ? 326  ARG A NH2   1 
ATOM   2394  N  N     . ALA A 1  327  ? 36.460  -27.997  39.668  1.00 128.49 ? 327  ALA A N     1 
ATOM   2395  C  CA    . ALA A 1  327  ? 34.997  -28.040  39.673  1.00 127.30 ? 327  ALA A CA    1 
ATOM   2396  C  C     . ALA A 1  327  ? 34.405  -28.959  38.600  1.00 130.13 ? 327  ALA A C     1 
ATOM   2397  O  O     . ALA A 1  327  ? 33.342  -29.541  38.837  1.00 129.72 ? 327  ALA A O     1 
ATOM   2398  C  CB    . ALA A 1  327  ? 34.426  -26.644  39.552  1.00 128.31 ? 327  ALA A CB    1 
ATOM   2399  N  N     . ARG A 1  328  ? 35.100  -29.103  37.437  1.00 125.65 ? 328  ARG A N     1 
ATOM   2400  C  CA    . ARG A 1  328  ? 34.709  -29.969  36.304  1.00 124.47 ? 328  ARG A CA    1 
ATOM   2401  C  C     . ARG A 1  328  ? 34.595  -31.433  36.754  1.00 126.37 ? 328  ARG A C     1 
ATOM   2402  O  O     . ARG A 1  328  ? 33.657  -32.125  36.365  1.00 125.29 ? 328  ARG A O     1 
ATOM   2403  C  CB    . ARG A 1  328  ? 35.735  -29.870  35.156  1.00 123.56 ? 328  ARG A CB    1 
ATOM   2404  C  CG    . ARG A 1  328  ? 35.316  -29.024  33.968  1.00 128.17 ? 328  ARG A CG    1 
ATOM   2405  C  CD    . ARG A 1  328  ? 36.545  -28.688  33.152  1.00 135.55 ? 328  ARG A CD    1 
ATOM   2406  N  NE    . ARG A 1  328  ? 36.242  -27.885  31.967  1.00 144.92 ? 328  ARG A NE    1 
ATOM   2407  C  CZ    . ARG A 1  328  ? 36.375  -28.312  30.714  1.00 156.94 ? 328  ARG A CZ    1 
ATOM   2408  N  NH1   . ARG A 1  328  ? 36.806  -29.543  30.467  1.00 143.66 ? 328  ARG A NH1   1 
ATOM   2409  N  NH2   . ARG A 1  328  ? 36.082  -27.510  29.700  1.00 140.24 ? 328  ARG A NH2   1 
ATOM   2410  N  N     . LEU A 1  329  ? 35.549  -31.887  37.576  1.00 122.14 ? 329  LEU A N     1 
ATOM   2411  C  CA    . LEU A 1  329  ? 35.591  -33.237  38.123  1.00 121.31 ? 329  LEU A CA    1 
ATOM   2412  C  C     . LEU A 1  329  ? 35.334  -33.178  39.635  1.00 126.14 ? 329  LEU A C     1 
ATOM   2413  O  O     . LEU A 1  329  ? 36.182  -33.573  40.436  1.00 126.22 ? 329  LEU A O     1 
ATOM   2414  C  CB    . LEU A 1  329  ? 36.925  -33.937  37.775  1.00 121.29 ? 329  LEU A CB    1 
ATOM   2415  C  CG    . LEU A 1  329  ? 38.122  -33.037  37.474  1.00 125.73 ? 329  LEU A CG    1 
ATOM   2416  C  CD1   . LEU A 1  329  ? 39.013  -32.897  38.673  1.00 125.80 ? 329  LEU A CD1   1 
ATOM   2417  C  CD2   . LEU A 1  329  ? 38.913  -33.563  36.319  1.00 127.66 ? 329  LEU A CD2   1 
ATOM   2418  N  N     . LYS A 1  330  ? 34.156  -32.651  40.020  1.00 122.72 ? 330  LYS A N     1 
ATOM   2419  C  CA    . LYS A 1  330  ? 33.758  -32.515  41.418  1.00 122.29 ? 330  LYS A CA    1 
ATOM   2420  C  C     . LYS A 1  330  ? 32.607  -33.442  41.836  1.00 126.88 ? 330  LYS A C     1 
ATOM   2421  O  O     . LYS A 1  330  ? 32.241  -34.368  41.093  1.00 126.92 ? 330  LYS A O     1 
ATOM   2422  C  CB    . LYS A 1  330  ? 33.468  -31.049  41.767  1.00 124.60 ? 330  LYS A CB    1 
ATOM   2423  C  CG    . LYS A 1  330  ? 34.588  -30.388  42.575  1.00 134.23 ? 330  LYS A CG    1 
ATOM   2424  C  CD    . LYS A 1  330  ? 34.563  -30.698  44.076  1.00 137.83 ? 330  LYS A CD    1 
ATOM   2425  C  CE    . LYS A 1  330  ? 33.551  -29.870  44.826  1.00 141.11 ? 330  LYS A CE    1 
ATOM   2426  N  NZ    . LYS A 1  330  ? 33.839  -29.848  46.278  1.00 149.43 ? 330  LYS A NZ    1 
ATOM   2427  N  N     . GLY A 1  331  ? 32.091  -33.205  43.045  1.00 122.90 ? 331  GLY A N     1 
ATOM   2428  C  CA    . GLY A 1  331  ? 31.009  -33.977  43.647  1.00 121.85 ? 331  GLY A CA    1 
ATOM   2429  C  C     . GLY A 1  331  ? 29.670  -33.841  42.951  1.00 123.85 ? 331  GLY A C     1 
ATOM   2430  O  O     . GLY A 1  331  ? 29.399  -32.822  42.304  1.00 123.79 ? 331  GLY A O     1 
ATOM   2431  N  N     . LYS A 1  332  ? 28.823  -34.885  43.110  1.00 118.45 ? 332  LYS A N     1 
ATOM   2432  C  CA    . LYS A 1  332  ? 27.470  -35.053  42.569  1.00 117.45 ? 332  LYS A CA    1 
ATOM   2433  C  C     . LYS A 1  332  ? 27.466  -34.920  41.055  1.00 121.96 ? 332  LYS A C     1 
ATOM   2434  O  O     . LYS A 1  332  ? 27.395  -35.926  40.350  1.00 121.82 ? 332  LYS A O     1 
ATOM   2435  C  CB    . LYS A 1  332  ? 26.455  -34.111  43.254  1.00 119.39 ? 332  LYS A CB    1 
ATOM   2436  C  CG    . LYS A 1  332  ? 25.021  -34.642  43.280  1.00 125.61 ? 332  LYS A CG    1 
ATOM   2437  C  CD    . LYS A 1  332  ? 24.762  -35.524  44.498  1.00 130.10 ? 332  LYS A CD    1 
ATOM   2438  C  CE    . LYS A 1  332  ? 23.314  -35.894  44.646  1.00 128.54 ? 332  LYS A CE    1 
ATOM   2439  N  NZ    . LYS A 1  332  ? 22.514  -34.801  45.256  1.00 127.65 ? 332  LYS A NZ    1 
ATOM   2440  N  N     . GLU A 1  333  ? 27.564  -33.681  40.561  1.00 118.82 ? 333  GLU A N     1 
ATOM   2441  C  CA    . GLU A 1  333  ? 27.636  -33.368  39.143  1.00 118.53 ? 333  GLU A CA    1 
ATOM   2442  C  C     . GLU A 1  333  ? 29.074  -32.940  38.879  1.00 122.58 ? 333  GLU A C     1 
ATOM   2443  O  O     . GLU A 1  333  ? 29.520  -31.869  39.323  1.00 123.06 ? 333  GLU A O     1 
ATOM   2444  C  CB    . GLU A 1  333  ? 26.605  -32.300  38.758  1.00 120.06 ? 333  GLU A CB    1 
ATOM   2445  C  CG    . GLU A 1  333  ? 25.183  -32.824  38.843  1.00 130.73 ? 333  GLU A CG    1 
ATOM   2446  C  CD    . GLU A 1  333  ? 24.104  -31.800  38.560  1.00 154.53 ? 333  GLU A CD    1 
ATOM   2447  O  OE1   . GLU A 1  333  ? 23.537  -31.830  37.443  1.00 152.64 ? 333  GLU A OE1   1 
ATOM   2448  O  OE2   . GLU A 1  333  ? 23.818  -30.977  39.460  1.00 148.11 ? 333  GLU A OE2   1 
ATOM   2449  N  N     . GLY A 1  334  ? 29.807  -33.862  38.270  1.00 117.83 ? 334  GLY A N     1 
ATOM   2450  C  CA    . GLY A 1  334  ? 31.219  -33.728  37.945  1.00 117.61 ? 334  GLY A CA    1 
ATOM   2451  C  C     . GLY A 1  334  ? 31.703  -34.940  37.184  1.00 120.61 ? 334  GLY A C     1 
ATOM   2452  O  O     . GLY A 1  334  ? 31.025  -35.974  37.188  1.00 119.75 ? 334  GLY A O     1 
ATOM   2453  N  N     . ARG A 1  335  ? 32.886  -34.825  36.534  1.00 116.92 ? 335  ARG A N     1 
ATOM   2454  C  CA    . ARG A 1  335  ? 33.487  -35.880  35.707  1.00 116.10 ? 335  ARG A CA    1 
ATOM   2455  C  C     . ARG A 1  335  ? 33.614  -37.232  36.392  1.00 120.08 ? 335  ARG A C     1 
ATOM   2456  O  O     . ARG A 1  335  ? 33.463  -38.259  35.725  1.00 119.79 ? 335  ARG A O     1 
ATOM   2457  C  CB    . ARG A 1  335  ? 34.805  -35.436  35.045  1.00 114.27 ? 335  ARG A CB    1 
ATOM   2458  C  CG    . ARG A 1  335  ? 34.845  -35.749  33.545  1.00 117.80 ? 335  ARG A CG    1 
ATOM   2459  C  CD    . ARG A 1  335  ? 34.579  -34.546  32.641  1.00 118.52 ? 335  ARG A CD    1 
ATOM   2460  N  NE    . ARG A 1  335  ? 33.314  -33.866  32.927  1.00 119.00 ? 335  ARG A NE    1 
ATOM   2461  C  CZ    . ARG A 1  335  ? 33.079  -32.580  32.686  1.00 125.99 ? 335  ARG A CZ    1 
ATOM   2462  N  NH1   . ARG A 1  335  ? 34.015  -31.819  32.128  1.00 115.84 ? 335  ARG A NH1   1 
ATOM   2463  N  NH2   . ARG A 1  335  ? 31.908  -32.042  33.005  1.00 102.14 ? 335  ARG A NH2   1 
ATOM   2464  N  N     . ILE A 1  336  ? 33.829  -37.245  37.720  1.00 116.42 ? 336  ILE A N     1 
ATOM   2465  C  CA    . ILE A 1  336  ? 33.932  -38.509  38.444  1.00 115.74 ? 336  ILE A CA    1 
ATOM   2466  C  C     . ILE A 1  336  ? 32.560  -39.066  38.848  1.00 118.84 ? 336  ILE A C     1 
ATOM   2467  O  O     . ILE A 1  336  ? 32.175  -40.156  38.405  1.00 117.92 ? 336  ILE A O     1 
ATOM   2468  C  CB    . ILE A 1  336  ? 34.949  -38.424  39.614  1.00 118.60 ? 336  ILE A CB    1 
ATOM   2469  C  CG1   . ILE A 1  336  ? 36.399  -38.387  39.090  1.00 119.21 ? 336  ILE A CG1   1 
ATOM   2470  C  CG2   . ILE A 1  336  ? 34.757  -39.560  40.625  1.00 118.93 ? 336  ILE A CG2   1 
ATOM   2471  C  CD1   . ILE A 1  336  ? 36.956  -39.733  38.512  1.00 124.87 ? 336  ILE A CD1   1 
ATOM   2472  N  N     . ARG A 1  337  ? 31.837  -38.301  39.681  1.00 114.44 ? 337  ARG A N     1 
ATOM   2473  C  CA    . ARG A 1  337  ? 30.544  -38.654  40.252  1.00 112.76 ? 337  ARG A CA    1 
ATOM   2474  C  C     . ARG A 1  337  ? 29.404  -38.885  39.242  1.00 114.10 ? 337  ARG A C     1 
ATOM   2475  O  O     . ARG A 1  337  ? 28.750  -39.927  39.304  1.00 113.34 ? 337  ARG A O     1 
ATOM   2476  C  CB    . ARG A 1  337  ? 30.150  -37.617  41.322  1.00 111.99 ? 337  ARG A CB    1 
ATOM   2477  C  CG    . ARG A 1  337  ? 30.910  -37.746  42.643  1.00 115.57 ? 337  ARG A CG    1 
ATOM   2478  C  CD    . ARG A 1  337  ? 30.165  -38.622  43.636  1.00 114.72 ? 337  ARG A CD    1 
ATOM   2479  N  NE    . ARG A 1  337  ? 29.609  -37.862  44.762  1.00 111.58 ? 337  ARG A NE    1 
ATOM   2480  C  CZ    . ARG A 1  337  ? 28.309  -37.708  45.012  1.00 118.86 ? 337  ARG A CZ    1 
ATOM   2481  N  NH1   . ARG A 1  337  ? 27.400  -38.250  44.211  1.00 102.70 ? 337  ARG A NH1   1 
ATOM   2482  N  NH2   . ARG A 1  337  ? 27.910  -37.015  46.066  1.00 108.18 ? 337  ARG A NH2   1 
ATOM   2483  N  N     . GLY A 1  338  ? 29.186  -37.926  38.337  1.00 108.96 ? 338  GLY A N     1 
ATOM   2484  C  CA    . GLY A 1  338  ? 28.079  -37.956  37.383  1.00 107.77 ? 338  GLY A CA    1 
ATOM   2485  C  C     . GLY A 1  338  ? 28.345  -38.284  35.927  1.00 109.32 ? 338  GLY A C     1 
ATOM   2486  O  O     . GLY A 1  338  ? 27.405  -38.274  35.124  1.00 108.12 ? 338  GLY A O     1 
ATOM   2487  N  N     . ASN A 1  339  ? 29.595  -38.590  35.568  1.00 105.38 ? 339  ASN A N     1 
ATOM   2488  C  CA    . ASN A 1  339  ? 29.930  -38.939  34.187  1.00 105.50 ? 339  ASN A CA    1 
ATOM   2489  C  C     . ASN A 1  339  ? 30.626  -40.297  34.077  1.00 111.76 ? 339  ASN A C     1 
ATOM   2490  O  O     . ASN A 1  339  ? 30.640  -40.890  32.995  1.00 111.92 ? 339  ASN A O     1 
ATOM   2491  C  CB    . ASN A 1  339  ? 30.719  -37.826  33.491  1.00 102.54 ? 339  ASN A CB    1 
ATOM   2492  C  CG    . ASN A 1  339  ? 29.970  -36.521  33.384  1.00 115.60 ? 339  ASN A CG    1 
ATOM   2493  O  OD1   . ASN A 1  339  ? 28.778  -36.473  33.068  1.00 109.66 ? 339  ASN A OD1   1 
ATOM   2494  N  ND2   . ASN A 1  339  ? 30.659  -35.421  33.623  1.00 105.84 ? 339  ASN A ND2   1 
ATOM   2495  N  N     . LEU A 1  340  ? 31.172  -40.807  35.202  1.00 109.28 ? 340  LEU A N     1 
ATOM   2496  C  CA    . LEU A 1  340  ? 31.862  -42.100  35.239  1.00 109.23 ? 340  LEU A CA    1 
ATOM   2497  C  C     . LEU A 1  340  ? 31.164  -43.171  36.072  1.00 110.31 ? 340  LEU A C     1 
ATOM   2498  O  O     . LEU A 1  340  ? 30.965  -44.281  35.566  1.00 109.78 ? 340  LEU A O     1 
ATOM   2499  C  CB    . LEU A 1  340  ? 33.353  -41.949  35.582  1.00 110.08 ? 340  LEU A CB    1 
ATOM   2500  C  CG    . LEU A 1  340  ? 34.208  -41.427  34.413  1.00 116.05 ? 340  LEU A CG    1 
ATOM   2501  C  CD1   . LEU A 1  340  ? 35.535  -40.854  34.896  1.00 116.63 ? 340  LEU A CD1   1 
ATOM   2502  C  CD2   . LEU A 1  340  ? 34.374  -42.494  33.307  1.00 119.04 ? 340  LEU A CD2   1 
ATOM   2503  N  N     . MET A 1  341  ? 30.764  -42.831  37.325  1.00 104.56 ? 341  MET A N     1 
ATOM   2504  C  CA    . MET A 1  341  ? 30.013  -43.713  38.243  1.00 102.82 ? 341  MET A CA    1 
ATOM   2505  C  C     . MET A 1  341  ? 28.590  -43.898  37.692  1.00 102.29 ? 341  MET A C     1 
ATOM   2506  O  O     . MET A 1  341  ? 28.127  -45.030  37.507  1.00 100.99 ? 341  MET A O     1 
ATOM   2507  C  CB    . MET A 1  341  ? 29.980  -43.137  39.684  1.00 105.03 ? 341  MET A CB    1 
ATOM   2508  C  CG    . MET A 1  341  ? 31.351  -42.978  40.330  1.00 108.74 ? 341  MET A CG    1 
ATOM   2509  S  SD    . MET A 1  341  ? 32.324  -44.504  40.370  1.00 113.01 ? 341  MET A SD    1 
ATOM   2510  C  CE    . MET A 1  341  ? 31.680  -45.234  41.777  1.00 109.43 ? 341  MET A CE    1 
ATOM   2511  N  N     . GLY A 1  342  ? 27.949  -42.766  37.402  1.00 96.48  ? 342  GLY A N     1 
ATOM   2512  C  CA    . GLY A 1  342  ? 26.634  -42.672  36.785  1.00 94.93  ? 342  GLY A CA    1 
ATOM   2513  C  C     . GLY A 1  342  ? 26.693  -41.905  35.474  1.00 94.74  ? 342  GLY A C     1 
ATOM   2514  O  O     . GLY A 1  342  ? 27.620  -41.125  35.250  1.00 93.90  ? 342  GLY A O     1 
ATOM   2515  N  N     . LYS A 1  343  ? 25.715  -42.136  34.589  1.00 88.66  ? 343  LYS A N     1 
ATOM   2516  C  CA    . LYS A 1  343  ? 25.622  -41.479  33.283  1.00 87.72  ? 343  LYS A CA    1 
ATOM   2517  C  C     . LYS A 1  343  ? 24.255  -41.664  32.624  1.00 89.32  ? 343  LYS A C     1 
ATOM   2518  O  O     . LYS A 1  343  ? 23.545  -42.613  32.945  1.00 87.45  ? 343  LYS A O     1 
ATOM   2519  C  CB    . LYS A 1  343  ? 26.770  -41.911  32.335  1.00 90.09  ? 343  LYS A CB    1 
ATOM   2520  C  CG    . LYS A 1  343  ? 26.990  -43.411  32.166  1.00 97.71  ? 343  LYS A CG    1 
ATOM   2521  C  CD    . LYS A 1  343  ? 28.166  -43.715  31.230  1.00 103.11 ? 343  LYS A CD    1 
ATOM   2522  C  CE    . LYS A 1  343  ? 29.492  -43.849  31.939  1.00 108.72 ? 343  LYS A CE    1 
ATOM   2523  N  NZ    . LYS A 1  343  ? 30.559  -44.306  31.016  1.00 113.27 ? 343  LYS A NZ    1 
ATOM   2524  N  N     . ARG A 1  344  ? 23.893  -40.755  31.702  1.00 86.41  ? 344  ARG A N     1 
ATOM   2525  C  CA    . ARG A 1  344  ? 22.639  -40.842  30.939  1.00 86.41  ? 344  ARG A CA    1 
ATOM   2526  C  C     . ARG A 1  344  ? 22.828  -41.983  29.922  1.00 89.53  ? 344  ARG A C     1 
ATOM   2527  O  O     . ARG A 1  344  ? 23.929  -42.125  29.385  1.00 89.10  ? 344  ARG A O     1 
ATOM   2528  C  CB    . ARG A 1  344  ? 22.314  -39.508  30.254  1.00 87.34  ? 344  ARG A CB    1 
ATOM   2529  C  CG    . ARG A 1  344  ? 22.488  -38.309  31.174  1.00 100.52 ? 344  ARG A CG    1 
ATOM   2530  C  CD    . ARG A 1  344  ? 21.412  -37.260  31.020  1.00 113.64 ? 344  ARG A CD    1 
ATOM   2531  N  NE    . ARG A 1  344  ? 20.916  -36.835  32.328  1.00 122.42 ? 344  ARG A NE    1 
ATOM   2532  C  CZ    . ARG A 1  344  ? 19.721  -37.148  32.815  1.00 137.03 ? 344  ARG A CZ    1 
ATOM   2533  N  NH1   . ARG A 1  344  ? 18.863  -37.851  32.086  1.00 122.36 ? 344  ARG A NH1   1 
ATOM   2534  N  NH2   . ARG A 1  344  ? 19.360  -36.734  34.022  1.00 126.25 ? 344  ARG A NH2   1 
ATOM   2535  N  N     . VAL A 1  345  ? 21.815  -42.857  29.749  1.00 85.01  ? 345  VAL A N     1 
ATOM   2536  C  CA    . VAL A 1  345  ? 21.964  -44.050  28.903  1.00 84.94  ? 345  VAL A CA    1 
ATOM   2537  C  C     . VAL A 1  345  ? 20.944  -44.216  27.769  1.00 89.36  ? 345  VAL A C     1 
ATOM   2538  O  O     . VAL A 1  345  ? 19.789  -43.794  27.900  1.00 90.07  ? 345  VAL A O     1 
ATOM   2539  C  CB    . VAL A 1  345  ? 22.093  -45.375  29.735  1.00 88.23  ? 345  VAL A CB    1 
ATOM   2540  C  CG1   . VAL A 1  345  ? 23.267  -45.332  30.715  1.00 87.64  ? 345  VAL A CG1   1 
ATOM   2541  C  CG2   . VAL A 1  345  ? 20.789  -45.737  30.453  1.00 87.74  ? 345  VAL A CG2   1 
ATOM   2542  N  N     . ASP A 1  346  ? 21.364  -44.914  26.683  1.00 84.00  ? 346  ASP A N     1 
ATOM   2543  C  CA    . ASP A 1  346  ? 20.502  -45.281  25.551  1.00 82.59  ? 346  ASP A CA    1 
ATOM   2544  C  C     . ASP A 1  346  ? 19.653  -46.485  26.015  1.00 82.98  ? 346  ASP A C     1 
ATOM   2545  O  O     . ASP A 1  346  ? 19.959  -47.065  27.067  1.00 83.69  ? 346  ASP A O     1 
ATOM   2546  C  CB    . ASP A 1  346  ? 21.364  -45.696  24.332  1.00 84.71  ? 346  ASP A CB    1 
ATOM   2547  C  CG    . ASP A 1  346  ? 22.073  -44.566  23.604  1.00 96.75  ? 346  ASP A CG    1 
ATOM   2548  O  OD1   . ASP A 1  346  ? 21.404  -43.577  23.247  1.00 98.52  ? 346  ASP A OD1   1 
ATOM   2549  O  OD2   . ASP A 1  346  ? 23.281  -44.711  23.314  1.00 103.07 ? 346  ASP A OD2   1 
ATOM   2550  N  N     . PHE A 1  347  ? 18.620  -46.878  25.241  1.00 77.43  ? 347  PHE A N     1 
ATOM   2551  C  CA    . PHE A 1  347  ? 17.747  -48.030  25.536  1.00 75.17  ? 347  PHE A CA    1 
ATOM   2552  C  C     . PHE A 1  347  ? 17.150  -47.990  26.921  1.00 76.16  ? 347  PHE A C     1 
ATOM   2553  O  O     . PHE A 1  347  ? 17.288  -48.920  27.717  1.00 75.41  ? 347  PHE A O     1 
ATOM   2554  C  CB    . PHE A 1  347  ? 18.423  -49.366  25.207  1.00 77.31  ? 347  PHE A CB    1 
ATOM   2555  C  CG    . PHE A 1  347  ? 18.920  -49.382  23.789  1.00 79.64  ? 347  PHE A CG    1 
ATOM   2556  C  CD1   . PHE A 1  347  ? 20.276  -49.270  23.513  1.00 83.47  ? 347  PHE A CD1   1 
ATOM   2557  C  CD2   . PHE A 1  347  ? 18.023  -49.407  22.720  1.00 81.93  ? 347  PHE A CD2   1 
ATOM   2558  C  CE1   . PHE A 1  347  ? 20.734  -49.255  22.191  1.00 85.71  ? 347  PHE A CE1   1 
ATOM   2559  C  CE2   . PHE A 1  347  ? 18.479  -49.383  21.400  1.00 85.50  ? 347  PHE A CE2   1 
ATOM   2560  C  CZ    . PHE A 1  347  ? 19.831  -49.316  21.141  1.00 84.59  ? 347  PHE A CZ    1 
ATOM   2561  N  N     . SER A 1  348  ? 16.513  -46.863  27.209  1.00 71.08  ? 348  SER A N     1 
ATOM   2562  C  CA    . SER A 1  348  ? 15.886  -46.576  28.490  1.00 69.43  ? 348  SER A CA    1 
ATOM   2563  C  C     . SER A 1  348  ? 14.527  -45.935  28.249  1.00 70.88  ? 348  SER A C     1 
ATOM   2564  O  O     . SER A 1  348  ? 14.302  -45.349  27.194  1.00 71.04  ? 348  SER A O     1 
ATOM   2565  C  CB    . SER A 1  348  ? 16.783  -45.675  29.339  1.00 72.12  ? 348  SER A CB    1 
ATOM   2566  O  OG    . SER A 1  348  ? 17.088  -44.457  28.675  1.00 79.23  ? 348  SER A OG    1 
ATOM   2567  N  N     . ALA A 1  349  ? 13.611  -46.085  29.200  1.00 64.85  ? 349  ALA A N     1 
ATOM   2568  C  CA    . ALA A 1  349  ? 12.270  -45.532  29.110  1.00 63.22  ? 349  ALA A CA    1 
ATOM   2569  C  C     . ALA A 1  349  ? 11.798  -45.140  30.476  1.00 66.56  ? 349  ALA A C     1 
ATOM   2570  O  O     . ALA A 1  349  ? 12.372  -45.571  31.486  1.00 68.14  ? 349  ALA A O     1 
ATOM   2571  C  CB    . ALA A 1  349  ? 11.324  -46.552  28.517  1.00 63.97  ? 349  ALA A CB    1 
ATOM   2572  N  N     . ARG A 1  350  ? 10.756  -44.312  30.514  1.00 60.15  ? 350  ARG A N     1 
ATOM   2573  C  CA    . ARG A 1  350  ? 10.179  -43.794  31.743  1.00 58.78  ? 350  ARG A CA    1 
ATOM   2574  C  C     . ARG A 1  350  ? 8.791   -43.304  31.481  1.00 60.36  ? 350  ARG A C     1 
ATOM   2575  O  O     . ARG A 1  350  ? 8.517   -42.747  30.415  1.00 60.33  ? 350  ARG A O     1 
ATOM   2576  C  CB    . ARG A 1  350  ? 11.064  -42.666  32.304  1.00 59.27  ? 350  ARG A CB    1 
ATOM   2577  C  CG    . ARG A 1  350  ? 10.433  -41.653  33.247  1.00 60.48  ? 350  ARG A CG    1 
ATOM   2578  C  CD    . ARG A 1  350  ? 11.197  -41.655  34.530  1.00 48.79  ? 350  ARG A CD    1 
ATOM   2579  N  NE    . ARG A 1  350  ? 10.843  -40.541  35.391  1.00 44.02  ? 350  ARG A NE    1 
ATOM   2580  C  CZ    . ARG A 1  350  ? 11.275  -40.410  36.637  1.00 67.97  ? 350  ARG A CZ    1 
ATOM   2581  N  NH1   . ARG A 1  350  ? 12.073  -41.335  37.174  1.00 52.89  ? 350  ARG A NH1   1 
ATOM   2582  N  NH2   . ARG A 1  350  ? 10.908  -39.361  37.365  1.00 62.38  ? 350  ARG A NH2   1 
ATOM   2583  N  N     . THR A 1  351  ? 7.913   -43.514  32.462  1.00 54.62  ? 351  THR A N     1 
ATOM   2584  C  CA    . THR A 1  351  ? 6.519   -43.096  32.450  1.00 53.25  ? 351  THR A CA    1 
ATOM   2585  C  C     . THR A 1  351  ? 5.924   -43.433  33.782  1.00 56.06  ? 351  THR A C     1 
ATOM   2586  O  O     . THR A 1  351  ? 6.534   -44.170  34.570  1.00 56.01  ? 351  THR A O     1 
ATOM   2587  C  CB    . THR A 1  351  ? 5.711   -43.712  31.266  1.00 60.30  ? 351  THR A CB    1 
ATOM   2588  O  OG1   . THR A 1  351  ? 4.437   -43.087  31.218  1.00 56.32  ? 351  THR A OG1   1 
ATOM   2589  C  CG2   . THR A 1  351  ? 5.506   -45.208  31.391  1.00 61.72  ? 351  THR A CG2   1 
ATOM   2590  N  N     . VAL A 1  352  ? 4.717   -42.902  34.011  1.00 51.48  ? 352  VAL A N     1 
ATOM   2591  C  CA    . VAL A 1  352  ? 3.867   -43.117  35.169  1.00 50.63  ? 352  VAL A CA    1 
ATOM   2592  C  C     . VAL A 1  352  ? 3.582   -44.623  35.294  1.00 55.59  ? 352  VAL A C     1 
ATOM   2593  O  O     . VAL A 1  352  ? 3.418   -45.329  34.288  1.00 54.44  ? 352  VAL A O     1 
ATOM   2594  C  CB    . VAL A 1  352  ? 2.552   -42.331  34.961  1.00 53.62  ? 352  VAL A CB    1 
ATOM   2595  C  CG1   . VAL A 1  352  ? 1.530   -42.583  36.076  1.00 53.23  ? 352  VAL A CG1   1 
ATOM   2596  C  CG2   . VAL A 1  352  ? 2.825   -40.845  34.780  1.00 53.12  ? 352  VAL A CG2   1 
ATOM   2597  N  N     . ILE A 1  353  ? 3.546   -45.104  36.531  1.00 53.36  ? 353  ILE A N     1 
ATOM   2598  C  CA    . ILE A 1  353  ? 3.195   -46.484  36.784  1.00 54.14  ? 353  ILE A CA    1 
ATOM   2599  C  C     . ILE A 1  353  ? 1.736   -46.622  37.202  1.00 61.20  ? 353  ILE A C     1 
ATOM   2600  O  O     . ILE A 1  353  ? 1.124   -45.662  37.690  1.00 61.47  ? 353  ILE A O     1 
ATOM   2601  C  CB    . ILE A 1  353  ? 4.176   -47.244  37.689  1.00 57.17  ? 353  ILE A CB    1 
ATOM   2602  C  CG1   . ILE A 1  353  ? 4.568   -46.427  38.941  1.00 57.13  ? 353  ILE A CG1   1 
ATOM   2603  C  CG2   . ILE A 1  353  ? 5.379   -47.680  36.876  1.00 57.42  ? 353  ILE A CG2   1 
ATOM   2604  C  CD1   . ILE A 1  353  ? 4.178   -47.027  40.208  1.00 59.28  ? 353  ILE A CD1   1 
ATOM   2605  N  N     . SER A 1  354  ? 1.173   -47.813  36.948  1.00 59.01  ? 354  SER A N     1 
ATOM   2606  C  CA    . SER A 1  354  ? -0.196  -48.179  37.254  1.00 58.41  ? 354  SER A CA    1 
ATOM   2607  C  C     . SER A 1  354  ? -0.333  -49.655  37.674  1.00 61.62  ? 354  SER A C     1 
ATOM   2608  O  O     . SER A 1  354  ? 0.488   -50.505  37.297  1.00 61.06  ? 354  SER A O     1 
ATOM   2609  C  CB    . SER A 1  354  ? -1.119  -47.803  36.103  1.00 61.38  ? 354  SER A CB    1 
ATOM   2610  O  OG    . SER A 1  354  ? -1.743  -46.579  36.458  1.00 69.71  ? 354  SER A OG    1 
ATOM   2611  N  N     . GLY A 1  355  ? -1.327  -49.916  38.521  1.00 57.47  ? 355  GLY A N     1 
ATOM   2612  C  CA    . GLY A 1  355  ? -1.603  -51.245  39.050  1.00 57.25  ? 355  GLY A CA    1 
ATOM   2613  C  C     . GLY A 1  355  ? -2.328  -52.121  38.064  1.00 59.30  ? 355  GLY A C     1 
ATOM   2614  O  O     . GLY A 1  355  ? -3.177  -51.623  37.315  1.00 58.93  ? 355  GLY A O     1 
ATOM   2615  N  N     . ASP A 1  356  ? -1.986  -53.425  38.056  1.00 53.66  ? 356  ASP A N     1 
ATOM   2616  C  CA    . ASP A 1  356  ? -2.622  -54.394  37.175  1.00 53.19  ? 356  ASP A CA    1 
ATOM   2617  C  C     . ASP A 1  356  ? -2.902  -55.753  37.809  1.00 57.13  ? 356  ASP A C     1 
ATOM   2618  O  O     . ASP A 1  356  ? -2.029  -56.619  37.767  1.00 56.39  ? 356  ASP A O     1 
ATOM   2619  C  CB    . ASP A 1  356  ? -1.872  -54.567  35.847  1.00 55.00  ? 356  ASP A CB    1 
ATOM   2620  C  CG    . ASP A 1  356  ? -2.773  -55.171  34.783  1.00 65.13  ? 356  ASP A CG    1 
ATOM   2621  O  OD1   . ASP A 1  356  ? -3.515  -56.126  35.103  1.00 66.06  ? 356  ASP A OD1   1 
ATOM   2622  O  OD2   . ASP A 1  356  ? -2.802  -54.636  33.653  1.00 70.68  ? 356  ASP A OD2   1 
ATOM   2623  N  N     . PRO A 1  357  ? -4.153  -56.021  38.265  1.00 54.23  ? 357  PRO A N     1 
ATOM   2624  C  CA    . PRO A 1  357  ? -4.450  -57.348  38.858  1.00 55.19  ? 357  PRO A CA    1 
ATOM   2625  C  C     . PRO A 1  357  ? -4.428  -58.560  37.888  1.00 61.48  ? 357  PRO A C     1 
ATOM   2626  O  O     . PRO A 1  357  ? -4.539  -59.737  38.320  1.00 61.22  ? 357  PRO A O     1 
ATOM   2627  C  CB    . PRO A 1  357  ? -5.827  -57.141  39.508  1.00 56.49  ? 357  PRO A CB    1 
ATOM   2628  C  CG    . PRO A 1  357  ? -6.427  -55.971  38.817  1.00 58.85  ? 357  PRO A CG    1 
ATOM   2629  C  CD    . PRO A 1  357  ? -5.300  -55.095  38.402  1.00 54.09  ? 357  PRO A CD    1 
ATOM   2630  N  N     . ASN A 1  358  ? -4.286  -58.272  36.569  1.00 58.52  ? 358  ASN A N     1 
ATOM   2631  C  CA    . ASN A 1  358  ? -4.280  -59.296  35.525  1.00 59.14  ? 358  ASN A CA    1 
ATOM   2632  C  C     . ASN A 1  358  ? -2.922  -59.571  34.875  1.00 66.99  ? 358  ASN A C     1 
ATOM   2633  O  O     . ASN A 1  358  ? -2.824  -60.436  34.007  1.00 68.85  ? 358  ASN A O     1 
ATOM   2634  C  CB    . ASN A 1  358  ? -5.390  -59.057  34.519  1.00 53.07  ? 358  ASN A CB    1 
ATOM   2635  C  CG    . ASN A 1  358  ? -6.768  -59.169  35.125  1.00 64.76  ? 358  ASN A CG    1 
ATOM   2636  O  OD1   . ASN A 1  358  ? -7.116  -60.155  35.800  1.00 51.21  ? 358  ASN A OD1   1 
ATOM   2637  N  ND2   . ASN A 1  358  ? -7.592  -58.158  34.896  1.00 58.47  ? 358  ASN A ND2   1 
ATOM   2638  N  N     . LEU A 1  359  ? -1.871  -58.893  35.339  1.00 64.21  ? 359  LEU A N     1 
ATOM   2639  C  CA    . LEU A 1  359  ? -0.500  -59.106  34.892  1.00 65.24  ? 359  LEU A CA    1 
ATOM   2640  C  C     . LEU A 1  359  ? 0.168   -60.094  35.871  1.00 72.80  ? 359  LEU A C     1 
ATOM   2641  O  O     . LEU A 1  359  ? -0.232  -60.186  37.052  1.00 71.08  ? 359  LEU A O     1 
ATOM   2642  C  CB    . LEU A 1  359  ? 0.229   -57.775  34.962  1.00 64.97  ? 359  LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1  359  ? 0.892   -57.225  33.713  1.00 70.32  ? 359  LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1  359  ? -0.133  -56.693  32.713  1.00 69.93  ? 359  LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1  359  ? 1.805   -56.075  34.095  1.00 73.59  ? 359  LEU A CD2   1 
ATOM   2646  N  N     . GLU A 1  360  ? 1.163   -60.862  35.379  1.00 72.98  ? 360  GLU A N     1 
ATOM   2647  C  CA    . GLU A 1  360  ? 1.875   -61.806  36.255  1.00 73.55  ? 360  GLU A CA    1 
ATOM   2648  C  C     . GLU A 1  360  ? 2.895   -61.041  37.096  1.00 75.43  ? 360  GLU A C     1 
ATOM   2649  O  O     . GLU A 1  360  ? 3.367   -59.990  36.655  1.00 75.39  ? 360  GLU A O     1 
ATOM   2650  C  CB    . GLU A 1  360  ? 2.494   -62.993  35.481  1.00 75.83  ? 360  GLU A CB    1 
ATOM   2651  C  CG    . GLU A 1  360  ? 1.517   -64.144  35.255  1.00 89.10  ? 360  GLU A CG    1 
ATOM   2652  C  CD    . GLU A 1  360  ? 0.985   -64.890  36.476  1.00 121.48 ? 360  GLU A CD    1 
ATOM   2653  O  OE1   . GLU A 1  360  ? -0.111  -65.491  36.360  1.00 108.44 ? 360  GLU A OE1   1 
ATOM   2654  O  OE2   . GLU A 1  360  ? 1.658   -64.889  37.538  1.00 123.33 ? 360  GLU A OE2   1 
ATOM   2655  N  N     . LEU A 1  361  ? 3.181   -61.519  38.315  1.00 69.86  ? 361  LEU A N     1 
ATOM   2656  C  CA    . LEU A 1  361  ? 4.109   -60.866  39.254  1.00 68.52  ? 361  LEU A CA    1 
ATOM   2657  C  C     . LEU A 1  361  ? 5.372   -60.333  38.567  1.00 71.89  ? 361  LEU A C     1 
ATOM   2658  O  O     . LEU A 1  361  ? 5.672   -59.123  38.690  1.00 72.50  ? 361  LEU A O     1 
ATOM   2659  C  CB    . LEU A 1  361  ? 4.475   -61.824  40.422  1.00 68.39  ? 361  LEU A CB    1 
ATOM   2660  C  CG    . LEU A 1  361  ? 5.454   -61.335  41.489  1.00 70.21  ? 361  LEU A CG    1 
ATOM   2661  C  CD1   . LEU A 1  361  ? 4.722   -60.783  42.690  1.00 68.81  ? 361  LEU A CD1   1 
ATOM   2662  C  CD2   . LEU A 1  361  ? 6.336   -62.454  41.925  1.00 71.93  ? 361  LEU A CD2   1 
ATOM   2663  N  N     . ASP A 1  362  ? 6.058   -61.244  37.802  1.00 65.44  ? 362  ASP A N     1 
ATOM   2664  C  CA    . ASP A 1  362  ? 7.317   -61.032  37.080  1.00 63.75  ? 362  ASP A CA    1 
ATOM   2665  C  C     . ASP A 1  362  ? 7.211   -60.274  35.745  1.00 65.11  ? 362  ASP A C     1 
ATOM   2666  O  O     . ASP A 1  362  ? 8.233   -59.989  35.119  1.00 65.66  ? 362  ASP A O     1 
ATOM   2667  C  CB    . ASP A 1  362  ? 8.088   -62.353  36.937  1.00 66.27  ? 362  ASP A CB    1 
ATOM   2668  C  CG    . ASP A 1  362  ? 7.407   -63.410  36.089  1.00 77.07  ? 362  ASP A CG    1 
ATOM   2669  O  OD1   . ASP A 1  362  ? 8.125   -64.141  35.375  1.00 77.31  ? 362  ASP A OD1   1 
ATOM   2670  O  OD2   . ASP A 1  362  ? 6.149   -63.531  36.169  1.00 83.21  ? 362  ASP A OD2   1 
ATOM   2671  N  N     . GLN A 1  363  ? 5.990   -59.918  35.332  1.00 57.92  ? 363  GLN A N     1 
ATOM   2672  C  CA    . GLN A 1  363  ? 5.774   -59.129  34.129  1.00 55.59  ? 363  GLN A CA    1 
ATOM   2673  C  C     . GLN A 1  363  ? 5.868   -57.631  34.453  1.00 59.71  ? 363  GLN A C     1 
ATOM   2674  O  O     . GLN A 1  363  ? 6.026   -57.232  35.625  1.00 58.74  ? 363  GLN A O     1 
ATOM   2675  C  CB    . GLN A 1  363  ? 4.417   -59.453  33.496  1.00 55.60  ? 363  GLN A CB    1 
ATOM   2676  C  CG    . GLN A 1  363  ? 4.392   -60.856  32.978  1.00 56.54  ? 363  GLN A CG    1 
ATOM   2677  C  CD    . GLN A 1  363  ? 3.257   -61.107  32.043  1.00 71.33  ? 363  GLN A CD    1 
ATOM   2678  O  OE1   . GLN A 1  363  ? 2.116   -61.339  32.488  1.00 66.26  ? 363  GLN A OE1   1 
ATOM   2679  N  NE2   . GLN A 1  363  ? 3.576   -61.166  30.725  1.00 55.46  ? 363  GLN A NE2   1 
ATOM   2680  N  N     . VAL A 1  364  ? 5.773   -56.816  33.380  1.00 55.79  ? 364  VAL A N     1 
ATOM   2681  C  CA    . VAL A 1  364  ? 5.746   -55.357  33.321  1.00 54.37  ? 364  VAL A CA    1 
ATOM   2682  C  C     . VAL A 1  364  ? 5.008   -54.999  32.037  1.00 62.22  ? 364  VAL A C     1 
ATOM   2683  O  O     . VAL A 1  364  ? 5.347   -55.508  30.954  1.00 64.83  ? 364  VAL A O     1 
ATOM   2684  C  CB    . VAL A 1  364  ? 7.145   -54.686  33.417  1.00 57.17  ? 364  VAL A CB    1 
ATOM   2685  C  CG1   . VAL A 1  364  ? 8.123   -55.171  32.337  1.00 57.04  ? 364  VAL A CG1   1 
ATOM   2686  C  CG2   . VAL A 1  364  ? 7.026   -53.164  33.417  1.00 56.32  ? 364  VAL A CG2   1 
ATOM   2687  N  N     . GLY A 1  365  ? 3.967   -54.189  32.171  1.00 58.10  ? 365  GLY A N     1 
ATOM   2688  C  CA    . GLY A 1  365  ? 3.158   -53.749  31.039  1.00 57.22  ? 365  GLY A CA    1 
ATOM   2689  C  C     . GLY A 1  365  ? 3.898   -52.652  30.327  1.00 60.36  ? 365  GLY A C     1 
ATOM   2690  O  O     . GLY A 1  365  ? 4.270   -51.666  30.947  1.00 59.60  ? 365  GLY A O     1 
ATOM   2691  N  N     . VAL A 1  366  ? 4.199   -52.835  29.056  1.00 58.10  ? 366  VAL A N     1 
ATOM   2692  C  CA    . VAL A 1  366  ? 4.943   -51.794  28.339  1.00 57.48  ? 366  VAL A CA    1 
ATOM   2693  C  C     . VAL A 1  366  ? 4.080   -51.155  27.237  1.00 59.46  ? 366  VAL A C     1 
ATOM   2694  O  O     . VAL A 1  366  ? 3.665   -51.869  26.338  1.00 59.57  ? 366  VAL A O     1 
ATOM   2695  C  CB    . VAL A 1  366  ? 6.335   -52.292  27.834  1.00 61.25  ? 366  VAL A CB    1 
ATOM   2696  C  CG1   . VAL A 1  366  ? 7.003   -51.273  26.896  1.00 60.58  ? 366  VAL A CG1   1 
ATOM   2697  C  CG2   . VAL A 1  366  ? 7.252   -52.662  29.010  1.00 60.41  ? 366  VAL A CG2   1 
ATOM   2698  N  N     . PRO A 1  367  ? 3.795   -49.834  27.296  1.00 55.00  ? 367  PRO A N     1 
ATOM   2699  C  CA    . PRO A 1  367  ? 3.008   -49.192  26.227  1.00 54.55  ? 367  PRO A CA    1 
ATOM   2700  C  C     . PRO A 1  367  ? 3.555   -49.475  24.842  1.00 60.50  ? 367  PRO A C     1 
ATOM   2701  O  O     . PRO A 1  367  ? 4.767   -49.423  24.641  1.00 60.11  ? 367  PRO A O     1 
ATOM   2702  C  CB    . PRO A 1  367  ? 3.150   -47.704  26.534  1.00 55.44  ? 367  PRO A CB    1 
ATOM   2703  C  CG    . PRO A 1  367  ? 3.384   -47.642  27.974  1.00 59.79  ? 367  PRO A CG    1 
ATOM   2704  C  CD    . PRO A 1  367  ? 4.200   -48.850  28.321  1.00 56.24  ? 367  PRO A CD    1 
ATOM   2705  N  N     . LYS A 1  368  ? 2.663   -49.795  23.902  1.00 59.56  ? 368  LYS A N     1 
ATOM   2706  C  CA    . LYS A 1  368  ? 2.981   -50.080  22.499  1.00 61.72  ? 368  LYS A CA    1 
ATOM   2707  C  C     . LYS A 1  368  ? 4.011   -49.073  21.936  1.00 65.78  ? 368  LYS A C     1 
ATOM   2708  O  O     . LYS A 1  368  ? 5.005   -49.497  21.333  1.00 66.82  ? 368  LYS A O     1 
ATOM   2709  C  CB    . LYS A 1  368  ? 1.692   -49.985  21.662  1.00 66.31  ? 368  LYS A CB    1 
ATOM   2710  C  CG    . LYS A 1  368  ? 1.365   -51.174  20.756  1.00 89.04  ? 368  LYS A CG    1 
ATOM   2711  C  CD    . LYS A 1  368  ? -0.118  -51.628  20.952  1.00 111.22 ? 368  LYS A CD    1 
ATOM   2712  C  CE    . LYS A 1  368  ? -1.191  -50.578  20.654  1.00 129.20 ? 368  LYS A CE    1 
ATOM   2713  N  NZ    . LYS A 1  368  ? -2.505  -50.901  21.285  1.00 136.45 ? 368  LYS A NZ    1 
ATOM   2714  N  N     . SER A 1  369  ? 3.769   -47.744  22.148  1.00 59.47  ? 369  SER A N     1 
ATOM   2715  C  CA    . SER A 1  369  ? 4.640   -46.665  21.687  1.00 58.31  ? 369  SER A CA    1 
ATOM   2716  C  C     . SER A 1  369  ? 6.066   -46.837  22.172  1.00 63.54  ? 369  SER A C     1 
ATOM   2717  O  O     . SER A 1  369  ? 6.985   -46.734  21.351  1.00 64.27  ? 369  SER A O     1 
ATOM   2718  C  CB    . SER A 1  369  ? 4.109   -45.305  22.123  1.00 58.98  ? 369  SER A CB    1 
ATOM   2719  O  OG    . SER A 1  369  ? 4.119   -45.117  23.528  1.00 60.91  ? 369  SER A OG    1 
ATOM   2720  N  N     . ILE A 1  370  ? 6.242   -47.122  23.508  1.00 58.43  ? 370  ILE A N     1 
ATOM   2721  C  CA    . ILE A 1  370  ? 7.531   -47.341  24.164  1.00 57.24  ? 370  ILE A CA    1 
ATOM   2722  C  C     . ILE A 1  370  ? 8.210   -48.559  23.546  1.00 62.38  ? 370  ILE A C     1 
ATOM   2723  O  O     . ILE A 1  370  ? 9.412   -48.504  23.266  1.00 62.05  ? 370  ILE A O     1 
ATOM   2724  C  CB    . ILE A 1  370  ? 7.403   -47.466  25.705  1.00 59.37  ? 370  ILE A CB    1 
ATOM   2725  C  CG1   . ILE A 1  370  ? 6.991   -46.142  26.378  1.00 57.62  ? 370  ILE A CG1   1 
ATOM   2726  C  CG2   . ILE A 1  370  ? 8.710   -47.975  26.303  1.00 61.99  ? 370  ILE A CG2   1 
ATOM   2727  C  CD1   . ILE A 1  370  ? 6.982   -46.201  27.947  1.00 55.60  ? 370  ILE A CD1   1 
ATOM   2728  N  N     . ALA A 1  371  ? 7.428   -49.651  23.323  1.00 60.44  ? 371  ALA A N     1 
ATOM   2729  C  CA    . ALA A 1  371  ? 7.891   -50.896  22.694  1.00 61.03  ? 371  ALA A CA    1 
ATOM   2730  C  C     . ALA A 1  371  ? 8.336   -50.570  21.279  1.00 65.80  ? 371  ALA A C     1 
ATOM   2731  O  O     . ALA A 1  371  ? 9.372   -51.059  20.825  1.00 66.15  ? 371  ALA A O     1 
ATOM   2732  C  CB    . ALA A 1  371  ? 6.774   -51.932  22.667  1.00 61.59  ? 371  ALA A CB    1 
ATOM   2733  N  N     . LYS A 1  372  ? 7.597   -49.672  20.618  1.00 62.77  ? 372  LYS A N     1 
ATOM   2734  C  CA    . LYS A 1  372  ? 7.923   -49.246  19.267  1.00 64.00  ? 372  LYS A CA    1 
ATOM   2735  C  C     . LYS A 1  372  ? 9.243   -48.441  19.157  1.00 69.97  ? 372  LYS A C     1 
ATOM   2736  O  O     . LYS A 1  372  ? 9.847   -48.429  18.077  1.00 72.07  ? 372  LYS A O     1 
ATOM   2737  C  CB    . LYS A 1  372  ? 6.733   -48.549  18.578  1.00 65.32  ? 372  LYS A CB    1 
ATOM   2738  C  CG    . LYS A 1  372  ? 5.690   -49.492  17.979  1.00 64.30  ? 372  LYS A CG    1 
ATOM   2739  C  CD    . LYS A 1  372  ? 4.832   -48.768  16.940  1.00 74.60  ? 372  LYS A CD    1 
ATOM   2740  C  CE    . LYS A 1  372  ? 3.417   -48.426  17.385  1.00 89.41  ? 372  LYS A CE    1 
ATOM   2741  N  NZ    . LYS A 1  372  ? 3.261   -47.005  17.835  1.00 96.96  ? 372  LYS A NZ    1 
ATOM   2742  N  N     . THR A 1  373  ? 9.708   -47.819  20.267  1.00 64.04  ? 373  THR A N     1 
ATOM   2743  C  CA    . THR A 1  373  ? 10.949  -47.044  20.285  1.00 63.29  ? 373  THR A CA    1 
ATOM   2744  C  C     . THR A 1  373  ? 12.159  -47.918  20.611  1.00 68.56  ? 373  THR A C     1 
ATOM   2745  O  O     . THR A 1  373  ? 13.136  -47.871  19.873  1.00 68.92  ? 373  THR A O     1 
ATOM   2746  C  CB    . THR A 1  373  ? 10.906  -45.901  21.307  1.00 66.43  ? 373  THR A CB    1 
ATOM   2747  O  OG1   . THR A 1  373  ? 9.613   -45.311  21.403  1.00 64.39  ? 373  THR A OG1   1 
ATOM   2748  C  CG2   . THR A 1  373  ? 11.925  -44.852  21.015  1.00 66.23  ? 373  THR A CG2   1 
ATOM   2749  N  N     . LEU A 1  374  ? 12.133  -48.638  21.755  1.00 65.15  ? 374  LEU A N     1 
ATOM   2750  C  CA    . LEU A 1  374  ? 13.253  -49.460  22.219  1.00 65.32  ? 374  LEU A CA    1 
ATOM   2751  C  C     . LEU A 1  374  ? 13.409  -50.713  21.379  1.00 71.20  ? 374  LEU A C     1 
ATOM   2752  O  O     . LEU A 1  374  ? 12.428  -51.427  21.159  1.00 71.66  ? 374  LEU A O     1 
ATOM   2753  C  CB    . LEU A 1  374  ? 13.107  -49.838  23.701  1.00 64.81  ? 374  LEU A CB    1 
ATOM   2754  C  CG    . LEU A 1  374  ? 12.737  -48.741  24.704  1.00 68.33  ? 374  LEU A CG    1 
ATOM   2755  C  CD1   . LEU A 1  374  ? 12.098  -49.345  25.911  1.00 68.01  ? 374  LEU A CD1   1 
ATOM   2756  C  CD2   . LEU A 1  374  ? 13.953  -47.956  25.151  1.00 70.01  ? 374  LEU A CD2   1 
ATOM   2757  N  N     . THR A 1  375  ? 14.645  -50.977  20.911  1.00 68.91  ? 375  THR A N     1 
ATOM   2758  C  CA    . THR A 1  375  ? 14.986  -52.135  20.072  1.00 69.89  ? 375  THR A CA    1 
ATOM   2759  C  C     . THR A 1  375  ? 16.053  -53.034  20.686  1.00 75.11  ? 375  THR A C     1 
ATOM   2760  O  O     . THR A 1  375  ? 16.694  -52.636  21.653  1.00 74.75  ? 375  THR A O     1 
ATOM   2761  C  CB    . THR A 1  375  ? 15.371  -51.723  18.630  1.00 78.27  ? 375  THR A CB    1 
ATOM   2762  O  OG1   . THR A 1  375  ? 16.443  -50.771  18.617  1.00 75.23  ? 375  THR A OG1   1 
ATOM   2763  C  CG2   . THR A 1  375  ? 14.185  -51.247  17.819  1.00 77.37  ? 375  THR A CG2   1 
ATOM   2764  N  N     . TYR A 1  376  ? 16.211  -54.260  20.138  1.00 72.40  ? 376  TYR A N     1 
ATOM   2765  C  CA    . TYR A 1  376  ? 17.206  -55.254  20.540  1.00 72.21  ? 376  TYR A CA    1 
ATOM   2766  C  C     . TYR A 1  376  ? 17.942  -55.783  19.296  1.00 75.18  ? 376  TYR A C     1 
ATOM   2767  O  O     . TYR A 1  376  ? 17.288  -56.249  18.357  1.00 74.71  ? 376  TYR A O     1 
ATOM   2768  C  CB    . TYR A 1  376  ? 16.561  -56.399  21.324  1.00 73.83  ? 376  TYR A CB    1 
ATOM   2769  C  CG    . TYR A 1  376  ? 17.529  -57.524  21.622  1.00 78.30  ? 376  TYR A CG    1 
ATOM   2770  C  CD1   . TYR A 1  376  ? 18.401  -57.452  22.706  1.00 80.25  ? 376  TYR A CD1   1 
ATOM   2771  C  CD2   . TYR A 1  376  ? 17.586  -58.655  20.811  1.00 80.75  ? 376  TYR A CD2   1 
ATOM   2772  C  CE1   . TYR A 1  376  ? 19.322  -58.466  22.959  1.00 82.15  ? 376  TYR A CE1   1 
ATOM   2773  C  CE2   . TYR A 1  376  ? 18.502  -59.677  21.056  1.00 82.57  ? 376  TYR A CE2   1 
ATOM   2774  C  CZ    . TYR A 1  376  ? 19.365  -59.579  22.133  1.00 90.95  ? 376  TYR A CZ    1 
ATOM   2775  O  OH    . TYR A 1  376  ? 20.264  -60.587  22.364  1.00 95.91  ? 376  TYR A OH    1 
ATOM   2776  N  N     . PRO A 1  377  ? 19.296  -55.742  19.273  1.00 71.58  ? 377  PRO A N     1 
ATOM   2777  C  CA    . PRO A 1  377  ? 20.026  -56.240  18.093  1.00 72.24  ? 377  PRO A CA    1 
ATOM   2778  C  C     . PRO A 1  377  ? 20.068  -57.755  18.054  1.00 77.72  ? 377  PRO A C     1 
ATOM   2779  O  O     . PRO A 1  377  ? 20.805  -58.391  18.823  1.00 80.18  ? 377  PRO A O     1 
ATOM   2780  C  CB    . PRO A 1  377  ? 21.423  -55.632  18.242  1.00 74.30  ? 377  PRO A CB    1 
ATOM   2781  C  CG    . PRO A 1  377  ? 21.586  -55.412  19.692  1.00 78.39  ? 377  PRO A CG    1 
ATOM   2782  C  CD    . PRO A 1  377  ? 20.221  -55.251  20.314  1.00 72.89  ? 377  PRO A CD    1 
ATOM   2783  N  N     . GLU A 1  378  ? 19.252  -58.337  17.180  1.00 71.45  ? 378  GLU A N     1 
ATOM   2784  C  CA    . GLU A 1  378  ? 19.172  -59.777  17.051  1.00 70.42  ? 378  GLU A CA    1 
ATOM   2785  C  C     . GLU A 1  378  ? 19.976  -60.219  15.865  1.00 75.12  ? 378  GLU A C     1 
ATOM   2786  O  O     . GLU A 1  378  ? 19.788  -59.660  14.794  1.00 75.78  ? 378  GLU A O     1 
ATOM   2787  C  CB    . GLU A 1  378  ? 17.712  -60.172  16.886  1.00 70.91  ? 378  GLU A CB    1 
ATOM   2788  C  CG    . GLU A 1  378  ? 17.502  -61.665  16.959  1.00 79.66  ? 378  GLU A CG    1 
ATOM   2789  C  CD    . GLU A 1  378  ? 16.174  -62.080  17.544  1.00 95.39  ? 378  GLU A CD    1 
ATOM   2790  O  OE1   . GLU A 1  378  ? 15.948  -63.304  17.662  1.00 101.15 ? 378  GLU A OE1   1 
ATOM   2791  O  OE2   . GLU A 1  378  ? 15.378  -61.194  17.924  1.00 82.32  ? 378  GLU A OE2   1 
ATOM   2792  N  N     . VAL A 1  379  ? 20.842  -61.227  16.014  1.00 72.99  ? 379  VAL A N     1 
ATOM   2793  C  CA    . VAL A 1  379  ? 21.588  -61.713  14.844  1.00 75.32  ? 379  VAL A CA    1 
ATOM   2794  C  C     . VAL A 1  379  ? 20.763  -62.731  14.049  1.00 81.22  ? 379  VAL A C     1 
ATOM   2795  O  O     . VAL A 1  379  ? 20.158  -63.616  14.648  1.00 82.01  ? 379  VAL A O     1 
ATOM   2796  C  CB    . VAL A 1  379  ? 23.014  -62.219  15.156  1.00 80.29  ? 379  VAL A CB    1 
ATOM   2797  C  CG1   . VAL A 1  379  ? 23.674  -62.853  13.924  1.00 81.32  ? 379  VAL A CG1   1 
ATOM   2798  C  CG2   . VAL A 1  379  ? 23.875  -61.084  15.691  1.00 79.77  ? 379  VAL A CG2   1 
ATOM   2799  N  N     . VAL A 1  380  ? 20.740  -62.602  12.712  1.00 77.90  ? 380  VAL A N     1 
ATOM   2800  C  CA    . VAL A 1  380  ? 20.008  -63.519  11.833  1.00 78.43  ? 380  VAL A CA    1 
ATOM   2801  C  C     . VAL A 1  380  ? 20.647  -64.929  11.862  1.00 86.71  ? 380  VAL A C     1 
ATOM   2802  O  O     . VAL A 1  380  ? 21.813  -65.102  11.501  1.00 87.74  ? 380  VAL A O     1 
ATOM   2803  C  CB    . VAL A 1  380  ? 19.789  -62.980  10.374  1.00 80.69  ? 380  VAL A CB    1 
ATOM   2804  C  CG1   . VAL A 1  380  ? 19.154  -64.038  9.497   1.00 80.89  ? 380  VAL A CG1   1 
ATOM   2805  C  CG2   . VAL A 1  380  ? 18.943  -61.709  10.349  1.00 78.66  ? 380  VAL A CG2   1 
ATOM   2806  N  N     . THR A 1  381  ? 19.876  -65.912  12.346  1.00 84.76  ? 381  THR A N     1 
ATOM   2807  C  CA    . THR A 1  381  ? 20.231  -67.330  12.401  1.00 85.98  ? 381  THR A CA    1 
ATOM   2808  C  C     . THR A 1  381  ? 19.133  -68.040  11.622  1.00 90.58  ? 381  THR A C     1 
ATOM   2809  O  O     . THR A 1  381  ? 18.074  -67.439  11.425  1.00 88.73  ? 381  THR A O     1 
ATOM   2810  C  CB    . THR A 1  381  ? 20.273  -67.861  13.855  1.00 97.04  ? 381  THR A CB    1 
ATOM   2811  O  OG1   . THR A 1  381  ? 18.963  -67.874  14.424  1.00 97.98  ? 381  THR A OG1   1 
ATOM   2812  C  CG2   . THR A 1  381  ? 21.252  -67.106  14.747  1.00 97.02  ? 381  THR A CG2   1 
ATOM   2813  N  N     . PRO A 1  382  ? 19.286  -69.307  11.196  1.00 89.42  ? 382  PRO A N     1 
ATOM   2814  C  CA    . PRO A 1  382  ? 18.173  -69.954  10.501  1.00 90.28  ? 382  PRO A CA    1 
ATOM   2815  C  C     . PRO A 1  382  ? 16.993  -70.179  11.451  1.00 97.35  ? 382  PRO A C     1 
ATOM   2816  O  O     . PRO A 1  382  ? 15.846  -70.124  10.993  1.00 97.05  ? 382  PRO A O     1 
ATOM   2817  C  CB    . PRO A 1  382  ? 18.797  -71.240  9.957   1.00 92.99  ? 382  PRO A CB    1 
ATOM   2818  C  CG    . PRO A 1  382  ? 20.288  -71.032  10.056  1.00 97.22  ? 382  PRO A CG    1 
ATOM   2819  C  CD    . PRO A 1  382  ? 20.433  -70.222  11.293  1.00 91.82  ? 382  PRO A CD    1 
ATOM   2820  N  N     . TYR A 1  383  ? 17.270  -70.318  12.784  1.00 95.61  ? 383  TYR A N     1 
ATOM   2821  C  CA    . TYR A 1  383  ? 16.250  -70.497  13.823  1.00 96.47  ? 383  TYR A CA    1 
ATOM   2822  C  C     . TYR A 1  383  ? 15.214  -69.362  13.840  1.00 99.06  ? 383  TYR A C     1 
ATOM   2823  O  O     . TYR A 1  383  ? 14.050  -69.627  14.146  1.00 98.81  ? 383  TYR A O     1 
ATOM   2824  C  CB    . TYR A 1  383  ? 16.864  -70.577  15.241  1.00 99.73  ? 383  TYR A CB    1 
ATOM   2825  C  CG    . TYR A 1  383  ? 18.120  -71.404  15.407  1.00 105.93 ? 383  TYR A CG    1 
ATOM   2826  C  CD1   . TYR A 1  383  ? 19.280  -70.845  15.938  1.00 108.59 ? 383  TYR A CD1   1 
ATOM   2827  C  CD2   . TYR A 1  383  ? 18.122  -72.769  15.130  1.00 108.85 ? 383  TYR A CD2   1 
ATOM   2828  C  CE1   . TYR A 1  383  ? 20.435  -71.608  16.123  1.00 111.87 ? 383  TYR A CE1   1 
ATOM   2829  C  CE2   . TYR A 1  383  ? 19.273  -73.541  15.298  1.00 111.50 ? 383  TYR A CE2   1 
ATOM   2830  C  CZ    . TYR A 1  383  ? 20.428  -72.957  15.798  1.00 121.18 ? 383  TYR A CZ    1 
ATOM   2831  O  OH    . TYR A 1  383  ? 21.564  -73.718  15.961  1.00 124.57 ? 383  TYR A OH    1 
ATOM   2832  N  N     . ASN A 1  384  ? 15.647  -68.102  13.555  1.00 94.26  ? 384  ASN A N     1 
ATOM   2833  C  CA    . ASN A 1  384  ? 14.814  -66.890  13.597  1.00 92.13  ? 384  ASN A CA    1 
ATOM   2834  C  C     . ASN A 1  384  ? 14.388  -66.271  12.248  1.00 95.43  ? 384  ASN A C     1 
ATOM   2835  O  O     . ASN A 1  384  ? 13.315  -65.673  12.179  1.00 94.23  ? 384  ASN A O     1 
ATOM   2836  C  CB    . ASN A 1  384  ? 15.469  -65.819  14.485  1.00 88.07  ? 384  ASN A CB    1 
ATOM   2837  C  CG    . ASN A 1  384  ? 16.773  -65.232  13.969  1.00 99.33  ? 384  ASN A CG    1 
ATOM   2838  O  OD1   . ASN A 1  384  ? 17.039  -65.127  12.773  1.00 92.05  ? 384  ASN A OD1   1 
ATOM   2839  N  ND2   . ASN A 1  384  ? 17.571  -64.712  14.868  1.00 91.77  ? 384  ASN A ND2   1 
ATOM   2840  N  N     . ILE A 1  385  ? 15.251  -66.364  11.212  1.00 91.66  ? 385  ILE A N     1 
ATOM   2841  C  CA    . ILE A 1  385  ? 15.089  -65.781  9.867   1.00 90.72  ? 385  ILE A CA    1 
ATOM   2842  C  C     . ILE A 1  385  ? 13.659  -65.503  9.366   1.00 94.20  ? 385  ILE A C     1 
ATOM   2843  O  O     . ILE A 1  385  ? 13.422  -64.437  8.797   1.00 92.83  ? 385  ILE A O     1 
ATOM   2844  C  CB    . ILE A 1  385  ? 16.013  -66.440  8.808   1.00 94.15  ? 385  ILE A CB    1 
ATOM   2845  C  CG1   . ILE A 1  385  ? 16.148  -65.563  7.549   1.00 93.24  ? 385  ILE A CG1   1 
ATOM   2846  C  CG2   . ILE A 1  385  ? 15.592  -67.886  8.495   1.00 95.99  ? 385  ILE A CG2   1 
ATOM   2847  C  CD1   . ILE A 1  385  ? 17.474  -65.564  6.918   1.00 93.89  ? 385  ILE A CD1   1 
ATOM   2848  N  N     . ASP A 1  386  ? 12.719  -66.433  9.601   1.00 91.71  ? 386  ASP A N     1 
ATOM   2849  C  CA    . ASP A 1  386  ? 11.319  -66.279  9.192   1.00 91.64  ? 386  ASP A CA    1 
ATOM   2850  C  C     . ASP A 1  386  ? 10.596  -65.216  10.029  1.00 92.44  ? 386  ASP A C     1 
ATOM   2851  O  O     . ASP A 1  386  ? 9.834   -64.422  9.482   1.00 91.32  ? 386  ASP A O     1 
ATOM   2852  C  CB    . ASP A 1  386  ? 10.574  -67.629  9.231   1.00 95.25  ? 386  ASP A CB    1 
ATOM   2853  C  CG    . ASP A 1  386  ? 11.078  -68.674  8.240   1.00 111.23 ? 386  ASP A CG    1 
ATOM   2854  O  OD1   . ASP A 1  386  ? 11.466  -69.785  8.687   1.00 112.45 ? 386  ASP A OD1   1 
ATOM   2855  O  OD2   . ASP A 1  386  ? 11.044  -68.401  7.017   1.00 119.49 ? 386  ASP A OD2   1 
ATOM   2856  N  N     . ARG A 1  387  ? 10.846  -65.188  11.349  1.00 87.84  ? 387  ARG A N     1 
ATOM   2857  C  CA    . ARG A 1  387  ? 10.261  -64.182  12.239  1.00 85.85  ? 387  ARG A CA    1 
ATOM   2858  C  C     . ARG A 1  387  ? 10.921  -62.840  11.915  1.00 87.99  ? 387  ARG A C     1 
ATOM   2859  O  O     . ARG A 1  387  ? 10.213  -61.851  11.706  1.00 87.14  ? 387  ARG A O     1 
ATOM   2860  C  CB    . ARG A 1  387  ? 10.457  -64.577  13.714  1.00 84.87  ? 387  ARG A CB    1 
ATOM   2861  C  CG    . ARG A 1  387  ? 9.756   -63.657  14.727  1.00 97.63  ? 387  ARG A CG    1 
ATOM   2862  C  CD    . ARG A 1  387  ? 9.985   -64.058  16.196  1.00 109.29 ? 387  ARG A CD    1 
ATOM   2863  N  NE    . ARG A 1  387  ? 11.366  -64.481  16.470  1.00 106.26 ? 387  ARG A NE    1 
ATOM   2864  C  CZ    . ARG A 1  387  ? 12.351  -63.677  16.860  1.00 102.21 ? 387  ARG A CZ    1 
ATOM   2865  N  NH1   . ARG A 1  387  ? 12.123  -62.383  17.062  1.00 85.87  ? 387  ARG A NH1   1 
ATOM   2866  N  NH2   . ARG A 1  387  ? 13.570  -64.159  17.048  1.00 73.87  ? 387  ARG A NH2   1 
ATOM   2867  N  N     . LEU A 1  388  ? 12.267  -62.842  11.773  1.00 83.11  ? 388  LEU A N     1 
ATOM   2868  C  CA    . LEU A 1  388  ? 13.042  -61.654  11.438  1.00 81.53  ? 388  LEU A CA    1 
ATOM   2869  C  C     . LEU A 1  388  ? 12.693  -60.977  10.098  1.00 83.72  ? 388  LEU A C     1 
ATOM   2870  O  O     . LEU A 1  388  ? 12.607  -59.751  10.086  1.00 81.94  ? 388  LEU A O     1 
ATOM   2871  C  CB    . LEU A 1  388  ? 14.555  -61.824  11.681  1.00 81.93  ? 388  LEU A CB    1 
ATOM   2872  C  CG    . LEU A 1  388  ? 15.016  -61.896  13.160  1.00 85.93  ? 388  LEU A CG    1 
ATOM   2873  C  CD1   . LEU A 1  388  ? 16.512  -61.791  13.266  1.00 86.99  ? 388  LEU A CD1   1 
ATOM   2874  C  CD2   . LEU A 1  388  ? 14.419  -60.781  14.015  1.00 85.45  ? 388  LEU A CD2   1 
ATOM   2875  N  N     . THR A 1  389  ? 12.421  -61.745  8.998   1.00 80.70  ? 389  THR A N     1 
ATOM   2876  C  CA    . THR A 1  389  ? 12.004  -61.119  7.720   1.00 80.32  ? 389  THR A CA    1 
ATOM   2877  C  C     . THR A 1  389  ? 10.635  -60.487  7.894   1.00 82.77  ? 389  THR A C     1 
ATOM   2878  O  O     . THR A 1  389  ? 10.458  -59.327  7.534   1.00 81.41  ? 389  THR A O     1 
ATOM   2879  C  CB    . THR A 1  389  ? 12.030  -62.052  6.497   1.00 83.77  ? 389  THR A CB    1 
ATOM   2880  O  OG1   . THR A 1  389  ? 11.843  -63.398  6.898   1.00 85.12  ? 389  THR A OG1   1 
ATOM   2881  C  CG2   . THR A 1  389  ? 13.286  -61.902  5.652   1.00 80.73  ? 389  THR A CG2   1 
ATOM   2882  N  N     . GLN A 1  390  ? 9.702   -61.215  8.531   1.00 79.27  ? 390  GLN A N     1 
ATOM   2883  C  CA    . GLN A 1  390  ? 8.363   -60.704  8.791   1.00 78.57  ? 390  GLN A CA    1 
ATOM   2884  C  C     . GLN A 1  390  ? 8.404   -59.459  9.662   1.00 80.23  ? 390  GLN A C     1 
ATOM   2885  O  O     . GLN A 1  390  ? 7.656   -58.521  9.412   1.00 78.24  ? 390  GLN A O     1 
ATOM   2886  C  CB    . GLN A 1  390  ? 7.443   -61.792  9.376   1.00 80.45  ? 390  GLN A CB    1 
ATOM   2887  C  CG    . GLN A 1  390  ? 5.940   -61.430  9.422   1.00 108.80 ? 390  GLN A CG    1 
ATOM   2888  C  CD    . GLN A 1  390  ? 5.422   -60.553  8.284   1.00 139.43 ? 390  GLN A CD    1 
ATOM   2889  O  OE1   . GLN A 1  390  ? 5.415   -60.938  7.102   1.00 138.37 ? 390  GLN A OE1   1 
ATOM   2890  N  NE2   . GLN A 1  390  ? 4.951   -59.355  8.628   1.00 131.23 ? 390  GLN A NE2   1 
ATOM   2891  N  N     . LEU A 1  391  ? 9.306   -59.431  10.643  1.00 78.22  ? 391  LEU A N     1 
ATOM   2892  C  CA    . LEU A 1  391  ? 9.478   -58.275  11.530  1.00 78.38  ? 391  LEU A CA    1 
ATOM   2893  C  C     . LEU A 1  391  ? 10.009  -57.055  10.741  1.00 82.77  ? 391  LEU A C     1 
ATOM   2894  O  O     . LEU A 1  391  ? 9.489   -55.949  10.906  1.00 81.47  ? 391  LEU A O     1 
ATOM   2895  C  CB    . LEU A 1  391  ? 10.382  -58.629  12.743  1.00 78.41  ? 391  LEU A CB    1 
ATOM   2896  C  CG    . LEU A 1  391  ? 9.720   -59.009  14.096  1.00 82.21  ? 391  LEU A CG    1 
ATOM   2897  C  CD1   . LEU A 1  391  ? 8.544   -59.978  13.937  1.00 82.80  ? 391  LEU A CD1   1 
ATOM   2898  C  CD2   . LEU A 1  391  ? 10.724  -59.653  15.015  1.00 84.79  ? 391  LEU A CD2   1 
ATOM   2899  N  N     . VAL A 1  392  ? 10.974  -57.281  9.824   1.00 80.15  ? 392  VAL A N     1 
ATOM   2900  C  CA    . VAL A 1  392  ? 11.516  -56.232  8.958   1.00 80.26  ? 392  VAL A CA    1 
ATOM   2901  C  C     . VAL A 1  392  ? 10.375  -55.728  8.046   1.00 84.31  ? 392  VAL A C     1 
ATOM   2902  O  O     . VAL A 1  392  ? 10.276  -54.522  7.802   1.00 82.21  ? 392  VAL A O     1 
ATOM   2903  C  CB    . VAL A 1  392  ? 12.760  -56.732  8.169   1.00 85.51  ? 392  VAL A CB    1 
ATOM   2904  C  CG1   . VAL A 1  392  ? 13.210  -55.726  7.118   1.00 85.88  ? 392  VAL A CG1   1 
ATOM   2905  C  CG2   . VAL A 1  392  ? 13.918  -57.062  9.104   1.00 85.19  ? 392  VAL A CG2   1 
ATOM   2906  N  N     . ARG A 1  393  ? 9.482   -56.663  7.608   1.00 83.55  ? 393  ARG A N     1 
ATOM   2907  C  CA    . ARG A 1  393  ? 8.305   -56.373  6.773   1.00 84.20  ? 393  ARG A CA    1 
ATOM   2908  C  C     . ARG A 1  393  ? 7.329   -55.450  7.507   1.00 87.73  ? 393  ARG A C     1 
ATOM   2909  O  O     . ARG A 1  393  ? 6.973   -54.408  6.953   1.00 87.97  ? 393  ARG A O     1 
ATOM   2910  C  CB    . ARG A 1  393  ? 7.579   -57.648  6.266   1.00 85.97  ? 393  ARG A CB    1 
ATOM   2911  C  CG    . ARG A 1  393  ? 8.385   -58.573  5.350   1.00 102.92 ? 393  ARG A CG    1 
ATOM   2912  C  CD    . ARG A 1  393  ? 8.639   -58.046  3.949   1.00 123.66 ? 393  ARG A CD    1 
ATOM   2913  N  NE    . ARG A 1  393  ? 9.743   -58.767  3.307   1.00 142.79 ? 393  ARG A NE    1 
ATOM   2914  C  CZ    . ARG A 1  393  ? 10.001  -58.752  2.002   1.00 163.64 ? 393  ARG A CZ    1 
ATOM   2915  N  NH1   . ARG A 1  393  ? 9.230   -58.058  1.171   1.00 152.37 ? 393  ARG A NH1   1 
ATOM   2916  N  NH2   . ARG A 1  393  ? 11.022  -59.444  1.514   1.00 153.54 ? 393  ARG A NH2   1 
ATOM   2917  N  N     . ASN A 1  394  ? 6.942   -55.790  8.764   1.00 82.80  ? 394  ASN A N     1 
ATOM   2918  C  CA    . ASN A 1  394  ? 6.056   -54.953  9.581   1.00 81.48  ? 394  ASN A CA    1 
ATOM   2919  C  C     . ASN A 1  394  ? 6.585   -53.520  9.710   1.00 85.93  ? 394  ASN A C     1 
ATOM   2920  O  O     . ASN A 1  394  ? 5.798   -52.578  9.835   1.00 85.87  ? 394  ASN A O     1 
ATOM   2921  C  CB    . ASN A 1  394  ? 5.822   -55.570  10.949  1.00 80.09  ? 394  ASN A CB    1 
ATOM   2922  C  CG    . ASN A 1  394  ? 4.953   -56.787  10.893  1.00 108.88 ? 394  ASN A CG    1 
ATOM   2923  O  OD1   . ASN A 1  394  ? 5.380   -57.895  11.213  1.00 111.59 ? 394  ASN A OD1   1 
ATOM   2924  N  ND2   . ASN A 1  394  ? 3.713   -56.620  10.465  1.00 99.25  ? 394  ASN A ND2   1 
ATOM   2925  N  N     . GLY A 1  395  ? 7.906   -53.372  9.636   1.00 82.10  ? 395  GLY A N     1 
ATOM   2926  C  CA    . GLY A 1  395  ? 8.561   -52.078  9.670   1.00 81.42  ? 395  GLY A CA    1 
ATOM   2927  C  C     . GLY A 1  395  ? 8.478   -51.364  10.998  1.00 85.42  ? 395  GLY A C     1 
ATOM   2928  O  O     . GLY A 1  395  ? 8.072   -51.955  12.008  1.00 84.65  ? 395  GLY A O     1 
ATOM   2929  N  N     . PRO A 1  396  ? 8.858   -50.065  11.009  1.00 82.12  ? 396  PRO A N     1 
ATOM   2930  C  CA    . PRO A 1  396  ? 8.933   -49.330  12.278  1.00 80.71  ? 396  PRO A CA    1 
ATOM   2931  C  C     . PRO A 1  396  ? 7.647   -48.803  12.880  1.00 83.35  ? 396  PRO A C     1 
ATOM   2932  O  O     . PRO A 1  396  ? 7.712   -48.257  13.985  1.00 81.29  ? 396  PRO A O     1 
ATOM   2933  C  CB    . PRO A 1  396  ? 9.950   -48.218  11.991  1.00 82.46  ? 396  PRO A CB    1 
ATOM   2934  C  CG    . PRO A 1  396  ? 10.470  -48.479  10.596  1.00 87.74  ? 396  PRO A CG    1 
ATOM   2935  C  CD    . PRO A 1  396  ? 9.412   -49.255  9.910   1.00 83.80  ? 396  PRO A CD    1 
ATOM   2936  N  N     . ASN A 1  397  ? 6.496   -48.952  12.201  1.00 81.78  ? 397  ASN A N     1 
ATOM   2937  C  CA    . ASN A 1  397  ? 5.268   -48.444  12.804  1.00 82.02  ? 397  ASN A CA    1 
ATOM   2938  C  C     . ASN A 1  397  ? 4.195   -49.453  13.184  1.00 87.59  ? 397  ASN A C     1 
ATOM   2939  O  O     . ASN A 1  397  ? 3.391   -49.168  14.071  1.00 87.74  ? 397  ASN A O     1 
ATOM   2940  C  CB    . ASN A 1  397  ? 4.724   -47.170  12.160  1.00 84.99  ? 397  ASN A CB    1 
ATOM   2941  C  CG    . ASN A 1  397  ? 4.230   -46.202  13.227  1.00 124.97 ? 397  ASN A CG    1 
ATOM   2942  O  OD1   . ASN A 1  397  ? 5.020   -45.520  13.897  1.00 121.66 ? 397  ASN A OD1   1 
ATOM   2943  N  ND2   . ASN A 1  397  ? 2.924   -46.203  13.497  1.00 120.10 ? 397  ASN A ND2   1 
ATOM   2944  N  N     . GLU A 1  398  ? 4.183   -50.632  12.563  1.00 85.29  ? 398  GLU A N     1 
ATOM   2945  C  CA    . GLU A 1  398  ? 3.242   -51.684  12.968  1.00 85.56  ? 398  GLU A CA    1 
ATOM   2946  C  C     . GLU A 1  398  ? 3.989   -52.344  14.158  1.00 87.14  ? 398  GLU A C     1 
ATOM   2947  O  O     . GLU A 1  398  ? 5.223   -52.413  14.059  1.00 86.40  ? 398  GLU A O     1 
ATOM   2948  C  CB    . GLU A 1  398  ? 2.995   -52.669  11.797  1.00 88.25  ? 398  GLU A CB    1 
ATOM   2949  C  CG    . GLU A 1  398  ? 1.528   -52.855  11.426  1.00 101.11 ? 398  GLU A CG    1 
ATOM   2950  C  CD    . GLU A 1  398  ? 0.935   -54.214  11.763  1.00 134.06 ? 398  GLU A CD    1 
ATOM   2951  O  OE1   . GLU A 1  398  ? 1.394   -55.226  11.184  1.00 139.90 ? 398  GLU A OE1   1 
ATOM   2952  O  OE2   . GLU A 1  398  ? -0.012  -54.264  12.583  1.00 129.56 ? 398  GLU A OE2   1 
ATOM   2953  N  N     . HIS A 1  399  ? 3.307   -52.737  15.295  1.00 81.80  ? 399  HIS A N     1 
ATOM   2954  C  CA    . HIS A 1  399  ? 4.114   -53.241  16.414  1.00 81.30  ? 399  HIS A CA    1 
ATOM   2955  C  C     . HIS A 1  399  ? 5.114   -54.349  16.155  1.00 86.56  ? 399  HIS A C     1 
ATOM   2956  O  O     . HIS A 1  399  ? 6.287   -53.956  16.087  1.00 88.98  ? 399  HIS A O     1 
ATOM   2957  C  CB    . HIS A 1  399  ? 3.495   -53.364  17.836  1.00 80.95  ? 399  HIS A CB    1 
ATOM   2958  C  CG    . HIS A 1  399  ? 4.472   -54.002  18.815  1.00 83.33  ? 399  HIS A CG    1 
ATOM   2959  N  ND1   . HIS A 1  399  ? 5.696   -53.403  19.118  1.00 84.33  ? 399  HIS A ND1   1 
ATOM   2960  C  CD2   . HIS A 1  399  ? 4.443   -55.224  19.399  1.00 84.20  ? 399  HIS A CD2   1 
ATOM   2961  C  CE1   . HIS A 1  399  ? 6.338   -54.261  19.896  1.00 83.21  ? 399  HIS A CE1   1 
ATOM   2962  N  NE2   . HIS A 1  399  ? 5.627   -55.365  20.098  1.00 83.69  ? 399  HIS A NE2   1 
ATOM   2963  N  N     . PRO A 1  400  ? 4.814   -55.684  16.181  1.00 78.45  ? 400  PRO A N     1 
ATOM   2964  C  CA    . PRO A 1  400  ? 5.927   -56.659  16.070  1.00 77.34  ? 400  PRO A CA    1 
ATOM   2965  C  C     . PRO A 1  400  ? 6.729   -56.473  14.775  1.00 81.74  ? 400  PRO A C     1 
ATOM   2966  O  O     . PRO A 1  400  ? 6.571   -57.202  13.799  1.00 83.94  ? 400  PRO A O     1 
ATOM   2967  C  CB    . PRO A 1  400  ? 5.260   -58.018  16.281  1.00 78.93  ? 400  PRO A CB    1 
ATOM   2968  C  CG    . PRO A 1  400  ? 3.899   -57.695  16.857  1.00 82.82  ? 400  PRO A CG    1 
ATOM   2969  C  CD    . PRO A 1  400  ? 3.509   -56.359  16.320  1.00 78.26  ? 400  PRO A CD    1 
ATOM   2970  N  N     . GLY A 1  401  ? 7.533   -55.408  14.782  1.00 75.54  ? 401  GLY A N     1 
ATOM   2971  C  CA    . GLY A 1  401  ? 8.343   -54.945  13.671  1.00 74.60  ? 401  GLY A CA    1 
ATOM   2972  C  C     . GLY A 1  401  ? 9.733   -54.547  14.085  1.00 75.15  ? 401  GLY A C     1 
ATOM   2973  O  O     . GLY A 1  401  ? 10.182  -54.875  15.183  1.00 73.38  ? 401  GLY A O     1 
ATOM   2974  N  N     . ALA A 1  402  ? 10.432  -53.856  13.196  1.00 71.56  ? 402  ALA A N     1 
ATOM   2975  C  CA    . ALA A 1  402  ? 11.811  -53.444  13.439  1.00 70.96  ? 402  ALA A CA    1 
ATOM   2976  C  C     . ALA A 1  402  ? 12.160  -52.079  12.839  1.00 73.10  ? 402  ALA A C     1 
ATOM   2977  O  O     . ALA A 1  402  ? 11.484  -51.598  11.919  1.00 72.74  ? 402  ALA A O     1 
ATOM   2978  C  CB    . ALA A 1  402  ? 12.785  -54.519  12.971  1.00 72.60  ? 402  ALA A CB    1 
ATOM   2979  N  N     . LYS A 1  403  ? 13.247  -51.486  13.365  1.00 67.74  ? 403  LYS A N     1 
ATOM   2980  C  CA    . LYS A 1  403  ? 13.705  -50.148  13.051  1.00 66.77  ? 403  LYS A CA    1 
ATOM   2981  C  C     . LYS A 1  403  ? 14.930  -50.054  12.141  1.00 70.34  ? 403  LYS A C     1 
ATOM   2982  O  O     . LYS A 1  403  ? 15.011  -49.098  11.355  1.00 69.62  ? 403  LYS A O     1 
ATOM   2983  C  CB    . LYS A 1  403  ? 13.876  -49.351  14.356  1.00 68.00  ? 403  LYS A CB    1 
ATOM   2984  C  CG    . LYS A 1  403  ? 12.569  -49.224  15.177  1.00 73.57  ? 403  LYS A CG    1 
ATOM   2985  C  CD    . LYS A 1  403  ? 12.337  -47.818  15.748  1.00 77.94  ? 403  LYS A CD    1 
ATOM   2986  C  CE    . LYS A 1  403  ? 13.440  -47.346  16.676  1.00 78.11  ? 403  LYS A CE    1 
ATOM   2987  N  NZ    . LYS A 1  403  ? 13.066  -46.109  17.415  1.00 85.10  ? 403  LYS A NZ    1 
ATOM   2988  N  N     . TYR A 1  404  ? 15.867  -51.032  12.236  1.00 67.24  ? 404  TYR A N     1 
ATOM   2989  C  CA    . TYR A 1  404  ? 17.104  -51.069  11.446  1.00 68.70  ? 404  TYR A CA    1 
ATOM   2990  C  C     . TYR A 1  404  ? 17.572  -52.479  11.082  1.00 72.32  ? 404  TYR A C     1 
ATOM   2991  O  O     . TYR A 1  404  ? 17.390  -53.410  11.868  1.00 71.83  ? 404  TYR A O     1 
ATOM   2992  C  CB    . TYR A 1  404  ? 18.246  -50.415  12.232  1.00 71.12  ? 404  TYR A CB    1 
ATOM   2993  C  CG    . TYR A 1  404  ? 18.119  -48.929  12.430  1.00 74.72  ? 404  TYR A CG    1 
ATOM   2994  C  CD1   . TYR A 1  404  ? 17.369  -48.409  13.481  1.00 75.96  ? 404  TYR A CD1   1 
ATOM   2995  C  CD2   . TYR A 1  404  ? 18.807  -48.040  11.617  1.00 77.69  ? 404  TYR A CD2   1 
ATOM   2996  C  CE1   . TYR A 1  404  ? 17.248  -47.033  13.675  1.00 77.81  ? 404  TYR A CE1   1 
ATOM   2997  C  CE2   . TYR A 1  404  ? 18.709  -46.660  11.808  1.00 79.44  ? 404  TYR A CE2   1 
ATOM   2998  C  CZ    . TYR A 1  404  ? 17.937  -46.158  12.848  1.00 89.26  ? 404  TYR A CZ    1 
ATOM   2999  O  OH    . TYR A 1  404  ? 17.843  -44.794  13.038  1.00 92.72  ? 404  TYR A OH    1 
ATOM   3000  N  N     . VAL A 1  405  ? 18.249  -52.613  9.924   1.00 69.21  ? 405  VAL A N     1 
ATOM   3001  C  CA    . VAL A 1  405  ? 18.886  -53.862  9.469   1.00 69.97  ? 405  VAL A CA    1 
ATOM   3002  C  C     . VAL A 1  405  ? 20.394  -53.557  9.329   1.00 77.63  ? 405  VAL A C     1 
ATOM   3003  O  O     . VAL A 1  405  ? 20.788  -52.698  8.537   1.00 78.23  ? 405  VAL A O     1 
ATOM   3004  C  CB    . VAL A 1  405  ? 18.289  -54.551  8.183   1.00 72.65  ? 405  VAL A CB    1 
ATOM   3005  C  CG1   . VAL A 1  405  ? 19.019  -55.845  7.884   1.00 72.81  ? 405  VAL A CG1   1 
ATOM   3006  C  CG2   . VAL A 1  405  ? 16.793  -54.830  8.309   1.00 71.41  ? 405  VAL A CG2   1 
ATOM   3007  N  N     . ILE A 1  406  ? 21.224  -54.223  10.127  1.00 75.88  ? 406  ILE A N     1 
ATOM   3008  C  CA    . ILE A 1  406  ? 22.666  -54.018  10.069  1.00 76.83  ? 406  ILE A CA    1 
ATOM   3009  C  C     . ILE A 1  406  ? 23.294  -55.221  9.413   1.00 86.78  ? 406  ILE A C     1 
ATOM   3010  O  O     . ILE A 1  406  ? 22.865  -56.345  9.658   1.00 85.14  ? 406  ILE A O     1 
ATOM   3011  C  CB    . ILE A 1  406  ? 23.272  -53.661  11.432  1.00 78.36  ? 406  ILE A CB    1 
ATOM   3012  C  CG1   . ILE A 1  406  ? 22.272  -52.819  12.271  1.00 77.23  ? 406  ILE A CG1   1 
ATOM   3013  C  CG2   . ILE A 1  406  ? 24.579  -52.917  11.212  1.00 78.83  ? 406  ILE A CG2   1 
ATOM   3014  C  CD1   . ILE A 1  406  ? 22.561  -52.679  13.764  1.00 87.03  ? 406  ILE A CD1   1 
ATOM   3015  N  N     . ARG A 1  407  ? 24.246  -54.980  8.507   1.00 90.70  ? 407  ARG A N     1 
ATOM   3016  C  CA    . ARG A 1  407  ? 24.881  -56.035  7.707   1.00 95.01  ? 407  ARG A CA    1 
ATOM   3017  C  C     . ARG A 1  407  ? 26.402  -56.003  7.800   1.00 107.04 ? 407  ARG A C     1 
ATOM   3018  O  O     . ARG A 1  407  ? 26.962  -55.432  8.743   1.00 105.98 ? 407  ARG A O     1 
ATOM   3019  C  CB    . ARG A 1  407  ? 24.500  -55.895  6.207   1.00 95.31  ? 407  ARG A CB    1 
ATOM   3020  C  CG    . ARG A 1  407  ? 23.230  -55.122  5.867   1.00 100.42 ? 407  ARG A CG    1 
ATOM   3021  C  CD    . ARG A 1  407  ? 23.545  -53.920  5.014   1.00 102.75 ? 407  ARG A CD    1 
ATOM   3022  N  NE    . ARG A 1  407  ? 23.949  -54.298  3.663   1.00 105.73 ? 407  ARG A NE    1 
ATOM   3023  C  CZ    . ARG A 1  407  ? 24.243  -53.428  2.704   1.00 116.87 ? 407  ARG A CZ    1 
ATOM   3024  N  NH1   . ARG A 1  407  ? 24.166  -52.122  2.935   1.00 100.99 ? 407  ARG A NH1   1 
ATOM   3025  N  NH2   . ARG A 1  407  ? 24.612  -53.857  1.503   1.00 101.52 ? 407  ARG A NH2   1 
ATOM   3026  N  N     . ASP A 1  408  ? 27.060  -56.601  6.764   1.00 110.38 ? 408  ASP A N     1 
ATOM   3027  C  CA    . ASP A 1  408  ? 28.501  -56.625  6.500   1.00 113.74 ? 408  ASP A CA    1 
ATOM   3028  C  C     . ASP A 1  408  ? 29.022  -55.189  6.623   1.00 120.16 ? 408  ASP A C     1 
ATOM   3029  O  O     . ASP A 1  408  ? 28.276  -54.240  6.331   1.00 119.11 ? 408  ASP A O     1 
ATOM   3030  C  CB    . ASP A 1  408  ? 28.762  -57.158  5.074   1.00 117.85 ? 408  ASP A CB    1 
ATOM   3031  C  CG    . ASP A 1  408  ? 28.292  -56.234  3.952   1.00 133.05 ? 408  ASP A CG    1 
ATOM   3032  O  OD1   . ASP A 1  408  ? 27.073  -56.234  3.646   1.00 133.18 ? 408  ASP A OD1   1 
ATOM   3033  O  OD2   . ASP A 1  408  ? 29.137  -55.493  3.400   1.00 141.73 ? 408  ASP A OD2   1 
ATOM   3034  N  N     . SER A 1  409  ? 30.279  -55.032  7.080   1.00 119.25 ? 409  SER A N     1 
ATOM   3035  C  CA    . SER A 1  409  ? 30.932  -53.743  7.381   1.00 119.98 ? 409  SER A CA    1 
ATOM   3036  C  C     . SER A 1  409  ? 30.366  -53.171  8.705   1.00 122.79 ? 409  SER A C     1 
ATOM   3037  O  O     . SER A 1  409  ? 31.130  -52.874  9.637   1.00 122.70 ? 409  SER A O     1 
ATOM   3038  C  CB    . SER A 1  409  ? 30.814  -52.739  6.228   1.00 124.87 ? 409  SER A CB    1 
ATOM   3039  O  OG    . SER A 1  409  ? 29.553  -52.085  6.178   1.00 134.44 ? 409  SER A OG    1 
ATOM   3040  N  N     . GLY A 1  410  ? 29.034  -53.083  8.771   1.00 117.18 ? 410  GLY A N     1 
ATOM   3041  C  CA    . GLY A 1  410  ? 28.285  -52.589  9.915   1.00 114.98 ? 410  GLY A CA    1 
ATOM   3042  C  C     . GLY A 1  410  ? 27.396  -51.420  9.558   1.00 116.97 ? 410  GLY A C     1 
ATOM   3043  O  O     . GLY A 1  410  ? 27.137  -50.569  10.415  1.00 115.80 ? 410  GLY A O     1 
ATOM   3044  N  N     . ASP A 1  411  ? 26.907  -51.375  8.290   1.00 112.51 ? 411  ASP A N     1 
ATOM   3045  C  CA    . ASP A 1  411  ? 26.038  -50.297  7.809   1.00 110.50 ? 411  ASP A CA    1 
ATOM   3046  C  C     . ASP A 1  411  ? 24.577  -50.444  8.249   1.00 107.31 ? 411  ASP A C     1 
ATOM   3047  O  O     . ASP A 1  411  ? 23.981  -51.517  8.097   1.00 106.87 ? 411  ASP A O     1 
ATOM   3048  C  CB    . ASP A 1  411  ? 26.142  -50.113  6.283   1.00 114.16 ? 411  ASP A CB    1 
ATOM   3049  C  CG    . ASP A 1  411  ? 25.340  -48.923  5.765   1.00 131.49 ? 411  ASP A CG    1 
ATOM   3050  O  OD1   . ASP A 1  411  ? 25.604  -47.776  6.222   1.00 132.37 ? 411  ASP A OD1   1 
ATOM   3051  O  OD2   . ASP A 1  411  ? 24.422  -49.140  4.932   1.00 139.21 ? 411  ASP A OD2   1 
ATOM   3052  N  N     . ARG A 1  412  ? 24.003  -49.345  8.767   1.00 98.15  ? 412  ARG A N     1 
ATOM   3053  C  CA    . ARG A 1  412  ? 22.616  -49.305  9.208   1.00 94.76  ? 412  ARG A CA    1 
ATOM   3054  C  C     . ARG A 1  412  ? 21.660  -48.845  8.107   1.00 93.70  ? 412  ARG A C     1 
ATOM   3055  O  O     . ARG A 1  412  ? 21.753  -47.717  7.610   1.00 92.79  ? 412  ARG A O     1 
ATOM   3056  C  CB    . ARG A 1  412  ? 22.453  -48.457  10.480  1.00 94.07  ? 412  ARG A CB    1 
ATOM   3057  C  CG    . ARG A 1  412  ? 22.913  -49.165  11.751  1.00 101.05 ? 412  ARG A CG    1 
ATOM   3058  C  CD    . ARG A 1  412  ? 22.619  -48.378  13.010  1.00 102.90 ? 412  ARG A CD    1 
ATOM   3059  N  NE    . ARG A 1  412  ? 22.806  -49.195  14.211  1.00 116.64 ? 412  ARG A NE    1 
ATOM   3060  C  CZ    . ARG A 1  412  ? 23.944  -49.297  14.897  1.00 138.59 ? 412  ARG A CZ    1 
ATOM   3061  N  NH1   . ARG A 1  412  ? 25.028  -48.636  14.503  1.00 130.19 ? 412  ARG A NH1   1 
ATOM   3062  N  NH2   . ARG A 1  412  ? 24.010  -50.067  15.975  1.00 126.09 ? 412  ARG A NH2   1 
ATOM   3063  N  N     . ILE A 1  413  ? 20.768  -49.758  7.702   1.00 86.84  ? 413  ILE A N     1 
ATOM   3064  C  CA    . ILE A 1  413  ? 19.691  -49.522  6.746   1.00 84.75  ? 413  ILE A CA    1 
ATOM   3065  C  C     . ILE A 1  413  ? 18.551  -49.000  7.627   1.00 89.00  ? 413  ILE A C     1 
ATOM   3066  O  O     . ILE A 1  413  ? 18.134  -49.705  8.560   1.00 88.77  ? 413  ILE A O     1 
ATOM   3067  C  CB    . ILE A 1  413  ? 19.273  -50.841  6.045   1.00 86.62  ? 413  ILE A CB    1 
ATOM   3068  C  CG1   . ILE A 1  413  ? 20.345  -51.323  5.063   1.00 87.64  ? 413  ILE A CG1   1 
ATOM   3069  C  CG2   . ILE A 1  413  ? 17.892  -50.715  5.392   1.00 85.04  ? 413  ILE A CG2   1 
ATOM   3070  C  CD1   . ILE A 1  413  ? 20.210  -52.782  4.654   1.00 92.38  ? 413  ILE A CD1   1 
ATOM   3071  N  N     . ASP A 1  414  ? 18.071  -47.772  7.376   1.00 84.56  ? 414  ASP A N     1 
ATOM   3072  C  CA    . ASP A 1  414  ? 16.989  -47.250  8.206   1.00 82.73  ? 414  ASP A CA    1 
ATOM   3073  C  C     . ASP A 1  414  ? 15.664  -47.587  7.587   1.00 83.48  ? 414  ASP A C     1 
ATOM   3074  O  O     . ASP A 1  414  ? 15.255  -46.957  6.613   1.00 83.60  ? 414  ASP A O     1 
ATOM   3075  C  CB    . ASP A 1  414  ? 17.126  -45.739  8.483   1.00 84.87  ? 414  ASP A CB    1 
ATOM   3076  C  CG    . ASP A 1  414  ? 16.141  -45.162  9.498   1.00 97.60  ? 414  ASP A CG    1 
ATOM   3077  O  OD1   . ASP A 1  414  ? 15.322  -45.944  10.056  1.00 98.49  ? 414  ASP A OD1   1 
ATOM   3078  O  OD2   . ASP A 1  414  ? 16.203  -43.934  9.755   1.00 103.18 ? 414  ASP A OD2   1 
ATOM   3079  N  N     . LEU A 1  415  ? 14.973  -48.554  8.184   1.00 77.30  ? 415  LEU A N     1 
ATOM   3080  C  CA    . LEU A 1  415  ? 13.666  -48.994  7.716   1.00 76.23  ? 415  LEU A CA    1 
ATOM   3081  C  C     . LEU A 1  415  ? 12.562  -47.895  7.602   1.00 77.98  ? 415  LEU A C     1 
ATOM   3082  O  O     . LEU A 1  415  ? 11.610  -48.076  6.849   1.00 77.28  ? 415  LEU A O     1 
ATOM   3083  C  CB    . LEU A 1  415  ? 13.178  -50.197  8.534   1.00 75.67  ? 415  LEU A CB    1 
ATOM   3084  C  CG    . LEU A 1  415  ? 13.886  -51.529  8.303   1.00 80.58  ? 415  LEU A CG    1 
ATOM   3085  C  CD1   . LEU A 1  415  ? 13.222  -52.608  9.122   1.00 79.85  ? 415  LEU A CD1   1 
ATOM   3086  C  CD2   . LEU A 1  415  ? 13.895  -51.929  6.802   1.00 83.60  ? 415  LEU A CD2   1 
ATOM   3087  N  N     . ARG A 1  416  ? 12.684  -46.775  8.319   1.00 73.20  ? 416  ARG A N     1 
ATOM   3088  C  CA    . ARG A 1  416  ? 11.653  -45.753  8.212   1.00 72.35  ? 416  ARG A CA    1 
ATOM   3089  C  C     . ARG A 1  416  ? 11.790  -44.898  6.954   1.00 78.07  ? 416  ARG A C     1 
ATOM   3090  O  O     . ARG A 1  416  ? 10.802  -44.294  6.521   1.00 78.20  ? 416  ARG A O     1 
ATOM   3091  C  CB    . ARG A 1  416  ? 11.435  -44.944  9.523   1.00 69.97  ? 416  ARG A CB    1 
ATOM   3092  C  CG    . ARG A 1  416  ? 12.608  -44.119  9.994   1.00 80.04  ? 416  ARG A CG    1 
ATOM   3093  C  CD    . ARG A 1  416  ? 12.435  -43.669  11.434  1.00 103.31 ? 416  ARG A CD    1 
ATOM   3094  N  NE    . ARG A 1  416  ? 13.141  -42.407  11.703  1.00 122.25 ? 416  ARG A NE    1 
ATOM   3095  C  CZ    . ARG A 1  416  ? 14.340  -42.310  12.276  1.00 135.40 ? 416  ARG A CZ    1 
ATOM   3096  N  NH1   . ARG A 1  416  ? 14.983  -43.400  12.679  1.00 121.34 ? 416  ARG A NH1   1 
ATOM   3097  N  NH2   . ARG A 1  416  ? 14.900  -41.120  12.460  1.00 119.18 ? 416  ARG A NH2   1 
ATOM   3098  N  N     . TYR A 1  417  ? 12.988  -44.876  6.339   1.00 75.16  ? 417  TYR A N     1 
ATOM   3099  C  CA    . TYR A 1  417  ? 13.200  -44.071  5.138   1.00 75.67  ? 417  TYR A CA    1 
ATOM   3100  C  C     . TYR A 1  417  ? 13.626  -44.846  3.916   1.00 79.14  ? 417  TYR A C     1 
ATOM   3101  O  O     . TYR A 1  417  ? 13.057  -44.603  2.860   1.00 80.46  ? 417  TYR A O     1 
ATOM   3102  C  CB    . TYR A 1  417  ? 14.111  -42.857  5.398   1.00 77.84  ? 417  TYR A CB    1 
ATOM   3103  C  CG    . TYR A 1  417  ? 13.621  -41.975  6.531   1.00 80.44  ? 417  TYR A CG    1 
ATOM   3104  C  CD1   . TYR A 1  417  ? 14.429  -41.708  7.634   1.00 82.37  ? 417  TYR A CD1   1 
ATOM   3105  C  CD2   . TYR A 1  417  ? 12.333  -41.446  6.524   1.00 81.35  ? 417  TYR A CD2   1 
ATOM   3106  C  CE1   . TYR A 1  417  ? 13.975  -40.915  8.689   1.00 83.03  ? 417  TYR A CE1   1 
ATOM   3107  C  CE2   . TYR A 1  417  ? 11.861  -40.670  7.583   1.00 81.74  ? 417  TYR A CE2   1 
ATOM   3108  C  CZ    . TYR A 1  417  ? 12.686  -40.401  8.661   1.00 89.68  ? 417  TYR A CZ    1 
ATOM   3109  O  OH    . TYR A 1  417  ? 12.204  -39.642  9.701   1.00 90.95  ? 417  TYR A OH    1 
ATOM   3110  N  N     . SER A 1  418  ? 14.590  -45.787  4.049   1.00 73.69  ? 418  SER A N     1 
ATOM   3111  C  CA    . SER A 1  418  ? 15.147  -46.628  2.974   1.00 73.22  ? 418  SER A CA    1 
ATOM   3112  C  C     . SER A 1  418  ? 14.150  -46.989  1.910   1.00 76.17  ? 418  SER A C     1 
ATOM   3113  O  O     . SER A 1  418  ? 13.037  -47.404  2.244   1.00 76.53  ? 418  SER A O     1 
ATOM   3114  C  CB    . SER A 1  418  ? 15.723  -47.918  3.537   1.00 75.71  ? 418  SER A CB    1 
ATOM   3115  O  OG    . SER A 1  418  ? 16.241  -48.688  2.466   1.00 83.49  ? 418  SER A OG    1 
ATOM   3116  N  N     . LYS A 1  419  ? 14.552  -46.861  0.631   1.00 71.11  ? 419  LYS A N     1 
ATOM   3117  C  CA    . LYS A 1  419  ? 13.683  -47.180  -0.505  1.00 70.40  ? 419  LYS A CA    1 
ATOM   3118  C  C     . LYS A 1  419  ? 13.476  -48.677  -0.614  1.00 78.35  ? 419  LYS A C     1 
ATOM   3119  O  O     . LYS A 1  419  ? 12.445  -49.117  -1.117  1.00 78.28  ? 419  LYS A O     1 
ATOM   3120  C  CB    . LYS A 1  419  ? 14.238  -46.610  -1.814  1.00 71.08  ? 419  LYS A CB    1 
ATOM   3121  C  CG    . LYS A 1  419  ? 15.583  -47.191  -2.228  1.00 60.13  ? 419  LYS A CG    1 
ATOM   3122  C  CD    . LYS A 1  419  ? 16.153  -46.562  -3.476  1.00 54.41  ? 419  LYS A CD    1 
ATOM   3123  C  CE    . LYS A 1  419  ? 16.747  -45.196  -3.255  1.00 63.62  ? 419  LYS A CE    1 
ATOM   3124  N  NZ    . LYS A 1  419  ? 18.212  -45.228  -3.008  1.00 77.64  ? 419  LYS A NZ    1 
ATOM   3125  N  N     . ARG A 1  420  ? 14.449  -49.460  -0.113  1.00 77.56  ? 420  ARG A N     1 
ATOM   3126  C  CA    . ARG A 1  420  ? 14.400  -50.919  -0.119  1.00 78.35  ? 420  ARG A CA    1 
ATOM   3127  C  C     . ARG A 1  420  ? 13.788  -51.478  1.178   1.00 83.16  ? 420  ARG A C     1 
ATOM   3128  O  O     . ARG A 1  420  ? 13.867  -52.682  1.388   1.00 83.67  ? 420  ARG A O     1 
ATOM   3129  C  CB    . ARG A 1  420  ? 15.809  -51.513  -0.292  1.00 77.50  ? 420  ARG A CB    1 
ATOM   3130  C  CG    . ARG A 1  420  ? 16.686  -50.892  -1.360  1.00 78.27  ? 420  ARG A CG    1 
ATOM   3131  C  CD    . ARG A 1  420  ? 16.674  -51.691  -2.630  1.00 81.90  ? 420  ARG A CD    1 
ATOM   3132  N  NE    . ARG A 1  420  ? 16.945  -53.117  -2.434  1.00 82.34  ? 420  ARG A NE    1 
ATOM   3133  C  CZ    . ARG A 1  420  ? 18.137  -53.684  -2.565  1.00 99.35  ? 420  ARG A CZ    1 
ATOM   3134  N  NH1   . ARG A 1  420  ? 19.208  -52.945  -2.821  1.00 81.62  ? 420  ARG A NH1   1 
ATOM   3135  N  NH2   . ARG A 1  420  ? 18.276  -54.992  -2.405  1.00 98.56  ? 420  ARG A NH2   1 
ATOM   3136  N  N     . ALA A 1  421  ? 13.179  -50.638  2.039   1.00 79.91  ? 421  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1  421  ? 12.564  -51.081  3.302   1.00 80.14  ? 421  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1  421  ? 11.581  -52.268  3.164   1.00 86.53  ? 421  ALA A C     1 
ATOM   3139  O  O     . ALA A 1  421  ? 11.459  -53.081  4.093   1.00 86.04  ? 421  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1  421  ? 11.893  -49.913  4.007   1.00 79.83  ? 421  ALA A CB    1 
ATOM   3141  N  N     . GLY A 1  422  ? 10.909  -52.341  2.014   1.00 84.65  ? 422  GLY A N     1 
ATOM   3142  C  CA    . GLY A 1  422  ? 9.971   -53.404  1.680   1.00 85.60  ? 422  GLY A CA    1 
ATOM   3143  C  C     . GLY A 1  422  ? 10.609  -54.489  0.840   1.00 93.06  ? 422  GLY A C     1 
ATOM   3144  O  O     . GLY A 1  422  ? 9.997   -55.535  0.617   1.00 93.02  ? 422  GLY A O     1 
ATOM   3145  N  N     . ASP A 1  423  ? 11.847  -54.238  0.363   1.00 92.05  ? 423  ASP A N     1 
ATOM   3146  C  CA    . ASP A 1  423  ? 12.639  -55.155  -0.449  1.00 93.58  ? 423  ASP A CA    1 
ATOM   3147  C  C     . ASP A 1  423  ? 13.431  -56.127  0.418   1.00 96.66  ? 423  ASP A C     1 
ATOM   3148  O  O     . ASP A 1  423  ? 13.243  -57.319  0.247   1.00 97.30  ? 423  ASP A O     1 
ATOM   3149  C  CB    . ASP A 1  423  ? 13.563  -54.382  -1.409  1.00 97.08  ? 423  ASP A CB    1 
ATOM   3150  C  CG    . ASP A 1  423  ? 14.571  -55.239  -2.157  1.00 116.24 ? 423  ASP A CG    1 
ATOM   3151  O  OD1   . ASP A 1  423  ? 14.559  -55.209  -3.410  1.00 118.91 ? 423  ASP A OD1   1 
ATOM   3152  O  OD2   . ASP A 1  423  ? 15.416  -55.891  -1.489  1.00 123.12 ? 423  ASP A OD2   1 
ATOM   3153  N  N     . ILE A 1  424  ? 14.345  -55.622  1.282   1.00 92.38  ? 424  ILE A N     1 
ATOM   3154  C  CA    . ILE A 1  424  ? 15.251  -56.341  2.213   1.00 92.64  ? 424  ILE A CA    1 
ATOM   3155  C  C     . ILE A 1  424  ? 15.294  -57.866  2.112   1.00 98.76  ? 424  ILE A C     1 
ATOM   3156  O  O     . ILE A 1  424  ? 14.349  -58.549  2.528   1.00 98.48  ? 424  ILE A O     1 
ATOM   3157  C  CB    . ILE A 1  424  ? 15.171  -55.905  3.723   1.00 94.42  ? 424  ILE A CB    1 
ATOM   3158  C  CG1   . ILE A 1  424  ? 14.781  -54.427  3.955   1.00 94.44  ? 424  ILE A CG1   1 
ATOM   3159  C  CG2   . ILE A 1  424  ? 16.428  -56.321  4.520   1.00 94.29  ? 424  ILE A CG2   1 
ATOM   3160  C  CD1   . ILE A 1  424  ? 15.897  -53.403  3.913   1.00 105.02 ? 424  ILE A CD1   1 
ATOM   3161  N  N     . GLN A 1  425  ? 16.433  -58.393  1.647   1.00 96.71  ? 425  GLN A N     1 
ATOM   3162  C  CA    . GLN A 1  425  ? 16.673  -59.831  1.538   1.00 97.59  ? 425  GLN A CA    1 
ATOM   3163  C  C     . GLN A 1  425  ? 17.729  -60.186  2.562   1.00 98.64  ? 425  GLN A C     1 
ATOM   3164  O  O     . GLN A 1  425  ? 18.925  -60.034  2.299   1.00 98.74  ? 425  GLN A O     1 
ATOM   3165  C  CB    . GLN A 1  425  ? 17.036  -60.270  0.087   1.00 101.30 ? 425  GLN A CB    1 
ATOM   3166  C  CG    . GLN A 1  425  ? 18.148  -59.463  -0.633  1.00 131.87 ? 425  GLN A CG    1 
ATOM   3167  C  CD    . GLN A 1  425  ? 17.739  -58.066  -1.063  1.00 149.35 ? 425  GLN A CD    1 
ATOM   3168  O  OE1   . GLN A 1  425  ? 17.938  -57.084  -0.327  1.00 142.37 ? 425  GLN A OE1   1 
ATOM   3169  N  NE2   . GLN A 1  425  ? 17.152  -57.951  -2.257  1.00 134.77 ? 425  GLN A NE2   1 
ATOM   3170  N  N     . LEU A 1  426  ? 17.268  -60.572  3.771   1.00 92.81  ? 426  LEU A N     1 
ATOM   3171  C  CA    . LEU A 1  426  ? 18.112  -60.891  4.931   1.00 91.66  ? 426  LEU A CA    1 
ATOM   3172  C  C     . LEU A 1  426  ? 19.155  -61.962  4.681   1.00 98.60  ? 426  LEU A C     1 
ATOM   3173  O  O     . LEU A 1  426  ? 18.920  -62.881  3.892   1.00 99.95  ? 426  LEU A O     1 
ATOM   3174  C  CB    . LEU A 1  426  ? 17.261  -61.276  6.151   1.00 89.79  ? 426  LEU A CB    1 
ATOM   3175  C  CG    . LEU A 1  426  ? 16.653  -60.136  6.931   1.00 91.48  ? 426  LEU A CG    1 
ATOM   3176  C  CD1   . LEU A 1  426  ? 15.831  -60.649  8.069   1.00 90.21  ? 426  LEU A CD1   1 
ATOM   3177  C  CD2   . LEU A 1  426  ? 17.711  -59.228  7.466   1.00 93.13  ? 426  LEU A CD2   1 
ATOM   3178  N  N     . GLN A 1  427  ? 20.308  -61.829  5.349   1.00 95.63  ? 427  GLN A N     1 
ATOM   3179  C  CA    . GLN A 1  427  ? 21.419  -62.777  5.298   1.00 97.47  ? 427  GLN A CA    1 
ATOM   3180  C  C     . GLN A 1  427  ? 21.796  -63.135  6.730   1.00 102.45 ? 427  GLN A C     1 
ATOM   3181  O  O     . GLN A 1  427  ? 21.644  -62.296  7.615   1.00 101.26 ? 427  GLN A O     1 
ATOM   3182  C  CB    . GLN A 1  427  ? 22.634  -62.150  4.596   1.00 99.79  ? 427  GLN A CB    1 
ATOM   3183  C  CG    . GLN A 1  427  ? 22.962  -62.753  3.237   1.00 119.00 ? 427  GLN A CG    1 
ATOM   3184  C  CD    . GLN A 1  427  ? 22.068  -62.225  2.141   1.00 146.75 ? 427  GLN A CD    1 
ATOM   3185  O  OE1   . GLN A 1  427  ? 22.047  -61.025  1.837   1.00 142.24 ? 427  GLN A OE1   1 
ATOM   3186  N  NE2   . GLN A 1  427  ? 21.322  -63.118  1.503   1.00 145.07 ? 427  GLN A NE2   1 
ATOM   3187  N  N     . TYR A 1  428  ? 22.302  -64.356  6.972   1.00 100.41 ? 428  TYR A N     1 
ATOM   3188  C  CA    . TYR A 1  428  ? 22.733  -64.733  8.320   1.00 100.31 ? 428  TYR A CA    1 
ATOM   3189  C  C     . TYR A 1  428  ? 23.948  -63.875  8.719   1.00 102.89 ? 428  TYR A C     1 
ATOM   3190  O  O     . TYR A 1  428  ? 24.673  -63.399  7.842   1.00 103.74 ? 428  TYR A O     1 
ATOM   3191  C  CB    . TYR A 1  428  ? 23.078  -66.226  8.403   1.00 103.78 ? 428  TYR A CB    1 
ATOM   3192  C  CG    . TYR A 1  428  ? 21.994  -67.169  7.924   1.00 107.55 ? 428  TYR A CG    1 
ATOM   3193  C  CD1   . TYR A 1  428  ? 22.213  -68.024  6.848   1.00 111.30 ? 428  TYR A CD1   1 
ATOM   3194  C  CD2   . TYR A 1  428  ? 20.774  -67.257  8.586   1.00 107.89 ? 428  TYR A CD2   1 
ATOM   3195  C  CE1   . TYR A 1  428  ? 21.229  -68.916  6.417   1.00 112.92 ? 428  TYR A CE1   1 
ATOM   3196  C  CE2   . TYR A 1  428  ? 19.773  -68.124  8.147   1.00 109.49 ? 428  TYR A CE2   1 
ATOM   3197  C  CZ    . TYR A 1  428  ? 20.012  -68.970  7.074   1.00 117.85 ? 428  TYR A CZ    1 
ATOM   3198  O  OH    . TYR A 1  428  ? 19.040  -69.845  6.639   1.00 117.57 ? 428  TYR A OH    1 
ATOM   3199  N  N     . GLY A 1  429  ? 24.130  -63.641  10.017  1.00 97.09  ? 429  GLY A N     1 
ATOM   3200  C  CA    . GLY A 1  429  ? 25.213  -62.797  10.516  1.00 96.18  ? 429  GLY A CA    1 
ATOM   3201  C  C     . GLY A 1  429  ? 24.842  -61.325  10.564  1.00 97.14  ? 429  GLY A C     1 
ATOM   3202  O  O     . GLY A 1  429  ? 25.538  -60.514  11.181  1.00 96.80  ? 429  GLY A O     1 
ATOM   3203  N  N     . TRP A 1  430  ? 23.743  -60.970  9.899   1.00 91.44  ? 430  TRP A N     1 
ATOM   3204  C  CA    . TRP A 1  430  ? 23.202  -59.623  9.866   1.00 89.52  ? 430  TRP A CA    1 
ATOM   3205  C  C     . TRP A 1  430  ? 22.410  -59.421  11.145  1.00 87.33  ? 430  TRP A C     1 
ATOM   3206  O  O     . TRP A 1  430  ? 21.923  -60.390  11.732  1.00 85.64  ? 430  TRP A O     1 
ATOM   3207  C  CB    . TRP A 1  430  ? 22.244  -59.474  8.672   1.00 89.27  ? 430  TRP A CB    1 
ATOM   3208  C  CG    . TRP A 1  430  ? 22.863  -59.261  7.311   1.00 91.94  ? 430  TRP A CG    1 
ATOM   3209  C  CD1   . TRP A 1  430  ? 24.087  -59.686  6.871   1.00 96.22  ? 430  TRP A CD1   1 
ATOM   3210  C  CD2   . TRP A 1  430  ? 22.219  -58.655  6.181   1.00 91.98  ? 430  TRP A CD2   1 
ATOM   3211  N  NE1   . TRP A 1  430  ? 24.271  -59.318  5.558   1.00 96.57  ? 430  TRP A NE1   1 
ATOM   3212  C  CE2   . TRP A 1  430  ? 23.131  -58.698  5.105   1.00 97.50  ? 430  TRP A CE2   1 
ATOM   3213  C  CE3   . TRP A 1  430  ? 20.956  -58.066  5.978   1.00 92.12  ? 430  TRP A CE3   1 
ATOM   3214  C  CZ2   . TRP A 1  430  ? 22.834  -58.136  3.855   1.00 97.24  ? 430  TRP A CZ2   1 
ATOM   3215  C  CZ3   . TRP A 1  430  ? 20.668  -57.503  4.746   1.00 93.78  ? 430  TRP A CZ3   1 
ATOM   3216  C  CH2   . TRP A 1  430  ? 21.598  -57.537  3.703   1.00 95.78  ? 430  TRP A CH2   1 
ATOM   3217  N  N     . LYS A 1  431  ? 22.247  -58.166  11.560  1.00 80.54  ? 431  LYS A N     1 
ATOM   3218  C  CA    . LYS A 1  431  ? 21.480  -57.849  12.758  1.00 77.35  ? 431  LYS A CA    1 
ATOM   3219  C  C     . LYS A 1  431  ? 20.192  -57.106  12.428  1.00 77.83  ? 431  LYS A C     1 
ATOM   3220  O  O     . LYS A 1  431  ? 20.144  -56.333  11.475  1.00 77.23  ? 431  LYS A O     1 
ATOM   3221  C  CB    . LYS A 1  431  ? 22.324  -57.083  13.781  1.00 78.07  ? 431  LYS A CB    1 
ATOM   3222  C  CG    . LYS A 1  431  ? 23.514  -57.867  14.279  1.00 87.69  ? 431  LYS A CG    1 
ATOM   3223  C  CD    . LYS A 1  431  ? 24.355  -57.044  15.239  1.00 103.16 ? 431  LYS A CD    1 
ATOM   3224  C  CE    . LYS A 1  431  ? 25.768  -57.570  15.374  1.00 122.21 ? 431  LYS A CE    1 
ATOM   3225  N  NZ    . LYS A 1  431  ? 26.531  -57.487  14.093  1.00 134.51 ? 431  LYS A NZ    1 
ATOM   3226  N  N     . VAL A 1  432  ? 19.133  -57.389  13.184  1.00 72.40  ? 432  VAL A N     1 
ATOM   3227  C  CA    . VAL A 1  432  ? 17.845  -56.730  13.028  1.00 71.00  ? 432  VAL A CA    1 
ATOM   3228  C  C     . VAL A 1  432  ? 17.407  -56.134  14.366  1.00 74.54  ? 432  VAL A C     1 
ATOM   3229  O  O     . VAL A 1  432  ? 16.989  -56.849  15.289  1.00 73.85  ? 432  VAL A O     1 
ATOM   3230  C  CB    . VAL A 1  432  ? 16.746  -57.610  12.393  1.00 74.65  ? 432  VAL A CB    1 
ATOM   3231  C  CG1   . VAL A 1  432  ? 15.470  -56.810  12.182  1.00 73.33  ? 432  VAL A CG1   1 
ATOM   3232  C  CG2   . VAL A 1  432  ? 17.209  -58.213  11.081  1.00 75.85  ? 432  VAL A CG2   1 
ATOM   3233  N  N     . GLU A 1  433  ? 17.492  -54.814  14.451  1.00 70.80  ? 433  GLU A N     1 
ATOM   3234  C  CA    . GLU A 1  433  ? 17.091  -54.040  15.615  1.00 69.70  ? 433  GLU A CA    1 
ATOM   3235  C  C     . GLU A 1  433  ? 15.573  -54.101  15.722  1.00 74.69  ? 433  GLU A C     1 
ATOM   3236  O  O     . GLU A 1  433  ? 14.868  -53.267  15.148  1.00 74.12  ? 433  GLU A O     1 
ATOM   3237  C  CB    . GLU A 1  433  ? 17.561  -52.595  15.449  1.00 70.59  ? 433  GLU A CB    1 
ATOM   3238  C  CG    . GLU A 1  433  ? 19.046  -52.493  15.194  1.00 78.44  ? 433  GLU A CG    1 
ATOM   3239  C  CD    . GLU A 1  433  ? 19.736  -51.669  16.249  1.00 96.87  ? 433  GLU A CD    1 
ATOM   3240  O  OE1   . GLU A 1  433  ? 19.643  -52.024  17.451  1.00 85.71  ? 433  GLU A OE1   1 
ATOM   3241  O  OE2   . GLU A 1  433  ? 20.347  -50.646  15.867  1.00 91.87  ? 433  GLU A OE2   1 
ATOM   3242  N  N     . ARG A 1  434  ? 15.073  -55.127  16.412  1.00 72.60  ? 434  ARG A N     1 
ATOM   3243  C  CA    . ARG A 1  434  ? 13.636  -55.337  16.553  1.00 72.81  ? 434  ARG A CA    1 
ATOM   3244  C  C     . ARG A 1  434  ? 12.995  -54.689  17.775  1.00 79.36  ? 434  ARG A C     1 
ATOM   3245  O  O     . ARG A 1  434  ? 13.627  -54.548  18.827  1.00 78.69  ? 434  ARG A O     1 
ATOM   3246  C  CB    . ARG A 1  434  ? 13.277  -56.823  16.464  1.00 71.44  ? 434  ARG A CB    1 
ATOM   3247  C  CG    . ARG A 1  434  ? 14.124  -57.724  17.332  1.00 78.61  ? 434  ARG A CG    1 
ATOM   3248  C  CD    . ARG A 1  434  ? 13.396  -59.016  17.580  1.00 87.22  ? 434  ARG A CD    1 
ATOM   3249  N  NE    . ARG A 1  434  ? 12.613  -58.983  18.812  1.00 92.16  ? 434  ARG A NE    1 
ATOM   3250  C  CZ    . ARG A 1  434  ? 13.072  -59.350  20.004  1.00 100.92 ? 434  ARG A CZ    1 
ATOM   3251  N  NH1   . ARG A 1  434  ? 14.326  -59.766  20.141  1.00 82.08  ? 434  ARG A NH1   1 
ATOM   3252  N  NH2   . ARG A 1  434  ? 12.286  -59.299  21.067  1.00 88.54  ? 434  ARG A NH2   1 
ATOM   3253  N  N     . HIS A 1  435  ? 11.711  -54.336  17.632  1.00 77.62  ? 435  HIS A N     1 
ATOM   3254  C  CA    . HIS A 1  435  ? 10.899  -53.764  18.697  1.00 77.39  ? 435  HIS A CA    1 
ATOM   3255  C  C     . HIS A 1  435  ? 10.887  -54.730  19.851  1.00 80.80  ? 435  HIS A C     1 
ATOM   3256  O  O     . HIS A 1  435  ? 10.696  -55.943  19.657  1.00 80.79  ? 435  HIS A O     1 
ATOM   3257  C  CB    . HIS A 1  435  ? 9.436   -53.623  18.243  1.00 78.57  ? 435  HIS A CB    1 
ATOM   3258  C  CG    . HIS A 1  435  ? 9.152   -52.533  17.259  1.00 82.60  ? 435  HIS A CG    1 
ATOM   3259  N  ND1   . HIS A 1  435  ? 9.999   -52.261  16.200  1.00 85.18  ? 435  HIS A ND1   1 
ATOM   3260  C  CD2   . HIS A 1  435  ? 8.056   -51.755  17.146  1.00 84.23  ? 435  HIS A CD2   1 
ATOM   3261  C  CE1   . HIS A 1  435  ? 9.419   -51.289  15.521  1.00 84.50  ? 435  HIS A CE1   1 
ATOM   3262  N  NE2   . HIS A 1  435  ? 8.252   -50.947  16.063  1.00 84.33  ? 435  HIS A NE2   1 
ATOM   3263  N  N     . ILE A 1  436  ? 11.077  -54.184  21.050  1.00 76.10  ? 436  ILE A N     1 
ATOM   3264  C  CA    . ILE A 1  436  ? 10.977  -54.893  22.316  1.00 75.48  ? 436  ILE A CA    1 
ATOM   3265  C  C     . ILE A 1  436  ? 9.621   -55.662  22.277  1.00 80.15  ? 436  ILE A C     1 
ATOM   3266  O  O     . ILE A 1  436  ? 8.566   -55.056  22.046  1.00 80.73  ? 436  ILE A O     1 
ATOM   3267  C  CB    . ILE A 1  436  ? 11.185  -53.817  23.453  1.00 77.40  ? 436  ILE A CB    1 
ATOM   3268  C  CG1   . ILE A 1  436  ? 12.518  -53.996  24.154  1.00 78.18  ? 436  ILE A CG1   1 
ATOM   3269  C  CG2   . ILE A 1  436  ? 10.047  -53.591  24.445  1.00 76.62  ? 436  ILE A CG2   1 
ATOM   3270  C  CD1   . ILE A 1  436  ? 13.694  -53.872  23.223  1.00 89.90  ? 436  ILE A CD1   1 
ATOM   3271  N  N     . MET A 1  437  ? 9.692   -57.002  22.284  1.00 75.59  ? 437  MET A N     1 
ATOM   3272  C  CA    . MET A 1  437  ? 8.531   -57.894  22.184  1.00 74.70  ? 437  MET A CA    1 
ATOM   3273  C  C     . MET A 1  437  ? 8.172   -58.541  23.532  1.00 74.84  ? 437  MET A C     1 
ATOM   3274  O  O     . MET A 1  437  ? 8.989   -58.540  24.458  1.00 74.39  ? 437  MET A O     1 
ATOM   3275  C  CB    . MET A 1  437  ? 8.832   -58.984  21.151  1.00 78.70  ? 437  MET A CB    1 
ATOM   3276  C  CG    . MET A 1  437  ? 8.172   -58.754  19.813  1.00 83.79  ? 437  MET A CG    1 
ATOM   3277  S  SD    . MET A 1  437  ? 9.064   -59.468  18.385  1.00 90.10  ? 437  MET A SD    1 
ATOM   3278  C  CE    . MET A 1  437  ? 8.813   -61.225  18.648  1.00 88.01  ? 437  MET A CE    1 
ATOM   3279  N  N     . ASP A 1  438  ? 6.957   -59.121  23.633  1.00 68.78  ? 438  ASP A N     1 
ATOM   3280  C  CA    . ASP A 1  438  ? 6.485   -59.834  24.827  1.00 67.16  ? 438  ASP A CA    1 
ATOM   3281  C  C     . ASP A 1  438  ? 7.510   -60.887  25.263  1.00 69.72  ? 438  ASP A C     1 
ATOM   3282  O  O     . ASP A 1  438  ? 8.154   -61.530  24.442  1.00 69.16  ? 438  ASP A O     1 
ATOM   3283  C  CB    . ASP A 1  438  ? 5.128   -60.519  24.576  1.00 68.97  ? 438  ASP A CB    1 
ATOM   3284  C  CG    . ASP A 1  438  ? 3.913   -59.607  24.542  1.00 83.92  ? 438  ASP A CG    1 
ATOM   3285  O  OD1   . ASP A 1  438  ? 3.750   -58.866  23.543  1.00 86.40  ? 438  ASP A OD1   1 
ATOM   3286  O  OD2   . ASP A 1  438  ? 3.059   -59.728  25.442  1.00 90.06  ? 438  ASP A OD2   1 
ATOM   3287  N  N     . ASN A 1  439  ? 7.678   -61.014  26.565  1.00 66.30  ? 439  ASN A N     1 
ATOM   3288  C  CA    . ASN A 1  439  ? 8.561   -61.951  27.236  1.00 66.49  ? 439  ASN A CA    1 
ATOM   3289  C  C     . ASN A 1  439  ? 10.065  -61.669  27.177  1.00 71.99  ? 439  ASN A C     1 
ATOM   3290  O  O     . ASN A 1  439  ? 10.850  -62.443  27.722  1.00 72.51  ? 439  ASN A O     1 
ATOM   3291  C  CB    . ASN A 1  439  ? 8.147   -63.412  27.030  1.00 64.95  ? 439  ASN A CB    1 
ATOM   3292  C  CG    . ASN A 1  439  ? 6.964   -63.806  27.906  1.00 99.34  ? 439  ASN A CG    1 
ATOM   3293  O  OD1   . ASN A 1  439  ? 6.162   -62.965  28.361  1.00 97.17  ? 439  ASN A OD1   1 
ATOM   3294  N  ND2   . ASN A 1  439  ? 6.848   -65.096  28.205  1.00 95.25  ? 439  ASN A ND2   1 
ATOM   3295  N  N     . ASP A 1  440  ? 10.467  -60.504  26.648  1.00 68.59  ? 440  ASP A N     1 
ATOM   3296  C  CA    . ASP A 1  440  ? 11.884  -60.120  26.674  1.00 68.67  ? 440  ASP A CA    1 
ATOM   3297  C  C     . ASP A 1  440  ? 12.290  -59.748  28.117  1.00 71.82  ? 440  ASP A C     1 
ATOM   3298  O  O     . ASP A 1  440  ? 11.466  -59.193  28.852  1.00 71.21  ? 440  ASP A O     1 
ATOM   3299  C  CB    . ASP A 1  440  ? 12.123  -58.877  25.791  1.00 70.02  ? 440  ASP A CB    1 
ATOM   3300  C  CG    . ASP A 1  440  ? 12.228  -59.111  24.300  1.00 76.78  ? 440  ASP A CG    1 
ATOM   3301  O  OD1   . ASP A 1  440  ? 11.696  -58.290  23.539  1.00 76.98  ? 440  ASP A OD1   1 
ATOM   3302  O  OD2   . ASP A 1  440  ? 12.952  -60.036  23.894  1.00 83.59  ? 440  ASP A OD2   1 
ATOM   3303  N  N     . PRO A 1  441  ? 13.544  -59.980  28.550  1.00 67.68  ? 441  PRO A N     1 
ATOM   3304  C  CA    . PRO A 1  441  ? 13.930  -59.511  29.893  1.00 66.02  ? 441  PRO A CA    1 
ATOM   3305  C  C     . PRO A 1  441  ? 14.258  -58.014  29.852  1.00 67.82  ? 441  PRO A C     1 
ATOM   3306  O  O     . PRO A 1  441  ? 14.929  -57.554  28.930  1.00 67.84  ? 441  PRO A O     1 
ATOM   3307  C  CB    . PRO A 1  441  ? 15.170  -60.343  30.220  1.00 68.45  ? 441  PRO A CB    1 
ATOM   3308  C  CG    . PRO A 1  441  ? 15.767  -60.695  28.901  1.00 74.16  ? 441  PRO A CG    1 
ATOM   3309  C  CD    . PRO A 1  441  ? 14.683  -60.596  27.840  1.00 69.90  ? 441  PRO A CD    1 
ATOM   3310  N  N     . VAL A 1  442  ? 13.742  -57.250  30.815  1.00 61.82  ? 442  VAL A N     1 
ATOM   3311  C  CA    . VAL A 1  442  ? 14.016  -55.817  30.936  1.00 59.61  ? 442  VAL A CA    1 
ATOM   3312  C  C     . VAL A 1  442  ? 14.294  -55.489  32.388  1.00 63.75  ? 442  VAL A C     1 
ATOM   3313  O  O     . VAL A 1  442  ? 13.811  -56.174  33.283  1.00 63.19  ? 442  VAL A O     1 
ATOM   3314  C  CB    . VAL A 1  442  ? 12.941  -54.870  30.335  1.00 61.35  ? 442  VAL A CB    1 
ATOM   3315  C  CG1   . VAL A 1  442  ? 13.088  -54.728  28.832  1.00 60.67  ? 442  VAL A CG1   1 
ATOM   3316  C  CG2   . VAL A 1  442  ? 11.521  -55.260  30.743  1.00 60.79  ? 442  VAL A CG2   1 
ATOM   3317  N  N     . LEU A 1  443  ? 15.070  -54.446  32.623  1.00 61.13  ? 443  LEU A N     1 
ATOM   3318  C  CA    . LEU A 1  443  ? 15.365  -54.003  33.969  1.00 61.13  ? 443  LEU A CA    1 
ATOM   3319  C  C     . LEU A 1  443  ? 14.363  -52.926  34.325  1.00 65.80  ? 443  LEU A C     1 
ATOM   3320  O  O     . LEU A 1  443  ? 14.238  -51.930  33.612  1.00 65.80  ? 443  LEU A O     1 
ATOM   3321  C  CB    . LEU A 1  443  ? 16.777  -53.445  34.056  1.00 61.36  ? 443  LEU A CB    1 
ATOM   3322  C  CG    . LEU A 1  443  ? 17.701  -54.072  35.069  1.00 66.77  ? 443  LEU A CG    1 
ATOM   3323  C  CD1   . LEU A 1  443  ? 18.705  -53.065  35.508  1.00 67.13  ? 443  LEU A CD1   1 
ATOM   3324  C  CD2   . LEU A 1  443  ? 16.963  -54.579  36.297  1.00 69.35  ? 443  LEU A CD2   1 
ATOM   3325  N  N     . PHE A 1  444  ? 13.627  -53.137  35.408  1.00 62.08  ? 444  PHE A N     1 
ATOM   3326  C  CA    . PHE A 1  444  ? 12.620  -52.187  35.846  1.00 60.67  ? 444  PHE A CA    1 
ATOM   3327  C  C     . PHE A 1  444  ? 12.997  -51.637  37.194  1.00 63.53  ? 444  PHE A C     1 
ATOM   3328  O  O     . PHE A 1  444  ? 13.370  -52.406  38.090  1.00 63.35  ? 444  PHE A O     1 
ATOM   3329  C  CB    . PHE A 1  444  ? 11.256  -52.856  35.855  1.00 62.23  ? 444  PHE A CB    1 
ATOM   3330  C  CG    . PHE A 1  444  ? 10.096  -51.906  35.844  1.00 62.88  ? 444  PHE A CG    1 
ATOM   3331  C  CD1   . PHE A 1  444  ? 10.091  -50.805  35.006  1.00 65.66  ? 444  PHE A CD1   1 
ATOM   3332  C  CD2   . PHE A 1  444  ? 8.967   -52.161  36.604  1.00 64.61  ? 444  PHE A CD2   1 
ATOM   3333  C  CE1   . PHE A 1  444  ? 9.013   -49.933  34.995  1.00 66.40  ? 444  PHE A CE1   1 
ATOM   3334  C  CE2   . PHE A 1  444  ? 7.880   -51.306  36.569  1.00 66.69  ? 444  PHE A CE2   1 
ATOM   3335  C  CZ    . PHE A 1  444  ? 7.910   -50.191  35.774  1.00 64.89  ? 444  PHE A CZ    1 
ATOM   3336  N  N     . ASN A 1  445  ? 12.970  -50.303  37.327  1.00 59.54  ? 445  ASN A N     1 
ATOM   3337  C  CA    . ASN A 1  445  ? 13.447  -49.653  38.544  1.00 59.30  ? 445  ASN A CA    1 
ATOM   3338  C  C     . ASN A 1  445  ? 12.650  -48.465  39.038  1.00 62.51  ? 445  ASN A C     1 
ATOM   3339  O  O     . ASN A 1  445  ? 12.071  -47.747  38.230  1.00 63.19  ? 445  ASN A O     1 
ATOM   3340  C  CB    . ASN A 1  445  ? 14.982  -49.366  38.394  1.00 61.36  ? 445  ASN A CB    1 
ATOM   3341  C  CG    . ASN A 1  445  ? 15.530  -47.963  38.579  1.00 79.12  ? 445  ASN A CG    1 
ATOM   3342  O  OD1   . ASN A 1  445  ? 15.839  -47.247  37.610  1.00 70.14  ? 445  ASN A OD1   1 
ATOM   3343  N  ND2   . ASN A 1  445  ? 15.871  -47.639  39.818  1.00 68.47  ? 445  ASN A ND2   1 
ATOM   3344  N  N     . ARG A 1  446  ? 12.640  -48.251  40.364  1.00 58.45  ? 446  ARG A N     1 
ATOM   3345  C  CA    . ARG A 1  446  ? 12.013  -47.094  41.021  1.00 58.25  ? 446  ARG A CA    1 
ATOM   3346  C  C     . ARG A 1  446  ? 13.069  -46.400  41.870  1.00 63.46  ? 446  ARG A C     1 
ATOM   3347  O  O     . ARG A 1  446  ? 13.689  -47.051  42.730  1.00 63.21  ? 446  ARG A O     1 
ATOM   3348  C  CB    . ARG A 1  446  ? 10.819  -47.500  41.914  1.00 58.12  ? 446  ARG A CB    1 
ATOM   3349  C  CG    . ARG A 1  446  ? 9.752   -46.406  42.078  1.00 59.88  ? 446  ARG A CG    1 
ATOM   3350  C  CD    . ARG A 1  446  ? 9.937   -45.670  43.360  1.00 67.47  ? 446  ARG A CD    1 
ATOM   3351  N  NE    . ARG A 1  446  ? 8.761   -44.896  43.734  1.00 80.82  ? 446  ARG A NE    1 
ATOM   3352  C  CZ    . ARG A 1  446  ? 8.686   -44.194  44.860  1.00 102.16 ? 446  ARG A CZ    1 
ATOM   3353  N  NH1   . ARG A 1  446  ? 9.706   -44.180  45.710  1.00 97.48  ? 446  ARG A NH1   1 
ATOM   3354  N  NH2   . ARG A 1  446  ? 7.583   -43.517  45.156  1.00 84.70  ? 446  ARG A NH2   1 
ATOM   3355  N  N     . GLN A 1  447  ? 13.275  -45.084  41.631  1.00 60.55  ? 447  GLN A N     1 
ATOM   3356  C  CA    . GLN A 1  447  ? 14.259  -44.278  42.373  1.00 61.07  ? 447  GLN A CA    1 
ATOM   3357  C  C     . GLN A 1  447  ? 13.669  -43.655  43.660  1.00 66.10  ? 447  GLN A C     1 
ATOM   3358  O  O     . GLN A 1  447  ? 12.493  -43.288  43.681  1.00 65.65  ? 447  GLN A O     1 
ATOM   3359  C  CB    . GLN A 1  447  ? 14.913  -43.224  41.477  1.00 62.40  ? 447  GLN A CB    1 
ATOM   3360  C  CG    . GLN A 1  447  ? 15.900  -43.799  40.479  1.00 71.39  ? 447  GLN A CG    1 
ATOM   3361  C  CD    . GLN A 1  447  ? 15.927  -43.057  39.164  1.00 93.68  ? 447  GLN A CD    1 
ATOM   3362  O  OE1   . GLN A 1  447  ? 14.997  -42.317  38.799  1.00 88.13  ? 447  GLN A OE1   1 
ATOM   3363  N  NE2   . GLN A 1  447  ? 16.988  -43.276  38.395  1.00 91.35  ? 447  GLN A NE2   1 
ATOM   3364  N  N     . PRO A 1  448  ? 14.422  -43.553  44.764  1.00 63.60  ? 448  PRO A N     1 
ATOM   3365  C  CA    . PRO A 1  448  ? 15.830  -43.921  44.968  1.00 64.79  ? 448  PRO A CA    1 
ATOM   3366  C  C     . PRO A 1  448  ? 16.041  -45.429  45.029  1.00 71.15  ? 448  PRO A C     1 
ATOM   3367  O  O     . PRO A 1  448  ? 15.245  -46.168  45.631  1.00 71.19  ? 448  PRO A O     1 
ATOM   3368  C  CB    . PRO A 1  448  ? 16.166  -43.242  46.295  1.00 66.53  ? 448  PRO A CB    1 
ATOM   3369  C  CG    . PRO A 1  448  ? 14.860  -43.274  47.042  1.00 70.46  ? 448  PRO A CG    1 
ATOM   3370  C  CD    . PRO A 1  448  ? 13.824  -43.010  45.995  1.00 65.13  ? 448  PRO A CD    1 
ATOM   3371  N  N     . SER A 1  449  ? 17.128  -45.877  44.398  1.00 68.00  ? 449  SER A N     1 
ATOM   3372  C  CA    . SER A 1  449  ? 17.478  -47.283  44.294  1.00 67.72  ? 449  SER A CA    1 
ATOM   3373  C  C     . SER A 1  449  ? 18.282  -47.786  45.494  1.00 72.09  ? 449  SER A C     1 
ATOM   3374  O  O     . SER A 1  449  ? 19.453  -48.158  45.359  1.00 73.37  ? 449  SER A O     1 
ATOM   3375  C  CB    . SER A 1  449  ? 18.186  -47.517  42.970  1.00 70.78  ? 449  SER A CB    1 
ATOM   3376  O  OG    . SER A 1  449  ? 17.331  -47.095  41.919  1.00 76.67  ? 449  SER A OG    1 
ATOM   3377  N  N     . LEU A 1  450  ? 17.638  -47.802  46.678  1.00 67.42  ? 450  LEU A N     1 
ATOM   3378  C  CA    . LEU A 1  450  ? 18.273  -48.176  47.947  1.00 67.71  ? 450  LEU A CA    1 
ATOM   3379  C  C     . LEU A 1  450  ? 18.508  -49.677  48.181  1.00 75.23  ? 450  LEU A C     1 
ATOM   3380  O  O     . LEU A 1  450  ? 19.360  -50.033  48.982  1.00 75.00  ? 450  LEU A O     1 
ATOM   3381  C  CB    . LEU A 1  450  ? 17.510  -47.559  49.126  1.00 67.09  ? 450  LEU A CB    1 
ATOM   3382  C  CG    . LEU A 1  450  ? 17.162  -46.061  49.019  1.00 70.87  ? 450  LEU A CG    1 
ATOM   3383  C  CD1   . LEU A 1  450  ? 15.922  -45.722  49.835  1.00 70.47  ? 450  LEU A CD1   1 
ATOM   3384  C  CD2   . LEU A 1  450  ? 18.319  -45.189  49.422  1.00 71.74  ? 450  LEU A CD2   1 
ATOM   3385  N  N     . HIS A 1  451  ? 17.770  -50.540  47.458  1.00 74.84  ? 451  HIS A N     1 
ATOM   3386  C  CA    . HIS A 1  451  ? 17.739  -52.013  47.487  1.00 75.58  ? 451  HIS A CA    1 
ATOM   3387  C  C     . HIS A 1  451  ? 18.226  -52.684  46.216  1.00 77.10  ? 451  HIS A C     1 
ATOM   3388  O  O     . HIS A 1  451  ? 17.962  -52.167  45.126  1.00 76.02  ? 451  HIS A O     1 
ATOM   3389  C  CB    . HIS A 1  451  ? 16.267  -52.399  47.448  1.00 77.12  ? 451  HIS A CB    1 
ATOM   3390  C  CG    . HIS A 1  451  ? 15.649  -52.621  48.752  1.00 81.43  ? 451  HIS A CG    1 
ATOM   3391  N  ND1   . HIS A 1  451  ? 14.279  -52.718  48.873  1.00 83.54  ? 451  HIS A ND1   1 
ATOM   3392  C  CD2   . HIS A 1  451  ? 16.230  -52.809  49.956  1.00 84.53  ? 451  HIS A CD2   1 
ATOM   3393  C  CE1   . HIS A 1  451  ? 14.059  -52.926  50.157  1.00 84.05  ? 451  HIS A CE1   1 
ATOM   3394  N  NE2   . HIS A 1  451  ? 15.212  -53.003  50.849  1.00 84.74  ? 451  HIS A NE2   1 
ATOM   3395  N  N     . LYS A 1  452  ? 18.673  -53.951  46.320  1.00 72.22  ? 452  LYS A N     1 
ATOM   3396  C  CA    . LYS A 1  452  ? 18.938  -54.716  45.102  1.00 71.17  ? 452  LYS A CA    1 
ATOM   3397  C  C     . LYS A 1  452  ? 17.571  -54.942  44.430  1.00 73.31  ? 452  LYS A C     1 
ATOM   3398  O  O     . LYS A 1  452  ? 17.511  -54.959  43.210  1.00 72.95  ? 452  LYS A O     1 
ATOM   3399  C  CB    . LYS A 1  452  ? 19.700  -56.041  45.373  1.00 73.40  ? 452  LYS A CB    1 
ATOM   3400  C  CG    . LYS A 1  452  ? 18.909  -57.148  46.072  1.00 71.66  ? 452  LYS A CG    1 
ATOM   3401  C  CD    . LYS A 1  452  ? 19.806  -58.219  46.691  1.00 73.62  ? 452  LYS A CD    1 
ATOM   3402  C  CE    . LYS A 1  452  ? 20.175  -59.368  45.783  1.00 72.77  ? 452  LYS A CE    1 
ATOM   3403  N  NZ    . LYS A 1  452  ? 21.379  -60.069  46.306  1.00 78.92  ? 452  LYS A NZ    1 
ATOM   3404  N  N     . MET A 1  453  ? 16.470  -54.969  45.243  1.00 69.34  ? 453  MET A N     1 
ATOM   3405  C  CA    . MET A 1  453  ? 15.052  -55.133  44.862  1.00 69.40  ? 453  MET A CA    1 
ATOM   3406  C  C     . MET A 1  453  ? 14.389  -53.887  44.278  1.00 70.95  ? 453  MET A C     1 
ATOM   3407  O  O     . MET A 1  453  ? 13.198  -53.904  43.976  1.00 69.85  ? 453  MET A O     1 
ATOM   3408  C  CB    . MET A 1  453  ? 14.216  -55.616  46.036  1.00 72.60  ? 453  MET A CB    1 
ATOM   3409  C  CG    . MET A 1  453  ? 14.781  -56.817  46.695  1.00 79.14  ? 453  MET A CG    1 
ATOM   3410  S  SD    . MET A 1  453  ? 15.602  -56.342  48.230  1.00 85.32  ? 453  MET A SD    1 
ATOM   3411  C  CE    . MET A 1  453  ? 14.133  -56.154  49.338  1.00 81.85  ? 453  MET A CE    1 
ATOM   3412  N  N     . SER A 1  454  ? 15.136  -52.802  44.137  1.00 66.04  ? 454  SER A N     1 
ATOM   3413  C  CA    . SER A 1  454  ? 14.604  -51.613  43.505  1.00 64.17  ? 454  SER A CA    1 
ATOM   3414  C  C     . SER A 1  454  ? 14.891  -51.761  42.007  1.00 65.52  ? 454  SER A C     1 
ATOM   3415  O  O     . SER A 1  454  ? 14.360  -51.020  41.198  1.00 63.94  ? 454  SER A O     1 
ATOM   3416  C  CB    . SER A 1  454  ? 15.263  -50.370  44.092  1.00 67.56  ? 454  SER A CB    1 
ATOM   3417  O  OG    . SER A 1  454  ? 14.845  -50.166  45.432  1.00 74.62  ? 454  SER A OG    1 
ATOM   3418  N  N     . MET A 1  455  ? 15.719  -52.752  41.658  1.00 62.39  ? 455  MET A N     1 
ATOM   3419  C  CA    . MET A 1  455  ? 16.121  -53.115  40.306  1.00 62.75  ? 455  MET A CA    1 
ATOM   3420  C  C     . MET A 1  455  ? 15.724  -54.567  40.055  1.00 64.94  ? 455  MET A C     1 
ATOM   3421  O  O     . MET A 1  455  ? 16.193  -55.465  40.761  1.00 63.54  ? 455  MET A O     1 
ATOM   3422  C  CB    . MET A 1  455  ? 17.631  -53.004  40.186  1.00 65.92  ? 455  MET A CB    1 
ATOM   3423  C  CG    . MET A 1  455  ? 18.049  -52.364  38.942  1.00 69.72  ? 455  MET A CG    1 
ATOM   3424  S  SD    . MET A 1  455  ? 18.600  -50.718  39.345  1.00 73.67  ? 455  MET A SD    1 
ATOM   3425  C  CE    . MET A 1  455  ? 18.778  -50.064  37.680  1.00 70.39  ? 455  MET A CE    1 
ATOM   3426  N  N     . MET A 1  456  ? 14.847  -54.808  39.072  1.00 60.42  ? 456  MET A N     1 
ATOM   3427  C  CA    . MET A 1  456  ? 14.406  -56.177  38.810  1.00 59.92  ? 456  MET A CA    1 
ATOM   3428  C  C     . MET A 1  456  ? 14.154  -56.481  37.339  1.00 65.41  ? 456  MET A C     1 
ATOM   3429  O  O     . MET A 1  456  ? 13.604  -55.654  36.594  1.00 64.60  ? 456  MET A O     1 
ATOM   3430  C  CB    . MET A 1  456  ? 13.164  -56.526  39.643  1.00 61.03  ? 456  MET A CB    1 
ATOM   3431  C  CG    . MET A 1  456  ? 13.435  -57.454  40.789  1.00 63.85  ? 456  MET A CG    1 
ATOM   3432  S  SD    . MET A 1  456  ? 12.778  -56.797  42.335  1.00 66.17  ? 456  MET A SD    1 
ATOM   3433  C  CE    . MET A 1  456  ? 11.192  -57.479  42.382  1.00 62.40  ? 456  MET A CE    1 
ATOM   3434  N  N     . ALA A 1  457  ? 14.563  -57.685  36.928  1.00 62.67  ? 457  ALA A N     1 
ATOM   3435  C  CA    . ALA A 1  457  ? 14.341  -58.156  35.576  1.00 62.56  ? 457  ALA A CA    1 
ATOM   3436  C  C     . ALA A 1  457  ? 12.860  -58.527  35.449  1.00 65.34  ? 457  ALA A C     1 
ATOM   3437  O  O     . ALA A 1  457  ? 12.325  -59.243  36.296  1.00 65.51  ? 457  ALA A O     1 
ATOM   3438  C  CB    . ALA A 1  457  ? 15.225  -59.356  35.288  1.00 64.21  ? 457  ALA A CB    1 
ATOM   3439  N  N     . HIS A 1  458  ? 12.187  -57.990  34.432  1.00 60.16  ? 458  HIS A N     1 
ATOM   3440  C  CA    . HIS A 1  458  ? 10.781  -58.280  34.212  1.00 59.30  ? 458  HIS A CA    1 
ATOM   3441  C  C     . HIS A 1  458  ? 10.524  -58.823  32.823  1.00 66.83  ? 458  HIS A C     1 
ATOM   3442  O  O     . HIS A 1  458  ? 11.273  -58.529  31.882  1.00 68.05  ? 458  HIS A O     1 
ATOM   3443  C  CB    . HIS A 1  458  ? 9.935   -57.035  34.401  1.00 58.15  ? 458  HIS A CB    1 
ATOM   3444  C  CG    . HIS A 1  458  ? 9.692   -56.638  35.818  1.00 60.09  ? 458  HIS A CG    1 
ATOM   3445  N  ND1   . HIS A 1  458  ? 8.482   -56.888  36.434  1.00 61.11  ? 458  HIS A ND1   1 
ATOM   3446  C  CD2   . HIS A 1  458  ? 10.478  -55.935  36.662  1.00 60.31  ? 458  HIS A CD2   1 
ATOM   3447  C  CE1   . HIS A 1  458  ? 8.578   -56.351  37.634  1.00 59.60  ? 458  HIS A CE1   1 
ATOM   3448  N  NE2   . HIS A 1  458  ? 9.764   -55.766  37.813  1.00 59.63  ? 458  HIS A NE2   1 
ATOM   3449  N  N     . ARG A 1  459  ? 9.432   -59.594  32.689  1.00 63.22  ? 459  ARG A N     1 
ATOM   3450  C  CA    . ARG A 1  459  ? 9.003   -60.144  31.424  1.00 63.36  ? 459  ARG A CA    1 
ATOM   3451  C  C     . ARG A 1  459  ? 8.172   -59.076  30.771  1.00 71.01  ? 459  ARG A C     1 
ATOM   3452  O  O     . ARG A 1  459  ? 7.227   -58.575  31.388  1.00 71.95  ? 459  ARG A O     1 
ATOM   3453  C  CB    . ARG A 1  459  ? 8.142   -61.368  31.676  1.00 61.86  ? 459  ARG A CB    1 
ATOM   3454  C  CG    . ARG A 1  459  ? 8.891   -62.676  31.505  1.00 65.97  ? 459  ARG A CG    1 
ATOM   3455  C  CD    . ARG A 1  459  ? 8.156   -63.815  32.171  1.00 62.18  ? 459  ARG A CD    1 
ATOM   3456  N  NE    . ARG A 1  459  ? 6.907   -64.143  31.480  1.00 65.65  ? 459  ARG A NE    1 
ATOM   3457  C  CZ    . ARG A 1  459  ? 5.717   -64.219  32.068  1.00 78.66  ? 459  ARG A CZ    1 
ATOM   3458  N  NH1   . ARG A 1  459  ? 5.595   -63.996  33.373  1.00 56.26  ? 459  ARG A NH1   1 
ATOM   3459  N  NH2   . ARG A 1  459  ? 4.640   -64.528  31.357  1.00 74.73  ? 459  ARG A NH2   1 
ATOM   3460  N  N     . VAL A 1  460  ? 8.536   -58.679  29.550  1.00 68.31  ? 460  VAL A N     1 
ATOM   3461  C  CA    . VAL A 1  460  ? 7.779   -57.677  28.810  1.00 67.66  ? 460  VAL A CA    1 
ATOM   3462  C  C     . VAL A 1  460  ? 6.426   -58.317  28.408  1.00 74.26  ? 460  VAL A C     1 
ATOM   3463  O  O     . VAL A 1  460  ? 6.316   -59.537  28.217  1.00 75.40  ? 460  VAL A O     1 
ATOM   3464  C  CB    . VAL A 1  460  ? 8.573   -57.186  27.567  1.00 71.23  ? 460  VAL A CB    1 
ATOM   3465  C  CG1   . VAL A 1  460  ? 7.784   -56.167  26.739  1.00 70.60  ? 460  VAL A CG1   1 
ATOM   3466  C  CG2   . VAL A 1  460  ? 9.921   -56.618  27.966  1.00 70.57  ? 460  VAL A CG2   1 
ATOM   3467  N  N     . LYS A 1  461  ? 5.397   -57.487  28.374  1.00 69.93  ? 461  LYS A N     1 
ATOM   3468  C  CA    . LYS A 1  461  ? 4.045   -57.791  27.939  1.00 69.00  ? 461  LYS A CA    1 
ATOM   3469  C  C     . LYS A 1  461  ? 3.664   -56.464  27.326  1.00 73.88  ? 461  LYS A C     1 
ATOM   3470  O  O     . LYS A 1  461  ? 3.513   -55.465  28.058  1.00 73.94  ? 461  LYS A O     1 
ATOM   3471  C  CB    . LYS A 1  461  ? 3.143   -58.174  29.136  1.00 69.40  ? 461  LYS A CB    1 
ATOM   3472  C  CG    . LYS A 1  461  ? 1.630   -58.026  28.938  1.00 66.44  ? 461  LYS A CG    1 
ATOM   3473  C  CD    . LYS A 1  461  ? 0.988   -59.156  28.149  1.00 79.54  ? 461  LYS A CD    1 
ATOM   3474  C  CE    . LYS A 1  461  ? -0.373  -59.537  28.696  1.00 94.31  ? 461  LYS A CE    1 
ATOM   3475  N  NZ    . LYS A 1  461  ? -1.421  -58.524  28.395  1.00 105.40 ? 461  LYS A NZ    1 
ATOM   3476  N  N     . VAL A 1  462  ? 3.654   -56.405  25.982  1.00 69.06  ? 462  VAL A N     1 
ATOM   3477  C  CA    . VAL A 1  462  ? 3.314   -55.154  25.300  1.00 67.14  ? 462  VAL A CA    1 
ATOM   3478  C  C     . VAL A 1  462  ? 1.813   -54.893  25.491  1.00 68.86  ? 462  VAL A C     1 
ATOM   3479  O  O     . VAL A 1  462  ? 1.016   -55.813  25.289  1.00 69.32  ? 462  VAL A O     1 
ATOM   3480  C  CB    . VAL A 1  462  ? 3.770   -55.112  23.819  1.00 70.82  ? 462  VAL A CB    1 
ATOM   3481  C  CG1   . VAL A 1  462  ? 3.670   -53.697  23.259  1.00 69.86  ? 462  VAL A CG1   1 
ATOM   3482  C  CG2   . VAL A 1  462  ? 5.195   -55.627  23.671  1.00 71.15  ? 462  VAL A CG2   1 
ATOM   3483  N  N     . ILE A 1  463  ? 1.450   -53.678  25.960  1.00 63.23  ? 463  ILE A N     1 
ATOM   3484  C  CA    . ILE A 1  463  ? 0.066   -53.285  26.240  1.00 62.73  ? 463  ILE A CA    1 
ATOM   3485  C  C     . ILE A 1  463  ? -0.386  -51.924  25.654  1.00 66.96  ? 463  ILE A C     1 
ATOM   3486  O  O     . ILE A 1  463  ? 0.458   -51.044  25.475  1.00 65.54  ? 463  ILE A O     1 
ATOM   3487  C  CB    . ILE A 1  463  ? -0.288  -53.395  27.765  1.00 65.26  ? 463  ILE A CB    1 
ATOM   3488  C  CG1   . ILE A 1  463  ? 0.764   -52.782  28.697  1.00 64.88  ? 463  ILE A CG1   1 
ATOM   3489  C  CG2   . ILE A 1  463  ? -0.652  -54.817  28.163  1.00 66.87  ? 463  ILE A CG2   1 
ATOM   3490  C  CD1   . ILE A 1  463  ? 0.525   -51.367  29.110  1.00 71.86  ? 463  ILE A CD1   1 
ATOM   3491  N  N     . PRO A 1  464  ? -1.725  -51.699  25.435  1.00 64.89  ? 464  PRO A N     1 
ATOM   3492  C  CA    . PRO A 1  464  ? -2.183  -50.360  25.012  1.00 64.69  ? 464  PRO A CA    1 
ATOM   3493  C  C     . PRO A 1  464  ? -2.107  -49.372  26.188  1.00 69.78  ? 464  PRO A C     1 
ATOM   3494  O  O     . PRO A 1  464  ? -1.815  -49.797  27.293  1.00 70.13  ? 464  PRO A O     1 
ATOM   3495  C  CB    . PRO A 1  464  ? -3.636  -50.607  24.607  1.00 66.29  ? 464  PRO A CB    1 
ATOM   3496  C  CG    . PRO A 1  464  ? -4.075  -51.729  25.465  1.00 70.60  ? 464  PRO A CG    1 
ATOM   3497  C  CD    . PRO A 1  464  ? -2.877  -52.616  25.623  1.00 66.55  ? 464  PRO A CD    1 
ATOM   3498  N  N     . TYR A 1  465  ? -2.412  -48.083  25.977  1.00 67.93  ? 465  TYR A N     1 
ATOM   3499  C  CA    . TYR A 1  465  ? -2.377  -47.033  27.012  1.00 69.00  ? 465  TYR A CA    1 
ATOM   3500  C  C     . TYR A 1  465  ? -0.963  -46.670  27.443  1.00 72.40  ? 465  TYR A C     1 
ATOM   3501  O  O     . TYR A 1  465  ? -0.028  -47.412  27.154  1.00 73.42  ? 465  TYR A O     1 
ATOM   3502  C  CB    . TYR A 1  465  ? -3.351  -47.265  28.181  1.00 71.65  ? 465  TYR A CB    1 
ATOM   3503  C  CG    . TYR A 1  465  ? -4.722  -47.657  27.703  1.00 75.60  ? 465  TYR A CG    1 
ATOM   3504  C  CD1   . TYR A 1  465  ? -5.125  -48.986  27.710  1.00 78.93  ? 465  TYR A CD1   1 
ATOM   3505  C  CD2   . TYR A 1  465  ? -5.579  -46.717  27.144  1.00 76.83  ? 465  TYR A CD2   1 
ATOM   3506  C  CE1   . TYR A 1  465  ? -6.356  -49.370  27.191  1.00 82.77  ? 465  TYR A CE1   1 
ATOM   3507  C  CE2   . TYR A 1  465  ? -6.818  -47.086  26.630  1.00 78.91  ? 465  TYR A CE2   1 
ATOM   3508  C  CZ    . TYR A 1  465  ? -7.209  -48.414  26.666  1.00 91.88  ? 465  TYR A CZ    1 
ATOM   3509  O  OH    . TYR A 1  465  ? -8.430  -48.794  26.161  1.00 98.17  ? 465  TYR A OH    1 
ATOM   3510  N  N     . SER A 1  466  ? -0.795  -45.497  28.058  1.00 65.81  ? 466  SER A N     1 
ATOM   3511  C  CA    . SER A 1  466  ? 0.518   -44.944  28.313  1.00 64.41  ? 466  SER A CA    1 
ATOM   3512  C  C     . SER A 1  466  ? 1.295   -45.259  29.605  1.00 66.17  ? 466  SER A C     1 
ATOM   3513  O  O     . SER A 1  466  ? 2.463   -44.871  29.717  1.00 65.49  ? 466  SER A O     1 
ATOM   3514  C  CB    . SER A 1  466  ? 0.486   -43.460  28.003  1.00 68.37  ? 466  SER A CB    1 
ATOM   3515  O  OG    . SER A 1  466  ? 0.022   -43.254  26.678  1.00 81.99  ? 466  SER A OG    1 
ATOM   3516  N  N     . THR A 1  467  ? 0.689   -45.969  30.559  1.00 60.69  ? 467  THR A N     1 
ATOM   3517  C  CA    . THR A 1  467  ? 1.364   -46.258  31.825  1.00 58.83  ? 467  THR A CA    1 
ATOM   3518  C  C     . THR A 1  467  ? 2.176   -47.551  31.786  1.00 63.34  ? 467  THR A C     1 
ATOM   3519  O  O     . THR A 1  467  ? 1.947   -48.391  30.899  1.00 63.59  ? 467  THR A O     1 
ATOM   3520  C  CB    . THR A 1  467  ? 0.367   -46.211  33.002  1.00 57.33  ? 467  THR A CB    1 
ATOM   3521  O  OG1   . THR A 1  467  ? -0.874  -46.845  32.689  1.00 55.17  ? 467  THR A OG1   1 
ATOM   3522  C  CG2   . THR A 1  467  ? 0.070   -44.833  33.426  1.00 52.35  ? 467  THR A CG2   1 
ATOM   3523  N  N     . PHE A 1  468  ? 3.142   -47.698  32.728  1.00 59.31  ? 468  PHE A N     1 
ATOM   3524  C  CA    . PHE A 1  468  ? 3.898   -48.946  32.897  1.00 59.81  ? 468  PHE A CA    1 
ATOM   3525  C  C     . PHE A 1  468  ? 3.034   -49.783  33.837  1.00 64.55  ? 468  PHE A C     1 
ATOM   3526  O  O     . PHE A 1  468  ? 2.806   -49.398  34.982  1.00 65.40  ? 468  PHE A O     1 
ATOM   3527  C  CB    . PHE A 1  468  ? 5.303   -48.766  33.529  1.00 61.07  ? 468  PHE A CB    1 
ATOM   3528  C  CG    . PHE A 1  468  ? 6.465   -48.507  32.611  1.00 62.48  ? 468  PHE A CG    1 
ATOM   3529  C  CD1   . PHE A 1  468  ? 7.418   -47.551  32.928  1.00 65.30  ? 468  PHE A CD1   1 
ATOM   3530  C  CD2   . PHE A 1  468  ? 6.615   -49.220  31.432  1.00 66.44  ? 468  PHE A CD2   1 
ATOM   3531  C  CE1   . PHE A 1  468  ? 8.488   -47.288  32.071  1.00 66.97  ? 468  PHE A CE1   1 
ATOM   3532  C  CE2   . PHE A 1  468  ? 7.686   -48.963  30.575  1.00 70.32  ? 468  PHE A CE2   1 
ATOM   3533  C  CZ    . PHE A 1  468  ? 8.618   -47.996  30.903  1.00 67.93  ? 468  PHE A CZ    1 
ATOM   3534  N  N     . ARG A 1  469  ? 2.510   -50.887  33.357  1.00 60.20  ? 469  ARG A N     1 
ATOM   3535  C  CA    . ARG A 1  469  ? 1.656   -51.682  34.213  1.00 59.75  ? 469  ARG A CA    1 
ATOM   3536  C  C     . ARG A 1  469  ? 2.456   -52.665  35.068  1.00 66.20  ? 469  ARG A C     1 
ATOM   3537  O  O     . ARG A 1  469  ? 3.460   -53.229  34.600  1.00 67.64  ? 469  ARG A O     1 
ATOM   3538  C  CB    . ARG A 1  469  ? 0.562   -52.367  33.398  1.00 55.21  ? 469  ARG A CB    1 
ATOM   3539  C  CG    . ARG A 1  469  ? -0.250  -51.371  32.636  1.00 53.02  ? 469  ARG A CG    1 
ATOM   3540  C  CD    . ARG A 1  469  ? -1.683  -51.762  32.581  1.00 54.20  ? 469  ARG A CD    1 
ATOM   3541  N  NE    . ARG A 1  469  ? -2.541  -50.636  32.921  1.00 61.02  ? 469  ARG A NE    1 
ATOM   3542  C  CZ    . ARG A 1  469  ? -3.399  -50.647  33.927  1.00 75.47  ? 469  ARG A CZ    1 
ATOM   3543  N  NH1   . ARG A 1  469  ? -3.516  -51.718  34.695  1.00 67.31  ? 469  ARG A NH1   1 
ATOM   3544  N  NH2   . ARG A 1  469  ? -4.149  -49.587  34.174  1.00 59.17  ? 469  ARG A NH2   1 
ATOM   3545  N  N     . LEU A 1  470  ? 2.035   -52.844  36.338  1.00 60.70  ? 470  LEU A N     1 
ATOM   3546  C  CA    . LEU A 1  470  ? 2.701   -53.794  37.219  1.00 59.15  ? 470  LEU A CA    1 
ATOM   3547  C  C     . LEU A 1  470  ? 1.807   -54.483  38.212  1.00 61.49  ? 470  LEU A C     1 
ATOM   3548  O  O     . LEU A 1  470  ? 0.794   -53.901  38.633  1.00 59.76  ? 470  LEU A O     1 
ATOM   3549  C  CB    . LEU A 1  470  ? 4.003   -53.279  37.851  1.00 58.08  ? 470  LEU A CB    1 
ATOM   3550  C  CG    . LEU A 1  470  ? 4.003   -51.920  38.460  1.00 61.28  ? 470  LEU A CG    1 
ATOM   3551  C  CD1   . LEU A 1  470  ? 3.890   -51.989  39.955  1.00 61.18  ? 470  LEU A CD1   1 
ATOM   3552  C  CD2   . LEU A 1  470  ? 5.263   -51.290  38.183  1.00 63.20  ? 470  LEU A CD2   1 
ATOM   3553  N  N     . ASN A 1  471  ? 2.181   -55.754  38.558  1.00 57.55  ? 471  ASN A N     1 
ATOM   3554  C  CA    . ASN A 1  471  ? 1.467   -56.571  39.526  1.00 57.01  ? 471  ASN A CA    1 
ATOM   3555  C  C     . ASN A 1  471  ? 1.580   -55.968  40.909  1.00 59.11  ? 471  ASN A C     1 
ATOM   3556  O  O     . ASN A 1  471  ? 2.681   -55.759  41.412  1.00 58.31  ? 471  ASN A O     1 
ATOM   3557  C  CB    . ASN A 1  471  ? 1.941   -58.019  39.549  1.00 57.40  ? 471  ASN A CB    1 
ATOM   3558  C  CG    . ASN A 1  471  ? 1.159   -58.815  40.578  1.00 74.58  ? 471  ASN A CG    1 
ATOM   3559  O  OD1   . ASN A 1  471  ? -0.082  -58.827  40.604  1.00 68.95  ? 471  ASN A OD1   1 
ATOM   3560  N  ND2   . ASN A 1  471  ? 1.854   -59.306  41.569  1.00 62.81  ? 471  ASN A ND2   1 
ATOM   3561  N  N     . LEU A 1  472  ? 0.435   -55.728  41.537  1.00 54.78  ? 472  LEU A N     1 
ATOM   3562  C  CA    . LEU A 1  472  ? 0.359   -55.110  42.850  1.00 54.35  ? 472  LEU A CA    1 
ATOM   3563  C  C     . LEU A 1  472  ? 1.305   -55.694  43.901  1.00 59.90  ? 472  LEU A C     1 
ATOM   3564  O  O     . LEU A 1  472  ? 1.721   -54.976  44.801  1.00 58.19  ? 472  LEU A O     1 
ATOM   3565  C  CB    . LEU A 1  472  ? -1.098  -55.079  43.343  1.00 54.15  ? 472  LEU A CB    1 
ATOM   3566  C  CG    . LEU A 1  472  ? -1.762  -53.709  43.287  1.00 57.03  ? 472  LEU A CG    1 
ATOM   3567  C  CD1   . LEU A 1  472  ? -2.949  -53.735  42.409  1.00 57.76  ? 472  LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A 1  472  ? -2.116  -53.231  44.650  1.00 56.49  ? 472  LEU A CD2   1 
ATOM   3569  N  N     . SER A 1  473  ? 1.670   -56.975  43.773  1.00 59.75  ? 473  SER A N     1 
ATOM   3570  C  CA    . SER A 1  473  ? 2.551   -57.611  44.747  1.00 60.80  ? 473  SER A CA    1 
ATOM   3571  C  C     . SER A 1  473  ? 4.051   -57.355  44.524  1.00 67.53  ? 473  SER A C     1 
ATOM   3572  O  O     . SER A 1  473  ? 4.873   -58.009  45.164  1.00 70.65  ? 473  SER A O     1 
ATOM   3573  C  CB    . SER A 1  473  ? 2.210   -59.093  44.931  1.00 63.42  ? 473  SER A CB    1 
ATOM   3574  O  OG    . SER A 1  473  ? 1.062   -59.271  45.750  1.00 66.42  ? 473  SER A OG    1 
ATOM   3575  N  N     . VAL A 1  474  ? 4.407   -56.393  43.652  1.00 61.88  ? 474  VAL A N     1 
ATOM   3576  C  CA    . VAL A 1  474  ? 5.799   -56.017  43.391  1.00 61.47  ? 474  VAL A CA    1 
ATOM   3577  C  C     . VAL A 1  474  ? 6.025   -54.556  43.872  1.00 67.14  ? 474  VAL A C     1 
ATOM   3578  O  O     . VAL A 1  474  ? 7.142   -54.025  43.884  1.00 66.88  ? 474  VAL A O     1 
ATOM   3579  C  CB    . VAL A 1  474  ? 6.192   -56.308  41.919  1.00 65.25  ? 474  VAL A CB    1 
ATOM   3580  C  CG1   . VAL A 1  474  ? 5.780   -55.185  40.985  1.00 64.71  ? 474  VAL A CG1   1 
ATOM   3581  C  CG2   . VAL A 1  474  ? 7.674   -56.595  41.790  1.00 65.42  ? 474  VAL A CG2   1 
ATOM   3582  N  N     . THR A 1  475  ? 4.918   -53.949  44.322  1.00 64.14  ? 475  THR A N     1 
ATOM   3583  C  CA    . THR A 1  475  ? 4.764   -52.608  44.864  1.00 62.74  ? 475  THR A CA    1 
ATOM   3584  C  C     . THR A 1  475  ? 5.759   -52.354  46.000  1.00 66.02  ? 475  THR A C     1 
ATOM   3585  O  O     . THR A 1  475  ? 6.481   -51.367  45.967  1.00 66.37  ? 475  THR A O     1 
ATOM   3586  C  CB    . THR A 1  475  ? 3.256   -52.423  45.237  1.00 67.25  ? 475  THR A CB    1 
ATOM   3587  O  OG1   . THR A 1  475  ? 2.697   -51.245  44.652  1.00 63.36  ? 475  THR A OG1   1 
ATOM   3588  C  CG2   . THR A 1  475  ? 2.928   -52.597  46.759  1.00 63.59  ? 475  THR A CG2   1 
ATOM   3589  N  N     . SER A 1  476  ? 5.822   -53.262  46.965  1.00 62.41  ? 476  SER A N     1 
ATOM   3590  C  CA    . SER A 1  476  ? 6.655   -53.154  48.160  1.00 62.95  ? 476  SER A CA    1 
ATOM   3591  C  C     . SER A 1  476  ? 8.174   -53.131  47.952  1.00 64.47  ? 476  SER A C     1 
ATOM   3592  O  O     . SER A 1  476  ? 8.781   -52.184  48.466  1.00 63.20  ? 476  SER A O     1 
ATOM   3593  C  CB    . SER A 1  476  ? 6.225   -54.161  49.217  1.00 70.97  ? 476  SER A CB    1 
ATOM   3594  O  OG    . SER A 1  476  ? 4.906   -54.599  48.919  1.00 89.47  ? 476  SER A OG    1 
ATOM   3595  N  N     . PRO A 1  477  ? 8.830   -54.070  47.198  1.00 60.54  ? 477  PRO A N     1 
ATOM   3596  C  CA    . PRO A 1  477  ? 10.294  -53.958  47.019  1.00 60.30  ? 477  PRO A CA    1 
ATOM   3597  C  C     . PRO A 1  477  ? 10.732  -52.681  46.304  1.00 63.68  ? 477  PRO A C     1 
ATOM   3598  O  O     . PRO A 1  477  ? 11.847  -52.215  46.520  1.00 64.29  ? 477  PRO A O     1 
ATOM   3599  C  CB    . PRO A 1  477  ? 10.670  -55.224  46.244  1.00 62.56  ? 477  PRO A CB    1 
ATOM   3600  C  CG    . PRO A 1  477  ? 9.421   -55.667  45.600  1.00 67.27  ? 477  PRO A CG    1 
ATOM   3601  C  CD    . PRO A 1  477  ? 8.317   -55.289  46.537  1.00 62.53  ? 477  PRO A CD    1 
ATOM   3602  N  N     . TYR A 1  478  ? 9.821   -52.096  45.501  1.00 59.06  ? 478  TYR A N     1 
ATOM   3603  C  CA    . TYR A 1  478  ? 10.006  -50.859  44.738  1.00 57.24  ? 478  TYR A CA    1 
ATOM   3604  C  C     . TYR A 1  478  ? 9.684   -49.616  45.541  1.00 61.48  ? 478  TYR A C     1 
ATOM   3605  O  O     . TYR A 1  478  ? 10.205  -48.537  45.228  1.00 60.52  ? 478  TYR A O     1 
ATOM   3606  C  CB    . TYR A 1  478  ? 9.130   -50.894  43.469  1.00 56.11  ? 478  TYR A CB    1 
ATOM   3607  C  CG    . TYR A 1  478  ? 9.711   -51.770  42.386  1.00 56.32  ? 478  TYR A CG    1 
ATOM   3608  C  CD1   . TYR A 1  478  ? 8.923   -52.697  41.719  1.00 58.52  ? 478  TYR A CD1   1 
ATOM   3609  C  CD2   . TYR A 1  478  ? 11.056  -51.682  42.034  1.00 56.65  ? 478  TYR A CD2   1 
ATOM   3610  C  CE1   . TYR A 1  478  ? 9.456   -53.514  40.721  1.00 58.41  ? 478  TYR A CE1   1 
ATOM   3611  C  CE2   . TYR A 1  478  ? 11.597  -52.484  41.034  1.00 57.30  ? 478  TYR A CE2   1 
ATOM   3612  C  CZ    . TYR A 1  478  ? 10.794  -53.403  40.386  1.00 60.30  ? 478  TYR A CZ    1 
ATOM   3613  O  OH    . TYR A 1  478  ? 11.328  -54.215  39.431  1.00 55.80  ? 478  TYR A OH    1 
ATOM   3614  N  N     . ASN A 1  479  ? 8.818   -49.784  46.570  1.00 59.70  ? 479  ASN A N     1 
ATOM   3615  C  CA    . ASN A 1  479  ? 8.230   -48.760  47.445  1.00 61.18  ? 479  ASN A CA    1 
ATOM   3616  C  C     . ASN A 1  479  ? 7.449   -47.787  46.589  1.00 67.68  ? 479  ASN A C     1 
ATOM   3617  O  O     . ASN A 1  479  ? 7.602   -46.559  46.663  1.00 67.26  ? 479  ASN A O     1 
ATOM   3618  C  CB    . ASN A 1  479  ? 9.237   -48.061  48.386  1.00 66.76  ? 479  ASN A CB    1 
ATOM   3619  C  CG    . ASN A 1  479  ? 8.612   -47.263  49.528  1.00 97.40  ? 479  ASN A CG    1 
ATOM   3620  O  OD1   . ASN A 1  479  ? 7.376   -47.128  49.686  1.00 85.12  ? 479  ASN A OD1   1 
ATOM   3621  N  ND2   . ASN A 1  479  ? 9.479   -46.683  50.339  1.00 97.22  ? 479  ASN A ND2   1 
ATOM   3622  N  N     . ALA A 1  480  ? 6.608   -48.379  45.751  1.00 65.73  ? 480  ALA A N     1 
ATOM   3623  C  CA    . ALA A 1  480  ? 5.769   -47.681  44.809  1.00 65.27  ? 480  ALA A CA    1 
ATOM   3624  C  C     . ALA A 1  480  ? 4.326   -47.699  45.266  1.00 71.21  ? 480  ALA A C     1 
ATOM   3625  O  O     . ALA A 1  480  ? 3.897   -48.579  46.029  1.00 71.57  ? 480  ALA A O     1 
ATOM   3626  C  CB    . ALA A 1  480  ? 5.878   -48.359  43.454  1.00 65.80  ? 480  ALA A CB    1 
ATOM   3627  N  N     . ASP A 1  481  ? 3.616   -46.648  44.860  1.00 67.76  ? 481  ASP A N     1 
ATOM   3628  C  CA    . ASP A 1  481  ? 2.178   -46.475  44.880  1.00 67.51  ? 481  ASP A CA    1 
ATOM   3629  C  C     . ASP A 1  481  ? 1.827   -45.829  43.555  1.00 68.67  ? 481  ASP A C     1 
ATOM   3630  O  O     . ASP A 1  481  ? 2.726   -45.543  42.766  1.00 67.97  ? 481  ASP A O     1 
ATOM   3631  C  CB    . ASP A 1  481  ? 1.571   -45.845  46.147  1.00 70.17  ? 481  ASP A CB    1 
ATOM   3632  C  CG    . ASP A 1  481  ? 2.044   -44.473  46.529  1.00 94.85  ? 481  ASP A CG    1 
ATOM   3633  O  OD1   . ASP A 1  481  ? 3.040   -43.996  45.929  1.00 97.70  ? 481  ASP A OD1   1 
ATOM   3634  O  OD2   . ASP A 1  481  ? 1.460   -43.890  47.480  1.00 106.27 ? 481  ASP A OD2   1 
ATOM   3635  N  N     . PHE A 1  482  ? 0.568   -45.747  43.227  1.00 63.98  ? 482  PHE A N     1 
ATOM   3636  C  CA    . PHE A 1  482  ? 0.205   -45.287  41.912  1.00 62.92  ? 482  PHE A CA    1 
ATOM   3637  C  C     . PHE A 1  482  ? -0.216  -43.847  41.861  1.00 66.96  ? 482  PHE A C     1 
ATOM   3638  O  O     . PHE A 1  482  ? -0.647  -43.397  40.804  1.00 68.49  ? 482  PHE A O     1 
ATOM   3639  C  CB    . PHE A 1  482  ? -0.812  -46.264  41.297  1.00 64.72  ? 482  PHE A CB    1 
ATOM   3640  C  CG    . PHE A 1  482  ? -0.308  -47.696  41.325  1.00 66.34  ? 482  PHE A CG    1 
ATOM   3641  C  CD1   . PHE A 1  482  ? -0.890  -48.638  42.158  1.00 69.09  ? 482  PHE A CD1   1 
ATOM   3642  C  CD2   . PHE A 1  482  ? 0.789   -48.085  40.555  1.00 68.38  ? 482  PHE A CD2   1 
ATOM   3643  C  CE1   . PHE A 1  482  ? -0.405  -49.956  42.203  1.00 70.22  ? 482  PHE A CE1   1 
ATOM   3644  C  CE2   . PHE A 1  482  ? 1.277   -49.397  40.603  1.00 71.07  ? 482  PHE A CE2   1 
ATOM   3645  C  CZ    . PHE A 1  482  ? 0.686   -50.319  41.442  1.00 69.23  ? 482  PHE A CZ    1 
ATOM   3646  N  N     . ASP A 1  483  ? 0.002   -43.091  42.960  1.00 61.89  ? 483  ASP A N     1 
ATOM   3647  C  CA    . ASP A 1  483  ? -0.362  -41.673  43.079  1.00 61.13  ? 483  ASP A CA    1 
ATOM   3648  C  C     . ASP A 1  483  ? 0.309   -40.716  42.096  1.00 64.64  ? 483  ASP A C     1 
ATOM   3649  O  O     . ASP A 1  483  ? 0.152   -39.509  42.223  1.00 64.50  ? 483  ASP A O     1 
ATOM   3650  C  CB    . ASP A 1  483  ? -0.205  -41.159  44.528  1.00 62.80  ? 483  ASP A CB    1 
ATOM   3651  C  CG    . ASP A 1  483  ? 1.200   -41.154  45.100  1.00 74.86  ? 483  ASP A CG    1 
ATOM   3652  O  OD1   . ASP A 1  483  ? 1.334   -41.303  46.328  1.00 78.55  ? 483  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP A 1  483  ? 2.162   -40.930  44.332  1.00 77.72  ? 483  ASP A OD2   1 
ATOM   3654  N  N     . GLY A 1  484  ? 1.073   -41.238  41.158  1.00 61.43  ? 484  GLY A N     1 
ATOM   3655  C  CA    . GLY A 1  484  ? 1.756   -40.394  40.193  1.00 61.34  ? 484  GLY A CA    1 
ATOM   3656  C  C     . GLY A 1  484  ? 3.203   -40.747  39.983  1.00 65.37  ? 484  GLY A C     1 
ATOM   3657  O  O     . GLY A 1  484  ? 3.877   -40.090  39.180  1.00 66.23  ? 484  GLY A O     1 
ATOM   3658  N  N     . ASP A 1  485  ? 3.679   -41.794  40.699  1.00 60.23  ? 485  ASP A N     1 
ATOM   3659  C  CA    . ASP A 1  485  ? 5.038   -42.327  40.612  1.00 59.37  ? 485  ASP A CA    1 
ATOM   3660  C  C     . ASP A 1  485  ? 5.359   -42.694  39.167  1.00 61.87  ? 485  ASP A C     1 
ATOM   3661  O  O     . ASP A 1  485  ? 4.465   -43.151  38.422  1.00 62.00  ? 485  ASP A O     1 
ATOM   3662  C  CB    . ASP A 1  485  ? 5.161   -43.623  41.441  1.00 61.43  ? 485  ASP A CB    1 
ATOM   3663  C  CG    . ASP A 1  485  ? 5.014   -43.514  42.946  1.00 70.62  ? 485  ASP A CG    1 
ATOM   3664  O  OD1   . ASP A 1  485  ? 4.323   -42.571  43.413  1.00 70.22  ? 485  ASP A OD1   1 
ATOM   3665  O  OD2   . ASP A 1  485  ? 5.510   -44.431  43.659  1.00 75.35  ? 485  ASP A OD2   1 
ATOM   3666  N  N     . GLU A 1  486  ? 6.630   -42.483  38.775  1.00 55.61  ? 486  GLU A N     1 
ATOM   3667  C  CA    . GLU A 1  486  ? 7.137   -42.851  37.449  1.00 54.71  ? 486  GLU A CA    1 
ATOM   3668  C  C     . GLU A 1  486  ? 8.226   -43.896  37.654  1.00 60.07  ? 486  GLU A C     1 
ATOM   3669  O  O     . GLU A 1  486  ? 8.887   -43.895  38.706  1.00 60.60  ? 486  GLU A O     1 
ATOM   3670  C  CB    . GLU A 1  486  ? 7.747   -41.656  36.710  1.00 55.26  ? 486  GLU A CB    1 
ATOM   3671  C  CG    . GLU A 1  486  ? 6.769   -40.673  36.109  1.00 62.80  ? 486  GLU A CG    1 
ATOM   3672  C  CD    . GLU A 1  486  ? 7.500   -39.467  35.548  1.00 86.36  ? 486  GLU A CD    1 
ATOM   3673  O  OE1   . GLU A 1  486  ? 7.976   -38.637  36.359  1.00 74.20  ? 486  GLU A OE1   1 
ATOM   3674  O  OE2   . GLU A 1  486  ? 7.655   -39.383  34.304  1.00 78.23  ? 486  GLU A OE2   1 
ATOM   3675  N  N     . MET A 1  487  ? 8.429   -44.788  36.663  1.00 55.76  ? 487  MET A N     1 
ATOM   3676  C  CA    . MET A 1  487  ? 9.498   -45.790  36.765  1.00 54.83  ? 487  MET A CA    1 
ATOM   3677  C  C     . MET A 1  487  ? 10.353  -45.883  35.513  1.00 62.50  ? 487  MET A C     1 
ATOM   3678  O  O     . MET A 1  487  ? 9.894   -45.525  34.416  1.00 62.52  ? 487  MET A O     1 
ATOM   3679  C  CB    . MET A 1  487  ? 8.983   -47.149  37.218  1.00 55.78  ? 487  MET A CB    1 
ATOM   3680  C  CG    . MET A 1  487  ? 8.866   -47.262  38.702  1.00 56.86  ? 487  MET A CG    1 
ATOM   3681  S  SD    . MET A 1  487  ? 8.811   -48.971  39.234  1.00 59.34  ? 487  MET A SD    1 
ATOM   3682  C  CE    . MET A 1  487  ? 7.260   -48.974  39.897  1.00 55.04  ? 487  MET A CE    1 
ATOM   3683  N  N     . ASN A 1  488  ? 11.616  -46.301  35.694  1.00 60.43  ? 488  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  488  ? 12.572  -46.401  34.600  1.00 61.83  ? 488  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  488  ? 12.667  -47.826  34.087  1.00 65.72  ? 488  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  488  ? 12.507  -48.759  34.873  1.00 66.95  ? 488  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  488  ? 13.940  -45.907  35.053  1.00 69.38  ? 488  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  488  ? 14.045  -44.425  35.313  1.00 105.83 ? 488  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  488  ? 13.053  -43.725  35.542  1.00 97.50  ? 488  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  488  ? 15.281  -43.935  35.357  1.00 103.52 ? 488  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  489  ? 12.966  -47.999  32.788  1.00 60.35  ? 489  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  489  ? 13.065  -49.318  32.170  1.00 60.55  ? 489  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  489  ? 14.271  -49.365  31.250  1.00 67.26  ? 489  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  489  ? 14.392  -48.528  30.367  1.00 67.38  ? 489  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  489  ? 11.768  -49.596  31.401  1.00 60.07  ? 489  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  489  ? 11.593  -50.933  30.741  1.00 63.56  ? 489  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  489  ? 10.383  -51.628  31.302  1.00 63.83  ? 489  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  489  ? 11.459  -50.765  29.274  1.00 61.06  ? 489  LEU A CD2   1 
ATOM   3699  N  N     . HIS A 1  490  ? 15.176  -50.315  31.476  1.00 65.99  ? 490  HIS A N     1 
ATOM   3700  C  CA    . HIS A 1  490  ? 16.408  -50.462  30.696  1.00 67.20  ? 490  HIS A CA    1 
ATOM   3701  C  C     . HIS A 1  490  ? 16.365  -51.747  29.939  1.00 73.45  ? 490  HIS A C     1 
ATOM   3702  O  O     . HIS A 1  490  ? 15.857  -52.743  30.452  1.00 74.70  ? 490  HIS A O     1 
ATOM   3703  C  CB    . HIS A 1  490  ? 17.640  -50.439  31.599  1.00 68.35  ? 490  HIS A CB    1 
ATOM   3704  C  CG    . HIS A 1  490  ? 17.761  -49.185  32.408  1.00 71.77  ? 490  HIS A CG    1 
ATOM   3705  N  ND1   . HIS A 1  490  ? 18.563  -48.138  31.998  1.00 74.06  ? 490  HIS A ND1   1 
ATOM   3706  C  CD2   . HIS A 1  490  ? 17.165  -48.847  33.578  1.00 73.18  ? 490  HIS A CD2   1 
ATOM   3707  C  CE1   . HIS A 1  490  ? 18.452  -47.212  32.938  1.00 73.05  ? 490  HIS A CE1   1 
ATOM   3708  N  NE2   . HIS A 1  490  ? 17.628  -47.598  33.914  1.00 72.81  ? 490  HIS A NE2   1 
ATOM   3709  N  N     . VAL A 1  491  ? 16.897  -51.740  28.717  1.00 69.85  ? 491  VAL A N     1 
ATOM   3710  C  CA    . VAL A 1  491  ? 16.870  -52.906  27.841  1.00 69.35  ? 491  VAL A CA    1 
ATOM   3711  C  C     . VAL A 1  491  ? 18.271  -53.529  27.645  1.00 74.91  ? 491  VAL A C     1 
ATOM   3712  O  O     . VAL A 1  491  ? 19.202  -52.842  27.234  1.00 73.70  ? 491  VAL A O     1 
ATOM   3713  C  CB    . VAL A 1  491  ? 16.182  -52.566  26.486  1.00 71.74  ? 491  VAL A CB    1 
ATOM   3714  C  CG1   . VAL A 1  491  ? 16.237  -53.744  25.529  1.00 72.12  ? 491  VAL A CG1   1 
ATOM   3715  C  CG2   . VAL A 1  491  ? 14.745  -52.089  26.679  1.00 70.29  ? 491  VAL A CG2   1 
ATOM   3716  N  N     . PRO A 1  492  ? 18.443  -54.839  27.891  1.00 74.15  ? 492  PRO A N     1 
ATOM   3717  C  CA    . PRO A 1  492  ? 19.748  -55.457  27.594  1.00 75.02  ? 492  PRO A CA    1 
ATOM   3718  C  C     . PRO A 1  492  ? 19.941  -55.531  26.075  1.00 77.66  ? 492  PRO A C     1 
ATOM   3719  O  O     . PRO A 1  492  ? 18.969  -55.755  25.354  1.00 75.75  ? 492  PRO A O     1 
ATOM   3720  C  CB    . PRO A 1  492  ? 19.639  -56.850  28.225  1.00 77.44  ? 492  PRO A CB    1 
ATOM   3721  C  CG    . PRO A 1  492  ? 18.180  -57.138  28.273  1.00 81.81  ? 492  PRO A CG    1 
ATOM   3722  C  CD    . PRO A 1  492  ? 17.466  -55.826  28.399  1.00 76.13  ? 492  PRO A CD    1 
ATOM   3723  N  N     . GLN A 1  493  ? 21.175  -55.306  25.598  1.00 75.26  ? 493  GLN A N     1 
ATOM   3724  C  CA    . GLN A 1  493  ? 21.531  -55.341  24.178  1.00 76.06  ? 493  GLN A CA    1 
ATOM   3725  C  C     . GLN A 1  493  ? 22.300  -56.596  23.743  1.00 82.89  ? 493  GLN A C     1 
ATOM   3726  O  O     . GLN A 1  493  ? 22.408  -56.861  22.545  1.00 81.25  ? 493  GLN A O     1 
ATOM   3727  C  CB    . GLN A 1  493  ? 22.285  -54.055  23.791  1.00 77.18  ? 493  GLN A CB    1 
ATOM   3728  C  CG    . GLN A 1  493  ? 21.425  -52.968  23.106  1.00 79.80  ? 493  GLN A CG    1 
ATOM   3729  C  CD    . GLN A 1  493  ? 19.958  -52.952  23.496  1.00 85.45  ? 493  GLN A CD    1 
ATOM   3730  O  OE1   . GLN A 1  493  ? 19.084  -53.189  22.681  1.00 81.68  ? 493  GLN A OE1   1 
ATOM   3731  N  NE2   . GLN A 1  493  ? 19.644  -52.684  24.739  1.00 72.93  ? 493  GLN A NE2   1 
ATOM   3732  N  N     . SER A 1  494  ? 22.807  -57.378  24.720  1.00 83.99  ? 494  SER A N     1 
ATOM   3733  C  CA    . SER A 1  494  ? 23.581  -58.610  24.483  1.00 86.38  ? 494  SER A CA    1 
ATOM   3734  C  C     . SER A 1  494  ? 22.862  -59.888  24.959  1.00 88.88  ? 494  SER A C     1 
ATOM   3735  O  O     . SER A 1  494  ? 22.108  -59.828  25.939  1.00 87.01  ? 494  SER A O     1 
ATOM   3736  C  CB    . SER A 1  494  ? 24.946  -58.512  25.170  1.00 92.69  ? 494  SER A CB    1 
ATOM   3737  O  OG    . SER A 1  494  ? 25.824  -59.534  24.723  1.00 107.36 ? 494  SER A OG    1 
ATOM   3738  N  N     . GLU A 1  495  ? 23.155  -61.055  24.310  1.00 85.23  ? 495  GLU A N     1 
ATOM   3739  C  CA    . GLU A 1  495  ? 22.590  -62.345  24.733  1.00 85.05  ? 495  GLU A CA    1 
ATOM   3740  C  C     . GLU A 1  495  ? 23.041  -62.689  26.159  1.00 88.83  ? 495  GLU A C     1 
ATOM   3741  O  O     . GLU A 1  495  ? 22.259  -63.236  26.945  1.00 87.84  ? 495  GLU A O     1 
ATOM   3742  C  CB    . GLU A 1  495  ? 22.945  -63.491  23.764  1.00 87.47  ? 495  GLU A CB    1 
ATOM   3743  C  CG    . GLU A 1  495  ? 21.888  -63.776  22.698  1.00 98.42  ? 495  GLU A CG    1 
ATOM   3744  C  CD    . GLU A 1  495  ? 20.498  -64.255  23.104  1.00 114.28 ? 495  GLU A CD    1 
ATOM   3745  O  OE1   . GLU A 1  495  ? 19.555  -64.091  22.290  1.00 77.60  ? 495  GLU A OE1   1 
ATOM   3746  O  OE2   . GLU A 1  495  ? 20.352  -64.810  24.219  1.00 117.43 ? 495  GLU A OE2   1 
ATOM   3747  N  N     . GLU A 1  496  ? 24.287  -62.331  26.497  1.00 86.17  ? 496  GLU A N     1 
ATOM   3748  C  CA    . GLU A 1  496  ? 24.857  -62.576  27.822  1.00 86.70  ? 496  GLU A CA    1 
ATOM   3749  C  C     . GLU A 1  496  ? 24.311  -61.648  28.899  1.00 88.72  ? 496  GLU A C     1 
ATOM   3750  O  O     . GLU A 1  496  ? 24.281  -62.026  30.074  1.00 88.66  ? 496  GLU A O     1 
ATOM   3751  C  CB    . GLU A 1  496  ? 26.397  -62.581  27.792  1.00 89.44  ? 496  GLU A CB    1 
ATOM   3752  C  CG    . GLU A 1  496  ? 27.018  -61.454  26.982  1.00 104.55 ? 496  GLU A CG    1 
ATOM   3753  C  CD    . GLU A 1  496  ? 28.451  -61.655  26.526  1.00 140.45 ? 496  GLU A CD    1 
ATOM   3754  O  OE1   . GLU A 1  496  ? 29.003  -60.712  25.913  1.00 145.10 ? 496  GLU A OE1   1 
ATOM   3755  O  OE2   . GLU A 1  496  ? 29.018  -62.748  26.767  1.00 137.64 ? 496  GLU A OE2   1 
ATOM   3756  N  N     . THR A 1  497  ? 23.882  -60.437  28.493  1.00 83.31  ? 497  THR A N     1 
ATOM   3757  C  CA    . THR A 1  497  ? 23.313  -59.393  29.355  1.00 80.78  ? 497  THR A CA    1 
ATOM   3758  C  C     . THR A 1  497  ? 21.861  -59.753  29.737  1.00 80.29  ? 497  THR A C     1 
ATOM   3759  O  O     . THR A 1  497  ? 21.463  -59.543  30.884  1.00 77.78  ? 497  THR A O     1 
ATOM   3760  C  CB    . THR A 1  497  ? 23.475  -58.041  28.663  1.00 88.41  ? 497  THR A CB    1 
ATOM   3761  O  OG1   . THR A 1  497  ? 24.868  -57.779  28.498  1.00 88.33  ? 497  THR A OG1   1 
ATOM   3762  C  CG2   . THR A 1  497  ? 22.886  -56.930  29.443  1.00 87.24  ? 497  THR A CG2   1 
ATOM   3763  N  N     . ARG A 1  498  ? 21.094  -60.333  28.775  1.00 75.25  ? 498  ARG A N     1 
ATOM   3764  C  CA    . ARG A 1  498  ? 19.721  -60.817  28.975  1.00 72.96  ? 498  ARG A CA    1 
ATOM   3765  C  C     . ARG A 1  498  ? 19.739  -61.955  30.000  1.00 75.07  ? 498  ARG A C     1 
ATOM   3766  O  O     . ARG A 1  498  ? 18.853  -62.001  30.854  1.00 74.65  ? 498  ARG A O     1 
ATOM   3767  C  CB    . ARG A 1  498  ? 19.116  -61.346  27.670  1.00 69.98  ? 498  ARG A CB    1 
ATOM   3768  C  CG    . ARG A 1  498  ? 19.198  -60.399  26.513  1.00 72.94  ? 498  ARG A CG    1 
ATOM   3769  C  CD    . ARG A 1  498  ? 18.690  -61.067  25.260  1.00 82.79  ? 498  ARG A CD    1 
ATOM   3770  N  NE    . ARG A 1  498  ? 17.280  -60.754  25.037  1.00 85.44  ? 498  ARG A NE    1 
ATOM   3771  C  CZ    . ARG A 1  498  ? 16.308  -61.656  25.002  1.00 87.50  ? 498  ARG A CZ    1 
ATOM   3772  N  NH1   . ARG A 1  498  ? 16.587  -62.950  25.130  1.00 73.98  ? 498  ARG A NH1   1 
ATOM   3773  N  NH2   . ARG A 1  498  ? 15.052  -61.276  24.838  1.00 62.98  ? 498  ARG A NH2   1 
ATOM   3774  N  N     . ALA A 1  499  ? 20.747  -62.870  29.913  1.00 69.97  ? 499  ALA A N     1 
ATOM   3775  C  CA    . ALA A 1  499  ? 20.922  -63.990  30.847  1.00 69.68  ? 499  ALA A CA    1 
ATOM   3776  C  C     . ALA A 1  499  ? 21.134  -63.446  32.281  1.00 72.65  ? 499  ALA A C     1 
ATOM   3777  O  O     . ALA A 1  499  ? 20.387  -63.810  33.190  1.00 72.51  ? 499  ALA A O     1 
ATOM   3778  C  CB    . ALA A 1  499  ? 22.098  -64.868  30.420  1.00 71.42  ? 499  ALA A CB    1 
ATOM   3779  N  N     . GLU A 1  500  ? 22.079  -62.500  32.454  1.00 66.68  ? 500  GLU A N     1 
ATOM   3780  C  CA    . GLU A 1  500  ? 22.349  -61.873  33.732  1.00 64.77  ? 500  GLU A CA    1 
ATOM   3781  C  C     . GLU A 1  500  ? 21.064  -61.444  34.420  1.00 67.89  ? 500  GLU A C     1 
ATOM   3782  O  O     . GLU A 1  500  ? 20.862  -61.806  35.566  1.00 68.12  ? 500  GLU A O     1 
ATOM   3783  C  CB    . GLU A 1  500  ? 23.307  -60.704  33.551  1.00 65.62  ? 500  GLU A CB    1 
ATOM   3784  C  CG    . GLU A 1  500  ? 24.571  -60.895  34.352  1.00 72.67  ? 500  GLU A CG    1 
ATOM   3785  C  CD    . GLU A 1  500  ? 25.830  -60.383  33.693  1.00 82.05  ? 500  GLU A CD    1 
ATOM   3786  O  OE1   . GLU A 1  500  ? 26.105  -59.169  33.813  1.00 76.93  ? 500  GLU A OE1   1 
ATOM   3787  O  OE2   . GLU A 1  500  ? 26.550  -61.197  33.069  1.00 67.20  ? 500  GLU A OE2   1 
ATOM   3788  N  N     . LEU A 1  501  ? 20.158  -60.772  33.694  1.00 64.23  ? 501  LEU A N     1 
ATOM   3789  C  CA    . LEU A 1  501  ? 18.854  -60.327  34.192  1.00 63.34  ? 501  LEU A CA    1 
ATOM   3790  C  C     . LEU A 1  501  ? 17.984  -61.537  34.558  1.00 67.26  ? 501  LEU A C     1 
ATOM   3791  O  O     . LEU A 1  501  ? 17.720  -61.761  35.738  1.00 67.79  ? 501  LEU A O     1 
ATOM   3792  C  CB    . LEU A 1  501  ? 18.113  -59.469  33.135  1.00 63.11  ? 501  LEU A CB    1 
ATOM   3793  C  CG    . LEU A 1  501  ? 18.730  -58.164  32.614  1.00 68.19  ? 501  LEU A CG    1 
ATOM   3794  C  CD1   . LEU A 1  501  ? 17.657  -57.275  32.006  1.00 67.90  ? 501  LEU A CD1   1 
ATOM   3795  C  CD2   . LEU A 1  501  ? 19.410  -57.372  33.714  1.00 71.06  ? 501  LEU A CD2   1 
ATOM   3796  N  N     . SER A 1  502  ? 17.571  -62.329  33.548  1.00 62.66  ? 502  SER A N     1 
ATOM   3797  C  CA    . SER A 1  502  ? 16.718  -63.513  33.686  1.00 62.17  ? 502  SER A CA    1 
ATOM   3798  C  C     . SER A 1  502  ? 17.231  -64.585  34.676  1.00 65.49  ? 502  SER A C     1 
ATOM   3799  O  O     . SER A 1  502  ? 16.433  -65.380  35.192  1.00 64.28  ? 502  SER A O     1 
ATOM   3800  C  CB    . SER A 1  502  ? 16.499  -64.147  32.322  1.00 65.92  ? 502  SER A CB    1 
ATOM   3801  O  OG    . SER A 1  502  ? 17.728  -64.641  31.817  1.00 76.12  ? 502  SER A OG    1 
ATOM   3802  N  N     . GLN A 1  503  ? 18.548  -64.601  34.940  1.00 62.02  ? 503  GLN A N     1 
ATOM   3803  C  CA    . GLN A 1  503  ? 19.151  -65.608  35.808  1.00 62.44  ? 503  GLN A CA    1 
ATOM   3804  C  C     . GLN A 1  503  ? 19.591  -65.131  37.173  1.00 63.95  ? 503  GLN A C     1 
ATOM   3805  O  O     . GLN A 1  503  ? 19.849  -65.959  38.038  1.00 62.06  ? 503  GLN A O     1 
ATOM   3806  C  CB    . GLN A 1  503  ? 20.283  -66.377  35.087  1.00 64.95  ? 503  GLN A CB    1 
ATOM   3807  C  CG    . GLN A 1  503  ? 19.894  -67.051  33.757  1.00 66.37  ? 503  GLN A CG    1 
ATOM   3808  C  CD    . GLN A 1  503  ? 18.586  -67.794  33.800  1.00 90.17  ? 503  GLN A CD    1 
ATOM   3809  O  OE1   . GLN A 1  503  ? 17.639  -67.438  33.082  1.00 90.30  ? 503  GLN A OE1   1 
ATOM   3810  N  NE2   . GLN A 1  503  ? 18.485  -68.805  34.674  1.00 78.35  ? 503  GLN A NE2   1 
ATOM   3811  N  N     . LEU A 1  504  ? 19.678  -63.817  37.371  1.00 61.07  ? 504  LEU A N     1 
ATOM   3812  C  CA    . LEU A 1  504  ? 20.091  -63.244  38.648  1.00 61.17  ? 504  LEU A CA    1 
ATOM   3813  C  C     . LEU A 1  504  ? 19.090  -62.175  39.131  1.00 68.53  ? 504  LEU A C     1 
ATOM   3814  O  O     . LEU A 1  504  ? 18.579  -62.283  40.248  1.00 70.76  ? 504  LEU A O     1 
ATOM   3815  C  CB    . LEU A 1  504  ? 21.527  -62.667  38.603  1.00 60.90  ? 504  LEU A CB    1 
ATOM   3816  C  CG    . LEU A 1  504  ? 22.653  -63.501  37.987  1.00 65.90  ? 504  LEU A CG    1 
ATOM   3817  C  CD1   . LEU A 1  504  ? 23.727  -62.611  37.454  1.00 65.53  ? 504  LEU A CD1   1 
ATOM   3818  C  CD2   . LEU A 1  504  ? 23.276  -64.440  38.999  1.00 69.07  ? 504  LEU A CD2   1 
ATOM   3819  N  N     . CYS A 1  505  ? 18.796  -61.166  38.303  1.00 64.26  ? 505  CYS A N     1 
ATOM   3820  C  CA    . CYS A 1  505  ? 17.920  -60.046  38.664  1.00 63.59  ? 505  CYS A CA    1 
ATOM   3821  C  C     . CYS A 1  505  ? 16.429  -60.296  38.605  1.00 64.52  ? 505  CYS A C     1 
ATOM   3822  O  O     . CYS A 1  505  ? 15.670  -59.393  38.974  1.00 63.09  ? 505  CYS A O     1 
ATOM   3823  C  CB    . CYS A 1  505  ? 18.302  -58.815  37.855  1.00 64.70  ? 505  CYS A CB    1 
ATOM   3824  S  SG    . CYS A 1  505  ? 20.081  -58.659  37.604  1.00 70.20  ? 505  CYS A SG    1 
ATOM   3825  N  N     . ALA A 1  506  ? 16.002  -61.481  38.108  1.00 59.79  ? 506  ALA A N     1 
ATOM   3826  C  CA    . ALA A 1  506  ? 14.595  -61.835  37.929  1.00 58.34  ? 506  ALA A CA    1 
ATOM   3827  C  C     . ALA A 1  506  ? 13.815  -61.739  39.208  1.00 61.23  ? 506  ALA A C     1 
ATOM   3828  O  O     . ALA A 1  506  ? 14.316  -62.122  40.273  1.00 61.59  ? 506  ALA A O     1 
ATOM   3829  C  CB    . ALA A 1  506  ? 14.466  -63.213  37.336  1.00 59.87  ? 506  ALA A CB    1 
ATOM   3830  N  N     . VAL A 1  507  ? 12.603  -61.148  39.093  1.00 55.96  ? 507  VAL A N     1 
ATOM   3831  C  CA    . VAL A 1  507  ? 11.615  -60.893  40.152  1.00 55.17  ? 507  VAL A CA    1 
ATOM   3832  C  C     . VAL A 1  507  ? 11.337  -62.144  40.997  1.00 62.61  ? 507  VAL A C     1 
ATOM   3833  O  O     . VAL A 1  507  ? 11.362  -62.020  42.231  1.00 63.14  ? 507  VAL A O     1 
ATOM   3834  C  CB    . VAL A 1  507  ? 10.298  -60.295  39.590  1.00 57.63  ? 507  VAL A CB    1 
ATOM   3835  C  CG1   . VAL A 1  507  ? 9.210   -60.204  40.656  1.00 56.68  ? 507  VAL A CG1   1 
ATOM   3836  C  CG2   . VAL A 1  507  ? 10.521  -58.947  38.909  1.00 56.56  ? 507  VAL A CG2   1 
ATOM   3837  N  N     . PRO A 1  508  ? 11.107  -63.353  40.398  1.00 60.06  ? 508  PRO A N     1 
ATOM   3838  C  CA    . PRO A 1  508  ? 10.830  -64.533  41.236  1.00 60.35  ? 508  PRO A CA    1 
ATOM   3839  C  C     . PRO A 1  508  ? 12.014  -64.913  42.090  1.00 64.43  ? 508  PRO A C     1 
ATOM   3840  O  O     . PRO A 1  508  ? 11.828  -65.353  43.222  1.00 65.43  ? 508  PRO A O     1 
ATOM   3841  C  CB    . PRO A 1  508  ? 10.474  -65.620  40.224  1.00 62.63  ? 508  PRO A CB    1 
ATOM   3842  C  CG    . PRO A 1  508  ? 10.095  -64.870  38.985  1.00 66.63  ? 508  PRO A CG    1 
ATOM   3843  C  CD    . PRO A 1  508  ? 11.029  -63.718  38.969  1.00 61.65  ? 508  PRO A CD    1 
ATOM   3844  N  N     . LEU A 1  509  ? 13.222  -64.659  41.582  1.00 60.00  ? 509  LEU A N     1 
ATOM   3845  C  CA    . LEU A 1  509  ? 14.449  -64.917  42.326  1.00 59.86  ? 509  LEU A CA    1 
ATOM   3846  C  C     . LEU A 1  509  ? 14.512  -64.023  43.554  1.00 65.59  ? 509  LEU A C     1 
ATOM   3847  O  O     . LEU A 1  509  ? 14.865  -64.483  44.646  1.00 66.04  ? 509  LEU A O     1 
ATOM   3848  C  CB    . LEU A 1  509  ? 15.672  -64.664  41.439  1.00 58.87  ? 509  LEU A CB    1 
ATOM   3849  C  CG    . LEU A 1  509  ? 15.732  -65.469  40.175  1.00 60.95  ? 509  LEU A CG    1 
ATOM   3850  C  CD1   . LEU A 1  509  ? 16.896  -65.075  39.356  1.00 60.33  ? 509  LEU A CD1   1 
ATOM   3851  C  CD2   . LEU A 1  509  ? 15.806  -66.922  40.479  1.00 61.81  ? 509  LEU A CD2   1 
ATOM   3852  N  N     . GLN A 1  510  ? 14.080  -62.767  43.377  1.00 62.07  ? 510  GLN A N     1 
ATOM   3853  C  CA    . GLN A 1  510  ? 14.090  -61.737  44.409  1.00 61.66  ? 510  GLN A CA    1 
ATOM   3854  C  C     . GLN A 1  510  ? 13.104  -61.885  45.571  1.00 65.31  ? 510  GLN A C     1 
ATOM   3855  O  O     . GLN A 1  510  ? 13.290  -61.208  46.586  1.00 62.75  ? 510  GLN A O     1 
ATOM   3856  C  CB    . GLN A 1  510  ? 14.039  -60.351  43.760  1.00 62.01  ? 510  GLN A CB    1 
ATOM   3857  C  CG    . GLN A 1  510  ? 15.249  -60.101  42.840  1.00 73.10  ? 510  GLN A CG    1 
ATOM   3858  C  CD    . GLN A 1  510  ? 16.601  -60.290  43.511  1.00 80.12  ? 510  GLN A CD    1 
ATOM   3859  O  OE1   . GLN A 1  510  ? 16.774  -60.050  44.712  1.00 77.46  ? 510  GLN A OE1   1 
ATOM   3860  N  NE2   . GLN A 1  510  ? 17.595  -60.728  42.751  1.00 61.97  ? 510  GLN A NE2   1 
ATOM   3861  N  N     . ILE A 1  511  ? 12.101  -62.805  45.435  1.00 63.33  ? 511  ILE A N     1 
ATOM   3862  C  CA    . ILE A 1  511  ? 11.020  -63.061  46.395  1.00 62.96  ? 511  ILE A CA    1 
ATOM   3863  C  C     . ILE A 1  511  ? 11.511  -63.173  47.817  1.00 70.10  ? 511  ILE A C     1 
ATOM   3864  O  O     . ILE A 1  511  ? 10.989  -62.463  48.669  1.00 69.90  ? 511  ILE A O     1 
ATOM   3865  C  CB    . ILE A 1  511  ? 10.025  -64.201  45.994  1.00 65.81  ? 511  ILE A CB    1 
ATOM   3866  C  CG1   . ILE A 1  511  ? 9.277   -63.893  44.649  1.00 64.64  ? 511  ILE A CG1   1 
ATOM   3867  C  CG2   . ILE A 1  511  ? 9.010   -64.449  47.128  1.00 65.98  ? 511  ILE A CG2   1 
ATOM   3868  C  CD1   . ILE A 1  511  ? 8.298   -64.999  44.118  1.00 60.45  ? 511  ILE A CD1   1 
ATOM   3869  N  N     . VAL A 1  512  ? 12.504  -64.048  48.087  1.00 68.95  ? 512  VAL A N     1 
ATOM   3870  C  CA    . VAL A 1  512  ? 13.057  -64.191  49.449  1.00 68.73  ? 512  VAL A CA    1 
ATOM   3871  C  C     . VAL A 1  512  ? 14.277  -63.255  49.609  1.00 74.75  ? 512  VAL A C     1 
ATOM   3872  O  O     . VAL A 1  512  ? 15.326  -63.491  48.988  1.00 74.85  ? 512  VAL A O     1 
ATOM   3873  C  CB    . VAL A 1  512  ? 13.280  -65.666  49.928  1.00 71.65  ? 512  VAL A CB    1 
ATOM   3874  C  CG1   . VAL A 1  512  ? 14.096  -65.722  51.208  1.00 71.50  ? 512  VAL A CG1   1 
ATOM   3875  C  CG2   . VAL A 1  512  ? 11.950  -66.374  50.145  1.00 71.16  ? 512  VAL A CG2   1 
ATOM   3876  N  N     . SER A 1  513  ? 14.088  -62.154  50.389  1.00 71.45  ? 513  SER A N     1 
ATOM   3877  C  CA    . SER A 1  513  ? 15.100  -61.128  50.640  1.00 71.48  ? 513  SER A CA    1 
ATOM   3878  C  C     . SER A 1  513  ? 16.223  -61.652  51.498  1.00 74.59  ? 513  SER A C     1 
ATOM   3879  O  O     . SER A 1  513  ? 15.964  -62.275  52.537  1.00 73.81  ? 513  SER A O     1 
ATOM   3880  C  CB    . SER A 1  513  ? 14.493  -59.870  51.277  1.00 77.02  ? 513  SER A CB    1 
ATOM   3881  O  OG    . SER A 1  513  ? 14.860  -59.617  52.634  1.00 87.63  ? 513  SER A OG    1 
ATOM   3882  N  N     . PRO A 1  514  ? 17.480  -61.339  51.105  1.00 71.16  ? 514  PRO A N     1 
ATOM   3883  C  CA    . PRO A 1  514  ? 18.622  -61.719  51.950  1.00 71.78  ? 514  PRO A CA    1 
ATOM   3884  C  C     . PRO A 1  514  ? 18.756  -60.722  53.102  1.00 77.79  ? 514  PRO A C     1 
ATOM   3885  O  O     . PRO A 1  514  ? 19.289  -61.047  54.145  1.00 78.63  ? 514  PRO A O     1 
ATOM   3886  C  CB    . PRO A 1  514  ? 19.807  -61.634  50.997  1.00 73.43  ? 514  PRO A CB    1 
ATOM   3887  C  CG    . PRO A 1  514  ? 19.416  -60.568  50.020  1.00 77.02  ? 514  PRO A CG    1 
ATOM   3888  C  CD    . PRO A 1  514  ? 17.911  -60.561  49.921  1.00 71.96  ? 514  PRO A CD    1 
ATOM   3889  N  N     . GLN A 1  515  ? 18.237  -59.508  52.905  1.00 74.92  ? 515  GLN A N     1 
ATOM   3890  C  CA    . GLN A 1  515  ? 18.243  -58.408  53.853  1.00 74.64  ? 515  GLN A CA    1 
ATOM   3891  C  C     . GLN A 1  515  ? 17.777  -58.850  55.239  1.00 77.19  ? 515  GLN A C     1 
ATOM   3892  O  O     . GLN A 1  515  ? 18.542  -58.760  56.199  1.00 75.63  ? 515  GLN A O     1 
ATOM   3893  C  CB    . GLN A 1  515  ? 17.366  -57.253  53.298  1.00 75.17  ? 515  GLN A CB    1 
ATOM   3894  C  CG    . GLN A 1  515  ? 17.260  -56.031  54.221  1.00 82.36  ? 515  GLN A CG    1 
ATOM   3895  C  CD    . GLN A 1  515  ? 16.706  -54.852  53.481  1.00 88.13  ? 515  GLN A CD    1 
ATOM   3896  O  OE1   . GLN A 1  515  ? 17.163  -54.506  52.385  1.00 73.91  ? 515  GLN A OE1   1 
ATOM   3897  N  NE2   . GLN A 1  515  ? 15.716  -54.204  54.074  1.00 83.53  ? 515  GLN A NE2   1 
ATOM   3898  N  N     . SER A 1  516  ? 16.536  -59.355  55.313  1.00 74.54  ? 516  SER A N     1 
ATOM   3899  C  CA    . SER A 1  516  ? 15.896  -59.743  56.555  1.00 75.13  ? 516  SER A CA    1 
ATOM   3900  C  C     . SER A 1  516  ? 15.536  -61.227  56.615  1.00 80.03  ? 516  SER A C     1 
ATOM   3901  O  O     . SER A 1  516  ? 14.667  -61.625  57.401  1.00 80.39  ? 516  SER A O     1 
ATOM   3902  C  CB    . SER A 1  516  ? 14.682  -58.853  56.802  1.00 79.38  ? 516  SER A CB    1 
ATOM   3903  O  OG    . SER A 1  516  ? 15.060  -57.482  56.782  1.00 91.00  ? 516  SER A OG    1 
ATOM   3904  N  N     . ASN A 1  517  ? 16.241  -62.052  55.800  1.00 75.99  ? 517  ASN A N     1 
ATOM   3905  C  CA    . ASN A 1  517  ? 16.110  -63.513  55.689  1.00 75.65  ? 517  ASN A CA    1 
ATOM   3906  C  C     . ASN A 1  517  ? 14.665  -64.043  55.534  1.00 78.06  ? 517  ASN A C     1 
ATOM   3907  O  O     . ASN A 1  517  ? 14.397  -65.246  55.650  1.00 79.60  ? 517  ASN A O     1 
ATOM   3908  C  CB    . ASN A 1  517  ? 16.919  -64.233  56.785  1.00 74.24  ? 517  ASN A CB    1 
ATOM   3909  C  CG    . ASN A 1  517  ? 16.447  -64.058  58.199  1.00 84.50  ? 517  ASN A CG    1 
ATOM   3910  O  OD1   . ASN A 1  517  ? 15.441  -64.621  58.611  1.00 84.19  ? 517  ASN A OD1   1 
ATOM   3911  N  ND2   . ASN A 1  517  ? 17.219  -63.353  59.000  1.00 70.33  ? 517  ASN A ND2   1 
ATOM   3912  N  N     . LYS A 1  518  ? 13.754  -63.130  55.224  1.00 70.96  ? 518  LYS A N     1 
ATOM   3913  C  CA    . LYS A 1  518  ? 12.335  -63.381  55.086  1.00 69.26  ? 518  LYS A CA    1 
ATOM   3914  C  C     . LYS A 1  518  ? 11.920  -62.885  53.695  1.00 70.50  ? 518  LYS A C     1 
ATOM   3915  O  O     . LYS A 1  518  ? 12.721  -62.164  53.087  1.00 69.31  ? 518  LYS A O     1 
ATOM   3916  C  CB    . LYS A 1  518  ? 11.598  -62.684  56.275  1.00 70.50  ? 518  LYS A CB    1 
ATOM   3917  C  CG    . LYS A 1  518  ? 10.615  -61.550  55.965  1.00 70.12  ? 518  LYS A CG    1 
ATOM   3918  C  CD    . LYS A 1  518  ? 11.085  -60.172  56.413  1.00 70.70  ? 518  LYS A CD    1 
ATOM   3919  C  CE    . LYS A 1  518  ? 10.603  -59.073  55.475  1.00 82.82  ? 518  LYS A CE    1 
ATOM   3920  N  NZ    . LYS A 1  518  ? 9.115   -58.952  55.405  1.00 84.77  ? 518  LYS A NZ    1 
ATOM   3921  N  N     . PRO A 1  519  ? 10.734  -63.270  53.137  1.00 65.97  ? 519  PRO A N     1 
ATOM   3922  C  CA    . PRO A 1  519  ? 10.369  -62.752  51.806  1.00 64.38  ? 519  PRO A CA    1 
ATOM   3923  C  C     . PRO A 1  519  ? 10.091  -61.257  51.820  1.00 66.59  ? 519  PRO A C     1 
ATOM   3924  O  O     . PRO A 1  519  ? 9.827   -60.679  52.867  1.00 65.86  ? 519  PRO A O     1 
ATOM   3925  C  CB    . PRO A 1  519  ? 9.127   -63.547  51.423  1.00 66.41  ? 519  PRO A CB    1 
ATOM   3926  C  CG    . PRO A 1  519  ? 8.603   -64.123  52.682  1.00 71.66  ? 519  PRO A CG    1 
ATOM   3927  C  CD    . PRO A 1  519  ? 9.688   -64.164  53.685  1.00 67.86  ? 519  PRO A CD    1 
ATOM   3928  N  N     . CYS A 1  520  ? 10.148  -60.632  50.657  1.00 62.34  ? 520  CYS A N     1 
ATOM   3929  C  CA    . CYS A 1  520  ? 9.935   -59.202  50.543  1.00 60.59  ? 520  CYS A CA    1 
ATOM   3930  C  C     . CYS A 1  520  ? 8.714   -58.792  49.710  1.00 65.42  ? 520  CYS A C     1 
ATOM   3931  O  O     . CYS A 1  520  ? 8.579   -57.607  49.374  1.00 66.18  ? 520  CYS A O     1 
ATOM   3932  C  CB    . CYS A 1  520  ? 11.209  -58.525  50.054  1.00 59.89  ? 520  CYS A CB    1 
ATOM   3933  S  SG    . CYS A 1  520  ? 11.586  -58.834  48.318  1.00 63.36  ? 520  CYS A SG    1 
ATOM   3934  N  N     . MET A 1  521  ? 7.825   -59.750  49.391  1.00 61.51  ? 521  MET A N     1 
ATOM   3935  C  CA    . MET A 1  521  ? 6.621   -59.516  48.578  1.00 61.41  ? 521  MET A CA    1 
ATOM   3936  C  C     . MET A 1  521  ? 5.511   -60.413  49.077  1.00 67.18  ? 521  MET A C     1 
ATOM   3937  O  O     . MET A 1  521  ? 5.741   -61.600  49.267  1.00 69.47  ? 521  MET A O     1 
ATOM   3938  C  CB    . MET A 1  521  ? 6.887   -59.862  47.105  1.00 63.71  ? 521  MET A CB    1 
ATOM   3939  C  CG    . MET A 1  521  ? 7.895   -58.973  46.438  1.00 66.29  ? 521  MET A CG    1 
ATOM   3940  S  SD    . MET A 1  521  ? 8.854   -59.865  45.200  1.00 70.16  ? 521  MET A SD    1 
ATOM   3941  C  CE    . MET A 1  521  ? 7.871   -59.610  43.857  1.00 66.07  ? 521  MET A CE    1 
ATOM   3942  N  N     . GLY A 1  522  ? 4.319   -59.872  49.256  1.00 62.45  ? 522  GLY A N     1 
ATOM   3943  C  CA    . GLY A 1  522  ? 3.198   -60.656  49.754  1.00 62.65  ? 522  GLY A CA    1 
ATOM   3944  C  C     . GLY A 1  522  ? 1.884   -60.252  49.147  1.00 67.60  ? 522  GLY A C     1 
ATOM   3945  O  O     . GLY A 1  522  ? 1.870   -59.522  48.151  1.00 67.37  ? 522  GLY A O     1 
ATOM   3946  N  N     . ILE A 1  523  ? 0.768   -60.748  49.732  1.00 64.79  ? 523  ILE A N     1 
ATOM   3947  C  CA    . ILE A 1  523  ? -0.589  -60.413  49.274  1.00 64.38  ? 523  ILE A CA    1 
ATOM   3948  C  C     . ILE A 1  523  ? -1.008  -59.121  49.990  1.00 68.09  ? 523  ILE A C     1 
ATOM   3949  O  O     . ILE A 1  523  ? -1.159  -59.105  51.212  1.00 68.77  ? 523  ILE A O     1 
ATOM   3950  C  CB    . ILE A 1  523  ? -1.591  -61.598  49.407  1.00 67.57  ? 523  ILE A CB    1 
ATOM   3951  C  CG1   . ILE A 1  523  ? -1.198  -62.843  48.539  1.00 67.99  ? 523  ILE A CG1   1 
ATOM   3952  C  CG2   . ILE A 1  523  ? -3.042  -61.176  49.208  1.00 67.76  ? 523  ILE A CG2   1 
ATOM   3953  C  CD1   . ILE A 1  523  ? -0.762  -62.661  47.065  1.00 70.52  ? 523  ILE A CD1   1 
ATOM   3954  N  N     . VAL A 1  524  ? -1.088  -58.025  49.226  1.00 62.30  ? 524  VAL A N     1 
ATOM   3955  C  CA    . VAL A 1  524  ? -1.355  -56.679  49.732  1.00 60.09  ? 524  VAL A CA    1 
ATOM   3956  C  C     . VAL A 1  524  ? -2.762  -56.197  49.323  1.00 64.90  ? 524  VAL A C     1 
ATOM   3957  O  O     . VAL A 1  524  ? -3.391  -56.840  48.477  1.00 67.55  ? 524  VAL A O     1 
ATOM   3958  C  CB    . VAL A 1  524  ? -0.209  -55.691  49.296  1.00 61.74  ? 524  VAL A CB    1 
ATOM   3959  C  CG1   . VAL A 1  524  ? 1.172   -56.359  49.336  1.00 60.82  ? 524  VAL A CG1   1 
ATOM   3960  C  CG2   . VAL A 1  524  ? -0.465  -55.070  47.914  1.00 61.37  ? 524  VAL A CG2   1 
ATOM   3961  N  N     . GLN A 1  525  ? -3.234  -55.068  49.907  1.00 58.32  ? 525  GLN A N     1 
ATOM   3962  C  CA    . GLN A 1  525  ? -4.496  -54.373  49.586  1.00 56.49  ? 525  GLN A CA    1 
ATOM   3963  C  C     . GLN A 1  525  ? -5.804  -55.233  49.412  1.00 58.37  ? 525  GLN A C     1 
ATOM   3964  O  O     . GLN A 1  525  ? -6.075  -56.082  50.271  1.00 57.84  ? 525  GLN A O     1 
ATOM   3965  C  CB    . GLN A 1  525  ? -4.289  -53.349  48.450  1.00 56.29  ? 525  GLN A CB    1 
ATOM   3966  C  CG    . GLN A 1  525  ? -3.245  -52.272  48.724  1.00 60.79  ? 525  GLN A CG    1 
ATOM   3967  C  CD    . GLN A 1  525  ? -3.805  -50.864  48.800  1.00 81.50  ? 525  GLN A CD    1 
ATOM   3968  O  OE1   . GLN A 1  525  ? -4.709  -50.462  48.054  1.00 80.96  ? 525  GLN A OE1   1 
ATOM   3969  N  NE2   . GLN A 1  525  ? -3.209  -50.044  49.642  1.00 71.54  ? 525  GLN A NE2   1 
ATOM   3970  N  N     . ASP A 1  526  ? -6.616  -54.976  48.341  1.00 52.94  ? 526  ASP A N     1 
ATOM   3971  C  CA    . ASP A 1  526  ? -7.907  -55.639  48.067  1.00 53.60  ? 526  ASP A CA    1 
ATOM   3972  C  C     . ASP A 1  526  ? -7.862  -57.137  48.308  1.00 58.39  ? 526  ASP A C     1 
ATOM   3973  O  O     . ASP A 1  526  ? -8.714  -57.680  49.004  1.00 56.64  ? 526  ASP A O     1 
ATOM   3974  C  CB    . ASP A 1  526  ? -8.431  -55.369  46.615  1.00 55.22  ? 526  ASP A CB    1 
ATOM   3975  C  CG    . ASP A 1  526  ? -9.046  -54.005  46.321  1.00 60.49  ? 526  ASP A CG    1 
ATOM   3976  O  OD1   . ASP A 1  526  ? -8.854  -53.071  47.143  1.00 58.03  ? 526  ASP A OD1   1 
ATOM   3977  O  OD2   . ASP A 1  526  ? -9.685  -53.857  45.237  1.00 68.54  ? 526  ASP A OD2   1 
ATOM   3978  N  N     . THR A 1  527  ? -6.866  -57.788  47.700  1.00 57.57  ? 527  THR A N     1 
ATOM   3979  C  CA    . THR A 1  527  ? -6.595  -59.215  47.761  1.00 59.18  ? 527  THR A CA    1 
ATOM   3980  C  C     . THR A 1  527  ? -6.364  -59.667  49.190  1.00 65.70  ? 527  THR A C     1 
ATOM   3981  O  O     . THR A 1  527  ? -6.879  -60.715  49.560  1.00 67.05  ? 527  THR A O     1 
ATOM   3982  C  CB    . THR A 1  527  ? -5.412  -59.572  46.890  1.00 71.16  ? 527  THR A CB    1 
ATOM   3983  O  OG1   . THR A 1  527  ? -4.864  -58.393  46.270  1.00 73.54  ? 527  THR A OG1   1 
ATOM   3984  C  CG2   . THR A 1  527  ? -5.763  -60.616  45.893  1.00 71.41  ? 527  THR A CG2   1 
ATOM   3985  N  N     . LEU A 1  528  ? -5.611  -58.878  50.003  1.00 61.65  ? 528  LEU A N     1 
ATOM   3986  C  CA    . LEU A 1  528  ? -5.411  -59.194  51.406  1.00 61.44  ? 528  LEU A CA    1 
ATOM   3987  C  C     . LEU A 1  528  ? -6.772  -59.058  52.132  1.00 69.67  ? 528  LEU A C     1 
ATOM   3988  O  O     . LEU A 1  528  ? -7.241  -60.026  52.740  1.00 71.17  ? 528  LEU A O     1 
ATOM   3989  C  CB    . LEU A 1  528  ? -4.331  -58.299  52.032  1.00 59.90  ? 528  LEU A CB    1 
ATOM   3990  C  CG    . LEU A 1  528  ? -3.977  -58.584  53.504  1.00 63.44  ? 528  LEU A CG    1 
ATOM   3991  C  CD1   . LEU A 1  528  ? -3.668  -60.045  53.748  1.00 63.37  ? 528  LEU A CD1   1 
ATOM   3992  C  CD2   . LEU A 1  528  ? -2.791  -57.786  53.925  1.00 65.82  ? 528  LEU A CD2   1 
ATOM   3993  N  N     . CYS A 1  529  ? -7.442  -57.897  51.981  1.00 66.64  ? 529  CYS A N     1 
ATOM   3994  C  CA    . CYS A 1  529  ? -8.757  -57.638  52.575  1.00 66.41  ? 529  CYS A CA    1 
ATOM   3995  C  C     . CYS A 1  529  ? -9.805  -58.699  52.193  1.00 67.75  ? 529  CYS A C     1 
ATOM   3996  O  O     . CYS A 1  529  ? -10.517 -59.220  53.053  1.00 68.11  ? 529  CYS A O     1 
ATOM   3997  C  CB    . CYS A 1  529  ? -9.224  -56.234  52.219  1.00 66.52  ? 529  CYS A CB    1 
ATOM   3998  S  SG    . CYS A 1  529  ? -10.935 -55.889  52.684  1.00 71.17  ? 529  CYS A SG    1 
ATOM   3999  N  N     . GLY A 1  530  ? -9.842  -59.018  50.910  1.00 62.09  ? 530  GLY A N     1 
ATOM   4000  C  CA    . GLY A 1  530  ? -10.754 -59.988  50.328  1.00 61.70  ? 530  GLY A CA    1 
ATOM   4001  C  C     . GLY A 1  530  ? -10.471 -61.406  50.742  1.00 64.41  ? 530  GLY A C     1 
ATOM   4002  O  O     . GLY A 1  530  ? -11.415 -62.158  50.955  1.00 65.33  ? 530  GLY A O     1 
ATOM   4003  N  N     . ILE A 1  531  ? -9.178  -61.792  50.851  1.00 59.25  ? 531  ILE A N     1 
ATOM   4004  C  CA    . ILE A 1  531  ? -8.800  -63.153  51.238  1.00 59.08  ? 531  ILE A CA    1 
ATOM   4005  C  C     . ILE A 1  531  ? -9.344  -63.461  52.624  1.00 64.52  ? 531  ILE A C     1 
ATOM   4006  O  O     . ILE A 1  531  ? -9.888  -64.548  52.800  1.00 64.29  ? 531  ILE A O     1 
ATOM   4007  C  CB    . ILE A 1  531  ? -7.294  -63.493  51.033  1.00 61.30  ? 531  ILE A CB    1 
ATOM   4008  C  CG1   . ILE A 1  531  ? -7.064  -64.985  50.875  1.00 61.74  ? 531  ILE A CG1   1 
ATOM   4009  C  CG2   . ILE A 1  531  ? -6.394  -62.916  52.127  1.00 62.42  ? 531  ILE A CG2   1 
ATOM   4010  C  CD1   . ILE A 1  531  ? -5.760  -65.340  50.274  1.00 62.69  ? 531  ILE A CD1   1 
ATOM   4011  N  N     . ARG A 1  532  ? -9.295  -62.472  53.575  1.00 61.64  ? 532  ARG A N     1 
ATOM   4012  C  CA    . ARG A 1  532  ? -9.864  -62.651  54.914  1.00 62.50  ? 532  ARG A CA    1 
ATOM   4013  C  C     . ARG A 1  532  ? -11.372 -62.886  54.777  1.00 66.87  ? 532  ARG A C     1 
ATOM   4014  O  O     . ARG A 1  532  ? -11.870 -63.949  55.169  1.00 67.05  ? 532  ARG A O     1 
ATOM   4015  C  CB    . ARG A 1  532  ? -9.586  -61.448  55.823  1.00 63.24  ? 532  ARG A CB    1 
ATOM   4016  C  CG    . ARG A 1  532  ? -9.961  -61.719  57.282  1.00 78.45  ? 532  ARG A CG    1 
ATOM   4017  C  CD    . ARG A 1  532  ? -10.274 -60.454  58.059  1.00 93.29  ? 532  ARG A CD    1 
ATOM   4018  N  NE    . ARG A 1  532  ? -11.614 -60.466  58.651  1.00 99.96  ? 532  ARG A NE    1 
ATOM   4019  C  CZ    . ARG A 1  532  ? -12.690 -59.950  58.067  1.00 110.34 ? 532  ARG A CZ    1 
ATOM   4020  N  NH1   . ARG A 1  532  ? -12.599 -59.390  56.862  1.00 91.23  ? 532  ARG A NH1   1 
ATOM   4021  N  NH2   . ARG A 1  532  ? -13.870 -59.995  58.678  1.00 93.57  ? 532  ARG A NH2   1 
ATOM   4022  N  N     . LYS A 1  533  ? -12.067 -61.920  54.150  1.00 63.02  ? 533  LYS A N     1 
ATOM   4023  C  CA    . LYS A 1  533  ? -13.501 -61.945  53.872  1.00 64.11  ? 533  LYS A CA    1 
ATOM   4024  C  C     . LYS A 1  533  ? -13.960 -63.287  53.251  1.00 71.83  ? 533  LYS A C     1 
ATOM   4025  O  O     . LYS A 1  533  ? -14.997 -63.812  53.651  1.00 73.62  ? 533  LYS A O     1 
ATOM   4026  C  CB    . LYS A 1  533  ? -13.878 -60.769  52.942  1.00 65.65  ? 533  LYS A CB    1 
ATOM   4027  C  CG    . LYS A 1  533  ? -13.818 -59.377  53.585  1.00 68.02  ? 533  LYS A CG    1 
ATOM   4028  C  CD    . LYS A 1  533  ? -14.827 -58.406  52.982  1.00 68.52  ? 533  LYS A CD    1 
ATOM   4029  C  CE    . LYS A 1  533  ? -16.252 -58.720  53.394  1.00 82.87  ? 533  LYS A CE    1 
ATOM   4030  N  NZ    . LYS A 1  533  ? -17.254 -57.897  52.658  1.00 91.48  ? 533  LYS A NZ    1 
ATOM   4031  N  N     . LEU A 1  534  ? -13.177 -63.842  52.296  1.00 68.64  ? 534  LEU A N     1 
ATOM   4032  C  CA    . LEU A 1  534  ? -13.465 -65.098  51.599  1.00 69.22  ? 534  LEU A CA    1 
ATOM   4033  C  C     . LEU A 1  534  ? -13.244 -66.302  52.469  1.00 74.15  ? 534  LEU A C     1 
ATOM   4034  O  O     . LEU A 1  534  ? -13.990 -67.249  52.334  1.00 75.30  ? 534  LEU A O     1 
ATOM   4035  C  CB    . LEU A 1  534  ? -12.630 -65.206  50.295  1.00 69.12  ? 534  LEU A CB    1 
ATOM   4036  C  CG    . LEU A 1  534  ? -12.536 -66.571  49.544  1.00 75.16  ? 534  LEU A CG    1 
ATOM   4037  C  CD1   . LEU A 1  534  ? -13.835 -66.919  48.832  1.00 76.38  ? 534  LEU A CD1   1 
ATOM   4038  C  CD2   . LEU A 1  534  ? -11.435 -66.538  48.502  1.00 76.67  ? 534  LEU A CD2   1 
ATOM   4039  N  N     . THR A 1  535  ? -12.215 -66.288  53.341  1.00 71.21  ? 535  THR A N     1 
ATOM   4040  C  CA    . THR A 1  535  ? -11.827 -67.429  54.199  1.00 71.60  ? 535  THR A CA    1 
ATOM   4041  C  C     . THR A 1  535  ? -12.592 -67.630  55.503  1.00 76.09  ? 535  THR A C     1 
ATOM   4042  O  O     . THR A 1  535  ? -12.260 -68.556  56.242  1.00 77.13  ? 535  THR A O     1 
ATOM   4043  C  CB    . THR A 1  535  ? -10.321 -67.438  54.467  1.00 72.12  ? 535  THR A CB    1 
ATOM   4044  O  OG1   . THR A 1  535  ? -9.947  -66.185  55.036  1.00 66.04  ? 535  THR A OG1   1 
ATOM   4045  C  CG2   . THR A 1  535  ? -9.514  -67.749  53.227  1.00 67.47  ? 535  THR A CG2   1 
ATOM   4046  N  N     . LEU A 1  536  ? -13.609 -66.804  55.793  1.00 71.26  ? 536  LEU A N     1 
ATOM   4047  C  CA    . LEU A 1  536  ? -14.401 -66.967  57.012  1.00 71.56  ? 536  LEU A CA    1 
ATOM   4048  C  C     . LEU A 1  536  ? -15.229 -68.256  56.945  1.00 82.22  ? 536  LEU A C     1 
ATOM   4049  O  O     . LEU A 1  536  ? -15.473 -68.764  55.827  1.00 84.24  ? 536  LEU A O     1 
ATOM   4050  C  CB    . LEU A 1  536  ? -15.349 -65.782  57.195  1.00 70.11  ? 536  LEU A CB    1 
ATOM   4051  C  CG    . LEU A 1  536  ? -14.816 -64.366  56.971  1.00 71.51  ? 536  LEU A CG    1 
ATOM   4052  C  CD1   . LEU A 1  536  ? -15.919 -63.386  57.149  1.00 70.98  ? 536  LEU A CD1   1 
ATOM   4053  C  CD2   . LEU A 1  536  ? -13.682 -64.015  57.924  1.00 71.00  ? 536  LEU A CD2   1 
ATOM   4054  N  N     . ARG A 1  537  ? -15.660 -68.797  58.128  1.00 79.97  ? 537  ARG A N     1 
ATOM   4055  C  CA    . ARG A 1  537  ? -16.513 -70.001  58.166  1.00 80.94  ? 537  ARG A CA    1 
ATOM   4056  C  C     . ARG A 1  537  ? -17.853 -69.701  57.515  1.00 86.00  ? 537  ARG A C     1 
ATOM   4057  O  O     . ARG A 1  537  ? -18.309 -70.497  56.702  1.00 86.22  ? 537  ARG A O     1 
ATOM   4058  C  CB    . ARG A 1  537  ? -16.740 -70.493  59.586  1.00 81.58  ? 537  ARG A CB    1 
ATOM   4059  C  CG    . ARG A 1  537  ? -15.510 -71.113  60.204  1.00 94.23  ? 537  ARG A CG    1 
ATOM   4060  C  CD    . ARG A 1  537  ? -15.852 -72.359  60.990  1.00 100.17 ? 537  ARG A CD    1 
ATOM   4061  N  NE    . ARG A 1  537  ? -15.369 -72.287  62.370  1.00 107.33 ? 537  ARG A NE    1 
ATOM   4062  C  CZ    . ARG A 1  537  ? -14.152 -72.648  62.765  1.00 120.94 ? 537  ARG A CZ    1 
ATOM   4063  N  NH1   . ARG A 1  537  ? -13.258 -73.086  61.882  1.00 106.94 ? 537  ARG A NH1   1 
ATOM   4064  N  NH2   . ARG A 1  537  ? -13.813 -72.560  64.043  1.00 107.79 ? 537  ARG A NH2   1 
ATOM   4065  N  N     . ASP A 1  538  ? -18.430 -68.504  57.817  1.00 83.10  ? 538  ASP A N     1 
ATOM   4066  C  CA    . ASP A 1  538  ? -19.684 -67.936  57.297  1.00 83.58  ? 538  ASP A CA    1 
ATOM   4067  C  C     . ASP A 1  538  ? -19.709 -67.816  55.772  1.00 88.84  ? 538  ASP A C     1 
ATOM   4068  O  O     . ASP A 1  538  ? -20.790 -67.901  55.179  1.00 90.74  ? 538  ASP A O     1 
ATOM   4069  C  CB    . ASP A 1  538  ? -19.920 -66.532  57.888  1.00 84.83  ? 538  ASP A CB    1 
ATOM   4070  C  CG    . ASP A 1  538  ? -20.874 -66.439  59.067  1.00 100.07 ? 538  ASP A CG    1 
ATOM   4071  O  OD1   . ASP A 1  538  ? -21.414 -67.484  59.480  1.00 104.83 ? 538  ASP A OD1   1 
ATOM   4072  O  OD2   . ASP A 1  538  ? -21.056 -65.320  59.598  1.00 103.08 ? 538  ASP A OD2   1 
ATOM   4073  N  N     . THR A 1  539  ? -18.536 -67.573  55.141  1.00 83.07  ? 539  THR A N     1 
ATOM   4074  C  CA    . THR A 1  539  ? -18.414 -67.428  53.687  1.00 81.17  ? 539  THR A CA    1 
ATOM   4075  C  C     . THR A 1  539  ? -18.580 -68.776  52.993  1.00 85.24  ? 539  THR A C     1 
ATOM   4076  O  O     . THR A 1  539  ? -17.696 -69.639  53.092  1.00 84.94  ? 539  THR A O     1 
ATOM   4077  C  CB    . THR A 1  539  ? -17.098 -66.747  53.315  1.00 80.75  ? 539  THR A CB    1 
ATOM   4078  O  OG1   . THR A 1  539  ? -16.877 -65.627  54.164  1.00 77.14  ? 539  THR A OG1   1 
ATOM   4079  C  CG2   . THR A 1  539  ? -17.061 -66.318  51.879  1.00 76.23  ? 539  THR A CG2   1 
ATOM   4080  N  N     . PHE A 1  540  ? -19.744 -68.957  52.333  1.00 82.32  ? 540  PHE A N     1 
ATOM   4081  C  CA    . PHE A 1  540  ? -20.123 -70.147  51.549  1.00 83.07  ? 540  PHE A CA    1 
ATOM   4082  C  C     . PHE A 1  540  ? -20.444 -69.697  50.131  1.00 87.12  ? 540  PHE A C     1 
ATOM   4083  O  O     . PHE A 1  540  ? -21.111 -68.672  49.955  1.00 87.55  ? 540  PHE A O     1 
ATOM   4084  C  CB    . PHE A 1  540  ? -21.350 -70.865  52.135  1.00 85.90  ? 540  PHE A CB    1 
ATOM   4085  C  CG    . PHE A 1  540  ? -21.092 -71.621  53.408  1.00 88.16  ? 540  PHE A CG    1 
ATOM   4086  C  CD1   . PHE A 1  540  ? -21.636 -71.191  54.612  1.00 91.67  ? 540  PHE A CD1   1 
ATOM   4087  C  CD2   . PHE A 1  540  ? -20.298 -72.757  53.411  1.00 90.89  ? 540  PHE A CD2   1 
ATOM   4088  C  CE1   . PHE A 1  540  ? -21.386 -71.883  55.800  1.00 93.11  ? 540  PHE A CE1   1 
ATOM   4089  C  CE2   . PHE A 1  540  ? -20.045 -73.447  54.601  1.00 94.63  ? 540  PHE A CE2   1 
ATOM   4090  C  CZ    . PHE A 1  540  ? -20.599 -73.010  55.786  1.00 92.74  ? 540  PHE A CZ    1 
ATOM   4091  N  N     . ILE A 1  541  ? -19.958 -70.438  49.123  1.00 82.44  ? 541  ILE A N     1 
ATOM   4092  C  CA    . ILE A 1  541  ? -20.159 -70.121  47.703  1.00 81.49  ? 541  ILE A CA    1 
ATOM   4093  C  C     . ILE A 1  541  ? -20.827 -71.262  46.891  1.00 86.57  ? 541  ILE A C     1 
ATOM   4094  O  O     . ILE A 1  541  ? -20.699 -72.447  47.233  1.00 87.28  ? 541  ILE A O     1 
ATOM   4095  C  CB    . ILE A 1  541  ? -18.916 -69.445  47.032  1.00 82.75  ? 541  ILE A CB    1 
ATOM   4096  C  CG1   . ILE A 1  541  ? -17.694 -70.364  47.013  1.00 82.72  ? 541  ILE A CG1   1 
ATOM   4097  C  CG2   . ILE A 1  541  ? -18.583 -68.079  47.688  1.00 82.13  ? 541  ILE A CG2   1 
ATOM   4098  C  CD1   . ILE A 1  541  ? -16.777 -70.136  48.086  1.00 89.74  ? 541  ILE A CD1   1 
ATOM   4099  N  N     . GLU A 1  542  ? -21.574 -70.896  45.853  1.00 82.24  ? 542  GLU A N     1 
ATOM   4100  C  CA    . GLU A 1  542  ? -22.320 -71.880  45.085  1.00 83.46  ? 542  GLU A CA    1 
ATOM   4101  C  C     . GLU A 1  542  ? -21.839 -72.158  43.666  1.00 89.53  ? 542  GLU A C     1 
ATOM   4102  O  O     . GLU A 1  542  ? -21.136 -71.336  43.086  1.00 88.81  ? 542  GLU A O     1 
ATOM   4103  C  CB    . GLU A 1  542  ? -23.818 -71.588  45.151  1.00 85.39  ? 542  GLU A CB    1 
ATOM   4104  C  CG    . GLU A 1  542  ? -24.163 -70.128  44.954  1.00 96.45  ? 542  GLU A CG    1 
ATOM   4105  C  CD    . GLU A 1  542  ? -25.511 -69.709  45.501  1.00 121.09 ? 542  GLU A CD    1 
ATOM   4106  O  OE1   . GLU A 1  542  ? -26.125 -70.494  46.262  1.00 93.79  ? 542  GLU A OE1   1 
ATOM   4107  O  OE2   . GLU A 1  542  ? -25.942 -68.575  45.180  1.00 127.86 ? 542  GLU A OE2   1 
ATOM   4108  N  N     . LEU A 1  543  ? -22.220 -73.342  43.122  1.00 88.55  ? 543  LEU A N     1 
ATOM   4109  C  CA    . LEU A 1  543  ? -21.874 -73.876  41.804  1.00 88.81  ? 543  LEU A CA    1 
ATOM   4110  C  C     . LEU A 1  543  ? -21.545 -72.814  40.768  1.00 91.47  ? 543  LEU A C     1 
ATOM   4111  O  O     . LEU A 1  543  ? -20.376 -72.691  40.411  1.00 89.90  ? 543  LEU A O     1 
ATOM   4112  C  CB    . LEU A 1  543  ? -22.954 -74.855  41.302  1.00 90.63  ? 543  LEU A CB    1 
ATOM   4113  C  CG    . LEU A 1  543  ? -22.674 -75.643  39.998  1.00 96.32  ? 543  LEU A CG    1 
ATOM   4114  C  CD1   . LEU A 1  543  ? -21.662 -76.754  40.218  1.00 96.94  ? 543  LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A 1  543  ? -23.950 -76.284  39.465  1.00 100.67 ? 543  LEU A CD2   1 
ATOM   4116  N  N     . ASP A 1  544  ? -22.541 -72.005  40.343  1.00 88.86  ? 544  ASP A N     1 
ATOM   4117  C  CA    . ASP A 1  544  ? -22.343 -70.944  39.344  1.00 88.49  ? 544  ASP A CA    1 
ATOM   4118  C  C     . ASP A 1  544  ? -21.006 -70.232  39.505  1.00 90.52  ? 544  ASP A C     1 
ATOM   4119  O  O     . ASP A 1  544  ? -20.194 -70.282  38.579  1.00 90.50  ? 544  ASP A O     1 
ATOM   4120  C  CB    . ASP A 1  544  ? -23.516 -69.937  39.306  1.00 91.08  ? 544  ASP A CB    1 
ATOM   4121  C  CG    . ASP A 1  544  ? -23.900 -69.368  40.663  1.00 110.34 ? 544  ASP A CG    1 
ATOM   4122  O  OD1   . ASP A 1  544  ? -23.788 -68.128  40.846  1.00 109.74 ? 544  ASP A OD1   1 
ATOM   4123  O  OD2   . ASP A 1  544  ? -24.289 -70.161  41.549  1.00 122.85 ? 544  ASP A OD2   1 
ATOM   4124  N  N     . GLN A 1  545  ? -20.749 -69.654  40.710  1.00 84.80  ? 545  GLN A N     1 
ATOM   4125  C  CA    . GLN A 1  545  ? -19.539 -68.908  41.052  1.00 82.42  ? 545  GLN A CA    1 
ATOM   4126  C  C     . GLN A 1  545  ? -18.336 -69.811  41.198  1.00 84.71  ? 545  GLN A C     1 
ATOM   4127  O  O     . GLN A 1  545  ? -17.275 -69.512  40.652  1.00 83.19  ? 545  GLN A O     1 
ATOM   4128  C  CB    . GLN A 1  545  ? -19.743 -68.099  42.331  1.00 83.30  ? 545  GLN A CB    1 
ATOM   4129  C  CG    . GLN A 1  545  ? -18.774 -66.917  42.421  1.00 106.04 ? 545  GLN A CG    1 
ATOM   4130  C  CD    . GLN A 1  545  ? -18.684 -66.283  43.788  1.00 127.74 ? 545  GLN A CD    1 
ATOM   4131  O  OE1   . GLN A 1  545  ? -17.931 -65.319  43.997  1.00 122.18 ? 545  GLN A OE1   1 
ATOM   4132  N  NE2   . GLN A 1  545  ? -19.410 -66.829  44.759  1.00 121.08 ? 545  GLN A NE2   1 
ATOM   4133  N  N     . VAL A 1  546  ? -18.499 -70.904  41.955  1.00 81.79  ? 546  VAL A N     1 
ATOM   4134  C  CA    . VAL A 1  546  ? -17.469 -71.908  42.200  1.00 81.20  ? 546  VAL A CA    1 
ATOM   4135  C  C     . VAL A 1  546  ? -16.812 -72.267  40.866  1.00 84.67  ? 546  VAL A C     1 
ATOM   4136  O  O     . VAL A 1  546  ? -15.609 -72.059  40.716  1.00 83.97  ? 546  VAL A O     1 
ATOM   4137  C  CB    . VAL A 1  546  ? -18.052 -73.137  42.939  1.00 85.81  ? 546  VAL A CB    1 
ATOM   4138  C  CG1   . VAL A 1  546  ? -17.081 -74.309  42.912  1.00 86.35  ? 546  VAL A CG1   1 
ATOM   4139  C  CG2   . VAL A 1  546  ? -18.419 -72.783  44.372  1.00 85.32  ? 546  VAL A CG2   1 
ATOM   4140  N  N     . LEU A 1  547  ? -17.626 -72.675  39.869  1.00 80.59  ? 547  LEU A N     1 
ATOM   4141  C  CA    . LEU A 1  547  ? -17.149 -73.033  38.539  1.00 79.46  ? 547  LEU A CA    1 
ATOM   4142  C  C     . LEU A 1  547  ? -16.317 -71.901  37.882  1.00 83.07  ? 547  LEU A C     1 
ATOM   4143  O  O     . LEU A 1  547  ? -15.248 -72.181  37.334  1.00 82.89  ? 547  LEU A O     1 
ATOM   4144  C  CB    . LEU A 1  547  ? -18.302 -73.528  37.638  1.00 79.66  ? 547  LEU A CB    1 
ATOM   4145  C  CG    . LEU A 1  547  ? -19.183 -74.698  38.147  1.00 84.18  ? 547  LEU A CG    1 
ATOM   4146  C  CD1   . LEU A 1  547  ? -20.226 -75.061  37.128  1.00 85.10  ? 547  LEU A CD1   1 
ATOM   4147  C  CD2   . LEU A 1  547  ? -18.382 -75.936  38.475  1.00 85.20  ? 547  LEU A CD2   1 
ATOM   4148  N  N     . ASN A 1  548  ? -16.752 -70.628  38.025  1.00 78.70  ? 548  ASN A N     1 
ATOM   4149  C  CA    . ASN A 1  548  ? -16.042 -69.461  37.473  1.00 76.73  ? 548  ASN A CA    1 
ATOM   4150  C  C     . ASN A 1  548  ? -14.729 -69.250  38.176  1.00 78.41  ? 548  ASN A C     1 
ATOM   4151  O  O     . ASN A 1  548  ? -13.714 -69.030  37.516  1.00 77.31  ? 548  ASN A O     1 
ATOM   4152  C  CB    . ASN A 1  548  ? -16.893 -68.188  37.555  1.00 76.59  ? 548  ASN A CB    1 
ATOM   4153  C  CG    . ASN A 1  548  ? -17.845 -68.002  36.398  1.00 101.74 ? 548  ASN A CG    1 
ATOM   4154  O  OD1   . ASN A 1  548  ? -17.468 -68.070  35.220  1.00 91.59  ? 548  ASN A OD1   1 
ATOM   4155  N  ND2   . ASN A 1  548  ? -19.096 -67.708  36.708  1.00 97.47  ? 548  ASN A ND2   1 
ATOM   4156  N  N     . MET A 1  549  ? -14.749 -69.347  39.517  1.00 74.38  ? 549  MET A N     1 
ATOM   4157  C  CA    . MET A 1  549  ? -13.582 -69.188  40.372  1.00 73.25  ? 549  MET A CA    1 
ATOM   4158  C  C     . MET A 1  549  ? -12.519 -70.215  40.004  1.00 76.18  ? 549  MET A C     1 
ATOM   4159  O  O     . MET A 1  549  ? -11.342 -69.870  39.910  1.00 75.48  ? 549  MET A O     1 
ATOM   4160  C  CB    . MET A 1  549  ? -13.977 -69.338  41.839  1.00 76.14  ? 549  MET A CB    1 
ATOM   4161  C  CG    . MET A 1  549  ? -14.788 -68.199  42.352  1.00 80.27  ? 549  MET A CG    1 
ATOM   4162  S  SD    . MET A 1  549  ? -14.424 -67.907  44.098  1.00 85.85  ? 549  MET A SD    1 
ATOM   4163  C  CE    . MET A 1  549  ? -15.990 -68.203  44.785  1.00 83.79  ? 549  MET A CE    1 
ATOM   4164  N  N     . LEU A 1  550  ? -12.946 -71.465  39.753  1.00 72.42  ? 550  LEU A N     1 
ATOM   4165  C  CA    . LEU A 1  550  ? -12.068 -72.580  39.399  1.00 72.49  ? 550  LEU A CA    1 
ATOM   4166  C  C     . LEU A 1  550  ? -11.403 -72.340  38.056  1.00 76.69  ? 550  LEU A C     1 
ATOM   4167  O  O     . LEU A 1  550  ? -10.173 -72.403  37.965  1.00 75.34  ? 550  LEU A O     1 
ATOM   4168  C  CB    . LEU A 1  550  ? -12.853 -73.907  39.375  1.00 73.67  ? 550  LEU A CB    1 
ATOM   4169  C  CG    . LEU A 1  550  ? -13.388 -74.435  40.694  1.00 77.71  ? 550  LEU A CG    1 
ATOM   4170  C  CD1   . LEU A 1  550  ? -14.377 -75.545  40.459  1.00 78.22  ? 550  LEU A CD1   1 
ATOM   4171  C  CD2   . LEU A 1  550  ? -12.262 -74.895  41.588  1.00 81.08  ? 550  LEU A CD2   1 
ATOM   4172  N  N     . TYR A 1  551  ? -12.220 -72.023  37.023  1.00 74.71  ? 551  TYR A N     1 
ATOM   4173  C  CA    . TYR A 1  551  ? -11.742 -71.733  35.676  1.00 74.86  ? 551  TYR A CA    1 
ATOM   4174  C  C     . TYR A 1  551  ? -10.736 -70.574  35.695  1.00 79.31  ? 551  TYR A C     1 
ATOM   4175  O  O     . TYR A 1  551  ? -9.757  -70.628  34.945  1.00 79.42  ? 551  TYR A O     1 
ATOM   4176  C  CB    . TYR A 1  551  ? -12.912 -71.473  34.697  1.00 76.16  ? 551  TYR A CB    1 
ATOM   4177  C  CG    . TYR A 1  551  ? -12.484 -71.310  33.249  1.00 77.65  ? 551  TYR A CG    1 
ATOM   4178  C  CD1   . TYR A 1  551  ? -11.596 -72.208  32.654  1.00 79.47  ? 551  TYR A CD1   1 
ATOM   4179  C  CD2   . TYR A 1  551  ? -12.985 -70.274  32.465  1.00 78.03  ? 551  TYR A CD2   1 
ATOM   4180  C  CE1   . TYR A 1  551  ? -11.164 -72.038  31.338  1.00 78.04  ? 551  TYR A CE1   1 
ATOM   4181  C  CE2   . TYR A 1  551  ? -12.591 -70.119  31.132  1.00 78.54  ? 551  TYR A CE2   1 
ATOM   4182  C  CZ    . TYR A 1  551  ? -11.672 -70.999  30.579  1.00 82.16  ? 551  TYR A CZ    1 
ATOM   4183  O  OH    . TYR A 1  551  ? -11.249 -70.831  29.289  1.00 78.50  ? 551  TYR A OH    1 
ATOM   4184  N  N     . TRP A 1  552  ? -10.928 -69.589  36.628  1.00 74.75  ? 552  TRP A N     1 
ATOM   4185  C  CA    . TRP A 1  552  ? -10.053 -68.431  36.809  1.00 72.90  ? 552  TRP A CA    1 
ATOM   4186  C  C     . TRP A 1  552  ? -8.615  -68.787  37.172  1.00 76.11  ? 552  TRP A C     1 
ATOM   4187  O  O     . TRP A 1  552  ? -7.709  -68.059  36.778  1.00 74.49  ? 552  TRP A O     1 
ATOM   4188  C  CB    . TRP A 1  552  ? -10.663 -67.394  37.747  1.00 71.17  ? 552  TRP A CB    1 
ATOM   4189  C  CG    . TRP A 1  552  ? -11.300 -66.231  37.028  1.00 72.36  ? 552  TRP A CG    1 
ATOM   4190  C  CD1   . TRP A 1  552  ? -12.634 -65.952  36.950  1.00 75.51  ? 552  TRP A CD1   1 
ATOM   4191  C  CD2   . TRP A 1  552  ? -10.626 -65.172  36.312  1.00 71.77  ? 552  TRP A CD2   1 
ATOM   4192  N  NE1   . TRP A 1  552  ? -12.838 -64.795  36.228  1.00 74.25  ? 552  TRP A NE1   1 
ATOM   4193  C  CE2   . TRP A 1  552  ? -11.622 -64.295  35.824  1.00 75.28  ? 552  TRP A CE2   1 
ATOM   4194  C  CE3   . TRP A 1  552  ? -9.274  -64.881  36.029  1.00 72.70  ? 552  TRP A CE3   1 
ATOM   4195  C  CZ2   . TRP A 1  552  ? -11.312 -63.161  35.048  1.00 73.72  ? 552  TRP A CZ2   1 
ATOM   4196  C  CZ3   . TRP A 1  552  ? -8.971  -63.749  35.275  1.00 73.08  ? 552  TRP A CZ3   1 
ATOM   4197  C  CH2   . TRP A 1  552  ? -9.982  -62.916  34.780  1.00 73.21  ? 552  TRP A CH2   1 
ATOM   4198  N  N     . VAL A 1  553  ? -8.388  -69.937  37.844  1.00 74.37  ? 553  VAL A N     1 
ATOM   4199  C  CA    . VAL A 1  553  ? -7.029  -70.408  38.138  1.00 74.65  ? 553  VAL A CA    1 
ATOM   4200  C  C     . VAL A 1  553  ? -6.460  -71.071  36.860  1.00 83.32  ? 553  VAL A C     1 
ATOM   4201  O  O     . VAL A 1  553  ? -7.085  -71.991  36.304  1.00 83.96  ? 553  VAL A O     1 
ATOM   4202  C  CB    . VAL A 1  553  ? -6.925  -71.339  39.369  1.00 78.00  ? 553  VAL A CB    1 
ATOM   4203  C  CG1   . VAL A 1  553  ? -5.482  -71.788  39.601  1.00 77.78  ? 553  VAL A CG1   1 
ATOM   4204  C  CG2   . VAL A 1  553  ? -7.476  -70.665  40.618  1.00 76.86  ? 553  VAL A CG2   1 
ATOM   4205  N  N     . PRO A 1  554  ? -5.305  -70.570  36.355  1.00 81.67  ? 554  PRO A N     1 
ATOM   4206  C  CA    . PRO A 1  554  ? -4.730  -71.139  35.119  1.00 82.83  ? 554  PRO A CA    1 
ATOM   4207  C  C     . PRO A 1  554  ? -4.199  -72.565  35.303  1.00 89.80  ? 554  PRO A C     1 
ATOM   4208  O  O     . PRO A 1  554  ? -4.383  -73.440  34.458  1.00 90.57  ? 554  PRO A O     1 
ATOM   4209  C  CB    . PRO A 1  554  ? -3.611  -70.145  34.755  1.00 83.62  ? 554  PRO A CB    1 
ATOM   4210  C  CG    . PRO A 1  554  ? -3.828  -68.937  35.639  1.00 86.50  ? 554  PRO A CG    1 
ATOM   4211  C  CD    . PRO A 1  554  ? -4.484  -69.453  36.865  1.00 82.08  ? 554  PRO A CD    1 
ATOM   4212  N  N     . ASP A 1  555  ? -3.587  -72.803  36.444  1.00 88.23  ? 555  ASP A N     1 
ATOM   4213  C  CA    . ASP A 1  555  ? -3.041  -74.102  36.790  1.00 90.35  ? 555  ASP A CA    1 
ATOM   4214  C  C     . ASP A 1  555  ? -4.147  -75.103  37.188  1.00 96.82  ? 555  ASP A C     1 
ATOM   4215  O  O     . ASP A 1  555  ? -3.821  -76.210  37.662  1.00 99.64  ? 555  ASP A O     1 
ATOM   4216  C  CB    . ASP A 1  555  ? -2.020  -73.928  37.940  1.00 92.14  ? 555  ASP A CB    1 
ATOM   4217  C  CG    . ASP A 1  555  ? -0.900  -72.963  37.607  1.00 105.75 ? 555  ASP A CG    1 
ATOM   4218  O  OD1   . ASP A 1  555  ? -0.526  -72.873  36.410  1.00 107.79 ? 555  ASP A OD1   1 
ATOM   4219  O  OD2   . ASP A 1  555  ? -0.405  -72.288  38.533  1.00 110.93 ? 555  ASP A OD2   1 
ATOM   4220  N  N     . TRP A 1  556  ? -5.446  -74.727  37.005  1.00 90.37  ? 556  TRP A N     1 
ATOM   4221  C  CA    . TRP A 1  556  ? -6.555  -75.572  37.426  1.00 90.04  ? 556  TRP A CA    1 
ATOM   4222  C  C     . TRP A 1  556  ? -6.535  -76.954  36.826  1.00 96.57  ? 556  TRP A C     1 
ATOM   4223  O  O     . TRP A 1  556  ? -6.407  -77.092  35.609  1.00 96.34  ? 556  TRP A O     1 
ATOM   4224  C  CB    . TRP A 1  556  ? -7.915  -74.893  37.286  1.00 87.88  ? 556  TRP A CB    1 
ATOM   4225  C  CG    . TRP A 1  556  ? -9.037  -75.700  37.862  1.00 89.69  ? 556  TRP A CG    1 
ATOM   4226  C  CD1   . TRP A 1  556  ? -9.071  -76.290  39.087  1.00 93.20  ? 556  TRP A CD1   1 
ATOM   4227  C  CD2   . TRP A 1  556  ? -10.283 -76.017  37.227  1.00 90.18  ? 556  TRP A CD2   1 
ATOM   4228  N  NE1   . TRP A 1  556  ? -10.252 -76.975  39.250  1.00 93.93  ? 556  TRP A NE1   1 
ATOM   4229  C  CE2   . TRP A 1  556  ? -11.026 -76.805  38.134  1.00 95.31  ? 556  TRP A CE2   1 
ATOM   4230  C  CE3   . TRP A 1  556  ? -10.857 -75.698  35.988  1.00 91.31  ? 556  TRP A CE3   1 
ATOM   4231  C  CZ2   . TRP A 1  556  ? -12.308 -77.280  37.840  1.00 95.51  ? 556  TRP A CZ2   1 
ATOM   4232  C  CZ3   . TRP A 1  556  ? -12.132 -76.160  35.702  1.00 93.61  ? 556  TRP A CZ3   1 
ATOM   4233  C  CH2   . TRP A 1  556  ? -12.837 -76.952  36.616  1.00 95.27  ? 556  TRP A CH2   1 
ATOM   4234  N  N     . ASP A 1  557  ? -6.603  -77.981  37.713  1.00 94.78  ? 557  ASP A N     1 
ATOM   4235  C  CA    . ASP A 1  557  ? -6.592  -79.414  37.389  1.00 95.49  ? 557  ASP A CA    1 
ATOM   4236  C  C     . ASP A 1  557  ? -7.776  -79.848  36.562  1.00 97.86  ? 557  ASP A C     1 
ATOM   4237  O  O     . ASP A 1  557  ? -7.680  -80.853  35.875  1.00 98.32  ? 557  ASP A O     1 
ATOM   4238  C  CB    . ASP A 1  557  ? -6.448  -80.285  38.659  1.00 98.63  ? 557  ASP A CB    1 
ATOM   4239  C  CG    . ASP A 1  557  ? -7.664  -80.424  39.572  1.00 112.17 ? 557  ASP A CG    1 
ATOM   4240  O  OD1   . ASP A 1  557  ? -8.430  -79.445  39.703  1.00 112.59 ? 557  ASP A OD1   1 
ATOM   4241  O  OD2   . ASP A 1  557  ? -7.782  -81.469  40.244  1.00 119.79 ? 557  ASP A OD2   1 
ATOM   4242  N  N     . GLY A 1  558  ? -8.862  -79.082  36.611  1.00 93.99  ? 558  GLY A N     1 
ATOM   4243  C  CA    . GLY A 1  558  ? -10.084 -79.360  35.864  1.00 94.80  ? 558  GLY A CA    1 
ATOM   4244  C  C     . GLY A 1  558  ? -10.962 -80.384  36.548  1.00 99.49  ? 558  GLY A C     1 
ATOM   4245  O  O     . GLY A 1  558  ? -11.623 -81.187  35.885  1.00 100.64 ? 558  GLY A O     1 
ATOM   4246  N  N     . VAL A 1  559  ? -10.933 -80.389  37.883  1.00 94.50  ? 559  VAL A N     1 
ATOM   4247  C  CA    . VAL A 1  559  ? -11.698 -81.312  38.706  1.00 94.75  ? 559  VAL A CA    1 
ATOM   4248  C  C     . VAL A 1  559  ? -12.405 -80.512  39.775  1.00 97.40  ? 559  VAL A C     1 
ATOM   4249  O  O     . VAL A 1  559  ? -11.752 -79.887  40.628  1.00 97.48  ? 559  VAL A O     1 
ATOM   4250  C  CB    . VAL A 1  559  ? -10.796 -82.423  39.294  1.00 98.93  ? 559  VAL A CB    1 
ATOM   4251  C  CG1   . VAL A 1  559  ? -11.440 -83.118  40.498  1.00 99.31  ? 559  VAL A CG1   1 
ATOM   4252  C  CG2   . VAL A 1  559  ? -10.411 -83.429  38.218  1.00 99.79  ? 559  VAL A CG2   1 
ATOM   4253  N  N     . ILE A 1  560  ? -13.743 -80.522  39.718  1.00 91.66  ? 560  ILE A N     1 
ATOM   4254  C  CA    . ILE A 1  560  ? -14.571 -79.820  40.690  1.00 89.63  ? 560  ILE A CA    1 
ATOM   4255  C  C     . ILE A 1  560  ? -14.436 -80.518  42.053  1.00 93.03  ? 560  ILE A C     1 
ATOM   4256  O  O     . ILE A 1  560  ? -14.686 -81.724  42.157  1.00 93.39  ? 560  ILE A O     1 
ATOM   4257  C  CB    . ILE A 1  560  ? -16.069 -79.684  40.287  1.00 92.64  ? 560  ILE A CB    1 
ATOM   4258  C  CG1   . ILE A 1  560  ? -16.380 -79.766  38.758  1.00 92.39  ? 560  ILE A CG1   1 
ATOM   4259  C  CG2   . ILE A 1  560  ? -16.758 -78.535  41.027  1.00 92.49  ? 560  ILE A CG2   1 
ATOM   4260  C  CD1   . ILE A 1  560  ? -15.836 -78.722  37.872  1.00 94.80  ? 560  ILE A CD1   1 
ATOM   4261  N  N     . PRO A 1  561  ? -14.012 -79.787  43.104  1.00 88.66  ? 561  PRO A N     1 
ATOM   4262  C  CA    . PRO A 1  561  ? -13.900 -80.410  44.426  1.00 88.74  ? 561  PRO A CA    1 
ATOM   4263  C  C     . PRO A 1  561  ? -15.277 -80.676  45.001  1.00 92.77  ? 561  PRO A C     1 
ATOM   4264  O  O     . PRO A 1  561  ? -16.247 -79.997  44.649  1.00 91.52  ? 561  PRO A O     1 
ATOM   4265  C  CB    . PRO A 1  561  ? -13.164 -79.356  45.253  1.00 88.96  ? 561  PRO A CB    1 
ATOM   4266  C  CG    . PRO A 1  561  ? -12.642 -78.360  44.255  1.00 92.22  ? 561  PRO A CG    1 
ATOM   4267  C  CD    . PRO A 1  561  ? -13.639 -78.364  43.169  1.00 88.43  ? 561  PRO A CD    1 
ATOM   4268  N  N     . THR A 1  562  ? -15.364 -81.682  45.859  1.00 90.63  ? 562  THR A N     1 
ATOM   4269  C  CA    . THR A 1  562  ? -16.623 -82.036  46.489  1.00 91.55  ? 562  THR A CA    1 
ATOM   4270  C  C     . THR A 1  562  ? -16.993 -80.962  47.497  1.00 94.12  ? 562  THR A C     1 
ATOM   4271  O  O     . THR A 1  562  ? -16.145 -80.585  48.319  1.00 92.55  ? 562  THR A O     1 
ATOM   4272  C  CB    . THR A 1  562  ? -16.562 -83.454  47.003  1.00 102.66 ? 562  THR A CB    1 
ATOM   4273  O  OG1   . THR A 1  562  ? -16.512 -84.284  45.846  1.00 106.12 ? 562  THR A OG1   1 
ATOM   4274  C  CG2   . THR A 1  562  ? -17.763 -83.827  47.874  1.00 101.31 ? 562  THR A CG2   1 
ATOM   4275  N  N     . PRO A 1  563  ? -18.228 -80.402  47.386  1.00 89.83  ? 563  PRO A N     1 
ATOM   4276  C  CA    . PRO A 1  563  ? -18.627 -79.321  48.302  1.00 88.43  ? 563  PRO A CA    1 
ATOM   4277  C  C     . PRO A 1  563  ? -18.608 -79.757  49.750  1.00 92.04  ? 563  PRO A C     1 
ATOM   4278  O  O     . PRO A 1  563  ? -19.019 -80.870  50.066  1.00 93.52  ? 563  PRO A O     1 
ATOM   4279  C  CB    . PRO A 1  563  ? -20.041 -78.957  47.838  1.00 90.16  ? 563  PRO A CB    1 
ATOM   4280  C  CG    . PRO A 1  563  ? -20.525 -80.158  47.120  1.00 95.54  ? 563  PRO A CG    1 
ATOM   4281  C  CD    . PRO A 1  563  ? -19.322 -80.738  46.452  1.00 91.15  ? 563  PRO A CD    1 
ATOM   4282  N  N     . ALA A 1  564  ? -18.116 -78.879  50.621  1.00 87.24  ? 564  ALA A N     1 
ATOM   4283  C  CA    . ALA A 1  564  ? -18.068 -79.097  52.065  1.00 87.47  ? 564  ALA A CA    1 
ATOM   4284  C  C     . ALA A 1  564  ? -19.483 -79.379  52.549  1.00 92.55  ? 564  ALA A C     1 
ATOM   4285  O  O     . ALA A 1  564  ? -19.659 -79.973  53.602  1.00 94.08  ? 564  ALA A O     1 
ATOM   4286  C  CB    . ALA A 1  564  ? -17.522 -77.854  52.767  1.00 86.72  ? 564  ALA A CB    1 
ATOM   4287  N  N     . ILE A 1  565  ? -20.485 -78.977  51.755  1.00 88.46  ? 565  ILE A N     1 
ATOM   4288  C  CA    . ILE A 1  565  ? -21.894 -79.162  52.044  1.00 89.62  ? 565  ILE A CA    1 
ATOM   4289  C  C     . ILE A 1  565  ? -22.552 -79.849  50.842  1.00 97.88  ? 565  ILE A C     1 
ATOM   4290  O  O     . ILE A 1  565  ? -22.535 -79.300  49.736  1.00 96.52  ? 565  ILE A O     1 
ATOM   4291  C  CB    . ILE A 1  565  ? -22.496 -77.793  52.441  1.00 91.39  ? 565  ILE A CB    1 
ATOM   4292  C  CG1   . ILE A 1  565  ? -22.037 -77.389  53.876  1.00 91.79  ? 565  ILE A CG1   1 
ATOM   4293  C  CG2   . ILE A 1  565  ? -23.999 -77.730  52.249  1.00 92.20  ? 565  ILE A CG2   1 
ATOM   4294  C  CD1   . ILE A 1  565  ? -22.584 -76.059  54.504  1.00 102.49 ? 565  ILE A CD1   1 
ATOM   4295  N  N     . ILE A 1  566  ? -23.080 -81.084  51.063  1.00 98.59  ? 566  ILE A N     1 
ATOM   4296  C  CA    . ILE A 1  566  ? -23.729 -81.926  50.035  1.00 100.54 ? 566  ILE A CA    1 
ATOM   4297  C  C     . ILE A 1  566  ? -25.272 -81.907  50.131  1.00 109.09 ? 566  ILE A C     1 
ATOM   4298  O  O     . ILE A 1  566  ? -25.943 -82.068  49.103  1.00 109.53 ? 566  ILE A O     1 
ATOM   4299  C  CB    . ILE A 1  566  ? -23.121 -83.359  49.996  1.00 104.26 ? 566  ILE A CB    1 
ATOM   4300  C  CG1   . ILE A 1  566  ? -21.597 -83.300  49.797  1.00 103.65 ? 566  ILE A CG1   1 
ATOM   4301  C  CG2   . ILE A 1  566  ? -23.754 -84.229  48.914  1.00 105.40 ? 566  ILE A CG2   1 
ATOM   4302  C  CD1   . ILE A 1  566  ? -20.873 -84.372  50.495  1.00 114.90 ? 566  ILE A CD1   1 
ATOM   4303  N  N     . LYS A 1  567  ? -25.808 -81.662  51.356  1.00 107.71 ? 567  LYS A N     1 
ATOM   4304  C  CA    . LYS A 1  567  ? -27.219 -81.536  51.782  1.00 109.39 ? 567  LYS A CA    1 
ATOM   4305  C  C     . LYS A 1  567  ? -28.084 -80.526  50.938  1.00 114.50 ? 567  LYS A C     1 
ATOM   4306  O  O     . LYS A 1  567  ? -27.681 -80.233  49.800  1.00 114.03 ? 567  LYS A O     1 
ATOM   4307  C  CB    . LYS A 1  567  ? -27.210 -81.079  53.230  1.00 112.18 ? 567  LYS A CB    1 
ATOM   4308  C  CG    . LYS A 1  567  ? -26.730 -79.645  53.367  1.00 137.96 ? 567  LYS A CG    1 
ATOM   4309  C  CD    . LYS A 1  567  ? -26.153 -79.367  54.690  1.00 161.73 ? 567  LYS A CD    1 
ATOM   4310  C  CE    . LYS A 1  567  ? -24.822 -80.037  54.898  1.00 184.18 ? 567  LYS A CE    1 
ATOM   4311  N  NZ    . LYS A 1  567  ? -23.834 -79.119  55.488  1.00 196.42 ? 567  LYS A NZ    1 
ATOM   4312  N  N     . PRO A 1  568  ? -29.251 -79.954  51.430  1.00 110.55 ? 568  PRO A N     1 
ATOM   4313  C  CA    . PRO A 1  568  ? -29.989 -78.997  50.592  1.00 109.04 ? 568  PRO A CA    1 
ATOM   4314  C  C     . PRO A 1  568  ? -28.997 -77.965  50.103  1.00 112.00 ? 568  PRO A C     1 
ATOM   4315  O  O     . PRO A 1  568  ? -28.326 -77.330  50.922  1.00 112.92 ? 568  PRO A O     1 
ATOM   4316  C  CB    . PRO A 1  568  ? -31.030 -78.416  51.559  1.00 110.62 ? 568  PRO A CB    1 
ATOM   4317  C  CG    . PRO A 1  568  ? -30.526 -78.737  52.940  1.00 115.24 ? 568  PRO A CG    1 
ATOM   4318  C  CD    . PRO A 1  568  ? -29.928 -80.089  52.738  1.00 112.36 ? 568  PRO A CD    1 
ATOM   4319  N  N     . LYS A 1  569  ? -28.761 -77.946  48.785  1.00 106.05 ? 569  LYS A N     1 
ATOM   4320  C  CA    . LYS A 1  569  ? -27.791 -77.060  48.135  1.00 103.00 ? 569  LYS A CA    1 
ATOM   4321  C  C     . LYS A 1  569  ? -26.328 -77.533  48.313  1.00 103.37 ? 569  LYS A C     1 
ATOM   4322  O  O     . LYS A 1  569  ? -25.816 -77.532  49.431  1.00 101.86 ? 569  LYS A O     1 
ATOM   4323  C  CB    . LYS A 1  569  ? -27.972 -75.566  48.571  1.00 103.38 ? 569  LYS A CB    1 
ATOM   4324  C  CG    . LYS A 1  569  ? -27.427 -74.530  47.606  1.00 109.62 ? 569  LYS A CG    1 
ATOM   4325  C  CD    . LYS A 1  569  ? -28.414 -73.398  47.406  1.00 120.45 ? 569  LYS A CD    1 
ATOM   4326  C  CE    . LYS A 1  569  ? -28.435 -72.972  45.955  1.00 138.45 ? 569  LYS A CE    1 
ATOM   4327  N  NZ    . LYS A 1  569  ? -29.407 -71.876  45.695  1.00 150.27 ? 569  LYS A NZ    1 
ATOM   4328  N  N     . PRO A 1  570  ? -25.632 -77.919  47.218  1.00 98.36  ? 570  PRO A N     1 
ATOM   4329  C  CA    . PRO A 1  570  ? -24.195 -78.192  47.332  1.00 97.18  ? 570  PRO A CA    1 
ATOM   4330  C  C     . PRO A 1  570  ? -23.508 -76.819  47.501  1.00 98.46  ? 570  PRO A C     1 
ATOM   4331  O  O     . PRO A 1  570  ? -23.645 -75.924  46.647  1.00 96.62  ? 570  PRO A O     1 
ATOM   4332  C  CB    . PRO A 1  570  ? -23.843 -78.865  45.998  1.00 99.12  ? 570  PRO A CB    1 
ATOM   4333  C  CG    . PRO A 1  570  ? -25.139 -78.987  45.235  1.00 104.52 ? 570  PRO A CG    1 
ATOM   4334  C  CD    . PRO A 1  570  ? -26.066 -77.975  45.811  1.00 99.72  ? 570  PRO A CD    1 
ATOM   4335  N  N     . LEU A 1  571  ? -22.857 -76.624  48.657  1.00 93.06  ? 571  LEU A N     1 
ATOM   4336  C  CA    . LEU A 1  571  ? -22.251 -75.353  49.005  1.00 90.50  ? 571  LEU A CA    1 
ATOM   4337  C  C     . LEU A 1  571  ? -20.785 -75.500  49.384  1.00 94.39  ? 571  LEU A C     1 
ATOM   4338  O  O     . LEU A 1  571  ? -20.447 -76.298  50.258  1.00 94.93  ? 571  LEU A O     1 
ATOM   4339  C  CB    . LEU A 1  571  ? -23.060 -74.743  50.158  1.00 90.24  ? 571  LEU A CB    1 
ATOM   4340  C  CG    . LEU A 1  571  ? -23.485 -73.284  50.039  1.00 93.61  ? 571  LEU A CG    1 
ATOM   4341  C  CD1   . LEU A 1  571  ? -24.225 -72.994  48.720  1.00 93.46  ? 571  LEU A CD1   1 
ATOM   4342  C  CD2   . LEU A 1  571  ? -24.327 -72.882  51.235  1.00 96.14  ? 571  LEU A CD2   1 
ATOM   4343  N  N     . TRP A 1  572  ? -19.912 -74.732  48.707  1.00 89.55  ? 572  TRP A N     1 
ATOM   4344  C  CA    . TRP A 1  572  ? -18.461 -74.730  48.932  1.00 88.17  ? 572  TRP A CA    1 
ATOM   4345  C  C     . TRP A 1  572  ? -18.075 -73.595  49.853  1.00 91.34  ? 572  TRP A C     1 
ATOM   4346  O  O     . TRP A 1  572  ? -18.563 -72.483  49.673  1.00 90.33  ? 572  TRP A O     1 
ATOM   4347  C  CB    . TRP A 1  572  ? -17.702 -74.529  47.608  1.00 85.66  ? 572  TRP A CB    1 
ATOM   4348  C  CG    . TRP A 1  572  ? -17.728 -75.698  46.678  1.00 86.96  ? 572  TRP A CG    1 
ATOM   4349  C  CD1   . TRP A 1  572  ? -16.706 -76.560  46.419  1.00 89.92  ? 572  TRP A CD1   1 
ATOM   4350  C  CD2   . TRP A 1  572  ? -18.825 -76.116  45.861  1.00 87.45  ? 572  TRP A CD2   1 
ATOM   4351  N  NE1   . TRP A 1  572  ? -17.100 -77.498  45.502  1.00 90.45  ? 572  TRP A NE1   1 
ATOM   4352  C  CE2   . TRP A 1  572  ? -18.400 -77.252  45.142  1.00 92.32  ? 572  TRP A CE2   1 
ATOM   4353  C  CE3   . TRP A 1  572  ? -20.144 -75.653  45.682  1.00 88.90  ? 572  TRP A CE3   1 
ATOM   4354  C  CZ2   . TRP A 1  572  ? -19.236 -77.919  44.234  1.00 92.63  ? 572  TRP A CZ2   1 
ATOM   4355  C  CZ3   . TRP A 1  572  ? -20.973 -76.314  44.784  1.00 91.27  ? 572  TRP A CZ3   1 
ATOM   4356  C  CH2   . TRP A 1  572  ? -20.519 -77.430  44.071  1.00 92.73  ? 572  TRP A CH2   1 
ATOM   4357  N  N     . SER A 1  573  ? -17.174 -73.847  50.815  1.00 87.59  ? 573  SER A N     1 
ATOM   4358  C  CA    . SER A 1  573  ? -16.687 -72.780  51.694  1.00 85.46  ? 573  SER A CA    1 
ATOM   4359  C  C     . SER A 1  573  ? -15.618 -71.986  50.922  1.00 89.45  ? 573  SER A C     1 
ATOM   4360  O  O     . SER A 1  573  ? -15.090 -72.466  49.903  1.00 88.80  ? 573  SER A O     1 
ATOM   4361  C  CB    . SER A 1  573  ? -16.110 -73.355  52.984  1.00 86.52  ? 573  SER A CB    1 
ATOM   4362  O  OG    . SER A 1  573  ? -14.828 -73.925  52.783  1.00 88.02  ? 573  SER A OG    1 
ATOM   4363  N  N     . GLY A 1  574  ? -15.343 -70.769  51.389  1.00 85.90  ? 574  GLY A N     1 
ATOM   4364  C  CA    . GLY A 1  574  ? -14.343 -69.898  50.779  1.00 84.47  ? 574  GLY A CA    1 
ATOM   4365  C  C     . GLY A 1  574  ? -12.977 -70.543  50.824  1.00 87.36  ? 574  GLY A C     1 
ATOM   4366  O  O     . GLY A 1  574  ? -12.262 -70.597  49.813  1.00 86.84  ? 574  GLY A O     1 
ATOM   4367  N  N     . LYS A 1  575  ? -12.664 -71.114  52.004  1.00 82.25  ? 575  LYS A N     1 
ATOM   4368  C  CA    . LYS A 1  575  ? -11.446 -71.855  52.301  1.00 80.93  ? 575  LYS A CA    1 
ATOM   4369  C  C     . LYS A 1  575  ? -11.222 -72.874  51.190  1.00 83.43  ? 575  LYS A C     1 
ATOM   4370  O  O     . LYS A 1  575  ? -10.147 -72.902  50.596  1.00 83.06  ? 575  LYS A O     1 
ATOM   4371  C  CB    . LYS A 1  575  ? -11.579 -72.561  53.664  1.00 83.56  ? 575  LYS A CB    1 
ATOM   4372  C  CG    . LYS A 1  575  ? -11.844 -71.624  54.838  1.00 85.55  ? 575  LYS A CG    1 
ATOM   4373  C  CD    . LYS A 1  575  ? -12.253 -72.404  56.071  1.00 83.34  ? 575  LYS A CD    1 
ATOM   4374  C  CE    . LYS A 1  575  ? -12.503 -71.531  57.276  1.00 76.00  ? 575  LYS A CE    1 
ATOM   4375  N  NZ    . LYS A 1  575  ? -11.241 -70.971  57.819  1.00 72.37  ? 575  LYS A NZ    1 
ATOM   4376  N  N     . GLN A 1  576  ? -12.273 -73.628  50.843  1.00 79.11  ? 576  GLN A N     1 
ATOM   4377  C  CA    . GLN A 1  576  ? -12.220 -74.635  49.797  1.00 79.35  ? 576  GLN A CA    1 
ATOM   4378  C  C     . GLN A 1  576  ? -11.645 -74.150  48.469  1.00 79.03  ? 576  GLN A C     1 
ATOM   4379  O  O     . GLN A 1  576  ? -10.513 -74.514  48.150  1.00 77.61  ? 576  GLN A O     1 
ATOM   4380  C  CB    . GLN A 1  576  ? -13.582 -75.316  49.600  1.00 82.31  ? 576  GLN A CB    1 
ATOM   4381  C  CG    . GLN A 1  576  ? -13.933 -76.371  50.646  1.00 88.43  ? 576  GLN A CG    1 
ATOM   4382  C  CD    . GLN A 1  576  ? -15.004 -77.289  50.117  1.00 95.41  ? 576  GLN A CD    1 
ATOM   4383  O  OE1   . GLN A 1  576  ? -16.087 -76.859  49.697  1.00 87.15  ? 576  GLN A OE1   1 
ATOM   4384  N  NE2   . GLN A 1  576  ? -14.708 -78.576  50.096  1.00 87.09  ? 576  GLN A NE2   1 
ATOM   4385  N  N     . ILE A 1  577  ? -12.395 -73.333  47.702  1.00 73.96  ? 577  ILE A N     1 
ATOM   4386  C  CA    . ILE A 1  577  ? -11.914 -72.873  46.383  1.00 72.79  ? 577  ILE A CA    1 
ATOM   4387  C  C     . ILE A 1  577  ? -10.567 -72.109  46.381  1.00 71.12  ? 577  ILE A C     1 
ATOM   4388  O  O     . ILE A 1  577  ? -9.848  -72.121  45.385  1.00 68.50  ? 577  ILE A O     1 
ATOM   4389  C  CB    . ILE A 1  577  ? -13.012 -72.263  45.468  1.00 76.22  ? 577  ILE A CB    1 
ATOM   4390  C  CG1   . ILE A 1  577  ? -13.987 -71.430  46.267  1.00 77.85  ? 577  ILE A CG1   1 
ATOM   4391  C  CG2   . ILE A 1  577  ? -13.768 -73.345  44.743  1.00 77.75  ? 577  ILE A CG2   1 
ATOM   4392  C  CD1   . ILE A 1  577  ? -13.383 -70.107  46.782  1.00 98.52  ? 577  ILE A CD1   1 
ATOM   4393  N  N     . LEU A 1  578  ? -10.212 -71.498  47.516  1.00 65.41  ? 578  LEU A N     1 
ATOM   4394  C  CA    . LEU A 1  578  ? -8.938  -70.808  47.639  1.00 63.50  ? 578  LEU A CA    1 
ATOM   4395  C  C     . LEU A 1  578  ? -7.766  -71.816  47.766  1.00 70.70  ? 578  LEU A C     1 
ATOM   4396  O  O     . LEU A 1  578  ? -6.645  -71.506  47.354  1.00 70.42  ? 578  LEU A O     1 
ATOM   4397  C  CB    . LEU A 1  578  ? -8.980  -69.831  48.810  1.00 61.77  ? 578  LEU A CB    1 
ATOM   4398  C  CG    . LEU A 1  578  ? -7.677  -69.160  49.148  1.00 64.37  ? 578  LEU A CG    1 
ATOM   4399  C  CD1   . LEU A 1  578  ? -7.347  -68.094  48.164  1.00 63.49  ? 578  LEU A CD1   1 
ATOM   4400  C  CD2   . LEU A 1  578  ? -7.699  -68.620  50.541  1.00 66.35  ? 578  LEU A CD2   1 
ATOM   4401  N  N     . SER A 1  579  ? -8.033  -73.030  48.299  1.00 69.20  ? 579  SER A N     1 
ATOM   4402  C  CA    . SER A 1  579  ? -7.014  -74.076  48.452  1.00 70.09  ? 579  SER A CA    1 
ATOM   4403  C  C     . SER A 1  579  ? -6.640  -74.663  47.093  1.00 75.86  ? 579  SER A C     1 
ATOM   4404  O  O     . SER A 1  579  ? -5.674  -75.446  46.992  1.00 76.57  ? 579  SER A O     1 
ATOM   4405  C  CB    . SER A 1  579  ? -7.508  -75.182  49.377  1.00 74.67  ? 579  SER A CB    1 
ATOM   4406  O  OG    . SER A 1  579  ? -7.509  -74.810  50.745  1.00 83.09  ? 579  SER A OG    1 
ATOM   4407  N  N     . VAL A 1  580  ? -7.442  -74.297  46.050  1.00 71.59  ? 580  VAL A N     1 
ATOM   4408  C  CA    . VAL A 1  580  ? -7.253  -74.700  44.654  1.00 71.28  ? 580  VAL A CA    1 
ATOM   4409  C  C     . VAL A 1  580  ? -6.026  -73.925  44.142  1.00 77.02  ? 580  VAL A C     1 
ATOM   4410  O  O     . VAL A 1  580  ? -5.199  -74.484  43.401  1.00 77.86  ? 580  VAL A O     1 
ATOM   4411  C  CB    . VAL A 1  580  ? -8.541  -74.461  43.805  1.00 73.13  ? 580  VAL A CB    1 
ATOM   4412  C  CG1   . VAL A 1  580  ? -8.336  -74.779  42.327  1.00 72.06  ? 580  VAL A CG1   1 
ATOM   4413  C  CG2   . VAL A 1  580  ? -9.713  -75.257  44.364  1.00 73.75  ? 580  VAL A CG2   1 
ATOM   4414  N  N     . ALA A 1  581  ? -5.881  -72.655  44.611  1.00 71.99  ? 581  ALA A N     1 
ATOM   4415  C  CA    . ALA A 1  581  ? -4.770  -71.773  44.261  1.00 70.59  ? 581  ALA A CA    1 
ATOM   4416  C  C     . ALA A 1  581  ? -3.479  -72.238  44.908  1.00 75.26  ? 581  ALA A C     1 
ATOM   4417  O  O     . ALA A 1  581  ? -2.412  -72.015  44.330  1.00 75.19  ? 581  ALA A O     1 
ATOM   4418  C  CB    . ALA A 1  581  ? -5.078  -70.345  44.667  1.00 70.10  ? 581  ALA A CB    1 
ATOM   4419  N  N     . ILE A 1  582  ? -3.579  -72.893  46.093  1.00 72.09  ? 582  ILE A N     1 
ATOM   4420  C  CA    . ILE A 1  582  ? -2.444  -73.449  46.841  1.00 72.35  ? 582  ILE A CA    1 
ATOM   4421  C  C     . ILE A 1  582  ? -2.030  -74.790  46.200  1.00 79.58  ? 582  ILE A C     1 
ATOM   4422  O  O     . ILE A 1  582  ? -2.872  -75.700  46.059  1.00 80.61  ? 582  ILE A O     1 
ATOM   4423  C  CB    . ILE A 1  582  ? -2.738  -73.613  48.368  1.00 75.08  ? 582  ILE A CB    1 
ATOM   4424  C  CG1   . ILE A 1  582  ? -3.315  -72.315  48.981  1.00 73.84  ? 582  ILE A CG1   1 
ATOM   4425  C  CG2   . ILE A 1  582  ? -1.483  -74.097  49.135  1.00 75.11  ? 582  ILE A CG2   1 
ATOM   4426  C  CD1   . ILE A 1  582  ? -4.073  -72.497  50.267  1.00 75.19  ? 582  ILE A CD1   1 
ATOM   4427  N  N     . PRO A 1  583  ? -0.731  -74.934  45.831  1.00 77.03  ? 583  PRO A N     1 
ATOM   4428  C  CA    . PRO A 1  583  ? -0.283  -76.199  45.221  1.00 79.38  ? 583  PRO A CA    1 
ATOM   4429  C  C     . PRO A 1  583  ? -0.248  -77.367  46.213  1.00 89.04  ? 583  PRO A C     1 
ATOM   4430  O  O     . PRO A 1  583  ? -0.262  -77.139  47.419  1.00 89.88  ? 583  PRO A O     1 
ATOM   4431  C  CB    . PRO A 1  583  ? 1.121   -75.865  44.690  1.00 79.97  ? 583  PRO A CB    1 
ATOM   4432  C  CG    . PRO A 1  583  ? 1.583   -74.743  45.502  1.00 82.04  ? 583  PRO A CG    1 
ATOM   4433  C  CD    . PRO A 1  583  ? 0.379   -73.966  45.940  1.00 76.80  ? 583  PRO A CD    1 
ATOM   4434  N  N     . ASN A 1  584  ? -0.168  -78.610  45.710  1.00 87.88  ? 584  ASN A N     1 
ATOM   4435  C  CA    . ASN A 1  584  ? -0.075  -79.794  46.567  1.00 89.35  ? 584  ASN A CA    1 
ATOM   4436  C  C     . ASN A 1  584  ? 1.282   -79.836  47.328  1.00 93.18  ? 584  ASN A C     1 
ATOM   4437  O  O     . ASN A 1  584  ? 2.182   -79.053  46.998  1.00 92.92  ? 584  ASN A O     1 
ATOM   4438  C  CB    . ASN A 1  584  ? -0.300  -81.058  45.731  1.00 91.90  ? 584  ASN A CB    1 
ATOM   4439  C  CG    . ASN A 1  584  ? -1.700  -81.184  45.181  1.00 120.82 ? 584  ASN A CG    1 
ATOM   4440  O  OD1   . ASN A 1  584  ? -1.898  -81.610  44.041  1.00 114.73 ? 584  ASN A OD1   1 
ATOM   4441  N  ND2   . ASN A 1  584  ? -2.711  -80.843  45.980  1.00 117.01 ? 584  ASN A ND2   1 
ATOM   4442  N  N     . GLY A 1  585  ? 1.389   -80.698  48.351  1.00 88.45  ? 585  GLY A N     1 
ATOM   4443  C  CA    . GLY A 1  585  ? 2.596   -80.855  49.159  1.00 87.61  ? 585  GLY A CA    1 
ATOM   4444  C  C     . GLY A 1  585  ? 2.972   -79.660  50.019  1.00 89.88  ? 585  GLY A C     1 
ATOM   4445  O  O     . GLY A 1  585  ? 4.086   -79.607  50.566  1.00 89.66  ? 585  GLY A O     1 
ATOM   4446  N  N     . ILE A 1  586  ? 2.053   -78.673  50.133  1.00 84.67  ? 586  ILE A N     1 
ATOM   4447  C  CA    . ILE A 1  586  ? 2.269   -77.463  50.934  1.00 82.18  ? 586  ILE A CA    1 
ATOM   4448  C  C     . ILE A 1  586  ? 1.695   -77.714  52.314  1.00 86.46  ? 586  ILE A C     1 
ATOM   4449  O  O     . ILE A 1  586  ? 0.496   -77.982  52.468  1.00 84.90  ? 586  ILE A O     1 
ATOM   4450  C  CB    . ILE A 1  586  ? 1.763   -76.137  50.250  1.00 82.35  ? 586  ILE A CB    1 
ATOM   4451  C  CG1   . ILE A 1  586  ? 2.424   -75.879  48.870  1.00 81.18  ? 586  ILE A CG1   1 
ATOM   4452  C  CG2   . ILE A 1  586  ? 1.896   -74.918  51.162  1.00 80.34  ? 586  ILE A CG2   1 
ATOM   4453  C  CD1   . ILE A 1  586  ? 3.948   -75.739  48.813  1.00 82.15  ? 586  ILE A CD1   1 
ATOM   4454  N  N     . HIS A 1  587  ? 2.572   -77.705  53.299  1.00 85.10  ? 587  HIS A N     1 
ATOM   4455  C  CA    . HIS A 1  587  ? 2.143   -77.937  54.655  1.00 87.73  ? 587  HIS A CA    1 
ATOM   4456  C  C     . HIS A 1  587  ? 2.497   -76.708  55.451  1.00 86.95  ? 587  HIS A C     1 
ATOM   4457  O  O     . HIS A 1  587  ? 3.637   -76.247  55.370  1.00 86.17  ? 587  HIS A O     1 
ATOM   4458  C  CB    . HIS A 1  587  ? 2.798   -79.215  55.249  1.00 92.78  ? 587  HIS A CB    1 
ATOM   4459  C  CG    . HIS A 1  587  ? 2.874   -80.397  54.303  1.00 100.07 ? 587  HIS A CG    1 
ATOM   4460  N  ND1   . HIS A 1  587  ? 1.788   -80.774  53.495  1.00 103.56 ? 587  HIS A ND1   1 
ATOM   4461  C  CD2   . HIS A 1  587  ? 3.889   -81.276  54.091  1.00 104.36 ? 587  HIS A CD2   1 
ATOM   4462  C  CE1   . HIS A 1  587  ? 2.194   -81.839  52.810  1.00 104.45 ? 587  HIS A CE1   1 
ATOM   4463  N  NE2   . HIS A 1  587  ? 3.446   -82.185  53.132  1.00 105.21 ? 587  HIS A NE2   1 
ATOM   4464  N  N     . LEU A 1  588  ? 1.530   -76.149  56.196  1.00 80.65  ? 588  LEU A N     1 
ATOM   4465  C  CA    . LEU A 1  588  ? 1.782   -74.974  57.040  1.00 79.02  ? 588  LEU A CA    1 
ATOM   4466  C  C     . LEU A 1  588  ? 0.978   -75.028  58.345  1.00 83.62  ? 588  LEU A C     1 
ATOM   4467  O  O     . LEU A 1  588  ? -0.239  -75.243  58.305  1.00 83.94  ? 588  LEU A O     1 
ATOM   4468  C  CB    . LEU A 1  588  ? 1.478   -73.683  56.267  1.00 77.59  ? 588  LEU A CB    1 
ATOM   4469  C  CG    . LEU A 1  588  ? 2.008   -72.389  56.839  1.00 80.14  ? 588  LEU A CG    1 
ATOM   4470  C  CD1   . LEU A 1  588  ? 2.522   -71.520  55.746  1.00 78.94  ? 588  LEU A CD1   1 
ATOM   4471  C  CD2   . LEU A 1  588  ? 0.944   -71.668  57.642  1.00 81.39  ? 588  LEU A CD2   1 
ATOM   4472  N  N     . GLN A 1  589  ? 1.661   -74.812  59.491  1.00 79.55  ? 589  GLN A N     1 
ATOM   4473  C  CA    . GLN A 1  589  ? 1.054   -74.839  60.818  1.00 79.82  ? 589  GLN A CA    1 
ATOM   4474  C  C     . GLN A 1  589  ? 1.337   -73.558  61.591  1.00 84.00  ? 589  GLN A C     1 
ATOM   4475  O  O     . GLN A 1  589  ? 2.472   -73.068  61.551  1.00 83.44  ? 589  GLN A O     1 
ATOM   4476  C  CB    . GLN A 1  589  ? 1.573   -76.033  61.600  1.00 82.53  ? 589  GLN A CB    1 
ATOM   4477  C  CG    . GLN A 1  589  ? 0.509   -76.667  62.484  1.00 113.24 ? 589  GLN A CG    1 
ATOM   4478  C  CD    . GLN A 1  589  ? 1.008   -77.923  63.161  1.00 137.50 ? 589  GLN A CD    1 
ATOM   4479  O  OE1   . GLN A 1  589  ? 0.937   -79.032  62.611  1.00 133.34 ? 589  GLN A OE1   1 
ATOM   4480  N  NE2   . GLN A 1  589  ? 1.528   -77.777  64.371  1.00 128.65 ? 589  GLN A NE2   1 
ATOM   4481  N  N     . ARG A 1  590  ? 0.331   -73.005  62.300  1.00 80.78  ? 590  ARG A N     1 
ATOM   4482  C  CA    . ARG A 1  590  ? 0.627   -71.795  63.040  1.00 80.83  ? 590  ARG A CA    1 
ATOM   4483  C  C     . ARG A 1  590  ? 0.414   -71.775  64.535  1.00 92.90  ? 590  ARG A C     1 
ATOM   4484  O  O     . ARG A 1  590  ? 1.406   -71.736  65.292  1.00 94.95  ? 590  ARG A O     1 
ATOM   4485  C  CB    . ARG A 1  590  ? 0.095   -70.535  62.393  1.00 77.15  ? 590  ARG A CB    1 
ATOM   4486  C  CG    . ARG A 1  590  ? 1.135   -69.413  62.458  1.00 80.98  ? 590  ARG A CG    1 
ATOM   4487  C  CD    . ARG A 1  590  ? 0.587   -67.993  62.590  1.00 83.54  ? 590  ARG A CD    1 
ATOM   4488  N  NE    . ARG A 1  590  ? -0.665  -67.742  61.864  1.00 90.20  ? 590  ARG A NE    1 
ATOM   4489  C  CZ    . ARG A 1  590  ? -0.816  -67.799  60.538  1.00 110.49 ? 590  ARG A CZ    1 
ATOM   4490  N  NH1   . ARG A 1  590  ? 0.206   -68.143  59.755  1.00 86.45  ? 590  ARG A NH1   1 
ATOM   4491  N  NH2   . ARG A 1  590  ? -1.998  -67.555  59.991  1.00 111.54 ? 590  ARG A NH2   1 
ATOM   4492  N  N     . PHE A 1  591  ? -0.865  -71.728  64.974  1.00 91.08  ? 591  PHE A N     1 
ATOM   4493  C  CA    . PHE A 1  591  ? -1.242  -71.576  66.388  1.00 90.89  ? 591  PHE A CA    1 
ATOM   4494  C  C     . PHE A 1  591  ? -1.037  -70.134  66.813  1.00 95.16  ? 591  PHE A C     1 
ATOM   4495  O  O     . PHE A 1  591  ? 0.078   -69.686  67.081  1.00 93.74  ? 591  PHE A O     1 
ATOM   4496  C  CB    . PHE A 1  591  ? -0.632  -72.636  67.352  1.00 92.72  ? 591  PHE A CB    1 
ATOM   4497  C  CG    . PHE A 1  591  ? -1.141  -74.018  67.033  1.00 94.56  ? 591  PHE A CG    1 
ATOM   4498  C  CD1   . PHE A 1  591  ? -0.465  -74.835  66.127  1.00 97.83  ? 591  PHE A CD1   1 
ATOM   4499  C  CD2   . PHE A 1  591  ? -2.348  -74.470  67.559  1.00 96.77  ? 591  PHE A CD2   1 
ATOM   4500  C  CE1   . PHE A 1  591  ? -0.990  -76.082  65.750  1.00 99.72  ? 591  PHE A CE1   1 
ATOM   4501  C  CE2   . PHE A 1  591  ? -2.870  -75.713  67.185  1.00 100.99 ? 591  PHE A CE2   1 
ATOM   4502  C  CZ    . PHE A 1  591  ? -2.186  -76.513  66.284  1.00 99.49  ? 591  PHE A CZ    1 
ATOM   4503  N  N     . ASP A 1  592  ? -2.118  -69.381  66.719  1.00 93.86  ? 592  ASP A N     1 
ATOM   4504  C  CA    . ASP A 1  592  ? -2.154  -67.981  67.065  1.00 94.59  ? 592  ASP A CA    1 
ATOM   4505  C  C     . ASP A 1  592  ? -2.275  -67.877  68.604  1.00 101.39 ? 592  ASP A C     1 
ATOM   4506  O  O     . ASP A 1  592  ? -1.332  -68.269  69.292  1.00 102.08 ? 592  ASP A O     1 
ATOM   4507  C  CB    . ASP A 1  592  ? -3.281  -67.247  66.273  1.00 96.66  ? 592  ASP A CB    1 
ATOM   4508  C  CG    . ASP A 1  592  ? -2.929  -66.713  64.874  1.00 107.83 ? 592  ASP A CG    1 
ATOM   4509  O  OD1   . ASP A 1  592  ? -2.026  -67.289  64.218  1.00 109.07 ? 592  ASP A OD1   1 
ATOM   4510  O  OD2   . ASP A 1  592  ? -3.606  -65.767  64.411  1.00 111.22 ? 592  ASP A OD2   1 
ATOM   4511  N  N     . GLU A 1  593  ? -3.413  -67.400  69.146  1.00 99.24  ? 593  GLU A N     1 
ATOM   4512  C  CA    . GLU A 1  593  ? -3.585  -67.241  70.586  1.00 100.22 ? 593  GLU A CA    1 
ATOM   4513  C  C     . GLU A 1  593  ? -4.395  -68.367  71.182  1.00 106.32 ? 593  GLU A C     1 
ATOM   4514  O  O     . GLU A 1  593  ? -3.817  -69.271  71.802  1.00 107.73 ? 593  GLU A O     1 
ATOM   4515  C  CB    . GLU A 1  593  ? -4.162  -65.855  70.935  1.00 101.12 ? 593  GLU A CB    1 
ATOM   4516  C  CG    . GLU A 1  593  ? -4.091  -65.495  72.413  1.00 116.50 ? 593  GLU A CG    1 
ATOM   4517  C  CD    . GLU A 1  593  ? -2.699  -65.429  73.018  1.00 141.40 ? 593  GLU A CD    1 
ATOM   4518  O  OE1   . GLU A 1  593  ? -2.059  -64.355  72.926  1.00 123.35 ? 593  GLU A OE1   1 
ATOM   4519  O  OE2   . GLU A 1  593  ? -2.258  -66.447  73.600  1.00 140.85 ? 593  GLU A OE2   1 
ATOM   4520  N  N     . GLY A 1  594  ? -5.713  -68.311  70.977  1.00 102.30 ? 594  GLY A N     1 
ATOM   4521  C  CA    . GLY A 1  594  ? -6.661  -69.314  71.463  1.00 102.74 ? 594  GLY A CA    1 
ATOM   4522  C  C     . GLY A 1  594  ? -6.447  -70.690  70.872  1.00 104.39 ? 594  GLY A C     1 
ATOM   4523  O  O     . GLY A 1  594  ? -6.612  -71.684  71.571  1.00 104.47 ? 594  GLY A O     1 
ATOM   4524  N  N     . THR A 1  595  ? -6.065  -70.730  69.579  1.00 99.33  ? 595  THR A N     1 
ATOM   4525  C  CA    . THR A 1  595  ? -5.754  -71.887  68.739  1.00 99.41  ? 595  THR A CA    1 
ATOM   4526  C  C     . THR A 1  595  ? -5.544  -73.188  69.459  1.00 104.07 ? 595  THR A C     1 
ATOM   4527  O  O     . THR A 1  595  ? -4.580  -73.343  70.215  1.00 103.88 ? 595  THR A O     1 
ATOM   4528  C  CB    . THR A 1  595  ? -4.548  -71.605  67.894  1.00 105.25 ? 595  THR A CB    1 
ATOM   4529  O  OG1   . THR A 1  595  ? -3.679  -70.681  68.568  1.00 104.64 ? 595  THR A OG1   1 
ATOM   4530  C  CG2   . THR A 1  595  ? -4.919  -71.165  66.530  1.00 99.61  ? 595  THR A CG2   1 
ATOM   4531  N  N     . THR A 1  596  ? -6.440  -74.128  69.198  1.00 100.88 ? 596  THR A N     1 
ATOM   4532  C  CA    . THR A 1  596  ? -6.428  -75.411  69.863  1.00 101.91 ? 596  THR A CA    1 
ATOM   4533  C  C     . THR A 1  596  ? -5.915  -76.547  68.963  1.00 108.52 ? 596  THR A C     1 
ATOM   4534  O  O     . THR A 1  596  ? -4.894  -77.156  69.287  1.00 110.81 ? 596  THR A O     1 
ATOM   4535  C  CB    . THR A 1  596  ? -7.803  -75.681  70.519  1.00 102.20 ? 596  THR A CB    1 
ATOM   4536  O  OG1   . THR A 1  596  ? -8.809  -75.696  69.506  1.00 105.24 ? 596  THR A OG1   1 
ATOM   4537  C  CG2   . THR A 1  596  ? -8.162  -74.662  71.594  1.00 91.17  ? 596  THR A CG2   1 
ATOM   4538  N  N     . LEU A 1  597  ? -6.630  -76.825  67.855  1.00 103.02 ? 597  LEU A N     1 
ATOM   4539  C  CA    . LEU A 1  597  ? -6.491  -77.888  66.843  1.00 102.80 ? 597  LEU A CA    1 
ATOM   4540  C  C     . LEU A 1  597  ? -7.929  -78.130  66.467  1.00 107.86 ? 597  LEU A C     1 
ATOM   4541  O  O     . LEU A 1  597  ? -8.242  -78.849  65.521  1.00 107.54 ? 597  LEU A O     1 
ATOM   4542  C  CB    . LEU A 1  597  ? -5.886  -79.208  67.374  1.00 104.05 ? 597  LEU A CB    1 
ATOM   4543  C  CG    . LEU A 1  597  ? -4.571  -79.679  66.728  1.00 108.55 ? 597  LEU A CG    1 
ATOM   4544  C  CD1   . LEU A 1  597  ? -3.985  -80.864  67.482  1.00 109.85 ? 597  LEU A CD1   1 
ATOM   4545  C  CD2   . LEU A 1  597  ? -4.745  -80.028  65.241  1.00 110.32 ? 597  LEU A CD2   1 
ATOM   4546  N  N     . LEU A 1  598  ? -8.807  -77.521  67.263  1.00 105.88 ? 598  LEU A N     1 
ATOM   4547  C  CA    . LEU A 1  598  ? -10.246 -77.488  67.102  1.00 107.03 ? 598  LEU A CA    1 
ATOM   4548  C  C     . LEU A 1  598  ? -10.620 -76.006  66.865  1.00 109.10 ? 598  LEU A C     1 
ATOM   4549  O  O     . LEU A 1  598  ? -11.806 -75.681  66.763  1.00 109.60 ? 598  LEU A O     1 
ATOM   4550  C  CB    . LEU A 1  598  ? -10.925 -78.070  68.362  1.00 108.79 ? 598  LEU A CB    1 
ATOM   4551  C  CG    . LEU A 1  598  ? -12.231 -78.881  68.181  1.00 115.27 ? 598  LEU A CG    1 
ATOM   4552  C  CD1   . LEU A 1  598  ? -13.426 -78.087  68.623  1.00 115.55 ? 598  LEU A CD1   1 
ATOM   4553  C  CD2   . LEU A 1  598  ? -12.410 -79.429  66.757  1.00 117.48 ? 598  LEU A CD2   1 
ATOM   4554  N  N     . SER A 1  599  ? -9.570  -75.129  66.726  1.00 102.34 ? 599  SER A N     1 
ATOM   4555  C  CA    . SER A 1  599  ? -9.571  -73.678  66.442  1.00 99.50  ? 599  SER A CA    1 
ATOM   4556  C  C     . SER A 1  599  ? -10.931 -73.004  66.612  1.00 103.03 ? 599  SER A C     1 
ATOM   4557  O  O     . SER A 1  599  ? -11.617 -72.743  65.624  1.00 102.23 ? 599  SER A O     1 
ATOM   4558  C  CB    . SER A 1  599  ? -9.010  -73.409  65.052  1.00 99.16  ? 599  SER A CB    1 
ATOM   4559  O  OG    . SER A 1  599  ? -9.001  -72.024  64.765  1.00 99.85  ? 599  SER A OG    1 
ATOM   4560  N  N     . PRO A 1  600  ? -11.354 -72.760  67.866  1.00 99.81  ? 600  PRO A N     1 
ATOM   4561  C  CA    . PRO A 1  600  ? -12.689 -72.190  68.096  1.00 99.21  ? 600  PRO A CA    1 
ATOM   4562  C  C     . PRO A 1  600  ? -12.944 -70.842  67.469  1.00 98.52  ? 600  PRO A C     1 
ATOM   4563  O  O     . PRO A 1  600  ? -14.053 -70.629  66.990  1.00 98.47  ? 600  PRO A O     1 
ATOM   4564  C  CB    . PRO A 1  600  ? -12.781 -72.111  69.622  1.00 101.96 ? 600  PRO A CB    1 
ATOM   4565  C  CG    . PRO A 1  600  ? -11.350 -72.089  70.091  1.00 106.24 ? 600  PRO A CG    1 
ATOM   4566  C  CD    . PRO A 1  600  ? -10.658 -73.014  69.144  1.00 101.96 ? 600  PRO A CD    1 
ATOM   4567  N  N     . LYS A 1  601  ? -11.942 -69.947  67.483  1.00 91.06  ? 601  LYS A N     1 
ATOM   4568  C  CA    . LYS A 1  601  ? -12.084 -68.590  66.958  1.00 89.16  ? 601  LYS A CA    1 
ATOM   4569  C  C     . LYS A 1  601  ? -11.784 -68.494  65.437  1.00 91.15  ? 601  LYS A C     1 
ATOM   4570  O  O     . LYS A 1  601  ? -11.885 -67.410  64.849  1.00 88.63  ? 601  LYS A O     1 
ATOM   4571  C  CB    . LYS A 1  601  ? -11.191 -67.626  67.761  1.00 90.60  ? 601  LYS A CB    1 
ATOM   4572  C  CG    . LYS A 1  601  ? -11.278 -67.791  69.285  1.00 105.53 ? 601  LYS A CG    1 
ATOM   4573  C  CD    . LYS A 1  601  ? -10.546 -66.672  70.063  1.00 114.47 ? 601  LYS A CD    1 
ATOM   4574  C  CE    . LYS A 1  601  ? -9.028  -66.773  70.061  1.00 121.67 ? 601  LYS A CE    1 
ATOM   4575  N  NZ    . LYS A 1  601  ? -8.371  -65.658  70.802  1.00 124.55 ? 601  LYS A NZ    1 
ATOM   4576  N  N     . ASP A 1  602  ? -11.438 -69.643  64.811  1.00 87.47  ? 602  ASP A N     1 
ATOM   4577  C  CA    . ASP A 1  602  ? -10.999 -69.773  63.420  1.00 86.15  ? 602  ASP A CA    1 
ATOM   4578  C  C     . ASP A 1  602  ? -9.664  -69.014  63.253  1.00 88.38  ? 602  ASP A C     1 
ATOM   4579  O  O     . ASP A 1  602  ? -9.370  -68.487  62.190  1.00 88.63  ? 602  ASP A O     1 
ATOM   4580  C  CB    . ASP A 1  602  ? -12.092 -69.369  62.397  1.00 87.58  ? 602  ASP A CB    1 
ATOM   4581  C  CG    . ASP A 1  602  ? -11.979 -69.950  60.979  1.00 93.55  ? 602  ASP A CG    1 
ATOM   4582  O  OD1   . ASP A 1  602  ? -11.336 -71.031  60.817  1.00 93.60  ? 602  ASP A OD1   1 
ATOM   4583  O  OD2   . ASP A 1  602  ? -12.601 -69.363  60.040  1.00 94.86  ? 602  ASP A OD2   1 
ATOM   4584  N  N     . ASN A 1  603  ? -8.851  -68.979  64.318  1.00 84.01  ? 603  ASN A N     1 
ATOM   4585  C  CA    . ASN A 1  603  ? -7.536  -68.341  64.325  1.00 82.82  ? 603  ASN A CA    1 
ATOM   4586  C  C     . ASN A 1  603  ? -6.471  -69.385  63.997  1.00 86.54  ? 603  ASN A C     1 
ATOM   4587  O  O     . ASN A 1  603  ? -6.822  -70.543  63.773  1.00 88.02  ? 603  ASN A O     1 
ATOM   4588  C  CB    . ASN A 1  603  ? -7.266  -67.613  65.663  1.00 84.55  ? 603  ASN A CB    1 
ATOM   4589  C  CG    . ASN A 1  603  ? -7.189  -68.473  66.896  1.00 118.81 ? 603  ASN A CG    1 
ATOM   4590  O  OD1   . ASN A 1  603  ? -7.792  -69.556  67.012  1.00 117.94 ? 603  ASN A OD1   1 
ATOM   4591  N  ND2   . ASN A 1  603  ? -6.461  -67.972  67.872  1.00 114.08 ? 603  ASN A ND2   1 
ATOM   4592  N  N     . GLY A 1  604  ? -5.205  -68.969  63.924  1.00 81.63  ? 604  GLY A N     1 
ATOM   4593  C  CA    . GLY A 1  604  ? -4.076  -69.836  63.586  1.00 81.56  ? 604  GLY A CA    1 
ATOM   4594  C  C     . GLY A 1  604  ? -4.120  -70.328  62.156  1.00 84.54  ? 604  GLY A C     1 
ATOM   4595  O  O     . GLY A 1  604  ? -4.868  -69.774  61.340  1.00 84.91  ? 604  GLY A O     1 
ATOM   4596  N  N     . MET A 1  605  ? -3.326  -71.371  61.829  1.00 78.93  ? 605  MET A N     1 
ATOM   4597  C  CA    . MET A 1  605  ? -3.329  -71.885  60.464  1.00 77.74  ? 605  MET A CA    1 
ATOM   4598  C  C     . MET A 1  605  ? -2.921  -73.306  60.377  1.00 82.74  ? 605  MET A C     1 
ATOM   4599  O  O     . MET A 1  605  ? -1.950  -73.702  61.014  1.00 83.13  ? 605  MET A O     1 
ATOM   4600  C  CB    . MET A 1  605  ? -2.424  -71.045  59.532  1.00 78.51  ? 605  MET A CB    1 
ATOM   4601  C  CG    . MET A 1  605  ? -2.681  -71.278  58.041  1.00 80.90  ? 605  MET A CG    1 
ATOM   4602  S  SD    . MET A 1  605  ? -4.256  -70.606  57.495  1.00 83.16  ? 605  MET A SD    1 
ATOM   4603  C  CE    . MET A 1  605  ? -4.892  -71.930  56.780  1.00 80.65  ? 605  MET A CE    1 
ATOM   4604  N  N     . LEU A 1  606  ? -3.642  -74.061  59.538  1.00 79.99  ? 606  LEU A N     1 
ATOM   4605  C  CA    . LEU A 1  606  ? -3.344  -75.435  59.207  1.00 81.26  ? 606  LEU A CA    1 
ATOM   4606  C  C     . LEU A 1  606  ? -3.686  -75.704  57.770  1.00 84.68  ? 606  LEU A C     1 
ATOM   4607  O  O     . LEU A 1  606  ? -4.852  -75.638  57.377  1.00 83.68  ? 606  LEU A O     1 
ATOM   4608  C  CB    . LEU A 1  606  ? -4.006  -76.455  60.139  1.00 83.13  ? 606  LEU A CB    1 
ATOM   4609  C  CG    . LEU A 1  606  ? -3.654  -77.931  59.852  1.00 89.51  ? 606  LEU A CG    1 
ATOM   4610  C  CD1   . LEU A 1  606  ? -2.233  -78.251  60.282  1.00 90.28  ? 606  LEU A CD1   1 
ATOM   4611  C  CD2   . LEU A 1  606  ? -4.628  -78.869  60.520  1.00 91.66  ? 606  LEU A CD2   1 
ATOM   4612  N  N     . ILE A 1  607  ? -2.649  -75.981  56.985  1.00 82.12  ? 607  ILE A N     1 
ATOM   4613  C  CA    . ILE A 1  607  ? -2.749  -76.317  55.572  1.00 83.04  ? 607  ILE A CA    1 
ATOM   4614  C  C     . ILE A 1  607  ? -2.011  -77.642  55.431  1.00 88.55  ? 607  ILE A C     1 
ATOM   4615  O  O     . ILE A 1  607  ? -0.850  -77.726  55.842  1.00 88.33  ? 607  ILE A O     1 
ATOM   4616  C  CB    . ILE A 1  607  ? -2.116  -75.221  54.659  1.00 85.54  ? 607  ILE A CB    1 
ATOM   4617  C  CG1   . ILE A 1  607  ? -2.777  -73.841  54.826  1.00 84.82  ? 607  ILE A CG1   1 
ATOM   4618  C  CG2   . ILE A 1  607  ? -2.120  -75.647  53.185  1.00 87.54  ? 607  ILE A CG2   1 
ATOM   4619  C  CD1   . ILE A 1  607  ? -1.800  -72.632  54.730  1.00 88.27  ? 607  ILE A CD1   1 
ATOM   4620  N  N     . ILE A 1  608  ? -2.684  -78.676  54.886  1.00 85.95  ? 608  ILE A N     1 
ATOM   4621  C  CA    . ILE A 1  608  ? -2.086  -80.002  54.673  1.00 87.21  ? 608  ILE A CA    1 
ATOM   4622  C  C     . ILE A 1  608  ? -2.286  -80.450  53.225  1.00 92.98  ? 608  ILE A C     1 
ATOM   4623  O  O     . ILE A 1  608  ? -3.414  -80.427  52.718  1.00 92.90  ? 608  ILE A O     1 
ATOM   4624  C  CB    . ILE A 1  608  ? -2.549  -81.066  55.697  1.00 91.48  ? 608  ILE A CB    1 
ATOM   4625  C  CG1   . ILE A 1  608  ? -2.432  -80.557  57.162  1.00 91.42  ? 608  ILE A CG1   1 
ATOM   4626  C  CG2   . ILE A 1  608  ? -1.781  -82.383  55.487  1.00 93.11  ? 608  ILE A CG2   1 
ATOM   4627  C  CD1   . ILE A 1  608  ? -3.311  -81.306  58.152  1.00 98.56  ? 608  ILE A CD1   1 
ATOM   4628  N  N     . ASP A 1  609  ? -1.175  -80.843  52.559  1.00 90.16  ? 609  ASP A N     1 
ATOM   4629  C  CA    . ASP A 1  609  ? -1.123  -81.221  51.147  1.00 90.43  ? 609  ASP A CA    1 
ATOM   4630  C  C     . ASP A 1  609  ? -1.710  -80.081  50.278  1.00 95.69  ? 609  ASP A C     1 
ATOM   4631  O  O     . ASP A 1  609  ? -2.366  -80.314  49.257  1.00 95.76  ? 609  ASP A O     1 
ATOM   4632  C  CB    . ASP A 1  609  ? -1.805  -82.575  50.903  1.00 93.34  ? 609  ASP A CB    1 
ATOM   4633  C  CG    . ASP A 1  609  ? -1.593  -83.136  49.516  1.00 102.15 ? 609  ASP A CG    1 
ATOM   4634  O  OD1   . ASP A 1  609  ? -0.434  -83.093  49.025  1.00 102.47 ? 609  ASP A OD1   1 
ATOM   4635  O  OD2   . ASP A 1  609  ? -2.589  -83.583  48.900  1.00 106.94 ? 609  ASP A OD2   1 
ATOM   4636  N  N     . GLY A 1  610  ? -1.476  -78.849  50.729  1.00 92.58  ? 610  GLY A N     1 
ATOM   4637  C  CA    . GLY A 1  610  ? -1.952  -77.645  50.063  1.00 91.93  ? 610  GLY A CA    1 
ATOM   4638  C  C     . GLY A 1  610  ? -3.462  -77.488  49.999  1.00 95.93  ? 610  GLY A C     1 
ATOM   4639  O  O     . GLY A 1  610  ? -4.022  -77.185  48.924  1.00 96.23  ? 610  GLY A O     1 
ATOM   4640  N  N     . GLN A 1  611  ? -4.119  -77.723  51.167  1.00 90.07  ? 611  GLN A N     1 
ATOM   4641  C  CA    . GLN A 1  611  ? -5.560  -77.600  51.400  1.00 88.84  ? 611  GLN A CA    1 
ATOM   4642  C  C     . GLN A 1  611  ? -5.744  -77.003  52.783  1.00 88.95  ? 611  GLN A C     1 
ATOM   4643  O  O     . GLN A 1  611  ? -5.204  -77.545  53.743  1.00 88.69  ? 611  GLN A O     1 
ATOM   4644  C  CB    . GLN A 1  611  ? -6.287  -78.961  51.255  1.00 91.92  ? 611  GLN A CB    1 
ATOM   4645  C  CG    . GLN A 1  611  ? -6.310  -79.566  49.822  1.00 110.11 ? 611  GLN A CG    1 
ATOM   4646  C  CD    . GLN A 1  611  ? -7.030  -78.731  48.775  1.00 127.97 ? 611  GLN A CD    1 
ATOM   4647  O  OE1   . GLN A 1  611  ? -8.261  -78.544  48.822  1.00 120.92 ? 611  GLN A OE1   1 
ATOM   4648  N  NE2   . GLN A 1  611  ? -6.272  -78.235  47.786  1.00 119.56 ? 611  GLN A NE2   1 
ATOM   4649  N  N     . ILE A 1  612  ? -6.411  -75.841  52.884  1.00 83.71  ? 612  ILE A N     1 
ATOM   4650  C  CA    . ILE A 1  612  ? -6.557  -75.177  54.182  1.00 83.15  ? 612  ILE A CA    1 
ATOM   4651  C  C     . ILE A 1  612  ? -7.551  -75.934  55.016  1.00 88.69  ? 612  ILE A C     1 
ATOM   4652  O  O     . ILE A 1  612  ? -8.686  -76.128  54.586  1.00 88.48  ? 612  ILE A O     1 
ATOM   4653  C  CB    . ILE A 1  612  ? -6.703  -73.599  54.196  1.00 84.80  ? 612  ILE A CB    1 
ATOM   4654  C  CG1   . ILE A 1  612  ? -8.132  -73.067  54.410  1.00 85.59  ? 612  ILE A CG1   1 
ATOM   4655  C  CG2   . ILE A 1  612  ? -5.957  -72.846  53.079  1.00 82.71  ? 612  ILE A CG2   1 
ATOM   4656  C  CD1   . ILE A 1  612  ? -8.453  -72.688  55.871  1.00 93.34  ? 612  ILE A CD1   1 
ATOM   4657  N  N     . ILE A 1  613  ? -7.093  -76.437  56.165  1.00 87.35  ? 613  ILE A N     1 
ATOM   4658  C  CA    . ILE A 1  613  ? -7.887  -77.265  57.087  1.00 89.01  ? 613  ILE A CA    1 
ATOM   4659  C  C     . ILE A 1  613  ? -8.696  -76.409  58.071  1.00 93.25  ? 613  ILE A C     1 
ATOM   4660  O  O     . ILE A 1  613  ? -9.867  -76.709  58.325  1.00 94.49  ? 613  ILE A O     1 
ATOM   4661  C  CB    . ILE A 1  613  ? -7.023  -78.348  57.803  1.00 92.72  ? 613  ILE A CB    1 
ATOM   4662  C  CG1   . ILE A 1  613  ? -5.901  -78.950  56.897  1.00 92.88  ? 613  ILE A CG1   1 
ATOM   4663  C  CG2   . ILE A 1  613  ? -7.880  -79.412  58.459  1.00 94.14  ? 613  ILE A CG2   1 
ATOM   4664  C  CD1   . ILE A 1  613  ? -6.317  -79.929  55.783  1.00 97.10  ? 613  ILE A CD1   1 
ATOM   4665  N  N     . PHE A 1  614  ? -8.068  -75.363  58.627  1.00 87.30  ? 614  PHE A N     1 
ATOM   4666  C  CA    . PHE A 1  614  ? -8.734  -74.424  59.514  1.00 86.64  ? 614  PHE A CA    1 
ATOM   4667  C  C     . PHE A 1  614  ? -7.935  -73.154  59.575  1.00 87.02  ? 614  PHE A C     1 
ATOM   4668  O  O     . PHE A 1  614  ? -6.747  -73.175  59.262  1.00 86.07  ? 614  PHE A O     1 
ATOM   4669  C  CB    . PHE A 1  614  ? -8.952  -75.018  60.926  1.00 90.44  ? 614  PHE A CB    1 
ATOM   4670  C  CG    . PHE A 1  614  ? -7.731  -75.251  61.806  1.00 92.88  ? 614  PHE A CG    1 
ATOM   4671  C  CD1   . PHE A 1  614  ? -7.109  -74.187  62.465  1.00 94.95  ? 614  PHE A CD1   1 
ATOM   4672  C  CD2   . PHE A 1  614  ? -7.261  -76.539  62.045  1.00 95.79  ? 614  PHE A CD2   1 
ATOM   4673  C  CE1   . PHE A 1  614  ? -6.008  -74.405  63.294  1.00 95.58  ? 614  PHE A CE1   1 
ATOM   4674  C  CE2   . PHE A 1  614  ? -6.169  -76.754  62.890  1.00 98.44  ? 614  PHE A CE2   1 
ATOM   4675  C  CZ    . PHE A 1  614  ? -5.537  -75.685  63.489  1.00 95.49  ? 614  PHE A CZ    1 
ATOM   4676  N  N     . GLY A 1  615  ? -8.561  -72.088  60.055  1.00 81.97  ? 615  GLY A N     1 
ATOM   4677  C  CA    . GLY A 1  615  ? -7.899  -70.806  60.242  1.00 80.23  ? 615  GLY A CA    1 
ATOM   4678  C  C     . GLY A 1  615  ? -8.119  -69.851  59.096  1.00 82.93  ? 615  GLY A C     1 
ATOM   4679  O  O     . GLY A 1  615  ? -7.914  -70.218  57.939  1.00 83.55  ? 615  GLY A O     1 
ATOM   4680  N  N     . VAL A 1  616  ? -8.552  -68.622  59.418  1.00 77.27  ? 616  VAL A N     1 
ATOM   4681  C  CA    . VAL A 1  616  ? -8.828  -67.555  58.461  1.00 75.53  ? 616  VAL A CA    1 
ATOM   4682  C  C     . VAL A 1  616  ? -7.485  -67.104  57.855  1.00 80.22  ? 616  VAL A C     1 
ATOM   4683  O  O     . VAL A 1  616  ? -6.509  -66.944  58.605  1.00 81.17  ? 616  VAL A O     1 
ATOM   4684  C  CB    . VAL A 1  616  ? -9.603  -66.395  59.158  1.00 78.24  ? 616  VAL A CB    1 
ATOM   4685  C  CG1   . VAL A 1  616  ? -9.654  -65.147  58.293  1.00 77.36  ? 616  VAL A CG1   1 
ATOM   4686  C  CG2   . VAL A 1  616  ? -11.017 -66.810  59.533  1.00 78.67  ? 616  VAL A CG2   1 
ATOM   4687  N  N     . VAL A 1  617  ? -7.432  -66.937  56.508  1.00 75.50  ? 617  VAL A N     1 
ATOM   4688  C  CA    . VAL A 1  617  ? -6.232  -66.477  55.795  1.00 74.43  ? 617  VAL A CA    1 
ATOM   4689  C  C     . VAL A 1  617  ? -6.157  -64.955  55.740  1.00 77.12  ? 617  VAL A C     1 
ATOM   4690  O  O     . VAL A 1  617  ? -6.990  -64.299  55.110  1.00 75.78  ? 617  VAL A O     1 
ATOM   4691  C  CB    . VAL A 1  617  ? -6.054  -67.097  54.390  1.00 78.75  ? 617  VAL A CB    1 
ATOM   4692  C  CG1   . VAL A 1  617  ? -4.776  -66.592  53.721  1.00 77.66  ? 617  VAL A CG1   1 
ATOM   4693  C  CG2   . VAL A 1  617  ? -6.047  -68.612  54.465  1.00 80.01  ? 617  VAL A CG2   1 
ATOM   4694  N  N     . GLU A 1  618  ? -5.124  -64.404  56.375  1.00 73.65  ? 618  GLU A N     1 
ATOM   4695  C  CA    . GLU A 1  618  ? -4.851  -62.968  56.397  1.00 72.10  ? 618  GLU A CA    1 
ATOM   4696  C  C     . GLU A 1  618  ? -3.326  -62.698  56.326  1.00 75.08  ? 618  GLU A C     1 
ATOM   4697  O  O     . GLU A 1  618  ? -2.572  -63.575  55.877  1.00 74.30  ? 618  GLU A O     1 
ATOM   4698  C  CB    . GLU A 1  618  ? -5.555  -62.268  57.586  1.00 73.12  ? 618  GLU A CB    1 
ATOM   4699  C  CG    . GLU A 1  618  ? -5.438  -62.991  58.910  1.00 84.04  ? 618  GLU A CG    1 
ATOM   4700  C  CD    . GLU A 1  618  ? -4.025  -63.402  59.265  1.00 100.93 ? 618  GLU A CD    1 
ATOM   4701  O  OE1   . GLU A 1  618  ? -3.288  -62.531  59.779  1.00 97.71  ? 618  GLU A OE1   1 
ATOM   4702  O  OE2   . GLU A 1  618  ? -3.620  -64.537  58.907  1.00 80.38  ? 618  GLU A OE2   1 
ATOM   4703  N  N     . LYS A 1  619  ? -2.882  -61.497  56.777  1.00 71.02  ? 619  LYS A N     1 
ATOM   4704  C  CA    . LYS A 1  619  ? -1.490  -61.057  56.708  1.00 70.02  ? 619  LYS A CA    1 
ATOM   4705  C  C     . LYS A 1  619  ? -0.490  -62.101  57.186  1.00 76.10  ? 619  LYS A C     1 
ATOM   4706  O  O     . LYS A 1  619  ? 0.388   -62.465  56.415  1.00 76.45  ? 619  LYS A O     1 
ATOM   4707  C  CB    . LYS A 1  619  ? -1.286  -59.676  57.351  1.00 70.45  ? 619  LYS A CB    1 
ATOM   4708  C  CG    . LYS A 1  619  ? -0.030  -58.948  56.843  1.00 73.30  ? 619  LYS A CG    1 
ATOM   4709  C  CD    . LYS A 1  619  ? 0.041   -57.476  57.275  1.00 71.64  ? 619  LYS A CD    1 
ATOM   4710  C  CE    . LYS A 1  619  ? 1.392   -56.869  56.977  1.00 80.47  ? 619  LYS A CE    1 
ATOM   4711  N  NZ    . LYS A 1  619  ? 1.346   -55.379  56.993  1.00 96.75  ? 619  LYS A NZ    1 
ATOM   4712  N  N     . LYS A 1  620  ? -0.684  -62.655  58.400  1.00 73.24  ? 620  LYS A N     1 
ATOM   4713  C  CA    . LYS A 1  620  ? 0.183   -63.674  59.021  1.00 73.55  ? 620  LYS A CA    1 
ATOM   4714  C  C     . LYS A 1  620  ? 0.519   -64.865  58.114  1.00 76.58  ? 620  LYS A C     1 
ATOM   4715  O  O     . LYS A 1  620  ? 1.623   -65.430  58.210  1.00 77.23  ? 620  LYS A O     1 
ATOM   4716  C  CB    . LYS A 1  620  ? -0.428  -64.192  60.342  1.00 76.47  ? 620  LYS A CB    1 
ATOM   4717  C  CG    . LYS A 1  620  ? -0.087  -63.378  61.587  1.00 75.53  ? 620  LYS A CG    1 
ATOM   4718  C  CD    . LYS A 1  620  ? -1.004  -63.750  62.737  1.00 76.94  ? 620  LYS A CD    1 
ATOM   4719  C  CE    . LYS A 1  620  ? -2.133  -62.766  62.938  1.00 77.09  ? 620  LYS A CE    1 
ATOM   4720  N  NZ    . LYS A 1  620  ? -1.777  -61.698  63.919  1.00 83.27  ? 620  LYS A NZ    1 
ATOM   4721  N  N     . THR A 1  621  ? -0.437  -65.247  57.260  1.00 71.04  ? 621  THR A N     1 
ATOM   4722  C  CA    . THR A 1  621  ? -0.283  -66.379  56.360  1.00 71.09  ? 621  THR A CA    1 
ATOM   4723  C  C     . THR A 1  621  ? 0.244   -65.884  55.016  1.00 75.10  ? 621  THR A C     1 
ATOM   4724  O  O     . THR A 1  621  ? 1.319   -66.261  54.541  1.00 74.27  ? 621  THR A O     1 
ATOM   4725  C  CB    . THR A 1  621  ? -1.674  -67.076  56.148  1.00 71.44  ? 621  THR A CB    1 
ATOM   4726  O  OG1   . THR A 1  621  ? -2.464  -67.106  57.343  1.00 64.07  ? 621  THR A OG1   1 
ATOM   4727  C  CG2   . THR A 1  621  ? -1.568  -68.454  55.513  1.00 68.00  ? 621  THR A CG2   1 
ATOM   4728  N  N     . VAL A 1  622  ? -0.555  -65.029  54.417  1.00 72.16  ? 622  VAL A N     1 
ATOM   4729  C  CA    . VAL A 1  622  ? -0.421  -64.564  53.071  1.00 71.67  ? 622  VAL A CA    1 
ATOM   4730  C  C     . VAL A 1  622  ? 0.376   -63.250  52.830  1.00 75.70  ? 622  VAL A C     1 
ATOM   4731  O  O     . VAL A 1  622  ? 0.602   -62.863  51.680  1.00 74.26  ? 622  VAL A O     1 
ATOM   4732  C  CB    . VAL A 1  622  ? -1.834  -64.680  52.462  1.00 75.54  ? 622  VAL A CB    1 
ATOM   4733  C  CG1   . VAL A 1  622  ? -2.571  -63.348  52.386  1.00 74.80  ? 622  VAL A CG1   1 
ATOM   4734  C  CG2   . VAL A 1  622  ? -1.818  -65.425  51.143  1.00 75.71  ? 622  VAL A CG2   1 
ATOM   4735  N  N     . GLY A 1  623  ? 0.857   -62.628  53.911  1.00 72.95  ? 623  GLY A N     1 
ATOM   4736  C  CA    . GLY A 1  623  ? 1.699   -61.436  53.844  1.00 71.93  ? 623  GLY A CA    1 
ATOM   4737  C  C     . GLY A 1  623  ? 3.134   -61.839  53.557  1.00 77.38  ? 623  GLY A C     1 
ATOM   4738  O  O     . GLY A 1  623  ? 3.385   -62.986  53.148  1.00 78.13  ? 623  GLY A O     1 
ATOM   4739  N  N     . SER A 1  624  ? 4.091   -60.905  53.780  1.00 74.21  ? 624  SER A N     1 
ATOM   4740  C  CA    . SER A 1  624  ? 5.536   -61.130  53.593  1.00 75.00  ? 624  SER A CA    1 
ATOM   4741  C  C     . SER A 1  624  ? 6.214   -61.550  54.924  1.00 80.29  ? 624  SER A C     1 
ATOM   4742  O  O     . SER A 1  624  ? 7.326   -61.123  55.252  1.00 79.83  ? 624  SER A O     1 
ATOM   4743  C  CB    . SER A 1  624  ? 6.204   -59.911  52.955  1.00 80.08  ? 624  SER A CB    1 
ATOM   4744  O  OG    . SER A 1  624  ? 5.974   -58.715  53.686  1.00 92.09  ? 624  SER A OG    1 
ATOM   4745  N  N     . SER A 1  625  ? 5.501   -62.424  55.671  1.00 78.24  ? 625  SER A N     1 
ATOM   4746  C  CA    . SER A 1  625  ? 5.828   -63.048  56.954  1.00 78.41  ? 625  SER A CA    1 
ATOM   4747  C  C     . SER A 1  625  ? 6.982   -64.019  56.802  1.00 81.78  ? 625  SER A C     1 
ATOM   4748  O  O     . SER A 1  625  ? 7.095   -64.678  55.760  1.00 81.84  ? 625  SER A O     1 
ATOM   4749  C  CB    . SER A 1  625  ? 4.620   -63.843  57.454  1.00 83.13  ? 625  SER A CB    1 
ATOM   4750  O  OG    . SER A 1  625  ? 3.448   -63.047  57.510  1.00 92.63  ? 625  SER A OG    1 
ATOM   4751  N  N     . ASN A 1  626  ? 7.780   -64.177  57.873  1.00 78.15  ? 626  ASN A N     1 
ATOM   4752  C  CA    . ASN A 1  626  ? 8.897   -65.121  57.893  1.00 78.81  ? 626  ASN A CA    1 
ATOM   4753  C  C     . ASN A 1  626  ? 8.430   -66.607  57.687  1.00 83.92  ? 626  ASN A C     1 
ATOM   4754  O  O     . ASN A 1  626  ? 8.967   -67.310  56.823  1.00 83.21  ? 626  ASN A O     1 
ATOM   4755  C  CB    . ASN A 1  626  ? 9.775   -64.935  59.162  1.00 78.30  ? 626  ASN A CB    1 
ATOM   4756  C  CG    . ASN A 1  626  ? 11.088  -65.713  59.137  1.00 107.35 ? 626  ASN A CG    1 
ATOM   4757  O  OD1   . ASN A 1  626  ? 11.472  -66.381  60.116  1.00 99.36  ? 626  ASN A OD1   1 
ATOM   4758  N  ND2   . ASN A 1  626  ? 11.793  -65.688  58.000  1.00 100.78 ? 626  ASN A ND2   1 
ATOM   4759  N  N     . GLY A 1  627  ? 7.417   -67.046  58.443  1.00 80.42  ? 627  GLY A N     1 
ATOM   4760  C  CA    . GLY A 1  627  ? 6.903   -68.409  58.322  1.00 81.05  ? 627  GLY A CA    1 
ATOM   4761  C  C     . GLY A 1  627  ? 5.660   -68.518  57.466  1.00 85.88  ? 627  GLY A C     1 
ATOM   4762  O  O     . GLY A 1  627  ? 4.907   -69.494  57.578  1.00 86.01  ? 627  GLY A O     1 
ATOM   4763  N  N     . GLY A 1  628  ? 5.464   -67.500  56.616  1.00 82.02  ? 628  GLY A N     1 
ATOM   4764  C  CA    . GLY A 1  628  ? 4.338   -67.343  55.705  1.00 80.23  ? 628  GLY A CA    1 
ATOM   4765  C  C     . GLY A 1  628  ? 4.282   -68.372  54.603  1.00 80.37  ? 628  GLY A C     1 
ATOM   4766  O  O     . GLY A 1  628  ? 5.261   -69.089  54.363  1.00 78.98  ? 628  GLY A O     1 
ATOM   4767  N  N     . LEU A 1  629  ? 3.115   -68.423  53.915  1.00 75.06  ? 629  LEU A N     1 
ATOM   4768  C  CA    . LEU A 1  629  ? 2.820   -69.322  52.794  1.00 73.82  ? 629  LEU A CA    1 
ATOM   4769  C  C     . LEU A 1  629  ? 3.819   -69.112  51.685  1.00 76.55  ? 629  LEU A C     1 
ATOM   4770  O  O     . LEU A 1  629  ? 4.272   -70.095  51.094  1.00 75.87  ? 629  LEU A O     1 
ATOM   4771  C  CB    . LEU A 1  629  ? 1.391   -69.095  52.277  1.00 73.04  ? 629  LEU A CB    1 
ATOM   4772  C  CG    . LEU A 1  629  ? 0.900   -70.082  51.224  1.00 77.36  ? 629  LEU A CG    1 
ATOM   4773  C  CD1   . LEU A 1  629  ? 0.099   -71.173  51.842  1.00 78.66  ? 629  LEU A CD1   1 
ATOM   4774  C  CD2   . LEU A 1  629  ? 0.050   -69.401  50.224  1.00 77.84  ? 629  LEU A CD2   1 
ATOM   4775  N  N     . ILE A 1  630  ? 4.188   -67.824  51.437  1.00 72.66  ? 630  ILE A N     1 
ATOM   4776  C  CA    . ILE A 1  630  ? 5.141   -67.423  50.408  1.00 71.94  ? 630  ILE A CA    1 
ATOM   4777  C  C     . ILE A 1  630  ? 6.524   -67.972  50.707  1.00 80.58  ? 630  ILE A C     1 
ATOM   4778  O  O     . ILE A 1  630  ? 7.038   -68.697  49.854  1.00 81.91  ? 630  ILE A O     1 
ATOM   4779  C  CB    . ILE A 1  630  ? 5.088   -65.919  50.069  1.00 72.43  ? 630  ILE A CB    1 
ATOM   4780  C  CG1   . ILE A 1  630  ? 3.805   -65.593  49.291  1.00 71.78  ? 630  ILE A CG1   1 
ATOM   4781  C  CG2   . ILE A 1  630  ? 6.295   -65.501  49.257  1.00 71.33  ? 630  ILE A CG2   1 
ATOM   4782  C  CD1   . ILE A 1  630  ? 3.010   -64.506  49.889  1.00 73.85  ? 630  ILE A CD1   1 
ATOM   4783  N  N     . HIS A 1  631  ? 7.089   -67.727  51.925  1.00 78.71  ? 631  HIS A N     1 
ATOM   4784  C  CA    . HIS A 1  631  ? 8.398   -68.300  52.278  1.00 80.39  ? 631  HIS A CA    1 
ATOM   4785  C  C     . HIS A 1  631  ? 8.387   -69.830  52.015  1.00 79.98  ? 631  HIS A C     1 
ATOM   4786  O  O     . HIS A 1  631  ? 9.272   -70.342  51.319  1.00 79.09  ? 631  HIS A O     1 
ATOM   4787  C  CB    . HIS A 1  631  ? 8.772   -67.992  53.743  1.00 83.39  ? 631  HIS A CB    1 
ATOM   4788  C  CG    . HIS A 1  631  ? 10.255  -67.947  54.048  1.00 88.66  ? 631  HIS A CG    1 
ATOM   4789  N  ND1   . HIS A 1  631  ? 11.132  -68.932  53.595  1.00 91.97  ? 631  HIS A ND1   1 
ATOM   4790  C  CD2   . HIS A 1  631  ? 10.958  -67.066  54.812  1.00 91.04  ? 631  HIS A CD2   1 
ATOM   4791  C  CE1   . HIS A 1  631  ? 12.333  -68.590  54.056  1.00 91.94  ? 631  HIS A CE1   1 
ATOM   4792  N  NE2   . HIS A 1  631  ? 12.277  -67.481  54.803  1.00 91.55  ? 631  HIS A NE2   1 
ATOM   4793  N  N     . VAL A 1  632  ? 7.325   -70.521  52.474  1.00 74.24  ? 632  VAL A N     1 
ATOM   4794  C  CA    . VAL A 1  632  ? 7.149   -71.967  52.279  1.00 74.21  ? 632  VAL A CA    1 
ATOM   4795  C  C     . VAL A 1  632  ? 7.080   -72.353  50.799  1.00 78.70  ? 632  VAL A C     1 
ATOM   4796  O  O     . VAL A 1  632  ? 7.866   -73.194  50.372  1.00 79.52  ? 632  VAL A O     1 
ATOM   4797  C  CB    . VAL A 1  632  ? 5.958   -72.570  53.072  1.00 76.99  ? 632  VAL A CB    1 
ATOM   4798  C  CG1   . VAL A 1  632  ? 5.866   -74.077  52.866  1.00 77.76  ? 632  VAL A CG1   1 
ATOM   4799  C  CG2   . VAL A 1  632  ? 6.050   -72.245  54.547  1.00 76.15  ? 632  VAL A CG2   1 
ATOM   4800  N  N     . VAL A 1  633  ? 6.141   -71.766  50.031  1.00 74.33  ? 633  VAL A N     1 
ATOM   4801  C  CA    . VAL A 1  633  ? 5.961   -72.094  48.609  1.00 74.79  ? 633  VAL A CA    1 
ATOM   4802  C  C     . VAL A 1  633  ? 7.239   -71.863  47.765  1.00 79.79  ? 633  VAL A C     1 
ATOM   4803  O  O     . VAL A 1  633  ? 7.524   -72.646  46.837  1.00 79.78  ? 633  VAL A O     1 
ATOM   4804  C  CB    . VAL A 1  633  ? 4.666   -71.484  48.000  1.00 78.10  ? 633  VAL A CB    1 
ATOM   4805  C  CG1   . VAL A 1  633  ? 4.524   -71.810  46.509  1.00 78.03  ? 633  VAL A CG1   1 
ATOM   4806  C  CG2   . VAL A 1  633  ? 3.435   -71.965  48.761  1.00 78.44  ? 633  VAL A CG2   1 
ATOM   4807  N  N     . THR A 1  634  ? 8.036   -70.830  48.139  1.00 75.60  ? 634  THR A N     1 
ATOM   4808  C  CA    . THR A 1  634  ? 9.293   -70.495  47.460  1.00 74.51  ? 634  THR A CA    1 
ATOM   4809  C  C     . THR A 1  634  ? 10.326  -71.586  47.730  1.00 78.61  ? 634  THR A C     1 
ATOM   4810  O  O     . THR A 1  634  ? 10.951  -72.106  46.799  1.00 76.67  ? 634  THR A O     1 
ATOM   4811  C  CB    . THR A 1  634  ? 9.810   -69.134  47.926  1.00 74.46  ? 634  THR A CB    1 
ATOM   4812  O  OG1   . THR A 1  634  ? 8.720   -68.227  48.034  1.00 71.86  ? 634  THR A OG1   1 
ATOM   4813  C  CG2   . THR A 1  634  ? 10.853  -68.566  46.989  1.00 72.52  ? 634  THR A CG2   1 
ATOM   4814  N  N     . ARG A 1  635  ? 10.489  -71.916  49.022  1.00 76.54  ? 635  ARG A N     1 
ATOM   4815  C  CA    . ARG A 1  635  ? 11.444  -72.904  49.499  1.00 77.56  ? 635  ARG A CA    1 
ATOM   4816  C  C     . ARG A 1  635  ? 11.123  -74.310  49.025  1.00 83.81  ? 635  ARG A C     1 
ATOM   4817  O  O     . ARG A 1  635  ? 12.012  -75.012  48.550  1.00 83.40  ? 635  ARG A O     1 
ATOM   4818  C  CB    . ARG A 1  635  ? 11.580  -72.831  51.032  1.00 75.23  ? 635  ARG A CB    1 
ATOM   4819  C  CG    . ARG A 1  635  ? 12.417  -71.650  51.495  1.00 82.88  ? 635  ARG A CG    1 
ATOM   4820  C  CD    . ARG A 1  635  ? 13.910  -71.892  51.303  1.00 95.64  ? 635  ARG A CD    1 
ATOM   4821  N  NE    . ARG A 1  635  ? 14.653  -70.646  51.093  1.00 105.60 ? 635  ARG A NE    1 
ATOM   4822  C  CZ    . ARG A 1  635  ? 15.534  -70.450  50.115  1.00 111.70 ? 635  ARG A CZ    1 
ATOM   4823  N  NH1   . ARG A 1  635  ? 15.797  -71.418  49.244  1.00 104.41 ? 635  ARG A NH1   1 
ATOM   4824  N  NH2   . ARG A 1  635  ? 16.165  -69.285  50.006  1.00 81.84  ? 635  ARG A NH2   1 
ATOM   4825  N  N     . GLU A 1  636  ? 9.852   -74.699  49.122  1.00 82.64  ? 636  GLU A N     1 
ATOM   4826  C  CA    . GLU A 1  636  ? 9.383   -76.022  48.756  1.00 84.85  ? 636  GLU A CA    1 
ATOM   4827  C  C     . GLU A 1  636  ? 9.363   -76.228  47.238  1.00 89.40  ? 636  GLU A C     1 
ATOM   4828  O  O     . GLU A 1  636  ? 10.212  -76.939  46.685  1.00 88.76  ? 636  GLU A O     1 
ATOM   4829  C  CB    . GLU A 1  636  ? 7.987   -76.261  49.363  1.00 86.80  ? 636  GLU A CB    1 
ATOM   4830  C  CG    . GLU A 1  636  ? 7.796   -77.649  49.942  1.00 102.01 ? 636  GLU A CG    1 
ATOM   4831  C  CD    . GLU A 1  636  ? 7.713   -77.656  51.452  1.00 124.00 ? 636  GLU A CD    1 
ATOM   4832  O  OE1   . GLU A 1  636  ? 8.731   -77.320  52.106  1.00 104.13 ? 636  GLU A OE1   1 
ATOM   4833  O  OE2   . GLU A 1  636  ? 6.628   -78.000  51.979  1.00 122.72 ? 636  GLU A OE2   1 
ATOM   4834  N  N     . LYS A 1  637  ? 8.400   -75.576  46.576  1.00 86.74  ? 637  LYS A N     1 
ATOM   4835  C  CA    . LYS A 1  637  ? 8.142   -75.681  45.147  1.00 87.03  ? 637  LYS A CA    1 
ATOM   4836  C  C     . LYS A 1  637  ? 9.086   -74.917  44.214  1.00 90.14  ? 637  LYS A C     1 
ATOM   4837  O  O     . LYS A 1  637  ? 9.393   -75.418  43.136  1.00 90.63  ? 637  LYS A O     1 
ATOM   4838  C  CB    . LYS A 1  637  ? 6.656   -75.420  44.853  1.00 89.18  ? 637  LYS A CB    1 
ATOM   4839  C  CG    . LYS A 1  637  ? 5.808   -76.692  44.732  1.00 100.93 ? 637  LYS A CG    1 
ATOM   4840  C  CD    . LYS A 1  637  ? 5.589   -77.449  46.035  1.00 104.53 ? 637  LYS A CD    1 
ATOM   4841  C  CE    . LYS A 1  637  ? 5.330   -78.910  45.760  1.00 120.23 ? 637  LYS A CE    1 
ATOM   4842  N  NZ    . LYS A 1  637  ? 5.631   -79.766  46.948  1.00 134.43 ? 637  LYS A NZ    1 
ATOM   4843  N  N     . GLY A 1  638  ? 9.551   -73.745  44.626  1.00 85.25  ? 638  GLY A N     1 
ATOM   4844  C  CA    . GLY A 1  638  ? 10.466  -72.962  43.804  1.00 84.77  ? 638  GLY A CA    1 
ATOM   4845  C  C     . GLY A 1  638  ? 10.038  -71.523  43.592  1.00 88.00  ? 638  GLY A C     1 
ATOM   4846  O  O     . GLY A 1  638  ? 8.871   -71.198  43.839  1.00 88.06  ? 638  GLY A O     1 
ATOM   4847  N  N     . PRO A 1  639  ? 10.955  -70.636  43.105  1.00 82.82  ? 639  PRO A N     1 
ATOM   4848  C  CA    . PRO A 1  639  ? 10.581  -69.225  42.881  1.00 80.78  ? 639  PRO A CA    1 
ATOM   4849  C  C     . PRO A 1  639  ? 9.506   -69.020  41.811  1.00 81.62  ? 639  PRO A C     1 
ATOM   4850  O  O     . PRO A 1  639  ? 8.546   -68.281  42.044  1.00 81.26  ? 639  PRO A O     1 
ATOM   4851  C  CB    . PRO A 1  639  ? 11.909  -68.564  42.473  1.00 82.28  ? 639  PRO A CB    1 
ATOM   4852  C  CG    . PRO A 1  639  ? 12.732  -69.666  41.921  1.00 87.81  ? 639  PRO A CG    1 
ATOM   4853  C  CD    . PRO A 1  639  ? 12.375  -70.862  42.760  1.00 84.61  ? 639  PRO A CD    1 
ATOM   4854  N  N     . GLN A 1  640  ? 9.679   -69.675  40.646  1.00 75.08  ? 640  GLN A N     1 
ATOM   4855  C  CA    . GLN A 1  640  ? 8.802   -69.608  39.482  1.00 72.87  ? 640  GLN A CA    1 
ATOM   4856  C  C     . GLN A 1  640  ? 7.416   -70.128  39.813  1.00 72.48  ? 640  GLN A C     1 
ATOM   4857  O  O     . GLN A 1  640  ? 6.429   -69.581  39.326  1.00 71.55  ? 640  GLN A O     1 
ATOM   4858  C  CB    . GLN A 1  640  ? 9.440   -70.301  38.251  1.00 75.16  ? 640  GLN A CB    1 
ATOM   4859  C  CG    . GLN A 1  640  ? 9.852   -71.788  38.445  1.00 114.51 ? 640  GLN A CG    1 
ATOM   4860  C  CD    . GLN A 1  640  ? 11.041  -72.065  39.376  1.00 137.82 ? 640  GLN A CD    1 
ATOM   4861  O  OE1   . GLN A 1  640  ? 10.929  -72.814  40.363  1.00 128.38 ? 640  GLN A OE1   1 
ATOM   4862  N  NE2   . GLN A 1  640  ? 12.211  -71.495  39.073  1.00 132.31 ? 640  GLN A NE2   1 
ATOM   4863  N  N     . VAL A 1  641  ? 7.344   -71.128  40.701  1.00 67.32  ? 641  VAL A N     1 
ATOM   4864  C  CA    . VAL A 1  641  ? 6.091   -71.733  41.149  1.00 66.75  ? 641  VAL A CA    1 
ATOM   4865  C  C     . VAL A 1  641  ? 5.370   -70.755  42.086  1.00 69.03  ? 641  VAL A C     1 
ATOM   4866  O  O     . VAL A 1  641  ? 4.168   -70.515  41.918  1.00 67.51  ? 641  VAL A O     1 
ATOM   4867  C  CB    . VAL A 1  641  ? 6.335   -73.120  41.796  1.00 71.09  ? 641  VAL A CB    1 
ATOM   4868  C  CG1   . VAL A 1  641  ? 5.029   -73.767  42.240  1.00 70.98  ? 641  VAL A CG1   1 
ATOM   4869  C  CG2   . VAL A 1  641  ? 7.101   -74.036  40.852  1.00 71.66  ? 641  VAL A CG2   1 
ATOM   4870  N  N     . CYS A 1  642  ? 6.124   -70.186  43.053  1.00 65.62  ? 642  CYS A N     1 
ATOM   4871  C  CA    . CYS A 1  642  ? 5.657   -69.190  44.019  1.00 65.34  ? 642  CYS A CA    1 
ATOM   4872  C  C     . CYS A 1  642  ? 5.198   -67.906  43.312  1.00 69.06  ? 642  CYS A C     1 
ATOM   4873  O  O     . CYS A 1  642  ? 4.165   -67.344  43.673  1.00 69.53  ? 642  CYS A O     1 
ATOM   4874  C  CB    . CYS A 1  642  ? 6.743   -68.889  45.043  1.00 65.72  ? 642  CYS A CB    1 
ATOM   4875  S  SG    . CYS A 1  642  ? 6.213   -67.775  46.362  1.00 68.87  ? 642  CYS A SG    1 
ATOM   4876  N  N     . ALA A 1  643  ? 5.966   -67.446  42.307  1.00 63.06  ? 643  ALA A N     1 
ATOM   4877  C  CA    . ALA A 1  643  ? 5.629   -66.273  41.524  1.00 60.50  ? 643  ALA A CA    1 
ATOM   4878  C  C     . ALA A 1  643  ? 4.270   -66.501  40.870  1.00 66.74  ? 643  ALA A C     1 
ATOM   4879  O  O     . ALA A 1  643  ? 3.425   -65.605  40.913  1.00 66.38  ? 643  ALA A O     1 
ATOM   4880  C  CB    . ALA A 1  643  ? 6.703   -66.020  40.485  1.00 60.52  ? 643  ALA A CB    1 
ATOM   4881  N  N     . LYS A 1  644  ? 4.024   -67.730  40.343  1.00 66.02  ? 644  LYS A N     1 
ATOM   4882  C  CA    . LYS A 1  644  ? 2.738   -68.103  39.737  1.00 66.58  ? 644  LYS A CA    1 
ATOM   4883  C  C     . LYS A 1  644  ? 1.632   -68.068  40.809  1.00 70.21  ? 644  LYS A C     1 
ATOM   4884  O  O     . LYS A 1  644  ? 0.504   -67.653  40.509  1.00 70.59  ? 644  LYS A O     1 
ATOM   4885  C  CB    . LYS A 1  644  ? 2.794   -69.494  39.073  1.00 70.17  ? 644  LYS A CB    1 
ATOM   4886  C  CG    . LYS A 1  644  ? 2.182   -69.589  37.663  1.00 92.33  ? 644  LYS A CG    1 
ATOM   4887  C  CD    . LYS A 1  644  ? 0.773   -68.954  37.493  1.00 107.33 ? 644  LYS A CD    1 
ATOM   4888  C  CE    . LYS A 1  644  ? -0.084  -69.550  36.392  1.00 121.72 ? 644  LYS A CE    1 
ATOM   4889  N  NZ    . LYS A 1  644  ? 0.431   -69.259  35.027  1.00 129.81 ? 644  LYS A NZ    1 
ATOM   4890  N  N     . LEU A 1  645  ? 1.976   -68.453  42.058  1.00 64.53  ? 645  LEU A N     1 
ATOM   4891  C  CA    . LEU A 1  645  ? 1.050   -68.465  43.183  1.00 63.44  ? 645  LEU A CA    1 
ATOM   4892  C  C     . LEU A 1  645  ? 0.404   -67.107  43.401  1.00 66.54  ? 645  LEU A C     1 
ATOM   4893  O  O     . LEU A 1  645  ? -0.823  -67.040  43.451  1.00 66.97  ? 645  LEU A O     1 
ATOM   4894  C  CB    . LEU A 1  645  ? 1.730   -68.988  44.454  1.00 63.19  ? 645  LEU A CB    1 
ATOM   4895  C  CG    . LEU A 1  645  ? 0.935   -68.954  45.736  1.00 66.61  ? 645  LEU A CG    1 
ATOM   4896  C  CD1   . LEU A 1  645  ? -0.105  -70.060  45.785  1.00 67.03  ? 645  LEU A CD1   1 
ATOM   4897  C  CD2   . LEU A 1  645  ? 1.849   -69.091  46.891  1.00 69.78  ? 645  LEU A CD2   1 
ATOM   4898  N  N     . PHE A 1  646  ? 1.202   -66.024  43.446  1.00 62.11  ? 646  PHE A N     1 
ATOM   4899  C  CA    . PHE A 1  646  ? 0.680   -64.650  43.602  1.00 60.61  ? 646  PHE A CA    1 
ATOM   4900  C  C     . PHE A 1  646  ? -0.432  -64.380  42.578  1.00 65.09  ? 646  PHE A C     1 
ATOM   4901  O  O     . PHE A 1  646  ? -1.498  -63.898  42.957  1.00 63.99  ? 646  PHE A O     1 
ATOM   4902  C  CB    . PHE A 1  646  ? 1.786   -63.606  43.425  1.00 60.75  ? 646  PHE A CB    1 
ATOM   4903  C  CG    . PHE A 1  646  ? 2.785   -63.490  44.543  1.00 61.16  ? 646  PHE A CG    1 
ATOM   4904  C  CD1   . PHE A 1  646  ? 3.969   -64.218  44.514  1.00 63.75  ? 646  PHE A CD1   1 
ATOM   4905  C  CD2   . PHE A 1  646  ? 2.592   -62.580  45.576  1.00 62.68  ? 646  PHE A CD2   1 
ATOM   4906  C  CE1   . PHE A 1  646  ? 4.921   -64.078  45.523  1.00 64.30  ? 646  PHE A CE1   1 
ATOM   4907  C  CE2   . PHE A 1  646  ? 3.559   -62.413  46.573  1.00 65.44  ? 646  PHE A CE2   1 
ATOM   4908  C  CZ    . PHE A 1  646  ? 4.712   -63.175  46.547  1.00 63.66  ? 646  PHE A CZ    1 
ATOM   4909  N  N     . GLY A 1  647  ? -0.184  -64.756  41.320  1.00 62.97  ? 647  GLY A N     1 
ATOM   4910  C  CA    . GLY A 1  647  ? -1.152  -64.633  40.237  1.00 63.86  ? 647  GLY A CA    1 
ATOM   4911  C  C     . GLY A 1  647  ? -2.493  -65.291  40.541  1.00 69.43  ? 647  GLY A C     1 
ATOM   4912  O  O     . GLY A 1  647  ? -3.522  -64.602  40.622  1.00 68.90  ? 647  GLY A O     1 
ATOM   4913  N  N     . ASN A 1  648  ? -2.475  -66.629  40.759  1.00 65.88  ? 648  ASN A N     1 
ATOM   4914  C  CA    . ASN A 1  648  ? -3.661  -67.429  41.094  1.00 65.49  ? 648  ASN A CA    1 
ATOM   4915  C  C     . ASN A 1  648  ? -4.399  -66.874  42.328  1.00 65.50  ? 648  ASN A C     1 
ATOM   4916  O  O     . ASN A 1  648  ? -5.615  -66.655  42.248  1.00 64.74  ? 648  ASN A O     1 
ATOM   4917  C  CB    . ASN A 1  648  ? -3.300  -68.918  41.290  1.00 68.39  ? 648  ASN A CB    1 
ATOM   4918  C  CG    . ASN A 1  648  ? -2.329  -69.483  40.275  1.00 101.32 ? 648  ASN A CG    1 
ATOM   4919  O  OD1   . ASN A 1  648  ? -2.166  -68.975  39.159  1.00 100.10 ? 648  ASN A OD1   1 
ATOM   4920  N  ND2   . ASN A 1  648  ? -1.631  -70.531  40.664  1.00 96.56  ? 648  ASN A ND2   1 
ATOM   4921  N  N     . ILE A 1  649  ? -3.662  -66.584  43.439  1.00 58.41  ? 649  ILE A N     1 
ATOM   4922  C  CA    . ILE A 1  649  ? -4.296  -66.041  44.643  1.00 56.72  ? 649  ILE A CA    1 
ATOM   4923  C  C     . ILE A 1  649  ? -5.083  -64.783  44.286  1.00 60.74  ? 649  ILE A C     1 
ATOM   4924  O  O     . ILE A 1  649  ? -6.283  -64.698  44.567  1.00 60.48  ? 649  ILE A O     1 
ATOM   4925  C  CB    . ILE A 1  649  ? -3.354  -65.860  45.865  1.00 58.33  ? 649  ILE A CB    1 
ATOM   4926  C  CG1   . ILE A 1  649  ? -2.632  -67.173  46.205  1.00 58.92  ? 649  ILE A CG1   1 
ATOM   4927  C  CG2   . ILE A 1  649  ? -4.147  -65.360  47.074  1.00 57.65  ? 649  ILE A CG2   1 
ATOM   4928  C  CD1   . ILE A 1  649  ? -1.760  -67.139  47.400  1.00 62.66  ? 649  ILE A CD1   1 
ATOM   4929  N  N     . GLN A 1  650  ? -4.432  -63.873  43.563  1.00 57.23  ? 650  GLN A N     1 
ATOM   4930  C  CA    . GLN A 1  650  ? -5.040  -62.628  43.116  1.00 56.31  ? 650  GLN A CA    1 
ATOM   4931  C  C     . GLN A 1  650  ? -6.264  -62.861  42.239  1.00 60.70  ? 650  GLN A C     1 
ATOM   4932  O  O     . GLN A 1  650  ? -7.364  -62.480  42.630  1.00 58.56  ? 650  GLN A O     1 
ATOM   4933  C  CB    . GLN A 1  650  ? -3.994  -61.699  42.479  1.00 56.54  ? 650  GLN A CB    1 
ATOM   4934  C  CG    . GLN A 1  650  ? -3.078  -61.064  43.530  1.00 58.21  ? 650  GLN A CG    1 
ATOM   4935  C  CD    . GLN A 1  650  ? -1.773  -60.544  43.002  1.00 76.30  ? 650  GLN A CD    1 
ATOM   4936  O  OE1   . GLN A 1  650  ? -1.378  -60.801  41.872  1.00 74.95  ? 650  GLN A OE1   1 
ATOM   4937  N  NE2   . GLN A 1  650  ? -1.041  -59.840  43.840  1.00 70.67  ? 650  GLN A NE2   1 
ATOM   4938  N  N     . LYS A 1  651  ? -6.098  -63.596  41.136  1.00 59.82  ? 651  LYS A N     1 
ATOM   4939  C  CA    . LYS A 1  651  ? -7.198  -63.898  40.218  1.00 60.84  ? 651  LYS A CA    1 
ATOM   4940  C  C     . LYS A 1  651  ? -8.506  -64.344  40.919  1.00 68.05  ? 651  LYS A C     1 
ATOM   4941  O  O     . LYS A 1  651  ? -9.565  -63.758  40.649  1.00 67.55  ? 651  LYS A O     1 
ATOM   4942  C  CB    . LYS A 1  651  ? -6.752  -64.837  39.072  1.00 62.47  ? 651  LYS A CB    1 
ATOM   4943  C  CG    . LYS A 1  651  ? -5.775  -64.159  38.102  1.00 64.71  ? 651  LYS A CG    1 
ATOM   4944  C  CD    . LYS A 1  651  ? -5.053  -65.120  37.158  1.00 71.03  ? 651  LYS A CD    1 
ATOM   4945  C  CE    . LYS A 1  651  ? -3.549  -64.904  37.052  1.00 73.79  ? 651  LYS A CE    1 
ATOM   4946  N  NZ    . LYS A 1  651  ? -3.178  -63.708  36.235  1.00 73.14  ? 651  LYS A NZ    1 
ATOM   4947  N  N     . VAL A 1  652  ? -8.402  -65.302  41.885  1.00 66.84  ? 652  VAL A N     1 
ATOM   4948  C  CA    . VAL A 1  652  ? -9.539  -65.855  42.654  1.00 67.58  ? 652  VAL A CA    1 
ATOM   4949  C  C     . VAL A 1  652  ? -10.138 -64.825  43.599  1.00 72.19  ? 652  VAL A C     1 
ATOM   4950  O  O     . VAL A 1  652  ? -11.328 -64.495  43.493  1.00 72.10  ? 652  VAL A O     1 
ATOM   4951  C  CB    . VAL A 1  652  ? -9.193  -67.145  43.445  1.00 71.92  ? 652  VAL A CB    1 
ATOM   4952  C  CG1   . VAL A 1  652  ? -10.458 -67.782  44.009  1.00 72.58  ? 652  VAL A CG1   1 
ATOM   4953  C  CG2   . VAL A 1  652  ? -8.443  -68.142  42.585  1.00 72.24  ? 652  VAL A CG2   1 
ATOM   4954  N  N     . VAL A 1  653  ? -9.310  -64.373  44.569  1.00 67.61  ? 653  VAL A N     1 
ATOM   4955  C  CA    . VAL A 1  653  ? -9.706  -63.438  45.602  1.00 66.05  ? 653  VAL A CA    1 
ATOM   4956  C  C     . VAL A 1  653  ? -10.308 -62.206  44.974  1.00 69.53  ? 653  VAL A C     1 
ATOM   4957  O  O     . VAL A 1  653  ? -11.429 -61.841  45.331  1.00 69.21  ? 653  VAL A O     1 
ATOM   4958  C  CB    . VAL A 1  653  ? -8.563  -63.130  46.581  1.00 69.10  ? 653  VAL A CB    1 
ATOM   4959  C  CG1   . VAL A 1  653  ? -8.979  -62.049  47.559  1.00 68.57  ? 653  VAL A CG1   1 
ATOM   4960  C  CG2   . VAL A 1  653  ? -8.123  -64.384  47.329  1.00 69.48  ? 653  VAL A CG2   1 
ATOM   4961  N  N     . ASN A 1  654  ? -9.615  -61.632  43.963  1.00 66.36  ? 654  ASN A N     1 
ATOM   4962  C  CA    . ASN A 1  654  ? -10.087 -60.449  43.236  1.00 65.24  ? 654  ASN A CA    1 
ATOM   4963  C  C     . ASN A 1  654  ? -11.465 -60.703  42.679  1.00 69.14  ? 654  ASN A C     1 
ATOM   4964  O  O     . ASN A 1  654  ? -12.405 -60.037  43.115  1.00 68.69  ? 654  ASN A O     1 
ATOM   4965  C  CB    . ASN A 1  654  ? -9.134  -60.033  42.115  1.00 61.83  ? 654  ASN A CB    1 
ATOM   4966  C  CG    . ASN A 1  654  ? -7.798  -59.504  42.551  1.00 74.04  ? 654  ASN A CG    1 
ATOM   4967  O  OD1   . ASN A 1  654  ? -7.624  -58.900  43.638  1.00 49.66  ? 654  ASN A OD1   1 
ATOM   4968  N  ND2   . ASN A 1  654  ? -6.830  -59.713  41.665  1.00 72.67  ? 654  ASN A ND2   1 
ATOM   4969  N  N     . PHE A 1  655  ? -11.602 -61.713  41.785  1.00 66.07  ? 655  PHE A N     1 
ATOM   4970  C  CA    . PHE A 1  655  ? -12.886 -62.066  41.197  1.00 66.83  ? 655  PHE A CA    1 
ATOM   4971  C  C     . PHE A 1  655  ? -13.966 -62.193  42.288  1.00 71.19  ? 655  PHE A C     1 
ATOM   4972  O  O     . PHE A 1  655  ? -14.990 -61.499  42.202  1.00 71.16  ? 655  PHE A O     1 
ATOM   4973  C  CB    . PHE A 1  655  ? -12.782 -63.334  40.331  1.00 69.46  ? 655  PHE A CB    1 
ATOM   4974  C  CG    . PHE A 1  655  ? -14.118 -63.896  39.890  1.00 72.00  ? 655  PHE A CG    1 
ATOM   4975  C  CD1   . PHE A 1  655  ? -14.730 -63.446  38.724  1.00 73.66  ? 655  PHE A CD1   1 
ATOM   4976  C  CD2   . PHE A 1  655  ? -14.768 -64.872  40.647  1.00 76.14  ? 655  PHE A CD2   1 
ATOM   4977  C  CE1   . PHE A 1  655  ? -15.970 -63.953  38.324  1.00 75.67  ? 655  PHE A CE1   1 
ATOM   4978  C  CE2   . PHE A 1  655  ? -16.011 -65.386  40.239  1.00 80.23  ? 655  PHE A CE2   1 
ATOM   4979  C  CZ    . PHE A 1  655  ? -16.606 -64.918  39.081  1.00 77.41  ? 655  PHE A CZ    1 
ATOM   4980  N  N     . TRP A 1  656  ? -13.703 -63.018  43.336  1.00 66.74  ? 656  TRP A N     1 
ATOM   4981  C  CA    . TRP A 1  656  ? -14.639 -63.216  44.442  1.00 66.41  ? 656  TRP A CA    1 
ATOM   4982  C  C     . TRP A 1  656  ? -15.122 -61.909  45.053  1.00 69.52  ? 656  TRP A C     1 
ATOM   4983  O  O     . TRP A 1  656  ? -16.338 -61.746  45.233  1.00 70.40  ? 656  TRP A O     1 
ATOM   4984  C  CB    . TRP A 1  656  ? -14.074 -64.129  45.540  1.00 65.08  ? 656  TRP A CB    1 
ATOM   4985  C  CG    . TRP A 1  656  ? -15.057 -64.288  46.662  1.00 66.22  ? 656  TRP A CG    1 
ATOM   4986  C  CD1   . TRP A 1  656  ? -16.160 -65.085  46.668  1.00 70.10  ? 656  TRP A CD1   1 
ATOM   4987  C  CD2   . TRP A 1  656  ? -15.137 -63.492  47.844  1.00 65.39  ? 656  TRP A CD2   1 
ATOM   4988  N  NE1   . TRP A 1  656  ? -16.887 -64.879  47.811  1.00 69.48  ? 656  TRP A NE1   1 
ATOM   4989  C  CE2   . TRP A 1  656  ? -16.282 -63.903  48.551  1.00 69.93  ? 656  TRP A CE2   1 
ATOM   4990  C  CE3   . TRP A 1  656  ? -14.336 -62.482  48.390  1.00 65.98  ? 656  TRP A CE3   1 
ATOM   4991  C  CZ2   . TRP A 1  656  ? -16.638 -63.354  49.787  1.00 69.47  ? 656  TRP A CZ2   1 
ATOM   4992  C  CZ3   . TRP A 1  656  ? -14.704 -61.917  49.600  1.00 67.55  ? 656  TRP A CZ3   1 
ATOM   4993  C  CH2   . TRP A 1  656  ? -15.830 -62.369  50.296  1.00 69.01  ? 656  TRP A CH2   1 
ATOM   4994  N  N     . LEU A 1  657  ? -14.158 -61.016  45.404  1.00 63.42  ? 657  LEU A N     1 
ATOM   4995  C  CA    . LEU A 1  657  ? -14.390 -59.712  46.015  1.00 62.16  ? 657  LEU A CA    1 
ATOM   4996  C  C     . LEU A 1  657  ? -15.061 -58.767  45.045  1.00 67.87  ? 657  LEU A C     1 
ATOM   4997  O  O     . LEU A 1  657  ? -15.992 -58.087  45.451  1.00 67.66  ? 657  LEU A O     1 
ATOM   4998  C  CB    . LEU A 1  657  ? -13.089 -59.103  46.595  1.00 61.03  ? 657  LEU A CB    1 
ATOM   4999  C  CG    . LEU A 1  657  ? -13.157 -57.664  47.221  1.00 63.99  ? 657  LEU A CG    1 
ATOM   5000  C  CD1   . LEU A 1  657  ? -14.065 -57.615  48.444  1.00 64.23  ? 657  LEU A CD1   1 
ATOM   5001  C  CD2   . LEU A 1  657  ? -11.769 -57.126  47.581  1.00 62.72  ? 657  LEU A CD2   1 
ATOM   5002  N  N     . LEU A 1  658  ? -14.630 -58.737  43.768  1.00 66.21  ? 658  LEU A N     1 
ATOM   5003  C  CA    . LEU A 1  658  ? -15.260 -57.907  42.726  1.00 66.79  ? 658  LEU A CA    1 
ATOM   5004  C  C     . LEU A 1  658  ? -16.767 -58.134  42.745  1.00 74.53  ? 658  LEU A C     1 
ATOM   5005  O  O     . LEU A 1  658  ? -17.541 -57.181  42.589  1.00 74.45  ? 658  LEU A O     1 
ATOM   5006  C  CB    . LEU A 1  658  ? -14.692 -58.235  41.320  1.00 66.31  ? 658  LEU A CB    1 
ATOM   5007  C  CG    . LEU A 1  658  ? -15.568 -57.996  40.071  1.00 70.01  ? 658  LEU A CG    1 
ATOM   5008  C  CD1   . LEU A 1  658  ? -15.714 -56.531  39.728  1.00 68.15  ? 658  LEU A CD1   1 
ATOM   5009  C  CD2   . LEU A 1  658  ? -14.967 -58.673  38.885  1.00 75.37  ? 658  LEU A CD2   1 
ATOM   5010  N  N     . HIS A 1  659  ? -17.167 -59.399  42.974  1.00 72.98  ? 659  HIS A N     1 
ATOM   5011  C  CA    . HIS A 1  659  ? -18.560 -59.796  43.038  1.00 73.86  ? 659  HIS A CA    1 
ATOM   5012  C  C     . HIS A 1  659  ? -19.178 -59.653  44.406  1.00 78.64  ? 659  HIS A C     1 
ATOM   5013  O  O     . HIS A 1  659  ? -20.377 -59.398  44.497  1.00 79.17  ? 659  HIS A O     1 
ATOM   5014  C  CB    . HIS A 1  659  ? -18.751 -61.171  42.420  1.00 75.47  ? 659  HIS A CB    1 
ATOM   5015  C  CG    . HIS A 1  659  ? -18.533 -61.122  40.949  1.00 78.52  ? 659  HIS A CG    1 
ATOM   5016  N  ND1   . HIS A 1  659  ? -19.531 -60.701  40.095  1.00 80.54  ? 659  HIS A ND1   1 
ATOM   5017  C  CD2   . HIS A 1  659  ? -17.401 -61.323  40.239  1.00 79.95  ? 659  HIS A CD2   1 
ATOM   5018  C  CE1   . HIS A 1  659  ? -18.988 -60.690  38.888  1.00 79.97  ? 659  HIS A CE1   1 
ATOM   5019  N  NE2   . HIS A 1  659  ? -17.710 -61.064  38.925  1.00 80.02  ? 659  HIS A NE2   1 
ATOM   5020  N  N     . ASN A 1  660  ? -18.362 -59.753  45.465  1.00 75.13  ? 660  ASN A N     1 
ATOM   5021  C  CA    . ASN A 1  660  ? -18.819 -59.589  46.846  1.00 74.67  ? 660  ASN A CA    1 
ATOM   5022  C  C     . ASN A 1  660  ? -18.986 -58.110  47.191  1.00 75.68  ? 660  ASN A C     1 
ATOM   5023  O  O     . ASN A 1  660  ? -19.988 -57.722  47.793  1.00 74.56  ? 660  ASN A O     1 
ATOM   5024  C  CB    . ASN A 1  660  ? -17.846 -60.257  47.816  1.00 74.50  ? 660  ASN A CB    1 
ATOM   5025  C  CG    . ASN A 1  660  ? -18.277 -60.152  49.246  1.00 90.55  ? 660  ASN A CG    1 
ATOM   5026  O  OD1   . ASN A 1  660  ? -19.245 -60.774  49.666  1.00 88.06  ? 660  ASN A OD1   1 
ATOM   5027  N  ND2   . ASN A 1  660  ? -17.554 -59.383  50.034  1.00 78.09  ? 660  ASN A ND2   1 
ATOM   5028  N  N     . GLY A 1  661  ? -17.984 -57.320  46.821  1.00 71.57  ? 661  GLY A N     1 
ATOM   5029  C  CA    . GLY A 1  661  ? -17.912 -55.886  47.069  1.00 70.80  ? 661  GLY A CA    1 
ATOM   5030  C  C     . GLY A 1  661  ? -17.422 -55.569  48.468  1.00 74.48  ? 661  GLY A C     1 
ATOM   5031  O  O     . GLY A 1  661  ? -17.620 -56.361  49.390  1.00 74.90  ? 661  GLY A O     1 
ATOM   5032  N  N     . PHE A 1  662  ? -16.786 -54.398  48.635  1.00 69.70  ? 662  PHE A N     1 
ATOM   5033  C  CA    . PHE A 1  662  ? -16.304 -53.868  49.911  1.00 68.77  ? 662  PHE A CA    1 
ATOM   5034  C  C     . PHE A 1  662  ? -16.157 -52.355  49.807  1.00 72.55  ? 662  PHE A C     1 
ATOM   5035  O  O     . PHE A 1  662  ? -15.649 -51.838  48.807  1.00 70.95  ? 662  PHE A O     1 
ATOM   5036  C  CB    . PHE A 1  662  ? -15.013 -54.549  50.388  1.00 70.21  ? 662  PHE A CB    1 
ATOM   5037  C  CG    . PHE A 1  662  ? -14.426 -53.992  51.664  1.00 71.21  ? 662  PHE A CG    1 
ATOM   5038  C  CD1   . PHE A 1  662  ? -15.110 -54.098  52.867  1.00 74.68  ? 662  PHE A CD1   1 
ATOM   5039  C  CD2   . PHE A 1  662  ? -13.184 -53.371  51.662  1.00 72.50  ? 662  PHE A CD2   1 
ATOM   5040  C  CE1   . PHE A 1  662  ? -14.560 -53.585  54.046  1.00 75.49  ? 662  PHE A CE1   1 
ATOM   5041  C  CE2   . PHE A 1  662  ? -12.630 -52.871  52.842  1.00 75.10  ? 662  PHE A CE2   1 
ATOM   5042  C  CZ    . PHE A 1  662  ? -13.317 -52.987  54.028  1.00 73.64  ? 662  PHE A CZ    1 
ATOM   5043  N  N     . SER A 1  663  ? -16.646 -51.657  50.836  1.00 70.21  ? 663  SER A N     1 
ATOM   5044  C  CA    . SER A 1  663  ? -16.682 -50.200  50.919  1.00 69.54  ? 663  SER A CA    1 
ATOM   5045  C  C     . SER A 1  663  ? -16.156 -49.742  52.293  1.00 72.73  ? 663  SER A C     1 
ATOM   5046  O  O     . SER A 1  663  ? -15.671 -50.583  53.043  1.00 73.09  ? 663  SER A O     1 
ATOM   5047  C  CB    . SER A 1  663  ? -18.120 -49.731  50.702  1.00 73.69  ? 663  SER A CB    1 
ATOM   5048  O  OG    . SER A 1  663  ? -18.217 -48.347  50.419  1.00 82.51  ? 663  SER A OG    1 
ATOM   5049  N  N     . THR A 1  664  ? -16.219 -48.416  52.594  1.00 68.05  ? 664  THR A N     1 
ATOM   5050  C  CA    . THR A 1  664  ? -15.813 -47.723  53.839  1.00 67.72  ? 664  THR A CA    1 
ATOM   5051  C  C     . THR A 1  664  ? -16.471 -46.348  53.773  1.00 73.05  ? 664  THR A C     1 
ATOM   5052  O  O     . THR A 1  664  ? -16.311 -45.656  52.759  1.00 73.18  ? 664  THR A O     1 
ATOM   5053  C  CB    . THR A 1  664  ? -14.265 -47.627  53.986  1.00 69.01  ? 664  THR A CB    1 
ATOM   5054  O  OG1   . THR A 1  664  ? -13.768 -48.847  54.527  1.00 67.27  ? 664  THR A OG1   1 
ATOM   5055  C  CG2   . THR A 1  664  ? -13.812 -46.488  54.886  1.00 63.72  ? 664  THR A CG2   1 
ATOM   5056  N  N     . GLY A 1  665  ? -17.203 -45.976  54.831  1.00 69.38  ? 665  GLY A N     1 
ATOM   5057  C  CA    . GLY A 1  665  ? -17.935 -44.711  54.892  1.00 68.22  ? 665  GLY A CA    1 
ATOM   5058  C  C     . GLY A 1  665  ? -17.844 -44.002  56.216  1.00 69.30  ? 665  GLY A C     1 
ATOM   5059  O  O     . GLY A 1  665  ? -17.131 -44.474  57.106  1.00 69.06  ? 665  GLY A O     1 
ATOM   5060  N  N     . ILE A 1  666  ? -18.552 -42.853  56.350  1.00 63.70  ? 666  ILE A N     1 
ATOM   5061  C  CA    . ILE A 1  666  ? -18.557 -42.082  57.599  1.00 63.08  ? 666  ILE A CA    1 
ATOM   5062  C  C     . ILE A 1  666  ? -19.152 -42.895  58.786  1.00 73.09  ? 666  ILE A C     1 
ATOM   5063  O  O     . ILE A 1  666  ? -18.628 -42.826  59.904  1.00 73.28  ? 666  ILE A O     1 
ATOM   5064  C  CB    . ILE A 1  666  ? -19.091 -40.624  57.460  1.00 64.46  ? 666  ILE A CB    1 
ATOM   5065  C  CG1   . ILE A 1  666  ? -18.715 -39.758  58.670  1.00 64.36  ? 666  ILE A CG1   1 
ATOM   5066  C  CG2   . ILE A 1  666  ? -20.590 -40.577  57.233  1.00 64.92  ? 666  ILE A CG2   1 
ATOM   5067  C  CD1   . ILE A 1  666  ? -17.251 -39.458  58.867  1.00 69.92  ? 666  ILE A CD1   1 
ATOM   5068  N  N     . GLY A 1  667  ? -20.162 -43.732  58.493  1.00 72.50  ? 667  GLY A N     1 
ATOM   5069  C  CA    . GLY A 1  667  ? -20.803 -44.615  59.466  1.00 72.83  ? 667  GLY A CA    1 
ATOM   5070  C  C     . GLY A 1  667  ? -19.836 -45.523  60.200  1.00 75.36  ? 667  GLY A C     1 
ATOM   5071  O  O     . GLY A 1  667  ? -20.075 -45.894  61.356  1.00 76.04  ? 667  GLY A O     1 
ATOM   5072  N  N     . ASP A 1  668  ? -18.735 -45.897  59.514  1.00 69.47  ? 668  ASP A N     1 
ATOM   5073  C  CA    . ASP A 1  668  ? -17.666 -46.733  60.050  1.00 67.78  ? 668  ASP A CA    1 
ATOM   5074  C  C     . ASP A 1  668  ? -16.817 -46.027  61.095  1.00 68.42  ? 668  ASP A C     1 
ATOM   5075  O  O     . ASP A 1  668  ? -16.045 -46.700  61.763  1.00 67.88  ? 668  ASP A O     1 
ATOM   5076  C  CB    . ASP A 1  668  ? -16.793 -47.307  58.933  1.00 68.38  ? 668  ASP A CB    1 
ATOM   5077  C  CG    . ASP A 1  668  ? -17.513 -48.282  58.043  1.00 70.74  ? 668  ASP A CG    1 
ATOM   5078  O  OD1   . ASP A 1  668  ? -17.982 -49.322  58.554  1.00 67.75  ? 668  ASP A OD1   1 
ATOM   5079  O  OD2   . ASP A 1  668  ? -17.536 -48.052  56.827  1.00 78.08  ? 668  ASP A OD2   1 
ATOM   5080  N  N     . THR A 1  669  ? -16.941 -44.697  61.246  1.00 63.36  ? 669  THR A N     1 
ATOM   5081  C  CA    . THR A 1  669  ? -16.204 -43.980  62.290  1.00 63.32  ? 669  THR A CA    1 
ATOM   5082  C  C     . THR A 1  669  ? -17.132 -43.705  63.485  1.00 68.44  ? 669  THR A C     1 
ATOM   5083  O  O     . THR A 1  669  ? -16.666 -43.417  64.588  1.00 67.96  ? 669  THR A O     1 
ATOM   5084  C  CB    . THR A 1  669  ? -15.502 -42.714  61.761  1.00 73.31  ? 669  THR A CB    1 
ATOM   5085  O  OG1   . THR A 1  669  ? -16.469 -41.717  61.439  1.00 73.76  ? 669  THR A OG1   1 
ATOM   5086  C  CG2   . THR A 1  669  ? -14.570 -42.985  60.582  1.00 71.15  ? 669  THR A CG2   1 
ATOM   5087  N  N     . ILE A 1  670  ? -18.449 -43.820  63.265  1.00 66.59  ? 670  ILE A N     1 
ATOM   5088  C  CA    . ILE A 1  670  ? -19.467 -43.597  64.295  1.00 67.45  ? 670  ILE A CA    1 
ATOM   5089  C  C     . ILE A 1  670  ? -19.483 -44.746  65.279  1.00 72.43  ? 670  ILE A C     1 
ATOM   5090  O  O     . ILE A 1  670  ? -19.675 -45.889  64.874  1.00 73.44  ? 670  ILE A O     1 
ATOM   5091  C  CB    . ILE A 1  670  ? -20.894 -43.418  63.698  1.00 71.14  ? 670  ILE A CB    1 
ATOM   5092  C  CG1   . ILE A 1  670  ? -20.954 -42.654  62.335  1.00 70.59  ? 670  ILE A CG1   1 
ATOM   5093  C  CG2   . ILE A 1  670  ? -21.904 -42.940  64.752  1.00 73.25  ? 670  ILE A CG2   1 
ATOM   5094  C  CD1   . ILE A 1  670  ? -20.698 -41.194  62.319  1.00 77.41  ? 670  ILE A CD1   1 
ATOM   5095  N  N     . ALA A 1  671  ? -19.331 -44.439  66.566  1.00 69.31  ? 671  ALA A N     1 
ATOM   5096  C  CA    . ALA A 1  671  ? -19.411 -45.427  67.634  1.00 69.90  ? 671  ALA A CA    1 
ATOM   5097  C  C     . ALA A 1  671  ? -20.561 -45.060  68.586  1.00 76.29  ? 671  ALA A C     1 
ATOM   5098  O  O     . ALA A 1  671  ? -20.912 -43.877  68.735  1.00 75.24  ? 671  ALA A O     1 
ATOM   5099  C  CB    . ALA A 1  671  ? -18.094 -45.516  68.376  1.00 70.15  ? 671  ALA A CB    1 
ATOM   5100  N  N     . ASP A 1  672  ? -21.166 -46.100  69.188  1.00 75.89  ? 672  ASP A N     1 
ATOM   5101  C  CA    . ASP A 1  672  ? -22.316 -46.081  70.097  1.00 77.87  ? 672  ASP A CA    1 
ATOM   5102  C  C     . ASP A 1  672  ? -22.542 -44.870  70.959  1.00 83.47  ? 672  ASP A C     1 
ATOM   5103  O  O     . ASP A 1  672  ? -21.584 -44.320  71.524  1.00 82.67  ? 672  ASP A O     1 
ATOM   5104  C  CB    . ASP A 1  672  ? -22.253 -47.268  71.046  1.00 80.80  ? 672  ASP A CB    1 
ATOM   5105  C  CG    . ASP A 1  672  ? -22.940 -48.487  70.547  1.00 96.16  ? 672  ASP A CG    1 
ATOM   5106  O  OD1   . ASP A 1  672  ? -23.858 -48.968  71.245  1.00 99.18  ? 672  ASP A OD1   1 
ATOM   5107  O  OD2   . ASP A 1  672  ? -22.531 -48.998  69.479  1.00 104.18 ? 672  ASP A OD2   1 
ATOM   5108  N  N     . GLY A 1  673  ? -23.833 -44.563  71.149  1.00 80.97  ? 673  GLY A N     1 
ATOM   5109  C  CA    . GLY A 1  673  ? -24.302 -43.528  72.060  1.00 81.23  ? 673  GLY A CA    1 
ATOM   5110  C  C     . GLY A 1  673  ? -23.678 -43.776  73.420  1.00 85.31  ? 673  GLY A C     1 
ATOM   5111  O  O     . GLY A 1  673  ? -22.831 -42.986  73.860  1.00 84.53  ? 673  GLY A O     1 
ATOM   5112  N  N     . PRO A 1  674  ? -23.935 -44.958  74.028  1.00 82.25  ? 674  PRO A N     1 
ATOM   5113  C  CA    . PRO A 1  674  ? -23.295 -45.269  75.303  1.00 82.34  ? 674  PRO A CA    1 
ATOM   5114  C  C     . PRO A 1  674  ? -21.769 -45.233  75.254  1.00 85.97  ? 674  PRO A C     1 
ATOM   5115  O  O     . PRO A 1  674  ? -21.178 -44.729  76.221  1.00 86.92  ? 674  PRO A O     1 
ATOM   5116  C  CB    . PRO A 1  674  ? -23.845 -46.653  75.630  1.00 85.02  ? 674  PRO A CB    1 
ATOM   5117  C  CG    . PRO A 1  674  ? -25.172 -46.664  74.982  1.00 90.20  ? 674  PRO A CG    1 
ATOM   5118  C  CD    . PRO A 1  674  ? -24.892 -46.020  73.667  1.00 84.85  ? 674  PRO A CD    1 
ATOM   5119  N  N     . THR A 1  675  ? -21.129 -45.679  74.129  1.00 79.69  ? 675  THR A N     1 
ATOM   5120  C  CA    . THR A 1  675  ? -19.654 -45.652  74.017  1.00 77.74  ? 675  THR A CA    1 
ATOM   5121  C  C     . THR A 1  675  ? -19.096 -44.240  74.107  1.00 81.77  ? 675  THR A C     1 
ATOM   5122  O  O     . THR A 1  675  ? -18.093 -43.998  74.784  1.00 78.46  ? 675  THR A O     1 
ATOM   5123  C  CB    . THR A 1  675  ? -19.183 -46.395  72.800  1.00 74.54  ? 675  THR A CB    1 
ATOM   5124  O  OG1   . THR A 1  675  ? -19.882 -47.617  72.818  1.00 78.37  ? 675  THR A OG1   1 
ATOM   5125  C  CG2   . THR A 1  675  ? -17.695 -46.685  72.836  1.00 67.81  ? 675  THR A CG2   1 
ATOM   5126  N  N     . MET A 1  676  ? -19.789 -43.304  73.455  1.00 81.54  ? 676  MET A N     1 
ATOM   5127  C  CA    . MET A 1  676  ? -19.409 -41.901  73.461  1.00 81.41  ? 676  MET A CA    1 
ATOM   5128  C  C     . MET A 1  676  ? -19.438 -41.321  74.853  1.00 86.47  ? 676  MET A C     1 
ATOM   5129  O  O     . MET A 1  676  ? -18.474 -40.663  75.254  1.00 86.35  ? 676  MET A O     1 
ATOM   5130  C  CB    . MET A 1  676  ? -20.219 -41.090  72.432  1.00 83.30  ? 676  MET A CB    1 
ATOM   5131  C  CG    . MET A 1  676  ? -19.593 -41.131  71.066  1.00 85.79  ? 676  MET A CG    1 
ATOM   5132  S  SD    . MET A 1  676  ? -17.790 -41.035  71.258  1.00 89.57  ? 676  MET A SD    1 
ATOM   5133  C  CE    . MET A 1  676  ? -17.411 -39.706  70.096  1.00 86.16  ? 676  MET A CE    1 
ATOM   5134  N  N     . ARG A 1  677  ? -20.485 -41.672  75.624  1.00 83.29  ? 677  ARG A N     1 
ATOM   5135  C  CA    . ARG A 1  677  ? -20.659 -41.232  76.999  1.00 83.67  ? 677  ARG A CA    1 
ATOM   5136  C  C     . ARG A 1  677  ? -19.534 -41.774  77.885  1.00 87.23  ? 677  ARG A C     1 
ATOM   5137  O  O     . ARG A 1  677  ? -19.085 -41.076  78.794  1.00 86.66  ? 677  ARG A O     1 
ATOM   5138  C  CB    . ARG A 1  677  ? -22.035 -41.658  77.504  1.00 85.34  ? 677  ARG A CB    1 
ATOM   5139  C  CG    . ARG A 1  677  ? -22.722 -40.595  78.346  1.00 100.04 ? 677  ARG A CG    1 
ATOM   5140  C  CD    . ARG A 1  677  ? -24.240 -40.613  78.207  1.00 120.35 ? 677  ARG A CD    1 
ATOM   5141  N  NE    . ARG A 1  677  ? -24.844 -41.920  78.508  1.00 136.70 ? 677  ARG A NE    1 
ATOM   5142  C  CZ    . ARG A 1  677  ? -26.054 -42.100  79.039  1.00 150.78 ? 677  ARG A CZ    1 
ATOM   5143  N  NH1   . ARG A 1  677  ? -26.809 -41.054  79.365  1.00 139.85 ? 677  ARG A NH1   1 
ATOM   5144  N  NH2   . ARG A 1  677  ? -26.512 -43.325  79.263  1.00 132.35 ? 677  ARG A NH2   1 
ATOM   5145  N  N     . GLU A 1  678  ? -19.033 -42.983  77.559  1.00 83.79  ? 678  GLU A N     1 
ATOM   5146  C  CA    . GLU A 1  678  ? -17.953 -43.671  78.275  1.00 83.76  ? 678  GLU A CA    1 
ATOM   5147  C  C     . GLU A 1  678  ? -16.562 -43.175  77.914  1.00 85.32  ? 678  GLU A C     1 
ATOM   5148  O  O     . GLU A 1  678  ? -15.664 -43.249  78.745  1.00 83.93  ? 678  GLU A O     1 
ATOM   5149  C  CB    . GLU A 1  678  ? -18.034 -45.178  78.040  1.00 86.12  ? 678  GLU A CB    1 
ATOM   5150  C  CG    . GLU A 1  678  ? -18.482 -45.967  79.256  1.00 102.37 ? 678  GLU A CG    1 
ATOM   5151  C  CD    . GLU A 1  678  ? -17.492 -47.053  79.621  1.00 134.06 ? 678  GLU A CD    1 
ATOM   5152  O  OE1   . GLU A 1  678  ? -16.627 -46.802  80.494  1.00 135.10 ? 678  GLU A OE1   1 
ATOM   5153  O  OE2   . GLU A 1  678  ? -17.542 -48.134  78.987  1.00 130.40 ? 678  GLU A OE2   1 
ATOM   5154  N  N     . ILE A 1  679  ? -16.367 -42.706  76.667  1.00 82.04  ? 679  ILE A N     1 
ATOM   5155  C  CA    . ILE A 1  679  ? -15.083 -42.153  76.214  1.00 80.23  ? 679  ILE A CA    1 
ATOM   5156  C  C     . ILE A 1  679  ? -14.945 -40.802  76.889  1.00 84.36  ? 679  ILE A C     1 
ATOM   5157  O  O     . ILE A 1  679  ? -13.911 -40.522  77.499  1.00 83.76  ? 679  ILE A O     1 
ATOM   5158  C  CB    . ILE A 1  679  ? -14.971 -42.104  74.665  1.00 81.76  ? 679  ILE A CB    1 
ATOM   5159  C  CG1   . ILE A 1  679  ? -14.596 -43.492  74.122  1.00 81.91  ? 679  ILE A CG1   1 
ATOM   5160  C  CG2   . ILE A 1  679  ? -13.940 -41.079  74.212  1.00 80.95  ? 679  ILE A CG2   1 
ATOM   5161  C  CD1   . ILE A 1  679  ? -15.280 -43.897  72.867  1.00 84.64  ? 679  ILE A CD1   1 
ATOM   5162  N  N     . THR A 1  680  ? -16.034 -40.015  76.863  1.00 81.64  ? 680  THR A N     1 
ATOM   5163  C  CA    . THR A 1  680  ? -16.112 -38.709  77.503  1.00 82.38  ? 680  THR A CA    1 
ATOM   5164  C  C     . THR A 1  680  ? -15.727 -38.817  78.995  1.00 89.15  ? 680  THR A C     1 
ATOM   5165  O  O     . THR A 1  680  ? -14.882 -38.051  79.473  1.00 88.31  ? 680  THR A O     1 
ATOM   5166  C  CB    . THR A 1  680  ? -17.483 -38.113  77.236  1.00 90.60  ? 680  THR A CB    1 
ATOM   5167  O  OG1   . THR A 1  680  ? -17.603 -37.909  75.827  1.00 86.48  ? 680  THR A OG1   1 
ATOM   5168  C  CG2   . THR A 1  680  ? -17.703 -36.802  77.967  1.00 92.87  ? 680  THR A CG2   1 
ATOM   5169  N  N     . GLU A 1  681  ? -16.308 -39.818  79.689  1.00 88.05  ? 681  GLU A N     1 
ATOM   5170  C  CA    . GLU A 1  681  ? -16.067 -40.153  81.091  1.00 89.02  ? 681  GLU A CA    1 
ATOM   5171  C  C     . GLU A 1  681  ? -14.565 -40.442  81.323  1.00 91.75  ? 681  GLU A C     1 
ATOM   5172  O  O     . GLU A 1  681  ? -14.003 -39.951  82.304  1.00 91.81  ? 681  GLU A O     1 
ATOM   5173  C  CB    . GLU A 1  681  ? -16.996 -41.321  81.513  1.00 91.86  ? 681  GLU A CB    1 
ATOM   5174  C  CG    . GLU A 1  681  ? -16.360 -42.443  82.334  1.00 110.29 ? 681  GLU A CG    1 
ATOM   5175  C  CD    . GLU A 1  681  ? -17.054 -43.798  82.349  1.00 142.49 ? 681  GLU A CD    1 
ATOM   5176  O  OE1   . GLU A 1  681  ? -18.224 -43.884  81.907  1.00 148.07 ? 681  GLU A OE1   1 
ATOM   5177  O  OE2   . GLU A 1  681  ? -16.426 -44.774  82.825  1.00 132.76 ? 681  GLU A OE2   1 
ATOM   5178  N  N     . THR A 1  682  ? -13.919 -41.186  80.388  1.00 86.87  ? 682  THR A N     1 
ATOM   5179  C  CA    . THR A 1  682  ? -12.490 -41.554  80.416  1.00 85.86  ? 682  THR A CA    1 
ATOM   5180  C  C     . THR A 1  682  ? -11.584 -40.309  80.381  1.00 88.61  ? 682  THR A C     1 
ATOM   5181  O  O     . THR A 1  682  ? -10.615 -40.221  81.150  1.00 87.15  ? 682  THR A O     1 
ATOM   5182  C  CB    . THR A 1  682  ? -12.199 -42.533  79.275  1.00 88.57  ? 682  THR A CB    1 
ATOM   5183  O  OG1   . THR A 1  682  ? -13.074 -43.637  79.440  1.00 91.39  ? 682  THR A OG1   1 
ATOM   5184  C  CG2   . THR A 1  682  ? -10.746 -43.006  79.233  1.00 83.00  ? 682  THR A CG2   1 
ATOM   5185  N  N     . ILE A 1  683  ? -11.911 -39.356  79.483  1.00 84.15  ? 683  ILE A N     1 
ATOM   5186  C  CA    . ILE A 1  683  ? -11.160 -38.115  79.350  1.00 82.67  ? 683  ILE A CA    1 
ATOM   5187  C  C     . ILE A 1  683  ? -11.373 -37.267  80.597  1.00 87.32  ? 683  ILE A C     1 
ATOM   5188  O  O     . ILE A 1  683  ? -10.391 -36.779  81.156  1.00 87.68  ? 683  ILE A O     1 
ATOM   5189  C  CB    . ILE A 1  683  ? -11.487 -37.371  78.038  1.00 84.67  ? 683  ILE A CB    1 
ATOM   5190  C  CG1   . ILE A 1  683  ? -11.417 -38.313  76.820  1.00 85.24  ? 683  ILE A CG1   1 
ATOM   5191  C  CG2   . ILE A 1  683  ? -10.579 -36.168  77.852  1.00 83.94  ? 683  ILE A CG2   1 
ATOM   5192  C  CD1   . ILE A 1  683  ? -10.062 -39.156  76.624  1.00 95.84  ? 683  ILE A CD1   1 
ATOM   5193  N  N     . ALA A 1  684  ? -12.634 -37.161  81.071  1.00 83.36  ? 684  ALA A N     1 
ATOM   5194  C  CA    . ALA A 1  684  ? -13.008 -36.404  82.266  1.00 83.53  ? 684  ALA A CA    1 
ATOM   5195  C  C     . ALA A 1  684  ? -12.226 -36.829  83.534  1.00 86.47  ? 684  ALA A C     1 
ATOM   5196  O  O     . ALA A 1  684  ? -11.745 -35.959  84.272  1.00 84.86  ? 684  ALA A O     1 
ATOM   5197  C  CB    . ALA A 1  684  ? -14.500 -36.514  82.495  1.00 85.26  ? 684  ALA A CB    1 
ATOM   5198  N  N     . GLU A 1  685  ? -12.060 -38.155  83.759  1.00 82.93  ? 685  GLU A N     1 
ATOM   5199  C  CA    . GLU A 1  685  ? -11.282 -38.621  84.902  1.00 83.02  ? 685  GLU A CA    1 
ATOM   5200  C  C     . GLU A 1  685  ? -9.807  -38.291  84.758  1.00 84.35  ? 685  GLU A C     1 
ATOM   5201  O  O     . GLU A 1  685  ? -9.192  -37.953  85.760  1.00 85.07  ? 685  GLU A O     1 
ATOM   5202  C  CB    . GLU A 1  685  ? -11.544 -40.087  85.298  1.00 85.64  ? 685  GLU A CB    1 
ATOM   5203  C  CG    . GLU A 1  685  ? -11.384 -41.139  84.206  1.00 101.56 ? 685  GLU A CG    1 
ATOM   5204  C  CD    . GLU A 1  685  ? -12.045 -42.484  84.489  1.00 133.02 ? 685  GLU A CD    1 
ATOM   5205  O  OE1   . GLU A 1  685  ? -11.321 -43.505  84.523  1.00 127.77 ? 685  GLU A OE1   1 
ATOM   5206  O  OE2   . GLU A 1  685  ? -13.288 -42.522  84.658  1.00 130.72 ? 685  GLU A OE2   1 
ATOM   5207  N  N     . ALA A 1  686  ? -9.255  -38.303  83.517  1.00 78.10  ? 686  ALA A N     1 
ATOM   5208  C  CA    . ALA A 1  686  ? -7.855  -37.928  83.262  1.00 76.17  ? 686  ALA A CA    1 
ATOM   5209  C  C     . ALA A 1  686  ? -7.699  -36.464  83.596  1.00 79.01  ? 686  ALA A C     1 
ATOM   5210  O  O     . ALA A 1  686  ? -6.769  -36.090  84.329  1.00 78.72  ? 686  ALA A O     1 
ATOM   5211  C  CB    . ALA A 1  686  ? -7.484  -38.165  81.811  1.00 75.74  ? 686  ALA A CB    1 
ATOM   5212  N  N     . LYS A 1  687  ? -8.676  -35.650  83.135  1.00 74.63  ? 687  LYS A N     1 
ATOM   5213  C  CA    . LYS A 1  687  ? -8.737  -34.214  83.404  1.00 74.42  ? 687  LYS A CA    1 
ATOM   5214  C  C     . LYS A 1  687  ? -8.626  -33.942  84.932  1.00 77.60  ? 687  LYS A C     1 
ATOM   5215  O  O     . LYS A 1  687  ? -7.821  -33.092  85.349  1.00 75.89  ? 687  LYS A O     1 
ATOM   5216  C  CB    . LYS A 1  687  ? -9.989  -33.556  82.756  1.00 76.70  ? 687  LYS A CB    1 
ATOM   5217  C  CG    . LYS A 1  687  ? -10.000 -33.548  81.208  1.00 81.84  ? 687  LYS A CG    1 
ATOM   5218  C  CD    . LYS A 1  687  ? -9.519  -32.231  80.582  1.00 88.26  ? 687  LYS A CD    1 
ATOM   5219  C  CE    . LYS A 1  687  ? -10.569 -31.561  79.722  1.00 94.59  ? 687  LYS A CE    1 
ATOM   5220  N  NZ    . LYS A 1  687  ? -10.530 -30.073  79.853  1.00 98.98  ? 687  LYS A NZ    1 
ATOM   5221  N  N     . LYS A 1  688  ? -9.358  -34.748  85.749  1.00 74.50  ? 688  LYS A N     1 
ATOM   5222  C  CA    . LYS A 1  688  ? -9.333  -34.663  87.219  1.00 74.72  ? 688  LYS A CA    1 
ATOM   5223  C  C     . LYS A 1  688  ? -7.989  -35.052  87.776  1.00 76.03  ? 688  LYS A C     1 
ATOM   5224  O  O     . LYS A 1  688  ? -7.404  -34.262  88.505  1.00 75.12  ? 688  LYS A O     1 
ATOM   5225  C  CB    . LYS A 1  688  ? -10.466 -35.479  87.877  1.00 78.48  ? 688  LYS A CB    1 
ATOM   5226  C  CG    . LYS A 1  688  ? -11.594 -34.616  88.478  1.00 100.90 ? 688  LYS A CG    1 
ATOM   5227  C  CD    . LYS A 1  688  ? -12.213 -33.557  87.493  1.00 115.32 ? 688  LYS A CD    1 
ATOM   5228  C  CE    . LYS A 1  688  ? -13.193 -34.094  86.462  1.00 125.37 ? 688  LYS A CE    1 
ATOM   5229  N  NZ    . LYS A 1  688  ? -12.984 -33.483  85.115  1.00 128.80 ? 688  LYS A NZ    1 
ATOM   5230  N  N     . LYS A 1  689  ? -7.476  -36.232  87.381  1.00 71.89  ? 689  LYS A N     1 
ATOM   5231  C  CA    . LYS A 1  689  ? -6.174  -36.785  87.773  1.00 71.50  ? 689  LYS A CA    1 
ATOM   5232  C  C     . LYS A 1  689  ? -5.085  -35.715  87.613  1.00 73.91  ? 689  LYS A C     1 
ATOM   5233  O  O     . LYS A 1  689  ? -4.334  -35.446  88.567  1.00 72.95  ? 689  LYS A O     1 
ATOM   5234  C  CB    . LYS A 1  689  ? -5.849  -38.024  86.912  1.00 73.16  ? 689  LYS A CB    1 
ATOM   5235  C  CG    . LYS A 1  689  ? -5.085  -39.128  87.628  1.00 81.85  ? 689  LYS A CG    1 
ATOM   5236  C  CD    . LYS A 1  689  ? -5.008  -40.365  86.731  1.00 93.96  ? 689  LYS A CD    1 
ATOM   5237  C  CE    . LYS A 1  689  ? -4.429  -41.591  87.402  1.00 109.21 ? 689  LYS A CE    1 
ATOM   5238  N  NZ    . LYS A 1  689  ? -4.295  -42.732  86.452  1.00 117.00 ? 689  LYS A NZ    1 
ATOM   5239  N  N     . VAL A 1  690  ? -5.052  -35.063  86.429  1.00 69.08  ? 690  VAL A N     1 
ATOM   5240  C  CA    . VAL A 1  690  ? -4.103  -33.986  86.144  1.00 68.24  ? 690  VAL A CA    1 
ATOM   5241  C  C     . VAL A 1  690  ? -4.285  -32.781  87.112  1.00 73.66  ? 690  VAL A C     1 
ATOM   5242  O  O     . VAL A 1  690  ? -3.326  -32.362  87.773  1.00 73.62  ? 690  VAL A O     1 
ATOM   5243  C  CB    . VAL A 1  690  ? -4.179  -33.597  84.668  1.00 69.83  ? 690  VAL A CB    1 
ATOM   5244  C  CG1   . VAL A 1  690  ? -3.409  -32.318  84.397  1.00 68.49  ? 690  VAL A CG1   1 
ATOM   5245  C  CG2   . VAL A 1  690  ? -3.669  -34.740  83.805  1.00 69.21  ? 690  VAL A CG2   1 
ATOM   5246  N  N     . LEU A 1  691  ? -5.530  -32.284  87.229  1.00 69.65  ? 691  LEU A N     1 
ATOM   5247  C  CA    . LEU A 1  691  ? -5.909  -31.187  88.113  1.00 68.99  ? 691  LEU A CA    1 
ATOM   5248  C  C     . LEU A 1  691  ? -5.531  -31.488  89.560  1.00 74.38  ? 691  LEU A C     1 
ATOM   5249  O  O     . LEU A 1  691  ? -5.058  -30.593  90.249  1.00 74.80  ? 691  LEU A O     1 
ATOM   5250  C  CB    . LEU A 1  691  ? -7.420  -30.930  87.986  1.00 68.70  ? 691  LEU A CB    1 
ATOM   5251  C  CG    . LEU A 1  691  ? -8.035  -29.583  88.417  1.00 72.58  ? 691  LEU A CG    1 
ATOM   5252  C  CD1   . LEU A 1  691  ? -9.074  -29.786  89.464  1.00 73.87  ? 691  LEU A CD1   1 
ATOM   5253  C  CD2   . LEU A 1  691  ? -7.004  -28.515  88.821  1.00 73.84  ? 691  LEU A CD2   1 
ATOM   5254  N  N     . ASP A 1  692  ? -5.714  -32.731  90.017  1.00 72.20  ? 692  ASP A N     1 
ATOM   5255  C  CA    . ASP A 1  692  ? -5.362  -33.115  91.386  1.00 73.41  ? 692  ASP A CA    1 
ATOM   5256  C  C     . ASP A 1  692  ? -3.852  -33.051  91.568  1.00 77.47  ? 692  ASP A C     1 
ATOM   5257  O  O     . ASP A 1  692  ? -3.391  -32.406  92.505  1.00 77.17  ? 692  ASP A O     1 
ATOM   5258  C  CB    . ASP A 1  692  ? -5.948  -34.493  91.765  1.00 76.17  ? 692  ASP A CB    1 
ATOM   5259  C  CG    . ASP A 1  692  ? -7.481  -34.583  91.768  1.00 92.23  ? 692  ASP A CG    1 
ATOM   5260  O  OD1   . ASP A 1  692  ? -8.149  -33.516  91.862  1.00 95.28  ? 692  ASP A OD1   1 
ATOM   5261  O  OD2   . ASP A 1  692  ? -8.015  -35.722  91.672  1.00 96.53  ? 692  ASP A OD2   1 
ATOM   5262  N  N     . VAL A 1  693  ? -3.091  -33.602  90.604  1.00 74.46  ? 693  VAL A N     1 
ATOM   5263  C  CA    . VAL A 1  693  ? -1.622  -33.568  90.591  1.00 74.39  ? 693  VAL A CA    1 
ATOM   5264  C  C     . VAL A 1  693  ? -1.118  -32.139  90.550  1.00 75.61  ? 693  VAL A C     1 
ATOM   5265  O  O     . VAL A 1  693  ? -0.110  -31.834  91.177  1.00 76.01  ? 693  VAL A O     1 
ATOM   5266  C  CB    . VAL A 1  693  ? -1.035  -34.481  89.477  1.00 79.10  ? 693  VAL A CB    1 
ATOM   5267  C  CG1   . VAL A 1  693  ? 0.370   -34.063  89.040  1.00 77.97  ? 693  VAL A CG1   1 
ATOM   5268  C  CG2   . VAL A 1  693  ? -1.020  -35.924  89.960  1.00 80.41  ? 693  VAL A CG2   1 
ATOM   5269  N  N     . THR A 1  694  ? -1.842  -31.263  89.847  1.00 69.75  ? 694  THR A N     1 
ATOM   5270  C  CA    . THR A 1  694  ? -1.523  -29.846  89.734  1.00 68.48  ? 694  THR A CA    1 
ATOM   5271  C  C     . THR A 1  694  ? -1.705  -29.169  91.090  1.00 73.68  ? 694  THR A C     1 
ATOM   5272  O  O     . THR A 1  694  ? -0.799  -28.475  91.549  1.00 73.82  ? 694  THR A O     1 
ATOM   5273  C  CB    . THR A 1  694  ? -2.392  -29.223  88.652  1.00 66.44  ? 694  THR A CB    1 
ATOM   5274  O  OG1   . THR A 1  694  ? -2.031  -29.801  87.400  1.00 62.31  ? 694  THR A OG1   1 
ATOM   5275  C  CG2   . THR A 1  694  ? -2.286  -27.713  88.607  1.00 61.69  ? 694  THR A CG2   1 
ATOM   5276  N  N     . LYS A 1  695  ? -2.864  -29.399  91.733  1.00 70.36  ? 695  LYS A N     1 
ATOM   5277  C  CA    . LYS A 1  695  ? -3.216  -28.837  93.027  1.00 70.96  ? 695  LYS A CA    1 
ATOM   5278  C  C     . LYS A 1  695  ? -2.187  -29.242  94.075  1.00 75.74  ? 695  LYS A C     1 
ATOM   5279  O  O     . LYS A 1  695  ? -1.767  -28.405  94.894  1.00 75.38  ? 695  LYS A O     1 
ATOM   5280  C  CB    . LYS A 1  695  ? -4.650  -29.243  93.418  1.00 74.35  ? 695  LYS A CB    1 
ATOM   5281  C  CG    . LYS A 1  695  ? -5.745  -28.376  92.763  1.00 95.88  ? 695  LYS A CG    1 
ATOM   5282  C  CD    . LYS A 1  695  ? -5.912  -26.984  93.442  1.00 108.14 ? 695  LYS A CD    1 
ATOM   5283  C  CE    . LYS A 1  695  ? -5.855  -25.805  92.492  1.00 115.40 ? 695  LYS A CE    1 
ATOM   5284  N  NZ    . LYS A 1  695  ? -5.701  -24.509  93.218  1.00 122.29 ? 695  LYS A NZ    1 
ATOM   5285  N  N     . GLU A 1  696  ? -1.736  -30.526  93.978  1.00 72.60  ? 696  GLU A N     1 
ATOM   5286  C  CA    . GLU A 1  696  ? -0.710  -31.201  94.783  1.00 72.16  ? 696  GLU A CA    1 
ATOM   5287  C  C     . GLU A 1  696  ? 0.621   -30.479  94.550  1.00 76.23  ? 696  GLU A C     1 
ATOM   5288  O  O     . GLU A 1  696  ? 1.194   -29.956  95.504  1.00 78.07  ? 696  GLU A O     1 
ATOM   5289  C  CB    . GLU A 1  696  ? -0.646  -32.691  94.385  1.00 73.05  ? 696  GLU A CB    1 
ATOM   5290  C  CG    . GLU A 1  696  ? 0.585   -33.449  94.846  1.00 85.80  ? 696  GLU A CG    1 
ATOM   5291  C  CD    . GLU A 1  696  ? 0.385   -34.936  95.086  1.00 117.68 ? 696  GLU A CD    1 
ATOM   5292  O  OE1   . GLU A 1  696  ? -0.216  -35.603  94.211  1.00 129.18 ? 696  GLU A OE1   1 
ATOM   5293  O  OE2   . GLU A 1  696  ? 0.853   -35.440  96.136  1.00 107.10 ? 696  GLU A OE2   1 
ATOM   5294  N  N     . ALA A 1  697  ? 1.056   -30.378  93.277  1.00 70.70  ? 697  ALA A N     1 
ATOM   5295  C  CA    . ALA A 1  697  ? 2.277   -29.694  92.843  1.00 69.60  ? 697  ALA A CA    1 
ATOM   5296  C  C     . ALA A 1  697  ? 2.392   -28.279  93.417  1.00 72.95  ? 697  ALA A C     1 
ATOM   5297  O  O     . ALA A 1  697  ? 3.446   -27.931  93.948  1.00 70.57  ? 697  ALA A O     1 
ATOM   5298  C  CB    . ALA A 1  697  ? 2.339   -29.660  91.316  1.00 69.29  ? 697  ALA A CB    1 
ATOM   5299  N  N     . GLN A 1  698  ? 1.283   -27.504  93.347  1.00 72.45  ? 698  GLN A N     1 
ATOM   5300  C  CA    . GLN A 1  698  ? 1.128   -26.113  93.809  1.00 74.30  ? 698  GLN A CA    1 
ATOM   5301  C  C     . GLN A 1  698  ? 1.150   -25.968  95.332  1.00 83.20  ? 698  GLN A C     1 
ATOM   5302  O  O     . GLN A 1  698  ? 1.388   -24.862  95.834  1.00 83.52  ? 698  GLN A O     1 
ATOM   5303  C  CB    . GLN A 1  698  ? -0.174  -25.505  93.276  1.00 75.47  ? 698  GLN A CB    1 
ATOM   5304  C  CG    . GLN A 1  698  ? -0.189  -25.315  91.767  1.00 91.71  ? 698  GLN A CG    1 
ATOM   5305  C  CD    . GLN A 1  698  ? -1.559  -25.052  91.198  1.00 109.31 ? 698  GLN A CD    1 
ATOM   5306  O  OE1   . GLN A 1  698  ? -2.586  -25.062  91.895  1.00 101.71 ? 698  GLN A OE1   1 
ATOM   5307  N  NE2   . GLN A 1  698  ? -1.592  -24.785  89.906  1.00 106.97 ? 698  GLN A NE2   1 
ATOM   5308  N  N     . ALA A 1  699  ? 0.883   -27.062  96.073  1.00 81.71  ? 699  ALA A N     1 
ATOM   5309  C  CA    . ALA A 1  699  ? 0.907   -27.002  97.533  1.00 83.47  ? 699  ALA A CA    1 
ATOM   5310  C  C     . ALA A 1  699  ? 2.315   -27.263  98.098  1.00 91.07  ? 699  ALA A C     1 
ATOM   5311  O  O     . ALA A 1  699  ? 2.505   -27.211  99.315  1.00 91.09  ? 699  ALA A O     1 
ATOM   5312  C  CB    . ALA A 1  699  ? -0.106  -27.970  98.114  1.00 84.49  ? 699  ALA A CB    1 
ATOM   5313  N  N     . ASN A 1  700  ? 3.309   -27.475  97.190  1.00 90.33  ? 700  ASN A N     1 
ATOM   5314  C  CA    . ASN A 1  700  ? 4.726   -27.801  97.442  1.00 91.63  ? 700  ASN A CA    1 
ATOM   5315  C  C     . ASN A 1  700  ? 4.778   -29.134  98.144  1.00 102.23 ? 700  ASN A C     1 
ATOM   5316  O  O     . ASN A 1  700  ? 5.610   -29.365  99.023  1.00 102.84 ? 700  ASN A O     1 
ATOM   5317  C  CB    . ASN A 1  700  ? 5.445   -26.712  98.257  1.00 88.40  ? 700  ASN A CB    1 
ATOM   5318  C  CG    . ASN A 1  700  ? 6.943   -26.695  98.087  1.00 95.37  ? 700  ASN A CG    1 
ATOM   5319  O  OD1   . ASN A 1  700  ? 7.521   -27.513  97.364  1.00 84.98  ? 700  ASN A OD1   1 
ATOM   5320  N  ND2   . ASN A 1  700  ? 7.605   -25.743  98.733  1.00 85.66  ? 700  ASN A ND2   1 
ATOM   5321  N  N     . LEU A 1  701  ? 3.845   -30.011  97.776  1.00 103.04 ? 701  LEU A N     1 
ATOM   5322  C  CA    . LEU A 1  701  ? 3.717   -31.295  98.428  1.00 105.27 ? 701  LEU A CA    1 
ATOM   5323  C  C     . LEU A 1  701  ? 4.488   -32.396  97.745  1.00 114.64 ? 701  LEU A C     1 
ATOM   5324  O  O     . LEU A 1  701  ? 5.346   -33.015  98.398  1.00 116.37 ? 701  LEU A O     1 
ATOM   5325  C  CB    . LEU A 1  701  ? 2.241   -31.670  98.667  1.00 105.16 ? 701  LEU A CB    1 
ATOM   5326  C  CG    . LEU A 1  701  ? 1.452   -30.792  99.651  1.00 109.57 ? 701  LEU A CG    1 
ATOM   5327  C  CD1   . LEU A 1  701  ? 0.060   -31.342  99.875  1.00 109.86 ? 701  LEU A CD1   1 
ATOM   5328  C  CD2   . LEU A 1  701  ? 2.185   -30.599  100.977 1.00 111.44 ? 701  LEU A CD2   1 
ATOM   5329  N  N     . LEU A 1  702  ? 4.220   -32.623  96.436  1.00 112.16 ? 702  LEU A N     1 
ATOM   5330  C  CA    . LEU A 1  702  ? 4.878   -33.693  95.699  1.00 112.72 ? 702  LEU A CA    1 
ATOM   5331  C  C     . LEU A 1  702  ? 6.394   -33.636  95.684  1.00 120.36 ? 702  LEU A C     1 
ATOM   5332  O  O     . LEU A 1  702  ? 6.979   -32.595  95.383  1.00 119.30 ? 702  LEU A O     1 
ATOM   5333  C  CB    . LEU A 1  702  ? 4.247   -34.018  94.328  1.00 111.69 ? 702  LEU A CB    1 
ATOM   5334  C  CG    . LEU A 1  702  ? 4.487   -33.106  93.140  1.00 114.85 ? 702  LEU A CG    1 
ATOM   5335  C  CD1   . LEU A 1  702  ? 5.711   -33.555  92.347  1.00 114.19 ? 702  LEU A CD1   1 
ATOM   5336  C  CD2   . LEU A 1  702  ? 3.309   -33.168  92.215  1.00 117.01 ? 702  LEU A CD2   1 
ATOM   5337  N  N     . THR A 1  703  ? 7.011   -34.754  96.093  1.00 120.22 ? 703  THR A N     1 
ATOM   5338  C  CA    . THR A 1  703  ? 8.458   -34.920  96.172  1.00 120.96 ? 703  THR A CA    1 
ATOM   5339  C  C     . THR A 1  703  ? 8.941   -35.773  95.005  1.00 125.72 ? 703  THR A C     1 
ATOM   5340  O  O     . THR A 1  703  ? 8.643   -36.976  94.949  1.00 125.57 ? 703  THR A O     1 
ATOM   5341  C  CB    . THR A 1  703  ? 8.871   -35.474  97.545  1.00 128.47 ? 703  THR A CB    1 
ATOM   5342  O  OG1   . THR A 1  703  ? 8.120   -36.668  97.814  1.00 125.96 ? 703  THR A OG1   1 
ATOM   5343  C  CG2   . THR A 1  703  ? 8.700   -34.441  98.672  1.00 127.69 ? 703  THR A CG2   1 
ATOM   5344  N  N     . ALA A 1  704  ? 9.641   -35.123  94.043  1.00 121.88 ? 704  ALA A N     1 
ATOM   5345  C  CA    . ALA A 1  704  ? 10.228  -35.778  92.874  1.00 120.48 ? 704  ALA A CA    1 
ATOM   5346  C  C     . ALA A 1  704  ? 11.386  -36.657  93.339  1.00 123.27 ? 704  ALA A C     1 
ATOM   5347  O  O     . ALA A 1  704  ? 12.141  -36.301  94.260  1.00 123.20 ? 704  ALA A O     1 
ATOM   5348  C  CB    . ALA A 1  704  ? 10.724  -34.754  91.865  1.00 120.31 ? 704  ALA A CB    1 
ATOM   5349  N  N     . LYS A 1  705  ? 11.475  -37.834  92.729  1.00 117.72 ? 705  LYS A N     1 
ATOM   5350  C  CA    . LYS A 1  705  ? 12.502  -38.824  93.006  1.00 116.58 ? 705  LYS A CA    1 
ATOM   5351  C  C     . LYS A 1  705  ? 13.841  -38.324  92.483  1.00 114.56 ? 705  LYS A C     1 
ATOM   5352  O  O     . LYS A 1  705  ? 13.889  -37.445  91.604  1.00 112.78 ? 705  LYS A O     1 
ATOM   5353  C  CB    . LYS A 1  705  ? 12.129  -40.206  92.402  1.00 119.79 ? 705  LYS A CB    1 
ATOM   5354  C  CG    . LYS A 1  705  ? 12.037  -40.265  90.862  1.00 135.99 ? 705  LYS A CG    1 
ATOM   5355  C  CD    . LYS A 1  705  ? 10.603  -40.097  90.330  1.00 145.41 ? 705  LYS A CD    1 
ATOM   5356  C  CE    . LYS A 1  705  ? 10.281  -38.701  89.834  1.00 149.85 ? 705  LYS A CE    1 
ATOM   5357  N  NZ    . LYS A 1  705  ? 8.879   -38.603  89.353  1.00 153.70 ? 705  LYS A NZ    1 
ATOM   5358  N  N     . HIS A 1  706  ? 14.923  -38.905  93.022  1.00 107.64 ? 706  HIS A N     1 
ATOM   5359  C  CA    . HIS A 1  706  ? 16.293  -38.593  92.650  1.00 105.45 ? 706  HIS A CA    1 
ATOM   5360  C  C     . HIS A 1  706  ? 16.459  -38.594  91.131  1.00 105.97 ? 706  HIS A C     1 
ATOM   5361  O  O     . HIS A 1  706  ? 15.905  -39.454  90.459  1.00 105.29 ? 706  HIS A O     1 
ATOM   5362  C  CB    . HIS A 1  706  ? 17.246  -39.605  93.297  1.00 106.26 ? 706  HIS A CB    1 
ATOM   5363  C  CG    . HIS A 1  706  ? 18.688  -39.297  93.058  1.00 109.36 ? 706  HIS A CG    1 
ATOM   5364  N  ND1   . HIS A 1  706  ? 19.402  -38.490  93.916  1.00 111.51 ? 706  HIS A ND1   1 
ATOM   5365  C  CD2   . HIS A 1  706  ? 19.494  -39.677  92.042  1.00 110.61 ? 706  HIS A CD2   1 
ATOM   5366  C  CE1   . HIS A 1  706  ? 20.618  -38.409  93.406  1.00 110.91 ? 706  HIS A CE1   1 
ATOM   5367  N  NE2   . HIS A 1  706  ? 20.722  -39.114  92.280  1.00 110.74 ? 706  HIS A NE2   1 
ATOM   5368  N  N     . GLY A 1  707  ? 17.176  -37.609  90.614  1.00 101.16 ? 707  GLY A N     1 
ATOM   5369  C  CA    . GLY A 1  707  ? 17.459  -37.509  89.189  1.00 100.29 ? 707  GLY A CA    1 
ATOM   5370  C  C     . GLY A 1  707  ? 16.616  -36.553  88.372  1.00 103.29 ? 707  GLY A C     1 
ATOM   5371  O  O     . GLY A 1  707  ? 16.998  -36.229  87.242  1.00 101.70 ? 707  GLY A O     1 
ATOM   5372  N  N     . MET A 1  708  ? 15.459  -36.102  88.907  1.00 100.15 ? 708  MET A N     1 
ATOM   5373  C  CA    . MET A 1  708  ? 14.612  -35.175  88.150  1.00 99.11  ? 708  MET A CA    1 
ATOM   5374  C  C     . MET A 1  708  ? 13.884  -34.061  88.910  1.00 99.41  ? 708  MET A C     1 
ATOM   5375  O  O     . MET A 1  708  ? 13.432  -34.248  90.049  1.00 98.44  ? 708  MET A O     1 
ATOM   5376  C  CB    . MET A 1  708  ? 13.718  -35.880  87.110  1.00 101.35 ? 708  MET A CB    1 
ATOM   5377  C  CG    . MET A 1  708  ? 12.743  -36.865  87.681  1.00 105.93 ? 708  MET A CG    1 
ATOM   5378  S  SD    . MET A 1  708  ? 11.664  -37.421  86.349  1.00 110.13 ? 708  MET A SD    1 
ATOM   5379  C  CE    . MET A 1  708  ? 11.947  -39.176  86.444  1.00 107.53 ? 708  MET A CE    1 
ATOM   5380  N  N     . THR A 1  709  ? 13.774  -32.897  88.221  1.00 93.50  ? 709  THR A N     1 
ATOM   5381  C  CA    . THR A 1  709  ? 13.140  -31.650  88.647  1.00 92.29  ? 709  THR A CA    1 
ATOM   5382  C  C     . THR A 1  709  ? 11.736  -31.910  89.136  1.00 95.31  ? 709  THR A C     1 
ATOM   5383  O  O     . THR A 1  709  ? 11.017  -32.731  88.565  1.00 95.32  ? 709  THR A O     1 
ATOM   5384  C  CB    . THR A 1  709  ? 13.101  -30.654  87.472  1.00 96.26  ? 709  THR A CB    1 
ATOM   5385  O  OG1   . THR A 1  709  ? 14.403  -30.502  86.928  1.00 95.48  ? 709  THR A OG1   1 
ATOM   5386  C  CG2   . THR A 1  709  ? 12.547  -29.301  87.847  1.00 94.54  ? 709  THR A CG2   1 
ATOM   5387  N  N     . LEU A 1  710  ? 11.335  -31.164  90.170  1.00 90.93  ? 710  LEU A N     1 
ATOM   5388  C  CA    . LEU A 1  710  ? 10.008  -31.197  90.763  1.00 89.99  ? 710  LEU A CA    1 
ATOM   5389  C  C     . LEU A 1  710  ? 8.961   -30.955  89.687  1.00 87.57  ? 710  LEU A C     1 
ATOM   5390  O  O     . LEU A 1  710  ? 7.892   -31.569  89.727  1.00 85.91  ? 710  LEU A O     1 
ATOM   5391  C  CB    . LEU A 1  710  ? 9.932   -30.115  91.853  1.00 91.41  ? 710  LEU A CB    1 
ATOM   5392  C  CG    . LEU A 1  710  ? 9.248   -30.491  93.189  1.00 98.18  ? 710  LEU A CG    1 
ATOM   5393  C  CD1   . LEU A 1  710  ? 7.737   -30.568  93.046  1.00 99.31  ? 710  LEU A CD1   1 
ATOM   5394  C  CD2   . LEU A 1  710  ? 9.858   -31.742  93.852  1.00 99.97  ? 710  LEU A CD2   1 
ATOM   5395  N  N     . ARG A 1  711  ? 9.317   -30.112  88.690  1.00 80.79  ? 711  ARG A N     1 
ATOM   5396  C  CA    . ARG A 1  711  ? 8.511   -29.771  87.518  1.00 78.47  ? 711  ARG A CA    1 
ATOM   5397  C  C     . ARG A 1  711  ? 8.568   -30.864  86.454  1.00 79.24  ? 711  ARG A C     1 
ATOM   5398  O  O     . ARG A 1  711  ? 7.549   -31.149  85.831  1.00 77.98  ? 711  ARG A O     1 
ATOM   5399  C  CB    . ARG A 1  711  ? 8.965   -28.439  86.913  1.00 77.07  ? 711  ARG A CB    1 
ATOM   5400  C  CG    . ARG A 1  711  ? 8.798   -27.247  87.831  1.00 85.72  ? 711  ARG A CG    1 
ATOM   5401  C  CD    . ARG A 1  711  ? 9.241   -25.961  87.162  1.00 89.09  ? 711  ARG A CD    1 
ATOM   5402  N  NE    . ARG A 1  711  ? 8.109   -25.093  86.842  1.00 93.03  ? 711  ARG A NE    1 
ATOM   5403  C  CZ    . ARG A 1  711  ? 7.641   -24.142  87.645  1.00 112.61 ? 711  ARG A CZ    1 
ATOM   5404  N  NH1   . ARG A 1  711  ? 8.194   -23.934  88.836  1.00 102.35 ? 711  ARG A NH1   1 
ATOM   5405  N  NH2   . ARG A 1  711  ? 6.617   -23.389  87.264  1.00 99.33  ? 711  ARG A NH2   1 
ATOM   5406  N  N     . GLU A 1  712  ? 9.774   -31.441  86.221  1.00 74.58  ? 712  GLU A N     1 
ATOM   5407  C  CA    . GLU A 1  712  ? 10.056  -32.495  85.237  1.00 73.13  ? 712  GLU A CA    1 
ATOM   5408  C  C     . GLU A 1  712  ? 9.180   -33.678  85.520  1.00 75.20  ? 712  GLU A C     1 
ATOM   5409  O  O     . GLU A 1  712  ? 8.613   -34.270  84.594  1.00 73.64  ? 712  GLU A O     1 
ATOM   5410  C  CB    . GLU A 1  712  ? 11.503  -32.962  85.366  1.00 74.64  ? 712  GLU A CB    1 
ATOM   5411  C  CG    . GLU A 1  712  ? 12.372  -32.696  84.163  1.00 83.18  ? 712  GLU A CG    1 
ATOM   5412  C  CD    . GLU A 1  712  ? 13.827  -32.637  84.569  1.00 104.29 ? 712  GLU A CD    1 
ATOM   5413  O  OE1   . GLU A 1  712  ? 14.416  -31.535  84.483  1.00 98.22  ? 712  GLU A OE1   1 
ATOM   5414  O  OE2   . GLU A 1  712  ? 14.349  -33.659  85.073  1.00 96.37  ? 712  GLU A OE2   1 
ATOM   5415  N  N     . SER A 1  713  ? 9.092   -34.034  86.811  1.00 71.49  ? 713  SER A N     1 
ATOM   5416  C  CA    . SER A 1  713  ? 8.272   -35.136  87.274  1.00 71.72  ? 713  SER A CA    1 
ATOM   5417  C  C     . SER A 1  713  ? 6.808   -34.811  86.974  1.00 75.31  ? 713  SER A C     1 
ATOM   5418  O  O     . SER A 1  713  ? 6.166   -35.584  86.251  1.00 75.63  ? 713  SER A O     1 
ATOM   5419  C  CB    . SER A 1  713  ? 8.506   -35.392  88.754  1.00 76.51  ? 713  SER A CB    1 
ATOM   5420  O  OG    . SER A 1  713  ? 8.583   -34.153  89.433  1.00 93.01  ? 713  SER A OG    1 
ATOM   5421  N  N     . PHE A 1  714  ? 6.327   -33.609  87.394  1.00 69.58  ? 714  PHE A N     1 
ATOM   5422  C  CA    . PHE A 1  714  ? 4.951   -33.159  87.151  1.00 67.54  ? 714  PHE A CA    1 
ATOM   5423  C  C     . PHE A 1  714  ? 4.456   -33.447  85.725  1.00 70.92  ? 714  PHE A C     1 
ATOM   5424  O  O     . PHE A 1  714  ? 3.360   -33.985  85.545  1.00 70.95  ? 714  PHE A O     1 
ATOM   5425  C  CB    . PHE A 1  714  ? 4.807   -31.672  87.460  1.00 68.19  ? 714  PHE A CB    1 
ATOM   5426  C  CG    . PHE A 1  714  ? 3.488   -31.109  87.009  1.00 68.72  ? 714  PHE A CG    1 
ATOM   5427  C  CD1   . PHE A 1  714  ? 2.370   -31.187  87.822  1.00 72.39  ? 714  PHE A CD1   1 
ATOM   5428  C  CD2   . PHE A 1  714  ? 3.355   -30.528  85.758  1.00 69.84  ? 714  PHE A CD2   1 
ATOM   5429  C  CE1   . PHE A 1  714  ? 1.141   -30.688  87.393  1.00 72.97  ? 714  PHE A CE1   1 
ATOM   5430  C  CE2   . PHE A 1  714  ? 2.123   -30.050  85.323  1.00 72.45  ? 714  PHE A CE2   1 
ATOM   5431  C  CZ    . PHE A 1  714  ? 1.029   -30.111  86.154  1.00 70.96  ? 714  PHE A CZ    1 
ATOM   5432  N  N     . GLU A 1  715  ? 5.254   -33.057  84.726  1.00 66.32  ? 715  GLU A N     1 
ATOM   5433  C  CA    . GLU A 1  715  ? 4.919   -33.229  83.326  1.00 65.37  ? 715  GLU A CA    1 
ATOM   5434  C  C     . GLU A 1  715  ? 4.840   -34.683  82.910  1.00 72.42  ? 715  GLU A C     1 
ATOM   5435  O  O     . GLU A 1  715  ? 3.917   -35.038  82.170  1.00 71.73  ? 715  GLU A O     1 
ATOM   5436  C  CB    . GLU A 1  715  ? 5.873   -32.442  82.454  1.00 65.87  ? 715  GLU A CB    1 
ATOM   5437  C  CG    . GLU A 1  715  ? 5.499   -30.976  82.445  1.00 78.64  ? 715  GLU A CG    1 
ATOM   5438  C  CD    . GLU A 1  715  ? 4.398   -30.611  81.470  1.00 90.80  ? 715  GLU A CD    1 
ATOM   5439  O  OE1   . GLU A 1  715  ? 4.497   -31.036  80.293  1.00 69.52  ? 715  GLU A OE1   1 
ATOM   5440  O  OE2   . GLU A 1  715  ? 3.478   -29.852  81.863  1.00 76.13  ? 715  GLU A OE2   1 
ATOM   5441  N  N     . ASP A 1  716  ? 5.760   -35.542  83.424  1.00 70.55  ? 716  ASP A N     1 
ATOM   5442  C  CA    . ASP A 1  716  ? 5.739   -36.974  83.108  1.00 70.53  ? 716  ASP A CA    1 
ATOM   5443  C  C     . ASP A 1  716  ? 4.421   -37.511  83.514  1.00 69.68  ? 716  ASP A C     1 
ATOM   5444  O  O     . ASP A 1  716  ? 3.755   -38.129  82.692  1.00 69.28  ? 716  ASP A O     1 
ATOM   5445  C  CB    . ASP A 1  716  ? 6.839   -37.750  83.843  1.00 74.90  ? 716  ASP A CB    1 
ATOM   5446  C  CG    . ASP A 1  716  ? 8.242   -37.478  83.339  1.00 100.20 ? 716  ASP A CG    1 
ATOM   5447  O  OD1   . ASP A 1  716  ? 9.213   -37.847  84.062  1.00 103.44 ? 716  ASP A OD1   1 
ATOM   5448  O  OD2   . ASP A 1  716  ? 8.381   -36.888  82.213  1.00 106.68 ? 716  ASP A OD2   1 
ATOM   5449  N  N     . ASN A 1  717  ? 4.005   -37.186  84.753  1.00 63.33  ? 717  ASN A N     1 
ATOM   5450  C  CA    . ASN A 1  717  ? 2.732   -37.581  85.330  1.00 62.11  ? 717  ASN A CA    1 
ATOM   5451  C  C     . ASN A 1  717  ? 1.577   -37.170  84.441  1.00 60.87  ? 717  ASN A C     1 
ATOM   5452  O  O     . ASN A 1  717  ? 0.882   -38.053  83.922  1.00 60.40  ? 717  ASN A O     1 
ATOM   5453  C  CB    . ASN A 1  717  ? 2.571   -37.025  86.740  1.00 63.83  ? 717  ASN A CB    1 
ATOM   5454  C  CG    . ASN A 1  717  ? 3.411   -37.745  87.755  1.00 88.99  ? 717  ASN A CG    1 
ATOM   5455  O  OD1   . ASN A 1  717  ? 4.475   -37.269  88.168  1.00 81.12  ? 717  ASN A OD1   1 
ATOM   5456  N  ND2   . ASN A 1  717  ? 2.937   -38.901  88.197  1.00 84.65  ? 717  ASN A ND2   1 
ATOM   5457  N  N     . VAL A 1  718  ? 1.422   -35.855  84.203  1.00 53.37  ? 718  VAL A N     1 
ATOM   5458  C  CA    . VAL A 1  718  ? 0.350   -35.319  83.365  1.00 52.11  ? 718  VAL A CA    1 
ATOM   5459  C  C     . VAL A 1  718  ? 0.312   -35.997  81.986  1.00 57.47  ? 718  VAL A C     1 
ATOM   5460  O  O     . VAL A 1  718  ? -0.685  -36.655  81.640  1.00 56.45  ? 718  VAL A O     1 
ATOM   5461  C  CB    . VAL A 1  718  ? 0.386   -33.774  83.285  1.00 54.42  ? 718  VAL A CB    1 
ATOM   5462  C  CG1   . VAL A 1  718  ? -0.635  -33.243  82.284  1.00 53.18  ? 718  VAL A CG1   1 
ATOM   5463  C  CG2   . VAL A 1  718  ? 0.172   -33.156  84.659  1.00 54.84  ? 718  VAL A CG2   1 
ATOM   5464  N  N     . VAL A 1  719  ? 1.426   -35.890  81.240  1.00 55.21  ? 719  VAL A N     1 
ATOM   5465  C  CA    . VAL A 1  719  ? 1.564   -36.480  79.915  1.00 55.25  ? 719  VAL A CA    1 
ATOM   5466  C  C     . VAL A 1  719  ? 1.238   -37.995  79.878  1.00 58.81  ? 719  VAL A C     1 
ATOM   5467  O  O     . VAL A 1  719  ? 0.562   -38.437  78.953  1.00 56.88  ? 719  VAL A O     1 
ATOM   5468  C  CB    . VAL A 1  719  ? 2.890   -36.045  79.247  1.00 59.81  ? 719  VAL A CB    1 
ATOM   5469  C  CG1   . VAL A 1  719  ? 3.966   -37.125  79.307  1.00 60.18  ? 719  VAL A CG1   1 
ATOM   5470  C  CG2   . VAL A 1  719  ? 2.658   -35.576  77.823  1.00 59.33  ? 719  VAL A CG2   1 
ATOM   5471  N  N     . ARG A 1  720  ? 1.637   -38.747  80.937  1.00 57.47  ? 720  ARG A N     1 
ATOM   5472  C  CA    . ARG A 1  720  ? 1.331   -40.162  81.114  1.00 58.88  ? 720  ARG A CA    1 
ATOM   5473  C  C     . ARG A 1  720  ? -0.194  -40.332  81.248  1.00 63.91  ? 720  ARG A C     1 
ATOM   5474  O  O     . ARG A 1  720  ? -0.784  -41.032  80.420  1.00 62.99  ? 720  ARG A O     1 
ATOM   5475  C  CB    . ARG A 1  720  ? 2.048   -40.738  82.356  1.00 63.77  ? 720  ARG A CB    1 
ATOM   5476  C  CG    . ARG A 1  720  ? 1.854   -42.262  82.552  1.00 83.09  ? 720  ARG A CG    1 
ATOM   5477  C  CD    . ARG A 1  720  ? 2.653   -42.866  83.693  1.00 89.72  ? 720  ARG A CD    1 
ATOM   5478  N  NE    . ARG A 1  720  ? 2.029   -42.600  84.988  1.00 102.40 ? 720  ARG A NE    1 
ATOM   5479  C  CZ    . ARG A 1  720  ? 2.437   -41.655  85.830  1.00 120.92 ? 720  ARG A CZ    1 
ATOM   5480  N  NH1   . ARG A 1  720  ? 3.483   -40.891  85.528  1.00 106.11 ? 720  ARG A NH1   1 
ATOM   5481  N  NH2   . ARG A 1  720  ? 1.813   -41.475  86.988  1.00 110.20 ? 720  ARG A NH2   1 
ATOM   5482  N  N     . PHE A 1  721  ? -0.827  -39.661  82.261  1.00 61.66  ? 721  PHE A N     1 
ATOM   5483  C  CA    . PHE A 1  721  ? -2.279  -39.689  82.528  1.00 62.31  ? 721  PHE A CA    1 
ATOM   5484  C  C     . PHE A 1  721  ? -3.086  -39.405  81.294  1.00 68.54  ? 721  PHE A C     1 
ATOM   5485  O  O     . PHE A 1  721  ? -4.204  -39.923  81.156  1.00 69.44  ? 721  PHE A O     1 
ATOM   5486  C  CB    . PHE A 1  721  ? -2.678  -38.591  83.513  1.00 64.13  ? 721  PHE A CB    1 
ATOM   5487  C  CG    . PHE A 1  721  ? -2.117  -38.658  84.901  1.00 65.85  ? 721  PHE A CG    1 
ATOM   5488  C  CD1   . PHE A 1  721  ? -1.996  -37.506  85.669  1.00 69.16  ? 721  PHE A CD1   1 
ATOM   5489  C  CD2   . PHE A 1  721  ? -1.728  -39.870  85.456  1.00 67.26  ? 721  PHE A CD2   1 
ATOM   5490  C  CE1   . PHE A 1  721  ? -1.472  -37.561  86.954  1.00 70.47  ? 721  PHE A CE1   1 
ATOM   5491  C  CE2   . PHE A 1  721  ? -1.214  -39.926  86.744  1.00 70.85  ? 721  PHE A CE2   1 
ATOM   5492  C  CZ    . PHE A 1  721  ? -1.092  -38.773  87.488  1.00 69.45  ? 721  PHE A CZ    1 
ATOM   5493  N  N     . LEU A 1  722  ? -2.552  -38.489  80.449  1.00 64.67  ? 722  LEU A N     1 
ATOM   5494  C  CA    . LEU A 1  722  ? -3.165  -38.033  79.209  1.00 63.20  ? 722  LEU A CA    1 
ATOM   5495  C  C     . LEU A 1  722  ? -2.979  -39.005  78.066  1.00 65.58  ? 722  LEU A C     1 
ATOM   5496  O  O     . LEU A 1  722  ? -3.812  -39.023  77.159  1.00 66.90  ? 722  LEU A O     1 
ATOM   5497  C  CB    . LEU A 1  722  ? -2.711  -36.608  78.857  1.00 62.34  ? 722  LEU A CB    1 
ATOM   5498  C  CG    . LEU A 1  722  ? -3.711  -35.457  79.092  1.00 67.10  ? 722  LEU A CG    1 
ATOM   5499  C  CD1   . LEU A 1  722  ? -4.715  -35.724  80.241  1.00 68.27  ? 722  LEU A CD1   1 
ATOM   5500  C  CD2   . LEU A 1  722  ? -2.980  -34.184  79.382  1.00 70.24  ? 722  LEU A CD2   1 
ATOM   5501  N  N     . ASN A 1  723  ? -1.919  -39.822  78.094  1.00 59.37  ? 723  ASN A N     1 
ATOM   5502  C  CA    . ASN A 1  723  ? -1.773  -40.813  77.039  1.00 58.63  ? 723  ASN A CA    1 
ATOM   5503  C  C     . ASN A 1  723  ? -2.680  -41.976  77.383  1.00 63.77  ? 723  ASN A C     1 
ATOM   5504  O  O     . ASN A 1  723  ? -3.491  -42.385  76.543  1.00 61.34  ? 723  ASN A O     1 
ATOM   5505  C  CB    . ASN A 1  723  ? -0.329  -41.204  76.818  1.00 57.82  ? 723  ASN A CB    1 
ATOM   5506  C  CG    . ASN A 1  723  ? 0.468   -40.089  76.198  1.00 88.42  ? 723  ASN A CG    1 
ATOM   5507  O  OD1   . ASN A 1  723  ? -0.050  -39.250  75.427  1.00 82.80  ? 723  ASN A OD1   1 
ATOM   5508  N  ND2   . ASN A 1  723  ? 1.746   -40.033  76.548  1.00 83.52  ? 723  ASN A ND2   1 
ATOM   5509  N  N     . GLU A 1  724  ? -2.641  -42.401  78.677  1.00 63.56  ? 724  GLU A N     1 
ATOM   5510  C  CA    . GLU A 1  724  ? -3.514  -43.417  79.267  1.00 64.75  ? 724  GLU A CA    1 
ATOM   5511  C  C     . GLU A 1  724  ? -4.934  -43.092  78.794  1.00 70.41  ? 724  GLU A C     1 
ATOM   5512  O  O     . GLU A 1  724  ? -5.538  -43.928  78.135  1.00 71.73  ? 724  GLU A O     1 
ATOM   5513  C  CB    . GLU A 1  724  ? -3.476  -43.344  80.807  1.00 66.89  ? 724  GLU A CB    1 
ATOM   5514  C  CG    . GLU A 1  724  ? -2.364  -44.115  81.499  1.00 81.06  ? 724  GLU A CG    1 
ATOM   5515  C  CD    . GLU A 1  724  ? -2.378  -44.007  83.018  1.00 119.71 ? 724  GLU A CD    1 
ATOM   5516  O  OE1   . GLU A 1  724  ? -1.365  -44.395  83.645  1.00 130.40 ? 724  GLU A OE1   1 
ATOM   5517  O  OE2   . GLU A 1  724  ? -3.384  -43.511  83.581  1.00 115.78 ? 724  GLU A OE2   1 
ATOM   5518  N  N     . ALA A 1  725  ? -5.410  -41.842  79.024  1.00 66.38  ? 725  ALA A N     1 
ATOM   5519  C  CA    . ALA A 1  725  ? -6.732  -41.374  78.623  1.00 66.43  ? 725  ALA A CA    1 
ATOM   5520  C  C     . ALA A 1  725  ? -7.046  -41.720  77.158  1.00 71.76  ? 725  ALA A C     1 
ATOM   5521  O  O     . ALA A 1  725  ? -7.963  -42.520  76.914  1.00 71.75  ? 725  ALA A O     1 
ATOM   5522  C  CB    . ALA A 1  725  ? -6.853  -39.882  78.863  1.00 66.72  ? 725  ALA A CB    1 
ATOM   5523  N  N     . ARG A 1  726  ? -6.225  -41.193  76.206  1.00 68.07  ? 726  ARG A N     1 
ATOM   5524  C  CA    . ARG A 1  726  ? -6.354  -41.398  74.752  1.00 67.58  ? 726  ARG A CA    1 
ATOM   5525  C  C     . ARG A 1  726  ? -6.434  -42.873  74.386  1.00 72.29  ? 726  ARG A C     1 
ATOM   5526  O  O     . ARG A 1  726  ? -7.341  -43.263  73.646  1.00 71.96  ? 726  ARG A O     1 
ATOM   5527  C  CB    . ARG A 1  726  ? -5.184  -40.725  74.012  1.00 66.34  ? 726  ARG A CB    1 
ATOM   5528  C  CG    . ARG A 1  726  ? -5.082  -41.016  72.507  1.00 71.73  ? 726  ARG A CG    1 
ATOM   5529  C  CD    . ARG A 1  726  ? -3.709  -40.640  71.958  1.00 80.66  ? 726  ARG A CD    1 
ATOM   5530  N  NE    . ARG A 1  726  ? -2.643  -41.458  72.540  1.00 93.42  ? 726  ARG A NE    1 
ATOM   5531  C  CZ    . ARG A 1  726  ? -1.345  -41.284  72.310  1.00 111.87 ? 726  ARG A CZ    1 
ATOM   5532  N  NH1   . ARG A 1  726  ? -0.931  -40.321  71.496  1.00 93.28  ? 726  ARG A NH1   1 
ATOM   5533  N  NH2   . ARG A 1  726  ? -0.451  -42.076  72.891  1.00 107.08 ? 726  ARG A NH2   1 
ATOM   5534  N  N     . ASP A 1  727  ? -5.477  -43.675  74.912  1.00 68.83  ? 727  ASP A N     1 
ATOM   5535  C  CA    . ASP A 1  727  ? -5.341  -45.105  74.667  1.00 68.67  ? 727  ASP A CA    1 
ATOM   5536  C  C     . ASP A 1  727  ? -6.533  -45.853  75.195  1.00 73.11  ? 727  ASP A C     1 
ATOM   5537  O  O     . ASP A 1  727  ? -7.110  -46.658  74.468  1.00 72.90  ? 727  ASP A O     1 
ATOM   5538  C  CB    . ASP A 1  727  ? -4.041  -45.648  75.282  1.00 70.90  ? 727  ASP A CB    1 
ATOM   5539  C  CG    . ASP A 1  727  ? -2.747  -44.986  74.823  1.00 87.88  ? 727  ASP A CG    1 
ATOM   5540  O  OD1   . ASP A 1  727  ? -2.799  -44.130  73.897  1.00 87.35  ? 727  ASP A OD1   1 
ATOM   5541  O  OD2   . ASP A 1  727  ? -1.684  -45.309  75.396  1.00 99.68  ? 727  ASP A OD2   1 
ATOM   5542  N  N     . LYS A 1  728  ? -6.935  -45.559  76.439  1.00 71.04  ? 728  LYS A N     1 
ATOM   5543  C  CA    . LYS A 1  728  ? -8.079  -46.207  77.075  1.00 72.38  ? 728  LYS A CA    1 
ATOM   5544  C  C     . LYS A 1  728  ? -9.348  -45.871  76.324  1.00 77.30  ? 728  LYS A C     1 
ATOM   5545  O  O     . LYS A 1  728  ? -10.117 -46.782  75.996  1.00 77.09  ? 728  LYS A O     1 
ATOM   5546  C  CB    . LYS A 1  728  ? -8.173  -45.856  78.567  1.00 75.46  ? 728  LYS A CB    1 
ATOM   5547  C  CG    . LYS A 1  728  ? -7.367  -46.809  79.453  1.00 87.88  ? 728  LYS A CG    1 
ATOM   5548  C  CD    . LYS A 1  728  ? -6.099  -46.181  80.045  1.00 96.20  ? 728  LYS A CD    1 
ATOM   5549  C  CE    . LYS A 1  728  ? -5.631  -46.811  81.347  1.00 115.25 ? 728  LYS A CE    1 
ATOM   5550  N  NZ    . LYS A 1  728  ? -6.088  -46.059  82.559  1.00 122.16 ? 728  LYS A NZ    1 
ATOM   5551  N  N     . ALA A 1  729  ? -9.506  -44.577  75.950  1.00 74.01  ? 729  ALA A N     1 
ATOM   5552  C  CA    . ALA A 1  729  ? -10.637 -44.077  75.165  1.00 73.44  ? 729  ALA A CA    1 
ATOM   5553  C  C     . ALA A 1  729  ? -10.703 -44.755  73.813  1.00 76.00  ? 729  ALA A C     1 
ATOM   5554  O  O     . ALA A 1  729  ? -11.796 -45.045  73.350  1.00 76.24  ? 729  ALA A O     1 
ATOM   5555  C  CB    . ALA A 1  729  ? -10.527 -42.576  74.981  1.00 73.64  ? 729  ALA A CB    1 
ATOM   5556  N  N     . GLY A 1  730  ? -9.537  -45.013  73.215  1.00 71.81  ? 730  GLY A N     1 
ATOM   5557  C  CA    . GLY A 1  730  ? -9.391  -45.666  71.917  1.00 71.40  ? 730  GLY A CA    1 
ATOM   5558  C  C     . GLY A 1  730  ? -9.721  -47.143  71.936  1.00 75.87  ? 730  GLY A C     1 
ATOM   5559  O  O     . GLY A 1  730  ? -10.379 -47.662  71.024  1.00 74.29  ? 730  GLY A O     1 
ATOM   5560  N  N     . ARG A 1  731  ? -9.239  -47.836  72.973  1.00 74.45  ? 731  ARG A N     1 
ATOM   5561  C  CA    . ARG A 1  731  ? -9.507  -49.264  73.163  1.00 75.27  ? 731  ARG A CA    1 
ATOM   5562  C  C     . ARG A 1  731  ? -11.024 -49.465  73.360  1.00 77.95  ? 731  ARG A C     1 
ATOM   5563  O  O     . ARG A 1  731  ? -11.567 -50.430  72.829  1.00 77.61  ? 731  ARG A O     1 
ATOM   5564  C  CB    . ARG A 1  731  ? -8.662  -49.837  74.315  1.00 76.63  ? 731  ARG A CB    1 
ATOM   5565  C  CG    . ARG A 1  731  ? -7.172  -49.908  73.973  1.00 87.90  ? 731  ARG A CG    1 
ATOM   5566  C  CD    . ARG A 1  731  ? -6.332  -50.506  75.083  1.00 105.42 ? 731  ARG A CD    1 
ATOM   5567  N  NE    . ARG A 1  731  ? -6.122  -49.599  76.215  1.00 118.89 ? 731  ARG A NE    1 
ATOM   5568  C  CZ    . ARG A 1  731  ? -4.991  -48.940  76.446  1.00 135.69 ? 731  ARG A CZ    1 
ATOM   5569  N  NH1   . ARG A 1  731  ? -3.963  -49.056  75.612  1.00 124.69 ? 731  ARG A NH1   1 
ATOM   5570  N  NH2   . ARG A 1  731  ? -4.880  -48.154  77.511  1.00 121.41 ? 731  ARG A NH2   1 
ATOM   5571  N  N     . LEU A 1  732  ? -11.703 -48.482  74.031  1.00 72.88  ? 732  LEU A N     1 
ATOM   5572  C  CA    . LEU A 1  732  ? -13.154 -48.412  74.255  1.00 72.19  ? 732  LEU A CA    1 
ATOM   5573  C  C     . LEU A 1  732  ? -13.882 -48.404  72.915  1.00 75.95  ? 732  LEU A C     1 
ATOM   5574  O  O     . LEU A 1  732  ? -14.870 -49.126  72.762  1.00 77.03  ? 732  LEU A O     1 
ATOM   5575  C  CB    . LEU A 1  732  ? -13.546 -47.125  75.019  1.00 71.54  ? 732  LEU A CB    1 
ATOM   5576  C  CG    . LEU A 1  732  ? -13.707 -47.154  76.539  1.00 75.71  ? 732  LEU A CG    1 
ATOM   5577  C  CD1   . LEU A 1  732  ? -14.166 -45.809  77.028  1.00 75.19  ? 732  LEU A CD1   1 
ATOM   5578  C  CD2   . LEU A 1  732  ? -14.760 -48.147  76.977  1.00 78.50  ? 732  LEU A CD2   1 
ATOM   5579  N  N     . ALA A 1  733  ? -13.393 -47.575  71.954  1.00 70.51  ? 733  ALA A N     1 
ATOM   5580  C  CA    . ALA A 1  733  ? -13.937 -47.417  70.606  1.00 69.23  ? 733  ALA A CA    1 
ATOM   5581  C  C     . ALA A 1  733  ? -13.800 -48.721  69.821  1.00 73.18  ? 733  ALA A C     1 
ATOM   5582  O  O     . ALA A 1  733  ? -14.811 -49.298  69.456  1.00 72.35  ? 733  ALA A O     1 
ATOM   5583  C  CB    . ALA A 1  733  ? -13.222 -46.288  69.891  1.00 68.70  ? 733  ALA A CB    1 
ATOM   5584  N  N     . GLU A 1  734  ? -12.561 -49.220  69.642  1.00 70.75  ? 734  GLU A N     1 
ATOM   5585  C  CA    . GLU A 1  734  ? -12.186 -50.467  68.964  1.00 71.29  ? 734  GLU A CA    1 
ATOM   5586  C  C     . GLU A 1  734  ? -13.110 -51.633  69.367  1.00 77.66  ? 734  GLU A C     1 
ATOM   5587  O  O     . GLU A 1  734  ? -13.623 -52.354  68.506  1.00 78.39  ? 734  GLU A O     1 
ATOM   5588  C  CB    . GLU A 1  734  ? -10.720 -50.773  69.316  1.00 72.64  ? 734  GLU A CB    1 
ATOM   5589  C  CG    . GLU A 1  734  ? -10.055 -51.903  68.554  1.00 87.94  ? 734  GLU A CG    1 
ATOM   5590  C  CD    . GLU A 1  734  ? -8.557  -52.010  68.795  1.00 126.17 ? 734  GLU A CD    1 
ATOM   5591  O  OE1   . GLU A 1  734  ? -8.142  -52.195  69.967  1.00 133.91 ? 734  GLU A OE1   1 
ATOM   5592  O  OE2   . GLU A 1  734  ? -7.798  -51.915  67.801  1.00 119.69 ? 734  GLU A OE2   1 
ATOM   5593  N  N     . VAL A 1  735  ? -13.352 -51.769  70.678  1.00 75.49  ? 735  VAL A N     1 
ATOM   5594  C  CA    . VAL A 1  735  ? -14.222 -52.766  71.326  1.00 76.19  ? 735  VAL A CA    1 
ATOM   5595  C  C     . VAL A 1  735  ? -15.709 -52.639  70.913  1.00 79.04  ? 735  VAL A C     1 
ATOM   5596  O  O     . VAL A 1  735  ? -16.388 -53.655  70.761  1.00 79.60  ? 735  VAL A O     1 
ATOM   5597  C  CB    . VAL A 1  735  ? -14.024 -52.663  72.846  1.00 80.49  ? 735  VAL A CB    1 
ATOM   5598  C  CG1   . VAL A 1  735  ? -15.193 -53.259  73.618  1.00 81.87  ? 735  VAL A CG1   1 
ATOM   5599  C  CG2   . VAL A 1  735  ? -12.703 -53.300  73.253  1.00 80.13  ? 735  VAL A CG2   1 
ATOM   5600  N  N     . ASN A 1  736  ? -16.192 -51.395  70.733  1.00 73.44  ? 736  ASN A N     1 
ATOM   5601  C  CA    . ASN A 1  736  ? -17.554 -51.078  70.302  1.00 72.76  ? 736  ASN A CA    1 
ATOM   5602  C  C     . ASN A 1  736  ? -17.753 -51.281  68.785  1.00 74.95  ? 736  ASN A C     1 
ATOM   5603  O  O     . ASN A 1  736  ? -18.889 -51.209  68.295  1.00 74.52  ? 736  ASN A O     1 
ATOM   5604  C  CB    . ASN A 1  736  ? -17.898 -49.639  70.682  1.00 71.96  ? 736  ASN A CB    1 
ATOM   5605  C  CG    . ASN A 1  736  ? -19.319 -49.237  70.370  1.00 91.50  ? 736  ASN A CG    1 
ATOM   5606  O  OD1   . ASN A 1  736  ? -19.573 -48.307  69.614  1.00 88.14  ? 736  ASN A OD1   1 
ATOM   5607  N  ND2   . ASN A 1  736  ? -20.279 -49.942  70.934  1.00 84.33  ? 736  ASN A ND2   1 
ATOM   5608  N  N     . LEU A 1  737  ? -16.652 -51.506  68.038  1.00 70.17  ? 737  LEU A N     1 
ATOM   5609  C  CA    . LEU A 1  737  ? -16.733 -51.692  66.589  1.00 68.53  ? 737  LEU A CA    1 
ATOM   5610  C  C     . LEU A 1  737  ? -17.186 -53.089  66.295  1.00 74.24  ? 737  LEU A C     1 
ATOM   5611  O  O     . LEU A 1  737  ? -16.675 -54.040  66.902  1.00 76.30  ? 737  LEU A O     1 
ATOM   5612  C  CB    . LEU A 1  737  ? -15.412 -51.376  65.869  1.00 66.46  ? 737  LEU A CB    1 
ATOM   5613  C  CG    . LEU A 1  737  ? -14.821 -49.976  66.081  1.00 68.20  ? 737  LEU A CG    1 
ATOM   5614  C  CD1   . LEU A 1  737  ? -13.608 -49.798  65.228  1.00 67.31  ? 737  LEU A CD1   1 
ATOM   5615  C  CD2   . LEU A 1  737  ? -15.854 -48.852  65.835  1.00 65.41  ? 737  LEU A CD2   1 
ATOM   5616  N  N     . LYS A 1  738  ? -18.186 -53.208  65.406  1.00 68.94  ? 738  LYS A N     1 
ATOM   5617  C  CA    . LYS A 1  738  ? -18.764 -54.483  65.012  1.00 69.23  ? 738  LYS A CA    1 
ATOM   5618  C  C     . LYS A 1  738  ? -17.827 -55.267  64.096  1.00 73.39  ? 738  LYS A C     1 
ATOM   5619  O  O     . LYS A 1  738  ? -16.809 -54.750  63.665  1.00 71.49  ? 738  LYS A O     1 
ATOM   5620  C  CB    . LYS A 1  738  ? -20.095 -54.243  64.313  1.00 71.98  ? 738  LYS A CB    1 
ATOM   5621  C  CG    . LYS A 1  738  ? -21.231 -53.857  65.232  1.00 80.49  ? 738  LYS A CG    1 
ATOM   5622  C  CD    . LYS A 1  738  ? -22.478 -53.526  64.432  1.00 85.08  ? 738  LYS A CD    1 
ATOM   5623  C  CE    . LYS A 1  738  ? -23.519 -52.853  65.264  1.00 91.00  ? 738  LYS A CE    1 
ATOM   5624  N  NZ    . LYS A 1  738  ? -23.219 -51.409  65.438  1.00 101.64 ? 738  LYS A NZ    1 
ATOM   5625  N  N     . ASP A 1  739  ? -18.168 -56.508  63.780  1.00 73.08  ? 739  ASP A N     1 
ATOM   5626  C  CA    . ASP A 1  739  ? -17.314 -57.289  62.900  1.00 73.79  ? 739  ASP A CA    1 
ATOM   5627  C  C     . ASP A 1  739  ? -17.594 -56.901  61.444  1.00 77.02  ? 739  ASP A C     1 
ATOM   5628  O  O     . ASP A 1  739  ? -16.789 -57.204  60.553  1.00 76.79  ? 739  ASP A O     1 
ATOM   5629  C  CB    . ASP A 1  739  ? -17.462 -58.801  63.187  1.00 78.02  ? 739  ASP A CB    1 
ATOM   5630  C  CG    . ASP A 1  739  ? -16.459 -59.411  64.185  1.00 94.27  ? 739  ASP A CG    1 
ATOM   5631  O  OD1   . ASP A 1  739  ? -15.753 -58.636  64.889  1.00 95.64  ? 739  ASP A OD1   1 
ATOM   5632  O  OD2   . ASP A 1  739  ? -16.381 -60.657  64.260  1.00 101.93 ? 739  ASP A OD2   1 
ATOM   5633  N  N     . LEU A 1  740  ? -18.709 -56.153  61.233  1.00 72.25  ? 740  LEU A N     1 
ATOM   5634  C  CA    . LEU A 1  740  ? -19.153 -55.594  59.950  1.00 70.74  ? 740  LEU A CA    1 
ATOM   5635  C  C     . LEU A 1  740  ? -18.578 -54.208  59.698  1.00 71.32  ? 740  LEU A C     1 
ATOM   5636  O  O     . LEU A 1  740  ? -18.823 -53.654  58.615  1.00 70.33  ? 740  LEU A O     1 
ATOM   5637  C  CB    . LEU A 1  740  ? -20.700 -55.535  59.833  1.00 71.74  ? 740  LEU A CB    1 
ATOM   5638  C  CG    . LEU A 1  740  ? -21.498 -54.891  60.983  1.00 77.03  ? 740  LEU A CG    1 
ATOM   5639  C  CD1   . LEU A 1  740  ? -22.508 -53.860  60.476  1.00 75.92  ? 740  LEU A CD1   1 
ATOM   5640  C  CD2   . LEU A 1  740  ? -22.160 -55.974  61.848  1.00 83.60  ? 740  LEU A CD2   1 
ATOM   5641  N  N     . ASN A 1  741  ? -17.863 -53.628  60.713  1.00 66.03  ? 741  ASN A N     1 
ATOM   5642  C  CA    . ASN A 1  741  ? -17.231 -52.300  60.655  1.00 64.28  ? 741  ASN A CA    1 
ATOM   5643  C  C     . ASN A 1  741  ? -16.063 -52.370  59.701  1.00 67.30  ? 741  ASN A C     1 
ATOM   5644  O  O     . ASN A 1  741  ? -15.102 -53.101  59.948  1.00 65.00  ? 741  ASN A O     1 
ATOM   5645  C  CB    . ASN A 1  741  ? -16.794 -51.816  62.032  1.00 63.25  ? 741  ASN A CB    1 
ATOM   5646  C  CG    . ASN A 1  741  ? -16.216 -50.432  62.012  1.00 82.91  ? 741  ASN A CG    1 
ATOM   5647  O  OD1   . ASN A 1  741  ? -16.935 -49.444  62.179  1.00 85.52  ? 741  ASN A OD1   1 
ATOM   5648  N  ND2   . ASN A 1  741  ? -14.915 -50.323  61.790  1.00 66.21  ? 741  ASN A ND2   1 
ATOM   5649  N  N     . ASN A 1  742  ? -16.176 -51.635  58.583  1.00 65.85  ? 742  ASN A N     1 
ATOM   5650  C  CA    . ASN A 1  742  ? -15.220 -51.665  57.474  1.00 65.83  ? 742  ASN A CA    1 
ATOM   5651  C  C     . ASN A 1  742  ? -13.815 -51.264  57.830  1.00 71.17  ? 742  ASN A C     1 
ATOM   5652  O  O     . ASN A 1  742  ? -12.879 -51.723  57.167  1.00 71.06  ? 742  ASN A O     1 
ATOM   5653  C  CB    . ASN A 1  742  ? -15.740 -50.934  56.262  1.00 64.31  ? 742  ASN A CB    1 
ATOM   5654  C  CG    . ASN A 1  742  ? -17.090 -51.427  55.833  1.00 92.06  ? 742  ASN A CG    1 
ATOM   5655  O  OD1   . ASN A 1  742  ? -17.249 -52.545  55.321  1.00 94.58  ? 742  ASN A OD1   1 
ATOM   5656  N  ND2   . ASN A 1  742  ? -18.103 -50.615  56.079  1.00 81.17  ? 742  ASN A ND2   1 
ATOM   5657  N  N     . VAL A 1  743  ? -13.653 -50.468  58.906  1.00 67.64  ? 743  VAL A N     1 
ATOM   5658  C  CA    . VAL A 1  743  ? -12.318 -50.097  59.356  1.00 66.94  ? 743  VAL A CA    1 
ATOM   5659  C  C     . VAL A 1  743  ? -11.745 -51.246  60.154  1.00 69.03  ? 743  VAL A C     1 
ATOM   5660  O  O     . VAL A 1  743  ? -10.618 -51.669  59.876  1.00 68.54  ? 743  VAL A O     1 
ATOM   5661  C  CB    . VAL A 1  743  ? -12.183 -48.743  60.086  1.00 71.15  ? 743  VAL A CB    1 
ATOM   5662  C  CG1   . VAL A 1  743  ? -10.781 -48.179  59.879  1.00 70.25  ? 743  VAL A CG1   1 
ATOM   5663  C  CG2   . VAL A 1  743  ? -13.231 -47.740  59.613  1.00 71.07  ? 743  VAL A CG2   1 
ATOM   5664  N  N     . LYS A 1  744  ? -12.545 -51.788  61.099  1.00 64.69  ? 744  LYS A N     1 
ATOM   5665  C  CA    . LYS A 1  744  ? -12.189 -52.950  61.917  1.00 64.43  ? 744  LYS A CA    1 
ATOM   5666  C  C     . LYS A 1  744  ? -11.810 -54.075  60.957  1.00 68.85  ? 744  LYS A C     1 
ATOM   5667  O  O     . LYS A 1  744  ? -10.749 -54.660  61.128  1.00 68.96  ? 744  LYS A O     1 
ATOM   5668  C  CB    . LYS A 1  744  ? -13.349 -53.351  62.861  1.00 66.91  ? 744  LYS A CB    1 
ATOM   5669  C  CG    . LYS A 1  744  ? -13.143 -54.674  63.613  1.00 79.77  ? 744  LYS A CG    1 
ATOM   5670  C  CD    . LYS A 1  744  ? -13.761 -54.681  65.016  1.00 89.41  ? 744  LYS A CD    1 
ATOM   5671  C  CE    . LYS A 1  744  ? -13.642 -56.031  65.689  1.00 90.28  ? 744  LYS A CE    1 
ATOM   5672  N  NZ    . LYS A 1  744  ? -14.807 -56.328  66.574  1.00 96.74  ? 744  LYS A NZ    1 
ATOM   5673  N  N     . GLN A 1  745  ? -12.613 -54.268  59.884  1.00 65.22  ? 745  GLN A N     1 
ATOM   5674  C  CA    . GLN A 1  745  ? -12.419 -55.262  58.828  1.00 65.34  ? 745  GLN A CA    1 
ATOM   5675  C  C     . GLN A 1  745  ? -11.037 -55.197  58.162  1.00 69.56  ? 745  GLN A C     1 
ATOM   5676  O  O     . GLN A 1  745  ? -10.411 -56.241  57.935  1.00 68.65  ? 745  GLN A O     1 
ATOM   5677  C  CB    . GLN A 1  745  ? -13.529 -55.138  57.771  1.00 66.53  ? 745  GLN A CB    1 
ATOM   5678  C  CG    . GLN A 1  745  ? -14.843 -55.815  58.163  1.00 73.36  ? 745  GLN A CG    1 
ATOM   5679  C  CD    . GLN A 1  745  ? -15.564 -56.361  56.955  1.00 85.01  ? 745  GLN A CD    1 
ATOM   5680  O  OE1   . GLN A 1  745  ? -16.574 -55.810  56.485  1.00 79.58  ? 745  GLN A OE1   1 
ATOM   5681  N  NE2   . GLN A 1  745  ? -15.047 -57.452  56.411  1.00 73.74  ? 745  GLN A NE2   1 
ATOM   5682  N  N     . MET A 1  746  ? -10.570 -53.970  57.840  1.00 66.85  ? 746  MET A N     1 
ATOM   5683  C  CA    . MET A 1  746  ? -9.269  -53.756  57.193  1.00 66.04  ? 746  MET A CA    1 
ATOM   5684  C  C     . MET A 1  746  ? -8.128  -54.028  58.157  1.00 72.24  ? 746  MET A C     1 
ATOM   5685  O  O     . MET A 1  746  ? -7.159  -54.699  57.793  1.00 71.74  ? 746  MET A O     1 
ATOM   5686  C  CB    . MET A 1  746  ? -9.170  -52.361  56.556  1.00 66.68  ? 746  MET A CB    1 
ATOM   5687  C  CG    . MET A 1  746  ? -9.839  -52.290  55.200  1.00 69.21  ? 746  MET A CG    1 
ATOM   5688  S  SD    . MET A 1  746  ? -9.778  -50.664  54.432  1.00 71.32  ? 746  MET A SD    1 
ATOM   5689  C  CE    . MET A 1  746  ? -10.863 -49.817  55.428  1.00 68.17  ? 746  MET A CE    1 
ATOM   5690  N  N     . VAL A 1  747  ? -8.280  -53.544  59.401  1.00 70.19  ? 747  VAL A N     1 
ATOM   5691  C  CA    . VAL A 1  747  ? -7.328  -53.740  60.482  1.00 70.71  ? 747  VAL A CA    1 
ATOM   5692  C  C     . VAL A 1  747  ? -7.197  -55.238  60.743  1.00 76.18  ? 747  VAL A C     1 
ATOM   5693  O  O     . VAL A 1  747  ? -6.072  -55.722  60.790  1.00 76.72  ? 747  VAL A O     1 
ATOM   5694  C  CB    . VAL A 1  747  ? -7.737  -52.945  61.748  1.00 75.43  ? 747  VAL A CB    1 
ATOM   5695  C  CG1   . VAL A 1  747  ? -6.896  -53.339  62.947  1.00 75.74  ? 747  VAL A CG1   1 
ATOM   5696  C  CG2   . VAL A 1  747  ? -7.645  -51.436  61.513  1.00 74.87  ? 747  VAL A CG2   1 
ATOM   5697  N  N     . MET A 1  748  ? -8.335  -55.971  60.852  1.00 73.50  ? 748  MET A N     1 
ATOM   5698  C  CA    . MET A 1  748  ? -8.388  -57.423  61.103  1.00 74.22  ? 748  MET A CA    1 
ATOM   5699  C  C     . MET A 1  748  ? -7.673  -58.209  60.021  1.00 75.70  ? 748  MET A C     1 
ATOM   5700  O  O     . MET A 1  748  ? -6.933  -59.135  60.332  1.00 75.13  ? 748  MET A O     1 
ATOM   5701  C  CB    . MET A 1  748  ? -9.833  -57.932  61.256  1.00 78.17  ? 748  MET A CB    1 
ATOM   5702  C  CG    . MET A 1  748  ? -10.561 -57.420  62.500  1.00 83.30  ? 748  MET A CG    1 
ATOM   5703  S  SD    . MET A 1  748  ? -12.185 -58.192  62.845  1.00 90.28  ? 748  MET A SD    1 
ATOM   5704  C  CE    . MET A 1  748  ? -13.149 -57.787  61.337  1.00 86.58  ? 748  MET A CE    1 
ATOM   5705  N  N     . ALA A 1  749  ? -7.878  -57.832  58.754  1.00 72.34  ? 749  ALA A N     1 
ATOM   5706  C  CA    . ALA A 1  749  ? -7.219  -58.457  57.605  1.00 72.30  ? 749  ALA A CA    1 
ATOM   5707  C  C     . ALA A 1  749  ? -5.728  -58.092  57.635  1.00 77.61  ? 749  ALA A C     1 
ATOM   5708  O  O     . ALA A 1  749  ? -4.874  -58.942  57.374  1.00 77.22  ? 749  ALA A O     1 
ATOM   5709  C  CB    . ALA A 1  749  ? -7.864  -57.976  56.305  1.00 72.30  ? 749  ALA A CB    1 
ATOM   5710  N  N     . GLY A 1  750  ? -5.449  -56.851  58.038  1.00 75.11  ? 750  GLY A N     1 
ATOM   5711  C  CA    . GLY A 1  750  ? -4.112  -56.280  58.116  1.00 75.06  ? 750  GLY A CA    1 
ATOM   5712  C  C     . GLY A 1  750  ? -3.765  -55.611  56.814  1.00 80.44  ? 750  GLY A C     1 
ATOM   5713  O  O     . GLY A 1  750  ? -2.589  -55.418  56.499  1.00 79.77  ? 750  GLY A O     1 
ATOM   5714  N  N     . SER A 1  751  ? -4.813  -55.280  56.045  1.00 79.32  ? 751  SER A N     1 
ATOM   5715  C  CA    . SER A 1  751  ? -4.740  -54.661  54.727  1.00 79.82  ? 751  SER A CA    1 
ATOM   5716  C  C     . SER A 1  751  ? -4.423  -53.176  54.808  1.00 84.06  ? 751  SER A C     1 
ATOM   5717  O  O     . SER A 1  751  ? -3.656  -52.693  53.968  1.00 84.49  ? 751  SER A O     1 
ATOM   5718  C  CB    . SER A 1  751  ? -6.010  -54.935  53.920  1.00 84.62  ? 751  SER A CB    1 
ATOM   5719  O  OG    . SER A 1  751  ? -7.195  -54.519  54.583  1.00 93.81  ? 751  SER A OG    1 
ATOM   5720  N  N     . LYS A 1  752  ? -5.009  -52.463  55.810  1.00 79.32  ? 752  LYS A N     1 
ATOM   5721  C  CA    . LYS A 1  752  ? -4.789  -51.040  56.110  1.00 78.16  ? 752  LYS A CA    1 
ATOM   5722  C  C     . LYS A 1  752  ? -5.234  -50.615  57.503  1.00 83.36  ? 752  LYS A C     1 
ATOM   5723  O  O     . LYS A 1  752  ? -6.232  -51.110  58.042  1.00 83.59  ? 752  LYS A O     1 
ATOM   5724  C  CB    . LYS A 1  752  ? -5.367  -50.081  55.057  1.00 78.78  ? 752  LYS A CB    1 
ATOM   5725  C  CG    . LYS A 1  752  ? -4.329  -49.610  54.051  1.00 86.44  ? 752  LYS A CG    1 
ATOM   5726  C  CD    . LYS A 1  752  ? -3.463  -48.454  54.520  1.00 91.66  ? 752  LYS A CD    1 
ATOM   5727  C  CE    . LYS A 1  752  ? -2.366  -48.147  53.517  1.00 101.99 ? 752  LYS A CE    1 
ATOM   5728  N  NZ    . LYS A 1  752  ? -2.841  -47.360  52.339  1.00 109.68 ? 752  LYS A NZ    1 
ATOM   5729  N  N     . GLY A 1  753  ? -4.475  -49.686  58.065  1.00 79.82  ? 753  GLY A N     1 
ATOM   5730  C  CA    . GLY A 1  753  ? -4.759  -49.109  59.366  1.00 79.91  ? 753  GLY A CA    1 
ATOM   5731  C  C     . GLY A 1  753  ? -4.387  -49.938  60.576  1.00 84.35  ? 753  GLY A C     1 
ATOM   5732  O  O     . GLY A 1  753  ? -4.230  -51.168  60.513  1.00 85.63  ? 753  GLY A O     1 
ATOM   5733  N  N     . SER A 1  754  ? -4.287  -49.227  61.695  1.00 78.59  ? 754  SER A N     1 
ATOM   5734  C  CA    . SER A 1  754  ? -3.937  -49.721  63.002  1.00 78.26  ? 754  SER A CA    1 
ATOM   5735  C  C     . SER A 1  754  ? -4.988  -49.249  64.003  1.00 79.67  ? 754  SER A C     1 
ATOM   5736  O  O     . SER A 1  754  ? -6.009  -48.669  63.620  1.00 78.30  ? 754  SER A O     1 
ATOM   5737  C  CB    . SER A 1  754  ? -2.553  -49.196  63.392  1.00 82.96  ? 754  SER A CB    1 
ATOM   5738  O  OG    . SER A 1  754  ? -2.509  -47.781  63.507  1.00 94.22  ? 754  SER A OG    1 
ATOM   5739  N  N     . PHE A 1  755  ? -4.729  -49.503  65.289  1.00 75.01  ? 755  PHE A N     1 
ATOM   5740  C  CA    . PHE A 1  755  ? -5.591  -49.108  66.382  1.00 74.00  ? 755  PHE A CA    1 
ATOM   5741  C  C     . PHE A 1  755  ? -5.687  -47.599  66.456  1.00 74.29  ? 755  PHE A C     1 
ATOM   5742  O  O     . PHE A 1  755  ? -6.783  -47.067  66.405  1.00 72.95  ? 755  PHE A O     1 
ATOM   5743  C  CB    . PHE A 1  755  ? -5.024  -49.671  67.691  1.00 76.19  ? 755  PHE A CB    1 
ATOM   5744  C  CG    . PHE A 1  755  ? -5.425  -48.956  68.959  1.00 77.38  ? 755  PHE A CG    1 
ATOM   5745  C  CD1   . PHE A 1  755  ? -6.720  -49.053  69.451  1.00 80.89  ? 755  PHE A CD1   1 
ATOM   5746  C  CD2   . PHE A 1  755  ? -4.492  -48.239  69.694  1.00 78.72  ? 755  PHE A CD2   1 
ATOM   5747  C  CE1   . PHE A 1  755  ? -7.075  -48.436  70.642  1.00 81.91  ? 755  PHE A CE1   1 
ATOM   5748  C  CE2   . PHE A 1  755  ? -4.853  -47.614  70.888  1.00 81.87  ? 755  PHE A CE2   1 
ATOM   5749  C  CZ    . PHE A 1  755  ? -6.147  -47.709  71.349  1.00 80.54  ? 755  PHE A CZ    1 
ATOM   5750  N  N     . ILE A 1  756  ? -4.527  -46.920  66.576  1.00 69.38  ? 756  ILE A N     1 
ATOM   5751  C  CA    . ILE A 1  756  ? -4.370  -45.472  66.727  1.00 67.63  ? 756  ILE A CA    1 
ATOM   5752  C  C     . ILE A 1  756  ? -5.300  -44.671  65.822  1.00 68.49  ? 756  ILE A C     1 
ATOM   5753  O  O     . ILE A 1  756  ? -5.857  -43.662  66.247  1.00 66.99  ? 756  ILE A O     1 
ATOM   5754  C  CB    . ILE A 1  756  ? -2.858  -45.091  66.634  1.00 70.39  ? 756  ILE A CB    1 
ATOM   5755  C  CG1   . ILE A 1  756  ? -2.324  -44.317  67.874  1.00 70.91  ? 756  ILE A CG1   1 
ATOM   5756  C  CG2   . ILE A 1  756  ? -2.392  -44.536  65.275  1.00 71.03  ? 756  ILE A CG2   1 
ATOM   5757  C  CD1   . ILE A 1  756  ? -2.776  -42.824  68.106  1.00 76.72  ? 756  ILE A CD1   1 
ATOM   5758  N  N     . ASN A 1  757  ? -5.522  -45.182  64.598  1.00 64.26  ? 757  ASN A N     1 
ATOM   5759  C  CA    . ASN A 1  757  ? -6.385  -44.568  63.593  1.00 63.10  ? 757  ASN A CA    1 
ATOM   5760  C  C     . ASN A 1  757  ? -7.832  -44.590  64.047  1.00 65.84  ? 757  ASN A C     1 
ATOM   5761  O  O     . ASN A 1  757  ? -8.470  -43.540  64.054  1.00 65.13  ? 757  ASN A O     1 
ATOM   5762  C  CB    . ASN A 1  757  ? -6.163  -45.206  62.224  1.00 60.87  ? 757  ASN A CB    1 
ATOM   5763  C  CG    . ASN A 1  757  ? -4.718  -45.101  61.786  1.00 79.53  ? 757  ASN A CG    1 
ATOM   5764  O  OD1   . ASN A 1  757  ? -4.100  -44.028  61.813  1.00 74.48  ? 757  ASN A OD1   1 
ATOM   5765  N  ND2   . ASN A 1  757  ? -4.126  -46.216  61.418  1.00 70.58  ? 757  ASN A ND2   1 
ATOM   5766  N  N     . ILE A 1  758  ? -8.300  -45.755  64.541  1.00 61.49  ? 758  ILE A N     1 
ATOM   5767  C  CA    . ILE A 1  758  ? -9.633  -45.944  65.116  1.00 61.07  ? 758  ILE A CA    1 
ATOM   5768  C  C     . ILE A 1  758  ? -9.757  -44.914  66.250  1.00 65.33  ? 758  ILE A C     1 
ATOM   5769  O  O     . ILE A 1  758  ? -10.642 -44.059  66.219  1.00 65.24  ? 758  ILE A O     1 
ATOM   5770  C  CB    . ILE A 1  758  ? -9.773  -47.399  65.661  1.00 64.28  ? 758  ILE A CB    1 
ATOM   5771  C  CG1   . ILE A 1  758  ? -9.335  -48.507  64.660  1.00 64.04  ? 758  ILE A CG1   1 
ATOM   5772  C  CG2   . ILE A 1  758  ? -11.089 -47.664  66.396  1.00 65.68  ? 758  ILE A CG2   1 
ATOM   5773  C  CD1   . ILE A 1  758  ? -10.270 -48.913  63.582  1.00 67.21  ? 758  ILE A CD1   1 
ATOM   5774  N  N     . ALA A 1  759  ? -8.804  -44.961  67.199  1.00 62.24  ? 759  ALA A N     1 
ATOM   5775  C  CA    . ALA A 1  759  ? -8.722  -44.093  68.367  1.00 62.08  ? 759  ALA A CA    1 
ATOM   5776  C  C     . ALA A 1  759  ? -8.844  -42.589  68.011  1.00 65.75  ? 759  ALA A C     1 
ATOM   5777  O  O     . ALA A 1  759  ? -9.723  -41.896  68.542  1.00 65.23  ? 759  ALA A O     1 
ATOM   5778  C  CB    . ALA A 1  759  ? -7.427  -44.373  69.118  1.00 62.43  ? 759  ALA A CB    1 
ATOM   5779  N  N     . GLN A 1  760  ? -8.010  -42.114  67.068  1.00 61.20  ? 760  GLN A N     1 
ATOM   5780  C  CA    . GLN A 1  760  ? -7.994  -40.710  66.660  1.00 59.85  ? 760  GLN A CA    1 
ATOM   5781  C  C     . GLN A 1  760  ? -9.188  -40.299  65.821  1.00 64.00  ? 760  GLN A C     1 
ATOM   5782  O  O     . GLN A 1  760  ? -9.692  -39.186  65.985  1.00 63.36  ? 760  GLN A O     1 
ATOM   5783  C  CB    . GLN A 1  760  ? -6.681  -40.359  65.970  1.00 59.81  ? 760  GLN A CB    1 
ATOM   5784  C  CG    . GLN A 1  760  ? -5.514  -40.326  66.937  1.00 60.48  ? 760  GLN A CG    1 
ATOM   5785  C  CD    . GLN A 1  760  ? -4.247  -39.982  66.220  1.00 84.40  ? 760  GLN A CD    1 
ATOM   5786  O  OE1   . GLN A 1  760  ? -3.766  -40.724  65.352  1.00 80.48  ? 760  GLN A OE1   1 
ATOM   5787  N  NE2   . GLN A 1  760  ? -3.673  -38.844  66.568  1.00 80.92  ? 760  GLN A NE2   1 
ATOM   5788  N  N     . MET A 1  761  ? -9.654  -41.203  64.947  1.00 61.01  ? 761  MET A N     1 
ATOM   5789  C  CA    . MET A 1  761  ? -10.788 -40.945  64.070  1.00 61.14  ? 761  MET A CA    1 
ATOM   5790  C  C     . MET A 1  761  ? -12.133 -40.946  64.775  1.00 63.30  ? 761  MET A C     1 
ATOM   5791  O  O     . MET A 1  761  ? -12.976 -40.109  64.433  1.00 61.72  ? 761  MET A O     1 
ATOM   5792  C  CB    . MET A 1  761  ? -10.822 -41.931  62.901  1.00 63.99  ? 761  MET A CB    1 
ATOM   5793  C  CG    . MET A 1  761  ? -9.853  -41.598  61.810  1.00 67.50  ? 761  MET A CG    1 
ATOM   5794  S  SD    . MET A 1  761  ? -10.183 -42.464  60.263  1.00 72.42  ? 761  MET A SD    1 
ATOM   5795  C  CE    . MET A 1  761  ? -9.623  -44.152  60.695  1.00 69.49  ? 761  MET A CE    1 
ATOM   5796  N  N     . SER A 1  762  ? -12.356 -41.903  65.711  1.00 59.62  ? 762  SER A N     1 
ATOM   5797  C  CA    . SER A 1  762  ? -13.637 -42.028  66.408  1.00 60.14  ? 762  SER A CA    1 
ATOM   5798  C  C     . SER A 1  762  ? -13.684 -41.608  67.841  1.00 65.34  ? 762  SER A C     1 
ATOM   5799  O  O     . SER A 1  762  ? -14.669 -40.983  68.220  1.00 66.54  ? 762  SER A O     1 
ATOM   5800  C  CB    . SER A 1  762  ? -14.245 -43.417  66.258  1.00 63.39  ? 762  SER A CB    1 
ATOM   5801  O  OG    . SER A 1  762  ? -13.277 -44.433  66.078  1.00 71.98  ? 762  SER A OG    1 
ATOM   5802  N  N     . ALA A 1  763  ? -12.658 -41.924  68.643  1.00 61.69  ? 763  ALA A N     1 
ATOM   5803  C  CA    . ALA A 1  763  ? -12.676 -41.624  70.078  1.00 62.67  ? 763  ALA A CA    1 
ATOM   5804  C  C     . ALA A 1  763  ? -12.124 -40.265  70.541  1.00 69.85  ? 763  ALA A C     1 
ATOM   5805  O  O     . ALA A 1  763  ? -12.893 -39.430  71.041  1.00 70.59  ? 763  ALA A O     1 
ATOM   5806  C  CB    . ALA A 1  763  ? -12.027 -42.758  70.857  1.00 63.60  ? 763  ALA A CB    1 
ATOM   5807  N  N     . CYS A 1  764  ? -10.792 -40.058  70.407  1.00 67.34  ? 764  CYS A N     1 
ATOM   5808  C  CA    . CYS A 1  764  ? -10.060 -38.867  70.868  1.00 67.33  ? 764  CYS A CA    1 
ATOM   5809  C  C     . CYS A 1  764  ? -8.735  -38.769  70.086  1.00 70.62  ? 764  CYS A C     1 
ATOM   5810  O  O     . CYS A 1  764  ? -8.065  -39.800  69.948  1.00 72.04  ? 764  CYS A O     1 
ATOM   5811  C  CB    . CYS A 1  764  ? -9.814  -38.991  72.376  1.00 68.34  ? 764  CYS A CB    1 
ATOM   5812  S  SG    . CYS A 1  764  ? -8.517  -37.909  73.036  1.00 71.79  ? 764  CYS A SG    1 
ATOM   5813  N  N     . VAL A 1  765  ? -8.342  -37.557  69.590  1.00 63.83  ? 765  VAL A N     1 
ATOM   5814  C  CA    . VAL A 1  765  ? -7.070  -37.387  68.854  1.00 61.44  ? 765  VAL A CA    1 
ATOM   5815  C  C     . VAL A 1  765  ? -5.846  -37.605  69.761  1.00 65.50  ? 765  VAL A C     1 
ATOM   5816  O  O     . VAL A 1  765  ? -5.011  -38.469  69.460  1.00 64.87  ? 765  VAL A O     1 
ATOM   5817  C  CB    . VAL A 1  765  ? -7.005  -36.107  67.995  1.00 63.45  ? 765  VAL A CB    1 
ATOM   5818  C  CG1   . VAL A 1  765  ? -5.571  -35.760  67.588  1.00 62.26  ? 765  VAL A CG1   1 
ATOM   5819  C  CG2   . VAL A 1  765  ? -7.898  -36.248  66.769  1.00 63.14  ? 765  VAL A CG2   1 
ATOM   5820  N  N     . GLY A 1  766  ? -5.788  -36.863  70.873  1.00 61.68  ? 766  GLY A N     1 
ATOM   5821  C  CA    . GLY A 1  766  ? -4.728  -37.004  71.865  1.00 60.76  ? 766  GLY A CA    1 
ATOM   5822  C  C     . GLY A 1  766  ? -3.806  -35.826  72.040  1.00 61.98  ? 766  GLY A C     1 
ATOM   5823  O  O     . GLY A 1  766  ? -3.952  -34.790  71.379  1.00 61.50  ? 766  GLY A O     1 
ATOM   5824  N  N     . GLN A 1  767  ? -2.840  -35.993  72.944  1.00 56.81  ? 767  GLN A N     1 
ATOM   5825  C  CA    . GLN A 1  767  ? -1.865  -34.946  73.232  1.00 55.64  ? 767  GLN A CA    1 
ATOM   5826  C  C     . GLN A 1  767  ? -0.850  -34.790  72.087  1.00 58.58  ? 767  GLN A C     1 
ATOM   5827  O  O     . GLN A 1  767  ? -0.284  -35.762  71.557  1.00 55.49  ? 767  GLN A O     1 
ATOM   5828  C  CB    . GLN A 1  767  ? -1.222  -35.117  74.640  1.00 56.81  ? 767  GLN A CB    1 
ATOM   5829  C  CG    . GLN A 1  767  ? -0.125  -34.123  75.050  1.00 52.93  ? 767  GLN A CG    1 
ATOM   5830  C  CD    . GLN A 1  767  ? -0.613  -32.736  75.350  1.00 72.79  ? 767  GLN A CD    1 
ATOM   5831  O  OE1   . GLN A 1  767  ? -1.245  -32.455  76.370  1.00 64.12  ? 767  GLN A OE1   1 
ATOM   5832  N  NE2   . GLN A 1  767  ? -0.244  -31.813  74.499  1.00 80.82  ? 767  GLN A NE2   1 
ATOM   5833  N  N     . GLN A 1  768  ? -0.702  -33.531  71.681  1.00 57.65  ? 768  GLN A N     1 
ATOM   5834  C  CA    . GLN A 1  768  ? 0.211   -33.054  70.653  1.00 57.51  ? 768  GLN A CA    1 
ATOM   5835  C  C     . GLN A 1  768  ? 1.546   -32.668  71.291  1.00 63.05  ? 768  GLN A C     1 
ATOM   5836  O  O     . GLN A 1  768  ? 1.577   -32.150  72.410  1.00 62.31  ? 768  GLN A O     1 
ATOM   5837  C  CB    . GLN A 1  768  ? -0.412  -31.865  69.897  1.00 58.17  ? 768  GLN A CB    1 
ATOM   5838  C  CG    . GLN A 1  768  ? -1.701  -32.212  69.138  1.00 64.38  ? 768  GLN A CG    1 
ATOM   5839  C  CD    . GLN A 1  768  ? -1.537  -33.380  68.186  1.00 87.94  ? 768  GLN A CD    1 
ATOM   5840  O  OE1   . GLN A 1  768  ? -2.340  -34.327  68.190  1.00 85.97  ? 768  GLN A OE1   1 
ATOM   5841  N  NE2   . GLN A 1  768  ? -0.464  -33.372  67.384  1.00 77.59  ? 768  GLN A NE2   1 
ATOM   5842  N  N     . SER A 1  769  ? 2.646   -32.968  70.599  1.00 60.88  ? 769  SER A N     1 
ATOM   5843  C  CA    . SER A 1  769  ? 3.968   -32.637  71.113  1.00 60.99  ? 769  SER A CA    1 
ATOM   5844  C  C     . SER A 1  769  ? 4.819   -31.960  70.063  1.00 64.83  ? 769  SER A C     1 
ATOM   5845  O  O     . SER A 1  769  ? 4.635   -32.186  68.855  1.00 66.13  ? 769  SER A O     1 
ATOM   5846  C  CB    . SER A 1  769  ? 4.678   -33.889  71.623  1.00 64.38  ? 769  SER A CB    1 
ATOM   5847  O  OG    . SER A 1  769  ? 5.475   -34.518  70.630  1.00 69.05  ? 769  SER A OG    1 
ATOM   5848  N  N     . VAL A 1  770  ? 5.770   -31.159  70.537  1.00 59.06  ? 770  VAL A N     1 
ATOM   5849  C  CA    . VAL A 1  770  ? 6.809   -30.492  69.768  1.00 58.33  ? 770  VAL A CA    1 
ATOM   5850  C  C     . VAL A 1  770  ? 8.058   -30.664  70.628  1.00 63.59  ? 770  VAL A C     1 
ATOM   5851  O  O     . VAL A 1  770  ? 8.037   -30.335  71.814  1.00 63.41  ? 770  VAL A O     1 
ATOM   5852  C  CB    . VAL A 1  770  ? 6.510   -29.006  69.452  1.00 61.94  ? 770  VAL A CB    1 
ATOM   5853  C  CG1   . VAL A 1  770  ? 7.754   -28.284  68.933  1.00 61.60  ? 770  VAL A CG1   1 
ATOM   5854  C  CG2   . VAL A 1  770  ? 5.364   -28.869  68.457  1.00 61.59  ? 770  VAL A CG2   1 
ATOM   5855  N  N     . GLU A 1  771  ? 9.114   -31.235  70.041  1.00 61.27  ? 771  GLU A N     1 
ATOM   5856  C  CA    . GLU A 1  771  ? 10.399  -31.496  70.679  1.00 62.03  ? 771  GLU A CA    1 
ATOM   5857  C  C     . GLU A 1  771  ? 10.254  -32.300  71.968  1.00 67.11  ? 771  GLU A C     1 
ATOM   5858  O  O     . GLU A 1  771  ? 10.930  -32.031  72.971  1.00 68.19  ? 771  GLU A O     1 
ATOM   5859  C  CB    . GLU A 1  771  ? 11.192  -30.199  70.915  1.00 63.90  ? 771  GLU A CB    1 
ATOM   5860  C  CG    . GLU A 1  771  ? 11.412  -29.359  69.677  1.00 79.81  ? 771  GLU A CG    1 
ATOM   5861  C  CD    . GLU A 1  771  ? 12.263  -28.131  69.934  1.00 114.35 ? 771  GLU A CD    1 
ATOM   5862  O  OE1   . GLU A 1  771  ? 11.748  -27.000  69.769  1.00 117.70 ? 771  GLU A OE1   1 
ATOM   5863  O  OE2   . GLU A 1  771  ? 13.445  -28.304  70.313  1.00 113.45 ? 771  GLU A OE2   1 
ATOM   5864  N  N     . GLY A 1  772  ? 9.364   -33.269  71.958  1.00 63.72  ? 772  GLY A N     1 
ATOM   5865  C  CA    . GLY A 1  772  ? 9.221   -34.098  73.145  1.00 64.95  ? 772  GLY A CA    1 
ATOM   5866  C  C     . GLY A 1  772  ? 8.247   -33.566  74.163  1.00 70.04  ? 772  GLY A C     1 
ATOM   5867  O  O     . GLY A 1  772  ? 7.397   -34.321  74.638  1.00 72.67  ? 772  GLY A O     1 
ATOM   5868  N  N     . LYS A 1  773  ? 8.341   -32.283  74.497  1.00 63.74  ? 773  LYS A N     1 
ATOM   5869  C  CA    . LYS A 1  773  ? 7.425   -31.665  75.462  1.00 62.60  ? 773  LYS A CA    1 
ATOM   5870  C  C     . LYS A 1  773  ? 6.059   -31.340  74.815  1.00 63.40  ? 773  LYS A C     1 
ATOM   5871  O  O     . LYS A 1  773  ? 5.945   -31.261  73.588  1.00 60.67  ? 773  LYS A O     1 
ATOM   5872  C  CB    . LYS A 1  773  ? 8.033   -30.381  76.094  1.00 64.71  ? 773  LYS A CB    1 
ATOM   5873  C  CG    . LYS A 1  773  ? 9.441   -30.518  76.670  1.00 69.57  ? 773  LYS A CG    1 
ATOM   5874  C  CD    . LYS A 1  773  ? 10.543  -30.021  75.716  1.00 78.37  ? 773  LYS A CD    1 
ATOM   5875  C  CE    . LYS A 1  773  ? 11.942  -30.239  76.258  1.00 91.72  ? 773  LYS A CE    1 
ATOM   5876  N  NZ    . LYS A 1  773  ? 12.204  -29.479  77.523  1.00 97.52  ? 773  LYS A NZ    1 
ATOM   5877  N  N     . ARG A 1  774  ? 5.029   -31.145  75.667  1.00 60.06  ? 774  ARG A N     1 
ATOM   5878  C  CA    . ARG A 1  774  ? 3.698   -30.719  75.245  1.00 59.05  ? 774  ARG A CA    1 
ATOM   5879  C  C     . ARG A 1  774  ? 3.767   -29.239  74.893  1.00 60.00  ? 774  ARG A C     1 
ATOM   5880  O  O     . ARG A 1  774  ? 4.713   -28.579  75.310  1.00 59.83  ? 774  ARG A O     1 
ATOM   5881  C  CB    . ARG A 1  774  ? 2.600   -31.056  76.289  1.00 60.75  ? 774  ARG A CB    1 
ATOM   5882  C  CG    . ARG A 1  774  ? 2.893   -30.751  77.756  1.00 67.55  ? 774  ARG A CG    1 
ATOM   5883  C  CD    . ARG A 1  774  ? 2.051   -31.606  78.719  1.00 68.39  ? 774  ARG A CD    1 
ATOM   5884  N  NE    . ARG A 1  774  ? 0.657   -31.157  78.846  1.00 68.35  ? 774  ARG A NE    1 
ATOM   5885  C  CZ    . ARG A 1  774  ? 0.155   -30.446  79.861  1.00 71.72  ? 774  ARG A CZ    1 
ATOM   5886  N  NH1   . ARG A 1  774  ? 0.931   -30.078  80.882  1.00 27.62  ? 774  ARG A NH1   1 
ATOM   5887  N  NH2   . ARG A 1  774  ? -1.122  -30.090  79.857  1.00 67.99  ? 774  ARG A NH2   1 
ATOM   5888  N  N     . ILE A 1  775  ? 2.825   -28.734  74.084  1.00 55.93  ? 775  ILE A N     1 
ATOM   5889  C  CA    . ILE A 1  775  ? 2.826   -27.346  73.598  1.00 56.57  ? 775  ILE A CA    1 
ATOM   5890  C  C     . ILE A 1  775  ? 3.357   -26.316  74.595  1.00 63.80  ? 775  ILE A C     1 
ATOM   5891  O  O     . ILE A 1  775  ? 2.856   -26.240  75.709  1.00 63.89  ? 775  ILE A O     1 
ATOM   5892  C  CB    . ILE A 1  775  ? 1.495   -26.928  72.935  1.00 59.54  ? 775  ILE A CB    1 
ATOM   5893  C  CG1   . ILE A 1  775  ? 1.127   -27.844  71.760  1.00 59.15  ? 775  ILE A CG1   1 
ATOM   5894  C  CG2   . ILE A 1  775  ? 1.525   -25.456  72.506  1.00 61.21  ? 775  ILE A CG2   1 
ATOM   5895  C  CD1   . ILE A 1  775  ? 2.136   -27.909  70.603  1.00 66.86  ? 775  ILE A CD1   1 
ATOM   5896  N  N     . ALA A 1  776  ? 4.395   -25.552  74.192  1.00 62.55  ? 776  ALA A N     1 
ATOM   5897  C  CA    . ALA A 1  776  ? 5.080   -24.553  75.032  1.00 63.82  ? 776  ALA A CA    1 
ATOM   5898  C  C     . ALA A 1  776  ? 4.544   -23.120  74.977  1.00 68.61  ? 776  ALA A C     1 
ATOM   5899  O  O     . ALA A 1  776  ? 3.897   -22.731  74.006  1.00 67.89  ? 776  ALA A O     1 
ATOM   5900  C  CB    . ALA A 1  776  ? 6.576   -24.555  74.731  1.00 64.74  ? 776  ALA A CB    1 
ATOM   5901  N  N     . PHE A 1  777  ? 4.862   -22.331  76.019  1.00 66.15  ? 777  PHE A N     1 
ATOM   5902  C  CA    . PHE A 1  777  ? 4.489   -20.929  76.133  1.00 66.84  ? 777  PHE A CA    1 
ATOM   5903  C  C     . PHE A 1  777  ? 5.309   -20.050  75.140  1.00 67.70  ? 777  PHE A C     1 
ATOM   5904  O  O     . PHE A 1  777  ? 6.354   -19.498  75.516  1.00 67.57  ? 777  PHE A O     1 
ATOM   5905  C  CB    . PHE A 1  777  ? 4.686   -20.443  77.588  1.00 70.50  ? 777  PHE A CB    1 
ATOM   5906  C  CG    . PHE A 1  777  ? 3.990   -21.254  78.659  1.00 74.06  ? 777  PHE A CG    1 
ATOM   5907  C  CD1   . PHE A 1  777  ? 2.694   -20.956  79.048  1.00 78.38  ? 777  PHE A CD1   1 
ATOM   5908  C  CD2   . PHE A 1  777  ? 4.634   -22.309  79.284  1.00 78.67  ? 777  PHE A CD2   1 
ATOM   5909  C  CE1   . PHE A 1  777  ? 2.063   -21.654  80.079  1.00 79.84  ? 777  PHE A CE1   1 
ATOM   5910  C  CE2   . PHE A 1  777  ? 3.986   -23.044  80.287  1.00 82.54  ? 777  PHE A CE2   1 
ATOM   5911  C  CZ    . PHE A 1  777  ? 2.702   -22.707  80.676  1.00 80.32  ? 777  PHE A CZ    1 
ATOM   5912  N  N     . GLY A 1  778  ? 4.834   -19.949  73.892  1.00 61.36  ? 778  GLY A N     1 
ATOM   5913  C  CA    . GLY A 1  778  ? 5.435   -19.104  72.857  1.00 60.36  ? 778  GLY A CA    1 
ATOM   5914  C  C     . GLY A 1  778  ? 5.160   -17.645  73.165  1.00 63.88  ? 778  GLY A C     1 
ATOM   5915  O  O     . GLY A 1  778  ? 6.025   -16.778  72.992  1.00 64.89  ? 778  GLY A O     1 
ATOM   5916  N  N     . PHE A 1  779  ? 3.946   -17.388  73.682  1.00 58.17  ? 779  PHE A N     1 
ATOM   5917  C  CA    . PHE A 1  779  ? 3.515   -16.115  74.227  1.00 57.28  ? 779  PHE A CA    1 
ATOM   5918  C  C     . PHE A 1  779  ? 3.975   -16.104  75.695  1.00 65.78  ? 779  PHE A C     1 
ATOM   5919  O  O     . PHE A 1  779  ? 4.195   -17.179  76.287  1.00 66.85  ? 779  PHE A O     1 
ATOM   5920  C  CB    . PHE A 1  779  ? 2.000   -16.001  74.142  1.00 57.74  ? 779  PHE A CB    1 
ATOM   5921  C  CG    . PHE A 1  779  ? 1.520   -15.807  72.733  1.00 57.65  ? 779  PHE A CG    1 
ATOM   5922  C  CD1   . PHE A 1  779  ? 0.914   -16.843  72.043  1.00 59.22  ? 779  PHE A CD1   1 
ATOM   5923  C  CD2   . PHE A 1  779  ? 1.710   -14.595  72.077  1.00 58.55  ? 779  PHE A CD2   1 
ATOM   5924  C  CE1   . PHE A 1  779  ? 0.496   -16.668  70.728  1.00 58.89  ? 779  PHE A CE1   1 
ATOM   5925  C  CE2   . PHE A 1  779  ? 1.298   -14.425  70.761  1.00 60.01  ? 779  PHE A CE2   1 
ATOM   5926  C  CZ    . PHE A 1  779  ? 0.674   -15.453  70.105  1.00 57.51  ? 779  PHE A CZ    1 
ATOM   5927  N  N     . VAL A 1  780  ? 4.143   -14.910  76.293  1.00 63.33  ? 780  VAL A N     1 
ATOM   5928  C  CA    . VAL A 1  780  ? 4.639   -14.848  77.667  1.00 63.34  ? 780  VAL A CA    1 
ATOM   5929  C  C     . VAL A 1  780  ? 3.665   -15.522  78.607  1.00 69.59  ? 780  VAL A C     1 
ATOM   5930  O  O     . VAL A 1  780  ? 2.513   -15.085  78.690  1.00 72.23  ? 780  VAL A O     1 
ATOM   5931  C  CB    . VAL A 1  780  ? 5.055   -13.433  78.117  1.00 66.78  ? 780  VAL A CB    1 
ATOM   5932  C  CG1   . VAL A 1  780  ? 5.385   -13.404  79.602  1.00 67.20  ? 780  VAL A CG1   1 
ATOM   5933  C  CG2   . VAL A 1  780  ? 6.250   -12.953  77.315  1.00 66.41  ? 780  VAL A CG2   1 
ATOM   5934  N  N     . ASP A 1  781  ? 4.107   -16.648  79.223  1.00 63.38  ? 781  ASP A N     1 
ATOM   5935  C  CA    . ASP A 1  781  ? 3.359   -17.455  80.188  1.00 62.56  ? 781  ASP A CA    1 
ATOM   5936  C  C     . ASP A 1  781  ? 2.004   -18.015  79.704  1.00 64.48  ? 781  ASP A C     1 
ATOM   5937  O  O     . ASP A 1  781  ? 1.194   -18.505  80.505  1.00 65.19  ? 781  ASP A O     1 
ATOM   5938  C  CB    . ASP A 1  781  ? 3.274   -16.769  81.560  1.00 65.78  ? 781  ASP A CB    1 
ATOM   5939  C  CG    . ASP A 1  781  ? 4.605   -16.397  82.214  1.00 82.12  ? 781  ASP A CG    1 
ATOM   5940  O  OD1   . ASP A 1  781  ? 5.653   -16.983  81.820  1.00 81.11  ? 781  ASP A OD1   1 
ATOM   5941  O  OD2   . ASP A 1  781  ? 4.594   -15.537  83.153  1.00 92.18  ? 781  ASP A OD2   1 
ATOM   5942  N  N     . ARG A 1  782  ? 1.804   -18.038  78.375  1.00 57.66  ? 782  ARG A N     1 
ATOM   5943  C  CA    . ARG A 1  782  ? 0.637   -18.670  77.771  1.00 56.32  ? 782  ARG A CA    1 
ATOM   5944  C  C     . ARG A 1  782  ? 0.983   -19.295  76.399  1.00 59.41  ? 782  ARG A C     1 
ATOM   5945  O  O     . ARG A 1  782  ? 1.947   -18.852  75.778  1.00 57.60  ? 782  ARG A O     1 
ATOM   5946  C  CB    . ARG A 1  782  ? -0.598  -17.751  77.779  1.00 53.93  ? 782  ARG A CB    1 
ATOM   5947  C  CG    . ARG A 1  782  ? -0.456  -16.485  77.004  1.00 49.60  ? 782  ARG A CG    1 
ATOM   5948  C  CD    . ARG A 1  782  ? -0.667  -15.318  77.895  1.00 51.68  ? 782  ARG A CD    1 
ATOM   5949  N  NE    . ARG A 1  782  ? -0.658  -14.074  77.129  1.00 59.62  ? 782  ARG A NE    1 
ATOM   5950  C  CZ    . ARG A 1  782  ? -1.756  -13.465  76.680  1.00 78.10  ? 782  ARG A CZ    1 
ATOM   5951  N  NH1   . ARG A 1  782  ? -2.962  -13.971  76.933  1.00 47.64  ? 782  ARG A NH1   1 
ATOM   5952  N  NH2   . ARG A 1  782  ? -1.659  -12.338  75.993  1.00 83.37  ? 782  ARG A NH2   1 
ATOM   5953  N  N     . THR A 1  783  ? 0.252   -20.359  75.958  1.00 56.75  ? 783  THR A N     1 
ATOM   5954  C  CA    . THR A 1  783  ? 0.489   -20.994  74.629  1.00 56.34  ? 783  THR A CA    1 
ATOM   5955  C  C     . THR A 1  783  ? -0.157  -20.196  73.466  1.00 58.43  ? 783  THR A C     1 
ATOM   5956  O  O     . THR A 1  783  ? 0.322   -20.222  72.326  1.00 56.00  ? 783  THR A O     1 
ATOM   5957  C  CB    . THR A 1  783  ? 0.021   -22.462  74.590  1.00 66.10  ? 783  THR A CB    1 
ATOM   5958  O  OG1   . THR A 1  783  ? -1.305  -22.543  75.094  1.00 65.18  ? 783  THR A OG1   1 
ATOM   5959  C  CG2   . THR A 1  783  ? 0.915   -23.382  75.385  1.00 67.83  ? 783  THR A CG2   1 
ATOM   5960  N  N     . LEU A 1  784  ? -1.277  -19.529  73.776  1.00 55.35  ? 784  LEU A N     1 
ATOM   5961  C  CA    . LEU A 1  784  ? -2.066  -18.696  72.877  1.00 54.80  ? 784  LEU A CA    1 
ATOM   5962  C  C     . LEU A 1  784  ? -2.574  -17.489  73.664  1.00 59.36  ? 784  LEU A C     1 
ATOM   5963  O  O     . LEU A 1  784  ? -2.646  -17.582  74.904  1.00 58.98  ? 784  LEU A O     1 
ATOM   5964  C  CB    . LEU A 1  784  ? -3.249  -19.480  72.290  1.00 54.33  ? 784  LEU A CB    1 
ATOM   5965  C  CG    . LEU A 1  784  ? -2.930  -20.475  71.202  1.00 58.52  ? 784  LEU A CG    1 
ATOM   5966  C  CD1   . LEU A 1  784  ? -4.130  -21.287  70.897  1.00 59.30  ? 784  LEU A CD1   1 
ATOM   5967  C  CD2   . LEU A 1  784  ? -2.437  -19.792  69.928  1.00 60.55  ? 784  LEU A CD2   1 
ATOM   5968  N  N     . PRO A 1  785  ? -2.955  -16.364  72.984  1.00 55.16  ? 785  PRO A N     1 
ATOM   5969  C  CA    . PRO A 1  785  ? -3.457  -15.189  73.731  1.00 55.55  ? 785  PRO A CA    1 
ATOM   5970  C  C     . PRO A 1  785  ? -4.928  -15.319  74.200  1.00 59.79  ? 785  PRO A C     1 
ATOM   5971  O  O     . PRO A 1  785  ? -5.549  -14.351  74.621  1.00 60.78  ? 785  PRO A O     1 
ATOM   5972  C  CB    . PRO A 1  785  ? -3.244  -14.047  72.740  1.00 56.75  ? 785  PRO A CB    1 
ATOM   5973  C  CG    . PRO A 1  785  ? -3.402  -14.694  71.404  1.00 59.94  ? 785  PRO A CG    1 
ATOM   5974  C  CD    . PRO A 1  785  ? -2.931  -16.103  71.528  1.00 54.98  ? 785  PRO A CD    1 
ATOM   5975  N  N     . HIS A 1  786  ? -5.461  -16.523  74.147  1.00 55.30  ? 786  HIS A N     1 
ATOM   5976  C  CA    . HIS A 1  786  ? -6.829  -16.830  74.497  1.00 56.27  ? 786  HIS A CA    1 
ATOM   5977  C  C     . HIS A 1  786  ? -6.868  -17.437  75.862  1.00 64.22  ? 786  HIS A C     1 
ATOM   5978  O  O     . HIS A 1  786  ? -7.948  -17.751  76.388  1.00 65.56  ? 786  HIS A O     1 
ATOM   5979  C  CB    . HIS A 1  786  ? -7.381  -17.816  73.470  1.00 56.41  ? 786  HIS A CB    1 
ATOM   5980  C  CG    . HIS A 1  786  ? -7.186  -17.339  72.069  1.00 59.14  ? 786  HIS A CG    1 
ATOM   5981  N  ND1   . HIS A 1  786  ? -8.161  -16.612  71.416  1.00 61.09  ? 786  HIS A ND1   1 
ATOM   5982  C  CD2   . HIS A 1  786  ? -6.102  -17.438  71.269  1.00 60.26  ? 786  HIS A CD2   1 
ATOM   5983  C  CE1   . HIS A 1  786  ? -7.645  -16.300  70.246  1.00 60.26  ? 786  HIS A CE1   1 
ATOM   5984  N  NE2   . HIS A 1  786  ? -6.407  -16.766  70.115  1.00 60.21  ? 786  HIS A NE2   1 
ATOM   5985  N  N     . PHE A 1  787  ? -5.672  -17.624  76.430  1.00 61.12  ? 787  PHE A N     1 
ATOM   5986  C  CA    . PHE A 1  787  ? -5.473  -18.216  77.739  1.00 61.13  ? 787  PHE A CA    1 
ATOM   5987  C  C     . PHE A 1  787  ? -4.891  -17.202  78.697  1.00 66.55  ? 787  PHE A C     1 
ATOM   5988  O  O     . PHE A 1  787  ? -4.310  -16.180  78.288  1.00 66.20  ? 787  PHE A O     1 
ATOM   5989  C  CB    . PHE A 1  787  ? -4.509  -19.418  77.654  1.00 61.93  ? 787  PHE A CB    1 
ATOM   5990  C  CG    . PHE A 1  787  ? -4.979  -20.565  76.809  1.00 63.14  ? 787  PHE A CG    1 
ATOM   5991  C  CD1   . PHE A 1  787  ? -4.175  -21.078  75.803  1.00 66.56  ? 787  PHE A CD1   1 
ATOM   5992  C  CD2   . PHE A 1  787  ? -6.225  -21.141  77.020  1.00 65.28  ? 787  PHE A CD2   1 
ATOM   5993  C  CE1   . PHE A 1  787  ? -4.614  -22.141  75.008  1.00 66.70  ? 787  PHE A CE1   1 
ATOM   5994  C  CE2   . PHE A 1  787  ? -6.660  -22.196  76.231  1.00 68.06  ? 787  PHE A CE2   1 
ATOM   5995  C  CZ    . PHE A 1  787  ? -5.849  -22.690  75.228  1.00 65.89  ? 787  PHE A CZ    1 
ATOM   5996  N  N     . SER A 1  788  ? -4.994  -17.539  79.988  1.00 62.92  ? 788  SER A N     1 
ATOM   5997  C  CA    . SER A 1  788  ? -4.407  -16.773  81.053  1.00 62.23  ? 788  SER A CA    1 
ATOM   5998  C  C     . SER A 1  788  ? -2.954  -17.203  81.208  1.00 65.48  ? 788  SER A C     1 
ATOM   5999  O  O     . SER A 1  788  ? -2.493  -18.220  80.655  1.00 63.13  ? 788  SER A O     1 
ATOM   6000  C  CB    . SER A 1  788  ? -5.174  -16.995  82.347  1.00 65.74  ? 788  SER A CB    1 
ATOM   6001  O  OG    . SER A 1  788  ? -6.386  -16.264  82.326  1.00 77.32  ? 788  SER A OG    1 
ATOM   6002  N  N     . LYS A 1  789  ? -2.226  -16.415  81.973  1.00 63.87  ? 789  LYS A N     1 
ATOM   6003  C  CA    . LYS A 1  789  ? -0.840  -16.713  82.229  1.00 63.30  ? 789  LYS A CA    1 
ATOM   6004  C  C     . LYS A 1  789  ? -0.705  -17.918  83.185  1.00 70.38  ? 789  LYS A C     1 
ATOM   6005  O  O     . LYS A 1  789  ? -1.632  -18.233  83.953  1.00 70.62  ? 789  LYS A O     1 
ATOM   6006  C  CB    . LYS A 1  789  ? -0.081  -15.452  82.666  1.00 63.55  ? 789  LYS A CB    1 
ATOM   6007  C  CG    . LYS A 1  789  ? 0.283   -14.563  81.475  1.00 52.99  ? 789  LYS A CG    1 
ATOM   6008  C  CD    . LYS A 1  789  ? 0.888   -13.241  81.911  1.00 63.44  ? 789  LYS A CD    1 
ATOM   6009  C  CE    . LYS A 1  789  ? 1.886   -12.660  80.944  1.00 72.63  ? 789  LYS A CE    1 
ATOM   6010  N  NZ    . LYS A 1  789  ? 1.290   -12.342  79.617  1.00 85.51  ? 789  LYS A NZ    1 
ATOM   6011  N  N     . ASP A 1  790  ? 0.413   -18.649  83.039  1.00 67.64  ? 790  ASP A N     1 
ATOM   6012  C  CA    . ASP A 1  790  ? 0.776   -19.811  83.840  1.00 67.58  ? 790  ASP A CA    1 
ATOM   6013  C  C     . ASP A 1  790  ? -0.333  -20.911  83.895  1.00 72.50  ? 790  ASP A C     1 
ATOM   6014  O  O     . ASP A 1  790  ? -0.598  -21.464  84.967  1.00 74.13  ? 790  ASP A O     1 
ATOM   6015  C  CB    . ASP A 1  790  ? 1.294   -19.362  85.235  1.00 69.72  ? 790  ASP A CB    1 
ATOM   6016  C  CG    . ASP A 1  790  ? 2.574   -18.527  85.214  1.00 77.53  ? 790  ASP A CG    1 
ATOM   6017  O  OD1   . ASP A 1  790  ? 2.501   -17.312  85.534  1.00 77.66  ? 790  ASP A OD1   1 
ATOM   6018  O  OD2   . ASP A 1  790  ? 3.659   -19.099  84.925  1.00 83.01  ? 790  ASP A OD2   1 
ATOM   6019  N  N     . ASP A 1  791  ? -0.965  -21.230  82.731  1.00 67.38  ? 791  ASP A N     1 
ATOM   6020  C  CA    . ASP A 1  791  ? -1.992  -22.287  82.620  1.00 66.45  ? 791  ASP A CA    1 
ATOM   6021  C  C     . ASP A 1  791  ? -1.375  -23.619  82.090  1.00 68.33  ? 791  ASP A C     1 
ATOM   6022  O  O     . ASP A 1  791  ? -1.009  -23.714  80.920  1.00 67.18  ? 791  ASP A O     1 
ATOM   6023  C  CB    . ASP A 1  791  ? -3.211  -21.823  81.778  1.00 67.86  ? 791  ASP A CB    1 
ATOM   6024  C  CG    . ASP A 1  791  ? -4.373  -22.815  81.667  1.00 75.37  ? 791  ASP A CG    1 
ATOM   6025  O  OD1   . ASP A 1  791  ? -4.377  -23.825  82.414  1.00 77.85  ? 791  ASP A OD1   1 
ATOM   6026  O  OD2   . ASP A 1  791  ? -5.295  -22.564  80.861  1.00 75.70  ? 791  ASP A OD2   1 
ATOM   6027  N  N     . TYR A 1  792  ? -1.283  -24.644  82.957  1.00 64.00  ? 792  TYR A N     1 
ATOM   6028  C  CA    . TYR A 1  792  ? -0.662  -25.926  82.612  1.00 62.67  ? 792  TYR A CA    1 
ATOM   6029  C  C     . TYR A 1  792  ? -1.643  -27.074  82.306  1.00 65.93  ? 792  TYR A C     1 
ATOM   6030  O  O     . TYR A 1  792  ? -1.235  -28.242  82.192  1.00 64.46  ? 792  TYR A O     1 
ATOM   6031  C  CB    . TYR A 1  792  ? 0.362   -26.302  83.689  1.00 63.72  ? 792  TYR A CB    1 
ATOM   6032  C  CG    . TYR A 1  792  ? 1.555   -25.369  83.745  1.00 65.37  ? 792  TYR A CG    1 
ATOM   6033  C  CD1   . TYR A 1  792  ? 1.524   -24.207  84.516  1.00 67.90  ? 792  TYR A CD1   1 
ATOM   6034  C  CD2   . TYR A 1  792  ? 2.730   -25.666  83.059  1.00 65.95  ? 792  TYR A CD2   1 
ATOM   6035  C  CE1   . TYR A 1  792  ? 2.627   -23.356  84.587  1.00 69.31  ? 792  TYR A CE1   1 
ATOM   6036  C  CE2   . TYR A 1  792  ? 3.850   -24.839  83.148  1.00 67.16  ? 792  TYR A CE2   1 
ATOM   6037  C  CZ    . TYR A 1  792  ? 3.787   -23.675  83.896  1.00 77.42  ? 792  TYR A CZ    1 
ATOM   6038  O  OH    . TYR A 1  792  ? 4.880   -22.848  83.954  1.00 81.38  ? 792  TYR A OH    1 
ATOM   6039  N  N     . SER A 1  793  ? -2.926  -26.710  82.101  1.00 62.75  ? 793  SER A N     1 
ATOM   6040  C  CA    . SER A 1  793  ? -4.045  -27.610  81.833  1.00 62.27  ? 793  SER A CA    1 
ATOM   6041  C  C     . SER A 1  793  ? -3.910  -28.381  80.549  1.00 66.09  ? 793  SER A C     1 
ATOM   6042  O  O     . SER A 1  793  ? -3.316  -27.854  79.615  1.00 65.36  ? 793  SER A O     1 
ATOM   6043  C  CB    . SER A 1  793  ? -5.367  -26.849  81.844  1.00 65.81  ? 793  SER A CB    1 
ATOM   6044  O  OG    . SER A 1  793  ? -5.416  -25.795  80.899  1.00 74.47  ? 793  SER A OG    1 
ATOM   6045  N  N     . PRO A 1  794  ? -4.479  -29.614  80.471  1.00 64.20  ? 794  PRO A N     1 
ATOM   6046  C  CA    . PRO A 1  794  ? -4.397  -30.413  79.220  1.00 63.58  ? 794  PRO A CA    1 
ATOM   6047  C  C     . PRO A 1  794  ? -4.533  -29.610  77.925  1.00 64.76  ? 794  PRO A C     1 
ATOM   6048  O  O     . PRO A 1  794  ? -3.628  -29.642  77.086  1.00 62.74  ? 794  PRO A O     1 
ATOM   6049  C  CB    . PRO A 1  794  ? -5.564  -31.401  79.368  1.00 66.07  ? 794  PRO A CB    1 
ATOM   6050  C  CG    . PRO A 1  794  ? -5.707  -31.591  80.843  1.00 71.42  ? 794  PRO A CG    1 
ATOM   6051  C  CD    . PRO A 1  794  ? -5.204  -30.354  81.533  1.00 66.80  ? 794  PRO A CD    1 
ATOM   6052  N  N     . GLU A 1  795  ? -5.674  -28.872  77.812  1.00 61.05  ? 795  GLU A N     1 
ATOM   6053  C  CA    . GLU A 1  795  ? -6.136  -27.977  76.735  1.00 59.54  ? 795  GLU A CA    1 
ATOM   6054  C  C     . GLU A 1  795  ? -5.132  -26.870  76.411  1.00 59.22  ? 795  GLU A C     1 
ATOM   6055  O  O     . GLU A 1  795  ? -4.751  -26.716  75.246  1.00 58.54  ? 795  GLU A O     1 
ATOM   6056  C  CB    . GLU A 1  795  ? -7.568  -27.407  77.020  1.00 61.37  ? 795  GLU A CB    1 
ATOM   6057  C  CG    . GLU A 1  795  ? -7.789  -26.744  78.383  1.00 76.26  ? 795  GLU A CG    1 
ATOM   6058  C  CD    . GLU A 1  795  ? -8.082  -27.566  79.642  1.00 104.19 ? 795  GLU A CD    1 
ATOM   6059  O  OE1   . GLU A 1  795  ? -7.854  -28.802  79.664  1.00 82.42  ? 795  GLU A OE1   1 
ATOM   6060  O  OE2   . GLU A 1  795  ? -8.508  -26.938  80.641  1.00 101.11 ? 795  GLU A OE2   1 
ATOM   6061  N  N     . SER A 1  796  ? -4.683  -26.137  77.441  1.00 53.13  ? 796  SER A N     1 
ATOM   6062  C  CA    . SER A 1  796  ? -3.716  -25.061  77.331  1.00 52.32  ? 796  SER A CA    1 
ATOM   6063  C  C     . SER A 1  796  ? -2.439  -25.537  76.667  1.00 56.41  ? 796  SER A C     1 
ATOM   6064  O  O     . SER A 1  796  ? -1.934  -24.854  75.790  1.00 57.53  ? 796  SER A O     1 
ATOM   6065  C  CB    . SER A 1  796  ? -3.378  -24.514  78.705  1.00 56.11  ? 796  SER A CB    1 
ATOM   6066  O  OG    . SER A 1  796  ? -2.361  -23.537  78.590  1.00 66.00  ? 796  SER A OG    1 
ATOM   6067  N  N     . LYS A 1  797  ? -1.933  -26.706  77.045  1.00 51.20  ? 797  LYS A N     1 
ATOM   6068  C  CA    . LYS A 1  797  ? -0.698  -27.223  76.468  1.00 49.64  ? 797  LYS A CA    1 
ATOM   6069  C  C     . LYS A 1  797  ? -0.835  -28.319  75.356  1.00 50.88  ? 797  LYS A C     1 
ATOM   6070  O  O     . LYS A 1  797  ? -0.026  -29.241  75.274  1.00 49.51  ? 797  LYS A O     1 
ATOM   6071  C  CB    . LYS A 1  797  ? 0.315   -27.563  77.573  1.00 52.31  ? 797  LYS A CB    1 
ATOM   6072  C  CG    . LYS A 1  797  ? 0.725   -26.353  78.435  1.00 56.34  ? 797  LYS A CG    1 
ATOM   6073  C  CD    . LYS A 1  797  ? 1.786   -26.689  79.495  1.00 58.49  ? 797  LYS A CD    1 
ATOM   6074  C  CE    . LYS A 1  797  ? 3.124   -27.105  78.913  1.00 69.01  ? 797  LYS A CE    1 
ATOM   6075  N  NZ    . LYS A 1  797  ? 3.973   -25.946  78.543  1.00 78.16  ? 797  LYS A NZ    1 
ATOM   6076  N  N     . GLY A 1  798  ? -1.831  -28.163  74.491  1.00 46.10  ? 798  GLY A N     1 
ATOM   6077  C  CA    . GLY A 1  798  ? -2.000  -29.018  73.330  1.00 45.95  ? 798  GLY A CA    1 
ATOM   6078  C  C     . GLY A 1  798  ? -2.717  -30.346  73.408  1.00 53.31  ? 798  GLY A C     1 
ATOM   6079  O  O     . GLY A 1  798  ? -2.496  -31.180  72.523  1.00 51.13  ? 798  GLY A O     1 
ATOM   6080  N  N     . PHE A 1  799  ? -3.602  -30.572  74.407  1.00 55.17  ? 799  PHE A N     1 
ATOM   6081  C  CA    . PHE A 1  799  ? -4.347  -31.845  74.442  1.00 56.76  ? 799  PHE A CA    1 
ATOM   6082  C  C     . PHE A 1  799  ? -5.655  -31.757  73.671  1.00 63.02  ? 799  PHE A C     1 
ATOM   6083  O  O     . PHE A 1  799  ? -6.553  -30.972  74.024  1.00 64.40  ? 799  PHE A O     1 
ATOM   6084  C  CB    . PHE A 1  799  ? -4.558  -32.412  75.850  1.00 59.42  ? 799  PHE A CB    1 
ATOM   6085  C  CG    . PHE A 1  799  ? -5.370  -33.691  75.926  1.00 61.87  ? 799  PHE A CG    1 
ATOM   6086  C  CD1   . PHE A 1  799  ? -4.770  -34.931  75.727  1.00 65.83  ? 799  PHE A CD1   1 
ATOM   6087  C  CD2   . PHE A 1  799  ? -6.719  -33.660  76.262  1.00 64.62  ? 799  PHE A CD2   1 
ATOM   6088  C  CE1   . PHE A 1  799  ? -5.507  -36.118  75.858  1.00 67.00  ? 799  PHE A CE1   1 
ATOM   6089  C  CE2   . PHE A 1  799  ? -7.455  -34.845  76.388  1.00 68.01  ? 799  PHE A CE2   1 
ATOM   6090  C  CZ    . PHE A 1  799  ? -6.845  -36.064  76.187  1.00 66.22  ? 799  PHE A CZ    1 
ATOM   6091  N  N     . VAL A 1  800  ? -5.739  -32.574  72.606  1.00 58.29  ? 800  VAL A N     1 
ATOM   6092  C  CA    . VAL A 1  800  ? -6.888  -32.663  71.726  1.00 57.07  ? 800  VAL A CA    1 
ATOM   6093  C  C     . VAL A 1  800  ? -7.770  -33.771  72.248  1.00 61.60  ? 800  VAL A C     1 
ATOM   6094  O  O     . VAL A 1  800  ? -7.440  -34.956  72.150  1.00 59.73  ? 800  VAL A O     1 
ATOM   6095  C  CB    . VAL A 1  800  ? -6.511  -32.881  70.246  1.00 59.63  ? 800  VAL A CB    1 
ATOM   6096  C  CG1   . VAL A 1  800  ? -7.750  -32.838  69.372  1.00 59.72  ? 800  VAL A CG1   1 
ATOM   6097  C  CG2   . VAL A 1  800  ? -5.479  -31.871  69.770  1.00 58.47  ? 800  VAL A CG2   1 
ATOM   6098  N  N     . GLU A 1  801  ? -8.877  -33.359  72.839  1.00 60.72  ? 801  GLU A N     1 
ATOM   6099  C  CA    . GLU A 1  801  ? -9.901  -34.220  73.406  1.00 61.92  ? 801  GLU A CA    1 
ATOM   6100  C  C     . GLU A 1  801  ? -10.767 -34.797  72.274  1.00 67.06  ? 801  GLU A C     1 
ATOM   6101  O  O     . GLU A 1  801  ? -11.200 -35.952  72.331  1.00 68.22  ? 801  GLU A O     1 
ATOM   6102  C  CB    . GLU A 1  801  ? -10.751 -33.382  74.375  1.00 64.04  ? 801  GLU A CB    1 
ATOM   6103  C  CG    . GLU A 1  801  ? -11.927 -34.115  74.996  1.00 80.12  ? 801  GLU A CG    1 
ATOM   6104  C  CD    . GLU A 1  801  ? -12.509 -33.491  76.250  1.00 119.58 ? 801  GLU A CD    1 
ATOM   6105  O  OE1   . GLU A 1  801  ? -13.409 -34.123  76.850  1.00 130.16 ? 801  GLU A OE1   1 
ATOM   6106  O  OE2   . GLU A 1  801  ? -12.047 -32.397  76.655  1.00 116.34 ? 801  GLU A OE2   1 
ATOM   6107  N  N     . ASN A 1  802  ? -11.033 -33.990  71.255  1.00 62.79  ? 802  ASN A N     1 
ATOM   6108  C  CA    . ASN A 1  802  ? -11.891 -34.432  70.173  1.00 62.57  ? 802  ASN A CA    1 
ATOM   6109  C  C     . ASN A 1  802  ? -11.216 -35.355  69.183  1.00 66.97  ? 802  ASN A C     1 
ATOM   6110  O  O     . ASN A 1  802  ? -9.998  -35.312  69.004  1.00 66.56  ? 802  ASN A O     1 
ATOM   6111  C  CB    . ASN A 1  802  ? -12.516 -33.248  69.470  1.00 60.26  ? 802  ASN A CB    1 
ATOM   6112  C  CG    . ASN A 1  802  ? -13.409 -32.439  70.361  1.00 76.25  ? 802  ASN A CG    1 
ATOM   6113  O  OD1   . ASN A 1  802  ? -14.457 -32.917  70.806  1.00 68.84  ? 802  ASN A OD1   1 
ATOM   6114  N  ND2   . ASN A 1  802  ? -13.006 -31.200  70.650  1.00 66.02  ? 802  ASN A ND2   1 
ATOM   6115  N  N     . SER A 1  803  ? -12.033 -36.217  68.570  1.00 62.74  ? 803  SER A N     1 
ATOM   6116  C  CA    . SER A 1  803  ? -11.670 -37.143  67.512  1.00 61.19  ? 803  SER A CA    1 
ATOM   6117  C  C     . SER A 1  803  ? -11.819 -36.373  66.194  1.00 65.69  ? 803  SER A C     1 
ATOM   6118  O  O     . SER A 1  803  ? -12.395 -35.269  66.185  1.00 65.72  ? 803  SER A O     1 
ATOM   6119  C  CB    . SER A 1  803  ? -12.623 -38.338  67.517  1.00 63.08  ? 803  SER A CB    1 
ATOM   6120  O  OG    . SER A 1  803  ? -13.986 -38.001  67.753  1.00 65.62  ? 803  SER A OG    1 
ATOM   6121  N  N     . TYR A 1  804  ? -11.339 -36.947  65.072  1.00 61.00  ? 804  TYR A N     1 
ATOM   6122  C  CA    . TYR A 1  804  ? -11.489 -36.277  63.783  1.00 59.18  ? 804  TYR A CA    1 
ATOM   6123  C  C     . TYR A 1  804  ? -12.943 -36.219  63.358  1.00 64.24  ? 804  TYR A C     1 
ATOM   6124  O  O     . TYR A 1  804  ? -13.343 -35.296  62.645  1.00 64.74  ? 804  TYR A O     1 
ATOM   6125  C  CB    . TYR A 1  804  ? -10.622 -36.921  62.716  1.00 58.24  ? 804  TYR A CB    1 
ATOM   6126  C  CG    . TYR A 1  804  ? -9.150  -36.721  62.971  1.00 57.79  ? 804  TYR A CG    1 
ATOM   6127  C  CD1   . TYR A 1  804  ? -8.313  -37.804  63.199  1.00 60.50  ? 804  TYR A CD1   1 
ATOM   6128  C  CD2   . TYR A 1  804  ? -8.593  -35.448  63.002  1.00 57.07  ? 804  TYR A CD2   1 
ATOM   6129  C  CE1   . TYR A 1  804  ? -6.948  -37.632  63.416  1.00 61.47  ? 804  TYR A CE1   1 
ATOM   6130  C  CE2   . TYR A 1  804  ? -7.228  -35.262  63.223  1.00 57.23  ? 804  TYR A CE2   1 
ATOM   6131  C  CZ    . TYR A 1  804  ? -6.406  -36.359  63.424  1.00 64.04  ? 804  TYR A CZ    1 
ATOM   6132  O  OH    . TYR A 1  804  ? -5.052  -36.222  63.625  1.00 62.71  ? 804  TYR A OH    1 
ATOM   6133  N  N     . LEU A 1  805  ? -13.746 -37.174  63.840  1.00 60.49  ? 805  LEU A N     1 
ATOM   6134  C  CA    . LEU A 1  805  ? -15.184 -37.227  63.571  1.00 60.34  ? 805  LEU A CA    1 
ATOM   6135  C  C     . LEU A 1  805  ? -15.876 -36.022  64.218  1.00 61.79  ? 805  LEU A C     1 
ATOM   6136  O  O     . LEU A 1  805  ? -16.675 -35.330  63.562  1.00 61.22  ? 805  LEU A O     1 
ATOM   6137  C  CB    . LEU A 1  805  ? -15.767 -38.548  64.137  1.00 60.91  ? 805  LEU A CB    1 
ATOM   6138  C  CG    . LEU A 1  805  ? -17.273 -38.762  64.058  1.00 65.75  ? 805  LEU A CG    1 
ATOM   6139  C  CD1   . LEU A 1  805  ? -17.762 -38.731  62.602  1.00 65.89  ? 805  LEU A CD1   1 
ATOM   6140  C  CD2   . LEU A 1  805  ? -17.659 -40.058  64.747  1.00 68.56  ? 805  LEU A CD2   1 
ATOM   6141  N  N     . ARG A 1  806  ? -15.547 -35.790  65.508  1.00 55.88  ? 806  ARG A N     1 
ATOM   6142  C  CA    . ARG A 1  806  ? -16.118 -34.750  66.344  1.00 55.83  ? 806  ARG A CA    1 
ATOM   6143  C  C     . ARG A 1  806  ? -15.779 -33.405  65.803  1.00 58.90  ? 806  ARG A C     1 
ATOM   6144  O  O     . ARG A 1  806  ? -16.656 -32.541  65.730  1.00 58.68  ? 806  ARG A O     1 
ATOM   6145  C  CB    . ARG A 1  806  ? -15.597 -34.882  67.780  1.00 58.19  ? 806  ARG A CB    1 
ATOM   6146  C  CG    . ARG A 1  806  ? -16.457 -35.757  68.670  1.00 71.71  ? 806  ARG A CG    1 
ATOM   6147  C  CD    . ARG A 1  806  ? -17.049 -34.918  69.777  1.00 79.65  ? 806  ARG A CD    1 
ATOM   6148  N  NE    . ARG A 1  806  ? -17.698 -35.710  70.821  1.00 88.29  ? 806  ARG A NE    1 
ATOM   6149  C  CZ    . ARG A 1  806  ? -17.059 -36.345  71.802  1.00 106.55 ? 806  ARG A CZ    1 
ATOM   6150  N  NH1   . ARG A 1  806  ? -15.728 -36.328  71.863  1.00 95.73  ? 806  ARG A NH1   1 
ATOM   6151  N  NH2   . ARG A 1  806  ? -17.744 -37.009  72.724  1.00 93.15  ? 806  ARG A NH2   1 
ATOM   6152  N  N     . GLY A 1  807  ? -14.519 -33.274  65.382  1.00 54.74  ? 807  GLY A N     1 
ATOM   6153  C  CA    . GLY A 1  807  ? -13.920 -32.048  64.879  1.00 53.58  ? 807  GLY A CA    1 
ATOM   6154  C  C     . GLY A 1  807  ? -13.109 -31.412  65.994  1.00 56.23  ? 807  GLY A C     1 
ATOM   6155  O  O     . GLY A 1  807  ? -13.493 -31.471  67.169  1.00 56.04  ? 807  GLY A O     1 
ATOM   6156  N  N     . LEU A 1  808  ? -11.976 -30.808  65.629  1.00 50.46  ? 808  LEU A N     1 
ATOM   6157  C  CA    . LEU A 1  808  ? -11.061 -30.114  66.525  1.00 48.90  ? 808  LEU A CA    1 
ATOM   6158  C  C     . LEU A 1  808  ? -11.501 -28.659  66.661  1.00 53.01  ? 808  LEU A C     1 
ATOM   6159  O  O     . LEU A 1  808  ? -12.043 -28.084  65.703  1.00 52.72  ? 808  LEU A O     1 
ATOM   6160  C  CB    . LEU A 1  808  ? -9.659  -30.142  65.903  1.00 47.93  ? 808  LEU A CB    1 
ATOM   6161  C  CG    . LEU A 1  808  ? -8.782  -31.327  66.245  1.00 52.21  ? 808  LEU A CG    1 
ATOM   6162  C  CD1   . LEU A 1  808  ? -9.053  -32.498  65.349  1.00 52.50  ? 808  LEU A CD1   1 
ATOM   6163  C  CD2   . LEU A 1  808  ? -7.345  -30.962  66.105  1.00 54.90  ? 808  LEU A CD2   1 
ATOM   6164  N  N     . THR A 1  809  ? -11.246 -28.051  67.844  1.00 63.22  ? 809  THR A N     1 
ATOM   6165  C  CA    . THR A 1  809  ? -11.547 -26.632  68.108  1.00 62.84  ? 809  THR A CA    1 
ATOM   6166  C  C     . THR A 1  809  ? -10.355 -25.821  67.563  1.00 62.68  ? 809  THR A C     1 
ATOM   6167  O  O     . THR A 1  809  ? -9.285  -26.421  67.384  1.00 62.02  ? 809  THR A O     1 
ATOM   6168  C  CB    . THR A 1  809  ? -11.686 -26.390  69.614  1.00 70.02  ? 809  THR A CB    1 
ATOM   6169  O  OG1   . THR A 1  809  ? -10.419 -26.629  70.238  1.00 68.07  ? 809  THR A OG1   1 
ATOM   6170  C  CG2   . THR A 1  809  ? -12.798 -27.221  70.245  1.00 68.31  ? 809  THR A CG2   1 
ATOM   6171  N  N     . PRO A 1  810  ? -10.462 -24.481  67.338  1.00 54.82  ? 810  PRO A N     1 
ATOM   6172  C  CA    . PRO A 1  810  ? -9.298  -23.730  66.815  1.00 52.39  ? 810  PRO A CA    1 
ATOM   6173  C  C     . PRO A 1  810  ? -7.982  -23.851  67.606  1.00 54.37  ? 810  PRO A C     1 
ATOM   6174  O  O     . PRO A 1  810  ? -6.909  -23.954  67.000  1.00 52.00  ? 810  PRO A O     1 
ATOM   6175  C  CB    . PRO A 1  810  ? -9.809  -22.302  66.707  1.00 54.99  ? 810  PRO A CB    1 
ATOM   6176  C  CG    . PRO A 1  810  ? -11.023 -22.263  67.518  1.00 60.81  ? 810  PRO A CG    1 
ATOM   6177  C  CD    . PRO A 1  810  ? -11.631 -23.603  67.493  1.00 56.64  ? 810  PRO A CD    1 
ATOM   6178  N  N     . GLN A 1  811  ? -8.058  -23.905  68.948  1.00 50.80  ? 811  GLN A N     1 
ATOM   6179  C  CA    . GLN A 1  811  ? -6.861  -24.057  69.753  1.00 49.69  ? 811  GLN A CA    1 
ATOM   6180  C  C     . GLN A 1  811  ? -6.295  -25.414  69.404  1.00 57.69  ? 811  GLN A C     1 
ATOM   6181  O  O     . GLN A 1  811  ? -5.153  -25.479  68.937  1.00 58.19  ? 811  GLN A O     1 
ATOM   6182  C  CB    . GLN A 1  811  ? -7.169  -23.938  71.249  1.00 51.18  ? 811  GLN A CB    1 
ATOM   6183  C  CG    . GLN A 1  811  ? -7.585  -22.544  71.715  1.00 39.87  ? 811  GLN A CG    1 
ATOM   6184  C  CD    . GLN A 1  811  ? -9.071  -22.263  71.571  1.00 69.49  ? 811  GLN A CD    1 
ATOM   6185  O  OE1   . GLN A 1  811  ? -9.795  -22.811  70.711  1.00 70.99  ? 811  GLN A OE1   1 
ATOM   6186  N  NE2   . GLN A 1  811  ? -9.562  -21.364  72.401  1.00 60.48  ? 811  GLN A NE2   1 
ATOM   6187  N  N     . GLU A 1  812  ? -7.143  -26.483  69.485  1.00 56.27  ? 812  GLU A N     1 
ATOM   6188  C  CA    . GLU A 1  812  ? -6.774  -27.881  69.166  1.00 55.28  ? 812  GLU A CA    1 
ATOM   6189  C  C     . GLU A 1  812  ? -6.164  -27.934  67.797  1.00 57.37  ? 812  GLU A C     1 
ATOM   6190  O  O     . GLU A 1  812  ? -5.082  -28.490  67.632  1.00 53.53  ? 812  GLU A O     1 
ATOM   6191  C  CB    . GLU A 1  812  ? -8.007  -28.811  69.204  1.00 57.13  ? 812  GLU A CB    1 
ATOM   6192  C  CG    . GLU A 1  812  ? -8.332  -29.373  70.574  1.00 69.68  ? 812  GLU A CG    1 
ATOM   6193  C  CD    . GLU A 1  812  ? -9.657  -30.096  70.710  1.00 89.40  ? 812  GLU A CD    1 
ATOM   6194  O  OE1   . GLU A 1  812  ? -9.767  -30.919  71.647  1.00 94.15  ? 812  GLU A OE1   1 
ATOM   6195  O  OE2   . GLU A 1  812  ? -10.586 -29.832  69.909  1.00 74.49  ? 812  GLU A OE2   1 
ATOM   6196  N  N     . PHE A 1  813  ? -6.859  -27.288  66.831  1.00 56.29  ? 813  PHE A N     1 
ATOM   6197  C  CA    . PHE A 1  813  ? -6.480  -27.184  65.440  1.00 56.56  ? 813  PHE A CA    1 
ATOM   6198  C  C     . PHE A 1  813  ? -5.032  -26.685  65.270  1.00 61.84  ? 813  PHE A C     1 
ATOM   6199  O  O     . PHE A 1  813  ? -4.210  -27.356  64.609  1.00 62.08  ? 813  PHE A O     1 
ATOM   6200  C  CB    . PHE A 1  813  ? -7.477  -26.292  64.680  1.00 59.39  ? 813  PHE A CB    1 
ATOM   6201  C  CG    . PHE A 1  813  ? -7.222  -26.258  63.192  1.00 60.63  ? 813  PHE A CG    1 
ATOM   6202  C  CD1   . PHE A 1  813  ? -7.812  -27.194  62.349  1.00 64.72  ? 813  PHE A CD1   1 
ATOM   6203  C  CD2   . PHE A 1  813  ? -6.345  -25.334  62.642  1.00 62.49  ? 813  PHE A CD2   1 
ATOM   6204  C  CE1   . PHE A 1  813  ? -7.553  -27.187  60.978  1.00 65.32  ? 813  PHE A CE1   1 
ATOM   6205  C  CE2   . PHE A 1  813  ? -6.080  -25.329  61.274  1.00 65.62  ? 813  PHE A CE2   1 
ATOM   6206  C  CZ    . PHE A 1  813  ? -6.693  -26.251  60.447  1.00 63.91  ? 813  PHE A CZ    1 
ATOM   6207  N  N     . PHE A 1  814  ? -4.731  -25.519  65.881  1.00 57.11  ? 814  PHE A N     1 
ATOM   6208  C  CA    . PHE A 1  814  ? -3.422  -24.898  65.812  1.00 55.49  ? 814  PHE A CA    1 
ATOM   6209  C  C     . PHE A 1  814  ? -2.376  -25.769  66.454  1.00 57.38  ? 814  PHE A C     1 
ATOM   6210  O  O     . PHE A 1  814  ? -1.341  -26.000  65.837  1.00 54.96  ? 814  PHE A O     1 
ATOM   6211  C  CB    . PHE A 1  814  ? -3.446  -23.504  66.431  1.00 58.68  ? 814  PHE A CB    1 
ATOM   6212  C  CG    . PHE A 1  814  ? -2.249  -22.670  66.057  1.00 60.31  ? 814  PHE A CG    1 
ATOM   6213  C  CD1   . PHE A 1  814  ? -2.238  -21.929  64.889  1.00 62.91  ? 814  PHE A CD1   1 
ATOM   6214  C  CD2   . PHE A 1  814  ? -1.132  -22.618  66.880  1.00 63.29  ? 814  PHE A CD2   1 
ATOM   6215  C  CE1   . PHE A 1  814  ? -1.126  -21.155  64.546  1.00 64.09  ? 814  PHE A CE1   1 
ATOM   6216  C  CE2   . PHE A 1  814  ? -0.019  -21.840  66.534  1.00 66.03  ? 814  PHE A CE2   1 
ATOM   6217  C  CZ    . PHE A 1  814  ? -0.026  -21.111  65.372  1.00 63.62  ? 814  PHE A CZ    1 
ATOM   6218  N  N     . PHE A 1  815  ? -2.660  -26.300  67.662  1.00 55.80  ? 815  PHE A N     1 
ATOM   6219  C  CA    . PHE A 1  815  ? -1.734  -27.179  68.380  1.00 56.03  ? 815  PHE A CA    1 
ATOM   6220  C  C     . PHE A 1  815  ? -1.393  -28.404  67.560  1.00 62.37  ? 815  PHE A C     1 
ATOM   6221  O  O     . PHE A 1  815  ? -0.220  -28.754  67.419  1.00 60.14  ? 815  PHE A O     1 
ATOM   6222  C  CB    . PHE A 1  815  ? -2.295  -27.575  69.737  1.00 58.58  ? 815  PHE A CB    1 
ATOM   6223  C  CG    . PHE A 1  815  ? -2.431  -26.417  70.681  1.00 62.29  ? 815  PHE A CG    1 
ATOM   6224  C  CD1   . PHE A 1  815  ? -3.563  -26.272  71.464  1.00 67.89  ? 815  PHE A CD1   1 
ATOM   6225  C  CD2   . PHE A 1  815  ? -1.434  -25.460  70.780  1.00 65.15  ? 815  PHE A CD2   1 
ATOM   6226  C  CE1   . PHE A 1  815  ? -3.704  -25.179  72.319  1.00 70.74  ? 815  PHE A CE1   1 
ATOM   6227  C  CE2   . PHE A 1  815  ? -1.576  -24.367  71.632  1.00 70.11  ? 815  PHE A CE2   1 
ATOM   6228  C  CZ    . PHE A 1  815  ? -2.703  -24.241  72.407  1.00 69.96  ? 815  PHE A CZ    1 
ATOM   6229  N  N     . HIS A 1  816  ? -2.422  -29.004  66.944  1.00 62.35  ? 816  HIS A N     1 
ATOM   6230  C  CA    . HIS A 1  816  ? -2.270  -30.158  66.079  1.00 61.82  ? 816  HIS A CA    1 
ATOM   6231  C  C     . HIS A 1  816  ? -1.365  -29.761  64.922  1.00 64.63  ? 816  HIS A C     1 
ATOM   6232  O  O     . HIS A 1  816  ? -0.428  -30.506  64.606  1.00 63.01  ? 816  HIS A O     1 
ATOM   6233  C  CB    . HIS A 1  816  ? -3.642  -30.630  65.572  1.00 63.23  ? 816  HIS A CB    1 
ATOM   6234  C  CG    . HIS A 1  816  ? -3.626  -31.961  64.872  1.00 66.13  ? 816  HIS A CG    1 
ATOM   6235  N  ND1   . HIS A 1  816  ? -2.514  -32.788  64.897  1.00 67.19  ? 816  HIS A ND1   1 
ATOM   6236  C  CD2   . HIS A 1  816  ? -4.596  -32.564  64.150  1.00 68.10  ? 816  HIS A CD2   1 
ATOM   6237  C  CE1   . HIS A 1  816  ? -2.848  -33.857  64.196  1.00 66.12  ? 816  HIS A CE1   1 
ATOM   6238  N  NE2   . HIS A 1  816  ? -4.088  -33.764  63.723  1.00 66.97  ? 816  HIS A NE2   1 
ATOM   6239  N  N     . ALA A 1  817  ? -1.603  -28.551  64.347  1.00 60.75  ? 817  ALA A N     1 
ATOM   6240  C  CA    . ALA A 1  817  ? -0.803  -28.025  63.247  1.00 59.70  ? 817  ALA A CA    1 
ATOM   6241  C  C     . ALA A 1  817  ? 0.682   -27.859  63.634  1.00 63.12  ? 817  ALA A C     1 
ATOM   6242  O  O     . ALA A 1  817  ? 1.568   -28.136  62.804  1.00 62.28  ? 817  ALA A O     1 
ATOM   6243  C  CB    . ALA A 1  817  ? -1.388  -26.724  62.750  1.00 61.03  ? 817  ALA A CB    1 
ATOM   6244  N  N     . MET A 1  818  ? 0.947   -27.477  64.910  1.00 58.50  ? 818  MET A N     1 
ATOM   6245  C  CA    . MET A 1  818  ? 2.312   -27.333  65.434  1.00 57.39  ? 818  MET A CA    1 
ATOM   6246  C  C     . MET A 1  818  ? 3.029   -28.669  65.469  1.00 62.11  ? 818  MET A C     1 
ATOM   6247  O  O     . MET A 1  818  ? 4.188   -28.763  65.044  1.00 60.74  ? 818  MET A O     1 
ATOM   6248  C  CB    . MET A 1  818  ? 2.318   -26.695  66.827  1.00 59.68  ? 818  MET A CB    1 
ATOM   6249  C  CG    . MET A 1  818  ? 2.206   -25.222  66.778  1.00 62.10  ? 818  MET A CG    1 
ATOM   6250  S  SD    . MET A 1  818  ? 1.613   -24.537  68.291  1.00 65.37  ? 818  MET A SD    1 
ATOM   6251  C  CE    . MET A 1  818  ? 3.080   -24.496  69.188  1.00 62.42  ? 818  MET A CE    1 
ATOM   6252  N  N     . GLY A 1  819  ? 2.319   -29.678  65.969  1.00 60.51  ? 819  GLY A N     1 
ATOM   6253  C  CA    . GLY A 1  819  ? 2.805   -31.049  66.033  1.00 61.31  ? 819  GLY A CA    1 
ATOM   6254  C  C     . GLY A 1  819  ? 2.969   -31.610  64.632  1.00 67.53  ? 819  GLY A C     1 
ATOM   6255  O  O     . GLY A 1  819  ? 4.018   -32.184  64.303  1.00 67.52  ? 819  GLY A O     1 
ATOM   6256  N  N     . GLY A 1  820  ? 1.952   -31.381  63.795  1.00 63.95  ? 820  GLY A N     1 
ATOM   6257  C  CA    . GLY A 1  820  ? 1.953   -31.803  62.403  1.00 63.03  ? 820  GLY A CA    1 
ATOM   6258  C  C     . GLY A 1  820  ? 3.181   -31.310  61.672  1.00 66.81  ? 820  GLY A C     1 
ATOM   6259  O  O     . GLY A 1  820  ? 3.888   -32.117  61.055  1.00 64.82  ? 820  GLY A O     1 
ATOM   6260  N  N     . ARG A 1  821  ? 3.474   -29.978  61.806  1.00 64.65  ? 821  ARG A N     1 
ATOM   6261  C  CA    . ARG A 1  821  ? 4.632   -29.322  61.197  1.00 64.16  ? 821  ARG A CA    1 
ATOM   6262  C  C     . ARG A 1  821  ? 5.943   -30.041  61.531  1.00 67.75  ? 821  ARG A C     1 
ATOM   6263  O  O     . ARG A 1  821  ? 6.680   -30.365  60.598  1.00 67.33  ? 821  ARG A O     1 
ATOM   6264  C  CB    . ARG A 1  821  ? 4.679   -27.834  61.542  1.00 65.10  ? 821  ARG A CB    1 
ATOM   6265  C  CG    . ARG A 1  821  ? 5.853   -27.067  60.920  1.00 74.18  ? 821  ARG A CG    1 
ATOM   6266  C  CD    . ARG A 1  821  ? 5.679   -26.621  59.471  1.00 76.63  ? 821  ARG A CD    1 
ATOM   6267  N  NE    . ARG A 1  821  ? 5.511   -25.169  59.371  1.00 76.83  ? 821  ARG A NE    1 
ATOM   6268  C  CZ    . ARG A 1  821  ? 4.345   -24.581  59.140  1.00 101.16 ? 821  ARG A CZ    1 
ATOM   6269  N  NH1   . ARG A 1  821  ? 3.251   -25.312  58.952  1.00 97.41  ? 821  ARG A NH1   1 
ATOM   6270  N  NH2   . ARG A 1  821  ? 4.264   -23.257  59.081  1.00 91.24  ? 821  ARG A NH2   1 
ATOM   6271  N  N     . GLU A 1  822  ? 6.181   -30.387  62.822  1.00 63.81  ? 822  GLU A N     1 
ATOM   6272  C  CA    . GLU A 1  822  ? 7.378   -31.127  63.249  1.00 63.05  ? 822  GLU A CA    1 
ATOM   6273  C  C     . GLU A 1  822  ? 7.606   -32.379  62.407  1.00 65.12  ? 822  GLU A C     1 
ATOM   6274  O  O     . GLU A 1  822  ? 8.740   -32.667  62.009  1.00 62.64  ? 822  GLU A O     1 
ATOM   6275  C  CB    . GLU A 1  822  ? 7.328   -31.472  64.744  1.00 65.09  ? 822  GLU A CB    1 
ATOM   6276  C  CG    . GLU A 1  822  ? 8.669   -31.913  65.310  1.00 75.91  ? 822  GLU A CG    1 
ATOM   6277  C  CD    . GLU A 1  822  ? 8.785   -31.828  66.820  1.00 96.25  ? 822  GLU A CD    1 
ATOM   6278  O  OE1   . GLU A 1  822  ? 9.402   -30.854  67.311  1.00 84.83  ? 822  GLU A OE1   1 
ATOM   6279  O  OE2   . GLU A 1  822  ? 8.287   -32.747  67.510  1.00 89.59  ? 822  GLU A OE2   1 
ATOM   6280  N  N     . GLY A 1  823  ? 6.518   -33.068  62.105  1.00 64.12  ? 823  GLY A N     1 
ATOM   6281  C  CA    . GLY A 1  823  ? 6.541   -34.276  61.289  1.00 65.12  ? 823  GLY A CA    1 
ATOM   6282  C  C     . GLY A 1  823  ? 7.144   -34.002  59.930  1.00 72.25  ? 823  GLY A C     1 
ATOM   6283  O  O     . GLY A 1  823  ? 8.236   -34.486  59.624  1.00 73.04  ? 823  GLY A O     1 
ATOM   6284  N  N     . LEU A 1  824  ? 6.481   -33.131  59.168  1.00 69.15  ? 824  LEU A N     1 
ATOM   6285  C  CA    . LEU A 1  824  ? 6.893   -32.680  57.847  1.00 68.60  ? 824  LEU A CA    1 
ATOM   6286  C  C     . LEU A 1  824  ? 8.335   -32.178  57.837  1.00 70.53  ? 824  LEU A C     1 
ATOM   6287  O  O     . LEU A 1  824  ? 9.091   -32.555  56.934  1.00 69.02  ? 824  LEU A O     1 
ATOM   6288  C  CB    . LEU A 1  824  ? 5.919   -31.601  57.340  1.00 69.69  ? 824  LEU A CB    1 
ATOM   6289  C  CG    . LEU A 1  824  ? 4.437   -32.044  57.269  1.00 75.64  ? 824  LEU A CG    1 
ATOM   6290  C  CD1   . LEU A 1  824  ? 3.523   -30.992  57.818  1.00 77.15  ? 824  LEU A CD1   1 
ATOM   6291  C  CD2   . LEU A 1  824  ? 4.021   -32.406  55.860  1.00 78.42  ? 824  LEU A CD2   1 
ATOM   6292  N  N     . ILE A 1  825  ? 8.735   -31.398  58.877  1.00 67.62  ? 825  ILE A N     1 
ATOM   6293  C  CA    . ILE A 1  825  ? 10.099  -30.862  59.008  1.00 68.21  ? 825  ILE A CA    1 
ATOM   6294  C  C     . ILE A 1  825  ? 11.107  -31.960  59.140  1.00 75.73  ? 825  ILE A C     1 
ATOM   6295  O  O     . ILE A 1  825  ? 12.057  -31.977  58.361  1.00 74.73  ? 825  ILE A O     1 
ATOM   6296  C  CB    . ILE A 1  825  ? 10.287  -29.784  60.104  1.00 71.63  ? 825  ILE A CB    1 
ATOM   6297  C  CG1   . ILE A 1  825  ? 9.440   -28.544  59.817  1.00 72.29  ? 825  ILE A CG1   1 
ATOM   6298  C  CG2   . ILE A 1  825  ? 11.764  -29.390  60.249  1.00 72.28  ? 825  ILE A CG2   1 
ATOM   6299  C  CD1   . ILE A 1  825  ? 9.044   -27.882  61.001  1.00 78.06  ? 825  ILE A CD1   1 
ATOM   6300  N  N     . ASP A 1  826  ? 10.922  -32.874  60.107  1.00 76.61  ? 826  ASP A N     1 
ATOM   6301  C  CA    . ASP A 1  826  ? 11.891  -33.954  60.225  1.00 78.75  ? 826  ASP A CA    1 
ATOM   6302  C  C     . ASP A 1  826  ? 11.836  -34.935  59.064  1.00 82.27  ? 826  ASP A C     1 
ATOM   6303  O  O     . ASP A 1  826  ? 12.884  -35.386  58.633  1.00 82.05  ? 826  ASP A O     1 
ATOM   6304  C  CB    . ASP A 1  826  ? 11.944  -34.614  61.611  1.00 82.80  ? 826  ASP A CB    1 
ATOM   6305  C  CG    . ASP A 1  826  ? 10.679  -35.320  62.054  1.00 110.69 ? 826  ASP A CG    1 
ATOM   6306  O  OD1   . ASP A 1  826  ? 10.137  -36.147  61.257  1.00 113.21 ? 826  ASP A OD1   1 
ATOM   6307  O  OD2   . ASP A 1  826  ? 10.273  -35.122  63.229  1.00 122.73 ? 826  ASP A OD2   1 
ATOM   6308  N  N     . THR A 1  827  ? 10.652  -35.192  58.490  1.00 78.69  ? 827  THR A N     1 
ATOM   6309  C  CA    . THR A 1  827  ? 10.559  -36.043  57.307  1.00 78.31  ? 827  THR A CA    1 
ATOM   6310  C  C     . THR A 1  827  ? 11.577  -35.513  56.313  1.00 83.68  ? 827  THR A C     1 
ATOM   6311  O  O     . THR A 1  827  ? 12.441  -36.272  55.886  1.00 83.49  ? 827  THR A O     1 
ATOM   6312  C  CB    . THR A 1  827  ? 9.127   -36.070  56.759  1.00 85.34  ? 827  THR A CB    1 
ATOM   6313  O  OG1   . THR A 1  827  ? 8.335   -36.817  57.676  1.00 92.61  ? 827  THR A OG1   1 
ATOM   6314  C  CG2   . THR A 1  827  ? 9.029   -36.710  55.383  1.00 77.19  ? 827  THR A CG2   1 
ATOM   6315  N  N     . ALA A 1  828  ? 11.548  -34.194  56.046  1.00 81.30  ? 828  ALA A N     1 
ATOM   6316  C  CA    . ALA A 1  828  ? 12.490  -33.530  55.163  1.00 81.69  ? 828  ALA A CA    1 
ATOM   6317  C  C     . ALA A 1  828  ? 13.935  -33.811  55.584  1.00 87.43  ? 828  ALA A C     1 
ATOM   6318  O  O     . ALA A 1  828  ? 14.726  -34.221  54.737  1.00 86.25  ? 828  ALA A O     1 
ATOM   6319  C  CB    . ALA A 1  828  ? 12.223  -32.046  55.161  1.00 83.13  ? 828  ALA A CB    1 
ATOM   6320  N  N     . VAL A 1  829  ? 14.252  -33.667  56.894  1.00 86.94  ? 829  VAL A N     1 
ATOM   6321  C  CA    . VAL A 1  829  ? 15.582  -33.909  57.486  1.00 88.60  ? 829  VAL A CA    1 
ATOM   6322  C  C     . VAL A 1  829  ? 16.031  -35.365  57.244  1.00 97.64  ? 829  VAL A C     1 
ATOM   6323  O  O     . VAL A 1  829  ? 17.025  -35.596  56.557  1.00 97.67  ? 829  VAL A O     1 
ATOM   6324  C  CB    . VAL A 1  829  ? 15.610  -33.580  59.007  1.00 92.63  ? 829  VAL A CB    1 
ATOM   6325  C  CG1   . VAL A 1  829  ? 16.975  -33.865  59.614  1.00 92.58  ? 829  VAL A CG1   1 
ATOM   6326  C  CG2   . VAL A 1  829  ? 15.198  -32.145  59.282  1.00 93.45  ? 829  VAL A CG2   1 
ATOM   6327  N  N     . LYS A 1  830  ? 15.291  -36.328  57.839  1.00 97.29  ? 830  LYS A N     1 
ATOM   6328  C  CA    . LYS A 1  830  ? 15.499  -37.783  57.809  1.00 97.77  ? 830  LYS A CA    1 
ATOM   6329  C  C     . LYS A 1  830  ? 15.777  -38.323  56.416  1.00 101.17 ? 830  LYS A C     1 
ATOM   6330  O  O     . LYS A 1  830  ? 16.738  -39.074  56.259  1.00 101.80 ? 830  LYS A O     1 
ATOM   6331  C  CB    . LYS A 1  830  ? 14.286  -38.532  58.416  1.00 101.53 ? 830  LYS A CB    1 
ATOM   6332  C  CG    . LYS A 1  830  ? 14.095  -38.339  59.921  1.00 124.82 ? 830  LYS A CG    1 
ATOM   6333  C  CD    . LYS A 1  830  ? 12.614  -38.351  60.332  1.00 133.65 ? 830  LYS A CD    1 
ATOM   6334  C  CE    . LYS A 1  830  ? 12.418  -38.535  61.820  1.00 139.58 ? 830  LYS A CE    1 
ATOM   6335  N  NZ    . LYS A 1  830  ? 13.191  -37.560  62.642  1.00 143.64 ? 830  LYS A NZ    1 
ATOM   6336  N  N     . THR A 1  831  ? 14.943  -37.950  55.409  1.00 95.21  ? 831  THR A N     1 
ATOM   6337  C  CA    . THR A 1  831  ? 15.105  -38.424  54.031  1.00 93.28  ? 831  THR A CA    1 
ATOM   6338  C  C     . THR A 1  831  ? 16.363  -37.878  53.392  1.00 94.86  ? 831  THR A C     1 
ATOM   6339  O  O     . THR A 1  831  ? 17.001  -38.591  52.624  1.00 94.13  ? 831  THR A O     1 
ATOM   6340  C  CB    . THR A 1  831  ? 13.846  -38.228  53.180  1.00 98.70  ? 831  THR A CB    1 
ATOM   6341  O  OG1   . THR A 1  831  ? 13.572  -36.838  53.020  1.00 95.13  ? 831  THR A OG1   1 
ATOM   6342  C  CG2   . THR A 1  831  ? 12.636  -38.970  53.738  1.00 98.34  ? 831  THR A CG2   1 
ATOM   6343  N  N     . ALA A 1  832  ? 16.750  -36.643  53.739  1.00 90.59  ? 832  ALA A N     1 
ATOM   6344  C  CA    . ALA A 1  832  ? 17.968  -36.042  53.201  1.00 90.51  ? 832  ALA A CA    1 
ATOM   6345  C  C     . ALA A 1  832  ? 19.188  -36.666  53.854  1.00 93.41  ? 832  ALA A C     1 
ATOM   6346  O  O     . ALA A 1  832  ? 20.162  -36.975  53.166  1.00 92.64  ? 832  ALA A O     1 
ATOM   6347  C  CB    . ALA A 1  832  ? 17.959  -34.543  53.433  1.00 91.88  ? 832  ALA A CB    1 
ATOM   6348  N  N     . GLU A 1  833  ? 19.104  -36.871  55.186  1.00 89.82  ? 833  GLU A N     1 
ATOM   6349  C  CA    . GLU A 1  833  ? 20.137  -37.438  56.046  1.00 89.60  ? 833  GLU A CA    1 
ATOM   6350  C  C     . GLU A 1  833  ? 20.441  -38.891  55.672  1.00 91.54  ? 833  GLU A C     1 
ATOM   6351  O  O     . GLU A 1  833  ? 21.570  -39.191  55.272  1.00 92.03  ? 833  GLU A O     1 
ATOM   6352  C  CB    . GLU A 1  833  ? 19.739  -37.313  57.542  1.00 91.45  ? 833  GLU A CB    1 
ATOM   6353  C  CG    . GLU A 1  833  ? 20.027  -35.952  58.173  1.00 106.38 ? 833  GLU A CG    1 
ATOM   6354  C  CD    . GLU A 1  833  ? 20.259  -35.944  59.679  1.00 134.12 ? 833  GLU A CD    1 
ATOM   6355  O  OE1   . GLU A 1  833  ? 19.294  -36.215  60.431  1.00 136.95 ? 833  GLU A OE1   1 
ATOM   6356  O  OE2   . GLU A 1  833  ? 21.397  -35.641  60.109  1.00 124.94 ? 833  GLU A OE2   1 
ATOM   6357  N  N     . THR A 1  834  ? 19.429  -39.781  55.765  1.00 85.31  ? 834  THR A N     1 
ATOM   6358  C  CA    . THR A 1  834  ? 19.560  -41.211  55.474  1.00 83.81  ? 834  THR A CA    1 
ATOM   6359  C  C     . THR A 1  834  ? 20.150  -41.498  54.099  1.00 86.17  ? 834  THR A C     1 
ATOM   6360  O  O     . THR A 1  834  ? 20.822  -42.513  53.922  1.00 86.90  ? 834  THR A O     1 
ATOM   6361  C  CB    . THR A 1  834  ? 18.236  -41.954  55.670  1.00 88.61  ? 834  THR A CB    1 
ATOM   6362  O  OG1   . THR A 1  834  ? 17.265  -41.454  54.750  1.00 91.28  ? 834  THR A OG1   1 
ATOM   6363  C  CG2   . THR A 1  834  ? 17.714  -41.876  57.085  1.00 82.58  ? 834  THR A CG2   1 
ATOM   6364  N  N     . GLY A 1  835  ? 19.896  -40.606  53.151  1.00 80.40  ? 835  GLY A N     1 
ATOM   6365  C  CA    . GLY A 1  835  ? 20.390  -40.726  51.788  1.00 79.57  ? 835  GLY A CA    1 
ATOM   6366  C  C     . GLY A 1  835  ? 21.890  -40.579  51.721  1.00 81.70  ? 835  GLY A C     1 
ATOM   6367  O  O     . GLY A 1  835  ? 22.556  -41.247  50.923  1.00 81.53  ? 835  GLY A O     1 
ATOM   6368  N  N     . TYR A 1  836  ? 22.419  -39.713  52.566  1.00 77.46  ? 836  TYR A N     1 
ATOM   6369  C  CA    . TYR A 1  836  ? 23.848  -39.499  52.652  1.00 78.43  ? 836  TYR A CA    1 
ATOM   6370  C  C     . TYR A 1  836  ? 24.480  -40.673  53.375  1.00 80.26  ? 836  TYR A C     1 
ATOM   6371  O  O     . TYR A 1  836  ? 25.558  -41.114  52.981  1.00 80.54  ? 836  TYR A O     1 
ATOM   6372  C  CB    . TYR A 1  836  ? 24.139  -38.200  53.394  1.00 81.56  ? 836  TYR A CB    1 
ATOM   6373  C  CG    . TYR A 1  836  ? 25.601  -37.824  53.481  1.00 85.97  ? 836  TYR A CG    1 
ATOM   6374  C  CD1   . TYR A 1  836  ? 26.432  -37.903  52.364  1.00 88.28  ? 836  TYR A CD1   1 
ATOM   6375  C  CD2   . TYR A 1  836  ? 26.133  -37.297  54.653  1.00 88.14  ? 836  TYR A CD2   1 
ATOM   6376  C  CE1   . TYR A 1  836  ? 27.763  -37.495  52.424  1.00 90.14  ? 836  TYR A CE1   1 
ATOM   6377  C  CE2   . TYR A 1  836  ? 27.455  -36.863  54.717  1.00 90.27  ? 836  TYR A CE2   1 
ATOM   6378  C  CZ    . TYR A 1  836  ? 28.268  -36.966  53.602  1.00 98.86  ? 836  TYR A CZ    1 
ATOM   6379  O  OH    . TYR A 1  836  ? 29.577  -36.561  53.693  1.00 103.35 ? 836  TYR A OH    1 
ATOM   6380  N  N     . ILE A 1  837  ? 23.797  -41.196  54.410  1.00 74.10  ? 837  ILE A N     1 
ATOM   6381  C  CA    . ILE A 1  837  ? 24.256  -42.348  55.181  1.00 72.81  ? 837  ILE A CA    1 
ATOM   6382  C  C     . ILE A 1  837  ? 24.477  -43.540  54.222  1.00 74.20  ? 837  ILE A C     1 
ATOM   6383  O  O     . ILE A 1  837  ? 25.523  -44.200  54.268  1.00 73.69  ? 837  ILE A O     1 
ATOM   6384  C  CB    . ILE A 1  837  ? 23.260  -42.639  56.345  1.00 75.34  ? 837  ILE A CB    1 
ATOM   6385  C  CG1   . ILE A 1  837  ? 23.459  -41.633  57.497  1.00 76.39  ? 837  ILE A CG1   1 
ATOM   6386  C  CG2   . ILE A 1  837  ? 23.365  -44.078  56.840  1.00 75.75  ? 837  ILE A CG2   1 
ATOM   6387  C  CD1   . ILE A 1  837  ? 22.601  -41.858  58.798  1.00 84.88  ? 837  ILE A CD1   1 
ATOM   6388  N  N     . GLN A 1  838  ? 23.505  -43.751  53.323  1.00 69.08  ? 838  GLN A N     1 
ATOM   6389  C  CA    . GLN A 1  838  ? 23.491  -44.800  52.311  1.00 68.40  ? 838  GLN A CA    1 
ATOM   6390  C  C     . GLN A 1  838  ? 24.701  -44.689  51.361  1.00 71.38  ? 838  GLN A C     1 
ATOM   6391  O  O     . GLN A 1  838  ? 25.461  -45.652  51.245  1.00 70.81  ? 838  GLN A O     1 
ATOM   6392  C  CB    . GLN A 1  838  ? 22.147  -44.779  51.555  1.00 69.09  ? 838  GLN A CB    1 
ATOM   6393  C  CG    . GLN A 1  838  ? 21.488  -46.135  51.391  1.00 77.29  ? 838  GLN A CG    1 
ATOM   6394  C  CD    . GLN A 1  838  ? 21.795  -46.754  50.048  1.00 109.95 ? 838  GLN A CD    1 
ATOM   6395  O  OE1   . GLN A 1  838  ? 22.764  -46.394  49.362  1.00 109.77 ? 838  GLN A OE1   1 
ATOM   6396  N  NE2   . GLN A 1  838  ? 20.980  -47.715  49.641  1.00 105.76 ? 838  GLN A NE2   1 
ATOM   6397  N  N     . ARG A 1  839  ? 24.937  -43.512  50.763  1.00 67.90  ? 839  ARG A N     1 
ATOM   6398  C  CA    . ARG A 1  839  ? 26.084  -43.342  49.868  1.00 68.97  ? 839  ARG A CA    1 
ATOM   6399  C  C     . ARG A 1  839  ? 27.438  -43.662  50.541  1.00 73.06  ? 839  ARG A C     1 
ATOM   6400  O  O     . ARG A 1  839  ? 28.310  -44.281  49.933  1.00 71.25  ? 839  ARG A O     1 
ATOM   6401  C  CB    . ARG A 1  839  ? 26.050  -41.979  49.136  1.00 72.28  ? 839  ARG A CB    1 
ATOM   6402  C  CG    . ARG A 1  839  ? 27.041  -40.899  49.613  1.00 90.50  ? 839  ARG A CG    1 
ATOM   6403  C  CD    . ARG A 1  839  ? 27.382  -39.872  48.529  1.00 101.41 ? 839  ARG A CD    1 
ATOM   6404  N  NE    . ARG A 1  839  ? 28.696  -40.102  47.911  1.00 103.53 ? 839  ARG A NE    1 
ATOM   6405  C  CZ    . ARG A 1  839  ? 28.924  -40.937  46.897  1.00 110.58 ? 839  ARG A CZ    1 
ATOM   6406  N  NH1   . ARG A 1  839  ? 27.931  -41.649  46.373  1.00 99.14  ? 839  ARG A NH1   1 
ATOM   6407  N  NH2   . ARG A 1  839  ? 30.144  -41.066  46.399  1.00 89.58  ? 839  ARG A NH2   1 
ATOM   6408  N  N     . ARG A 1  840  ? 27.567  -43.284  51.815  1.00 72.24  ? 840  ARG A N     1 
ATOM   6409  C  CA    . ARG A 1  840  ? 28.757  -43.506  52.634  1.00 73.36  ? 840  ARG A CA    1 
ATOM   6410  C  C     . ARG A 1  840  ? 28.935  -44.997  52.877  1.00 76.58  ? 840  ARG A C     1 
ATOM   6411  O  O     . ARG A 1  840  ? 29.956  -45.551  52.467  1.00 77.75  ? 840  ARG A O     1 
ATOM   6412  C  CB    . ARG A 1  840  ? 28.664  -42.716  53.948  1.00 75.56  ? 840  ARG A CB    1 
ATOM   6413  C  CG    . ARG A 1  840  ? 28.871  -41.216  53.735  1.00 92.28  ? 840  ARG A CG    1 
ATOM   6414  C  CD    . ARG A 1  840  ? 28.233  -40.346  54.791  1.00 109.88 ? 840  ARG A CD    1 
ATOM   6415  N  NE    . ARG A 1  840  ? 28.697  -40.648  56.142  1.00 118.60 ? 840  ARG A NE    1 
ATOM   6416  C  CZ    . ARG A 1  840  ? 27.966  -40.468  57.235  1.00 130.75 ? 840  ARG A CZ    1 
ATOM   6417  N  NH1   . ARG A 1  840  ? 26.731  -39.978  57.145  1.00 114.73 ? 840  ARG A NH1   1 
ATOM   6418  N  NH2   . ARG A 1  840  ? 28.457  -40.779  58.426  1.00 117.50 ? 840  ARG A NH2   1 
ATOM   6419  N  N     . LEU A 1  841  ? 27.910  -45.655  53.466  1.00 70.21  ? 841  LEU A N     1 
ATOM   6420  C  CA    . LEU A 1  841  ? 27.870  -47.099  53.730  1.00 68.50  ? 841  LEU A CA    1 
ATOM   6421  C  C     . LEU A 1  841  ? 28.287  -47.902  52.473  1.00 68.43  ? 841  LEU A C     1 
ATOM   6422  O  O     . LEU A 1  841  ? 29.220  -48.710  52.543  1.00 66.66  ? 841  LEU A O     1 
ATOM   6423  C  CB    . LEU A 1  841  ? 26.438  -47.479  54.162  1.00 67.85  ? 841  LEU A CB    1 
ATOM   6424  C  CG    . LEU A 1  841  ? 26.215  -47.773  55.634  1.00 72.29  ? 841  LEU A CG    1 
ATOM   6425  C  CD1   . LEU A 1  841  ? 26.592  -46.622  56.465  1.00 73.34  ? 841  LEU A CD1   1 
ATOM   6426  C  CD2   . LEU A 1  841  ? 24.765  -48.057  55.905  1.00 74.04  ? 841  LEU A CD2   1 
ATOM   6427  N  N     . VAL A 1  842  ? 27.624  -47.619  51.317  1.00 62.51  ? 842  VAL A N     1 
ATOM   6428  C  CA    . VAL A 1  842  ? 27.898  -48.243  50.020  1.00 61.04  ? 842  VAL A CA    1 
ATOM   6429  C  C     . VAL A 1  842  ? 29.358  -48.022  49.602  1.00 67.60  ? 842  VAL A C     1 
ATOM   6430  O  O     . VAL A 1  842  ? 30.082  -48.987  49.368  1.00 68.17  ? 842  VAL A O     1 
ATOM   6431  C  CB    . VAL A 1  842  ? 26.885  -47.813  48.936  1.00 61.97  ? 842  VAL A CB    1 
ATOM   6432  C  CG1   . VAL A 1  842  ? 27.419  -48.082  47.532  1.00 61.67  ? 842  VAL A CG1   1 
ATOM   6433  C  CG2   . VAL A 1  842  ? 25.539  -48.488  49.153  1.00 60.34  ? 842  VAL A CG2   1 
ATOM   6434  N  N     . LYS A 1  843  ? 29.806  -46.770  49.584  1.00 64.61  ? 843  LYS A N     1 
ATOM   6435  C  CA    . LYS A 1  843  ? 31.183  -46.479  49.223  1.00 64.77  ? 843  LYS A CA    1 
ATOM   6436  C  C     . LYS A 1  843  ? 32.214  -47.144  50.131  1.00 66.42  ? 843  LYS A C     1 
ATOM   6437  O  O     . LYS A 1  843  ? 33.265  -47.542  49.640  1.00 66.14  ? 843  LYS A O     1 
ATOM   6438  C  CB    . LYS A 1  843  ? 31.398  -44.968  49.074  1.00 67.11  ? 843  LYS A CB    1 
ATOM   6439  C  CG    . LYS A 1  843  ? 31.542  -44.516  47.622  1.00 66.95  ? 843  LYS A CG    1 
ATOM   6440  C  CD    . LYS A 1  843  ? 30.339  -44.782  46.765  1.00 75.21  ? 843  LYS A CD    1 
ATOM   6441  C  CE    . LYS A 1  843  ? 30.704  -44.682  45.299  1.00 101.81 ? 843  LYS A CE    1 
ATOM   6442  N  NZ    . LYS A 1  843  ? 29.496  -44.547  44.412  1.00 116.54 ? 843  LYS A NZ    1 
ATOM   6443  N  N     . ALA A 1  844  ? 31.872  -47.350  51.415  1.00 62.42  ? 844  ALA A N     1 
ATOM   6444  C  CA    . ALA A 1  844  ? 32.757  -47.973  52.415  1.00 63.32  ? 844  ALA A CA    1 
ATOM   6445  C  C     . ALA A 1  844  ? 32.825  -49.496  52.322  1.00 67.92  ? 844  ALA A C     1 
ATOM   6446  O  O     . ALA A 1  844  ? 33.783  -50.105  52.821  1.00 69.16  ? 844  ALA A O     1 
ATOM   6447  C  CB    . ALA A 1  844  ? 32.349  -47.559  53.828  1.00 63.57  ? 844  ALA A CB    1 
ATOM   6448  N  N     . LEU A 1  845  ? 31.792  -50.115  51.741  1.00 61.93  ? 845  LEU A N     1 
ATOM   6449  C  CA    . LEU A 1  845  ? 31.748  -51.562  51.675  1.00 60.66  ? 845  LEU A CA    1 
ATOM   6450  C  C     . LEU A 1  845  ? 31.775  -52.106  50.250  1.00 67.37  ? 845  LEU A C     1 
ATOM   6451  O  O     . LEU A 1  845  ? 32.203  -53.232  50.078  1.00 67.36  ? 845  LEU A O     1 
ATOM   6452  C  CB    . LEU A 1  845  ? 30.589  -52.133  52.516  1.00 59.03  ? 845  LEU A CB    1 
ATOM   6453  C  CG    . LEU A 1  845  ? 30.327  -51.551  53.920  1.00 61.68  ? 845  LEU A CG    1 
ATOM   6454  C  CD1   . LEU A 1  845  ? 29.151  -52.214  54.578  1.00 60.76  ? 845  LEU A CD1   1 
ATOM   6455  C  CD2   . LEU A 1  845  ? 31.504  -51.697  54.821  1.00 63.69  ? 845  LEU A CD2   1 
ATOM   6456  N  N     . GLU A 1  846  ? 31.354  -51.311  49.238  1.00 66.60  ? 846  GLU A N     1 
ATOM   6457  C  CA    . GLU A 1  846  ? 31.366  -51.596  47.786  1.00 68.51  ? 846  GLU A CA    1 
ATOM   6458  C  C     . GLU A 1  846  ? 32.029  -52.949  47.394  1.00 76.94  ? 846  GLU A C     1 
ATOM   6459  O  O     . GLU A 1  846  ? 31.334  -53.944  47.115  1.00 77.53  ? 846  GLU A O     1 
ATOM   6460  C  CB    . GLU A 1  846  ? 32.168  -50.482  47.081  1.00 70.82  ? 846  GLU A CB    1 
ATOM   6461  C  CG    . GLU A 1  846  ? 31.422  -49.296  46.498  1.00 81.54  ? 846  GLU A CG    1 
ATOM   6462  C  CD    . GLU A 1  846  ? 32.319  -48.432  45.628  1.00 100.88 ? 846  GLU A CD    1 
ATOM   6463  O  OE1   . GLU A 1  846  ? 33.436  -48.081  46.079  1.00 80.66  ? 846  GLU A OE1   1 
ATOM   6464  O  OE2   . GLU A 1  846  ? 31.926  -48.149  44.473  1.00 99.97  ? 846  GLU A OE2   1 
ATOM   6465  N  N     . ASP A 1  847  ? 33.401  -52.951  47.430  1.00 75.12  ? 847  ASP A N     1 
ATOM   6466  C  CA    . ASP A 1  847  ? 34.374  -54.005  47.092  1.00 75.99  ? 847  ASP A CA    1 
ATOM   6467  C  C     . ASP A 1  847  ? 34.463  -55.237  48.056  1.00 79.61  ? 847  ASP A C     1 
ATOM   6468  O  O     . ASP A 1  847  ? 35.295  -56.128  47.839  1.00 80.99  ? 847  ASP A O     1 
ATOM   6469  C  CB    . ASP A 1  847  ? 35.757  -53.369  46.877  1.00 79.08  ? 847  ASP A CB    1 
ATOM   6470  C  CG    . ASP A 1  847  ? 36.283  -52.695  48.134  1.00 101.99 ? 847  ASP A CG    1 
ATOM   6471  O  OD1   . ASP A 1  847  ? 35.550  -51.850  48.714  1.00 103.47 ? 847  ASP A OD1   1 
ATOM   6472  O  OD2   . ASP A 1  847  ? 37.416  -53.023  48.556  1.00 114.33 ? 847  ASP A OD2   1 
ATOM   6473  N  N     . ILE A 1  848  ? 33.610  -55.319  49.086  1.00 73.47  ? 848  ILE A N     1 
ATOM   6474  C  CA    . ILE A 1  848  ? 33.678  -56.503  49.929  1.00 72.80  ? 848  ILE A CA    1 
ATOM   6475  C  C     . ILE A 1  848  ? 32.876  -57.591  49.232  1.00 77.42  ? 848  ILE A C     1 
ATOM   6476  O  O     . ILE A 1  848  ? 31.707  -57.375  48.896  1.00 76.90  ? 848  ILE A O     1 
ATOM   6477  C  CB    . ILE A 1  848  ? 33.263  -56.311  51.430  1.00 74.51  ? 848  ILE A CB    1 
ATOM   6478  C  CG1   . ILE A 1  848  ? 33.841  -55.042  52.103  1.00 74.83  ? 848  ILE A CG1   1 
ATOM   6479  C  CG2   . ILE A 1  848  ? 33.558  -57.550  52.254  1.00 74.11  ? 848  ILE A CG2   1 
ATOM   6480  C  CD1   . ILE A 1  848  ? 35.324  -54.886  52.152  1.00 83.35  ? 848  ILE A CD1   1 
ATOM   6481  N  N     . MET A 1  849  ? 33.535  -58.727  48.951  1.00 74.62  ? 849  MET A N     1 
ATOM   6482  C  CA    . MET A 1  849  ? 32.891  -59.883  48.350  1.00 74.84  ? 849  MET A CA    1 
ATOM   6483  C  C     . MET A 1  849  ? 33.468  -61.198  48.851  1.00 77.73  ? 849  MET A C     1 
ATOM   6484  O  O     . MET A 1  849  ? 34.647  -61.264  49.196  1.00 77.77  ? 849  MET A O     1 
ATOM   6485  C  CB    . MET A 1  849  ? 32.847  -59.805  46.803  1.00 78.12  ? 849  MET A CB    1 
ATOM   6486  C  CG    . MET A 1  849  ? 34.124  -60.252  46.077  1.00 83.31  ? 849  MET A CG    1 
ATOM   6487  S  SD    . MET A 1  849  ? 33.775  -60.846  44.388  1.00 87.70  ? 849  MET A SD    1 
ATOM   6488  C  CE    . MET A 1  849  ? 35.371  -61.460  43.936  1.00 85.66  ? 849  MET A CE    1 
ATOM   6489  N  N     . VAL A 1  850  ? 32.623  -62.242  48.880  1.00 73.08  ? 850  VAL A N     1 
ATOM   6490  C  CA    . VAL A 1  850  ? 32.994  -63.599  49.262  1.00 72.86  ? 850  VAL A CA    1 
ATOM   6491  C  C     . VAL A 1  850  ? 33.858  -64.160  48.138  1.00 77.21  ? 850  VAL A C     1 
ATOM   6492  O  O     . VAL A 1  850  ? 33.455  -64.141  46.969  1.00 76.34  ? 850  VAL A O     1 
ATOM   6493  C  CB    . VAL A 1  850  ? 31.749  -64.483  49.511  1.00 76.04  ? 850  VAL A CB    1 
ATOM   6494  C  CG1   . VAL A 1  850  ? 32.134  -65.943  49.732  1.00 76.68  ? 850  VAL A CG1   1 
ATOM   6495  C  CG2   . VAL A 1  850  ? 30.936  -63.961  50.681  1.00 74.76  ? 850  VAL A CG2   1 
ATOM   6496  N  N     . HIS A 1  851  ? 35.056  -64.618  48.496  1.00 74.76  ? 851  HIS A N     1 
ATOM   6497  C  CA    . HIS A 1  851  ? 35.998  -65.194  47.544  1.00 75.93  ? 851  HIS A CA    1 
ATOM   6498  C  C     . HIS A 1  851  ? 35.836  -66.700  47.471  1.00 79.83  ? 851  HIS A C     1 
ATOM   6499  O  O     . HIS A 1  851  ? 35.087  -67.281  48.272  1.00 77.49  ? 851  HIS A O     1 
ATOM   6500  C  CB    . HIS A 1  851  ? 37.440  -64.782  47.881  1.00 77.30  ? 851  HIS A CB    1 
ATOM   6501  C  CG    . HIS A 1  851  ? 37.758  -63.389  47.445  1.00 80.12  ? 851  HIS A CG    1 
ATOM   6502  N  ND1   . HIS A 1  851  ? 38.558  -63.146  46.350  1.00 82.47  ? 851  HIS A ND1   1 
ATOM   6503  C  CD2   . HIS A 1  851  ? 37.332  -62.207  47.947  1.00 80.64  ? 851  HIS A CD2   1 
ATOM   6504  C  CE1   . HIS A 1  851  ? 38.616  -61.829  46.237  1.00 81.35  ? 851  HIS A CE1   1 
ATOM   6505  N  NE2   . HIS A 1  851  ? 37.880  -61.222  47.166  1.00 80.56  ? 851  HIS A NE2   1 
ATOM   6506  N  N     . TYR A 1  852  ? 36.536  -67.333  46.499  1.00 78.24  ? 852  TYR A N     1 
ATOM   6507  C  CA    . TYR A 1  852  ? 36.495  -68.780  46.269  1.00 79.11  ? 852  TYR A CA    1 
ATOM   6508  C  C     . TYR A 1  852  ? 37.143  -69.654  47.388  1.00 84.01  ? 852  TYR A C     1 
ATOM   6509  O  O     . TYR A 1  852  ? 37.497  -70.807  47.136  1.00 85.18  ? 852  TYR A O     1 
ATOM   6510  C  CB    . TYR A 1  852  ? 36.994  -69.127  44.853  1.00 81.33  ? 852  TYR A CB    1 
ATOM   6511  C  CG    . TYR A 1  852  ? 35.960  -68.926  43.766  1.00 82.80  ? 852  TYR A CG    1 
ATOM   6512  C  CD1   . TYR A 1  852  ? 36.034  -67.843  42.897  1.00 84.97  ? 852  TYR A CD1   1 
ATOM   6513  C  CD2   . TYR A 1  852  ? 34.944  -69.854  43.564  1.00 83.50  ? 852  TYR A CD2   1 
ATOM   6514  C  CE1   . TYR A 1  852  ? 35.100  -67.668  41.874  1.00 87.00  ? 852  TYR A CE1   1 
ATOM   6515  C  CE2   . TYR A 1  852  ? 33.989  -69.680  42.563  1.00 84.27  ? 852  TYR A CE2   1 
ATOM   6516  C  CZ    . TYR A 1  852  ? 34.073  -68.589  41.711  1.00 93.01  ? 852  TYR A CZ    1 
ATOM   6517  O  OH    . TYR A 1  852  ? 33.115  -68.405  40.732  1.00 90.90  ? 852  TYR A OH    1 
ATOM   6518  N  N     . ASP A 1  853  ? 37.268  -69.102  48.622  1.00 79.04  ? 853  ASP A N     1 
ATOM   6519  C  CA    . ASP A 1  853  ? 37.770  -69.776  49.825  1.00 79.05  ? 853  ASP A CA    1 
ATOM   6520  C  C     . ASP A 1  853  ? 36.888  -69.420  51.014  1.00 81.13  ? 853  ASP A C     1 
ATOM   6521  O  O     . ASP A 1  853  ? 37.299  -69.545  52.173  1.00 79.94  ? 853  ASP A O     1 
ATOM   6522  C  CB    . ASP A 1  853  ? 39.283  -69.486  50.095  1.00 82.11  ? 853  ASP A CB    1 
ATOM   6523  C  CG    . ASP A 1  853  ? 39.731  -68.060  50.422  1.00 87.93  ? 853  ASP A CG    1 
ATOM   6524  O  OD1   . ASP A 1  853  ? 38.925  -67.116  50.210  1.00 88.53  ? 853  ASP A OD1   1 
ATOM   6525  O  OD2   . ASP A 1  853  ? 40.922  -67.884  50.834  1.00 84.69  ? 853  ASP A OD2   1 
ATOM   6526  N  N     . ASN A 1  854  ? 35.663  -68.960  50.707  1.00 78.26  ? 854  ASN A N     1 
ATOM   6527  C  CA    . ASN A 1  854  ? 34.651  -68.496  51.662  1.00 78.00  ? 854  ASN A CA    1 
ATOM   6528  C  C     . ASN A 1  854  ? 35.078  -67.256  52.465  1.00 80.84  ? 854  ASN A C     1 
ATOM   6529  O  O     . ASN A 1  854  ? 34.299  -66.779  53.300  1.00 79.52  ? 854  ASN A O     1 
ATOM   6530  C  CB    . ASN A 1  854  ? 34.156  -69.623  52.588  1.00 82.71  ? 854  ASN A CB    1 
ATOM   6531  C  CG    . ASN A 1  854  ? 33.134  -70.531  51.959  1.00 110.15 ? 854  ASN A CG    1 
ATOM   6532  O  OD1   . ASN A 1  854  ? 32.016  -70.113  51.612  1.00 106.04 ? 854  ASN A OD1   1 
ATOM   6533  N  ND2   . ASN A 1  854  ? 33.484  -71.807  51.842  1.00 101.06 ? 854  ASN A ND2   1 
ATOM   6534  N  N     . THR A 1  855  ? 36.286  -66.716  52.192  1.00 77.40  ? 855  THR A N     1 
ATOM   6535  C  CA    . THR A 1  855  ? 36.766  -65.548  52.918  1.00 77.47  ? 855  THR A CA    1 
ATOM   6536  C  C     . THR A 1  855  ? 36.204  -64.241  52.384  1.00 82.37  ? 855  THR A C     1 
ATOM   6537  O  O     . THR A 1  855  ? 36.298  -63.966  51.187  1.00 83.24  ? 855  THR A O     1 
ATOM   6538  C  CB    . THR A 1  855  ? 38.282  -65.527  53.068  1.00 85.85  ? 855  THR A CB    1 
ATOM   6539  O  OG1   . THR A 1  855  ? 38.869  -65.277  51.801  1.00 85.67  ? 855  THR A OG1   1 
ATOM   6540  C  CG2   . THR A 1  855  ? 38.838  -66.795  53.704  1.00 85.65  ? 855  THR A CG2   1 
ATOM   6541  N  N     . THR A 1  856  ? 35.625  -63.438  53.288  1.00 78.02  ? 856  THR A N     1 
ATOM   6542  C  CA    . THR A 1  856  ? 35.043  -62.130  53.005  1.00 77.11  ? 856  THR A CA    1 
ATOM   6543  C  C     . THR A 1  856  ? 36.214  -61.133  52.963  1.00 82.76  ? 856  THR A C     1 
ATOM   6544  O  O     . THR A 1  856  ? 36.810  -60.822  54.003  1.00 83.28  ? 856  THR A O     1 
ATOM   6545  C  CB    . THR A 1  856  ? 33.950  -61.822  54.043  1.00 79.94  ? 856  THR A CB    1 
ATOM   6546  O  OG1   . THR A 1  856  ? 33.128  -62.971  54.218  1.00 80.10  ? 856  THR A OG1   1 
ATOM   6547  C  CG2   . THR A 1  856  ? 33.075  -60.682  53.651  1.00 75.47  ? 856  THR A CG2   1 
ATOM   6548  N  N     . ARG A 1  857  ? 36.597  -60.713  51.742  1.00 79.15  ? 857  ARG A N     1 
ATOM   6549  C  CA    . ARG A 1  857  ? 37.743  -59.834  51.518  1.00 79.43  ? 857  ARG A CA    1 
ATOM   6550  C  C     . ARG A 1  857  ? 37.428  -58.622  50.654  1.00 84.89  ? 857  ARG A C     1 
ATOM   6551  O  O     . ARG A 1  857  ? 36.495  -58.650  49.840  1.00 85.04  ? 857  ARG A O     1 
ATOM   6552  C  CB    . ARG A 1  857  ? 38.910  -60.617  50.875  1.00 78.64  ? 857  ARG A CB    1 
ATOM   6553  C  CG    . ARG A 1  857  ? 39.493  -61.733  51.725  1.00 80.82  ? 857  ARG A CG    1 
ATOM   6554  C  CD    . ARG A 1  857  ? 40.830  -62.158  51.180  1.00 80.60  ? 857  ARG A CD    1 
ATOM   6555  N  NE    . ARG A 1  857  ? 41.089  -63.578  51.404  1.00 89.19  ? 857  ARG A NE    1 
ATOM   6556  C  CZ    . ARG A 1  857  ? 42.295  -64.143  51.357  1.00 106.39 ? 857  ARG A CZ    1 
ATOM   6557  N  NH1   . ARG A 1  857  ? 43.374  -63.408  51.103  1.00 89.29  ? 857  ARG A NH1   1 
ATOM   6558  N  NH2   . ARG A 1  857  ? 42.429  -65.453  51.537  1.00 95.06  ? 857  ARG A NH2   1 
ATOM   6559  N  N     . ASN A 1  858  ? 38.267  -57.575  50.792  1.00 81.76  ? 858  ASN A N     1 
ATOM   6560  C  CA    . ASN A 1  858  ? 38.183  -56.340  50.017  1.00 80.93  ? 858  ASN A CA    1 
ATOM   6561  C  C     . ASN A 1  858  ? 39.106  -56.404  48.780  1.00 84.91  ? 858  ASN A C     1 
ATOM   6562  O  O     . ASN A 1  858  ? 39.759  -57.424  48.547  1.00 84.15  ? 858  ASN A O     1 
ATOM   6563  C  CB    . ASN A 1  858  ? 38.511  -55.134  50.904  1.00 80.33  ? 858  ASN A CB    1 
ATOM   6564  C  CG    . ASN A 1  858  ? 39.971  -54.890  51.133  1.00 106.11 ? 858  ASN A CG    1 
ATOM   6565  O  OD1   . ASN A 1  858  ? 40.760  -55.814  51.339  1.00 101.67 ? 858  ASN A OD1   1 
ATOM   6566  N  ND2   . ASN A 1  858  ? 40.362  -53.630  51.090  1.00 100.63 ? 858  ASN A ND2   1 
ATOM   6567  N  N     . SER A 1  859  ? 39.162  -55.297  48.012  1.00 82.80  ? 859  SER A N     1 
ATOM   6568  C  CA    . SER A 1  859  ? 39.958  -55.105  46.786  1.00 84.32  ? 859  SER A CA    1 
ATOM   6569  C  C     . SER A 1  859  ? 41.464  -55.390  46.988  1.00 88.78  ? 859  SER A C     1 
ATOM   6570  O  O     . SER A 1  859  ? 42.132  -55.932  46.089  1.00 89.48  ? 859  SER A O     1 
ATOM   6571  C  CB    . SER A 1  859  ? 39.757  -53.688  46.244  1.00 88.29  ? 859  SER A CB    1 
ATOM   6572  O  OG    . SER A 1  859  ? 40.067  -52.713  47.230  1.00 98.80  ? 859  SER A OG    1 
ATOM   6573  N  N     . LEU A 1  860  ? 41.976  -55.034  48.183  1.00 83.42  ? 860  LEU A N     1 
ATOM   6574  C  CA    . LEU A 1  860  ? 43.372  -55.219  48.585  1.00 83.29  ? 860  LEU A CA    1 
ATOM   6575  C  C     . LEU A 1  860  ? 43.659  -56.671  49.009  1.00 85.36  ? 860  LEU A C     1 
ATOM   6576  O  O     . LEU A 1  860  ? 44.815  -57.035  49.251  1.00 85.37  ? 860  LEU A O     1 
ATOM   6577  C  CB    . LEU A 1  860  ? 43.717  -54.246  49.728  1.00 82.85  ? 860  LEU A CB    1 
ATOM   6578  C  CG    . LEU A 1  860  ? 43.524  -52.754  49.455  1.00 86.70  ? 860  LEU A CG    1 
ATOM   6579  C  CD1   . LEU A 1  860  ? 43.358  -51.991  50.754  1.00 86.17  ? 860  LEU A CD1   1 
ATOM   6580  C  CD2   . LEU A 1  860  ? 44.681  -52.188  48.641  1.00 89.99  ? 860  LEU A CD2   1 
ATOM   6581  N  N     . GLY A 1  861  ? 42.603  -57.477  49.081  1.00 80.06  ? 861  GLY A N     1 
ATOM   6582  C  CA    . GLY A 1  861  ? 42.690  -58.870  49.485  1.00 79.90  ? 861  GLY A CA    1 
ATOM   6583  C  C     . GLY A 1  861  ? 42.860  -59.054  50.979  1.00 82.67  ? 861  GLY A C     1 
ATOM   6584  O  O     . GLY A 1  861  ? 43.390  -60.080  51.415  1.00 82.65  ? 861  GLY A O     1 
ATOM   6585  N  N     . ASN A 1  862  ? 42.424  -58.061  51.779  1.00 77.96  ? 862  ASN A N     1 
ATOM   6586  C  CA    . ASN A 1  862  ? 42.508  -58.153  53.234  1.00 77.15  ? 862  ASN A CA    1 
ATOM   6587  C  C     . ASN A 1  862  ? 41.261  -58.869  53.744  1.00 80.53  ? 862  ASN A C     1 
ATOM   6588  O  O     . ASN A 1  862  ? 40.169  -58.696  53.196  1.00 77.97  ? 862  ASN A O     1 
ATOM   6589  C  CB    . ASN A 1  862  ? 42.666  -56.777  53.913  1.00 75.52  ? 862  ASN A CB    1 
ATOM   6590  C  CG    . ASN A 1  862  ? 43.749  -55.859  53.363  1.00 102.39 ? 862  ASN A CG    1 
ATOM   6591  O  OD1   . ASN A 1  862  ? 44.833  -56.276  52.924  1.00 98.65  ? 862  ASN A OD1   1 
ATOM   6592  N  ND2   . ASN A 1  862  ? 43.492  -54.561  53.423  1.00 95.18  ? 862  ASN A ND2   1 
ATOM   6593  N  N     . VAL A 1  863  ? 41.439  -59.698  54.779  1.00 78.73  ? 863  VAL A N     1 
ATOM   6594  C  CA    . VAL A 1  863  ? 40.347  -60.448  55.397  1.00 77.79  ? 863  VAL A CA    1 
ATOM   6595  C  C     . VAL A 1  863  ? 39.543  -59.525  56.323  1.00 82.18  ? 863  VAL A C     1 
ATOM   6596  O  O     . VAL A 1  863  ? 40.116  -58.780  57.138  1.00 81.95  ? 863  VAL A O     1 
ATOM   6597  C  CB    . VAL A 1  863  ? 40.848  -61.723  56.120  1.00 81.55  ? 863  VAL A CB    1 
ATOM   6598  C  CG1   . VAL A 1  863  ? 39.688  -62.538  56.689  1.00 80.58  ? 863  VAL A CG1   1 
ATOM   6599  C  CG2   . VAL A 1  863  ? 41.673  -62.582  55.178  1.00 82.30  ? 863  VAL A CG2   1 
ATOM   6600  N  N     . ILE A 1  864  ? 38.206  -59.567  56.154  1.00 77.45  ? 864  ILE A N     1 
ATOM   6601  C  CA    . ILE A 1  864  ? 37.226  -58.811  56.943  1.00 74.99  ? 864  ILE A CA    1 
ATOM   6602  C  C     . ILE A 1  864  ? 36.493  -59.828  57.818  1.00 78.14  ? 864  ILE A C     1 
ATOM   6603  O  O     . ILE A 1  864  ? 36.166  -59.527  58.968  1.00 77.17  ? 864  ILE A O     1 
ATOM   6604  C  CB    . ILE A 1  864  ? 36.248  -58.017  56.034  1.00 76.07  ? 864  ILE A CB    1 
ATOM   6605  C  CG1   . ILE A 1  864  ? 36.923  -57.430  54.771  1.00 76.06  ? 864  ILE A CG1   1 
ATOM   6606  C  CG2   . ILE A 1  864  ? 35.486  -56.974  56.820  1.00 75.65  ? 864  ILE A CG2   1 
ATOM   6607  C  CD1   . ILE A 1  864  ? 37.981  -56.373  54.960  1.00 78.68  ? 864  ILE A CD1   1 
ATOM   6608  N  N     . GLN A 1  865  ? 36.235  -61.032  57.244  1.00 74.51  ? 865  GLN A N     1 
ATOM   6609  C  CA    . GLN A 1  865  ? 35.585  -62.198  57.853  1.00 74.06  ? 865  GLN A CA    1 
ATOM   6610  C  C     . GLN A 1  865  ? 36.220  -63.454  57.244  1.00 78.86  ? 865  GLN A C     1 
ATOM   6611  O  O     . GLN A 1  865  ? 36.427  -63.500  56.030  1.00 78.41  ? 865  GLN A O     1 
ATOM   6612  C  CB    . GLN A 1  865  ? 34.047  -62.219  57.613  1.00 74.29  ? 865  GLN A CB    1 
ATOM   6613  C  CG    . GLN A 1  865  ? 33.339  -60.860  57.638  1.00 78.66  ? 865  GLN A CG    1 
ATOM   6614  C  CD    . GLN A 1  865  ? 31.899  -60.954  58.053  1.00 95.06  ? 865  GLN A CD    1 
ATOM   6615  O  OE1   . GLN A 1  865  ? 31.042  -61.482  57.333  1.00 90.44  ? 865  GLN A OE1   1 
ATOM   6616  N  NE2   . GLN A 1  865  ? 31.595  -60.388  59.209  1.00 87.52  ? 865  GLN A NE2   1 
ATOM   6617  N  N     . PHE A 1  866  ? 36.527  -64.466  58.077  1.00 76.33  ? 866  PHE A N     1 
ATOM   6618  C  CA    . PHE A 1  866  ? 37.147  -65.735  57.654  1.00 77.08  ? 866  PHE A CA    1 
ATOM   6619  C  C     . PHE A 1  866  ? 36.153  -66.754  57.037  1.00 84.24  ? 866  PHE A C     1 
ATOM   6620  O  O     . PHE A 1  866  ? 36.563  -67.676  56.315  1.00 85.82  ? 866  PHE A O     1 
ATOM   6621  C  CB    . PHE A 1  866  ? 37.980  -66.339  58.797  1.00 78.54  ? 866  PHE A CB    1 
ATOM   6622  C  CG    . PHE A 1  866  ? 39.208  -65.521  59.138  1.00 79.54  ? 866  PHE A CG    1 
ATOM   6623  C  CD1   . PHE A 1  866  ? 39.146  -64.501  60.079  1.00 82.01  ? 866  PHE A CD1   1 
ATOM   6624  C  CD2   . PHE A 1  866  ? 40.426  -65.775  58.522  1.00 81.77  ? 866  PHE A CD2   1 
ATOM   6625  C  CE1   . PHE A 1  866  ? 40.280  -63.744  60.391  1.00 83.31  ? 866  PHE A CE1   1 
ATOM   6626  C  CE2   . PHE A 1  866  ? 41.555  -65.012  58.824  1.00 85.01  ? 866  PHE A CE2   1 
ATOM   6627  C  CZ    . PHE A 1  866  ? 41.474  -63.996  59.751  1.00 82.90  ? 866  PHE A CZ    1 
ATOM   6628  N  N     . ILE A 1  867  ? 34.850  -66.586  57.365  1.00 80.15  ? 867  ILE A N     1 
ATOM   6629  C  CA    . ILE A 1  867  ? 33.661  -67.314  56.885  1.00 79.19  ? 867  ILE A CA    1 
ATOM   6630  C  C     . ILE A 1  867  ? 32.606  -66.214  56.847  1.00 81.15  ? 867  ILE A C     1 
ATOM   6631  O  O     . ILE A 1  867  ? 32.514  -65.436  57.806  1.00 80.19  ? 867  ILE A O     1 
ATOM   6632  C  CB    . ILE A 1  867  ? 33.192  -68.517  57.768  1.00 82.51  ? 867  ILE A CB    1 
ATOM   6633  C  CG1   . ILE A 1  867  ? 34.268  -68.942  58.825  1.00 85.81  ? 867  ILE A CG1   1 
ATOM   6634  C  CG2   . ILE A 1  867  ? 32.782  -69.688  56.886  1.00 81.07  ? 867  ILE A CG2   1 
ATOM   6635  C  CD1   . ILE A 1  867  ? 33.830  -69.981  60.138  1.00 102.33 ? 867  ILE A CD1   1 
ATOM   6636  N  N     . TYR A 1  868  ? 31.865  -66.087  55.731  1.00 76.19  ? 868  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  868  ? 30.869  -65.026  55.632  1.00 74.41  ? 868  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  868  ? 29.762  -65.120  56.678  1.00 73.53  ? 868  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  868  ? 29.081  -66.136  56.798  1.00 72.75  ? 868  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  868  ? 30.337  -64.846  54.196  1.00 76.64  ? 868  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  868  ? 29.038  -64.066  54.080  1.00 78.29  ? 868  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  868  ? 28.964  -62.729  54.464  1.00 79.28  ? 868  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  868  ? 27.889  -64.660  53.572  1.00 79.27  ? 868  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  868  ? 27.755  -62.037  54.432  1.00 78.74  ? 868  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  868  ? 26.690  -63.955  53.474  1.00 79.47  ? 868  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  868  ? 26.628  -62.641  53.901  1.00 83.15  ? 868  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  868  ? 25.447  -61.945  53.787  1.00 80.40  ? 868  TYR A OH    1 
ATOM   6648  N  N     . GLY A 1  869  ? 29.626  -64.049  57.439  1.00 67.43  ? 869  GLY A N     1 
ATOM   6649  C  CA    . GLY A 1  869  ? 28.639  -63.941  58.498  1.00 65.83  ? 869  GLY A CA    1 
ATOM   6650  C  C     . GLY A 1  869  ? 28.889  -64.938  59.602  1.00 68.80  ? 869  GLY A C     1 
ATOM   6651  O  O     . GLY A 1  869  ? 27.955  -65.327  60.292  1.00 68.53  ? 869  GLY A O     1 
ATOM   6652  N  N     . GLU A 1  870  ? 30.158  -65.361  59.764  1.00 65.02  ? 870  GLU A N     1 
ATOM   6653  C  CA    . GLU A 1  870  ? 30.637  -66.315  60.771  1.00 64.62  ? 870  GLU A CA    1 
ATOM   6654  C  C     . GLU A 1  870  ? 30.168  -67.773  60.516  1.00 68.95  ? 870  GLU A C     1 
ATOM   6655  O  O     . GLU A 1  870  ? 30.500  -68.671  61.298  1.00 69.17  ? 870  GLU A O     1 
ATOM   6656  C  CB    . GLU A 1  870  ? 30.395  -65.801  62.225  1.00 64.97  ? 870  GLU A CB    1 
ATOM   6657  C  CG    . GLU A 1  870  ? 31.089  -64.480  62.507  1.00 70.06  ? 870  GLU A CG    1 
ATOM   6658  C  CD    . GLU A 1  870  ? 30.805  -63.720  63.790  1.00 94.52  ? 870  GLU A CD    1 
ATOM   6659  O  OE1   . GLU A 1  870  ? 30.431  -64.347  64.807  1.00 86.90  ? 870  GLU A OE1   1 
ATOM   6660  O  OE2   . GLU A 1  870  ? 31.018  -62.485  63.788  1.00 92.55  ? 870  GLU A OE2   1 
ATOM   6661  N  N     . ASP A 1  871  ? 29.450  -68.010  59.398  1.00 65.93  ? 871  ASP A N     1 
ATOM   6662  C  CA    . ASP A 1  871  ? 28.903  -69.325  59.059  1.00 67.33  ? 871  ASP A CA    1 
ATOM   6663  C  C     . ASP A 1  871  ? 28.975  -69.776  57.600  1.00 71.82  ? 871  ASP A C     1 
ATOM   6664  O  O     . ASP A 1  871  ? 28.616  -70.930  57.329  1.00 73.06  ? 871  ASP A O     1 
ATOM   6665  C  CB    . ASP A 1  871  ? 27.440  -69.435  59.534  1.00 69.48  ? 871  ASP A CB    1 
ATOM   6666  C  CG    . ASP A 1  871  ? 26.446  -68.543  58.811  1.00 77.57  ? 871  ASP A CG    1 
ATOM   6667  O  OD1   . ASP A 1  871  ? 26.846  -67.868  57.840  1.00 76.73  ? 871  ASP A OD1   1 
ATOM   6668  O  OD2   . ASP A 1  871  ? 25.273  -68.493  59.241  1.00 83.34  ? 871  ASP A OD2   1 
ATOM   6669  N  N     . GLY A 1  872  ? 29.312  -68.855  56.687  1.00 66.65  ? 872  GLY A N     1 
ATOM   6670  C  CA    . GLY A 1  872  ? 29.419  -69.108  55.250  1.00 66.41  ? 872  GLY A CA    1 
ATOM   6671  C  C     . GLY A 1  872  ? 28.109  -69.536  54.626  1.00 70.99  ? 872  GLY A C     1 
ATOM   6672  O  O     . GLY A 1  872  ? 28.081  -70.339  53.693  1.00 71.27  ? 872  GLY A O     1 
ATOM   6673  N  N     . MET A 1  873  ? 27.017  -68.994  55.154  1.00 67.50  ? 873  MET A N     1 
ATOM   6674  C  CA    . MET A 1  873  ? 25.648  -69.244  54.719  1.00 66.90  ? 873  MET A CA    1 
ATOM   6675  C  C     . MET A 1  873  ? 25.099  -67.986  54.013  1.00 67.54  ? 873  MET A C     1 
ATOM   6676  O  O     . MET A 1  873  ? 25.473  -66.870  54.374  1.00 63.35  ? 873  MET A O     1 
ATOM   6677  C  CB    . MET A 1  873  ? 24.802  -69.593  55.963  1.00 69.12  ? 873  MET A CB    1 
ATOM   6678  C  CG    . MET A 1  873  ? 23.918  -70.803  55.817  1.00 73.28  ? 873  MET A CG    1 
ATOM   6679  S  SD    . MET A 1  873  ? 24.700  -72.290  55.143  1.00 78.84  ? 873  MET A SD    1 
ATOM   6680  C  CE    . MET A 1  873  ? 25.874  -72.650  56.389  1.00 76.84  ? 873  MET A CE    1 
ATOM   6681  N  N     . ASP A 1  874  ? 24.250  -68.179  52.989  1.00 67.10  ? 874  ASP A N     1 
ATOM   6682  C  CA    . ASP A 1  874  ? 23.608  -67.092  52.234  1.00 67.71  ? 874  ASP A CA    1 
ATOM   6683  C  C     . ASP A 1  874  ? 22.328  -66.747  52.990  1.00 73.09  ? 874  ASP A C     1 
ATOM   6684  O  O     . ASP A 1  874  ? 21.516  -67.635  53.268  1.00 74.39  ? 874  ASP A O     1 
ATOM   6685  C  CB    . ASP A 1  874  ? 23.304  -67.531  50.787  1.00 70.63  ? 874  ASP A CB    1 
ATOM   6686  C  CG    . ASP A 1  874  ? 22.599  -66.518  49.891  1.00 85.78  ? 874  ASP A CG    1 
ATOM   6687  O  OD1   . ASP A 1  874  ? 21.420  -66.187  50.174  1.00 84.79  ? 874  ASP A OD1   1 
ATOM   6688  O  OD2   . ASP A 1  874  ? 23.162  -66.183  48.817  1.00 96.97  ? 874  ASP A OD2   1 
ATOM   6689  N  N     . ALA A 1  875  ? 22.176  -65.459  53.338  1.00 68.26  ? 875  ALA A N     1 
ATOM   6690  C  CA    . ALA A 1  875  ? 21.089  -64.857  54.107  1.00 66.87  ? 875  ALA A CA    1 
ATOM   6691  C  C     . ALA A 1  875  ? 19.649  -65.235  53.697  1.00 72.45  ? 875  ALA A C     1 
ATOM   6692  O  O     . ALA A 1  875  ? 18.795  -65.338  54.569  1.00 71.27  ? 875  ALA A O     1 
ATOM   6693  C  CB    . ALA A 1  875  ? 21.260  -63.363  54.103  1.00 66.46  ? 875  ALA A CB    1 
ATOM   6694  N  N     . ALA A 1  876  ? 19.390  -65.461  52.383  1.00 71.21  ? 876  ALA A N     1 
ATOM   6695  C  CA    . ALA A 1  876  ? 18.081  -65.821  51.811  1.00 71.30  ? 876  ALA A CA    1 
ATOM   6696  C  C     . ALA A 1  876  ? 17.639  -67.216  52.232  1.00 78.01  ? 876  ALA A C     1 
ATOM   6697  O  O     . ALA A 1  876  ? 16.448  -67.497  52.385  1.00 77.22  ? 876  ALA A O     1 
ATOM   6698  C  CB    . ALA A 1  876  ? 18.163  -65.750  50.304  1.00 72.07  ? 876  ALA A CB    1 
ATOM   6699  N  N     . HIS A 1  877  ? 18.627  -68.077  52.450  1.00 77.60  ? 877  HIS A N     1 
ATOM   6700  C  CA    . HIS A 1  877  ? 18.483  -69.477  52.822  1.00 78.94  ? 877  HIS A CA    1 
ATOM   6701  C  C     . HIS A 1  877  ? 18.497  -69.726  54.333  1.00 81.18  ? 877  HIS A C     1 
ATOM   6702  O  O     . HIS A 1  877  ? 18.821  -70.828  54.770  1.00 81.16  ? 877  HIS A O     1 
ATOM   6703  C  CB    . HIS A 1  877  ? 19.612  -70.258  52.149  1.00 81.17  ? 877  HIS A CB    1 
ATOM   6704  C  CG    . HIS A 1  877  ? 19.632  -70.154  50.653  1.00 85.27  ? 877  HIS A CG    1 
ATOM   6705  N  ND1   . HIS A 1  877  ? 18.841  -70.967  49.862  1.00 87.80  ? 877  HIS A ND1   1 
ATOM   6706  C  CD2   . HIS A 1  877  ? 20.379  -69.360  49.853  1.00 87.16  ? 877  HIS A CD2   1 
ATOM   6707  C  CE1   . HIS A 1  877  ? 19.112  -70.627  48.615  1.00 87.57  ? 877  HIS A CE1   1 
ATOM   6708  N  NE2   . HIS A 1  877  ? 20.036  -69.668  48.560  1.00 87.53  ? 877  HIS A NE2   1 
ATOM   6709  N  N     . ILE A 1  878  ? 18.094  -68.731  55.119  1.00 77.12  ? 878  ILE A N     1 
ATOM   6710  C  CA    . ILE A 1  878  ? 18.116  -68.792  56.578  1.00 76.86  ? 878  ILE A CA    1 
ATOM   6711  C  C     . ILE A 1  878  ? 16.754  -68.448  57.191  1.00 80.77  ? 878  ILE A C     1 
ATOM   6712  O  O     . ILE A 1  878  ? 16.121  -67.487  56.756  1.00 81.85  ? 878  ILE A O     1 
ATOM   6713  C  CB    . ILE A 1  878  ? 19.264  -67.831  57.019  1.00 79.18  ? 878  ILE A CB    1 
ATOM   6714  C  CG1   . ILE A 1  878  ? 20.605  -68.578  57.087  1.00 80.34  ? 878  ILE A CG1   1 
ATOM   6715  C  CG2   . ILE A 1  878  ? 18.982  -67.019  58.289  1.00 78.54  ? 878  ILE A CG2   1 
ATOM   6716  C  CD1   . ILE A 1  878  ? 21.732  -67.773  56.534  1.00 89.01  ? 878  ILE A CD1   1 
ATOM   6717  N  N     . GLU A 1  879  ? 16.309  -69.218  58.200  1.00 75.25  ? 879  GLU A N     1 
ATOM   6718  C  CA    . GLU A 1  879  ? 15.053  -68.930  58.905  1.00 74.08  ? 879  GLU A CA    1 
ATOM   6719  C  C     . GLU A 1  879  ? 15.072  -69.193  60.420  1.00 78.82  ? 879  GLU A C     1 
ATOM   6720  O  O     . GLU A 1  879  ? 15.813  -70.066  60.890  1.00 79.15  ? 879  GLU A O     1 
ATOM   6721  C  CB    . GLU A 1  879  ? 13.826  -69.549  58.223  1.00 75.30  ? 879  GLU A CB    1 
ATOM   6722  C  CG    . GLU A 1  879  ? 14.097  -70.772  57.374  1.00 80.73  ? 879  GLU A CG    1 
ATOM   6723  C  CD    . GLU A 1  879  ? 12.861  -71.330  56.694  1.00 96.53  ? 879  GLU A CD    1 
ATOM   6724  O  OE1   . GLU A 1  879  ? 12.972  -71.760  55.519  1.00 78.24  ? 879  GLU A OE1   1 
ATOM   6725  O  OE2   . GLU A 1  879  ? 11.782  -71.342  57.334  1.00 82.33  ? 879  GLU A OE2   1 
ATOM   6726  N  N     . LYS A 1  880  ? 14.268  -68.422  61.185  1.00 75.16  ? 880  LYS A N     1 
ATOM   6727  C  CA    . LYS A 1  880  ? 14.167  -68.590  62.639  1.00 75.98  ? 880  LYS A CA    1 
ATOM   6728  C  C     . LYS A 1  880  ? 13.578  -69.957  62.913  1.00 82.34  ? 880  LYS A C     1 
ATOM   6729  O  O     . LYS A 1  880  ? 12.526  -70.297  62.363  1.00 82.11  ? 880  LYS A O     1 
ATOM   6730  C  CB    . LYS A 1  880  ? 13.222  -67.542  63.265  1.00 78.88  ? 880  LYS A CB    1 
ATOM   6731  C  CG    . LYS A 1  880  ? 13.876  -66.330  63.924  1.00 95.67  ? 880  LYS A CG    1 
ATOM   6732  C  CD    . LYS A 1  880  ? 12.807  -65.223  64.127  1.00 106.86 ? 880  LYS A CD    1 
ATOM   6733  C  CE    . LYS A 1  880  ? 13.345  -63.806  64.197  1.00 112.48 ? 880  LYS A CE    1 
ATOM   6734  N  NZ    . LYS A 1  880  ? 12.251  -62.790  64.183  1.00 115.15 ? 880  LYS A NZ    1 
ATOM   6735  N  N     . GLN A 1  881  ? 14.270  -70.752  63.730  1.00 80.66  ? 881  GLN A N     1 
ATOM   6736  C  CA    . GLN A 1  881  ? 13.793  -72.067  64.183  1.00 81.86  ? 881  GLN A CA    1 
ATOM   6737  C  C     . GLN A 1  881  ? 14.271  -72.297  65.609  1.00 87.21  ? 881  GLN A C     1 
ATOM   6738  O  O     . GLN A 1  881  ? 15.397  -71.897  65.928  1.00 87.26  ? 881  GLN A O     1 
ATOM   6739  C  CB    . GLN A 1  881  ? 14.082  -73.233  63.204  1.00 83.26  ? 881  GLN A CB    1 
ATOM   6740  C  CG    . GLN A 1  881  ? 15.450  -73.201  62.528  1.00 77.27  ? 881  GLN A CG    1 
ATOM   6741  C  CD    . GLN A 1  881  ? 15.554  -74.125  61.335  1.00 77.03  ? 881  GLN A CD    1 
ATOM   6742  O  OE1   . GLN A 1  881  ? 15.111  -75.293  61.350  1.00 70.76  ? 881  GLN A OE1   1 
ATOM   6743  N  NE2   . GLN A 1  881  ? 16.208  -73.635  60.294  1.00 57.17  ? 881  GLN A NE2   1 
ATOM   6744  N  N     . SER A 1  882  ? 13.381  -72.831  66.490  1.00 83.75  ? 882  SER A N     1 
ATOM   6745  C  CA    . SER A 1  882  ? 13.662  -73.030  67.917  1.00 83.32  ? 882  SER A CA    1 
ATOM   6746  C  C     . SER A 1  882  ? 14.650  -74.130  68.202  1.00 88.56  ? 882  SER A C     1 
ATOM   6747  O  O     . SER A 1  882  ? 14.490  -75.247  67.703  1.00 88.47  ? 882  SER A O     1 
ATOM   6748  C  CB    . SER A 1  882  ? 12.381  -73.294  68.695  1.00 86.35  ? 882  SER A CB    1 
ATOM   6749  O  OG    . SER A 1  882  ? 11.956  -74.633  68.512  1.00 96.13  ? 882  SER A OG    1 
ATOM   6750  N  N     . LEU A 1  883  ? 15.653  -73.816  69.038  1.00 86.72  ? 883  LEU A N     1 
ATOM   6751  C  CA    . LEU A 1  883  ? 16.671  -74.762  69.501  1.00 88.08  ? 883  LEU A CA    1 
ATOM   6752  C  C     . LEU A 1  883  ? 16.104  -75.460  70.758  1.00 94.19  ? 883  LEU A C     1 
ATOM   6753  O  O     . LEU A 1  883  ? 16.098  -74.897  71.860  1.00 93.46  ? 883  LEU A O     1 
ATOM   6754  C  CB    . LEU A 1  883  ? 18.023  -74.057  69.743  1.00 87.42  ? 883  LEU A CB    1 
ATOM   6755  C  CG    . LEU A 1  883  ? 18.806  -73.728  68.464  1.00 91.58  ? 883  LEU A CG    1 
ATOM   6756  C  CD1   . LEU A 1  883  ? 19.137  -72.270  68.383  1.00 90.75  ? 883  LEU A CD1   1 
ATOM   6757  C  CD2   . LEU A 1  883  ? 20.067  -74.542  68.362  1.00 94.82  ? 883  LEU A CD2   1 
ATOM   6758  N  N     . ASP A 1  884  ? 15.542  -76.661  70.550  1.00 92.24  ? 884  ASP A N     1 
ATOM   6759  C  CA    . ASP A 1  884  ? 14.846  -77.427  71.579  1.00 93.39  ? 884  ASP A CA    1 
ATOM   6760  C  C     . ASP A 1  884  ? 15.653  -77.936  72.803  1.00 97.44  ? 884  ASP A C     1 
ATOM   6761  O  O     . ASP A 1  884  ? 15.041  -78.309  73.811  1.00 98.62  ? 884  ASP A O     1 
ATOM   6762  C  CB    . ASP A 1  884  ? 13.927  -78.480  70.945  1.00 96.55  ? 884  ASP A CB    1 
ATOM   6763  C  CG    . ASP A 1  884  ? 12.897  -77.903  69.978  1.00 108.36 ? 884  ASP A CG    1 
ATOM   6764  O  OD1   . ASP A 1  884  ? 12.224  -76.907  70.345  1.00 109.28 ? 884  ASP A OD1   1 
ATOM   6765  O  OD2   . ASP A 1  884  ? 12.747  -78.462  68.865  1.00 112.32 ? 884  ASP A OD2   1 
ATOM   6766  N  N     . THR A 1  885  ? 17.005  -77.911  72.743  1.00 91.27  ? 885  THR A N     1 
ATOM   6767  C  CA    . THR A 1  885  ? 17.822  -78.306  73.893  1.00 90.02  ? 885  THR A CA    1 
ATOM   6768  C  C     . THR A 1  885  ? 18.024  -77.139  74.882  1.00 91.66  ? 885  THR A C     1 
ATOM   6769  O  O     . THR A 1  885  ? 18.397  -77.387  76.018  1.00 92.37  ? 885  THR A O     1 
ATOM   6770  C  CB    . THR A 1  885  ? 19.150  -79.046  73.502  1.00 93.14  ? 885  THR A CB    1 
ATOM   6771  O  OG1   . THR A 1  885  ? 19.735  -78.536  72.306  1.00 90.61  ? 885  THR A OG1   1 
ATOM   6772  C  CG2   . THR A 1  885  ? 18.979  -80.532  73.368  1.00 92.34  ? 885  THR A CG2   1 
ATOM   6773  N  N     . ILE A 1  886  ? 17.781  -75.880  74.475  1.00 85.32  ? 886  ILE A N     1 
ATOM   6774  C  CA    . ILE A 1  886  ? 18.046  -74.733  75.357  1.00 83.52  ? 886  ILE A CA    1 
ATOM   6775  C  C     . ILE A 1  886  ? 17.010  -74.409  76.431  1.00 86.62  ? 886  ILE A C     1 
ATOM   6776  O  O     . ILE A 1  886  ? 17.378  -73.972  77.511  1.00 86.52  ? 886  ILE A O     1 
ATOM   6777  C  CB    . ILE A 1  886  ? 18.557  -73.478  74.594  1.00 85.10  ? 886  ILE A CB    1 
ATOM   6778  C  CG1   . ILE A 1  886  ? 19.460  -72.609  75.473  1.00 84.75  ? 886  ILE A CG1   1 
ATOM   6779  C  CG2   . ILE A 1  886  ? 17.409  -72.680  73.975  1.00 86.72  ? 886  ILE A CG2   1 
ATOM   6780  C  CD1   . ILE A 1  886  ? 19.779  -71.220  74.967  1.00 94.79  ? 886  ILE A CD1   1 
ATOM   6781  N  N     . GLY A 1  887  ? 15.740  -74.581  76.135  1.00 82.95  ? 887  GLY A N     1 
ATOM   6782  C  CA    . GLY A 1  887  ? 14.719  -74.190  77.095  1.00 83.07  ? 887  GLY A CA    1 
ATOM   6783  C  C     . GLY A 1  887  ? 14.184  -75.279  77.985  1.00 87.50  ? 887  GLY A C     1 
ATOM   6784  O  O     . GLY A 1  887  ? 14.683  -76.406  77.969  1.00 87.67  ? 887  GLY A O     1 
ATOM   6785  N  N     . GLY A 1  888  ? 13.159  -74.911  78.755  1.00 84.16  ? 888  GLY A N     1 
ATOM   6786  C  CA    . GLY A 1  888  ? 12.421  -75.800  79.646  1.00 85.11  ? 888  GLY A CA    1 
ATOM   6787  C  C     . GLY A 1  888  ? 13.184  -76.234  80.870  1.00 89.26  ? 888  GLY A C     1 
ATOM   6788  O  O     . GLY A 1  888  ? 14.343  -75.850  81.052  1.00 87.80  ? 888  GLY A O     1 
ATOM   6789  N  N     . SER A 1  889  ? 12.531  -77.033  81.727  1.00 87.77  ? 889  SER A N     1 
ATOM   6790  C  CA    . SER A 1  889  ? 13.176  -77.532  82.946  1.00 88.48  ? 889  SER A CA    1 
ATOM   6791  C  C     . SER A 1  889  ? 14.061  -78.735  82.645  1.00 92.50  ? 889  SER A C     1 
ATOM   6792  O  O     . SER A 1  889  ? 13.961  -79.335  81.566  1.00 91.48  ? 889  SER A O     1 
ATOM   6793  C  CB    . SER A 1  889  ? 12.147  -77.861  84.026  1.00 93.28  ? 889  SER A CB    1 
ATOM   6794  O  OG    . SER A 1  889  ? 11.424  -79.050  83.755  1.00 103.14 ? 889  SER A OG    1 
ATOM   6795  N  N     . ASP A 1  890  ? 14.932  -79.082  83.595  1.00 89.97  ? 890  ASP A N     1 
ATOM   6796  C  CA    . ASP A 1  890  ? 15.811  -80.235  83.446  1.00 90.89  ? 890  ASP A CA    1 
ATOM   6797  C  C     . ASP A 1  890  ? 14.952  -81.518  83.394  1.00 95.93  ? 890  ASP A C     1 
ATOM   6798  O  O     . ASP A 1  890  ? 15.223  -82.404  82.575  1.00 96.78  ? 890  ASP A O     1 
ATOM   6799  C  CB    . ASP A 1  890  ? 16.853  -80.273  84.578  1.00 93.51  ? 890  ASP A CB    1 
ATOM   6800  C  CG    . ASP A 1  890  ? 17.740  -79.039  84.659  1.00 106.68 ? 890  ASP A CG    1 
ATOM   6801  O  OD1   . ASP A 1  890  ? 18.223  -78.577  83.590  1.00 106.53 ? 890  ASP A OD1   1 
ATOM   6802  O  OD2   . ASP A 1  890  ? 17.983  -78.555  85.793  1.00 113.87 ? 890  ASP A OD2   1 
ATOM   6803  N  N     . ALA A 1  891  ? 13.861  -81.560  84.201  1.00 90.83  ? 891  ALA A N     1 
ATOM   6804  C  CA    . ALA A 1  891  ? 12.889  -82.658  84.258  1.00 90.61  ? 891  ALA A CA    1 
ATOM   6805  C  C     . ALA A 1  891  ? 12.189  -82.806  82.922  1.00 90.60  ? 891  ALA A C     1 
ATOM   6806  O  O     . ALA A 1  891  ? 11.997  -83.921  82.438  1.00 89.29  ? 891  ALA A O     1 
ATOM   6807  C  CB    . ALA A 1  891  ? 11.860  -82.368  85.334  1.00 92.34  ? 891  ALA A CB    1 
ATOM   6808  N  N     . ALA A 1  892  ? 11.825  -81.651  82.330  1.00 86.25  ? 892  ALA A N     1 
ATOM   6809  C  CA    . ALA A 1  892  ? 11.157  -81.503  81.043  1.00 85.13  ? 892  ALA A CA    1 
ATOM   6810  C  C     . ALA A 1  892  ? 12.061  -81.955  79.909  1.00 87.17  ? 892  ALA A C     1 
ATOM   6811  O  O     . ALA A 1  892  ? 11.561  -82.581  78.968  1.00 86.81  ? 892  ALA A O     1 
ATOM   6812  C  CB    . ALA A 1  892  ? 10.761  -80.063  80.848  1.00 84.91  ? 892  ALA A CB    1 
ATOM   6813  N  N     . PHE A 1  893  ? 13.391  -81.650  80.009  1.00 82.55  ? 893  PHE A N     1 
ATOM   6814  C  CA    . PHE A 1  893  ? 14.438  -82.064  79.055  1.00 81.86  ? 893  PHE A CA    1 
ATOM   6815  C  C     . PHE A 1  893  ? 14.597  -83.582  79.156  1.00 87.90  ? 893  PHE A C     1 
ATOM   6816  O  O     . PHE A 1  893  ? 14.595  -84.276  78.133  1.00 86.60  ? 893  PHE A O     1 
ATOM   6817  C  CB    . PHE A 1  893  ? 15.783  -81.366  79.377  1.00 82.32  ? 893  PHE A CB    1 
ATOM   6818  C  CG    . PHE A 1  893  ? 17.003  -81.749  78.553  1.00 82.91  ? 893  PHE A CG    1 
ATOM   6819  C  CD1   . PHE A 1  893  ? 17.502  -80.892  77.580  1.00 84.08  ? 893  PHE A CD1   1 
ATOM   6820  C  CD2   . PHE A 1  893  ? 17.715  -82.915  78.827  1.00 85.62  ? 893  PHE A CD2   1 
ATOM   6821  C  CE1   . PHE A 1  893  ? 18.657  -81.219  76.859  1.00 84.57  ? 893  PHE A CE1   1 
ATOM   6822  C  CE2   . PHE A 1  893  ? 18.868  -83.243  78.098  1.00 87.87  ? 893  PHE A CE2   1 
ATOM   6823  C  CZ    . PHE A 1  893  ? 19.330  -82.392  77.120  1.00 84.60  ? 893  PHE A CZ    1 
ATOM   6824  N  N     . GLU A 1  894  ? 14.732  -84.083  80.405  1.00 87.21  ? 894  GLU A N     1 
ATOM   6825  C  CA    . GLU A 1  894  ? 14.891  -85.500  80.711  1.00 89.94  ? 894  GLU A CA    1 
ATOM   6826  C  C     . GLU A 1  894  ? 13.773  -86.288  80.057  1.00 96.32  ? 894  GLU A C     1 
ATOM   6827  O  O     . GLU A 1  894  ? 14.065  -87.234  79.321  1.00 98.39  ? 894  GLU A O     1 
ATOM   6828  C  CB    . GLU A 1  894  ? 14.895  -85.746  82.237  1.00 92.61  ? 894  GLU A CB    1 
ATOM   6829  C  CG    . GLU A 1  894  ? 15.796  -86.889  82.690  1.00 105.63 ? 894  GLU A CG    1 
ATOM   6830  C  CD    . GLU A 1  894  ? 17.015  -86.546  83.537  1.00 132.18 ? 894  GLU A CD    1 
ATOM   6831  O  OE1   . GLU A 1  894  ? 17.646  -87.501  84.049  1.00 131.69 ? 894  GLU A OE1   1 
ATOM   6832  O  OE2   . GLU A 1  894  ? 17.352  -85.345  83.684  1.00 123.82 ? 894  GLU A OE2   1 
ATOM   6833  N  N     . LYS A 1  895  ? 12.502  -85.858  80.262  1.00 91.42  ? 895  LYS A N     1 
ATOM   6834  C  CA    . LYS A 1  895  ? 11.322  -86.540  79.728  1.00 91.72  ? 895  LYS A CA    1 
ATOM   6835  C  C     . LYS A 1  895  ? 11.388  -86.674  78.221  1.00 95.58  ? 895  LYS A C     1 
ATOM   6836  O  O     . LYS A 1  895  ? 11.157  -87.762  77.681  1.00 95.28  ? 895  LYS A O     1 
ATOM   6837  C  CB    . LYS A 1  895  ? 10.030  -85.837  80.183  1.00 93.80  ? 895  LYS A CB    1 
ATOM   6838  C  CG    . LYS A 1  895  ? 8.777   -86.713  80.105  1.00 107.14 ? 895  LYS A CG    1 
ATOM   6839  C  CD    . LYS A 1  895  ? 7.632   -86.143  80.947  1.00 119.85 ? 895  LYS A CD    1 
ATOM   6840  C  CE    . LYS A 1  895  ? 6.405   -87.028  80.949  1.00 134.76 ? 895  LYS A CE    1 
ATOM   6841  N  NZ    . LYS A 1  895  ? 5.432   -86.635  82.008  1.00 144.18 ? 895  LYS A NZ    1 
ATOM   6842  N  N     . ARG A 1  896  ? 11.780  -85.578  77.556  1.00 92.49  ? 896  ARG A N     1 
ATOM   6843  C  CA    . ARG A 1  896  ? 11.848  -85.484  76.103  1.00 92.26  ? 896  ARG A CA    1 
ATOM   6844  C  C     . ARG A 1  896  ? 13.029  -86.178  75.436  1.00 98.60  ? 896  ARG A C     1 
ATOM   6845  O  O     . ARG A 1  896  ? 12.888  -86.614  74.291  1.00 99.52  ? 896  ARG A O     1 
ATOM   6846  C  CB    . ARG A 1  896  ? 11.781  -84.022  75.664  1.00 88.05  ? 896  ARG A CB    1 
ATOM   6847  C  CG    . ARG A 1  896  ? 10.919  -83.830  74.447  1.00 95.05  ? 896  ARG A CG    1 
ATOM   6848  C  CD    . ARG A 1  896  ? 11.688  -83.142  73.351  1.00 102.43 ? 896  ARG A CD    1 
ATOM   6849  N  NE    . ARG A 1  896  ? 10.906  -82.059  72.761  1.00 105.97 ? 896  ARG A NE    1 
ATOM   6850  C  CZ    . ARG A 1  896  ? 11.067  -80.777  73.064  1.00 122.01 ? 896  ARG A CZ    1 
ATOM   6851  N  NH1   . ARG A 1  896  ? 11.998  -80.404  73.936  1.00 107.69 ? 896  ARG A NH1   1 
ATOM   6852  N  NH2   . ARG A 1  896  ? 10.309  -79.856  72.491  1.00 115.24 ? 896  ARG A NH2   1 
ATOM   6853  N  N     . TYR A 1  897  ? 14.183  -86.263  76.115  1.00 94.90  ? 897  TYR A N     1 
ATOM   6854  C  CA    . TYR A 1  897  ? 15.384  -86.800  75.493  1.00 94.57  ? 897  TYR A CA    1 
ATOM   6855  C  C     . TYR A 1  897  ? 15.954  -88.091  76.011  1.00 99.48  ? 897  TYR A C     1 
ATOM   6856  O  O     . TYR A 1  897  ? 16.390  -88.913  75.202  1.00 100.63 ? 897  TYR A O     1 
ATOM   6857  C  CB    . TYR A 1  897  ? 16.457  -85.718  75.425  1.00 94.68  ? 897  TYR A CB    1 
ATOM   6858  C  CG    . TYR A 1  897  ? 16.049  -84.565  74.541  1.00 96.35  ? 897  TYR A CG    1 
ATOM   6859  C  CD1   . TYR A 1  897  ? 15.599  -83.368  75.087  1.00 97.95  ? 897  TYR A CD1   1 
ATOM   6860  C  CD2   . TYR A 1  897  ? 16.049  -84.689  73.157  1.00 97.19  ? 897  TYR A CD2   1 
ATOM   6861  C  CE1   . TYR A 1  897  ? 15.198  -82.307  74.272  1.00 98.58  ? 897  TYR A CE1   1 
ATOM   6862  C  CE2   . TYR A 1  897  ? 15.690  -83.626  72.334  1.00 97.06  ? 897  TYR A CE2   1 
ATOM   6863  C  CZ    . TYR A 1  897  ? 15.244  -82.442  72.893  1.00 103.62 ? 897  TYR A CZ    1 
ATOM   6864  O  OH    . TYR A 1  897  ? 14.870  -81.411  72.066  1.00 102.14 ? 897  TYR A OH    1 
ATOM   6865  N  N     . ARG A 1  898  ? 16.013  -88.257  77.340  1.00 95.18  ? 898  ARG A N     1 
ATOM   6866  C  CA    . ARG A 1  898  ? 16.585  -89.439  77.967  1.00 95.71  ? 898  ARG A CA    1 
ATOM   6867  C  C     . ARG A 1  898  ? 15.863  -90.718  77.618  1.00 100.91 ? 898  ARG A C     1 
ATOM   6868  O  O     . ARG A 1  898  ? 14.630  -90.760  77.629  1.00 100.76 ? 898  ARG A O     1 
ATOM   6869  C  CB    . ARG A 1  898  ? 16.681  -89.255  79.503  1.00 95.60  ? 898  ARG A CB    1 
ATOM   6870  C  CG    . ARG A 1  898  ? 17.420  -90.360  80.291  1.00 103.82 ? 898  ARG A CG    1 
ATOM   6871  C  CD    . ARG A 1  898  ? 18.779  -90.726  79.713  1.00 109.69 ? 898  ARG A CD    1 
ATOM   6872  N  NE    . ARG A 1  898  ? 19.563  -91.577  80.609  1.00 113.35 ? 898  ARG A NE    1 
ATOM   6873  C  CZ    . ARG A 1  898  ? 20.635  -92.269  80.233  1.00 126.39 ? 898  ARG A CZ    1 
ATOM   6874  N  NH1   . ARG A 1  898  ? 21.037  -92.252  78.966  1.00 113.08 ? 898  ARG A NH1   1 
ATOM   6875  N  NH2   . ARG A 1  898  ? 21.302  -92.998  81.115  1.00 116.56 ? 898  ARG A NH2   1 
ATOM   6876  N  N     . VAL A 1  899  ? 16.656  -91.755  77.287  1.00 98.30  ? 899  VAL A N     1 
ATOM   6877  C  CA    . VAL A 1  899  ? 16.229  -93.141  77.054  1.00 99.38  ? 899  VAL A CA    1 
ATOM   6878  C  C     . VAL A 1  899  ? 17.179  -94.044  77.892  1.00 103.92 ? 899  VAL A C     1 
ATOM   6879  O  O     . VAL A 1  899  ? 18.384  -94.050  77.624  1.00 104.56 ? 899  VAL A O     1 
ATOM   6880  C  CB    . VAL A 1  899  ? 16.233  -93.570  75.565  1.00 102.12 ? 899  VAL A CB    1 
ATOM   6881  C  CG1   . VAL A 1  899  ? 15.851  -95.036  75.426  1.00 103.82 ? 899  VAL A CG1   1 
ATOM   6882  C  CG2   . VAL A 1  899  ? 15.316  -92.704  74.732  1.00 100.68 ? 899  VAL A CG2   1 
ATOM   6883  N  N     . ASP A 1  900  ? 16.657  -94.765  78.908  1.00 98.96  ? 900  ASP A N     1 
ATOM   6884  C  CA    . ASP A 1  900  ? 17.478  -95.681  79.714  1.00 98.77  ? 900  ASP A CA    1 
ATOM   6885  C  C     . ASP A 1  900  ? 16.921  -97.058  79.451  1.00 100.86 ? 900  ASP A C     1 
ATOM   6886  O  O     . ASP A 1  900  ? 15.885  -97.424  80.010  1.00 100.68 ? 900  ASP A O     1 
ATOM   6887  C  CB    . ASP A 1  900  ? 17.491  -95.316  81.237  1.00 100.69 ? 900  ASP A CB    1 
ATOM   6888  C  CG    . ASP A 1  900  ? 18.484  -96.092  82.112  1.00 109.82 ? 900  ASP A CG    1 
ATOM   6889  O  OD1   . ASP A 1  900  ? 19.691  -95.748  82.107  1.00 108.58 ? 900  ASP A OD1   1 
ATOM   6890  O  OD2   . ASP A 1  900  ? 18.042  -96.975  82.864  1.00 118.68 ? 900  ASP A OD2   1 
ATOM   6891  N  N     . LEU A 1  901  ? 17.571  -97.806  78.551  1.00 96.65  ? 901  LEU A N     1 
ATOM   6892  C  CA    . LEU A 1  901  ? 17.120  -99.156  78.223  1.00 98.73  ? 901  LEU A CA    1 
ATOM   6893  C  C     . LEU A 1  901  ? 17.159  -100.099 79.452  1.00 106.61 ? 901  LEU A C     1 
ATOM   6894  O  O     . LEU A 1  901  ? 16.585  -101.187 79.408  1.00 108.20 ? 901  LEU A O     1 
ATOM   6895  C  CB    . LEU A 1  901  ? 17.893  -99.760  77.026  1.00 98.75  ? 901  LEU A CB    1 
ATOM   6896  C  CG    . LEU A 1  901  ? 17.965  -98.961  75.716  1.00 100.69 ? 901  LEU A CG    1 
ATOM   6897  C  CD1   . LEU A 1  901  ? 18.911  -99.621  74.745  1.00 101.11 ? 901  LEU A CD1   1 
ATOM   6898  C  CD2   . LEU A 1  901  ? 16.609  -98.809  75.061  1.00 100.97 ? 901  LEU A CD2   1 
ATOM   6899  N  N     . LEU A 1  902  ? 17.798  -99.645  80.557  1.00 103.62 ? 902  LEU A N     1 
ATOM   6900  C  CA    . LEU A 1  902  ? 17.948  -100.361 81.831  1.00 104.49 ? 902  LEU A CA    1 
ATOM   6901  C  C     . LEU A 1  902  ? 16.977  -99.810  82.902  1.00 111.55 ? 902  LEU A C     1 
ATOM   6902  O  O     . LEU A 1  902  ? 17.341  -99.662  84.074  1.00 111.54 ? 902  LEU A O     1 
ATOM   6903  C  CB    . LEU A 1  902  ? 19.412  -100.315 82.323  1.00 103.13 ? 902  LEU A CB    1 
ATOM   6904  C  CG    . LEU A 1  902  ? 20.498  -100.227 81.264  1.00 105.59 ? 902  LEU A CG    1 
ATOM   6905  C  CD1   . LEU A 1  902  ? 21.590  -99.305  81.702  1.00 104.34 ? 902  LEU A CD1   1 
ATOM   6906  C  CD2   . LEU A 1  902  ? 21.032  -101.581 80.882  1.00 107.77 ? 902  LEU A CD2   1 
ATOM   6907  N  N     . ASN A 1  903  ? 15.748  -99.471  82.470  1.00 109.95 ? 903  ASN A N     1 
ATOM   6908  C  CA    . ASN A 1  903  ? 14.676  -98.947  83.313  1.00 110.62 ? 903  ASN A CA    1 
ATOM   6909  C  C     . ASN A 1  903  ? 13.341  -99.312  82.660  1.00 117.81 ? 903  ASN A C     1 
ATOM   6910  O  O     . ASN A 1  903  ? 13.019  -98.782  81.592  1.00 116.43 ? 903  ASN A O     1 
ATOM   6911  C  CB    . ASN A 1  903  ? 14.815  -97.431  83.481  1.00 108.83 ? 903  ASN A CB    1 
ATOM   6912  C  CG    . ASN A 1  903  ? 14.073  -96.838  84.652  1.00 130.56 ? 903  ASN A CG    1 
ATOM   6913  O  OD1   . ASN A 1  903  ? 13.263  -97.488  85.325  1.00 124.81 ? 903  ASN A OD1   1 
ATOM   6914  N  ND2   . ASN A 1  903  ? 14.329  -95.564  84.912  1.00 121.68 ? 903  ASN A ND2   1 
ATOM   6915  N  N     . THR A 1  904  ? 12.576  -100.238 83.300  1.00 117.80 ? 904  THR A N     1 
ATOM   6916  C  CA    . THR A 1  904  ? 11.271  -100.745 82.835  1.00 119.22 ? 904  THR A CA    1 
ATOM   6917  C  C     . THR A 1  904  ? 10.205  -99.684  82.542  1.00 123.69 ? 904  THR A C     1 
ATOM   6918  O  O     . THR A 1  904  ? 9.186   -100.012 81.936  1.00 124.82 ? 904  THR A O     1 
ATOM   6919  C  CB    . THR A 1  904  ? 10.727  -101.868 83.736  1.00 127.28 ? 904  THR A CB    1 
ATOM   6920  O  OG1   . THR A 1  904  ? 9.496   -102.332 83.176  1.00 127.54 ? 904  THR A OG1   1 
ATOM   6921  C  CG2   . THR A 1  904  ? 10.464  -101.415 85.158  1.00 125.12 ? 904  THR A CG2   1 
ATOM   6922  N  N     . ASP A 1  905  ? 10.419  -98.439  82.987  1.00 119.01 ? 905  ASP A N     1 
ATOM   6923  C  CA    . ASP A 1  905  ? 9.483   -97.344  82.764  1.00 118.02 ? 905  ASP A CA    1 
ATOM   6924  C  C     . ASP A 1  905  ? 10.088  -96.287  81.849  1.00 121.18 ? 905  ASP A C     1 
ATOM   6925  O  O     . ASP A 1  905  ? 9.375   -95.720  81.020  1.00 120.58 ? 905  ASP A O     1 
ATOM   6926  C  CB    . ASP A 1  905  ? 9.014   -96.708  84.096  1.00 119.73 ? 905  ASP A CB    1 
ATOM   6927  C  CG    . ASP A 1  905  ? 9.510   -97.373  85.376  1.00 128.54 ? 905  ASP A CG    1 
ATOM   6928  O  OD1   . ASP A 1  905  ? 9.031   -98.492  85.693  1.00 130.62 ? 905  ASP A OD1   1 
ATOM   6929  O  OD2   . ASP A 1  905  ? 10.341  -96.758  86.080  1.00 131.23 ? 905  ASP A OD2   1 
ATOM   6930  N  N     . HIS A 1  906  ? 11.401  -96.035  81.982  1.00 117.28 ? 906  HIS A N     1 
ATOM   6931  C  CA    . HIS A 1  906  ? 12.083  -94.990  81.223  1.00 115.29 ? 906  HIS A CA    1 
ATOM   6932  C  C     . HIS A 1  906  ? 12.851  -95.407  79.958  1.00 116.77 ? 906  HIS A C     1 
ATOM   6933  O  O     . HIS A 1  906  ? 13.729  -94.680  79.480  1.00 114.38 ? 906  HIS A O     1 
ATOM   6934  C  CB    . HIS A 1  906  ? 12.840  -94.033  82.152  1.00 115.68 ? 906  HIS A CB    1 
ATOM   6935  C  CG    . HIS A 1  906  ? 11.938  -93.318  83.122  1.00 120.01 ? 906  HIS A CG    1 
ATOM   6936  N  ND1   . HIS A 1  906  ? 11.464  -93.942  84.269  1.00 124.06 ? 906  HIS A ND1   1 
ATOM   6937  C  CD2   . HIS A 1  906  ? 11.458  -92.051  83.089  1.00 121.00 ? 906  HIS A CD2   1 
ATOM   6938  C  CE1   . HIS A 1  906  ? 10.719  -93.039  84.891  1.00 123.23 ? 906  HIS A CE1   1 
ATOM   6939  N  NE2   . HIS A 1  906  ? 10.689  -91.883  84.223  1.00 121.65 ? 906  HIS A NE2   1 
ATOM   6940  N  N     . THR A 1  907  ? 12.471  -96.554  79.384  1.00 113.73 ? 907  THR A N     1 
ATOM   6941  C  CA    . THR A 1  907  ? 12.999  -97.026  78.103  1.00 113.18 ? 907  THR A CA    1 
ATOM   6942  C  C     . THR A 1  907  ? 11.931  -96.692  77.050  1.00 117.85 ? 907  THR A C     1 
ATOM   6943  O  O     . THR A 1  907  ? 10.912  -96.083  77.398  1.00 117.84 ? 907  THR A O     1 
ATOM   6944  C  CB    . THR A 1  907  ? 13.328  -98.535  78.145  1.00 116.86 ? 907  THR A CB    1 
ATOM   6945  O  OG1   . THR A 1  907  ? 13.909  -98.901  76.895  1.00 112.79 ? 907  THR A OG1   1 
ATOM   6946  C  CG2   . THR A 1  907  ? 12.102  -99.421  78.416  1.00 115.50 ? 907  THR A CG2   1 
ATOM   6947  N  N     . LEU A 1  908  ? 12.135  -97.104  75.785  1.00 114.06 ? 908  LEU A N     1 
ATOM   6948  C  CA    . LEU A 1  908  ? 11.132  -96.898  74.736  1.00 113.28 ? 908  LEU A CA    1 
ATOM   6949  C  C     . LEU A 1  908  ? 10.261  -98.152  74.576  1.00 119.84 ? 908  LEU A C     1 
ATOM   6950  O  O     . LEU A 1  908  ? 10.773  -99.265  74.422  1.00 119.68 ? 908  LEU A O     1 
ATOM   6951  C  CB    . LEU A 1  908  ? 11.723  -96.432  73.384  1.00 111.52 ? 908  LEU A CB    1 
ATOM   6952  C  CG    . LEU A 1  908  ? 13.241  -96.401  73.234  1.00 114.45 ? 908  LEU A CG    1 
ATOM   6953  C  CD1   . LEU A 1  908  ? 13.781  -97.734  72.746  1.00 116.50 ? 908  LEU A CD1   1 
ATOM   6954  C  CD2   . LEU A 1  908  ? 13.664  -95.308  72.305  1.00 112.84 ? 908  LEU A CD2   1 
ATOM   6955  N  N     . ASP A 1  909  ? 8.940   -97.951  74.647  1.00 118.59 ? 909  ASP A N     1 
ATOM   6956  C  CA    . ASP A 1  909  ? 7.899   -98.968  74.537  1.00 121.12 ? 909  ASP A CA    1 
ATOM   6957  C  C     . ASP A 1  909  ? 8.024   -99.829  73.266  1.00 124.01 ? 909  ASP A C     1 
ATOM   6958  O  O     . ASP A 1  909  ? 8.389   -99.291  72.213  1.00 122.34 ? 909  ASP A O     1 
ATOM   6959  C  CB    . ASP A 1  909  ? 6.519   -98.287  74.562  1.00 123.89 ? 909  ASP A CB    1 
ATOM   6960  C  CG    . ASP A 1  909  ? 5.436   -99.194  75.099  1.00 144.23 ? 909  ASP A CG    1 
ATOM   6961  O  OD1   . ASP A 1  909  ? 4.667   -99.749  74.280  1.00 146.66 ? 909  ASP A OD1   1 
ATOM   6962  O  OD2   . ASP A 1  909  ? 5.429   -99.444  76.325  1.00 153.29 ? 909  ASP A OD2   1 
ATOM   6963  N  N     . PRO A 1  910  ? 7.681   -101.147 73.324  1.00 121.09 ? 910  PRO A N     1 
ATOM   6964  C  CA    . PRO A 1  910  ? 7.763   -101.990 72.112  1.00 121.78 ? 910  PRO A CA    1 
ATOM   6965  C  C     . PRO A 1  910  ? 6.773   -101.614 70.993  1.00 124.93 ? 910  PRO A C     1 
ATOM   6966  O  O     . PRO A 1  910  ? 6.915   -102.087 69.859  1.00 125.41 ? 910  PRO A O     1 
ATOM   6967  C  CB    . PRO A 1  910  ? 7.484   -103.396 72.652  1.00 125.89 ? 910  PRO A CB    1 
ATOM   6968  C  CG    . PRO A 1  910  ? 6.623   -103.154 73.833  1.00 130.61 ? 910  PRO A CG    1 
ATOM   6969  C  CD    . PRO A 1  910  ? 7.220   -101.941 74.478  1.00 123.83 ? 910  PRO A CD    1 
ATOM   6970  N  N     . SER A 1  911  ? 5.770   -100.771 71.323  1.00 119.02 ? 911  SER A N     1 
ATOM   6971  C  CA    . SER A 1  911  ? 4.744   -100.278 70.410  1.00 117.49 ? 911  SER A CA    1 
ATOM   6972  C  C     . SER A 1  911  ? 5.335   -99.305  69.403  1.00 118.42 ? 911  SER A C     1 
ATOM   6973  O  O     . SER A 1  911  ? 4.720   -99.049  68.367  1.00 118.79 ? 911  SER A O     1 
ATOM   6974  C  CB    . SER A 1  911  ? 3.638   -99.589  71.197  1.00 119.75 ? 911  SER A CB    1 
ATOM   6975  O  OG    . SER A 1  911  ? 4.193   -98.609  72.058  1.00 124.14 ? 911  SER A OG    1 
ATOM   6976  N  N     . LEU A 1  912  ? 6.519   -98.761  69.698  1.00 111.97 ? 912  LEU A N     1 
ATOM   6977  C  CA    . LEU A 1  912  ? 7.157   -97.809  68.803  1.00 109.54 ? 912  LEU A CA    1 
ATOM   6978  C  C     . LEU A 1  912  ? 8.510   -98.240  68.224  1.00 112.55 ? 912  LEU A C     1 
ATOM   6979  O  O     . LEU A 1  912  ? 9.333   -97.384  67.913  1.00 110.35 ? 912  LEU A O     1 
ATOM   6980  C  CB    . LEU A 1  912  ? 7.182   -96.382  69.396  1.00 107.62 ? 912  LEU A CB    1 
ATOM   6981  C  CG    . LEU A 1  912  ? 7.527   -96.226  70.866  1.00 112.24 ? 912  LEU A CG    1 
ATOM   6982  C  CD1   . LEU A 1  912  ? 8.671   -95.265  71.046  1.00 110.34 ? 912  LEU A CD1   1 
ATOM   6983  C  CD2   . LEU A 1  912  ? 6.328   -95.744  71.637  1.00 115.49 ? 912  LEU A CD2   1 
ATOM   6984  N  N     . LEU A 1  913  ? 8.722   -99.547  68.018  1.00 111.28 ? 913  LEU A N     1 
ATOM   6985  C  CA    . LEU A 1  913  ? 9.985   -100.067 67.480  1.00 111.91 ? 913  LEU A CA    1 
ATOM   6986  C  C     . LEU A 1  913  ? 9.909   -101.566 67.210  1.00 120.27 ? 913  LEU A C     1 
ATOM   6987  O  O     . LEU A 1  913  ? 9.401   -102.323 68.048  1.00 121.64 ? 913  LEU A O     1 
ATOM   6988  C  CB    . LEU A 1  913  ? 11.139  -99.807  68.490  1.00 111.00 ? 913  LEU A CB    1 
ATOM   6989  C  CG    . LEU A 1  913  ? 12.577  -99.897  67.972  1.00 114.60 ? 913  LEU A CG    1 
ATOM   6990  C  CD1   . LEU A 1  913  ? 12.871  -98.797  66.957  1.00 113.11 ? 913  LEU A CD1   1 
ATOM   6991  C  CD2   . LEU A 1  913  ? 13.556  -99.822  69.115  1.00 113.62 ? 913  LEU A CD2   1 
ATOM   6992  N  N     . GLU A 1  914  ? 10.491  -102.003 66.079  1.00 117.73 ? 914  GLU A N     1 
ATOM   6993  C  CA    . GLU A 1  914  ? 10.551  -103.422 65.736  1.00 119.87 ? 914  GLU A CA    1 
ATOM   6994  C  C     . GLU A 1  914  ? 11.429  -104.143 66.759  1.00 126.59 ? 914  GLU A C     1 
ATOM   6995  O  O     . GLU A 1  914  ? 11.052  -105.218 67.231  1.00 129.13 ? 914  GLU A O     1 
ATOM   6996  C  CB    . GLU A 1  914  ? 11.076  -103.630 64.307  1.00 120.97 ? 914  GLU A CB    1 
ATOM   6997  C  CG    . GLU A 1  914  ? 9.973   -103.759 63.268  1.00 128.33 ? 914  GLU A CG    1 
ATOM   6998  C  CD    . GLU A 1  914  ? 10.396  -103.760 61.807  1.00 140.00 ? 914  GLU A CD    1 
ATOM   6999  O  OE1   . GLU A 1  914  ? 11.578  -104.061 61.521  1.00 120.57 ? 914  GLU A OE1   1 
ATOM   7000  O  OE2   . GLU A 1  914  ? 9.529   -103.489 60.942  1.00 132.51 ? 914  GLU A OE2   1 
ATOM   7001  N  N     . SER A 1  915  ? 12.558  -103.513 67.159  1.00 122.00 ? 915  SER A N     1 
ATOM   7002  C  CA    . SER A 1  915  ? 13.504  -104.067 68.142  1.00 122.70 ? 915  SER A CA    1 
ATOM   7003  C  C     . SER A 1  915  ? 13.125  -103.828 69.629  1.00 125.45 ? 915  SER A C     1 
ATOM   7004  O  O     . SER A 1  915  ? 13.892  -104.197 70.522  1.00 124.72 ? 915  SER A O     1 
ATOM   7005  C  CB    . SER A 1  915  ? 14.940  -103.621 67.837  1.00 125.93 ? 915  SER A CB    1 
ATOM   7006  O  OG    . SER A 1  915  ? 15.090  -102.230 67.591  1.00 132.98 ? 915  SER A OG    1 
ATOM   7007  N  N     . GLY A 1  916  ? 11.930  -103.262 69.851  1.00 121.35 ? 916  GLY A N     1 
ATOM   7008  C  CA    . GLY A 1  916  ? 11.346  -102.893 71.144  1.00 120.67 ? 916  GLY A CA    1 
ATOM   7009  C  C     . GLY A 1  916  ? 11.706  -103.679 72.395  1.00 124.13 ? 916  GLY A C     1 
ATOM   7010  O  O     . GLY A 1  916  ? 12.418  -103.163 73.267  1.00 122.63 ? 916  GLY A O     1 
ATOM   7011  N  N     . SER A 1  917  ? 11.167  -104.906 72.524  1.00 121.24 ? 917  SER A N     1 
ATOM   7012  C  CA    . SER A 1  917  ? 11.428  -105.748 73.693  1.00 121.45 ? 917  SER A CA    1 
ATOM   7013  C  C     . SER A 1  917  ? 12.807  -106.372 73.622  1.00 123.37 ? 917  SER A C     1 
ATOM   7014  O  O     . SER A 1  917  ? 13.443  -106.560 74.656  1.00 123.75 ? 917  SER A O     1 
ATOM   7015  C  CB    . SER A 1  917  ? 10.353  -106.820 73.851  1.00 127.72 ? 917  SER A CB    1 
ATOM   7016  O  OG    . SER A 1  917  ? 10.443  -107.837 72.866  1.00 138.31 ? 917  SER A OG    1 
ATOM   7017  N  N     . GLU A 1  918  ? 13.278  -106.657 72.395  1.00 118.39 ? 918  GLU A N     1 
ATOM   7018  C  CA    . GLU A 1  918  ? 14.580  -107.247 72.047  1.00 118.45 ? 918  GLU A CA    1 
ATOM   7019  C  C     . GLU A 1  918  ? 15.734  -106.391 72.588  1.00 117.67 ? 918  GLU A C     1 
ATOM   7020  O  O     . GLU A 1  918  ? 16.880  -106.852 72.667  1.00 117.74 ? 918  GLU A O     1 
ATOM   7021  C  CB    . GLU A 1  918  ? 14.665  -107.303 70.508  1.00 120.45 ? 918  GLU A CB    1 
ATOM   7022  C  CG    . GLU A 1  918  ? 15.721  -108.202 69.884  1.00 136.27 ? 918  GLU A CG    1 
ATOM   7023  C  CD    . GLU A 1  918  ? 15.884  -107.954 68.392  1.00 158.41 ? 918  GLU A CD    1 
ATOM   7024  O  OE1   . GLU A 1  918  ? 16.883  -107.300 68.009  1.00 159.27 ? 918  GLU A OE1   1 
ATOM   7025  O  OE2   . GLU A 1  918  ? 14.987  -108.355 67.613  1.00 142.38 ? 918  GLU A OE2   1 
ATOM   7026  N  N     . ILE A 1  919  ? 15.407  -105.152 72.994  1.00 109.60 ? 919  ILE A N     1 
ATOM   7027  C  CA    . ILE A 1  919  ? 16.359  -104.149 73.428  1.00 105.80 ? 919  ILE A CA    1 
ATOM   7028  C  C     . ILE A 1  919  ? 16.411  -103.796 74.927  1.00 107.36 ? 919  ILE A C     1 
ATOM   7029  O  O     . ILE A 1  919  ? 17.367  -103.137 75.340  1.00 105.84 ? 919  ILE A O     1 
ATOM   7030  C  CB    . ILE A 1  919  ? 16.337  -102.955 72.404  1.00 106.23 ? 919  ILE A CB    1 
ATOM   7031  C  CG1   . ILE A 1  919  ? 17.703  -102.678 71.775  1.00 105.30 ? 919  ILE A CG1   1 
ATOM   7032  C  CG2   . ILE A 1  919  ? 15.527  -101.711 72.795  1.00 104.30 ? 919  ILE A CG2   1 
ATOM   7033  C  CD1   . ILE A 1  919  ? 18.300  -103.939 70.935  1.00 116.12 ? 919  ILE A CD1   1 
ATOM   7034  N  N     . LEU A 1  920  ? 15.451  -104.277 75.751  1.00 104.20 ? 920  LEU A N     1 
ATOM   7035  C  CA    . LEU A 1  920  ? 15.463  -104.032 77.209  1.00 103.24 ? 920  LEU A CA    1 
ATOM   7036  C  C     . LEU A 1  920  ? 16.753  -104.554 77.848  1.00 109.38 ? 920  LEU A C     1 
ATOM   7037  O  O     . LEU A 1  920  ? 17.131  -105.706 77.631  1.00 109.86 ? 920  LEU A O     1 
ATOM   7038  C  CB    . LEU A 1  920  ? 14.257  -104.665 77.925  1.00 104.10 ? 920  LEU A CB    1 
ATOM   7039  C  CG    . LEU A 1  920  ? 13.292  -103.725 78.668  1.00 106.42 ? 920  LEU A CG    1 
ATOM   7040  C  CD1   . LEU A 1  920  ? 12.185  -104.514 79.308  1.00 108.34 ? 920  LEU A CD1   1 
ATOM   7041  C  CD2   . LEU A 1  920  ? 13.978  -102.913 79.756  1.00 105.31 ? 920  LEU A CD2   1 
ATOM   7042  N  N     . GLY A 1  921  ? 17.421  -103.676 78.592  1.00 106.82 ? 921  GLY A N     1 
ATOM   7043  C  CA    . GLY A 1  921  ? 18.678  -103.947 79.283  1.00 107.55 ? 921  GLY A CA    1 
ATOM   7044  C  C     . GLY A 1  921  ? 19.848  -104.247 78.366  1.00 113.26 ? 921  GLY A C     1 
ATOM   7045  O  O     . GLY A 1  921  ? 20.691  -105.069 78.725  1.00 113.51 ? 921  GLY A O     1 
ATOM   7046  N  N     . ASP A 1  922  ? 19.922  -103.580 77.180  1.00 110.32 ? 922  ASP A N     1 
ATOM   7047  C  CA    . ASP A 1  922  ? 20.978  -103.837 76.195  1.00 110.46 ? 922  ASP A CA    1 
ATOM   7048  C  C     . ASP A 1  922  ? 22.424  -103.599 76.606  1.00 116.37 ? 922  ASP A C     1 
ATOM   7049  O  O     . ASP A 1  922  ? 23.303  -104.324 76.135  1.00 117.94 ? 922  ASP A O     1 
ATOM   7050  C  CB    . ASP A 1  922  ? 20.678  -103.266 74.815  1.00 110.44 ? 922  ASP A CB    1 
ATOM   7051  C  CG    . ASP A 1  922  ? 21.313  -104.102 73.717  1.00 118.08 ? 922  ASP A CG    1 
ATOM   7052  O  OD1   . ASP A 1  922  ? 22.495  -103.849 73.389  1.00 117.32 ? 922  ASP A OD1   1 
ATOM   7053  O  OD2   . ASP A 1  922  ? 20.645  -105.049 73.223  1.00 123.45 ? 922  ASP A OD2   1 
ATOM   7054  N  N     . LEU A 1  923  ? 22.677  -102.626 77.497  1.00 111.85 ? 923  LEU A N     1 
ATOM   7055  C  CA    . LEU A 1  923  ? 24.025  -102.269 77.976  1.00 110.73 ? 923  LEU A CA    1 
ATOM   7056  C  C     . LEU A 1  923  ? 24.904  -101.706 76.840  1.00 114.09 ? 923  LEU A C     1 
ATOM   7057  O  O     . LEU A 1  923  ? 25.165  -100.496 76.811  1.00 113.48 ? 923  LEU A O     1 
ATOM   7058  C  CB    . LEU A 1  923  ? 24.715  -103.419 78.732  1.00 111.93 ? 923  LEU A CB    1 
ATOM   7059  C  CG    . LEU A 1  923  ? 24.168  -103.667 80.113  1.00 116.81 ? 923  LEU A CG    1 
ATOM   7060  C  CD1   . LEU A 1  923  ? 23.566  -105.028 80.213  1.00 118.95 ? 923  LEU A CD1   1 
ATOM   7061  C  CD2   . LEU A 1  923  ? 25.245  -103.514 81.144  1.00 119.96 ? 923  LEU A CD2   1 
ATOM   7062  N  N     . LYS A 1  924  ? 25.300  -102.574 75.882  1.00 108.85 ? 924  LYS A N     1 
ATOM   7063  C  CA    . LYS A 1  924  ? 26.099  -102.245 74.699  1.00 105.94 ? 924  LYS A CA    1 
ATOM   7064  C  C     . LYS A 1  924  ? 25.452  -101.115 73.891  1.00 103.68 ? 924  LYS A C     1 
ATOM   7065  O  O     . LYS A 1  924  ? 26.161  -100.256 73.362  1.00 101.17 ? 924  LYS A O     1 
ATOM   7066  C  CB    . LYS A 1  924  ? 26.276  -103.502 73.832  1.00 109.54 ? 924  LYS A CB    1 
ATOM   7067  C  CG    . LYS A 1  924  ? 27.719  -103.937 73.680  1.00 110.38 ? 924  LYS A CG    1 
ATOM   7068  C  CD    . LYS A 1  924  ? 27.816  -105.054 72.688  1.00 121.25 ? 924  LYS A CD    1 
ATOM   7069  C  CE    . LYS A 1  924  ? 29.199  -105.179 72.105  1.00 141.55 ? 924  LYS A CE    1 
ATOM   7070  N  NZ    . LYS A 1  924  ? 29.293  -106.351 71.186  1.00 160.48 ? 924  LYS A NZ    1 
ATOM   7071  N  N     . LEU A 1  925  ? 24.108  -101.111 73.814  1.00 98.35  ? 925  LEU A N     1 
ATOM   7072  C  CA    . LEU A 1  925  ? 23.391  -100.053 73.108  1.00 96.04  ? 925  LEU A CA    1 
ATOM   7073  C  C     . LEU A 1  925  ? 23.188  -98.891  74.004  1.00 98.78  ? 925  LEU A C     1 
ATOM   7074  O  O     . LEU A 1  925  ? 23.219  -97.763  73.524  1.00 97.02  ? 925  LEU A O     1 
ATOM   7075  C  CB    . LEU A 1  925  ? 22.027  -100.496 72.580  1.00 96.35  ? 925  LEU A CB    1 
ATOM   7076  C  CG    . LEU A 1  925  ? 21.998  -101.171 71.236  1.00 100.65 ? 925  LEU A CG    1 
ATOM   7077  C  CD1   . LEU A 1  925  ? 20.633  -101.159 70.715  1.00 100.40 ? 925  LEU A CD1   1 
ATOM   7078  C  CD2   . LEU A 1  925  ? 22.893  -100.472 70.242  1.00 101.48 ? 925  LEU A CD2   1 
ATOM   7079  N  N     . GLN A 1  926  ? 22.961  -99.147  75.310  1.00 96.14  ? 926  GLN A N     1 
ATOM   7080  C  CA    . GLN A 1  926  ? 22.765  -98.082  76.287  1.00 94.68  ? 926  GLN A CA    1 
ATOM   7081  C  C     . GLN A 1  926  ? 23.960  -97.144  76.319  1.00 98.83  ? 926  GLN A C     1 
ATOM   7082  O  O     . GLN A 1  926  ? 23.796  -95.961  76.595  1.00 97.78  ? 926  GLN A O     1 
ATOM   7083  C  CB    . GLN A 1  926  ? 22.438  -98.637  77.666  1.00 96.52  ? 926  GLN A CB    1 
ATOM   7084  C  CG    . GLN A 1  926  ? 21.046  -98.237  78.128  1.00 97.57  ? 926  GLN A CG    1 
ATOM   7085  C  CD    . GLN A 1  926  ? 20.968  -96.805  78.587  1.00 101.38 ? 926  GLN A CD    1 
ATOM   7086  O  OE1   . GLN A 1  926  ? 20.357  -95.968  77.937  1.00 88.86  ? 926  GLN A OE1   1 
ATOM   7087  N  NE2   . GLN A 1  926  ? 21.591  -96.494  79.716  1.00 97.78  ? 926  GLN A NE2   1 
ATOM   7088  N  N     . VAL A 1  927  ? 25.134  -97.666  75.932  1.00 96.11  ? 927  VAL A N     1 
ATOM   7089  C  CA    . VAL A 1  927  ? 26.393  -96.957  75.773  1.00 95.05  ? 927  VAL A CA    1 
ATOM   7090  C  C     . VAL A 1  927  ? 26.276  -95.900  74.640  1.00 98.04  ? 927  VAL A C     1 
ATOM   7091  O  O     . VAL A 1  927  ? 26.801  -94.792  74.788  1.00 96.62  ? 927  VAL A O     1 
ATOM   7092  C  CB    . VAL A 1  927  ? 27.529  -97.998  75.594  1.00 100.34 ? 927  VAL A CB    1 
ATOM   7093  C  CG1   . VAL A 1  927  ? 28.418  -97.731  74.374  1.00 99.90  ? 927  VAL A CG1   1 
ATOM   7094  C  CG2   . VAL A 1  927  ? 28.346  -98.124  76.870  1.00 100.35 ? 927  VAL A CG2   1 
ATOM   7095  N  N     . LEU A 1  928  ? 25.545  -96.224  73.551  1.00 95.00  ? 928  LEU A N     1 
ATOM   7096  C  CA    . LEU A 1  928  ? 25.309  -95.278  72.460  1.00 93.82  ? 928  LEU A CA    1 
ATOM   7097  C  C     . LEU A 1  928  ? 24.255  -94.251  72.842  1.00 97.80  ? 928  LEU A C     1 
ATOM   7098  O  O     . LEU A 1  928  ? 24.378  -93.089  72.448  1.00 96.80  ? 928  LEU A O     1 
ATOM   7099  C  CB    . LEU A 1  928  ? 24.921  -95.974  71.156  1.00 94.72  ? 928  LEU A CB    1 
ATOM   7100  C  CG    . LEU A 1  928  ? 26.071  -96.281  70.201  1.00 99.96  ? 928  LEU A CG    1 
ATOM   7101  C  CD1   . LEU A 1  928  ? 25.646  -97.289  69.133  1.00 101.10 ? 928  LEU A CD1   1 
ATOM   7102  C  CD2   . LEU A 1  928  ? 26.626  -95.002  69.558  1.00 101.25 ? 928  LEU A CD2   1 
ATOM   7103  N  N     . LEU A 1  929  ? 23.227  -94.662  73.617  1.00 94.86  ? 929  LEU A N     1 
ATOM   7104  C  CA    . LEU A 1  929  ? 22.182  -93.750  74.091  1.00 93.48  ? 929  LEU A CA    1 
ATOM   7105  C  C     . LEU A 1  929  ? 22.729  -92.799  75.128  1.00 96.49  ? 929  LEU A C     1 
ATOM   7106  O  O     . LEU A 1  929  ? 22.204  -91.690  75.266  1.00 94.84  ? 929  LEU A O     1 
ATOM   7107  C  CB    . LEU A 1  929  ? 20.955  -94.491  74.624  1.00 94.52  ? 929  LEU A CB    1 
ATOM   7108  C  CG    . LEU A 1  929  ? 19.950  -94.913  73.559  1.00 99.03  ? 929  LEU A CG    1 
ATOM   7109  C  CD1   . LEU A 1  929  ? 19.209  -96.112  73.990  1.00 101.01 ? 929  LEU A CD1   1 
ATOM   7110  C  CD2   . LEU A 1  929  ? 18.969  -93.800  73.220  1.00 98.34  ? 929  LEU A CD2   1 
ATOM   7111  N  N     . ASP A 1  930  ? 23.799  -93.235  75.839  1.00 93.95  ? 930  ASP A N     1 
ATOM   7112  C  CA    . ASP A 1  930  ? 24.541  -92.446  76.823  1.00 93.34  ? 930  ASP A CA    1 
ATOM   7113  C  C     . ASP A 1  930  ? 25.437  -91.471  76.072  1.00 96.89  ? 930  ASP A C     1 
ATOM   7114  O  O     . ASP A 1  930  ? 25.509  -90.294  76.435  1.00 94.80  ? 930  ASP A O     1 
ATOM   7115  C  CB    . ASP A 1  930  ? 25.373  -93.344  77.764  1.00 96.22  ? 930  ASP A CB    1 
ATOM   7116  C  CG    . ASP A 1  930  ? 24.556  -94.029  78.846  1.00 107.64 ? 930  ASP A CG    1 
ATOM   7117  O  OD1   . ASP A 1  930  ? 23.302  -93.979  78.773  1.00 107.55 ? 930  ASP A OD1   1 
ATOM   7118  O  OD2   . ASP A 1  930  ? 25.166  -94.644  79.750  1.00 115.56 ? 930  ASP A OD2   1 
ATOM   7119  N  N     . GLU A 1  931  ? 26.080  -91.951  74.990  1.00 94.77  ? 931  GLU A N     1 
ATOM   7120  C  CA    . GLU A 1  931  ? 26.931  -91.132  74.137  1.00 94.27  ? 931  GLU A CA    1 
ATOM   7121  C  C     . GLU A 1  931  ? 26.076  -89.964  73.594  1.00 96.27  ? 931  GLU A C     1 
ATOM   7122  O  O     . GLU A 1  931  ? 26.529  -88.816  73.637  1.00 93.83  ? 931  GLU A O     1 
ATOM   7123  C  CB    . GLU A 1  931  ? 27.538  -92.002  73.013  1.00 97.26  ? 931  GLU A CB    1 
ATOM   7124  C  CG    . GLU A 1  931  ? 28.496  -91.274  72.076  1.00 117.34 ? 931  GLU A CG    1 
ATOM   7125  C  CD    . GLU A 1  931  ? 28.398  -91.652  70.604  1.00 154.40 ? 931  GLU A CD    1 
ATOM   7126  O  OE1   . GLU A 1  931  ? 27.428  -91.224  69.933  1.00 140.35 ? 931  GLU A OE1   1 
ATOM   7127  O  OE2   . GLU A 1  931  ? 29.315  -92.350  70.112  1.00 159.23 ? 931  GLU A OE2   1 
ATOM   7128  N  N     . GLU A 1  932  ? 24.808  -90.270  73.178  1.00 93.68  ? 932  GLU A N     1 
ATOM   7129  C  CA    . GLU A 1  932  ? 23.795  -89.339  72.651  1.00 92.44  ? 932  GLU A CA    1 
ATOM   7130  C  C     . GLU A 1  932  ? 23.459  -88.288  73.702  1.00 93.33  ? 932  GLU A C     1 
ATOM   7131  O  O     . GLU A 1  932  ? 23.770  -87.116  73.505  1.00 92.11  ? 932  GLU A O     1 
ATOM   7132  C  CB    . GLU A 1  932  ? 22.506  -90.100  72.219  1.00 94.93  ? 932  GLU A CB    1 
ATOM   7133  C  CG    . GLU A 1  932  ? 21.484  -89.260  71.446  1.00 102.68 ? 932  GLU A CG    1 
ATOM   7134  C  CD    . GLU A 1  932  ? 20.044  -89.758  71.383  1.00 113.13 ? 932  GLU A CD    1 
ATOM   7135  O  OE1   . GLU A 1  932  ? 19.576  -90.089  70.267  1.00 82.41  ? 932  GLU A OE1   1 
ATOM   7136  O  OE2   . GLU A 1  932  ? 19.358  -89.739  72.432  1.00 105.04 ? 932  GLU A OE2   1 
ATOM   7137  N  N     . TYR A 1  933  ? 22.864  -88.724  74.824  1.00 88.50  ? 933  TYR A N     1 
ATOM   7138  C  CA    . TYR A 1  933  ? 22.432  -87.891  75.944  1.00 86.85  ? 933  TYR A CA    1 
ATOM   7139  C  C     . TYR A 1  933  ? 23.459  -86.874  76.417  1.00 88.26  ? 933  TYR A C     1 
ATOM   7140  O  O     . TYR A 1  933  ? 23.104  -85.716  76.631  1.00 85.85  ? 933  TYR A O     1 
ATOM   7141  C  CB    . TYR A 1  933  ? 21.957  -88.765  77.111  1.00 89.10  ? 933  TYR A CB    1 
ATOM   7142  C  CG    . TYR A 1  933  ? 21.052  -88.016  78.056  1.00 90.41  ? 933  TYR A CG    1 
ATOM   7143  C  CD1   . TYR A 1  933  ? 19.782  -87.607  77.659  1.00 92.64  ? 933  TYR A CD1   1 
ATOM   7144  C  CD2   . TYR A 1  933  ? 21.484  -87.656  79.323  1.00 90.72  ? 933  TYR A CD2   1 
ATOM   7145  C  CE1   . TYR A 1  933  ? 18.959  -86.878  78.514  1.00 93.24  ? 933  TYR A CE1   1 
ATOM   7146  C  CE2   . TYR A 1  933  ? 20.660  -86.950  80.195  1.00 91.16  ? 933  TYR A CE2   1 
ATOM   7147  C  CZ    . TYR A 1  933  ? 19.389  -86.585  79.795  1.00 98.99  ? 933  TYR A CZ    1 
ATOM   7148  O  OH    . TYR A 1  933  ? 18.580  -85.899  80.659  1.00 101.67 ? 933  TYR A OH    1 
ATOM   7149  N  N     . LYS A 1  934  ? 24.730  -87.309  76.576  1.00 85.07  ? 934  LYS A N     1 
ATOM   7150  C  CA    . LYS A 1  934  ? 25.834  -86.449  76.995  1.00 83.39  ? 934  LYS A CA    1 
ATOM   7151  C  C     . LYS A 1  934  ? 26.045  -85.317  76.002  1.00 84.11  ? 934  LYS A C     1 
ATOM   7152  O  O     . LYS A 1  934  ? 26.188  -84.184  76.445  1.00 84.19  ? 934  LYS A O     1 
ATOM   7153  C  CB    . LYS A 1  934  ? 27.130  -87.238  77.250  1.00 86.88  ? 934  LYS A CB    1 
ATOM   7154  C  CG    . LYS A 1  934  ? 27.376  -87.584  78.726  1.00 108.77 ? 934  LYS A CG    1 
ATOM   7155  C  CD    . LYS A 1  934  ? 26.807  -88.972  79.127  1.00 124.88 ? 934  LYS A CD    1 
ATOM   7156  C  CE    . LYS A 1  934  ? 27.624  -89.709  80.176  1.00 134.89 ? 934  LYS A CE    1 
ATOM   7157  N  NZ    . LYS A 1  934  ? 27.205  -91.135  80.334  1.00 137.95 ? 934  LYS A NZ    1 
ATOM   7158  N  N     . GLN A 1  935  ? 25.992  -85.582  74.680  1.00 77.62  ? 935  GLN A N     1 
ATOM   7159  C  CA    . GLN A 1  935  ? 26.123  -84.509  73.683  1.00 75.45  ? 935  GLN A CA    1 
ATOM   7160  C  C     . GLN A 1  935  ? 25.016  -83.494  73.855  1.00 78.53  ? 935  GLN A C     1 
ATOM   7161  O  O     . GLN A 1  935  ? 25.269  -82.292  73.775  1.00 76.64  ? 935  GLN A O     1 
ATOM   7162  C  CB    . GLN A 1  935  ? 26.042  -85.046  72.254  1.00 76.84  ? 935  GLN A CB    1 
ATOM   7163  C  CG    . GLN A 1  935  ? 27.339  -84.943  71.465  1.00 81.85  ? 935  GLN A CG    1 
ATOM   7164  C  CD    . GLN A 1  935  ? 28.056  -83.633  71.622  1.00 81.44  ? 935  GLN A CD    1 
ATOM   7165  O  OE1   . GLN A 1  935  ? 29.129  -83.568  72.212  1.00 72.47  ? 935  GLN A OE1   1 
ATOM   7166  N  NE2   . GLN A 1  935  ? 27.483  -82.571  71.098  1.00 74.20  ? 935  GLN A NE2   1 
ATOM   7167  N  N     . LEU A 1  936  ? 23.787  -83.990  74.106  1.00 76.42  ? 936  LEU A N     1 
ATOM   7168  C  CA    . LEU A 1  936  ? 22.575  -83.192  74.313  1.00 75.94  ? 936  LEU A CA    1 
ATOM   7169  C  C     . LEU A 1  936  ? 22.638  -82.313  75.561  1.00 78.90  ? 936  LEU A C     1 
ATOM   7170  O  O     . LEU A 1  936  ? 22.153  -81.182  75.536  1.00 76.84  ? 936  LEU A O     1 
ATOM   7171  C  CB    . LEU A 1  936  ? 21.323  -84.079  74.317  1.00 77.10  ? 936  LEU A CB    1 
ATOM   7172  C  CG    . LEU A 1  936  ? 20.737  -84.421  72.950  1.00 81.97  ? 936  LEU A CG    1 
ATOM   7173  C  CD1   . LEU A 1  936  ? 21.375  -85.657  72.345  1.00 83.17  ? 936  LEU A CD1   1 
ATOM   7174  C  CD2   . LEU A 1  936  ? 19.279  -84.659  73.049  1.00 85.16  ? 936  LEU A CD2   1 
ATOM   7175  N  N     . VAL A 1  937  ? 23.253  -82.814  76.634  1.00 77.38  ? 937  VAL A N     1 
ATOM   7176  C  CA    . VAL A 1  937  ? 23.425  -82.003  77.835  1.00 77.44  ? 937  VAL A CA    1 
ATOM   7177  C  C     . VAL A 1  937  ? 24.566  -80.998  77.624  1.00 83.81  ? 937  VAL A C     1 
ATOM   7178  O  O     . VAL A 1  937  ? 24.437  -79.845  78.046  1.00 83.09  ? 937  VAL A O     1 
ATOM   7179  C  CB    . VAL A 1  937  ? 23.505  -82.796  79.156  1.00 81.37  ? 937  VAL A CB    1 
ATOM   7180  C  CG1   . VAL A 1  937  ? 22.349  -83.786  79.257  1.00 82.14  ? 937  VAL A CG1   1 
ATOM   7181  C  CG2   . VAL A 1  937  ? 24.842  -83.503  79.311  1.00 81.68  ? 937  VAL A CG2   1 
ATOM   7182  N  N     . LYS A 1  938  ? 25.634  -81.421  76.884  1.00 82.08  ? 938  LYS A N     1 
ATOM   7183  C  CA    . LYS A 1  938  ? 26.797  -80.605  76.515  1.00 81.62  ? 938  LYS A CA    1 
ATOM   7184  C  C     . LYS A 1  938  ? 26.308  -79.364  75.760  1.00 86.13  ? 938  LYS A C     1 
ATOM   7185  O  O     . LYS A 1  938  ? 26.717  -78.251  76.113  1.00 84.98  ? 938  LYS A O     1 
ATOM   7186  C  CB    . LYS A 1  938  ? 27.786  -81.419  75.662  1.00 84.30  ? 938  LYS A CB    1 
ATOM   7187  C  CG    . LYS A 1  938  ? 29.238  -81.002  75.834  1.00 101.04 ? 938  LYS A CG    1 
ATOM   7188  C  CD    . LYS A 1  938  ? 30.153  -81.620  74.769  1.00 112.70 ? 938  LYS A CD    1 
ATOM   7189  C  CE    . LYS A 1  938  ? 30.535  -80.618  73.696  1.00 121.35 ? 938  LYS A CE    1 
ATOM   7190  N  NZ    . LYS A 1  938  ? 31.212  -81.254  72.533  1.00 129.12 ? 938  LYS A NZ    1 
ATOM   7191  N  N     . ASP A 1  939  ? 25.360  -79.559  74.791  1.00 83.75  ? 939  ASP A N     1 
ATOM   7192  C  CA    . ASP A 1  939  ? 24.714  -78.505  73.988  1.00 83.04  ? 939  ASP A CA    1 
ATOM   7193  C  C     . ASP A 1  939  ? 23.840  -77.601  74.866  1.00 84.44  ? 939  ASP A C     1 
ATOM   7194  O  O     . ASP A 1  939  ? 24.039  -76.387  74.861  1.00 82.68  ? 939  ASP A O     1 
ATOM   7195  C  CB    . ASP A 1  939  ? 23.852  -79.114  72.862  1.00 86.00  ? 939  ASP A CB    1 
ATOM   7196  C  CG    . ASP A 1  939  ? 24.610  -79.866  71.787  1.00 102.18 ? 939  ASP A CG    1 
ATOM   7197  O  OD1   . ASP A 1  939  ? 25.874  -79.780  71.772  1.00 104.00 ? 939  ASP A OD1   1 
ATOM   7198  O  OD2   . ASP A 1  939  ? 23.943  -80.525  70.936  1.00 106.91 ? 939  ASP A OD2   1 
ATOM   7199  N  N     . ARG A 1  940  ? 22.873  -78.199  75.617  1.00 80.17  ? 940  ARG A N     1 
ATOM   7200  C  CA    . ARG A 1  940  ? 21.961  -77.529  76.561  1.00 78.94  ? 940  ARG A CA    1 
ATOM   7201  C  C     . ARG A 1  940  ? 22.739  -76.429  77.298  1.00 80.71  ? 940  ARG A C     1 
ATOM   7202  O  O     . ARG A 1  940  ? 22.327  -75.268  77.294  1.00 77.47  ? 940  ARG A O     1 
ATOM   7203  C  CB    . ARG A 1  940  ? 21.401  -78.588  77.556  1.00 78.98  ? 940  ARG A CB    1 
ATOM   7204  C  CG    . ARG A 1  940  ? 20.782  -78.060  78.858  1.00 84.09  ? 940  ARG A CG    1 
ATOM   7205  C  CD    . ARG A 1  940  ? 19.282  -77.902  78.744  1.00 85.22  ? 940  ARG A CD    1 
ATOM   7206  N  NE    . ARG A 1  940  ? 18.653  -77.426  79.973  1.00 85.14  ? 940  ARG A NE    1 
ATOM   7207  C  CZ    . ARG A 1  940  ? 17.344  -77.441  80.191  1.00 96.21  ? 940  ARG A CZ    1 
ATOM   7208  N  NH1   . ARG A 1  940  ? 16.516  -77.914  79.270  1.00 83.18  ? 940  ARG A NH1   1 
ATOM   7209  N  NH2   . ARG A 1  940  ? 16.853  -77.002  81.339  1.00 85.42  ? 940  ARG A NH2   1 
ATOM   7210  N  N     . LYS A 1  941  ? 23.908  -76.823  77.862  1.00 78.54  ? 941  LYS A N     1 
ATOM   7211  C  CA    . LYS A 1  941  ? 24.854  -76.000  78.607  1.00 77.98  ? 941  LYS A CA    1 
ATOM   7212  C  C     . LYS A 1  941  ? 25.617  -75.030  77.713  1.00 79.83  ? 941  LYS A C     1 
ATOM   7213  O  O     . LYS A 1  941  ? 25.905  -73.925  78.155  1.00 79.84  ? 941  LYS A O     1 
ATOM   7214  C  CB    . LYS A 1  941  ? 25.827  -76.887  79.396  1.00 81.60  ? 941  LYS A CB    1 
ATOM   7215  C  CG    . LYS A 1  941  ? 26.240  -76.284  80.736  1.00 100.83 ? 941  LYS A CG    1 
ATOM   7216  C  CD    . LYS A 1  941  ? 27.675  -75.742  80.724  1.00 108.41 ? 941  LYS A CD    1 
ATOM   7217  C  CE    . LYS A 1  941  ? 28.664  -76.705  81.343  1.00 108.13 ? 941  LYS A CE    1 
ATOM   7218  N  NZ    . LYS A 1  941  ? 30.063  -76.278  81.105  1.00 110.75 ? 941  LYS A NZ    1 
ATOM   7219  N  N     . PHE A 1  942  ? 25.957  -75.433  76.481  1.00 74.41  ? 942  PHE A N     1 
ATOM   7220  C  CA    . PHE A 1  942  ? 26.673  -74.571  75.545  1.00 72.85  ? 942  PHE A CA    1 
ATOM   7221  C  C     . PHE A 1  942  ? 25.784  -73.433  75.071  1.00 75.93  ? 942  PHE A C     1 
ATOM   7222  O  O     . PHE A 1  942  ? 26.205  -72.280  75.130  1.00 76.16  ? 942  PHE A O     1 
ATOM   7223  C  CB    . PHE A 1  942  ? 27.192  -75.373  74.341  1.00 74.64  ? 942  PHE A CB    1 
ATOM   7224  C  CG    . PHE A 1  942  ? 27.698  -74.535  73.188  1.00 75.22  ? 942  PHE A CG    1 
ATOM   7225  C  CD1   . PHE A 1  942  ? 28.973  -73.983  73.213  1.00 77.69  ? 942  PHE A CD1   1 
ATOM   7226  C  CD2   . PHE A 1  942  ? 26.899  -74.306  72.070  1.00 76.84  ? 942  PHE A CD2   1 
ATOM   7227  C  CE1   . PHE A 1  942  ? 29.443  -73.223  72.137  1.00 78.12  ? 942  PHE A CE1   1 
ATOM   7228  C  CE2   . PHE A 1  942  ? 27.372  -73.550  70.993  1.00 78.44  ? 942  PHE A CE2   1 
ATOM   7229  C  CZ    . PHE A 1  942  ? 28.643  -73.022  71.027  1.00 76.37  ? 942  PHE A CZ    1 
ATOM   7230  N  N     . LEU A 1  943  ? 24.581  -73.760  74.552  1.00 70.94  ? 943  LEU A N     1 
ATOM   7231  C  CA    . LEU A 1  943  ? 23.607  -72.794  74.041  1.00 68.94  ? 943  LEU A CA    1 
ATOM   7232  C  C     . LEU A 1  943  ? 23.242  -71.811  75.149  1.00 72.67  ? 943  LEU A C     1 
ATOM   7233  O  O     . LEU A 1  943  ? 23.197  -70.601  74.902  1.00 71.59  ? 943  LEU A O     1 
ATOM   7234  C  CB    . LEU A 1  943  ? 22.348  -73.499  73.518  1.00 68.96  ? 943  LEU A CB    1 
ATOM   7235  C  CG    . LEU A 1  943  ? 22.550  -74.547  72.429  1.00 74.68  ? 943  LEU A CG    1 
ATOM   7236  C  CD1   . LEU A 1  943  ? 21.409  -75.541  72.407  1.00 75.55  ? 943  LEU A CD1   1 
ATOM   7237  C  CD2   . LEU A 1  943  ? 22.715  -73.911  71.069  1.00 77.19  ? 943  LEU A CD2   1 
ATOM   7238  N  N     . ARG A 1  944  ? 23.062  -72.323  76.388  1.00 68.96  ? 944  ARG A N     1 
ATOM   7239  C  CA    . ARG A 1  944  ? 22.760  -71.490  77.537  1.00 68.52  ? 944  ARG A CA    1 
ATOM   7240  C  C     . ARG A 1  944  ? 23.873  -70.493  77.840  1.00 75.08  ? 944  ARG A C     1 
ATOM   7241  O  O     . ARG A 1  944  ? 23.603  -69.482  78.496  1.00 75.54  ? 944  ARG A O     1 
ATOM   7242  C  CB    . ARG A 1  944  ? 22.389  -72.328  78.751  1.00 67.60  ? 944  ARG A CB    1 
ATOM   7243  C  CG    . ARG A 1  944  ? 20.917  -72.641  78.765  1.00 71.70  ? 944  ARG A CG    1 
ATOM   7244  C  CD    . ARG A 1  944  ? 20.473  -73.517  79.906  1.00 73.53  ? 944  ARG A CD    1 
ATOM   7245  N  NE    . ARG A 1  944  ? 19.039  -73.775  79.793  1.00 81.72  ? 944  ARG A NE    1 
ATOM   7246  C  CZ    . ARG A 1  944  ? 18.194  -73.835  80.816  1.00 100.83 ? 944  ARG A CZ    1 
ATOM   7247  N  NH1   . ARG A 1  944  ? 18.630  -73.665  82.057  1.00 83.07  ? 944  ARG A NH1   1 
ATOM   7248  N  NH2   . ARG A 1  944  ? 16.902  -74.047  80.605  1.00 99.90  ? 944  ARG A NH2   1 
ATOM   7249  N  N     . GLU A 1  945  ? 25.111  -70.746  77.337  1.00 72.92  ? 945  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  945  ? 26.192  -69.777  77.505  1.00 73.55  ? 945  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  945  ? 26.321  -68.802  76.356  1.00 77.09  ? 945  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  945  ? 26.652  -67.640  76.593  1.00 77.18  ? 945  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  945  ? 27.528  -70.304  78.085  1.00 76.21  ? 945  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  945  ? 28.177  -71.522  77.441  1.00 94.41  ? 945  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  945  ? 29.232  -72.237  78.282  1.00 127.12 ? 945  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  945  ? 30.256  -72.665  77.699  1.00 131.83 ? 945  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  945  ? 29.026  -72.403  79.509  1.00 115.66 ? 945  GLU A OE2   1 
ATOM   7258  N  N     . VAL A 1  946  ? 25.975  -69.237  75.127  1.00 72.63  ? 946  VAL A N     1 
ATOM   7259  C  CA    . VAL A 1  946  ? 25.969  -68.362  73.945  1.00 70.78  ? 946  VAL A CA    1 
ATOM   7260  C  C     . VAL A 1  946  ? 24.739  -67.422  74.092  1.00 75.23  ? 946  VAL A C     1 
ATOM   7261  O  O     . VAL A 1  946  ? 24.905  -66.224  74.353  1.00 73.04  ? 946  VAL A O     1 
ATOM   7262  C  CB    . VAL A 1  946  ? 25.966  -69.181  72.629  1.00 72.91  ? 946  VAL A CB    1 
ATOM   7263  C  CG1   . VAL A 1  946  ? 25.960  -68.280  71.402  1.00 71.37  ? 946  VAL A CG1   1 
ATOM   7264  C  CG2   . VAL A 1  946  ? 27.156  -70.120  72.586  1.00 73.30  ? 946  VAL A CG2   1 
ATOM   7265  N  N     . PHE A 1  947  ? 23.522  -68.001  74.037  1.00 73.12  ? 947  PHE A N     1 
ATOM   7266  C  CA    . PHE A 1  947  ? 22.253  -67.292  74.193  1.00 73.00  ? 947  PHE A CA    1 
ATOM   7267  C  C     . PHE A 1  947  ? 21.883  -67.259  75.684  1.00 77.33  ? 947  PHE A C     1 
ATOM   7268  O  O     . PHE A 1  947  ? 21.083  -68.064  76.166  1.00 76.59  ? 947  PHE A O     1 
ATOM   7269  C  CB    . PHE A 1  947  ? 21.184  -67.959  73.311  1.00 75.22  ? 947  PHE A CB    1 
ATOM   7270  C  CG    . PHE A 1  947  ? 21.658  -68.203  71.891  1.00 77.00  ? 947  PHE A CG    1 
ATOM   7271  C  CD1   . PHE A 1  947  ? 21.960  -69.480  71.452  1.00 80.67  ? 947  PHE A CD1   1 
ATOM   7272  C  CD2   . PHE A 1  947  ? 21.852  -67.143  71.012  1.00 79.09  ? 947  PHE A CD2   1 
ATOM   7273  C  CE1   . PHE A 1  947  ? 22.419  -69.693  70.151  1.00 81.60  ? 947  PHE A CE1   1 
ATOM   7274  C  CE2   . PHE A 1  947  ? 22.296  -67.361  69.704  1.00 81.27  ? 947  PHE A CE2   1 
ATOM   7275  C  CZ    . PHE A 1  947  ? 22.587  -68.629  69.288  1.00 80.04  ? 947  PHE A CZ    1 
ATOM   7276  N  N     . VAL A 1  948  ? 22.547  -66.340  76.409  1.00 74.90  ? 948  VAL A N     1 
ATOM   7277  C  CA    . VAL A 1  948  ? 22.506  -66.092  77.858  1.00 75.28  ? 948  VAL A CA    1 
ATOM   7278  C  C     . VAL A 1  948  ? 21.119  -65.986  78.499  1.00 81.40  ? 948  VAL A C     1 
ATOM   7279  O  O     . VAL A 1  948  ? 20.944  -66.486  79.615  1.00 81.19  ? 948  VAL A O     1 
ATOM   7280  C  CB    . VAL A 1  948  ? 23.459  -64.930  78.235  1.00 78.35  ? 948  VAL A CB    1 
ATOM   7281  C  CG1   . VAL A 1  948  ? 23.067  -64.253  79.541  1.00 78.76  ? 948  VAL A CG1   1 
ATOM   7282  C  CG2   . VAL A 1  948  ? 24.897  -65.416  78.299  1.00 78.27  ? 948  VAL A CG2   1 
ATOM   7283  N  N     . ASP A 1  949  ? 20.143  -65.360  77.809  1.00 79.39  ? 949  ASP A N     1 
ATOM   7284  C  CA    . ASP A 1  949  ? 18.782  -65.194  78.341  1.00 80.94  ? 949  ASP A CA    1 
ATOM   7285  C  C     . ASP A 1  949  ? 17.884  -66.400  78.078  1.00 86.36  ? 949  ASP A C     1 
ATOM   7286  O  O     . ASP A 1  949  ? 16.731  -66.440  78.520  1.00 85.74  ? 949  ASP A O     1 
ATOM   7287  C  CB    . ASP A 1  949  ? 18.136  -63.929  77.766  1.00 83.39  ? 949  ASP A CB    1 
ATOM   7288  C  CG    . ASP A 1  949  ? 17.675  -64.048  76.327  1.00 101.46 ? 949  ASP A CG    1 
ATOM   7289  O  OD1   . ASP A 1  949  ? 18.431  -64.635  75.501  1.00 103.27 ? 949  ASP A OD1   1 
ATOM   7290  O  OD2   . ASP A 1  949  ? 16.574  -63.533  76.015  1.00 109.19 ? 949  ASP A OD2   1 
ATOM   7291  N  N     . GLY A 1  950  ? 18.422  -67.355  77.339  1.00 84.76  ? 950  GLY A N     1 
ATOM   7292  C  CA    . GLY A 1  950  ? 17.712  -68.564  76.968  1.00 85.86  ? 950  GLY A CA    1 
ATOM   7293  C  C     . GLY A 1  950  ? 16.753  -68.377  75.815  1.00 91.08  ? 950  GLY A C     1 
ATOM   7294  O  O     . GLY A 1  950  ? 15.769  -69.120  75.734  1.00 91.92  ? 950  GLY A O     1 
ATOM   7295  N  N     . GLU A 1  951  ? 17.031  -67.396  74.905  1.00 86.84  ? 951  GLU A N     1 
ATOM   7296  C  CA    . GLU A 1  951  ? 16.226  -67.175  73.696  1.00 86.31  ? 951  GLU A CA    1 
ATOM   7297  C  C     . GLU A 1  951  ? 16.452  -68.367  72.780  1.00 91.32  ? 951  GLU A C     1 
ATOM   7298  O  O     . GLU A 1  951  ? 17.589  -68.640  72.379  1.00 91.87  ? 951  GLU A O     1 
ATOM   7299  C  CB    . GLU A 1  951  ? 16.574  -65.863  72.978  1.00 86.58  ? 951  GLU A CB    1 
ATOM   7300  C  CG    . GLU A 1  951  ? 15.836  -65.668  71.660  1.00 95.61  ? 951  GLU A CG    1 
ATOM   7301  C  CD    . GLU A 1  951  ? 14.369  -66.055  71.629  1.00 117.28 ? 951  GLU A CD    1 
ATOM   7302  O  OE1   . GLU A 1  951  ? 13.574  -65.478  72.406  1.00 119.38 ? 951  GLU A OE1   1 
ATOM   7303  O  OE2   . GLU A 1  951  ? 14.023  -66.965  70.843  1.00 108.20 ? 951  GLU A OE2   1 
ATOM   7304  N  N     . ALA A 1  952  ? 15.362  -69.091  72.492  1.00 86.93  ? 952  ALA A N     1 
ATOM   7305  C  CA    . ALA A 1  952  ? 15.383  -70.333  71.728  1.00 86.20  ? 952  ALA A CA    1 
ATOM   7306  C  C     . ALA A 1  952  ? 15.494  -70.171  70.229  1.00 85.29  ? 952  ALA A C     1 
ATOM   7307  O  O     . ALA A 1  952  ? 16.401  -70.737  69.626  1.00 85.25  ? 952  ALA A O     1 
ATOM   7308  C  CB    . ALA A 1  952  ? 14.161  -71.172  72.077  1.00 88.16  ? 952  ALA A CB    1 
ATOM   7309  N  N     . ASN A 1  953  ? 14.554  -69.436  69.634  1.00 77.83  ? 953  ASN A N     1 
ATOM   7310  C  CA    . ASN A 1  953  ? 14.438  -69.244  68.201  1.00 75.81  ? 953  ASN A CA    1 
ATOM   7311  C  C     . ASN A 1  953  ? 15.487  -68.306  67.597  1.00 76.01  ? 953  ASN A C     1 
ATOM   7312  O  O     . ASN A 1  953  ? 15.564  -67.122  67.939  1.00 73.93  ? 953  ASN A O     1 
ATOM   7313  C  CB    . ASN A 1  953  ? 13.007  -68.872  67.831  1.00 76.22  ? 953  ASN A CB    1 
ATOM   7314  C  CG    . ASN A 1  953  ? 12.028  -69.092  68.962  1.00 95.98  ? 953  ASN A CG    1 
ATOM   7315  O  OD1   . ASN A 1  953  ? 11.630  -70.214  69.265  1.00 83.94  ? 953  ASN A OD1   1 
ATOM   7316  N  ND2   . ASN A 1  953  ? 11.702  -68.029  69.676  1.00 93.84  ? 953  ASN A ND2   1 
ATOM   7317  N  N     . TRP A 1  954  ? 16.324  -68.882  66.719  1.00 71.61  ? 954  TRP A N     1 
ATOM   7318  C  CA    . TRP A 1  954  ? 17.414  -68.216  66.028  1.00 70.35  ? 954  TRP A CA    1 
ATOM   7319  C  C     . TRP A 1  954  ? 17.493  -68.608  64.545  1.00 74.38  ? 954  TRP A C     1 
ATOM   7320  O  O     . TRP A 1  954  ? 17.272  -69.780  64.200  1.00 73.53  ? 954  TRP A O     1 
ATOM   7321  C  CB    . TRP A 1  954  ? 18.714  -68.486  66.754  1.00 69.56  ? 954  TRP A CB    1 
ATOM   7322  C  CG    . TRP A 1  954  ? 18.773  -67.763  68.063  1.00 70.99  ? 954  TRP A CG    1 
ATOM   7323  C  CD1   . TRP A 1  954  ? 18.393  -68.231  69.291  1.00 74.47  ? 954  TRP A CD1   1 
ATOM   7324  C  CD2   . TRP A 1  954  ? 19.159  -66.403  68.254  1.00 70.08  ? 954  TRP A CD2   1 
ATOM   7325  N  NE1   . TRP A 1  954  ? 18.549  -67.246  70.240  1.00 73.18  ? 954  TRP A NE1   1 
ATOM   7326  C  CE2   . TRP A 1  954  ? 19.013  -66.113  69.627  1.00 73.75  ? 954  TRP A CE2   1 
ATOM   7327  C  CE3   . TRP A 1  954  ? 19.651  -65.411  67.401  1.00 70.44  ? 954  TRP A CE3   1 
ATOM   7328  C  CZ2   . TRP A 1  954  ? 19.349  -64.881  70.158  1.00 72.74  ? 954  TRP A CZ2   1 
ATOM   7329  C  CZ3   . TRP A 1  954  ? 19.998  -64.196  67.935  1.00 71.28  ? 954  TRP A CZ3   1 
ATOM   7330  C  CH2   . TRP A 1  954  ? 19.817  -63.928  69.291  1.00 72.20  ? 954  TRP A CH2   1 
ATOM   7331  N  N     . PRO A 1  955  ? 17.788  -67.614  63.659  1.00 71.02  ? 955  PRO A N     1 
ATOM   7332  C  CA    . PRO A 1  955  ? 17.829  -67.871  62.216  1.00 70.29  ? 955  PRO A CA    1 
ATOM   7333  C  C     . PRO A 1  955  ? 18.966  -68.766  61.774  1.00 74.44  ? 955  PRO A C     1 
ATOM   7334  O  O     . PRO A 1  955  ? 20.139  -68.382  61.842  1.00 73.36  ? 955  PRO A O     1 
ATOM   7335  C  CB    . PRO A 1  955  ? 17.944  -66.468  61.611  1.00 71.02  ? 955  PRO A CB    1 
ATOM   7336  C  CG    . PRO A 1  955  ? 17.502  -65.556  62.666  1.00 75.73  ? 955  PRO A CG    1 
ATOM   7337  C  CD    . PRO A 1  955  ? 18.038  -66.187  63.912  1.00 72.36  ? 955  PRO A CD    1 
ATOM   7338  N  N     . LEU A 1  956  ? 18.592  -69.966  61.302  1.00 71.80  ? 956  LEU A N     1 
ATOM   7339  C  CA    . LEU A 1  956  ? 19.517  -70.996  60.829  1.00 72.14  ? 956  LEU A CA    1 
ATOM   7340  C  C     . LEU A 1  956  ? 19.079  -71.545  59.482  1.00 74.62  ? 956  LEU A C     1 
ATOM   7341  O  O     . LEU A 1  956  ? 17.882  -71.510  59.210  1.00 73.44  ? 956  LEU A O     1 
ATOM   7342  C  CB    . LEU A 1  956  ? 19.587  -72.146  61.846  1.00 72.98  ? 956  LEU A CB    1 
ATOM   7343  C  CG    . LEU A 1  956  ? 20.359  -71.848  63.095  1.00 76.39  ? 956  LEU A CG    1 
ATOM   7344  C  CD1   . LEU A 1  956  ? 19.585  -72.278  64.301  1.00 76.33  ? 956  LEU A CD1   1 
ATOM   7345  C  CD2   . LEU A 1  956  ? 21.710  -72.487  63.025  1.00 80.12  ? 956  LEU A CD2   1 
ATOM   7346  N  N     . PRO A 1  957  ? 20.001  -72.092  58.639  1.00 72.01  ? 957  PRO A N     1 
ATOM   7347  C  CA    . PRO A 1  957  ? 19.563  -72.680  57.375  1.00 72.38  ? 957  PRO A CA    1 
ATOM   7348  C  C     . PRO A 1  957  ? 18.869  -74.020  57.631  1.00 79.46  ? 957  PRO A C     1 
ATOM   7349  O  O     . PRO A 1  957  ? 18.971  -74.562  58.737  1.00 79.76  ? 957  PRO A O     1 
ATOM   7350  C  CB    . PRO A 1  957  ? 20.877  -72.859  56.614  1.00 73.83  ? 957  PRO A CB    1 
ATOM   7351  C  CG    . PRO A 1  957  ? 21.858  -73.135  57.633  1.00 78.34  ? 957  PRO A CG    1 
ATOM   7352  C  CD    . PRO A 1  957  ? 21.459  -72.271  58.809  1.00 73.81  ? 957  PRO A CD    1 
ATOM   7353  N  N     . VAL A 1  958  ? 18.171  -74.554  56.605  1.00 77.09  ? 958  VAL A N     1 
ATOM   7354  C  CA    . VAL A 1  958  ? 17.453  -75.839  56.637  1.00 77.42  ? 958  VAL A CA    1 
ATOM   7355  C  C     . VAL A 1  958  ? 16.320  -75.854  57.669  1.00 81.25  ? 958  VAL A C     1 
ATOM   7356  O  O     . VAL A 1  958  ? 16.579  -76.083  58.856  1.00 81.48  ? 958  VAL A O     1 
ATOM   7357  C  CB    . VAL A 1  958  ? 18.381  -77.080  56.787  1.00 81.41  ? 958  VAL A CB    1 
ATOM   7358  C  CG1   . VAL A 1  958  ? 17.658  -78.351  56.385  1.00 82.55  ? 958  VAL A CG1   1 
ATOM   7359  C  CG2   . VAL A 1  958  ? 19.669  -76.928  55.995  1.00 80.77  ? 958  VAL A CG2   1 
ATOM   7360  N  N     . ASN A 1  959  ? 15.068  -75.619  57.227  1.00 76.93  ? 959  ASN A N     1 
ATOM   7361  C  CA    . ASN A 1  959  ? 13.941  -75.691  58.157  1.00 76.52  ? 959  ASN A CA    1 
ATOM   7362  C  C     . ASN A 1  959  ? 13.622  -77.167  58.362  1.00 81.67  ? 959  ASN A C     1 
ATOM   7363  O  O     . ASN A 1  959  ? 12.960  -77.809  57.532  1.00 82.85  ? 959  ASN A O     1 
ATOM   7364  C  CB    . ASN A 1  959  ? 12.727  -74.895  57.690  1.00 73.16  ? 959  ASN A CB    1 
ATOM   7365  C  CG    . ASN A 1  959  ? 11.682  -74.741  58.767  1.00 81.46  ? 959  ASN A CG    1 
ATOM   7366  O  OD1   . ASN A 1  959  ? 10.845  -75.618  58.999  1.00 67.88  ? 959  ASN A OD1   1 
ATOM   7367  N  ND2   . ASN A 1  959  ? 11.722  -73.625  59.467  1.00 74.59  ? 959  ASN A ND2   1 
ATOM   7368  N  N     . ILE A 1  960  ? 14.182  -77.719  59.433  1.00 77.15  ? 960  ILE A N     1 
ATOM   7369  C  CA    . ILE A 1  960  ? 14.014  -79.126  59.740  1.00 77.74  ? 960  ILE A CA    1 
ATOM   7370  C  C     . ILE A 1  960  ? 12.534  -79.499  59.946  1.00 83.15  ? 960  ILE A C     1 
ATOM   7371  O  O     . ILE A 1  960  ? 12.071  -80.436  59.293  1.00 83.28  ? 960  ILE A O     1 
ATOM   7372  C  CB    . ILE A 1  960  ? 15.017  -79.611  60.840  1.00 79.79  ? 960  ILE A CB    1 
ATOM   7373  C  CG1   . ILE A 1  960  ? 16.425  -79.816  60.210  1.00 78.81  ? 960  ILE A CG1   1 
ATOM   7374  C  CG2   . ILE A 1  960  ? 14.526  -80.900  61.524  1.00 80.81  ? 960  ILE A CG2   1 
ATOM   7375  C  CD1   . ILE A 1  960  ? 17.592  -79.500  61.061  1.00 72.81  ? 960  ILE A CD1   1 
ATOM   7376  N  N     . ARG A 1  961  ? 11.783  -78.709  60.768  1.00 79.77  ? 961  ARG A N     1 
ATOM   7377  C  CA    . ARG A 1  961  ? 10.368  -78.959  61.071  1.00 80.59  ? 961  ARG A CA    1 
ATOM   7378  C  C     . ARG A 1  961  ? 9.601   -79.352  59.823  1.00 88.41  ? 961  ARG A C     1 
ATOM   7379  O  O     . ARG A 1  961  ? 8.993   -80.427  59.795  1.00 91.19  ? 961  ARG A O     1 
ATOM   7380  C  CB    . ARG A 1  961  ? 9.716   -77.777  61.797  1.00 78.59  ? 961  ARG A CB    1 
ATOM   7381  C  CG    . ARG A 1  961  ? 8.357   -78.088  62.438  1.00 91.28  ? 961  ARG A CG    1 
ATOM   7382  C  CD    . ARG A 1  961  ? 7.981   -76.999  63.434  1.00 112.33 ? 961  ARG A CD    1 
ATOM   7383  N  NE    . ARG A 1  961  ? 6.549   -76.949  63.762  1.00 127.31 ? 961  ARG A NE    1 
ATOM   7384  C  CZ    . ARG A 1  961  ? 5.661   -76.128  63.196  1.00 137.98 ? 961  ARG A CZ    1 
ATOM   7385  N  NH1   . ARG A 1  961  ? 6.033   -75.303  62.223  1.00 121.93 ? 961  ARG A NH1   1 
ATOM   7386  N  NH2   . ARG A 1  961  ? 4.392   -76.141  63.588  1.00 119.25 ? 961  ARG A NH2   1 
ATOM   7387  N  N     . ARG A 1  962  ? 9.730   -78.554  58.760  1.00 84.32  ? 962  ARG A N     1 
ATOM   7388  C  CA    . ARG A 1  962  ? 9.079   -78.842  57.491  1.00 84.98  ? 962  ARG A CA    1 
ATOM   7389  C  C     . ARG A 1  962  ? 9.500   -80.188  56.915  1.00 88.17  ? 962  ARG A C     1 
ATOM   7390  O  O     . ARG A 1  962  ? 8.617   -80.960  56.552  1.00 89.31  ? 962  ARG A O     1 
ATOM   7391  C  CB    . ARG A 1  962  ? 9.316   -77.718  56.475  1.00 87.36  ? 962  ARG A CB    1 
ATOM   7392  C  CG    . ARG A 1  962  ? 8.135   -76.762  56.308  1.00 97.61  ? 962  ARG A CG    1 
ATOM   7393  C  CD    . ARG A 1  962  ? 8.292   -75.944  55.047  1.00 99.59  ? 962  ARG A CD    1 
ATOM   7394  N  NE    . ARG A 1  962  ? 9.150   -74.767  55.230  1.00 96.83  ? 962  ARG A NE    1 
ATOM   7395  C  CZ    . ARG A 1  962  ? 10.433  -74.694  54.878  1.00 98.42  ? 962  ARG A CZ    1 
ATOM   7396  N  NH1   . ARG A 1  962  ? 11.052  -75.754  54.357  1.00 83.09  ? 962  ARG A NH1   1 
ATOM   7397  N  NH2   . ARG A 1  962  ? 11.111  -73.569  55.057  1.00 69.12  ? 962  ARG A NH2   1 
ATOM   7398  N  N     . ILE A 1  963  ? 10.824  -80.492  56.865  1.00 82.44  ? 963  ILE A N     1 
ATOM   7399  C  CA    . ILE A 1  963  ? 11.320  -81.764  56.317  1.00 82.65  ? 963  ILE A CA    1 
ATOM   7400  C  C     . ILE A 1  963  ? 10.598  -82.933  56.961  1.00 87.75  ? 963  ILE A C     1 
ATOM   7401  O  O     . ILE A 1  963  ? 10.105  -83.808  56.242  1.00 88.17  ? 963  ILE A O     1 
ATOM   7402  C  CB    . ILE A 1  963  ? 12.869  -81.914  56.356  1.00 84.85  ? 963  ILE A CB    1 
ATOM   7403  C  CG1   . ILE A 1  963  ? 13.556  -80.748  55.616  1.00 83.62  ? 963  ILE A CG1   1 
ATOM   7404  C  CG2   . ILE A 1  963  ? 13.311  -83.281  55.787  1.00 85.91  ? 963  ILE A CG2   1 
ATOM   7405  C  CD1   . ILE A 1  963  ? 15.046  -80.792  55.588  1.00 87.69  ? 963  ILE A CD1   1 
ATOM   7406  N  N     . ILE A 1  964  ? 10.477  -82.902  58.308  1.00 84.50  ? 964  ILE A N     1 
ATOM   7407  C  CA    . ILE A 1  964  ? 9.785   -83.926  59.093  1.00 85.90  ? 964  ILE A CA    1 
ATOM   7408  C  C     . ILE A 1  964  ? 8.328   -84.016  58.629  1.00 92.05  ? 964  ILE A C     1 
ATOM   7409  O  O     . ILE A 1  964  ? 7.885   -85.095  58.209  1.00 93.56  ? 964  ILE A O     1 
ATOM   7410  C  CB    . ILE A 1  964  ? 9.912   -83.686  60.623  1.00 88.17  ? 964  ILE A CB    1 
ATOM   7411  C  CG1   . ILE A 1  964  ? 11.388  -83.569  61.086  1.00 88.26  ? 964  ILE A CG1   1 
ATOM   7412  C  CG2   . ILE A 1  964  ? 9.136   -84.729  61.432  1.00 89.61  ? 964  ILE A CG2   1 
ATOM   7413  C  CD1   . ILE A 1  964  ? 12.364  -84.750  60.710  1.00 98.51  ? 964  ILE A CD1   1 
ATOM   7414  N  N     . GLN A 1  965  ? 7.617   -82.867  58.633  1.00 86.96  ? 965  GLN A N     1 
ATOM   7415  C  CA    . GLN A 1  965  ? 6.223   -82.787  58.202  1.00 87.21  ? 965  GLN A CA    1 
ATOM   7416  C  C     . GLN A 1  965  ? 6.040   -83.350  56.786  1.00 91.65  ? 965  GLN A C     1 
ATOM   7417  O  O     . GLN A 1  965  ? 5.105   -84.120  56.546  1.00 92.89  ? 965  GLN A O     1 
ATOM   7418  C  CB    . GLN A 1  965  ? 5.715   -81.349  58.301  1.00 87.29  ? 965  GLN A CB    1 
ATOM   7419  C  CG    . GLN A 1  965  ? 5.648   -80.830  59.734  1.00 103.98 ? 965  GLN A CG    1 
ATOM   7420  C  CD    . GLN A 1  965  ? 5.285   -79.365  59.871  1.00 120.37 ? 965  GLN A CD    1 
ATOM   7421  O  OE1   . GLN A 1  965  ? 5.154   -78.855  60.990  1.00 112.91 ? 965  GLN A OE1   1 
ATOM   7422  N  NE2   . GLN A 1  965  ? 5.115   -78.647  58.757  1.00 113.10 ? 965  GLN A NE2   1 
ATOM   7423  N  N     . ASN A 1  966  ? 6.979   -83.012  55.878  1.00 86.83  ? 966  ASN A N     1 
ATOM   7424  C  CA    . ASN A 1  966  ? 7.001   -83.459  54.491  1.00 86.95  ? 966  ASN A CA    1 
ATOM   7425  C  C     . ASN A 1  966  ? 7.141   -84.958  54.414  1.00 91.60  ? 966  ASN A C     1 
ATOM   7426  O  O     . ASN A 1  966  ? 6.326   -85.592  53.752  1.00 92.10  ? 966  ASN A O     1 
ATOM   7427  C  CB    . ASN A 1  966  ? 8.131   -82.785  53.716  1.00 87.26  ? 966  ASN A CB    1 
ATOM   7428  C  CG    . ASN A 1  966  ? 7.918   -81.323  53.422  1.00 104.48 ? 966  ASN A CG    1 
ATOM   7429  O  OD1   . ASN A 1  966  ? 6.816   -80.866  53.091  1.00 94.26  ? 966  ASN A OD1   1 
ATOM   7430  N  ND2   . ASN A 1  966  ? 9.002   -80.574  53.461  1.00 97.59  ? 966  ASN A ND2   1 
ATOM   7431  N  N     . ALA A 1  967  ? 8.132   -85.530  55.132  1.00 88.70  ? 967  ALA A N     1 
ATOM   7432  C  CA    . ALA A 1  967  ? 8.373   -86.977  55.182  1.00 90.32  ? 967  ALA A CA    1 
ATOM   7433  C  C     . ALA A 1  967  ? 7.113   -87.717  55.657  1.00 96.02  ? 967  ALA A C     1 
ATOM   7434  O  O     . ALA A 1  967  ? 6.725   -88.721  55.047  1.00 96.90  ? 967  ALA A O     1 
ATOM   7435  C  CB    . ALA A 1  967  ? 9.553   -87.283  56.095  1.00 90.66  ? 967  ALA A CB    1 
ATOM   7436  N  N     . GLN A 1  968  ? 6.436   -87.160  56.692  1.00 92.22  ? 968  GLN A N     1 
ATOM   7437  C  CA    . GLN A 1  968  ? 5.200   -87.699  57.265  1.00 93.30  ? 968  GLN A CA    1 
ATOM   7438  C  C     . GLN A 1  968  ? 4.104   -87.834  56.202  1.00 97.79  ? 968  GLN A C     1 
ATOM   7439  O  O     . GLN A 1  968  ? 3.499   -88.902  56.076  1.00 99.37  ? 968  GLN A O     1 
ATOM   7440  C  CB    . GLN A 1  968  ? 4.747   -86.856  58.466  1.00 93.68  ? 968  GLN A CB    1 
ATOM   7441  C  CG    . GLN A 1  968  ? 5.635   -87.081  59.684  1.00 111.15 ? 968  GLN A CG    1 
ATOM   7442  C  CD    . GLN A 1  968  ? 5.407   -86.095  60.797  1.00 128.90 ? 968  GLN A CD    1 
ATOM   7443  O  OE1   . GLN A 1  968  ? 5.776   -84.924  60.706  1.00 118.98 ? 968  GLN A OE1   1 
ATOM   7444  N  NE2   . GLN A 1  968  ? 4.881   -86.577  61.916  1.00 128.37 ? 968  GLN A NE2   1 
ATOM   7445  N  N     . GLN A 1  969  ? 3.916   -86.786  55.391  1.00 92.40  ? 969  GLN A N     1 
ATOM   7446  C  CA    . GLN A 1  969  ? 2.939   -86.788  54.315  1.00 92.69  ? 969  GLN A CA    1 
ATOM   7447  C  C     . GLN A 1  969  ? 3.366   -87.699  53.137  1.00 97.17  ? 969  GLN A C     1 
ATOM   7448  O  O     . GLN A 1  969  ? 2.551   -88.514  52.701  1.00 97.79  ? 969  GLN A O     1 
ATOM   7449  C  CB    . GLN A 1  969  ? 2.641   -85.352  53.858  1.00 92.48  ? 969  GLN A CB    1 
ATOM   7450  C  CG    . GLN A 1  969  ? 1.141   -85.045  53.767  1.00 116.71 ? 969  GLN A CG    1 
ATOM   7451  C  CD    . GLN A 1  969  ? 0.538   -85.266  52.385  1.00 141.35 ? 969  GLN A CD    1 
ATOM   7452  O  OE1   . GLN A 1  969  ? -0.426  -86.035  52.205  1.00 135.69 ? 969  GLN A OE1   1 
ATOM   7453  N  NE2   . GLN A 1  969  ? 1.053   -84.556  51.383  1.00 133.94 ? 969  GLN A NE2   1 
ATOM   7454  N  N     . THR A 1  970  ? 4.635   -87.567  52.641  1.00 93.04  ? 970  THR A N     1 
ATOM   7455  C  CA    . THR A 1  970  ? 5.234   -88.329  51.517  1.00 93.64  ? 970  THR A CA    1 
ATOM   7456  C  C     . THR A 1  970  ? 5.122   -89.828  51.719  1.00 104.12 ? 970  THR A C     1 
ATOM   7457  O  O     . THR A 1  970  ? 4.756   -90.547  50.781  1.00 106.21 ? 970  THR A O     1 
ATOM   7458  C  CB    . THR A 1  970  ? 6.744   -88.022  51.380  1.00 88.58  ? 970  THR A CB    1 
ATOM   7459  O  OG1   . THR A 1  970  ? 6.969   -86.622  51.399  1.00 91.04  ? 970  THR A OG1   1 
ATOM   7460  C  CG2   . THR A 1  970  ? 7.387   -88.654  50.148  1.00 78.20  ? 970  THR A CG2   1 
ATOM   7461  N  N     . PHE A 1  971  ? 5.491   -90.300  52.931  1.00 102.56 ? 971  PHE A N     1 
ATOM   7462  C  CA    . PHE A 1  971  ? 5.518   -91.716  53.266  1.00 104.98 ? 971  PHE A CA    1 
ATOM   7463  C  C     . PHE A 1  971  ? 4.237   -92.230  53.970  1.00 116.57 ? 971  PHE A C     1 
ATOM   7464  O  O     . PHE A 1  971  ? 4.149   -93.422  54.303  1.00 118.49 ? 971  PHE A O     1 
ATOM   7465  C  CB    . PHE A 1  971  ? 6.827   -92.053  53.994  1.00 105.24 ? 971  PHE A CB    1 
ATOM   7466  C  CG    . PHE A 1  971  ? 8.069   -91.683  53.209  1.00 104.39 ? 971  PHE A CG    1 
ATOM   7467  C  CD1   . PHE A 1  971  ? 8.703   -90.463  53.411  1.00 104.91 ? 971  PHE A CD1   1 
ATOM   7468  C  CD2   . PHE A 1  971  ? 8.607   -92.557  52.275  1.00 106.31 ? 971  PHE A CD2   1 
ATOM   7469  C  CE1   . PHE A 1  971  ? 9.851   -90.123  52.686  1.00 104.70 ? 971  PHE A CE1   1 
ATOM   7470  C  CE2   . PHE A 1  971  ? 9.762   -92.221  51.558  1.00 107.97 ? 971  PHE A CE2   1 
ATOM   7471  C  CZ    . PHE A 1  971  ? 10.376  -91.009  51.768  1.00 104.30 ? 971  PHE A CZ    1 
ATOM   7472  N  N     . HIS A 1  972  ? 3.221   -91.326  54.115  1.00 116.36 ? 972  HIS A N     1 
ATOM   7473  C  CA    . HIS A 1  972  ? 1.887   -91.540  54.710  1.00 118.89 ? 972  HIS A CA    1 
ATOM   7474  C  C     . HIS A 1  972  ? 1.973   -92.219  56.085  1.00 126.84 ? 972  HIS A C     1 
ATOM   7475  O  O     . HIS A 1  972  ? 1.258   -93.183  56.388  1.00 128.15 ? 972  HIS A O     1 
ATOM   7476  C  CB    . HIS A 1  972  ? 0.932   -92.239  53.716  1.00 121.66 ? 972  HIS A CB    1 
ATOM   7477  C  CG    . HIS A 1  972  ? 0.821   -91.530  52.395  1.00 124.51 ? 972  HIS A CG    1 
ATOM   7478  N  ND1   . HIS A 1  972  ? 0.159   -90.313  52.278  1.00 125.07 ? 972  HIS A ND1   1 
ATOM   7479  C  CD2   . HIS A 1  972  ? 1.312   -91.877  51.182  1.00 126.78 ? 972  HIS A CD2   1 
ATOM   7480  C  CE1   . HIS A 1  972  ? 0.265   -89.965  51.004  1.00 124.19 ? 972  HIS A CE1   1 
ATOM   7481  N  NE2   . HIS A 1  972  ? 0.950   -90.871  50.304  1.00 125.53 ? 972  HIS A NE2   1 
ATOM   7482  N  N     . ILE A 1  973  ? 2.894   -91.676  56.904  1.00 124.56 ? 973  ILE A N     1 
ATOM   7483  C  CA    . ILE A 1  973  ? 3.292   -92.111  58.240  1.00 125.85 ? 973  ILE A CA    1 
ATOM   7484  C  C     . ILE A 1  973  ? 2.157   -92.607  59.157  1.00 133.76 ? 973  ILE A C     1 
ATOM   7485  O  O     . ILE A 1  973  ? 1.210   -91.867  59.459  1.00 132.98 ? 973  ILE A O     1 
ATOM   7486  C  CB    . ILE A 1  973  ? 4.344   -91.128  58.864  1.00 126.73 ? 973  ILE A CB    1 
ATOM   7487  C  CG1   . ILE A 1  973  ? 5.741   -91.772  58.980  1.00 126.92 ? 973  ILE A CG1   1 
ATOM   7488  C  CG2   . ILE A 1  973  ? 3.913   -90.448  60.166  1.00 126.64 ? 973  ILE A CG2   1 
ATOM   7489  C  CD1   . ILE A 1  973  ? 6.580   -91.705  57.714  1.00 129.49 ? 973  ILE A CD1   1 
ATOM   7490  N  N     . ASP A 1  974  ? 2.240   -93.904  59.522  1.00 133.65 ? 974  ASP A N     1 
ATOM   7491  C  CA    . ASP A 1  974  ? 1.275   -94.584  60.378  1.00 135.55 ? 974  ASP A CA    1 
ATOM   7492  C  C     . ASP A 1  974  ? 1.688   -94.527  61.865  1.00 139.41 ? 974  ASP A C     1 
ATOM   7493  O  O     . ASP A 1  974  ? 2.462   -95.368  62.339  1.00 138.59 ? 974  ASP A O     1 
ATOM   7494  C  CB    . ASP A 1  974  ? 1.027   -96.020  59.879  1.00 139.88 ? 974  ASP A CB    1 
ATOM   7495  C  CG    . ASP A 1  974  ? -0.125  -96.720  60.571  1.00 155.57 ? 974  ASP A CG    1 
ATOM   7496  O  OD1   . ASP A 1  974  ? -0.128  -97.973  60.598  1.00 158.88 ? 974  ASP A OD1   1 
ATOM   7497  O  OD2   . ASP A 1  974  ? -1.022  -96.016  61.098  1.00 162.20 ? 974  ASP A OD2   1 
ATOM   7498  N  N     . HIS A 1  975  ? 1.149   -93.514  62.590  1.00 136.66 ? 975  HIS A N     1 
ATOM   7499  C  CA    . HIS A 1  975  ? 1.400   -93.222  64.015  1.00 136.88 ? 975  HIS A CA    1 
ATOM   7500  C  C     . HIS A 1  975  ? 0.972   -94.356  64.992  1.00 141.34 ? 975  HIS A C     1 
ATOM   7501  O  O     . HIS A 1  975  ? 1.278   -94.288  66.185  1.00 140.31 ? 975  HIS A O     1 
ATOM   7502  C  CB    . HIS A 1  975  ? 0.777   -91.854  64.422  1.00 137.11 ? 975  HIS A CB    1 
ATOM   7503  C  CG    . HIS A 1  975  ? 1.500   -90.626  63.907  1.00 139.11 ? 975  HIS A CG    1 
ATOM   7504  N  ND1   . HIS A 1  975  ? 2.353   -89.881  64.724  1.00 139.60 ? 975  HIS A ND1   1 
ATOM   7505  C  CD2   . HIS A 1  975  ? 1.425   -90.013  62.696  1.00 140.30 ? 975  HIS A CD2   1 
ATOM   7506  C  CE1   . HIS A 1  975  ? 2.792   -88.878  63.974  1.00 137.22 ? 975  HIS A CE1   1 
ATOM   7507  N  NE2   . HIS A 1  975  ? 2.261   -88.909  62.751  1.00 137.88 ? 975  HIS A NE2   1 
ATOM   7508  N  N     . THR A 1  976  ? 0.280   -95.394  64.481  1.00 139.22 ? 976  THR A N     1 
ATOM   7509  C  CA    . THR A 1  976  ? -0.187  -96.549  65.263  1.00 140.86 ? 976  THR A CA    1 
ATOM   7510  C  C     . THR A 1  976  ? 0.417   -97.860  64.712  1.00 143.88 ? 976  THR A C     1 
ATOM   7511  O  O     . THR A 1  976  ? -0.299  -98.820  64.391  1.00 145.42 ? 976  THR A O     1 
ATOM   7512  C  CB    . THR A 1  976  ? -1.724  -96.549  65.370  1.00 151.67 ? 976  THR A CB    1 
ATOM   7513  O  OG1   . THR A 1  976  ? -2.287  -96.404  64.063  1.00 151.12 ? 976  THR A OG1   1 
ATOM   7514  C  CG2   . THR A 1  976  ? -2.247  -95.461  66.307  1.00 148.98 ? 976  THR A CG2   1 
ATOM   7515  N  N     . LYS A 1  977  ? 1.758   -97.871  64.607  1.00 137.10 ? 977  LYS A N     1 
ATOM   7516  C  CA    . LYS A 1  977  ? 2.569   -98.964  64.075  1.00 136.70 ? 977  LYS A CA    1 
ATOM   7517  C  C     . LYS A 1  977  ? 4.027   -98.826  64.590  1.00 136.83 ? 977  LYS A C     1 
ATOM   7518  O  O     . LYS A 1  977  ? 4.534   -97.697  64.686  1.00 134.53 ? 977  LYS A O     1 
ATOM   7519  C  CB    . LYS A 1  977  ? 2.539   -98.898  62.526  1.00 138.48 ? 977  LYS A CB    1 
ATOM   7520  C  CG    . LYS A 1  977  ? 3.240   -100.026 61.765  1.00 148.64 ? 977  LYS A CG    1 
ATOM   7521  C  CD    . LYS A 1  977  ? 2.349   -101.243 61.584  1.00 159.18 ? 977  LYS A CD    1 
ATOM   7522  C  CE    . LYS A 1  977  ? 2.953   -102.251 60.643  1.00 166.20 ? 977  LYS A CE    1 
ATOM   7523  N  NZ    . LYS A 1  977  ? 2.132   -103.488 60.573  1.00 172.88 ? 977  LYS A NZ    1 
ATOM   7524  N  N     . PRO A 1  978  ? 4.736   -99.941  64.904  1.00 131.51 ? 978  PRO A N     1 
ATOM   7525  C  CA    . PRO A 1  978  ? 6.143   -99.810  65.325  1.00 128.64 ? 978  PRO A CA    1 
ATOM   7526  C  C     . PRO A 1  978  ? 7.057   -99.608  64.105  1.00 126.45 ? 978  PRO A C     1 
ATOM   7527  O  O     . PRO A 1  978  ? 6.908   -100.314 63.098  1.00 127.55 ? 978  PRO A O     1 
ATOM   7528  C  CB    . PRO A 1  978  ? 6.429   -101.136 66.052  1.00 132.40 ? 978  PRO A CB    1 
ATOM   7529  C  CG    . PRO A 1  978  ? 5.159   -101.950 65.957  1.00 139.37 ? 978  PRO A CG    1 
ATOM   7530  C  CD    . PRO A 1  978  ? 4.328   -101.358 64.875  1.00 134.87 ? 978  PRO A CD    1 
ATOM   7531  N  N     . SER A 1  979  ? 7.999   -98.648  64.193  1.00 115.87 ? 979  SER A N     1 
ATOM   7532  C  CA    . SER A 1  979  ? 8.938   -98.324  63.114  1.00 112.65 ? 979  SER A CA    1 
ATOM   7533  C  C     . SER A 1  979  ? 9.934   -99.459  62.780  1.00 114.71 ? 979  SER A C     1 
ATOM   7534  O  O     . SER A 1  979  ? 9.956   -100.477 63.472  1.00 116.04 ? 979  SER A O     1 
ATOM   7535  C  CB    . SER A 1  979  ? 9.683   -97.039  63.445  1.00 112.74 ? 979  SER A CB    1 
ATOM   7536  O  OG    . SER A 1  979  ? 10.853  -97.309  64.195  1.00 121.38 ? 979  SER A OG    1 
ATOM   7537  N  N     . ASP A 1  980  ? 10.780  -99.263  61.745  1.00 108.08 ? 980  ASP A N     1 
ATOM   7538  C  CA    . ASP A 1  980  ? 11.765  -100.265 61.323  1.00 108.04 ? 980  ASP A CA    1 
ATOM   7539  C  C     . ASP A 1  980  ? 13.266  -99.906  61.525  1.00 106.44 ? 980  ASP A C     1 
ATOM   7540  O  O     . ASP A 1  980  ? 14.154  -100.637 61.071  1.00 105.93 ? 980  ASP A O     1 
ATOM   7541  C  CB    . ASP A 1  980  ? 11.449  -100.760 59.902  1.00 111.75 ? 980  ASP A CB    1 
ATOM   7542  C  CG    . ASP A 1  980  ? 11.766  -99.795  58.781  1.00 124.39 ? 980  ASP A CG    1 
ATOM   7543  O  OD1   . ASP A 1  980  ? 11.134  -98.711  58.730  1.00 124.66 ? 980  ASP A OD1   1 
ATOM   7544  O  OD2   . ASP A 1  980  ? 12.570  -100.162 57.900  1.00 131.65 ? 980  ASP A OD2   1 
ATOM   7545  N  N     . LEU A 1  981  ? 13.535  -98.816  62.263  1.00 99.01  ? 981  LEU A N     1 
ATOM   7546  C  CA    . LEU A 1  981  ? 14.882  -98.340  62.595  1.00 96.27  ? 981  LEU A CA    1 
ATOM   7547  C  C     . LEU A 1  981  ? 15.431  -99.013  63.863  1.00 98.50  ? 981  LEU A C     1 
ATOM   7548  O  O     . LEU A 1  981  ? 14.709  -99.708  64.586  1.00 99.27  ? 981  LEU A O     1 
ATOM   7549  C  CB    . LEU A 1  981  ? 14.868  -96.830  62.858  1.00 93.89  ? 981  LEU A CB    1 
ATOM   7550  C  CG    . LEU A 1  981  ? 14.265  -95.910  61.825  1.00 97.32  ? 981  LEU A CG    1 
ATOM   7551  C  CD1   . LEU A 1  981  ? 12.867  -95.531  62.215  1.00 97.25  ? 981  LEU A CD1   1 
ATOM   7552  C  CD2   . LEU A 1  981  ? 15.078  -94.654  61.721  1.00 96.92  ? 981  LEU A CD2   1 
ATOM   7553  N  N     . THR A 1  982  ? 16.722  -98.775  64.129  1.00 92.45  ? 982  THR A N     1 
ATOM   7554  C  CA    . THR A 1  982  ? 17.431  -99.243  65.309  1.00 92.00  ? 982  THR A CA    1 
ATOM   7555  C  C     . THR A 1  982  ? 17.992  -98.024  65.983  1.00 92.40  ? 982  THR A C     1 
ATOM   7556  O  O     . THR A 1  982  ? 18.206  -97.013  65.322  1.00 88.97  ? 982  THR A O     1 
ATOM   7557  C  CB    . THR A 1  982  ? 18.634  -100.139 64.946  1.00 100.60 ? 982  THR A CB    1 
ATOM   7558  O  OG1   . THR A 1  982  ? 18.481  -100.722 63.642  1.00 91.20  ? 982  THR A OG1   1 
ATOM   7559  C  CG2   . THR A 1  982  ? 18.976  -101.195 66.082  1.00 103.22 ? 982  THR A CG2   1 
ATOM   7560  N  N     . ILE A 1  983  ? 18.314  -98.139  67.283  1.00 90.21  ? 983  ILE A N     1 
ATOM   7561  C  CA    . ILE A 1  983  ? 18.976  -97.083  68.050  1.00 88.34  ? 983  ILE A CA    1 
ATOM   7562  C  C     . ILE A 1  983  ? 20.261  -96.744  67.275  1.00 94.05  ? 983  ILE A C     1 
ATOM   7563  O  O     . ILE A 1  983  ? 20.579  -95.563  67.098  1.00 92.85  ? 983  ILE A O     1 
ATOM   7564  C  CB    . ILE A 1  983  ? 19.274  -97.584  69.485  1.00 91.25  ? 983  ILE A CB    1 
ATOM   7565  C  CG1   . ILE A 1  983  ? 18.001  -98.064  70.238  1.00 91.65  ? 983  ILE A CG1   1 
ATOM   7566  C  CG2   . ILE A 1  983  ? 20.092  -96.580  70.290  1.00 90.88  ? 983  ILE A CG2   1 
ATOM   7567  C  CD1   . ILE A 1  983  ? 16.822  -97.088  70.387  1.00 90.59  ? 983  ILE A CD1   1 
ATOM   7568  N  N     . LYS A 1  984  ? 20.916  -97.802  66.720  1.00 92.15  ? 984  LYS A N     1 
ATOM   7569  C  CA    . LYS A 1  984  ? 22.112  -97.768  65.877  1.00 91.59  ? 984  LYS A CA    1 
ATOM   7570  C  C     . LYS A 1  984  ? 21.879  -96.891  64.643  1.00 95.74  ? 984  LYS A C     1 
ATOM   7571  O  O     . LYS A 1  984  ? 22.669  -95.969  64.415  1.00 93.86  ? 984  LYS A O     1 
ATOM   7572  C  CB    . LYS A 1  984  ? 22.526  -99.197  65.480  1.00 95.26  ? 984  LYS A CB    1 
ATOM   7573  C  CG    . LYS A 1  984  ? 22.774  -100.094 66.692  1.00 101.17 ? 984  LYS A CG    1 
ATOM   7574  C  CD    . LYS A 1  984  ? 22.907  -101.555 66.360  1.00 110.21 ? 984  LYS A CD    1 
ATOM   7575  C  CE    . LYS A 1  984  ? 24.352  -102.001 66.374  1.00 124.02 ? 984  LYS A CE    1 
ATOM   7576  N  NZ    . LYS A 1  984  ? 24.484  -103.488 66.395  1.00 136.52 ? 984  LYS A NZ    1 
ATOM   7577  N  N     . ASP A 1  985  ? 20.754  -97.125  63.904  1.00 93.86  ? 985  ASP A N     1 
ATOM   7578  C  CA    . ASP A 1  985  ? 20.361  -96.369  62.701  1.00 93.18  ? 985  ASP A CA    1 
ATOM   7579  C  C     . ASP A 1  985  ? 20.290  -94.848  62.971  1.00 94.79  ? 985  ASP A C     1 
ATOM   7580  O  O     . ASP A 1  985  ? 20.972  -94.076  62.294  1.00 93.53  ? 985  ASP A O     1 
ATOM   7581  C  CB    . ASP A 1  985  ? 19.001  -96.867  62.131  1.00 96.62  ? 985  ASP A CB    1 
ATOM   7582  C  CG    . ASP A 1  985  ? 18.976  -98.216  61.425  1.00 116.94 ? 985  ASP A CG    1 
ATOM   7583  O  OD1   . ASP A 1  985  ? 19.978  -98.963  61.525  1.00 121.92 ? 985  ASP A OD1   1 
ATOM   7584  O  OD2   . ASP A 1  985  ? 17.927  -98.547  60.806  1.00 121.97 ? 985  ASP A OD2   1 
ATOM   7585  N  N     . ILE A 1  986  ? 19.474  -94.433  63.964  1.00 90.23  ? 986  ILE A N     1 
ATOM   7586  C  CA    . ILE A 1  986  ? 19.260  -93.030  64.338  1.00 87.99  ? 986  ILE A CA    1 
ATOM   7587  C  C     . ILE A 1  986  ? 20.548  -92.381  64.843  1.00 91.61  ? 986  ILE A C     1 
ATOM   7588  O  O     . ILE A 1  986  ? 21.012  -91.396  64.254  1.00 89.54  ? 986  ILE A O     1 
ATOM   7589  C  CB    . ILE A 1  986  ? 18.086  -92.876  65.363  1.00 90.61  ? 986  ILE A CB    1 
ATOM   7590  C  CG1   . ILE A 1  986  ? 16.753  -93.352  64.774  1.00 91.32  ? 986  ILE A CG1   1 
ATOM   7591  C  CG2   . ILE A 1  986  ? 17.961  -91.435  65.893  1.00 89.30  ? 986  ILE A CG2   1 
ATOM   7592  C  CD1   . ILE A 1  986  ? 16.152  -94.383  65.522  1.00 95.38  ? 986  ILE A CD1   1 
ATOM   7593  N  N     . VAL A 1  987  ? 21.108  -92.941  65.942  1.00 89.36  ? 987  VAL A N     1 
ATOM   7594  C  CA    . VAL A 1  987  ? 22.301  -92.427  66.607  1.00 88.42  ? 987  VAL A CA    1 
ATOM   7595  C  C     . VAL A 1  987  ? 23.478  -92.292  65.652  1.00 95.72  ? 987  VAL A C     1 
ATOM   7596  O  O     . VAL A 1  987  ? 24.017  -91.183  65.508  1.00 94.27  ? 987  VAL A O     1 
ATOM   7597  C  CB    . VAL A 1  987  ? 22.619  -93.159  67.927  1.00 91.51  ? 987  VAL A CB    1 
ATOM   7598  C  CG1   . VAL A 1  987  ? 23.886  -92.609  68.575  1.00 90.48  ? 987  VAL A CG1   1 
ATOM   7599  C  CG2   . VAL A 1  987  ? 21.447  -93.041  68.891  1.00 90.85  ? 987  VAL A CG2   1 
ATOM   7600  N  N     . LEU A 1  988  ? 23.805  -93.377  64.930  1.00 95.32  ? 988  LEU A N     1 
ATOM   7601  C  CA    . LEU A 1  988  ? 24.888  -93.318  63.965  1.00 96.07  ? 988  LEU A CA    1 
ATOM   7602  C  C     . LEU A 1  988  ? 24.561  -92.521  62.718  1.00 99.18  ? 988  LEU A C     1 
ATOM   7603  O  O     . LEU A 1  988  ? 25.470  -91.937  62.129  1.00 99.38  ? 988  LEU A O     1 
ATOM   7604  C  CB    . LEU A 1  988  ? 25.442  -94.704  63.623  1.00 98.72  ? 988  LEU A CB    1 
ATOM   7605  C  CG    . LEU A 1  988  ? 26.866  -95.006  64.135  1.00 105.35 ? 988  LEU A CG    1 
ATOM   7606  C  CD1   . LEU A 1  988  ? 27.888  -93.952  63.631  1.00 105.23 ? 988  LEU A CD1   1 
ATOM   7607  C  CD2   . LEU A 1  988  ? 26.914  -95.175  65.676  1.00 106.37 ? 988  LEU A CD2   1 
ATOM   7608  N  N     . GLY A 1  989  ? 23.275  -92.466  62.364  1.00 94.08  ? 989  GLY A N     1 
ATOM   7609  C  CA    . GLY A 1  989  ? 22.778  -91.743  61.202  1.00 92.38  ? 989  GLY A CA    1 
ATOM   7610  C  C     . GLY A 1  989  ? 22.991  -90.253  61.292  1.00 93.54  ? 989  GLY A C     1 
ATOM   7611  O  O     . GLY A 1  989  ? 23.557  -89.646  60.379  1.00 92.29  ? 989  GLY A O     1 
ATOM   7612  N  N     . VAL A 1  990  ? 22.548  -89.660  62.398  1.00 89.64  ? 990  VAL A N     1 
ATOM   7613  C  CA    . VAL A 1  990  ? 22.708  -88.224  62.643  1.00 88.25  ? 990  VAL A CA    1 
ATOM   7614  C  C     . VAL A 1  990  ? 24.217  -87.912  62.730  1.00 93.77  ? 990  VAL A C     1 
ATOM   7615  O  O     . VAL A 1  990  ? 24.688  -87.000  62.045  1.00 91.88  ? 990  VAL A O     1 
ATOM   7616  C  CB    . VAL A 1  990  ? 21.900  -87.753  63.890  1.00 91.00  ? 990  VAL A CB    1 
ATOM   7617  C  CG1   . VAL A 1  990  ? 22.024  -86.250  64.112  1.00 88.70  ? 990  VAL A CG1   1 
ATOM   7618  C  CG2   . VAL A 1  990  ? 20.434  -88.143  63.765  1.00 91.17  ? 990  VAL A CG2   1 
ATOM   7619  N  N     . LYS A 1  991  ? 24.972  -88.746  63.490  1.00 93.43  ? 991  LYS A N     1 
ATOM   7620  C  CA    . LYS A 1  991  ? 26.426  -88.644  63.678  1.00 94.17  ? 991  LYS A CA    1 
ATOM   7621  C  C     . LYS A 1  991  ? 27.138  -88.597  62.326  1.00 101.08 ? 991  LYS A C     1 
ATOM   7622  O  O     . LYS A 1  991  ? 28.055  -87.801  62.120  1.00 99.45  ? 991  LYS A O     1 
ATOM   7623  C  CB    . LYS A 1  991  ? 26.936  -89.819  64.525  1.00 97.41  ? 991  LYS A CB    1 
ATOM   7624  C  CG    . LYS A 1  991  ? 27.974  -89.413  65.565  1.00 104.71 ? 991  LYS A CG    1 
ATOM   7625  C  CD    . LYS A 1  991  ? 28.377  -90.599  66.440  1.00 110.96 ? 991  LYS A CD    1 
ATOM   7626  C  CE    . LYS A 1  991  ? 29.606  -90.350  67.277  1.00 107.11 ? 991  LYS A CE    1 
ATOM   7627  N  NZ    . LYS A 1  991  ? 30.256  -91.632  67.633  1.00 111.91 ? 991  LYS A NZ    1 
ATOM   7628  N  N     . ASP A 1  992  ? 26.660  -89.407  61.387  1.00 101.83 ? 992  ASP A N     1 
ATOM   7629  C  CA    . ASP A 1  992  ? 27.195  -89.425  60.039  1.00 103.25 ? 992  ASP A CA    1 
ATOM   7630  C  C     . ASP A 1  992  ? 26.748  -88.213  59.227  1.00 104.84 ? 992  ASP A C     1 
ATOM   7631  O  O     . ASP A 1  992  ? 27.573  -87.652  58.502  1.00 105.04 ? 992  ASP A O     1 
ATOM   7632  C  CB    . ASP A 1  992  ? 26.835  -90.719  59.324  1.00 107.71 ? 992  ASP A CB    1 
ATOM   7633  C  CG    . ASP A 1  992  ? 28.064  -91.364  58.743  1.00 126.88 ? 992  ASP A CG    1 
ATOM   7634  O  OD1   . ASP A 1  992  ? 28.726  -92.148  59.475  1.00 128.80 ? 992  ASP A OD1   1 
ATOM   7635  O  OD2   . ASP A 1  992  ? 28.407  -91.039  57.577  1.00 135.47 ? 992  ASP A OD2   1 
ATOM   7636  N  N     . LEU A 1  993  ? 25.459  -87.799  59.353  1.00 97.93  ? 993  LEU A N     1 
ATOM   7637  C  CA    . LEU A 1  993  ? 24.940  -86.633  58.640  1.00 95.22  ? 993  LEU A CA    1 
ATOM   7638  C  C     . LEU A 1  993  ? 25.771  -85.403  58.988  1.00 98.55  ? 993  LEU A C     1 
ATOM   7639  O  O     . LEU A 1  993  ? 26.127  -84.643  58.089  1.00 97.41  ? 993  LEU A O     1 
ATOM   7640  C  CB    . LEU A 1  993  ? 23.436  -86.408  58.916  1.00 94.03  ? 993  LEU A CB    1 
ATOM   7641  C  CG    . LEU A 1  993  ? 22.795  -85.088  58.431  1.00 95.43  ? 993  LEU A CG    1 
ATOM   7642  C  CD1   . LEU A 1  993  ? 22.958  -84.897  56.945  1.00 95.46  ? 993  LEU A CD1   1 
ATOM   7643  C  CD2   . LEU A 1  993  ? 21.342  -85.031  58.782  1.00 95.11  ? 993  LEU A CD2   1 
ATOM   7644  N  N     . GLN A 1  994  ? 26.132  -85.254  60.275  1.00 95.71  ? 994  GLN A N     1 
ATOM   7645  C  CA    . GLN A 1  994  ? 26.950  -84.151  60.769  1.00 95.16  ? 994  GLN A CA    1 
ATOM   7646  C  C     . GLN A 1  994  ? 28.237  -83.968  59.965  1.00 101.58 ? 994  GLN A C     1 
ATOM   7647  O  O     . GLN A 1  994  ? 28.480  -82.866  59.471  1.00 101.29 ? 994  GLN A O     1 
ATOM   7648  C  CB    . GLN A 1  994  ? 27.239  -84.315  62.265  1.00 96.44  ? 994  GLN A CB    1 
ATOM   7649  C  CG    . GLN A 1  994  ? 26.217  -83.613  63.132  1.00 102.37 ? 994  GLN A CG    1 
ATOM   7650  C  CD    . GLN A 1  994  ? 26.228  -84.130  64.535  1.00 118.73 ? 994  GLN A CD    1 
ATOM   7651  O  OE1   . GLN A 1  994  ? 27.051  -83.736  65.367  1.00 113.51 ? 994  GLN A OE1   1 
ATOM   7652  N  NE2   . GLN A 1  994  ? 25.313  -85.036  64.821  1.00 111.50 ? 994  GLN A NE2   1 
ATOM   7653  N  N     . GLU A 1  995  ? 29.009  -85.054  59.768  1.00 100.08 ? 995  GLU A N     1 
ATOM   7654  C  CA    . GLU A 1  995  ? 30.258  -85.059  59.000  1.00 100.82 ? 995  GLU A CA    1 
ATOM   7655  C  C     . GLU A 1  995  ? 30.082  -84.542  57.564  1.00 105.30 ? 995  GLU A C     1 
ATOM   7656  O  O     . GLU A 1  995  ? 30.987  -83.910  57.023  1.00 105.16 ? 995  GLU A O     1 
ATOM   7657  C  CB    . GLU A 1  995  ? 30.847  -86.478  58.964  1.00 104.04 ? 995  GLU A CB    1 
ATOM   7658  C  CG    . GLU A 1  995  ? 31.315  -86.982  60.312  1.00 118.76 ? 995  GLU A CG    1 
ATOM   7659  C  CD    . GLU A 1  995  ? 32.287  -86.059  61.022  1.00 155.50 ? 995  GLU A CD    1 
ATOM   7660  O  OE1   . GLU A 1  995  ? 33.317  -85.690  60.410  1.00 156.48 ? 995  GLU A OE1   1 
ATOM   7661  O  OE2   . GLU A 1  995  ? 32.003  -85.680  62.181  1.00 159.19 ? 995  GLU A OE2   1 
ATOM   7662  N  N     . ASN A 1  996  ? 28.912  -84.799  56.971  1.00 102.20 ? 996  ASN A N     1 
ATOM   7663  C  CA    . ASN A 1  996  ? 28.574  -84.425  55.604  1.00 102.77 ? 996  ASN A CA    1 
ATOM   7664  C  C     . ASN A 1  996  ? 28.088  -82.970  55.383  1.00 106.15 ? 996  ASN A C     1 
ATOM   7665  O  O     . ASN A 1  996  ? 27.961  -82.551  54.222  1.00 106.48 ? 996  ASN A O     1 
ATOM   7666  C  CB    . ASN A 1  996  ? 27.562  -85.426  55.032  1.00 106.62 ? 996  ASN A CB    1 
ATOM   7667  C  CG    . ASN A 1  996  ? 28.078  -86.837  54.891  1.00 141.06 ? 996  ASN A CG    1 
ATOM   7668  O  OD1   . ASN A 1  996  ? 29.208  -87.170  55.278  1.00 141.01 ? 996  ASN A OD1   1 
ATOM   7669  N  ND2   . ASN A 1  996  ? 27.244  -87.707  54.338  1.00 135.26 ? 996  ASN A ND2   1 
ATOM   7670  N  N     . LEU A 1  997  ? 27.800  -82.211  56.463  1.00 100.22 ? 997  LEU A N     1 
ATOM   7671  C  CA    . LEU A 1  997  ? 27.316  -80.831  56.326  1.00 97.69  ? 997  LEU A CA    1 
ATOM   7672  C  C     . LEU A 1  997  ? 28.496  -79.890  56.016  1.00 102.46 ? 997  LEU A C     1 
ATOM   7673  O  O     . LEU A 1  997  ? 29.046  -79.267  56.931  1.00 102.74 ? 997  LEU A O     1 
ATOM   7674  C  CB    . LEU A 1  997  ? 26.527  -80.385  57.582  1.00 96.03  ? 997  LEU A CB    1 
ATOM   7675  C  CG    . LEU A 1  997  ? 25.297  -81.210  57.968  1.00 99.89  ? 997  LEU A CG    1 
ATOM   7676  C  CD1   . LEU A 1  997  ? 24.856  -80.884  59.359  1.00 98.73  ? 997  LEU A CD1   1 
ATOM   7677  C  CD2   . LEU A 1  997  ? 24.143  -81.016  56.988  1.00 101.64 ? 997  LEU A CD2   1 
ATOM   7678  N  N     . LEU A 1  998  ? 28.901  -79.806  54.723  1.00 98.36  ? 998  LEU A N     1 
ATOM   7679  C  CA    . LEU A 1  998  ? 30.073  -79.017  54.319  1.00 97.61  ? 998  LEU A CA    1 
ATOM   7680  C  C     . LEU A 1  998  ? 29.920  -77.547  53.919  1.00 101.08 ? 998  LEU A C     1 
ATOM   7681  O  O     . LEU A 1  998  ? 29.137  -77.211  53.028  1.00 101.38 ? 998  LEU A O     1 
ATOM   7682  C  CB    . LEU A 1  998  ? 30.985  -79.764  53.327  1.00 98.57  ? 998  LEU A CB    1 
ATOM   7683  C  CG    . LEU A 1  998  ? 31.639  -81.081  53.783  1.00 104.15 ? 998  LEU A CG    1 
ATOM   7684  C  CD1   . LEU A 1  998  ? 32.527  -81.611  52.705  1.00 105.72 ? 998  LEU A CD1   1 
ATOM   7685  C  CD2   . LEU A 1  998  ? 32.481  -80.912  55.043  1.00 105.90 ? 998  LEU A CD2   1 
ATOM   7686  N  N     . VAL A 1  999  ? 30.742  -76.686  54.561  1.00 96.14  ? 999  VAL A N     1 
ATOM   7687  C  CA    . VAL A 1  999  ? 30.891  -75.250  54.311  1.00 94.33  ? 999  VAL A CA    1 
ATOM   7688  C  C     . VAL A 1  999  ? 32.265  -75.038  53.668  1.00 100.16 ? 999  VAL A C     1 
ATOM   7689  O  O     . VAL A 1  999  ? 32.346  -74.487  52.568  1.00 101.06 ? 999  VAL A O     1 
ATOM   7690  C  CB    . VAL A 1  999  ? 30.668  -74.406  55.589  1.00 96.19  ? 999  VAL A CB    1 
ATOM   7691  C  CG1   . VAL A 1  999  ? 31.487  -73.113  55.586  1.00 94.95  ? 999  VAL A CG1   1 
ATOM   7692  C  CG2   . VAL A 1  999  ? 29.187  -74.111  55.775  1.00 95.21  ? 999  VAL A CG2   1 
ATOM   7693  N  N     . LEU A 1  1000 ? 33.328  -75.526  54.331  1.00 97.13  ? 1000 LEU A N     1 
ATOM   7694  C  CA    . LEU A 1  1000 ? 34.705  -75.463  53.850  1.00 98.08  ? 1000 LEU A CA    1 
ATOM   7695  C  C     . LEU A 1  1000 ? 35.184  -76.854  53.419  1.00 105.48 ? 1000 LEU A C     1 
ATOM   7696  O  O     . LEU A 1  1000 ? 34.604  -77.854  53.847  1.00 105.90 ? 1000 LEU A O     1 
ATOM   7697  C  CB    . LEU A 1  1000 ? 35.623  -74.827  54.900  1.00 97.68  ? 1000 LEU A CB    1 
ATOM   7698  C  CG    . LEU A 1  1000 ? 35.529  -73.306  54.995  1.00 100.67 ? 1000 LEU A CG    1 
ATOM   7699  C  CD1   . LEU A 1  1000 ? 36.080  -72.832  56.283  1.00 100.62 ? 1000 LEU A CD1   1 
ATOM   7700  C  CD2   . LEU A 1  1000 ? 36.252  -72.615  53.830  1.00 103.03 ? 1000 LEU A CD2   1 
ATOM   7701  N  N     . ARG A 1  1001 ? 36.199  -76.930  52.534  1.00 104.20 ? 1001 ARG A N     1 
ATOM   7702  C  CA    . ARG A 1  1001 ? 36.638  -78.223  52.007  1.00 105.92 ? 1001 ARG A CA    1 
ATOM   7703  C  C     . ARG A 1  1001 ? 38.127  -78.588  52.091  1.00 112.59 ? 1001 ARG A C     1 
ATOM   7704  O  O     . ARG A 1  1001 ? 38.512  -79.650  51.596  1.00 114.68 ? 1001 ARG A O     1 
ATOM   7705  C  CB    . ARG A 1  1001 ? 36.049  -78.469  50.602  1.00 105.16 ? 1001 ARG A CB    1 
ATOM   7706  C  CG    . ARG A 1  1001 ? 34.843  -79.401  50.607  1.00 111.16 ? 1001 ARG A CG    1 
ATOM   7707  C  CD    . ARG A 1  1001 ? 34.053  -79.296  49.327  1.00 119.26 ? 1001 ARG A CD    1 
ATOM   7708  N  NE    . ARG A 1  1001 ? 33.101  -78.188  49.383  1.00 130.12 ? 1001 ARG A NE    1 
ATOM   7709  C  CZ    . ARG A 1  1001 ? 31.813  -78.324  49.683  1.00 142.69 ? 1001 ARG A CZ    1 
ATOM   7710  N  NH1   . ARG A 1  1001 ? 31.305  -79.528  49.936  1.00 122.56 ? 1001 ARG A NH1   1 
ATOM   7711  N  NH2   . ARG A 1  1001 ? 31.018  -77.260  49.722  1.00 129.04 ? 1001 ARG A NH2   1 
ATOM   7712  N  N     . GLY A 1  1002 ? 38.935  -77.750  52.737  1.00 108.80 ? 1002 GLY A N     1 
ATOM   7713  C  CA    . GLY A 1  1002 ? 40.366  -78.002  52.911  1.00 110.14 ? 1002 GLY A CA    1 
ATOM   7714  C  C     . GLY A 1  1002 ? 40.687  -79.274  53.684  1.00 115.47 ? 1002 GLY A C     1 
ATOM   7715  O  O     . GLY A 1  1002 ? 40.050  -79.573  54.700  1.00 114.31 ? 1002 GLY A O     1 
ATOM   7716  N  N     . LYS A 1  1003 ? 41.676  -80.041  53.194  1.00 113.91 ? 1003 LYS A N     1 
ATOM   7717  C  CA    . LYS A 1  1003 ? 42.096  -81.309  53.794  1.00 114.93 ? 1003 LYS A CA    1 
ATOM   7718  C  C     . LYS A 1  1003 ? 42.750  -81.118  55.179  1.00 118.68 ? 1003 LYS A C     1 
ATOM   7719  O  O     . LYS A 1  1003 ? 42.739  -82.055  55.983  1.00 119.04 ? 1003 LYS A O     1 
ATOM   7720  C  CB    . LYS A 1  1003 ? 43.039  -82.054  52.830  1.00 118.82 ? 1003 LYS A CB    1 
ATOM   7721  C  CG    . LYS A 1  1003 ? 43.115  -83.559  53.043  1.00 131.95 ? 1003 LYS A CG    1 
ATOM   7722  C  CD    . LYS A 1  1003 ? 44.321  -84.155  52.308  1.00 140.19 ? 1003 LYS A CD    1 
ATOM   7723  C  CE    . LYS A 1  1003 ? 44.434  -85.660  52.429  1.00 140.09 ? 1003 LYS A CE    1 
ATOM   7724  N  NZ    . LYS A 1  1003 ? 43.653  -86.366  51.379  1.00 138.86 ? 1003 LYS A NZ    1 
ATOM   7725  N  N     . ASN A 1  1004 ? 43.274  -79.891  55.459  1.00 113.92 ? 1004 ASN A N     1 
ATOM   7726  C  CA    . ASN A 1  1004 ? 44.010  -79.505  56.677  1.00 112.99 ? 1004 ASN A CA    1 
ATOM   7727  C  C     . ASN A 1  1004 ? 43.208  -79.175  57.930  1.00 114.38 ? 1004 ASN A C     1 
ATOM   7728  O  O     . ASN A 1  1004 ? 42.056  -78.771  57.856  1.00 112.24 ? 1004 ASN A O     1 
ATOM   7729  C  CB    . ASN A 1  1004 ? 44.995  -78.373  56.379  1.00 112.84 ? 1004 ASN A CB    1 
ATOM   7730  C  CG    . ASN A 1  1004 ? 44.319  -77.061  56.101  1.00 135.91 ? 1004 ASN A CG    1 
ATOM   7731  O  OD1   . ASN A 1  1004 ? 44.042  -76.276  57.014  1.00 130.09 ? 1004 ASN A OD1   1 
ATOM   7732  N  ND2   . ASN A 1  1004 ? 44.044  -76.793  54.832  1.00 128.43 ? 1004 ASN A ND2   1 
ATOM   7733  N  N     . GLU A 1  1005 ? 43.899  -79.263  59.073  1.00 111.88 ? 1005 GLU A N     1 
ATOM   7734  C  CA    . GLU A 1  1005 ? 43.470  -79.008  60.459  1.00 111.06 ? 1005 GLU A CA    1 
ATOM   7735  C  C     . GLU A 1  1005 ? 42.932  -77.587  60.756  1.00 110.32 ? 1005 GLU A C     1 
ATOM   7736  O  O     . GLU A 1  1005 ? 42.031  -77.440  61.585  1.00 108.60 ? 1005 GLU A O     1 
ATOM   7737  C  CB    . GLU A 1  1005 ? 44.604  -79.402  61.448  1.00 113.85 ? 1005 GLU A CB    1 
ATOM   7738  C  CG    . GLU A 1  1005 ? 45.879  -78.544  61.423  1.00 130.75 ? 1005 GLU A CG    1 
ATOM   7739  C  CD    . GLU A 1  1005 ? 46.480  -78.129  60.085  1.00 161.02 ? 1005 GLU A CD    1 
ATOM   7740  O  OE1   . GLU A 1  1005 ? 46.714  -79.012  59.226  1.00 160.13 ? 1005 GLU A OE1   1 
ATOM   7741  O  OE2   . GLU A 1  1005 ? 46.711  -76.912  59.895  1.00 154.05 ? 1005 GLU A OE2   1 
ATOM   7742  N  N     . ILE A 1  1006 ? 43.501  -76.553  60.111  1.00 104.41 ? 1006 ILE A N     1 
ATOM   7743  C  CA    . ILE A 1  1006 ? 43.067  -75.171  60.300  1.00 101.78 ? 1006 ILE A CA    1 
ATOM   7744  C  C     . ILE A 1  1006 ? 41.648  -75.037  59.749  1.00 99.67  ? 1006 ILE A C     1 
ATOM   7745  O  O     . ILE A 1  1006 ? 40.735  -74.634  60.474  1.00 97.45  ? 1006 ILE A O     1 
ATOM   7746  C  CB    . ILE A 1  1006 ? 44.110  -74.178  59.694  1.00 105.80 ? 1006 ILE A CB    1 
ATOM   7747  C  CG1   . ILE A 1  1006 ? 45.117  -73.736  60.785  1.00 107.12 ? 1006 ILE A CG1   1 
ATOM   7748  C  CG2   . ILE A 1  1006 ? 43.458  -72.963  59.016  1.00 106.08 ? 1006 ILE A CG2   1 
ATOM   7749  C  CD1   . ILE A 1  1006 ? 46.365  -72.938  60.315  1.00 115.79 ? 1006 ILE A CD1   1 
ATOM   7750  N  N     . ILE A 1  1007 ? 41.470  -75.478  58.496  1.00 93.87  ? 1007 ILE A N     1 
ATOM   7751  C  CA    . ILE A 1  1007 ? 40.214  -75.456  57.764  1.00 91.47  ? 1007 ILE A CA    1 
ATOM   7752  C  C     . ILE A 1  1007 ? 39.214  -76.465  58.325  1.00 95.42  ? 1007 ILE A C     1 
ATOM   7753  O  O     . ILE A 1  1007 ? 38.011  -76.213  58.265  1.00 94.30  ? 1007 ILE A O     1 
ATOM   7754  C  CB    . ILE A 1  1007 ? 40.476  -75.614  56.252  1.00 94.06  ? 1007 ILE A CB    1 
ATOM   7755  C  CG1   . ILE A 1  1007 ? 41.521  -74.586  55.731  1.00 94.09  ? 1007 ILE A CG1   1 
ATOM   7756  C  CG2   . ILE A 1  1007 ? 39.188  -75.553  55.454  1.00 93.68  ? 1007 ILE A CG2   1 
ATOM   7757  C  CD1   . ILE A 1  1007 ? 41.242  -73.028  55.984  1.00 96.98  ? 1007 ILE A CD1   1 
ATOM   7758  N  N     . GLN A 1  1008 ? 39.704  -77.584  58.901  1.00 92.84  ? 1008 GLN A N     1 
ATOM   7759  C  CA    . GLN A 1  1008 ? 38.832  -78.594  59.511  1.00 92.37  ? 1008 GLN A CA    1 
ATOM   7760  C  C     . GLN A 1  1008 ? 38.167  -78.047  60.761  1.00 93.52  ? 1008 GLN A C     1 
ATOM   7761  O  O     . GLN A 1  1008 ? 36.970  -78.274  60.967  1.00 92.32  ? 1008 GLN A O     1 
ATOM   7762  C  CB    . GLN A 1  1008 ? 39.561  -79.931  59.777  1.00 95.09  ? 1008 GLN A CB    1 
ATOM   7763  C  CG    . GLN A 1  1008 ? 39.660  -80.852  58.546  1.00 107.00 ? 1008 GLN A CG    1 
ATOM   7764  C  CD    . GLN A 1  1008 ? 38.343  -81.042  57.809  1.00 120.69 ? 1008 GLN A CD    1 
ATOM   7765  O  OE1   . GLN A 1  1008 ? 37.325  -81.439  58.394  1.00 119.27 ? 1008 GLN A OE1   1 
ATOM   7766  N  NE2   . GLN A 1  1008 ? 38.331  -80.747  56.509  1.00 100.01 ? 1008 GLN A NE2   1 
ATOM   7767  N  N     . ASN A 1  1009 ? 38.922  -77.267  61.554  1.00 88.92  ? 1009 ASN A N     1 
ATOM   7768  C  CA    . ASN A 1  1009 ? 38.379  -76.632  62.749  1.00 87.92  ? 1009 ASN A CA    1 
ATOM   7769  C  C     . ASN A 1  1009 ? 37.436  -75.493  62.327  1.00 89.61  ? 1009 ASN A C     1 
ATOM   7770  O  O     . ASN A 1  1009 ? 36.333  -75.374  62.869  1.00 88.25  ? 1009 ASN A O     1 
ATOM   7771  C  CB    . ASN A 1  1009 ? 39.499  -76.171  63.695  1.00 89.96  ? 1009 ASN A CB    1 
ATOM   7772  C  CG    . ASN A 1  1009 ? 40.423  -77.288  64.171  1.00 115.31 ? 1009 ASN A CG    1 
ATOM   7773  O  OD1   . ASN A 1  1009 ? 40.274  -78.467  63.815  1.00 113.28 ? 1009 ASN A OD1   1 
ATOM   7774  N  ND2   . ASN A 1  1009 ? 41.443  -76.936  64.949  1.00 105.23 ? 1009 ASN A ND2   1 
ATOM   7775  N  N     . ALA A 1  1010 ? 37.823  -74.742  61.273  1.00 84.53  ? 1010 ALA A N     1 
ATOM   7776  C  CA    . ALA A 1  1010 ? 37.017  -73.663  60.717  1.00 82.40  ? 1010 ALA A CA    1 
ATOM   7777  C  C     . ALA A 1  1010 ? 35.637  -74.185  60.363  1.00 85.64  ? 1010 ALA A C     1 
ATOM   7778  O  O     . ALA A 1  1010 ? 34.640  -73.550  60.698  1.00 83.96  ? 1010 ALA A O     1 
ATOM   7779  C  CB    . ALA A 1  1010 ? 37.698  -73.088  59.492  1.00 83.20  ? 1010 ALA A CB    1 
ATOM   7780  N  N     . GLN A 1  1011 ? 35.595  -75.384  59.750  1.00 84.24  ? 1011 GLN A N     1 
ATOM   7781  C  CA    . GLN A 1  1011 ? 34.395  -76.113  59.327  1.00 84.33  ? 1011 GLN A CA    1 
ATOM   7782  C  C     . GLN A 1  1011 ? 33.583  -76.535  60.547  1.00 88.90  ? 1011 GLN A C     1 
ATOM   7783  O  O     . GLN A 1  1011 ? 32.382  -76.253  60.612  1.00 87.55  ? 1011 GLN A O     1 
ATOM   7784  C  CB    . GLN A 1  1011 ? 34.797  -77.334  58.470  1.00 86.60  ? 1011 GLN A CB    1 
ATOM   7785  C  CG    . GLN A 1  1011 ? 33.714  -78.393  58.280  1.00 94.81  ? 1011 GLN A CG    1 
ATOM   7786  C  CD    . GLN A 1  1011 ? 32.534  -77.885  57.503  1.00 107.06 ? 1011 GLN A CD    1 
ATOM   7787  O  OE1   . GLN A 1  1011 ? 32.666  -77.385  56.391  1.00 103.44 ? 1011 GLN A OE1   1 
ATOM   7788  N  NE2   . GLN A 1  1011 ? 31.353  -78.009  58.069  1.00 98.55  ? 1011 GLN A NE2   1 
ATOM   7789  N  N     . ARG A 1  1012 ? 34.263  -77.185  61.516  1.00 86.48  ? 1012 ARG A N     1 
ATOM   7790  C  CA    . ARG A 1  1012 ? 33.711  -77.657  62.782  1.00 86.74  ? 1012 ARG A CA    1 
ATOM   7791  C  C     . ARG A 1  1012 ? 33.022  -76.505  63.511  1.00 88.31  ? 1012 ARG A C     1 
ATOM   7792  O  O     . ARG A 1  1012 ? 31.895  -76.675  63.980  1.00 87.70  ? 1012 ARG A O     1 
ATOM   7793  C  CB    . ARG A 1  1012 ? 34.851  -78.226  63.646  1.00 91.12  ? 1012 ARG A CB    1 
ATOM   7794  C  CG    . ARG A 1  1012 ? 34.451  -79.161  64.797  1.00 106.61 ? 1012 ARG A CG    1 
ATOM   7795  C  CD    . ARG A 1  1012 ? 35.633  -80.025  65.243  1.00 120.41 ? 1012 ARG A CD    1 
ATOM   7796  N  NE    . ARG A 1  1012 ? 35.984  -81.044  64.242  1.00 136.21 ? 1012 ARG A NE    1 
ATOM   7797  C  CZ    . ARG A 1  1012 ? 37.069  -81.018  63.468  1.00 153.36 ? 1012 ARG A CZ    1 
ATOM   7798  N  NH1   . ARG A 1  1012 ? 37.950  -80.031  63.579  1.00 137.21 ? 1012 ARG A NH1   1 
ATOM   7799  N  NH2   . ARG A 1  1012 ? 37.285  -81.985  62.586  1.00 145.80 ? 1012 ARG A NH2   1 
ATOM   7800  N  N     . ASP A 1  1013 ? 33.682  -75.326  63.564  1.00 83.11  ? 1013 ASP A N     1 
ATOM   7801  C  CA    . ASP A 1  1013 ? 33.142  -74.149  64.236  1.00 81.67  ? 1013 ASP A CA    1 
ATOM   7802  C  C     . ASP A 1  1013 ? 31.892  -73.628  63.549  1.00 83.40  ? 1013 ASP A C     1 
ATOM   7803  O  O     . ASP A 1  1013 ? 30.883  -73.432  64.221  1.00 82.13  ? 1013 ASP A O     1 
ATOM   7804  C  CB    . ASP A 1  1013 ? 34.214  -73.051  64.442  1.00 83.89  ? 1013 ASP A CB    1 
ATOM   7805  C  CG    . ASP A 1  1013 ? 35.358  -73.434  65.389  1.00 101.08 ? 1013 ASP A CG    1 
ATOM   7806  O  OD1   . ASP A 1  1013 ? 35.069  -73.888  66.539  1.00 102.53 ? 1013 ASP A OD1   1 
ATOM   7807  O  OD2   . ASP A 1  1013 ? 36.541  -73.258  64.998  1.00 108.20 ? 1013 ASP A OD2   1 
ATOM   7808  N  N     . ALA A 1  1014 ? 31.935  -73.495  62.199  1.00 79.56  ? 1014 ALA A N     1 
ATOM   7809  C  CA    . ALA A 1  1014 ? 30.860  -72.990  61.324  1.00 78.00  ? 1014 ALA A CA    1 
ATOM   7810  C  C     . ALA A 1  1014 ? 29.530  -73.742  61.418  1.00 79.66  ? 1014 ALA A C     1 
ATOM   7811  O  O     . ALA A 1  1014 ? 28.476  -73.207  61.070  1.00 78.35  ? 1014 ALA A O     1 
ATOM   7812  C  CB    . ALA A 1  1014 ? 31.338  -72.972  59.884  1.00 79.09  ? 1014 ALA A CB    1 
ATOM   7813  N  N     . VAL A 1  1015 ? 29.588  -74.987  61.848  1.00 75.57  ? 1015 VAL A N     1 
ATOM   7814  C  CA    . VAL A 1  1015 ? 28.397  -75.813  61.945  1.00 74.70  ? 1015 VAL A CA    1 
ATOM   7815  C  C     . VAL A 1  1015 ? 28.017  -76.127  63.393  1.00 79.51  ? 1015 VAL A C     1 
ATOM   7816  O  O     . VAL A 1  1015 ? 27.001  -76.789  63.620  1.00 80.28  ? 1015 VAL A O     1 
ATOM   7817  C  CB    . VAL A 1  1015 ? 28.551  -77.081  61.090  1.00 78.27  ? 1015 VAL A CB    1 
ATOM   7818  C  CG1   . VAL A 1  1015 ? 28.577  -76.733  59.616  1.00 77.50  ? 1015 VAL A CG1   1 
ATOM   7819  C  CG2   . VAL A 1  1015 ? 29.800  -77.866  61.485  1.00 79.08  ? 1015 VAL A CG2   1 
ATOM   7820  N  N     . THR A 1  1016 ? 28.819  -75.653  64.373  1.00 74.53  ? 1016 THR A N     1 
ATOM   7821  C  CA    . THR A 1  1016 ? 28.573  -75.906  65.794  1.00 73.66  ? 1016 THR A CA    1 
ATOM   7822  C  C     . THR A 1  1016 ? 27.111  -75.711  66.157  1.00 76.64  ? 1016 THR A C     1 
ATOM   7823  O  O     . THR A 1  1016 ? 26.484  -76.643  66.643  1.00 77.21  ? 1016 THR A O     1 
ATOM   7824  C  CB    . THR A 1  1016 ? 29.554  -75.118  66.648  1.00 79.63  ? 1016 THR A CB    1 
ATOM   7825  O  OG1   . THR A 1  1016 ? 30.872  -75.521  66.293  1.00 81.80  ? 1016 THR A OG1   1 
ATOM   7826  C  CG2   . THR A 1  1016 ? 29.318  -75.281  68.151  1.00 76.49  ? 1016 THR A CG2   1 
ATOM   7827  N  N     . LEU A 1  1017 ? 26.552  -74.548  65.823  1.00 72.13  ? 1017 LEU A N     1 
ATOM   7828  C  CA    . LEU A 1  1017 ? 25.169  -74.236  66.124  1.00 71.41  ? 1017 LEU A CA    1 
ATOM   7829  C  C     . LEU A 1  1017 ? 24.177  -75.071  65.334  1.00 76.08  ? 1017 LEU A C     1 
ATOM   7830  O  O     . LEU A 1  1017 ? 23.286  -75.653  65.947  1.00 75.13  ? 1017 LEU A O     1 
ATOM   7831  C  CB    . LEU A 1  1017 ? 24.899  -72.732  65.981  1.00 70.21  ? 1017 LEU A CB    1 
ATOM   7832  C  CG    . LEU A 1  1017 ? 23.555  -72.214  66.502  1.00 73.66  ? 1017 LEU A CG    1 
ATOM   7833  C  CD1   . LEU A 1  1017 ? 23.431  -72.407  68.011  1.00 72.94  ? 1017 LEU A CD1   1 
ATOM   7834  C  CD2   . LEU A 1  1017 ? 23.316  -70.749  66.057  1.00 74.27  ? 1017 LEU A CD2   1 
ATOM   7835  N  N     . PHE A 1  1018 ? 24.317  -75.148  63.996  1.00 74.23  ? 1018 PHE A N     1 
ATOM   7836  C  CA    . PHE A 1  1018 ? 23.382  -75.949  63.195  1.00 75.43  ? 1018 PHE A CA    1 
ATOM   7837  C  C     . PHE A 1  1018 ? 23.272  -77.401  63.680  1.00 80.99  ? 1018 PHE A C     1 
ATOM   7838  O  O     . PHE A 1  1018 ? 22.171  -77.954  63.730  1.00 81.04  ? 1018 PHE A O     1 
ATOM   7839  C  CB    . PHE A 1  1018 ? 23.694  -75.891  61.690  1.00 77.78  ? 1018 PHE A CB    1 
ATOM   7840  C  CG    . PHE A 1  1018 ? 22.687  -76.651  60.850  1.00 80.88  ? 1018 PHE A CG    1 
ATOM   7841  C  CD1   . PHE A 1  1018 ? 21.353  -76.262  60.806  1.00 84.59  ? 1018 PHE A CD1   1 
ATOM   7842  C  CD2   . PHE A 1  1018 ? 23.066  -77.773  60.129  1.00 85.10  ? 1018 PHE A CD2   1 
ATOM   7843  C  CE1   . PHE A 1  1018 ? 20.420  -76.989  60.064  1.00 86.51  ? 1018 PHE A CE1   1 
ATOM   7844  C  CE2   . PHE A 1  1018 ? 22.125  -78.507  59.398  1.00 88.88  ? 1018 PHE A CE2   1 
ATOM   7845  C  CZ    . PHE A 1  1018 ? 20.812  -78.106  59.365  1.00 86.64  ? 1018 PHE A CZ    1 
ATOM   7846  N  N     . CYS A 1  1019 ? 24.410  -77.988  64.080  1.00 78.31  ? 1019 CYS A N     1 
ATOM   7847  C  CA    . CYS A 1  1019 ? 24.469  -79.344  64.585  1.00 79.26  ? 1019 CYS A CA    1 
ATOM   7848  C  C     . CYS A 1  1019 ? 23.711  -79.468  65.866  1.00 81.34  ? 1019 CYS A C     1 
ATOM   7849  O  O     . CYS A 1  1019 ? 23.001  -80.445  66.014  1.00 81.34  ? 1019 CYS A O     1 
ATOM   7850  C  CB    . CYS A 1  1019 ? 25.909  -79.811  64.724  1.00 80.85  ? 1019 CYS A CB    1 
ATOM   7851  S  SG    . CYS A 1  1019 ? 26.757  -80.013  63.135  1.00 85.66  ? 1019 CYS A SG    1 
ATOM   7852  N  N     . CYS A 1  1020 ? 23.759  -78.440  66.742  1.00 77.21  ? 1020 CYS A N     1 
ATOM   7853  C  CA    . CYS A 1  1020 ? 23.001  -78.414  67.998  1.00 77.25  ? 1020 CYS A CA    1 
ATOM   7854  C  C     . CYS A 1  1020 ? 21.529  -78.635  67.708  1.00 82.84  ? 1020 CYS A C     1 
ATOM   7855  O  O     . CYS A 1  1020 ? 20.902  -79.480  68.348  1.00 83.60  ? 1020 CYS A O     1 
ATOM   7856  C  CB    . CYS A 1  1020 ? 23.218  -77.107  68.749  1.00 76.54  ? 1020 CYS A CB    1 
ATOM   7857  S  SG    . CYS A 1  1020 ? 24.877  -76.911  69.436  1.00 80.52  ? 1020 CYS A SG    1 
ATOM   7858  N  N     . LEU A 1  1021 ? 20.995  -77.900  66.699  1.00 79.46  ? 1021 LEU A N     1 
ATOM   7859  C  CA    . LEU A 1  1021 ? 19.604  -77.979  66.241  1.00 78.77  ? 1021 LEU A CA    1 
ATOM   7860  C  C     . LEU A 1  1021 ? 19.334  -79.378  65.732  1.00 82.59  ? 1021 LEU A C     1 
ATOM   7861  O  O     . LEU A 1  1021 ? 18.510  -80.091  66.307  1.00 82.84  ? 1021 LEU A O     1 
ATOM   7862  C  CB    . LEU A 1  1021 ? 19.333  -76.926  65.147  1.00 77.35  ? 1021 LEU A CB    1 
ATOM   7863  C  CG    . LEU A 1  1021 ? 17.959  -76.942  64.493  1.00 81.58  ? 1021 LEU A CG    1 
ATOM   7864  C  CD1   . LEU A 1  1021 ? 16.907  -76.330  65.403  1.00 80.89  ? 1021 LEU A CD1   1 
ATOM   7865  C  CD2   . LEU A 1  1021 ? 17.993  -76.197  63.162  1.00 84.66  ? 1021 LEU A CD2   1 
ATOM   7866  N  N     . LEU A 1  1022 ? 20.099  -79.779  64.707  1.00 78.63  ? 1022 LEU A N     1 
ATOM   7867  C  CA    . LEU A 1  1022 ? 20.061  -81.076  64.047  1.00 79.31  ? 1022 LEU A CA    1 
ATOM   7868  C  C     . LEU A 1  1022 ? 19.943  -82.226  65.057  1.00 85.77  ? 1022 LEU A C     1 
ATOM   7869  O  O     . LEU A 1  1022 ? 19.058  -83.071  64.919  1.00 87.58  ? 1022 LEU A O     1 
ATOM   7870  C  CB    . LEU A 1  1022 ? 21.346  -81.213  63.234  1.00 78.97  ? 1022 LEU A CB    1 
ATOM   7871  C  CG    . LEU A 1  1022 ? 21.432  -82.425  62.388  1.00 84.94  ? 1022 LEU A CG    1 
ATOM   7872  C  CD1   . LEU A 1  1022 ? 20.848  -82.157  61.044  1.00 85.86  ? 1022 LEU A CD1   1 
ATOM   7873  C  CD2   . LEU A 1  1022 ? 22.845  -82.872  62.268  1.00 87.14  ? 1022 LEU A CD2   1 
ATOM   7874  N  N     . ARG A 1  1023 ? 20.814  -82.216  66.090  1.00 81.00  ? 1023 ARG A N     1 
ATOM   7875  C  CA    . ARG A 1  1023 ? 20.879  -83.222  67.136  1.00 81.28  ? 1023 ARG A CA    1 
ATOM   7876  C  C     . ARG A 1  1023 ? 19.720  -83.070  68.089  1.00 87.63  ? 1023 ARG A C     1 
ATOM   7877  O  O     . ARG A 1  1023 ? 19.254  -84.082  68.609  1.00 89.02  ? 1023 ARG A O     1 
ATOM   7878  C  CB    . ARG A 1  1023 ? 22.187  -83.111  67.945  1.00 78.20  ? 1023 ARG A CB    1 
ATOM   7879  C  CG    . ARG A 1  1023 ? 23.487  -83.281  67.180  1.00 79.36  ? 1023 ARG A CG    1 
ATOM   7880  C  CD    . ARG A 1  1023 ? 24.641  -83.180  68.150  1.00 84.57  ? 1023 ARG A CD    1 
ATOM   7881  N  NE    . ARG A 1  1023 ? 25.821  -82.539  67.574  1.00 95.07  ? 1023 ARG A NE    1 
ATOM   7882  C  CZ    . ARG A 1  1023 ? 26.434  -81.491  68.116  1.00 113.13 ? 1023 ARG A CZ    1 
ATOM   7883  N  NH1   . ARG A 1  1023 ? 25.974  -80.952  69.234  1.00 94.25  ? 1023 ARG A NH1   1 
ATOM   7884  N  NH2   . ARG A 1  1023 ? 27.509  -80.970  67.537  1.00 106.26 ? 1023 ARG A NH2   1 
ATOM   7885  N  N     . SER A 1  1024 ? 19.304  -81.813  68.396  1.00 84.50  ? 1024 SER A N     1 
ATOM   7886  C  CA    . SER A 1  1024 ? 18.207  -81.577  69.351  1.00 85.00  ? 1024 SER A CA    1 
ATOM   7887  C  C     . SER A 1  1024 ? 16.907  -82.104  68.759  1.00 91.10  ? 1024 SER A C     1 
ATOM   7888  O  O     . SER A 1  1024 ? 16.100  -82.715  69.456  1.00 91.45  ? 1024 SER A O     1 
ATOM   7889  C  CB    . SER A 1  1024 ? 18.092  -80.094  69.740  1.00 85.87  ? 1024 SER A CB    1 
ATOM   7890  O  OG    . SER A 1  1024 ? 17.381  -79.248  68.846  1.00 85.99  ? 1024 SER A OG    1 
ATOM   7891  N  N     . ARG A 1  1025 ? 16.744  -81.897  67.451  1.00 87.43  ? 1025 ARG A N     1 
ATOM   7892  C  CA    . ARG A 1  1025 ? 15.576  -82.300  66.711  1.00 86.99  ? 1025 ARG A CA    1 
ATOM   7893  C  C     . ARG A 1  1025 ? 15.579  -83.803  66.425  1.00 92.44  ? 1025 ARG A C     1 
ATOM   7894  O  O     . ARG A 1  1025 ? 14.609  -84.478  66.779  1.00 93.67  ? 1025 ARG A O     1 
ATOM   7895  C  CB    . ARG A 1  1025 ? 15.456  -81.445  65.445  1.00 83.05  ? 1025 ARG A CB    1 
ATOM   7896  C  CG    . ARG A 1  1025 ? 14.254  -80.521  65.496  1.00 92.30  ? 1025 ARG A CG    1 
ATOM   7897  C  CD    . ARG A 1  1025 ? 14.509  -79.156  66.116  1.00 103.14 ? 1025 ARG A CD    1 
ATOM   7898  N  NE    . ARG A 1  1025 ? 13.302  -78.319  66.085  1.00 115.33 ? 1025 ARG A NE    1 
ATOM   7899  C  CZ    . ARG A 1  1025 ? 12.886  -77.616  65.031  1.00 135.51 ? 1025 ARG A CZ    1 
ATOM   7900  N  NH1   . ARG A 1  1025 ? 13.578  -77.631  63.897  1.00 123.42 ? 1025 ARG A NH1   1 
ATOM   7901  N  NH2   . ARG A 1  1025 ? 11.774  -76.897  65.102  1.00 130.37 ? 1025 ARG A NH2   1 
ATOM   7902  N  N     . LEU A 1  1026 ? 16.685  -84.335  65.846  1.00 87.77  ? 1026 LEU A N     1 
ATOM   7903  C  CA    . LEU A 1  1026 ? 16.817  -85.749  65.469  1.00 87.75  ? 1026 LEU A CA    1 
ATOM   7904  C  C     . LEU A 1  1026 ? 17.492  -86.666  66.499  1.00 92.37  ? 1026 LEU A C     1 
ATOM   7905  O  O     . LEU A 1  1026 ? 18.471  -87.349  66.183  1.00 93.37  ? 1026 LEU A O     1 
ATOM   7906  C  CB    . LEU A 1  1026 ? 17.493  -85.889  64.108  1.00 87.17  ? 1026 LEU A CB    1 
ATOM   7907  C  CG    . LEU A 1  1026 ? 16.815  -85.243  62.932  1.00 90.48  ? 1026 LEU A CG    1 
ATOM   7908  C  CD1   . LEU A 1  1026 ? 17.792  -85.089  61.797  1.00 90.06  ? 1026 LEU A CD1   1 
ATOM   7909  C  CD2   . LEU A 1  1026 ? 15.587  -86.034  62.495  1.00 93.70  ? 1026 LEU A CD2   1 
ATOM   7910  N  N     . ALA A 1  1027 ? 16.946  -86.707  67.721  1.00 87.31  ? 1027 ALA A N     1 
ATOM   7911  C  CA    . ALA A 1  1027 ? 17.436  -87.560  68.797  1.00 86.68  ? 1027 ALA A CA    1 
ATOM   7912  C  C     . ALA A 1  1027 ? 16.442  -88.689  68.899  1.00 90.54  ? 1027 ALA A C     1 
ATOM   7913  O  O     . ALA A 1  1027 ? 15.250  -88.465  68.654  1.00 88.69  ? 1027 ALA A O     1 
ATOM   7914  C  CB    . ALA A 1  1027 ? 17.493  -86.782  70.102  1.00 86.50  ? 1027 ALA A CB    1 
ATOM   7915  N  N     . THR A 1  1028 ? 16.937  -89.905  69.240  1.00 88.90  ? 1028 THR A N     1 
ATOM   7916  C  CA    . THR A 1  1028 ? 16.177  -91.166  69.341  1.00 90.10  ? 1028 THR A CA    1 
ATOM   7917  C  C     . THR A 1  1028 ? 14.719  -91.031  69.803  1.00 93.71  ? 1028 THR A C     1 
ATOM   7918  O  O     . THR A 1  1028 ? 13.824  -91.143  68.967  1.00 93.02  ? 1028 THR A O     1 
ATOM   7919  C  CB    . THR A 1  1028 ? 17.012  -92.262  69.996  1.00 95.50  ? 1028 THR A CB    1 
ATOM   7920  O  OG1   . THR A 1  1028 ? 18.173  -92.473  69.194  1.00 94.12  ? 1028 THR A OG1   1 
ATOM   7921  C  CG2   . THR A 1  1028 ? 16.262  -93.560  70.130  1.00 94.28  ? 1028 THR A CG2   1 
ATOM   7922  N  N     . ARG A 1  1029 ? 14.495  -90.728  71.102  1.00 90.31  ? 1029 ARG A N     1 
ATOM   7923  C  CA    . ARG A 1  1029 ? 13.176  -90.503  71.706  1.00 90.53  ? 1029 ARG A CA    1 
ATOM   7924  C  C     . ARG A 1  1029 ? 12.208  -89.776  70.758  1.00 94.47  ? 1029 ARG A C     1 
ATOM   7925  O  O     . ARG A 1  1029 ? 11.117  -90.278  70.496  1.00 95.46  ? 1029 ARG A O     1 
ATOM   7926  C  CB    . ARG A 1  1029 ? 13.338  -89.635  72.959  1.00 90.00  ? 1029 ARG A CB    1 
ATOM   7927  C  CG    . ARG A 1  1029 ? 12.966  -90.296  74.258  1.00 101.48 ? 1029 ARG A CG    1 
ATOM   7928  C  CD    . ARG A 1  1029 ? 11.488  -90.588  74.475  1.00 102.86 ? 1029 ARG A CD    1 
ATOM   7929  N  NE    . ARG A 1  1029 ? 11.310  -91.953  74.969  1.00 101.06 ? 1029 ARG A NE    1 
ATOM   7930  C  CZ    . ARG A 1  1029 ? 11.590  -92.357  76.207  1.00 117.31 ? 1029 ARG A CZ    1 
ATOM   7931  N  NH1   . ARG A 1  1029 ? 12.048  -91.496  77.108  1.00 98.58  ? 1029 ARG A NH1   1 
ATOM   7932  N  NH2   . ARG A 1  1029 ? 11.413  -93.620  76.552  1.00 115.10 ? 1029 ARG A NH2   1 
ATOM   7933  N  N     . ARG A 1  1030 ? 12.629  -88.595  70.247  1.00 89.41  ? 1030 ARG A N     1 
ATOM   7934  C  CA    . ARG A 1  1030 ? 11.876  -87.714  69.350  1.00 87.84  ? 1030 ARG A CA    1 
ATOM   7935  C  C     . ARG A 1  1030 ? 11.591  -88.344  67.993  1.00 90.58  ? 1030 ARG A C     1 
ATOM   7936  O  O     . ARG A 1  1030 ? 10.449  -88.340  67.542  1.00 89.13  ? 1030 ARG A O     1 
ATOM   7937  C  CB    . ARG A 1  1030 ? 12.638  -86.416  69.155  1.00 85.69  ? 1030 ARG A CB    1 
ATOM   7938  C  CG    . ARG A 1  1030 ? 12.639  -85.533  70.364  1.00 94.40  ? 1030 ARG A CG    1 
ATOM   7939  C  CD    . ARG A 1  1030 ? 12.987  -84.127  69.916  1.00 103.48 ? 1030 ARG A CD    1 
ATOM   7940  N  NE    . ARG A 1  1030 ? 11.810  -83.353  69.533  1.00 100.59 ? 1030 ARG A NE    1 
ATOM   7941  C  CZ    . ARG A 1  1030 ? 11.836  -82.056  69.271  1.00 110.34 ? 1030 ARG A CZ    1 
ATOM   7942  N  NH1   . ARG A 1  1030 ? 12.975  -81.382  69.329  1.00 93.32  ? 1030 ARG A NH1   1 
ATOM   7943  N  NH2   . ARG A 1  1030 ? 10.720  -81.421  68.944  1.00 103.46 ? 1030 ARG A NH2   1 
ATOM   7944  N  N     . VAL A 1  1031 ? 12.635  -88.887  67.348  1.00 87.56  ? 1031 VAL A N     1 
ATOM   7945  C  CA    . VAL A 1  1031 ? 12.542  -89.558  66.055  1.00 88.01  ? 1031 VAL A CA    1 
ATOM   7946  C  C     . VAL A 1  1031 ? 11.509  -90.683  66.163  1.00 95.47  ? 1031 VAL A C     1 
ATOM   7947  O  O     . VAL A 1  1031 ? 10.751  -90.900  65.224  1.00 96.91  ? 1031 VAL A O     1 
ATOM   7948  C  CB    . VAL A 1  1031 ? 13.933  -90.079  65.600  1.00 91.43  ? 1031 VAL A CB    1 
ATOM   7949  C  CG1   . VAL A 1  1031 ? 13.851  -90.837  64.284  1.00 92.15  ? 1031 VAL A CG1   1 
ATOM   7950  C  CG2   . VAL A 1  1031 ? 14.926  -88.939  65.473  1.00 89.46  ? 1031 VAL A CG2   1 
ATOM   7951  N  N     . LEU A 1  1032 ? 11.432  -91.334  67.333  1.00 93.44  ? 1032 LEU A N     1 
ATOM   7952  C  CA    . LEU A 1  1032 ? 10.523  -92.446  67.594  1.00 95.57  ? 1032 LEU A CA    1 
ATOM   7953  C  C     . LEU A 1  1032 ? 9.146   -92.089  68.128  1.00 101.05 ? 1032 LEU A C     1 
ATOM   7954  O  O     . LEU A 1  1032 ? 8.153   -92.363  67.451  1.00 101.47 ? 1032 LEU A O     1 
ATOM   7955  C  CB    . LEU A 1  1032 ? 11.180  -93.520  68.497  1.00 96.63  ? 1032 LEU A CB    1 
ATOM   7956  C  CG    . LEU A 1  1032 ? 12.034  -94.597  67.827  1.00 101.93 ? 1032 LEU A CG    1 
ATOM   7957  C  CD1   . LEU A 1  1032 ? 11.425  -95.075  66.526  1.00 103.28 ? 1032 LEU A CD1   1 
ATOM   7958  C  CD2   . LEU A 1  1032 ? 13.440  -94.128  67.608  1.00 102.27 ? 1032 LEU A CD2   1 
ATOM   7959  N  N     . GLN A 1  1033 ? 9.066   -91.592  69.378  1.00 97.63  ? 1033 GLN A N     1 
ATOM   7960  C  CA    . GLN A 1  1033 ? 7.764   -91.318  69.966  1.00 97.86  ? 1033 GLN A CA    1 
ATOM   7961  C  C     . GLN A 1  1033 ? 7.066   -90.102  69.398  1.00 100.07 ? 1033 GLN A C     1 
ATOM   7962  O  O     . GLN A 1  1033 ? 5.858   -90.173  69.160  1.00 101.12 ? 1033 GLN A O     1 
ATOM   7963  C  CB    . GLN A 1  1033 ? 7.732   -91.461  71.500  1.00 99.54  ? 1033 GLN A CB    1 
ATOM   7964  C  CG    . GLN A 1  1033 ? 7.960   -90.191  72.303  1.00 122.60 ? 1033 GLN A CG    1 
ATOM   7965  C  CD    . GLN A 1  1033 ? 7.409   -90.313  73.704  1.00 152.77 ? 1033 GLN A CD    1 
ATOM   7966  O  OE1   . GLN A 1  1033 ? 6.327   -90.881  73.933  1.00 148.29 ? 1033 GLN A OE1   1 
ATOM   7967  N  NE2   . GLN A 1  1033 ? 8.132   -89.753  74.674  1.00 149.82 ? 1033 GLN A NE2   1 
ATOM   7968  N  N     . GLU A 1  1034 ? 7.833   -89.025  69.102  1.00 93.28  ? 1034 GLU A N     1 
ATOM   7969  C  CA    . GLU A 1  1034 ? 7.299   -87.799  68.512  1.00 90.70  ? 1034 GLU A CA    1 
ATOM   7970  C  C     . GLU A 1  1034 ? 7.036   -87.974  67.007  1.00 92.42  ? 1034 GLU A C     1 
ATOM   7971  O  O     . GLU A 1  1034 ? 5.883   -88.179  66.627  1.00 91.66  ? 1034 GLU A O     1 
ATOM   7972  C  CB    . GLU A 1  1034 ? 8.202   -86.585  68.808  1.00 90.08  ? 1034 GLU A CB    1 
ATOM   7973  C  CG    . GLU A 1  1034 ? 7.905   -85.891  70.127  1.00 101.99 ? 1034 GLU A CG    1 
ATOM   7974  C  CD    . GLU A 1  1034 ? 8.844   -84.766  70.537  1.00 120.78 ? 1034 GLU A CD    1 
ATOM   7975  O  OE1   . GLU A 1  1034 ? 8.979   -83.782  69.772  1.00 112.81 ? 1034 GLU A OE1   1 
ATOM   7976  O  OE2   . GLU A 1  1034 ? 9.397   -84.841  71.659  1.00 109.50 ? 1034 GLU A OE2   1 
ATOM   7977  N  N     . TYR A 1  1035 ? 8.099   -87.959  66.173  1.00 88.38  ? 1035 TYR A N     1 
ATOM   7978  C  CA    . TYR A 1  1035 ? 8.024   -88.030  64.707  1.00 88.81  ? 1035 TYR A CA    1 
ATOM   7979  C  C     . TYR A 1  1035 ? 7.467   -89.314  64.135  1.00 95.11  ? 1035 TYR A C     1 
ATOM   7980  O  O     . TYR A 1  1035 ? 6.903   -89.293  63.034  1.00 95.26  ? 1035 TYR A O     1 
ATOM   7981  C  CB    . TYR A 1  1035 ? 9.373   -87.714  64.030  1.00 89.45  ? 1035 TYR A CB    1 
ATOM   7982  C  CG    . TYR A 1  1035 ? 10.097  -86.465  64.492  1.00 90.20  ? 1035 TYR A CG    1 
ATOM   7983  C  CD1   . TYR A 1  1035 ? 11.436  -86.254  64.173  1.00 91.82  ? 1035 TYR A CD1   1 
ATOM   7984  C  CD2   . TYR A 1  1035 ? 9.448   -85.497  65.257  1.00 90.05  ? 1035 TYR A CD2   1 
ATOM   7985  C  CE1   . TYR A 1  1035 ? 12.121  -85.131  64.629  1.00 91.34  ? 1035 TYR A CE1   1 
ATOM   7986  C  CE2   . TYR A 1  1035 ? 10.131  -84.387  65.745  1.00 89.65  ? 1035 TYR A CE2   1 
ATOM   7987  C  CZ    . TYR A 1  1035 ? 11.464  -84.203  65.419  1.00 99.00  ? 1035 TYR A CZ    1 
ATOM   7988  O  OH    . TYR A 1  1035 ? 12.133  -83.104  65.892  1.00 103.50 ? 1035 TYR A OH    1 
ATOM   7989  N  N     . ARG A 1  1036 ? 7.652   -90.432  64.855  1.00 93.02  ? 1036 ARG A N     1 
ATOM   7990  C  CA    . ARG A 1  1036 ? 7.209   -91.775  64.459  1.00 94.81  ? 1036 ARG A CA    1 
ATOM   7991  C  C     . ARG A 1  1036 ? 7.634   -92.074  63.022  1.00 98.28  ? 1036 ARG A C     1 
ATOM   7992  O  O     . ARG A 1  1036 ? 6.827   -92.466  62.181  1.00 99.82  ? 1036 ARG A O     1 
ATOM   7993  C  CB    . ARG A 1  1036 ? 5.704   -91.990  64.736  1.00 97.33  ? 1036 ARG A CB    1 
ATOM   7994  C  CG    . ARG A 1  1036 ? 5.310   -91.599  66.167  1.00 113.88 ? 1036 ARG A CG    1 
ATOM   7995  C  CD    . ARG A 1  1036 ? 3.975   -92.142  66.635  1.00 131.79 ? 1036 ARG A CD    1 
ATOM   7996  N  NE    . ARG A 1  1036 ? 3.913   -93.606  66.621  1.00 145.11 ? 1036 ARG A NE    1 
ATOM   7997  C  CZ    . ARG A 1  1036 ? 4.363   -94.392  67.594  1.00 158.84 ? 1036 ARG A CZ    1 
ATOM   7998  N  NH1   . ARG A 1  1036 ? 4.947   -93.865  68.666  1.00 144.38 ? 1036 ARG A NH1   1 
ATOM   7999  N  NH2   . ARG A 1  1036 ? 4.247   -95.711  67.497  1.00 145.00 ? 1036 ARG A NH2   1 
ATOM   8000  N  N     . LEU A 1  1037 ? 8.915   -91.813  62.745  1.00 92.79  ? 1037 LEU A N     1 
ATOM   8001  C  CA    . LEU A 1  1037 ? 9.546   -91.997  61.449  1.00 92.60  ? 1037 LEU A CA    1 
ATOM   8002  C  C     . LEU A 1  1037 ? 9.879   -93.453  61.169  1.00 98.78  ? 1037 LEU A C     1 
ATOM   8003  O  O     . LEU A 1  1037 ? 9.941   -94.248  62.101  1.00 99.94  ? 1037 LEU A O     1 
ATOM   8004  C  CB    . LEU A 1  1037 ? 10.826  -91.163  61.429  1.00 90.90  ? 1037 LEU A CB    1 
ATOM   8005  C  CG    . LEU A 1  1037 ? 10.854  -90.009  60.446  1.00 93.94  ? 1037 LEU A CG    1 
ATOM   8006  C  CD1   . LEU A 1  1037 ? 9.647   -89.097  60.621  1.00 92.85  ? 1037 LEU A CD1   1 
ATOM   8007  C  CD2   . LEU A 1  1037 ? 12.148  -89.236  60.574  1.00 95.13  ? 1037 LEU A CD2   1 
ATOM   8008  N  N     . THR A 1  1038 ? 10.085  -93.803  59.887  1.00 95.44  ? 1038 THR A N     1 
ATOM   8009  C  CA    . THR A 1  1038 ? 10.489  -95.148  59.450  1.00 97.13  ? 1038 THR A CA    1 
ATOM   8010  C  C     . THR A 1  1038 ? 11.854  -95.032  58.767  1.00 101.89 ? 1038 THR A C     1 
ATOM   8011  O  O     . THR A 1  1038 ? 12.211  -93.930  58.355  1.00 100.43 ? 1038 THR A O     1 
ATOM   8012  C  CB    . THR A 1  1038 ? 9.436   -95.793  58.560  1.00 102.62 ? 1038 THR A CB    1 
ATOM   8013  O  OG1   . THR A 1  1038 ? 9.369   -95.088  57.320  1.00 102.96 ? 1038 THR A OG1   1 
ATOM   8014  C  CG2   . THR A 1  1038 ? 8.073   -95.876  59.232  1.00 99.63  ? 1038 THR A CG2   1 
ATOM   8015  N  N     . LYS A 1  1039 ? 12.624  -96.141  58.662  1.00 100.26 ? 1039 LYS A N     1 
ATOM   8016  C  CA    . LYS A 1  1039 ? 13.963  -96.149  58.044  1.00 100.18 ? 1039 LYS A CA    1 
ATOM   8017  C  C     . LYS A 1  1039 ? 13.959  -95.495  56.663  1.00 104.01 ? 1039 LYS A C     1 
ATOM   8018  O  O     . LYS A 1  1039 ? 14.816  -94.645  56.390  1.00 101.81 ? 1039 LYS A O     1 
ATOM   8019  C  CB    . LYS A 1  1039 ? 14.570  -97.575  58.036  1.00 104.99 ? 1039 LYS A CB    1 
ATOM   8020  C  CG    . LYS A 1  1039 ? 15.843  -97.798  57.194  1.00 116.80 ? 1039 LYS A CG    1 
ATOM   8021  C  CD    . LYS A 1  1039 ? 17.118  -97.269  57.844  1.00 121.19 ? 1039 LYS A CD    1 
ATOM   8022  C  CE    . LYS A 1  1039 ? 18.347  -97.607  57.037  1.00 124.98 ? 1039 LYS A CE    1 
ATOM   8023  N  NZ    . LYS A 1  1039 ? 19.340  -96.498  57.073  1.00 125.98 ? 1039 LYS A NZ    1 
ATOM   8024  N  N     . GLN A 1  1040 ? 12.951  -95.845  55.832  1.00 102.34 ? 1040 GLN A N     1 
ATOM   8025  C  CA    . GLN A 1  1040 ? 12.731  -95.292  54.491  1.00 102.02 ? 1040 GLN A CA    1 
ATOM   8026  C  C     . GLN A 1  1040 ? 12.530  -93.780  54.572  1.00 103.72 ? 1040 GLN A C     1 
ATOM   8027  O  O     . GLN A 1  1040 ? 13.171  -93.031  53.829  1.00 102.24 ? 1040 GLN A O     1 
ATOM   8028  C  CB    . GLN A 1  1040 ? 11.496  -95.950  53.852  1.00 105.00 ? 1040 GLN A CB    1 
ATOM   8029  C  CG    . GLN A 1  1040 ? 11.315  -95.692  52.354  1.00 108.92 ? 1040 GLN A CG    1 
ATOM   8030  C  CD    . GLN A 1  1040 ? 9.858   -95.676  51.956  1.00 123.95 ? 1040 GLN A CD    1 
ATOM   8031  O  OE1   . GLN A 1  1040 ? 8.947   -95.788  52.793  1.00 118.21 ? 1040 GLN A OE1   1 
ATOM   8032  N  NE2   . GLN A 1  1040 ? 9.597   -95.450  50.671  1.00 115.08 ? 1040 GLN A NE2   1 
ATOM   8033  N  N     . ALA A 1  1041 ? 11.654  -93.340  55.487  1.00 99.95  ? 1041 ALA A N     1 
ATOM   8034  C  CA    . ALA A 1  1041 ? 11.363  -91.928  55.689  1.00 98.29  ? 1041 ALA A CA    1 
ATOM   8035  C  C     . ALA A 1  1041 ? 12.575  -91.175  56.232  1.00 101.76 ? 1041 ALA A C     1 
ATOM   8036  O  O     . ALA A 1  1041 ? 12.963  -90.162  55.658  1.00 100.65 ? 1041 ALA A O     1 
ATOM   8037  C  CB    . ALA A 1  1041 ? 10.173  -91.770  56.619  1.00 99.14  ? 1041 ALA A CB    1 
ATOM   8038  N  N     . PHE A 1  1042 ? 13.186  -91.693  57.308  1.00 99.16  ? 1042 PHE A N     1 
ATOM   8039  C  CA    . PHE A 1  1042 ? 14.342  -91.135  58.005  1.00 97.99  ? 1042 PHE A CA    1 
ATOM   8040  C  C     . PHE A 1  1042 ? 15.548  -90.883  57.100  1.00 101.87 ? 1042 PHE A C     1 
ATOM   8041  O  O     . PHE A 1  1042 ? 16.152  -89.815  57.196  1.00 99.53  ? 1042 PHE A O     1 
ATOM   8042  C  CB    . PHE A 1  1042 ? 14.723  -92.056  59.169  1.00 100.71 ? 1042 PHE A CB    1 
ATOM   8043  C  CG    . PHE A 1  1042 ? 15.851  -91.572  60.043  1.00 101.17 ? 1042 PHE A CG    1 
ATOM   8044  C  CD1   . PHE A 1  1042 ? 15.622  -90.644  61.050  1.00 102.76 ? 1042 PHE A CD1   1 
ATOM   8045  C  CD2   . PHE A 1  1042 ? 17.134  -92.083  59.896  1.00 103.72 ? 1042 PHE A CD2   1 
ATOM   8046  C  CE1   . PHE A 1  1042 ? 16.662  -90.212  61.874  1.00 102.72 ? 1042 PHE A CE1   1 
ATOM   8047  C  CE2   . PHE A 1  1042 ? 18.176  -91.653  60.723  1.00 105.58 ? 1042 PHE A CE2   1 
ATOM   8048  C  CZ    . PHE A 1  1042 ? 17.933  -90.715  61.702  1.00 102.36 ? 1042 PHE A CZ    1 
ATOM   8049  N  N     . ASP A 1  1043 ? 15.911  -91.871  56.252  1.00 100.32 ? 1043 ASP A N     1 
ATOM   8050  C  CA    . ASP A 1  1043 ? 17.042  -91.793  55.323  1.00 100.35 ? 1043 ASP A CA    1 
ATOM   8051  C  C     . ASP A 1  1043 ? 16.944  -90.591  54.388  1.00 103.56 ? 1043 ASP A C     1 
ATOM   8052  O  O     . ASP A 1  1043 ? 17.954  -89.933  54.135  1.00 101.77 ? 1043 ASP A O     1 
ATOM   8053  C  CB    . ASP A 1  1043 ? 17.111  -93.063  54.473  1.00 104.28 ? 1043 ASP A CB    1 
ATOM   8054  C  CG    . ASP A 1  1043 ? 17.793  -94.239  55.112  1.00 113.26 ? 1043 ASP A CG    1 
ATOM   8055  O  OD1   . ASP A 1  1043 ? 18.779  -94.025  55.844  1.00 113.37 ? 1043 ASP A OD1   1 
ATOM   8056  O  OD2   . ASP A 1  1043 ? 17.411  -95.382  54.793  1.00 119.13 ? 1043 ASP A OD2   1 
ATOM   8057  N  N     . TRP A 1  1044 ? 15.725  -90.343  53.855  1.00 101.46 ? 1044 TRP A N     1 
ATOM   8058  C  CA    . TRP A 1  1044 ? 15.347  -89.255  52.949  1.00 100.89 ? 1044 TRP A CA    1 
ATOM   8059  C  C     . TRP A 1  1044 ? 15.522  -87.908  53.659  1.00 99.85  ? 1044 TRP A C     1 
ATOM   8060  O  O     . TRP A 1  1044 ? 15.993  -86.956  53.037  1.00 98.69  ? 1044 TRP A O     1 
ATOM   8061  C  CB    . TRP A 1  1044 ? 13.893  -89.463  52.491  1.00 101.76 ? 1044 TRP A CB    1 
ATOM   8062  C  CG    . TRP A 1  1044 ? 13.319  -88.400  51.596  1.00 103.01 ? 1044 TRP A CG    1 
ATOM   8063  C  CD1   . TRP A 1  1044 ? 13.378  -88.357  50.231  1.00 106.52 ? 1044 TRP A CD1   1 
ATOM   8064  C  CD2   . TRP A 1  1044 ? 12.478  -87.303  51.996  1.00 101.97 ? 1044 TRP A CD2   1 
ATOM   8065  N  NE1   . TRP A 1  1044 ? 12.665  -87.275  49.759  1.00 105.09 ? 1044 TRP A NE1   1 
ATOM   8066  C  CE2   . TRP A 1  1044 ? 12.095  -86.617  50.820  1.00 105.42 ? 1044 TRP A CE2   1 
ATOM   8067  C  CE3   . TRP A 1  1044 ? 12.025  -86.820  53.238  1.00 102.70 ? 1044 TRP A CE3   1 
ATOM   8068  C  CZ2   . TRP A 1  1044 ? 11.287  -85.473  50.851  1.00 103.34 ? 1044 TRP A CZ2   1 
ATOM   8069  C  CZ3   . TRP A 1  1044 ? 11.236  -85.677  53.263  1.00 102.91 ? 1044 TRP A CZ3   1 
ATOM   8070  C  CH2   . TRP A 1  1044 ? 10.869  -85.024  52.081  1.00 102.91 ? 1044 TRP A CH2   1 
ATOM   8071  N  N     . VAL A 1  1045 ? 15.176  -87.848  54.965  1.00 93.21  ? 1045 VAL A N     1 
ATOM   8072  C  CA    . VAL A 1  1045 ? 15.340  -86.683  55.835  1.00 90.03  ? 1045 VAL A CA    1 
ATOM   8073  C  C     . VAL A 1  1045 ? 16.827  -86.306  55.852  1.00 91.79  ? 1045 VAL A C     1 
ATOM   8074  O  O     . VAL A 1  1045 ? 17.157  -85.154  55.604  1.00 90.30  ? 1045 VAL A O     1 
ATOM   8075  C  CB    . VAL A 1  1045 ? 14.778  -86.962  57.257  1.00 93.78  ? 1045 VAL A CB    1 
ATOM   8076  C  CG1   . VAL A 1  1045 ? 15.108  -85.840  58.236  1.00 91.69  ? 1045 VAL A CG1   1 
ATOM   8077  C  CG2   . VAL A 1  1045 ? 13.277  -87.204  57.213  1.00 94.45  ? 1045 VAL A CG2   1 
ATOM   8078  N  N     . LEU A 1  1046 ? 17.713  -87.288  56.064  1.00 88.68  ? 1046 LEU A N     1 
ATOM   8079  C  CA    . LEU A 1  1046 ? 19.167  -87.110  56.076  1.00 87.89  ? 1046 LEU A CA    1 
ATOM   8080  C  C     . LEU A 1  1046 ? 19.727  -86.571  54.735  1.00 92.60  ? 1046 LEU A C     1 
ATOM   8081  O  O     . LEU A 1  1046 ? 20.626  -85.724  54.729  1.00 90.61  ? 1046 LEU A O     1 
ATOM   8082  C  CB    . LEU A 1  1046 ? 19.830  -88.435  56.470  1.00 89.18  ? 1046 LEU A CB    1 
ATOM   8083  C  CG    . LEU A 1  1046 ? 20.216  -88.591  57.952  1.00 93.65  ? 1046 LEU A CG    1 
ATOM   8084  C  CD1   . LEU A 1  1046 ? 18.998  -88.615  58.876  1.00 93.57  ? 1046 LEU A CD1   1 
ATOM   8085  C  CD2   . LEU A 1  1046 ? 21.038  -89.833  58.164  1.00 96.88  ? 1046 LEU A CD2   1 
ATOM   8086  N  N     . SER A 1  1047 ? 19.156  -87.029  53.605  1.00 91.28  ? 1047 SER A N     1 
ATOM   8087  C  CA    . SER A 1  1047 ? 19.549  -86.608  52.255  1.00 91.00  ? 1047 SER A CA    1 
ATOM   8088  C  C     . SER A 1  1047 ? 19.034  -85.208  51.983  1.00 93.22  ? 1047 SER A C     1 
ATOM   8089  O  O     . SER A 1  1047 ? 19.754  -84.396  51.395  1.00 92.28  ? 1047 SER A O     1 
ATOM   8090  C  CB    . SER A 1  1047 ? 18.989  -87.568  51.216  1.00 96.78  ? 1047 SER A CB    1 
ATOM   8091  O  OG    . SER A 1  1047 ? 19.214  -88.914  51.600  1.00 111.36 ? 1047 SER A OG    1 
ATOM   8092  N  N     . ASN A 1  1048 ? 17.784  -84.932  52.428  1.00 88.79  ? 1048 ASN A N     1 
ATOM   8093  C  CA    . ASN A 1  1048 ? 17.089  -83.649  52.310  1.00 86.91  ? 1048 ASN A CA    1 
ATOM   8094  C  C     . ASN A 1  1048 ? 17.807  -82.545  53.074  1.00 88.71  ? 1048 ASN A C     1 
ATOM   8095  O  O     . ASN A 1  1048 ? 17.924  -81.426  52.556  1.00 87.64  ? 1048 ASN A O     1 
ATOM   8096  C  CB    . ASN A 1  1048 ? 15.665  -83.772  52.824  1.00 88.25  ? 1048 ASN A CB    1 
ATOM   8097  C  CG    . ASN A 1  1048 ? 14.654  -83.393  51.800  1.00 117.53 ? 1048 ASN A CG    1 
ATOM   8098  O  OD1   . ASN A 1  1048 ? 14.298  -82.213  51.649  1.00 113.60 ? 1048 ASN A OD1   1 
ATOM   8099  N  ND2   . ASN A 1  1048 ? 14.239  -84.383  51.025  1.00 109.43 ? 1048 ASN A ND2   1 
ATOM   8100  N  N     . ILE A 1  1049 ? 18.273  -82.862  54.313  1.00 83.75  ? 1049 ILE A N     1 
ATOM   8101  C  CA    . ILE A 1  1049 ? 19.004  -81.935  55.165  1.00 81.63  ? 1049 ILE A CA    1 
ATOM   8102  C  C     . ILE A 1  1049 ? 20.320  -81.599  54.489  1.00 85.53  ? 1049 ILE A C     1 
ATOM   8103  O  O     . ILE A 1  1049 ? 20.592  -80.416  54.272  1.00 84.66  ? 1049 ILE A O     1 
ATOM   8104  C  CB    . ILE A 1  1049 ? 19.186  -82.446  56.618  1.00 84.42  ? 1049 ILE A CB    1 
ATOM   8105  C  CG1   . ILE A 1  1049 ? 17.839  -82.446  57.365  1.00 84.08  ? 1049 ILE A CG1   1 
ATOM   8106  C  CG2   . ILE A 1  1049 ? 20.219  -81.583  57.366  1.00 84.33  ? 1049 ILE A CG2   1 
ATOM   8107  C  CD1   . ILE A 1  1049 ? 17.775  -83.286  58.578  1.00 87.00  ? 1049 ILE A CD1   1 
ATOM   8108  N  N     . GLU A 1  1050 ? 21.096  -82.633  54.095  1.00 82.15  ? 1050 GLU A N     1 
ATOM   8109  C  CA    . GLU A 1  1050 ? 22.373  -82.433  53.414  1.00 81.76  ? 1050 GLU A CA    1 
ATOM   8110  C  C     . GLU A 1  1050 ? 22.220  -81.526  52.182  1.00 83.79  ? 1050 GLU A C     1 
ATOM   8111  O  O     . GLU A 1  1050 ? 22.922  -80.509  52.078  1.00 80.93  ? 1050 GLU A O     1 
ATOM   8112  C  CB    . GLU A 1  1050 ? 23.018  -83.772  53.047  1.00 84.84  ? 1050 GLU A CB    1 
ATOM   8113  C  CG    . GLU A 1  1050 ? 24.487  -83.628  52.693  1.00 97.12  ? 1050 GLU A CG    1 
ATOM   8114  C  CD    . GLU A 1  1050 ? 25.201  -84.898  52.283  1.00 129.14 ? 1050 GLU A CD    1 
ATOM   8115  O  OE1   . GLU A 1  1050 ? 24.601  -85.996  52.379  1.00 122.48 ? 1050 GLU A OE1   1 
ATOM   8116  O  OE2   . GLU A 1  1050 ? 26.380  -84.790  51.875  1.00 133.45 ? 1050 GLU A OE2   1 
ATOM   8117  N  N     . ALA A 1  1051 ? 21.256  -81.872  51.298  1.00 81.60  ? 1051 ALA A N     1 
ATOM   8118  C  CA    . ALA A 1  1051 ? 20.945  -81.145  50.073  1.00 81.14  ? 1051 ALA A CA    1 
ATOM   8119  C  C     . ALA A 1  1051 ? 20.625  -79.685  50.358  1.00 84.54  ? 1051 ALA A C     1 
ATOM   8120  O  O     . ALA A 1  1051 ? 21.349  -78.803  49.882  1.00 83.60  ? 1051 ALA A O     1 
ATOM   8121  C  CB    . ALA A 1  1051 ? 19.785  -81.803  49.369  1.00 82.72  ? 1051 ALA A CB    1 
ATOM   8122  N  N     . GLN A 1  1052 ? 19.581  -79.431  51.181  1.00 81.18  ? 1052 GLN A N     1 
ATOM   8123  C  CA    . GLN A 1  1052 ? 19.161  -78.078  51.545  1.00 80.00  ? 1052 GLN A CA    1 
ATOM   8124  C  C     . GLN A 1  1052 ? 20.286  -77.258  52.156  1.00 83.76  ? 1052 GLN A C     1 
ATOM   8125  O  O     . GLN A 1  1052 ? 20.403  -76.086  51.808  1.00 82.37  ? 1052 GLN A O     1 
ATOM   8126  C  CB    . GLN A 1  1052 ? 17.915  -78.080  52.445  1.00 81.30  ? 1052 GLN A CB    1 
ATOM   8127  C  CG    . GLN A 1  1052 ? 16.626  -78.389  51.693  1.00 100.32 ? 1052 GLN A CG    1 
ATOM   8128  C  CD    . GLN A 1  1052 ? 15.360  -78.144  52.486  1.00 121.91 ? 1052 GLN A CD    1 
ATOM   8129  O  OE1   . GLN A 1  1052 ? 15.067  -77.022  52.941  1.00 112.36 ? 1052 GLN A OE1   1 
ATOM   8130  N  NE2   . GLN A 1  1052 ? 14.528  -79.177  52.574  1.00 118.67 ? 1052 GLN A NE2   1 
ATOM   8131  N  N     . PHE A 1  1053 ? 21.130  -77.883  53.036  1.00 81.34  ? 1053 PHE A N     1 
ATOM   8132  C  CA    . PHE A 1  1053 ? 22.286  -77.247  53.701  1.00 80.24  ? 1053 PHE A CA    1 
ATOM   8133  C  C     . PHE A 1  1053 ? 23.253  -76.756  52.649  1.00 85.29  ? 1053 PHE A C     1 
ATOM   8134  O  O     . PHE A 1  1053 ? 23.617  -75.576  52.646  1.00 84.40  ? 1053 PHE A O     1 
ATOM   8135  C  CB    . PHE A 1  1053 ? 23.019  -78.216  54.666  1.00 82.10  ? 1053 PHE A CB    1 
ATOM   8136  C  CG    . PHE A 1  1053 ? 24.180  -77.594  55.417  1.00 82.81  ? 1053 PHE A CG    1 
ATOM   8137  C  CD1   . PHE A 1  1053 ? 23.994  -77.021  56.675  1.00 84.82  ? 1053 PHE A CD1   1 
ATOM   8138  C  CD2   . PHE A 1  1053 ? 25.458  -77.568  54.865  1.00 85.02  ? 1053 PHE A CD2   1 
ATOM   8139  C  CE1   . PHE A 1  1053 ? 25.064  -76.432  57.364  1.00 84.42  ? 1053 PHE A CE1   1 
ATOM   8140  C  CE2   . PHE A 1  1053 ? 26.525  -76.964  55.550  1.00 86.90  ? 1053 PHE A CE2   1 
ATOM   8141  C  CZ    . PHE A 1  1053 ? 26.320  -76.407  56.794  1.00 83.75  ? 1053 PHE A CZ    1 
ATOM   8142  N  N     . LEU A 1  1054 ? 23.664  -77.672  51.752  1.00 81.97  ? 1054 LEU A N     1 
ATOM   8143  C  CA    . LEU A 1  1054 ? 24.590  -77.373  50.672  1.00 80.91  ? 1054 LEU A CA    1 
ATOM   8144  C  C     . LEU A 1  1054 ? 24.085  -76.212  49.777  1.00 81.43  ? 1054 LEU A C     1 
ATOM   8145  O  O     . LEU A 1  1054 ? 24.880  -75.341  49.393  1.00 79.53  ? 1054 LEU A O     1 
ATOM   8146  C  CB    . LEU A 1  1054 ? 24.933  -78.663  49.899  1.00 82.14  ? 1054 LEU A CB    1 
ATOM   8147  C  CG    . LEU A 1  1054 ? 25.895  -79.606  50.629  1.00 86.40  ? 1054 LEU A CG    1 
ATOM   8148  C  CD1   . LEU A 1  1054 ? 25.679  -81.020  50.221  1.00 87.70  ? 1054 LEU A CD1   1 
ATOM   8149  C  CD2   . LEU A 1  1054 ? 27.334  -79.232  50.367  1.00 88.47  ? 1054 LEU A CD2   1 
ATOM   8150  N  N     . ARG A 1  1055 ? 22.751  -76.161  49.545  1.00 76.88  ? 1055 ARG A N     1 
ATOM   8151  C  CA    . ARG A 1  1055 ? 22.069  -75.098  48.784  1.00 75.28  ? 1055 ARG A CA    1 
ATOM   8152  C  C     . ARG A 1  1055 ? 22.053  -73.764  49.563  1.00 74.96  ? 1055 ARG A C     1 
ATOM   8153  O  O     . ARG A 1  1055 ? 22.114  -72.676  48.969  1.00 72.92  ? 1055 ARG A O     1 
ATOM   8154  C  CB    . ARG A 1  1055 ? 20.627  -75.510  48.474  1.00 75.18  ? 1055 ARG A CB    1 
ATOM   8155  C  CG    . ARG A 1  1055 ? 20.534  -76.408  47.287  1.00 88.77  ? 1055 ARG A CG    1 
ATOM   8156  C  CD    . ARG A 1  1055 ? 19.104  -76.564  46.851  1.00 105.53 ? 1055 ARG A CD    1 
ATOM   8157  N  NE    . ARG A 1  1055 ? 18.684  -77.963  46.953  1.00 120.37 ? 1055 ARG A NE    1 
ATOM   8158  C  CZ    . ARG A 1  1055 ? 17.644  -78.378  47.668  1.00 131.48 ? 1055 ARG A CZ    1 
ATOM   8159  N  NH1   . ARG A 1  1055 ? 16.897  -77.503  48.337  1.00 119.47 ? 1055 ARG A NH1   1 
ATOM   8160  N  NH2   . ARG A 1  1055 ? 17.330  -79.669  47.708  1.00 107.95 ? 1055 ARG A NH2   1 
ATOM   8161  N  N     . SER A 1  1056 ? 21.964  -73.873  50.901  1.00 69.14  ? 1056 SER A N     1 
ATOM   8162  C  CA    . SER A 1  1056 ? 21.906  -72.750  51.821  1.00 66.47  ? 1056 SER A CA    1 
ATOM   8163  C  C     . SER A 1  1056 ? 23.222  -71.945  51.897  1.00 69.95  ? 1056 SER A C     1 
ATOM   8164  O  O     . SER A 1  1056 ? 23.213  -70.772  52.298  1.00 67.09  ? 1056 SER A O     1 
ATOM   8165  C  CB    . SER A 1  1056 ? 21.427  -73.215  53.194  1.00 66.67  ? 1056 SER A CB    1 
ATOM   8166  O  OG    . SER A 1  1056 ? 20.035  -73.496  53.226  1.00 66.36  ? 1056 SER A OG    1 
ATOM   8167  N  N     . VAL A 1  1057 ? 24.335  -72.566  51.457  1.00 68.95  ? 1057 VAL A N     1 
ATOM   8168  C  CA    . VAL A 1  1057 ? 25.681  -71.982  51.469  1.00 69.70  ? 1057 VAL A CA    1 
ATOM   8169  C  C     . VAL A 1  1057 ? 25.823  -70.768  50.529  1.00 74.45  ? 1057 VAL A C     1 
ATOM   8170  O  O     . VAL A 1  1057 ? 25.115  -70.668  49.507  1.00 74.31  ? 1057 VAL A O     1 
ATOM   8171  C  CB    . VAL A 1  1057 ? 26.786  -73.074  51.271  1.00 75.19  ? 1057 VAL A CB    1 
ATOM   8172  C  CG1   . VAL A 1  1057 ? 28.187  -72.473  51.138  1.00 74.93  ? 1057 VAL A CG1   1 
ATOM   8173  C  CG2   . VAL A 1  1057 ? 26.764  -74.097  52.411  1.00 75.86  ? 1057 VAL A CG2   1 
ATOM   8174  N  N     . VAL A 1  1058 ? 26.738  -69.842  50.912  1.00 70.88  ? 1058 VAL A N     1 
ATOM   8175  C  CA    . VAL A 1  1058 ? 27.077  -68.628  50.169  1.00 70.56  ? 1058 VAL A CA    1 
ATOM   8176  C  C     . VAL A 1  1058 ? 27.830  -68.959  48.862  1.00 76.43  ? 1058 VAL A C     1 
ATOM   8177  O  O     . VAL A 1  1058 ? 28.581  -69.948  48.804  1.00 77.64  ? 1058 VAL A O     1 
ATOM   8178  C  CB    . VAL A 1  1058 ? 27.826  -67.600  51.060  1.00 73.50  ? 1058 VAL A CB    1 
ATOM   8179  C  CG1   . VAL A 1  1058 ? 29.256  -68.049  51.387  1.00 73.81  ? 1058 VAL A CG1   1 
ATOM   8180  C  CG2   . VAL A 1  1058 ? 27.801  -66.207  50.441  1.00 72.47  ? 1058 VAL A CG2   1 
ATOM   8181  N  N     . HIS A 1  1059 ? 27.624  -68.130  47.826  1.00 72.01  ? 1059 HIS A N     1 
ATOM   8182  C  CA    . HIS A 1  1059 ? 28.274  -68.329  46.540  1.00 72.48  ? 1059 HIS A CA    1 
ATOM   8183  C  C     . HIS A 1  1059 ? 29.450  -67.367  46.368  1.00 72.91  ? 1059 HIS A C     1 
ATOM   8184  O  O     . HIS A 1  1059 ? 29.194  -66.164  46.400  1.00 71.88  ? 1059 HIS A O     1 
ATOM   8185  C  CB    . HIS A 1  1059 ? 27.268  -68.093  45.411  1.00 73.96  ? 1059 HIS A CB    1 
ATOM   8186  C  CG    . HIS A 1  1059 ? 26.244  -69.168  45.242  1.00 78.74  ? 1059 HIS A CG    1 
ATOM   8187  N  ND1   . HIS A 1  1059 ? 25.814  -69.549  43.981  1.00 81.63  ? 1059 HIS A ND1   1 
ATOM   8188  C  CD2   . HIS A 1  1059 ? 25.562  -69.880  46.172  1.00 81.69  ? 1059 HIS A CD2   1 
ATOM   8189  C  CE1   . HIS A 1  1059 ? 24.890  -70.475  44.177  1.00 82.13  ? 1059 HIS A CE1   1 
ATOM   8190  N  NE2   . HIS A 1  1059 ? 24.713  -70.720  45.480  1.00 82.48  ? 1059 HIS A NE2   1 
ATOM   8191  N  N     . PRO A 1  1060 ? 30.722  -67.826  46.141  1.00 67.51  ? 1060 PRO A N     1 
ATOM   8192  C  CA    . PRO A 1  1060 ? 31.814  -66.867  45.887  1.00 67.06  ? 1060 PRO A CA    1 
ATOM   8193  C  C     . PRO A 1  1060 ? 31.442  -66.012  44.687  1.00 73.30  ? 1060 PRO A C     1 
ATOM   8194  O  O     . PRO A 1  1060 ? 31.031  -66.530  43.625  1.00 74.77  ? 1060 PRO A O     1 
ATOM   8195  C  CB    . PRO A 1  1060 ? 33.016  -67.750  45.575  1.00 69.57  ? 1060 PRO A CB    1 
ATOM   8196  C  CG    . PRO A 1  1060 ? 32.679  -69.067  46.076  1.00 73.99  ? 1060 PRO A CG    1 
ATOM   8197  C  CD    . PRO A 1  1060 ? 31.204  -69.213  46.028  1.00 69.10  ? 1060 PRO A CD    1 
ATOM   8198  N  N     . GLY A 1  1061 ? 31.489  -64.709  44.907  1.00 69.18  ? 1061 GLY A N     1 
ATOM   8199  C  CA    . GLY A 1  1061 ? 31.068  -63.722  43.928  1.00 68.66  ? 1061 GLY A CA    1 
ATOM   8200  C  C     . GLY A 1  1061 ? 29.997  -62.846  44.534  1.00 72.60  ? 1061 GLY A C     1 
ATOM   8201  O  O     . GLY A 1  1061 ? 29.908  -61.674  44.172  1.00 72.75  ? 1061 GLY A O     1 
ATOM   8202  N  N     . GLU A 1  1062 ? 29.200  -63.397  45.502  1.00 68.91  ? 1062 GLU A N     1 
ATOM   8203  C  CA    . GLU A 1  1062 ? 28.165  -62.651  46.228  1.00 67.59  ? 1062 GLU A CA    1 
ATOM   8204  C  C     . GLU A 1  1062 ? 28.820  -61.469  46.865  1.00 73.70  ? 1062 GLU A C     1 
ATOM   8205  O  O     . GLU A 1  1062 ? 29.655  -61.627  47.756  1.00 73.59  ? 1062 GLU A O     1 
ATOM   8206  C  CB    . GLU A 1  1062 ? 27.452  -63.486  47.294  1.00 68.32  ? 1062 GLU A CB    1 
ATOM   8207  C  CG    . GLU A 1  1062 ? 26.029  -63.855  46.926  1.00 78.35  ? 1062 GLU A CG    1 
ATOM   8208  C  CD    . GLU A 1  1062 ? 24.989  -62.781  47.179  1.00 98.00  ? 1062 GLU A CD    1 
ATOM   8209  O  OE1   . GLU A 1  1062 ? 24.889  -61.831  46.369  1.00 99.29  ? 1062 GLU A OE1   1 
ATOM   8210  O  OE2   . GLU A 1  1062 ? 24.238  -62.916  48.171  1.00 89.17  ? 1062 GLU A OE2   1 
ATOM   8211  N  N     . MET A 1  1063 ? 28.508  -60.289  46.304  1.00 72.12  ? 1063 MET A N     1 
ATOM   8212  C  CA    . MET A 1  1063 ? 28.977  -58.951  46.661  1.00 72.49  ? 1063 MET A CA    1 
ATOM   8213  C  C     . MET A 1  1063 ? 28.371  -58.465  48.007  1.00 76.04  ? 1063 MET A C     1 
ATOM   8214  O  O     . MET A 1  1063 ? 27.542  -57.536  48.020  1.00 75.77  ? 1063 MET A O     1 
ATOM   8215  C  CB    . MET A 1  1063 ? 28.616  -57.975  45.518  1.00 74.88  ? 1063 MET A CB    1 
ATOM   8216  C  CG    . MET A 1  1063 ? 29.330  -58.248  44.205  1.00 79.54  ? 1063 MET A CG    1 
ATOM   8217  S  SD    . MET A 1  1063 ? 31.133  -58.176  44.304  1.00 84.89  ? 1063 MET A SD    1 
ATOM   8218  C  CE    . MET A 1  1063 ? 31.384  -56.577  45.231  1.00 80.59  ? 1063 MET A CE    1 
ATOM   8219  N  N     . VAL A 1  1064 ? 28.814  -59.077  49.135  1.00 70.55  ? 1064 VAL A N     1 
ATOM   8220  C  CA    . VAL A 1  1064 ? 28.279  -58.752  50.445  1.00 69.09  ? 1064 VAL A CA    1 
ATOM   8221  C  C     . VAL A 1  1064 ? 28.468  -57.309  50.942  1.00 73.15  ? 1064 VAL A C     1 
ATOM   8222  O  O     . VAL A 1  1064 ? 27.665  -56.809  51.742  1.00 71.48  ? 1064 VAL A O     1 
ATOM   8223  C  CB    . VAL A 1  1064 ? 28.516  -59.798  51.532  1.00 73.06  ? 1064 VAL A CB    1 
ATOM   8224  C  CG1   . VAL A 1  1064 ? 27.387  -59.710  52.553  1.00 72.96  ? 1064 VAL A CG1   1 
ATOM   8225  C  CG2   . VAL A 1  1064 ? 28.604  -61.199  50.953  1.00 72.89  ? 1064 VAL A CG2   1 
ATOM   8226  N  N     . GLY A 1  1065 ? 29.497  -56.645  50.440  1.00 70.96  ? 1065 GLY A N     1 
ATOM   8227  C  CA    . GLY A 1  1065 ? 29.764  -55.259  50.783  1.00 70.24  ? 1065 GLY A CA    1 
ATOM   8228  C  C     . GLY A 1  1065 ? 28.576  -54.380  50.469  1.00 71.64  ? 1065 GLY A C     1 
ATOM   8229  O  O     . GLY A 1  1065 ? 27.991  -53.779  51.380  1.00 69.15  ? 1065 GLY A O     1 
ATOM   8230  N  N     . VAL A 1  1066 ? 28.164  -54.375  49.177  1.00 67.88  ? 1066 VAL A N     1 
ATOM   8231  C  CA    . VAL A 1  1066 ? 27.014  -53.592  48.727  1.00 66.29  ? 1066 VAL A CA    1 
ATOM   8232  C  C     . VAL A 1  1066 ? 25.777  -54.069  49.443  1.00 70.44  ? 1066 VAL A C     1 
ATOM   8233  O  O     . VAL A 1  1066 ? 25.095  -53.256  50.071  1.00 70.14  ? 1066 VAL A O     1 
ATOM   8234  C  CB    . VAL A 1  1066 ? 26.854  -53.582  47.202  1.00 69.45  ? 1066 VAL A CB    1 
ATOM   8235  C  CG1   . VAL A 1  1066 ? 25.554  -52.898  46.786  1.00 68.26  ? 1066 VAL A CG1   1 
ATOM   8236  C  CG2   . VAL A 1  1066 ? 28.044  -52.890  46.563  1.00 69.87  ? 1066 VAL A CG2   1 
ATOM   8237  N  N     . LEU A 1  1067 ? 25.552  -55.393  49.438  1.00 66.78  ? 1067 LEU A N     1 
ATOM   8238  C  CA    . LEU A 1  1067 ? 24.441  -56.028  50.132  1.00 66.39  ? 1067 LEU A CA    1 
ATOM   8239  C  C     . LEU A 1  1067 ? 24.273  -55.487  51.565  1.00 70.04  ? 1067 LEU A C     1 
ATOM   8240  O  O     . LEU A 1  1067 ? 23.243  -54.877  51.845  1.00 69.12  ? 1067 LEU A O     1 
ATOM   8241  C  CB    . LEU A 1  1067 ? 24.664  -57.539  50.175  1.00 67.06  ? 1067 LEU A CB    1 
ATOM   8242  C  CG    . LEU A 1  1067 ? 23.497  -58.452  49.843  1.00 71.95  ? 1067 LEU A CG    1 
ATOM   8243  C  CD1   . LEU A 1  1067 ? 23.929  -59.886  49.999  1.00 73.57  ? 1067 LEU A CD1   1 
ATOM   8244  C  CD2   . LEU A 1  1067 ? 22.280  -58.191  50.738  1.00 72.65  ? 1067 LEU A CD2   1 
ATOM   8245  N  N     . ALA A 1  1068 ? 25.291  -55.659  52.445  1.00 66.82  ? 1068 ALA A N     1 
ATOM   8246  C  CA    . ALA A 1  1068 ? 25.219  -55.194  53.834  1.00 66.31  ? 1068 ALA A CA    1 
ATOM   8247  C  C     . ALA A 1  1068 ? 24.856  -53.714  53.932  1.00 69.43  ? 1068 ALA A C     1 
ATOM   8248  O  O     . ALA A 1  1068 ? 23.910  -53.349  54.641  1.00 68.59  ? 1068 ALA A O     1 
ATOM   8249  C  CB    . ALA A 1  1068 ? 26.524  -55.471  54.564  1.00 67.44  ? 1068 ALA A CB    1 
ATOM   8250  N  N     . ALA A 1  1069 ? 25.565  -52.875  53.164  1.00 65.84  ? 1069 ALA A N     1 
ATOM   8251  C  CA    . ALA A 1  1069 ? 25.364  -51.431  53.170  1.00 65.14  ? 1069 ALA A CA    1 
ATOM   8252  C  C     . ALA A 1  1069 ? 23.925  -51.057  52.859  1.00 67.31  ? 1069 ALA A C     1 
ATOM   8253  O  O     . ALA A 1  1069 ? 23.319  -50.310  53.625  1.00 66.03  ? 1069 ALA A O     1 
ATOM   8254  C  CB    . ALA A 1  1069 ? 26.323  -50.762  52.201  1.00 66.24  ? 1069 ALA A CB    1 
ATOM   8255  N  N     . GLN A 1  1070 ? 23.365  -51.638  51.774  1.00 63.19  ? 1070 GLN A N     1 
ATOM   8256  C  CA    . GLN A 1  1070 ? 21.994  -51.417  51.303  1.00 61.89  ? 1070 GLN A CA    1 
ATOM   8257  C  C     . GLN A 1  1070 ? 20.986  -51.960  52.309  1.00 63.71  ? 1070 GLN A C     1 
ATOM   8258  O  O     . GLN A 1  1070 ? 19.959  -51.320  52.571  1.00 61.62  ? 1070 GLN A O     1 
ATOM   8259  C  CB    . GLN A 1  1070 ? 21.791  -52.117  49.958  1.00 63.55  ? 1070 GLN A CB    1 
ATOM   8260  C  CG    . GLN A 1  1070 ? 22.522  -51.472  48.791  1.00 82.00  ? 1070 GLN A CG    1 
ATOM   8261  C  CD    . GLN A 1  1070 ? 22.015  -51.969  47.462  1.00 96.74  ? 1070 GLN A CD    1 
ATOM   8262  O  OE1   . GLN A 1  1070 ? 21.595  -53.139  47.320  1.00 90.47  ? 1070 GLN A OE1   1 
ATOM   8263  N  NE2   . GLN A 1  1070 ? 22.033  -51.071  46.467  1.00 83.86  ? 1070 GLN A NE2   1 
ATOM   8264  N  N     . SER A 1  1071 ? 21.307  -53.142  52.880  1.00 60.45  ? 1071 SER A N     1 
ATOM   8265  C  CA    . SER A 1  1071 ? 20.498  -53.831  53.872  1.00 60.13  ? 1071 SER A CA    1 
ATOM   8266  C  C     . SER A 1  1071 ? 20.383  -53.042  55.167  1.00 64.78  ? 1071 SER A C     1 
ATOM   8267  O  O     . SER A 1  1071 ? 19.410  -53.235  55.877  1.00 65.32  ? 1071 SER A O     1 
ATOM   8268  C  CB    . SER A 1  1071 ? 21.023  -55.237  54.130  1.00 62.75  ? 1071 SER A CB    1 
ATOM   8269  O  OG    . SER A 1  1071 ? 21.123  -55.932  52.897  1.00 69.70  ? 1071 SER A OG    1 
ATOM   8270  N  N     . ILE A 1  1072 ? 21.336  -52.152  55.475  1.00 60.30  ? 1072 ILE A N     1 
ATOM   8271  C  CA    . ILE A 1  1072 ? 21.209  -51.314  56.670  1.00 60.18  ? 1072 ILE A CA    1 
ATOM   8272  C  C     . ILE A 1  1072 ? 20.597  -49.960  56.243  1.00 68.53  ? 1072 ILE A C     1 
ATOM   8273  O  O     . ILE A 1  1072 ? 19.686  -49.437  56.901  1.00 67.23  ? 1072 ILE A O     1 
ATOM   8274  C  CB    . ILE A 1  1072 ? 22.565  -51.150  57.403  1.00 62.19  ? 1072 ILE A CB    1 
ATOM   8275  C  CG1   . ILE A 1  1072 ? 23.152  -52.519  57.773  1.00 61.84  ? 1072 ILE A CG1   1 
ATOM   8276  C  CG2   . ILE A 1  1072 ? 22.415  -50.243  58.639  1.00 61.11  ? 1072 ILE A CG2   1 
ATOM   8277  C  CD1   . ILE A 1  1072 ? 24.606  -52.524  57.973  1.00 65.14  ? 1072 ILE A CD1   1 
ATOM   8278  N  N     . GLY A 1  1073 ? 21.109  -49.453  55.116  1.00 69.06  ? 1073 GLY A N     1 
ATOM   8279  C  CA    . GLY A 1  1073 ? 20.758  -48.190  54.479  1.00 70.13  ? 1073 GLY A CA    1 
ATOM   8280  C  C     . GLY A 1  1073 ? 19.303  -48.050  54.106  1.00 76.43  ? 1073 GLY A C     1 
ATOM   8281  O  O     . GLY A 1  1073 ? 18.701  -47.029  54.436  1.00 76.66  ? 1073 GLY A O     1 
ATOM   8282  N  N     . GLU A 1  1074 ? 18.727  -49.042  53.403  1.00 74.12  ? 1074 GLU A N     1 
ATOM   8283  C  CA    . GLU A 1  1074 ? 17.309  -48.950  53.081  1.00 74.71  ? 1074 GLU A CA    1 
ATOM   8284  C  C     . GLU A 1  1074 ? 16.475  -48.856  54.399  1.00 82.51  ? 1074 GLU A C     1 
ATOM   8285  O  O     . GLU A 1  1074 ? 15.876  -47.803  54.626  1.00 82.23  ? 1074 GLU A O     1 
ATOM   8286  C  CB    . GLU A 1  1074 ? 16.845  -50.056  52.131  1.00 75.75  ? 1074 GLU A CB    1 
ATOM   8287  C  CG    . GLU A 1  1074 ? 15.435  -49.824  51.610  1.00 84.55  ? 1074 GLU A CG    1 
ATOM   8288  C  CD    . GLU A 1  1074 ? 14.285  -50.401  52.425  1.00 98.99  ? 1074 GLU A CD    1 
ATOM   8289  O  OE1   . GLU A 1  1074 ? 14.534  -51.201  53.361  1.00 69.00  ? 1074 GLU A OE1   1 
ATOM   8290  O  OE2   . GLU A 1  1074 ? 13.120  -50.090  52.076  1.00 93.13  ? 1074 GLU A OE2   1 
ATOM   8291  N  N     . PRO A 1  1075 ? 16.517  -49.831  55.337  1.00 81.47  ? 1075 PRO A N     1 
ATOM   8292  C  CA    . PRO A 1  1075 ? 15.779  -49.660  56.601  1.00 82.33  ? 1075 PRO A CA    1 
ATOM   8293  C  C     . PRO A 1  1075 ? 16.020  -48.341  57.324  1.00 88.42  ? 1075 PRO A C     1 
ATOM   8294  O  O     . PRO A 1  1075 ? 15.140  -47.925  58.075  1.00 89.33  ? 1075 PRO A O     1 
ATOM   8295  C  CB    . PRO A 1  1075 ? 16.288  -50.811  57.456  1.00 84.42  ? 1075 PRO A CB    1 
ATOM   8296  C  CG    . PRO A 1  1075 ? 16.602  -51.856  56.477  1.00 88.81  ? 1075 PRO A CG    1 
ATOM   8297  C  CD    . PRO A 1  1075 ? 17.191  -51.143  55.304  1.00 83.75  ? 1075 PRO A CD    1 
ATOM   8298  N  N     . ALA A 1  1076 ? 17.189  -47.686  57.105  1.00 85.28  ? 1076 ALA A N     1 
ATOM   8299  C  CA    . ALA A 1  1076 ? 17.507  -46.398  57.739  1.00 85.69  ? 1076 ALA A CA    1 
ATOM   8300  C  C     . ALA A 1  1076 ? 16.538  -45.325  57.304  1.00 91.55  ? 1076 ALA A C     1 
ATOM   8301  O  O     . ALA A 1  1076 ? 16.041  -44.577  58.129  1.00 90.12  ? 1076 ALA A O     1 
ATOM   8302  C  CB    . ALA A 1  1076 ? 18.930  -45.973  57.413  1.00 86.47  ? 1076 ALA A CB    1 
ATOM   8303  N  N     . THR A 1  1077 ? 16.228  -45.296  56.009  1.00 92.12  ? 1077 THR A N     1 
ATOM   8304  C  CA    . THR A 1  1077 ? 15.334  -44.333  55.361  1.00 93.28  ? 1077 THR A CA    1 
ATOM   8305  C  C     . THR A 1  1077 ? 13.892  -44.432  55.867  1.00 102.38 ? 1077 THR A C     1 
ATOM   8306  O  O     . THR A 1  1077 ? 13.173  -43.435  55.851  1.00 102.16 ? 1077 THR A O     1 
ATOM   8307  C  CB    . THR A 1  1077 ? 15.428  -44.489  53.841  1.00 93.49  ? 1077 THR A CB    1 
ATOM   8308  O  OG1   . THR A 1  1077 ? 14.789  -45.711  53.458  1.00 92.85  ? 1077 THR A OG1   1 
ATOM   8309  C  CG2   . THR A 1  1077 ? 16.876  -44.463  53.326  1.00 87.43  ? 1077 THR A CG2   1 
ATOM   8310  N  N     . GLN A 1  1078 ? 13.495  -45.631  56.332  1.00 103.15 ? 1078 GLN A N     1 
ATOM   8311  C  CA    . GLN A 1  1078 ? 12.159  -45.974  56.828  1.00 105.08 ? 1078 GLN A CA    1 
ATOM   8312  C  C     . GLN A 1  1078 ? 11.932  -45.561  58.288  1.00 114.17 ? 1078 GLN A C     1 
ATOM   8313  O  O     . GLN A 1  1078 ? 10.869  -45.837  58.854  1.00 113.62 ? 1078 GLN A O     1 
ATOM   8314  C  CB    . GLN A 1  1078 ? 11.903  -47.486  56.645  1.00 106.41 ? 1078 GLN A CB    1 
ATOM   8315  C  CG    . GLN A 1  1078 ? 12.310  -48.045  55.283  1.00 123.34 ? 1078 GLN A CG    1 
ATOM   8316  C  CD    . GLN A 1  1078 ? 11.368  -47.606  54.195  1.00 147.66 ? 1078 GLN A CD    1 
ATOM   8317  O  OE1   . GLN A 1  1078 ? 10.315  -48.215  53.986  1.00 145.07 ? 1078 GLN A OE1   1 
ATOM   8318  N  NE2   . GLN A 1  1078 ? 11.717  -46.527  53.492  1.00 138.39 ? 1078 GLN A NE2   1 
ATOM   8319  N  N     . MET A 1  1079 ? 12.910  -44.884  58.887  1.00 115.33 ? 1079 MET A N     1 
ATOM   8320  C  CA    . MET A 1  1079 ? 12.807  -44.458  60.272  1.00 118.34 ? 1079 MET A CA    1 
ATOM   8321  C  C     . MET A 1  1079 ? 12.053  -43.127  60.413  1.00 131.99 ? 1079 MET A C     1 
ATOM   8322  O  O     . MET A 1  1079 ? 12.398  -42.133  59.760  1.00 131.26 ? 1079 MET A O     1 
ATOM   8323  C  CB    . MET A 1  1079 ? 14.177  -44.483  60.960  1.00 120.40 ? 1079 MET A CB    1 
ATOM   8324  C  CG    . MET A 1  1079 ? 14.909  -45.804  60.752  1.00 123.13 ? 1079 MET A CG    1 
ATOM   8325  S  SD    . MET A 1  1079 ? 16.148  -46.209  61.991  1.00 126.84 ? 1079 MET A SD    1 
ATOM   8326  C  CE    . MET A 1  1079 ? 17.536  -45.228  61.414  1.00 123.32 ? 1079 MET A CE    1 
ATOM   8327  N  N     . THR A 1  1080 ? 10.984  -43.147  61.242  1.00 136.33 ? 1080 THR A N     1 
ATOM   8328  C  CA    . THR A 1  1080 ? 10.036  -42.050  61.510  1.00 139.79 ? 1080 THR A CA    1 
ATOM   8329  C  C     . THR A 1  1080 ? 10.185  -41.509  62.947  1.00 150.34 ? 1080 THR A C     1 
ATOM   8330  O  O     . THR A 1  1080 ? 10.615  -42.263  63.828  1.00 150.03 ? 1080 THR A O     1 
ATOM   8331  C  CB    . THR A 1  1080 ? 8.593   -42.587  61.287  1.00 152.37 ? 1080 THR A CB    1 
ATOM   8332  O  OG1   . THR A 1  1080 ? 8.555   -43.406  60.115  1.00 152.95 ? 1080 THR A OG1   1 
ATOM   8333  C  CG2   . THR A 1  1080 ? 7.537   -41.479  61.185  1.00 152.63 ? 1080 THR A CG2   1 
ATOM   8334  N  N     . LEU A 1  1081 ? 9.798   -40.211  63.170  1.00 152.05 ? 1081 LEU A N     1 
ATOM   8335  C  CA    . LEU A 1  1081 ? 9.788   -39.451  64.445  1.00 155.00 ? 1081 LEU A CA    1 
ATOM   8336  C  C     . LEU A 1  1081 ? 10.894  -39.893  65.454  1.00 164.71 ? 1081 LEU A C     1 
ATOM   8337  O  O     . LEU A 1  1081 ? 10.609  -40.215  66.619  1.00 164.92 ? 1081 LEU A O     1 
ATOM   8338  C  CB    . LEU A 1  1081 ? 8.358   -39.480  65.071  1.00 155.48 ? 1081 LEU A CB    1 
ATOM   8339  C  CG    . LEU A 1  1081 ? 7.803   -38.238  65.839  1.00 160.46 ? 1081 LEU A CG    1 
ATOM   8340  C  CD1   . LEU A 1  1081 ? 8.193   -38.228  67.317  1.00 160.74 ? 1081 LEU A CD1   1 
ATOM   8341  C  CD2   . LEU A 1  1081 ? 8.051   -36.914  65.111  1.00 162.34 ? 1081 LEU A CD2   1 
ATOM   8342  N  N     . ASN A 1  1082 ? 12.163  -39.921  64.972  1.00 164.45 ? 1082 ASN A N     1 
ATOM   8343  C  CA    . ASN A 1  1082 ? 13.329  -40.370  65.742  1.00 165.56 ? 1082 ASN A CA    1 
ATOM   8344  C  C     . ASN A 1  1082 ? 14.067  -39.340  66.600  1.00 172.80 ? 1082 ASN A C     1 
ATOM   8345  O  O     . ASN A 1  1082 ? 14.979  -38.640  66.144  1.00 172.04 ? 1082 ASN A O     1 
ATOM   8346  C  CB    . ASN A 1  1082 ? 14.267  -41.283  64.936  1.00 164.80 ? 1082 ASN A CB    1 
ATOM   8347  C  CG    . ASN A 1  1082 ? 14.616  -40.807  63.548  1.00 178.65 ? 1082 ASN A CG    1 
ATOM   8348  O  OD1   . ASN A 1  1082 ? 15.381  -39.854  63.354  1.00 171.40 ? 1082 ASN A OD1   1 
ATOM   8349  N  ND2   . ASN A 1  1082 ? 14.084  -41.490  62.550  1.00 166.62 ? 1082 ASN A ND2   1 
ATOM   8350  N  N     . THR A 1  1083 ? 13.637  -39.275  67.866  1.00 172.62 ? 1083 THR A N     1 
ATOM   8351  C  CA    . THR A 1  1083 ? 14.164  -38.451  68.953  1.00 174.46 ? 1083 THR A CA    1 
ATOM   8352  C  C     . THR A 1  1083 ? 14.266  -39.416  70.140  1.00 180.89 ? 1083 THR A C     1 
ATOM   8353  O  O     . THR A 1  1083 ? 15.370  -39.799  70.542  1.00 179.86 ? 1083 THR A O     1 
ATOM   8354  C  CB    . THR A 1  1083 ? 13.241  -37.231  69.241  1.00 183.73 ? 1083 THR A CB    1 
ATOM   8355  O  OG1   . THR A 1  1083 ? 11.887  -37.671  69.413  1.00 183.02 ? 1083 THR A OG1   1 
ATOM   8356  C  CG2   . THR A 1  1083 ? 13.324  -36.148  68.161  1.00 182.07 ? 1083 THR A CG2   1 
ATOM   8357  N  N     . PHE A 1  1084 ? 13.093  -39.857  70.645  1.00 180.14 ? 1084 PHE A N     1 
ATOM   8358  C  CA    . PHE A 1  1084 ? 12.923  -40.820  71.730  1.00 181.37 ? 1084 PHE A CA    1 
ATOM   8359  C  C     . PHE A 1  1084 ? 11.623  -41.612  71.506  1.00 186.25 ? 1084 PHE A C     1 
ATOM   8360  O  O     . PHE A 1  1084 ? 10.565  -41.030  71.239  1.00 185.93 ? 1084 PHE A O     1 
ATOM   8361  C  CB    . PHE A 1  1084 ? 12.899  -40.144  73.125  1.00 184.53 ? 1084 PHE A CB    1 
ATOM   8362  C  CG    . PHE A 1  1084 ? 14.006  -39.165  73.449  1.00 186.83 ? 1084 PHE A CG    1 
ATOM   8363  C  CD1   . PHE A 1  1084 ? 13.762  -37.796  73.467  1.00 190.85 ? 1084 PHE A CD1   1 
ATOM   8364  C  CD2   . PHE A 1  1084 ? 15.283  -39.611  73.767  1.00 189.09 ? 1084 PHE A CD2   1 
ATOM   8365  C  CE1   . PHE A 1  1084 ? 14.783  -36.889  73.772  1.00 192.37 ? 1084 PHE A CE1   1 
ATOM   8366  C  CE2   . PHE A 1  1084 ? 16.308  -38.702  74.048  1.00 192.57 ? 1084 PHE A CE2   1 
ATOM   8367  C  CZ    . PHE A 1  1084 ? 16.048  -37.349  74.065  1.00 191.37 ? 1084 PHE A CZ    1 
ATOM   8368  N  N     . HIS A 1  1085 ? 11.736  -42.945  71.594  1.00 183.32 ? 1085 HIS A N     1 
ATOM   8369  C  CA    . HIS A 1  1085 ? 10.666  -43.941  71.488  1.00 183.33 ? 1085 HIS A CA    1 
ATOM   8370  C  C     . HIS A 1  1085 ? 10.980  -45.059  72.502  1.00 188.04 ? 1085 HIS A C     1 
ATOM   8371  O  O     . HIS A 1  1085 ? 10.094  -45.833  72.870  1.00 188.01 ? 1085 HIS A O     1 
ATOM   8372  C  CB    . HIS A 1  1085 ? 10.550  -44.494  70.051  1.00 183.25 ? 1085 HIS A CB    1 
ATOM   8373  C  CG    . HIS A 1  1085 ? 9.595   -43.735  69.174  1.00 186.51 ? 1085 HIS A CG    1 
ATOM   8374  N  ND1   . HIS A 1  1085 ? 8.344   -44.239  68.863  1.00 188.26 ? 1085 HIS A ND1   1 
ATOM   8375  C  CD2   . HIS A 1  1085 ? 9.746   -42.538  68.560  1.00 188.13 ? 1085 HIS A CD2   1 
ATOM   8376  C  CE1   . HIS A 1  1085 ? 7.775   -43.335  68.081  1.00 187.60 ? 1085 HIS A CE1   1 
ATOM   8377  N  NE2   . HIS A 1  1085 ? 8.579   -42.293  67.872  1.00 187.84 ? 1085 HIS A NE2   1 
ATOM   8378  N  N     . PHE A 1  1086 ? 12.250  -45.092  72.983  1.00 184.76 ? 1086 PHE A N     1 
ATOM   8379  C  CA    . PHE A 1  1086 ? 12.804  -46.017  73.984  1.00 184.79 ? 1086 PHE A CA    1 
ATOM   8380  C  C     . PHE A 1  1086 ? 12.691  -45.394  75.411  1.00 188.98 ? 1086 PHE A C     1 
ATOM   8381  O  O     . PHE A 1  1086 ? 13.533  -45.660  76.278  1.00 188.48 ? 1086 PHE A O     1 
ATOM   8382  C  CB    . PHE A 1  1086 ? 14.284  -46.310  73.638  1.00 186.16 ? 1086 PHE A CB    1 
ATOM   8383  C  CG    . PHE A 1  1086 ? 14.650  -47.735  73.282  1.00 187.15 ? 1086 PHE A CG    1 
ATOM   8384  C  CD1   . PHE A 1  1086 ? 14.836  -48.113  71.957  1.00 189.32 ? 1086 PHE A CD1   1 
ATOM   8385  C  CD2   . PHE A 1  1086 ? 14.888  -48.679  74.275  1.00 189.57 ? 1086 PHE A CD2   1 
ATOM   8386  C  CE1   . PHE A 1  1086 ? 15.213  -49.421  71.630  1.00 189.83 ? 1086 PHE A CE1   1 
ATOM   8387  C  CE2   . PHE A 1  1086 ? 15.260  -49.987  73.946  1.00 191.99 ? 1086 PHE A CE2   1 
ATOM   8388  C  CZ    . PHE A 1  1086 ? 15.419  -50.349  72.626  1.00 189.29 ? 1086 PHE A CZ    1 
ATOM   8389  N  N     . ALA A 1  1087 ? 11.640  -44.566  75.639  1.00 185.86 ? 1087 ALA A N     1 
ATOM   8390  C  CA    . ALA A 1  1087 ? 11.384  -43.866  76.904  1.00 186.40 ? 1087 ALA A CA    1 
ATOM   8391  C  C     . ALA A 1  1087 ? 9.896   -43.805  77.295  1.00 189.58 ? 1087 ALA A C     1 
ATOM   8392  O  O     . ALA A 1  1087 ? 9.016   -43.768  76.430  1.00 188.80 ? 1087 ALA A O     1 
ATOM   8393  C  CB    . ALA A 1  1087 ? 11.962  -42.455  76.848  1.00 187.40 ? 1087 ALA A CB    1 
ATOM   8394  N  N     . GLY A 1  1088 ? 9.657   -43.776  78.607  1.00 185.85 ? 1088 GLY A N     1 
ATOM   8395  C  CA    . GLY A 1  1088 ? 8.341   -43.678  79.228  1.00 185.84 ? 1088 GLY A CA    1 
ATOM   8396  C  C     . GLY A 1  1088 ? 8.320   -42.664  80.360  1.00 189.04 ? 1088 GLY A C     1 
ATOM   8397  O  O     . GLY A 1  1088 ? 7.314   -41.972  80.557  1.00 189.36 ? 1088 GLY A O     1 
ATOM   8398  N  N     . VAL A 1  1089 ? 9.451   -42.568  81.107  1.00 184.06 ? 1089 VAL A N     1 
ATOM   8399  C  CA    . VAL A 1  1089 ? 9.669   -41.654  82.242  1.00 183.84 ? 1089 VAL A CA    1 
ATOM   8400  C  C     . VAL A 1  1089 ? 10.469  -40.410  81.747  1.00 184.86 ? 1089 VAL A C     1 
ATOM   8401  O  O     . VAL A 1  1089 ? 9.926   -39.620  80.969  1.00 184.42 ? 1089 VAL A O     1 
ATOM   8402  C  CB    . VAL A 1  1089 ? 10.320  -42.352  83.487  1.00 188.08 ? 1089 VAL A CB    1 
ATOM   8403  C  CG1   . VAL A 1  1089 ? 9.847   -41.705  84.784  1.00 189.23 ? 1089 VAL A CG1   1 
ATOM   8404  C  CG2   . VAL A 1  1089 ? 10.050  -43.858  83.517  1.00 187.51 ? 1089 VAL A CG2   1 
ATOM   8405  N  N     . ALA A 1  1090 ? 11.750  -40.254  82.176  1.00 179.00 ? 1090 ALA A N     1 
ATOM   8406  C  CA    . ALA A 1  1090 ? 12.676  -39.171  81.795  1.00 177.42 ? 1090 ALA A CA    1 
ATOM   8407  C  C     . ALA A 1  1090 ? 14.138  -39.631  81.920  1.00 177.48 ? 1090 ALA A C     1 
ATOM   8408  O  O     . ALA A 1  1090 ? 15.020  -39.071  81.259  1.00 176.80 ? 1090 ALA A O     1 
ATOM   8409  C  CB    . ALA A 1  1090 ? 12.441  -37.936  82.655  1.00 179.42 ? 1090 ALA A CB    1 
ATOM   8410  N  N     . SER A 1  1091 ? 14.374  -40.656  82.779  1.00 170.96 ? 1091 SER A N     1 
ATOM   8411  C  CA    . SER A 1  1091 ? 15.661  -41.298  83.081  1.00 168.74 ? 1091 SER A CA    1 
ATOM   8412  C  C     . SER A 1  1091 ? 16.245  -42.060  81.879  1.00 166.68 ? 1091 SER A C     1 
ATOM   8413  O  O     . SER A 1  1091 ? 17.466  -42.049  81.688  1.00 165.62 ? 1091 SER A O     1 
ATOM   8414  C  CB    . SER A 1  1091 ? 15.504  -42.239  84.275  1.00 172.48 ? 1091 SER A CB    1 
ATOM   8415  O  OG    . SER A 1  1091 ? 16.589  -43.141  84.417  1.00 179.92 ? 1091 SER A OG    1 
ATOM   8416  N  N     . LYS A 1  1092 ? 15.370  -42.739  81.098  1.00 158.97 ? 1092 LYS A N     1 
ATOM   8417  C  CA    . LYS A 1  1092 ? 15.724  -43.543  79.919  1.00 155.68 ? 1092 LYS A CA    1 
ATOM   8418  C  C     . LYS A 1  1092 ? 15.547  -42.765  78.584  1.00 153.44 ? 1092 LYS A C     1 
ATOM   8419  O  O     . LYS A 1  1092 ? 15.098  -43.335  77.578  1.00 152.49 ? 1092 LYS A O     1 
ATOM   8420  C  CB    . LYS A 1  1092 ? 14.967  -44.895  79.925  1.00 157.85 ? 1092 LYS A CB    1 
ATOM   8421  C  CG    . LYS A 1  1092 ? 15.378  -45.835  81.064  1.00 171.52 ? 1092 LYS A CG    1 
ATOM   8422  C  CD    . LYS A 1  1092 ? 14.565  -47.137  81.105  1.00 181.14 ? 1092 LYS A CD    1 
ATOM   8423  C  CE    . LYS A 1  1092 ? 15.252  -48.291  80.406  1.00 189.86 ? 1092 LYS A CE    1 
ATOM   8424  N  NZ    . LYS A 1  1092 ? 14.595  -49.593  80.701  1.00 196.68 ? 1092 LYS A NZ    1 
ATOM   8425  N  N     . LYS A 1  1093 ? 15.945  -41.466  78.582  1.00 145.25 ? 1093 LYS A N     1 
ATOM   8426  C  CA    . LYS A 1  1093 ? 15.877  -40.569  77.421  1.00 141.83 ? 1093 LYS A CA    1 
ATOM   8427  C  C     . LYS A 1  1093 ? 17.244  -40.423  76.708  1.00 138.18 ? 1093 LYS A C     1 
ATOM   8428  O  O     . LYS A 1  1093 ? 17.916  -39.393  76.819  1.00 137.56 ? 1093 LYS A O     1 
ATOM   8429  C  CB    . LYS A 1  1093 ? 15.262  -39.206  77.808  1.00 144.96 ? 1093 LYS A CB    1 
ATOM   8430  C  CG    . LYS A 1  1093 ? 13.743  -39.224  77.962  1.00 152.47 ? 1093 LYS A CG    1 
ATOM   8431  C  CD    . LYS A 1  1093 ? 13.200  -37.840  78.296  1.00 157.63 ? 1093 LYS A CD    1 
ATOM   8432  C  CE    . LYS A 1  1093 ? 11.695  -37.823  78.378  1.00 160.80 ? 1093 LYS A CE    1 
ATOM   8433  N  NZ    . LYS A 1  1093 ? 11.192  -36.544  78.937  1.00 166.08 ? 1093 LYS A NZ    1 
ATOM   8434  N  N     . VAL A 1  1094 ? 17.639  -41.469  75.966  1.00 129.31 ? 1094 VAL A N     1 
ATOM   8435  C  CA    . VAL A 1  1094 ? 18.893  -41.496  75.203  1.00 126.45 ? 1094 VAL A CA    1 
ATOM   8436  C  C     . VAL A 1  1094 ? 18.633  -41.254  73.718  1.00 125.24 ? 1094 VAL A C     1 
ATOM   8437  O  O     . VAL A 1  1094 ? 17.603  -41.693  73.196  1.00 123.87 ? 1094 VAL A O     1 
ATOM   8438  C  CB    . VAL A 1  1094 ? 19.769  -42.764  75.435  1.00 129.32 ? 1094 VAL A CB    1 
ATOM   8439  C  CG1   . VAL A 1  1094 ? 20.493  -42.707  76.772  1.00 129.73 ? 1094 VAL A CG1   1 
ATOM   8440  C  CG2   . VAL A 1  1094 ? 18.961  -44.050  75.301  1.00 128.49 ? 1094 VAL A CG2   1 
ATOM   8441  N  N     . THR A 1  1095 ? 19.579  -40.560  73.045  1.00 118.73 ? 1095 THR A N     1 
ATOM   8442  C  CA    . THR A 1  1095 ? 19.543  -40.231  71.613  1.00 116.23 ? 1095 THR A CA    1 
ATOM   8443  C  C     . THR A 1  1095 ? 19.333  -41.489  70.757  1.00 116.99 ? 1095 THR A C     1 
ATOM   8444  O  O     . THR A 1  1095 ? 20.046  -42.474  70.941  1.00 116.63 ? 1095 THR A O     1 
ATOM   8445  C  CB    . THR A 1  1095 ? 20.770  -39.377  71.200  1.00 115.97 ? 1095 THR A CB    1 
ATOM   8446  O  OG1   . THR A 1  1095 ? 21.994  -40.020  71.580  1.00 108.30 ? 1095 THR A OG1   1 
ATOM   8447  C  CG2   . THR A 1  1095 ? 20.716  -37.963  71.779  1.00 115.38 ? 1095 THR A CG2   1 
ATOM   8448  N  N     . SER A 1  1096 ? 18.318  -41.486  69.882  1.00 110.64 ? 1096 SER A N     1 
ATOM   8449  C  CA    . SER A 1  1096 ? 18.026  -42.657  69.056  1.00 108.51 ? 1096 SER A CA    1 
ATOM   8450  C  C     . SER A 1  1096 ? 17.976  -42.323  67.560  1.00 108.07 ? 1096 SER A C     1 
ATOM   8451  O  O     . SER A 1  1096 ? 18.546  -41.312  67.145  1.00 107.11 ? 1096 SER A O     1 
ATOM   8452  C  CB    . SER A 1  1096 ? 16.746  -43.344  69.531  1.00 112.76 ? 1096 SER A CB    1 
ATOM   8453  O  OG    . SER A 1  1096 ? 15.589  -42.572  69.251  1.00 123.70 ? 1096 SER A OG    1 
ATOM   8454  N  N     . GLY A 1  1097 ? 17.346  -43.210  66.783  1.00 101.48 ? 1097 GLY A N     1 
ATOM   8455  C  CA    . GLY A 1  1097 ? 17.143  -43.113  65.343  1.00 99.35  ? 1097 GLY A CA    1 
ATOM   8456  C  C     . GLY A 1  1097 ? 18.329  -42.708  64.497  1.00 99.91  ? 1097 GLY A C     1 
ATOM   8457  O  O     . GLY A 1  1097 ? 19.462  -43.108  64.768  1.00 99.85  ? 1097 GLY A O     1 
ATOM   8458  N  N     . VAL A 1  1098 ? 18.058  -41.913  63.452  1.00 93.83  ? 1098 VAL A N     1 
ATOM   8459  C  CA    . VAL A 1  1098 ? 19.056  -41.405  62.502  1.00 91.99  ? 1098 VAL A CA    1 
ATOM   8460  C  C     . VAL A 1  1098 ? 20.119  -40.523  63.199  1.00 94.89  ? 1098 VAL A C     1 
ATOM   8461  O  O     . VAL A 1  1098 ? 21.303  -40.736  62.932  1.00 95.82  ? 1098 VAL A O     1 
ATOM   8462  C  CB    . VAL A 1  1098 ? 18.431  -40.743  61.248  1.00 93.92  ? 1098 VAL A CB    1 
ATOM   8463  C  CG1   . VAL A 1  1098 ? 19.471  -40.538  60.152  1.00 92.98  ? 1098 VAL A CG1   1 
ATOM   8464  C  CG2   . VAL A 1  1098 ? 17.267  -41.572  60.728  1.00 93.04  ? 1098 VAL A CG2   1 
ATOM   8465  N  N     . PRO A 1  1099 ? 19.779  -39.603  64.136  1.00 88.95  ? 1099 PRO A N     1 
ATOM   8466  C  CA    . PRO A 1  1099 ? 20.847  -38.833  64.793  1.00 88.54  ? 1099 PRO A CA    1 
ATOM   8467  C  C     . PRO A 1  1099 ? 21.856  -39.705  65.549  1.00 88.48  ? 1099 PRO A C     1 
ATOM   8468  O  O     . PRO A 1  1099 ? 23.047  -39.380  65.519  1.00 89.03  ? 1099 PRO A O     1 
ATOM   8469  C  CB    . PRO A 1  1099 ? 20.093  -37.875  65.717  1.00 91.32  ? 1099 PRO A CB    1 
ATOM   8470  C  CG    . PRO A 1  1099 ? 18.723  -38.440  65.858  1.00 95.55  ? 1099 PRO A CG    1 
ATOM   8471  C  CD    . PRO A 1  1099 ? 18.443  -39.176  64.604  1.00 90.45  ? 1099 PRO A CD    1 
ATOM   8472  N  N     . ARG A 1  1100 ? 21.397  -40.821  66.188  1.00 80.17  ? 1100 ARG A N     1 
ATOM   8473  C  CA    . ARG A 1  1100 ? 22.287  -41.753  66.886  1.00 77.91  ? 1100 ARG A CA    1 
ATOM   8474  C  C     . ARG A 1  1100 ? 23.087  -42.518  65.864  1.00 79.19  ? 1100 ARG A C     1 
ATOM   8475  O  O     . ARG A 1  1100 ? 24.300  -42.577  65.995  1.00 78.65  ? 1100 ARG A O     1 
ATOM   8476  C  CB    . ARG A 1  1100 ? 21.523  -42.736  67.787  1.00 75.26  ? 1100 ARG A CB    1 
ATOM   8477  C  CG    . ARG A 1  1100 ? 22.403  -43.839  68.396  1.00 83.17  ? 1100 ARG A CG    1 
ATOM   8478  C  CD    . ARG A 1  1100 ? 23.049  -43.434  69.714  1.00 93.60  ? 1100 ARG A CD    1 
ATOM   8479  N  NE    . ARG A 1  1100 ? 24.146  -44.320  70.117  1.00 96.62  ? 1100 ARG A NE    1 
ATOM   8480  C  CZ    . ARG A 1  1100 ? 25.411  -43.931  70.247  1.00 109.22 ? 1100 ARG A CZ    1 
ATOM   8481  N  NH1   . ARG A 1  1100 ? 25.753  -42.671  70.006  1.00 103.57 ? 1100 ARG A NH1   1 
ATOM   8482  N  NH2   . ARG A 1  1100 ? 26.342  -44.794  70.624  1.00 90.37  ? 1100 ARG A NH2   1 
ATOM   8483  N  N     . LEU A 1  1101 ? 22.410  -43.102  64.842  1.00 74.59  ? 1101 LEU A N     1 
ATOM   8484  C  CA    . LEU A 1  1101 ? 23.042  -43.870  63.766  1.00 73.78  ? 1101 LEU A CA    1 
ATOM   8485  C  C     . LEU A 1  1101 ? 24.147  -43.044  63.147  1.00 76.74  ? 1101 LEU A C     1 
ATOM   8486  O  O     . LEU A 1  1101 ? 25.202  -43.592  62.843  1.00 77.22  ? 1101 LEU A O     1 
ATOM   8487  C  CB    . LEU A 1  1101 ? 22.018  -44.320  62.700  1.00 73.38  ? 1101 LEU A CB    1 
ATOM   8488  C  CG    . LEU A 1  1101 ? 22.555  -45.144  61.489  1.00 77.71  ? 1101 LEU A CG    1 
ATOM   8489  C  CD1   . LEU A 1  1101 ? 22.962  -46.566  61.888  1.00 76.98  ? 1101 LEU A CD1   1 
ATOM   8490  C  CD2   . LEU A 1  1101 ? 21.539  -45.191  60.364  1.00 79.39  ? 1101 LEU A CD2   1 
ATOM   8491  N  N     . LYS A 1  1102 ? 23.935  -41.714  63.047  1.00 71.86  ? 1102 LYS A N     1 
ATOM   8492  C  CA    . LYS A 1  1102 ? 24.927  -40.779  62.537  1.00 71.13  ? 1102 LYS A CA    1 
ATOM   8493  C  C     . LYS A 1  1102 ? 26.081  -40.750  63.517  1.00 72.79  ? 1102 LYS A C     1 
ATOM   8494  O  O     . LYS A 1  1102 ? 27.200  -41.029  63.100  1.00 72.36  ? 1102 LYS A O     1 
ATOM   8495  C  CB    . LYS A 1  1102 ? 24.336  -39.376  62.279  1.00 73.72  ? 1102 LYS A CB    1 
ATOM   8496  C  CG    . LYS A 1  1102 ? 25.063  -38.598  61.171  1.00 92.40  ? 1102 LYS A CG    1 
ATOM   8497  C  CD    . LYS A 1  1102 ? 24.792  -37.077  61.235  1.00 110.34 ? 1102 LYS A CD    1 
ATOM   8498  C  CE    . LYS A 1  1102 ? 25.725  -36.238  60.377  1.00 122.68 ? 1102 LYS A CE    1 
ATOM   8499  N  NZ    . LYS A 1  1102 ? 25.992  -34.893  60.975  1.00 128.06 ? 1102 LYS A NZ    1 
ATOM   8500  N  N     . GLU A 1  1103 ? 25.806  -40.553  64.830  1.00 68.75  ? 1103 GLU A N     1 
ATOM   8501  C  CA    . GLU A 1  1103 ? 26.853  -40.551  65.876  1.00 68.88  ? 1103 GLU A CA    1 
ATOM   8502  C  C     . GLU A 1  1103 ? 27.725  -41.811  65.741  1.00 73.24  ? 1103 GLU A C     1 
ATOM   8503  O  O     . GLU A 1  1103 ? 28.955  -41.688  65.672  1.00 75.38  ? 1103 GLU A O     1 
ATOM   8504  C  CB    . GLU A 1  1103 ? 26.264  -40.495  67.304  1.00 69.84  ? 1103 GLU A CB    1 
ATOM   8505  C  CG    . GLU A 1  1103 ? 25.509  -39.232  67.646  1.00 79.32  ? 1103 GLU A CG    1 
ATOM   8506  C  CD    . GLU A 1  1103 ? 25.381  -38.958  69.132  1.00 115.34 ? 1103 GLU A CD    1 
ATOM   8507  O  OE1   . GLU A 1  1103 ? 24.749  -39.773  69.848  1.00 110.81 ? 1103 GLU A OE1   1 
ATOM   8508  O  OE2   . GLU A 1  1103 ? 25.909  -37.912  69.578  1.00 119.35 ? 1103 GLU A OE2   1 
ATOM   8509  N  N     . ILE A 1  1104 ? 27.073  -43.011  65.640  1.00 65.67  ? 1104 ILE A N     1 
ATOM   8510  C  CA    . ILE A 1  1104 ? 27.732  -44.311  65.523  1.00 63.32  ? 1104 ILE A CA    1 
ATOM   8511  C  C     . ILE A 1  1104 ? 28.692  -44.349  64.328  1.00 67.61  ? 1104 ILE A C     1 
ATOM   8512  O  O     . ILE A 1  1104 ? 29.897  -44.482  64.527  1.00 66.95  ? 1104 ILE A O     1 
ATOM   8513  C  CB    . ILE A 1  1104 ? 26.756  -45.528  65.591  1.00 64.42  ? 1104 ILE A CB    1 
ATOM   8514  C  CG1   . ILE A 1  1104 ? 25.761  -45.415  66.770  1.00 63.45  ? 1104 ILE A CG1   1 
ATOM   8515  C  CG2   . ILE A 1  1104 ? 27.556  -46.799  65.731  1.00 65.44  ? 1104 ILE A CG2   1 
ATOM   8516  C  CD1   . ILE A 1  1104 ? 24.693  -46.579  66.940  1.00 57.12  ? 1104 ILE A CD1   1 
ATOM   8517  N  N     . LEU A 1  1105 ? 28.166  -44.164  63.110  1.00 65.84  ? 1105 LEU A N     1 
ATOM   8518  C  CA    . LEU A 1  1105 ? 28.936  -44.192  61.853  1.00 66.55  ? 1105 LEU A CA    1 
ATOM   8519  C  C     . LEU A 1  1105 ? 30.053  -43.157  61.774  1.00 73.04  ? 1105 LEU A C     1 
ATOM   8520  O  O     . LEU A 1  1105 ? 31.093  -43.435  61.180  1.00 73.04  ? 1105 LEU A O     1 
ATOM   8521  C  CB    . LEU A 1  1105 ? 28.028  -44.116  60.599  1.00 65.61  ? 1105 LEU A CB    1 
ATOM   8522  C  CG    . LEU A 1  1105 ? 26.859  -45.105  60.512  1.00 68.37  ? 1105 LEU A CG    1 
ATOM   8523  C  CD1   . LEU A 1  1105 ? 25.798  -44.588  59.616  1.00 67.88  ? 1105 LEU A CD1   1 
ATOM   8524  C  CD2   . LEU A 1  1105 ? 27.298  -46.457  60.069  1.00 68.99  ? 1105 LEU A CD2   1 
ATOM   8525  N  N     . ASN A 1  1106 ? 29.849  -41.985  62.389  1.00 71.35  ? 1106 ASN A N     1 
ATOM   8526  C  CA    . ASN A 1  1106 ? 30.849  -40.917  62.399  1.00 72.91  ? 1106 ASN A CA    1 
ATOM   8527  C  C     . ASN A 1  1106 ? 31.898  -41.183  63.454  1.00 78.97  ? 1106 ASN A C     1 
ATOM   8528  O  O     . ASN A 1  1106 ? 32.929  -40.494  63.476  1.00 79.09  ? 1106 ASN A O     1 
ATOM   8529  C  CB    . ASN A 1  1106 ? 30.202  -39.553  62.693  1.00 74.55  ? 1106 ASN A CB    1 
ATOM   8530  C  CG    . ASN A 1  1106 ? 29.196  -39.063  61.683  1.00 90.98  ? 1106 ASN A CG    1 
ATOM   8531  O  OD1   . ASN A 1  1106 ? 29.220  -39.415  60.494  1.00 78.28  ? 1106 ASN A OD1   1 
ATOM   8532  N  ND2   . ASN A 1  1106 ? 28.287  -38.222  62.155  1.00 82.02  ? 1106 ASN A ND2   1 
ATOM   8533  N  N     . VAL A 1  1107 ? 31.620  -42.164  64.357  1.00 76.76  ? 1107 VAL A N     1 
ATOM   8534  C  CA    . VAL A 1  1107 ? 32.456  -42.515  65.513  1.00 77.70  ? 1107 VAL A CA    1 
ATOM   8535  C  C     . VAL A 1  1107 ? 32.731  -41.178  66.208  1.00 82.88  ? 1107 VAL A C     1 
ATOM   8536  O  O     . VAL A 1  1107 ? 33.863  -40.684  66.256  1.00 82.88  ? 1107 VAL A O     1 
ATOM   8537  C  CB    . VAL A 1  1107 ? 33.729  -43.337  65.161  1.00 82.41  ? 1107 VAL A CB    1 
ATOM   8538  C  CG1   . VAL A 1  1107 ? 34.293  -44.018  66.399  1.00 82.88  ? 1107 VAL A CG1   1 
ATOM   8539  C  CG2   . VAL A 1  1107 ? 33.428  -44.381  64.095  1.00 81.67  ? 1107 VAL A CG2   1 
ATOM   8540  N  N     . ALA A 1  1108 ? 31.621  -40.547  66.613  1.00 80.67  ? 1108 ALA A N     1 
ATOM   8541  C  CA    . ALA A 1  1108 ? 31.555  -39.223  67.198  1.00 82.61  ? 1108 ALA A CA    1 
ATOM   8542  C  C     . ALA A 1  1108 ? 32.170  -39.161  68.580  1.00 90.09  ? 1108 ALA A C     1 
ATOM   8543  O  O     . ALA A 1  1108 ? 31.578  -39.641  69.553  1.00 89.82  ? 1108 ALA A O     1 
ATOM   8544  C  CB    . ALA A 1  1108 ? 30.113  -38.741  67.221  1.00 83.07  ? 1108 ALA A CB    1 
ATOM   8545  N  N     . LYS A 1  1109 ? 33.365  -38.551  68.659  1.00 89.48  ? 1109 LYS A N     1 
ATOM   8546  C  CA    . LYS A 1  1109 ? 34.162  -38.388  69.885  1.00 91.11  ? 1109 LYS A CA    1 
ATOM   8547  C  C     . LYS A 1  1109 ? 33.326  -37.799  71.040  1.00 96.49  ? 1109 LYS A C     1 
ATOM   8548  O  O     . LYS A 1  1109 ? 33.320  -38.325  72.161  1.00 95.85  ? 1109 LYS A O     1 
ATOM   8549  C  CB    . LYS A 1  1109 ? 35.401  -37.517  69.585  1.00 94.80  ? 1109 LYS A CB    1 
ATOM   8550  C  CG    . LYS A 1  1109 ? 36.266  -37.999  68.395  1.00 105.01 ? 1109 LYS A CG    1 
ATOM   8551  C  CD    . LYS A 1  1109 ? 37.046  -39.305  68.648  1.00 112.72 ? 1109 LYS A CD    1 
ATOM   8552  C  CE    . LYS A 1  1109 ? 38.167  -39.191  69.671  1.00 121.06 ? 1109 LYS A CE    1 
ATOM   8553  N  NZ    . LYS A 1  1109 ? 37.698  -39.416  71.071  1.00 121.04 ? 1109 LYS A NZ    1 
ATOM   8554  N  N     . ASN A 1  1110 ? 32.565  -36.746  70.697  1.00 94.43  ? 1110 ASN A N     1 
ATOM   8555  C  CA    . ASN A 1  1110 ? 31.635  -35.956  71.504  1.00 94.83  ? 1110 ASN A CA    1 
ATOM   8556  C  C     . ASN A 1  1110 ? 30.203  -36.460  71.254  1.00 96.11  ? 1110 ASN A C     1 
ATOM   8557  O  O     . ASN A 1  1110 ? 29.519  -36.009  70.329  1.00 94.79  ? 1110 ASN A O     1 
ATOM   8558  C  CB    . ASN A 1  1110 ? 31.765  -34.471  71.104  1.00 100.20 ? 1110 ASN A CB    1 
ATOM   8559  C  CG    . ASN A 1  1110 ? 32.156  -34.275  69.644  1.00 131.06 ? 1110 ASN A CG    1 
ATOM   8560  O  OD1   . ASN A 1  1110 ? 33.333  -34.073  69.322  1.00 131.21 ? 1110 ASN A OD1   1 
ATOM   8561  N  ND2   . ASN A 1  1110 ? 31.202  -34.436  68.724  1.00 117.89 ? 1110 ASN A ND2   1 
ATOM   8562  N  N     . MET A 1  1111 ? 29.772  -37.423  72.071  1.00 91.89  ? 1111 MET A N     1 
ATOM   8563  C  CA    . MET A 1  1111 ? 28.450  -38.047  72.023  1.00 90.53  ? 1111 MET A CA    1 
ATOM   8564  C  C     . MET A 1  1111 ? 27.369  -37.041  72.430  1.00 94.14  ? 1111 MET A C     1 
ATOM   8565  O  O     . MET A 1  1111 ? 27.662  -35.858  72.616  1.00 95.39  ? 1111 MET A O     1 
ATOM   8566  C  CB    . MET A 1  1111 ? 28.423  -39.209  73.023  1.00 92.84  ? 1111 MET A CB    1 
ATOM   8567  C  CG    . MET A 1  1111 ? 28.708  -40.559  72.437  1.00 95.67  ? 1111 MET A CG    1 
ATOM   8568  S  SD    . MET A 1  1111 ? 27.960  -41.835  73.483  1.00 99.51  ? 1111 MET A SD    1 
ATOM   8569  C  CE    . MET A 1  1111 ? 26.201  -41.425  73.283  1.00 95.98  ? 1111 MET A CE    1 
ATOM   8570  N  N     . LYS A 1  1112 ? 26.130  -37.511  72.604  1.00 88.94  ? 1112 LYS A N     1 
ATOM   8571  C  CA    . LYS A 1  1112 ? 25.037  -36.645  73.038  1.00 88.84  ? 1112 LYS A CA    1 
ATOM   8572  C  C     . LYS A 1  1112 ? 24.446  -37.159  74.334  1.00 91.18  ? 1112 LYS A C     1 
ATOM   8573  O  O     . LYS A 1  1112 ? 24.127  -36.365  75.211  1.00 91.11  ? 1112 LYS A O     1 
ATOM   8574  C  CB    . LYS A 1  1112 ? 23.953  -36.528  71.965  1.00 91.36  ? 1112 LYS A CB    1 
ATOM   8575  C  CG    . LYS A 1  1112 ? 23.933  -35.203  71.230  1.00 111.27 ? 1112 LYS A CG    1 
ATOM   8576  C  CD    . LYS A 1  1112 ? 22.933  -35.230  70.078  1.00 126.55 ? 1112 LYS A CD    1 
ATOM   8577  C  CE    . LYS A 1  1112 ? 23.567  -35.626  68.758  1.00 143.11 ? 1112 LYS A CE    1 
ATOM   8578  N  NZ    . LYS A 1  1112 ? 22.555  -35.868  67.691  1.00 151.87 ? 1112 LYS A NZ    1 
ATOM   8579  N  N     . THR A 1  1113 ? 24.294  -38.480  74.459  1.00 86.82  ? 1113 THR A N     1 
ATOM   8580  C  CA    . THR A 1  1113 ? 23.744  -39.077  75.676  1.00 86.74  ? 1113 THR A CA    1 
ATOM   8581  C  C     . THR A 1  1113 ? 24.707  -40.148  76.223  1.00 90.33  ? 1113 THR A C     1 
ATOM   8582  O  O     . THR A 1  1113 ? 24.369  -41.330  76.167  1.00 89.81  ? 1113 THR A O     1 
ATOM   8583  C  CB    . THR A 1  1113 ? 22.306  -39.589  75.442  1.00 92.32  ? 1113 THR A CB    1 
ATOM   8584  O  OG1   . THR A 1  1113 ? 22.257  -40.252  74.179  1.00 93.34  ? 1113 THR A OG1   1 
ATOM   8585  C  CG2   . THR A 1  1113 ? 21.258  -38.480  75.508  1.00 88.97  ? 1113 THR A CG2   1 
ATOM   8586  N  N     . PRO A 1  1114 ? 25.921  -39.790  76.715  1.00 86.67  ? 1114 PRO A N     1 
ATOM   8587  C  CA    . PRO A 1  1114 ? 26.837  -40.821  77.230  1.00 86.37  ? 1114 PRO A CA    1 
ATOM   8588  C  C     . PRO A 1  1114 ? 26.239  -41.442  78.479  1.00 90.66  ? 1114 PRO A C     1 
ATOM   8589  O  O     . PRO A 1  1114 ? 25.704  -40.710  79.321  1.00 91.26  ? 1114 PRO A O     1 
ATOM   8590  C  CB    . PRO A 1  1114 ? 28.130  -40.048  77.511  1.00 89.05  ? 1114 PRO A CB    1 
ATOM   8591  C  CG    . PRO A 1  1114 ? 27.986  -38.764  76.762  1.00 94.03  ? 1114 PRO A CG    1 
ATOM   8592  C  CD    . PRO A 1  1114 ? 26.525  -38.455  76.848  1.00 89.29  ? 1114 PRO A CD    1 
ATOM   8593  N  N     . SER A 1  1115 ? 26.216  -42.793  78.537  1.00 86.09  ? 1115 SER A N     1 
ATOM   8594  C  CA    . SER A 1  1115 ? 25.567  -43.516  79.621  1.00 85.90  ? 1115 SER A CA    1 
ATOM   8595  C  C     . SER A 1  1115 ? 26.219  -44.821  79.977  1.00 89.30  ? 1115 SER A C     1 
ATOM   8596  O  O     . SER A 1  1115 ? 26.337  -45.710  79.129  1.00 88.78  ? 1115 SER A O     1 
ATOM   8597  C  CB    . SER A 1  1115 ? 24.095  -43.773  79.284  1.00 88.68  ? 1115 SER A CB    1 
ATOM   8598  O  OG    . SER A 1  1115 ? 23.464  -44.628  80.229  1.00 97.19  ? 1115 SER A OG    1 
ATOM   8599  N  N     . LEU A 1  1116 ? 26.558  -44.961  81.262  1.00 85.13  ? 1116 LEU A N     1 
ATOM   8600  C  CA    . LEU A 1  1116 ? 27.068  -46.192  81.849  1.00 84.36  ? 1116 LEU A CA    1 
ATOM   8601  C  C     . LEU A 1  1116 ? 25.823  -46.926  82.363  1.00 85.87  ? 1116 LEU A C     1 
ATOM   8602  O  O     . LEU A 1  1116 ? 24.959  -46.299  82.982  1.00 85.96  ? 1116 LEU A O     1 
ATOM   8603  C  CB    . LEU A 1  1116 ? 27.943  -45.877  83.099  1.00 85.65  ? 1116 LEU A CB    1 
ATOM   8604  C  CG    . LEU A 1  1116 ? 29.470  -46.078  83.177  1.00 90.46  ? 1116 LEU A CG    1 
ATOM   8605  C  CD1   . LEU A 1  1116 ? 30.055  -46.770  81.972  1.00 89.62  ? 1116 LEU A CD1   1 
ATOM   8606  C  CD2   . LEU A 1  1116 ? 30.164  -44.775  83.469  1.00 93.70  ? 1116 LEU A CD2   1 
ATOM   8607  N  N     . THR A 1  1117 ? 25.719  -48.236  82.130  1.00 80.25  ? 1117 THR A N     1 
ATOM   8608  C  CA    . THR A 1  1117 ? 24.658  -49.011  82.763  1.00 79.22  ? 1117 THR A CA    1 
ATOM   8609  C  C     . THR A 1  1117 ? 25.329  -50.022  83.660  1.00 83.72  ? 1117 THR A C     1 
ATOM   8610  O  O     . THR A 1  1117 ? 25.973  -50.962  83.197  1.00 82.18  ? 1117 THR A O     1 
ATOM   8611  C  CB    . THR A 1  1117 ? 23.564  -49.489  81.863  1.00 76.21  ? 1117 THR A CB    1 
ATOM   8612  O  OG1   . THR A 1  1117 ? 24.061  -50.596  81.142  1.00 73.89  ? 1117 THR A OG1   1 
ATOM   8613  C  CG2   . THR A 1  1117 ? 23.020  -48.385  80.970  1.00 72.40  ? 1117 THR A CG2   1 
ATOM   8614  N  N     . VAL A 1  1118 ? 25.278  -49.718  84.953  1.00 81.86  ? 1118 VAL A N     1 
ATOM   8615  C  CA    . VAL A 1  1118 ? 25.928  -50.423  86.036  1.00 82.81  ? 1118 VAL A CA    1 
ATOM   8616  C  C     . VAL A 1  1118 ? 25.050  -51.550  86.582  1.00 88.84  ? 1118 VAL A C     1 
ATOM   8617  O  O     . VAL A 1  1118 ? 23.939  -51.316  87.067  1.00 89.00  ? 1118 VAL A O     1 
ATOM   8618  C  CB    . VAL A 1  1118 ? 26.354  -49.404  87.132  1.00 87.66  ? 1118 VAL A CB    1 
ATOM   8619  C  CG1   . VAL A 1  1118 ? 27.108  -50.080  88.266  1.00 88.18  ? 1118 VAL A CG1   1 
ATOM   8620  C  CG2   . VAL A 1  1118 ? 27.184  -48.266  86.541  1.00 87.42  ? 1118 VAL A CG2   1 
ATOM   8621  N  N     . TYR A 1  1119 ? 25.557  -52.782  86.476  1.00 85.91  ? 1119 TYR A N     1 
ATOM   8622  C  CA    . TYR A 1  1119 ? 24.889  -53.962  87.002  1.00 85.46  ? 1119 TYR A CA    1 
ATOM   8623  C  C     . TYR A 1  1119 ? 25.632  -54.222  88.273  1.00 93.32  ? 1119 TYR A C     1 
ATOM   8624  O  O     . TYR A 1  1119 ? 26.852  -54.037  88.319  1.00 91.81  ? 1119 TYR A O     1 
ATOM   8625  C  CB    . TYR A 1  1119 ? 24.967  -55.160  86.024  1.00 84.22  ? 1119 TYR A CB    1 
ATOM   8626  C  CG    . TYR A 1  1119 ? 24.296  -54.890  84.696  1.00 82.89  ? 1119 TYR A CG    1 
ATOM   8627  C  CD1   . TYR A 1  1119 ? 25.030  -54.450  83.598  1.00 84.00  ? 1119 TYR A CD1   1 
ATOM   8628  C  CD2   . TYR A 1  1119 ? 22.916  -54.993  84.556  1.00 83.13  ? 1119 TYR A CD2   1 
ATOM   8629  C  CE1   . TYR A 1  1119 ? 24.409  -54.154  82.378  1.00 84.35  ? 1119 TYR A CE1   1 
ATOM   8630  C  CE2   . TYR A 1  1119 ? 22.279  -54.677  83.350  1.00 83.05  ? 1119 TYR A CE2   1 
ATOM   8631  C  CZ    . TYR A 1  1119 ? 23.029  -54.260  82.257  1.00 86.21  ? 1119 TYR A CZ    1 
ATOM   8632  O  OH    . TYR A 1  1119 ? 22.403  -53.958  81.057  1.00 75.59  ? 1119 TYR A OH    1 
ATOM   8633  N  N     . LEU A 1  1120 ? 24.890  -54.560  89.323  1.00 95.15  ? 1120 LEU A N     1 
ATOM   8634  C  CA    . LEU A 1  1120 ? 25.410  -54.799  90.671  1.00 98.05  ? 1120 LEU A CA    1 
ATOM   8635  C  C     . LEU A 1  1120 ? 26.030  -56.182  90.842  1.00 105.75 ? 1120 LEU A C     1 
ATOM   8636  O  O     . LEU A 1  1120 ? 25.776  -57.085  90.035  1.00 104.59 ? 1120 LEU A O     1 
ATOM   8637  C  CB    . LEU A 1  1120 ? 24.264  -54.625  91.690  1.00 98.98  ? 1120 LEU A CB    1 
ATOM   8638  C  CG    . LEU A 1  1120 ? 24.092  -53.280  92.419  1.00 104.14 ? 1120 LEU A CG    1 
ATOM   8639  C  CD1   . LEU A 1  1120 ? 23.841  -52.123  91.460  1.00 103.16 ? 1120 LEU A CD1   1 
ATOM   8640  C  CD2   . LEU A 1  1120 ? 22.924  -53.359  93.373  1.00 108.11 ? 1120 LEU A CD2   1 
ATOM   8641  N  N     . GLU A 1  1121 ? 26.812  -56.341  91.939  1.00 106.28 ? 1121 GLU A N     1 
ATOM   8642  C  CA    . GLU A 1  1121 ? 27.469  -57.566  92.395  1.00 108.04 ? 1121 GLU A CA    1 
ATOM   8643  C  C     . GLU A 1  1121 ? 26.381  -58.647  92.466  1.00 117.67 ? 1121 GLU A C     1 
ATOM   8644  O  O     . GLU A 1  1121 ? 25.270  -58.339  92.907  1.00 117.03 ? 1121 GLU A O     1 
ATOM   8645  C  CB    . GLU A 1  1121 ? 28.090  -57.309  93.775  1.00 110.52 ? 1121 GLU A CB    1 
ATOM   8646  C  CG    . GLU A 1  1121 ? 28.866  -58.452  94.407  1.00 121.93 ? 1121 GLU A CG    1 
ATOM   8647  C  CD    . GLU A 1  1121 ? 29.389  -58.148  95.802  1.00 147.64 ? 1121 GLU A CD    1 
ATOM   8648  O  OE1   . GLU A 1  1121 ? 28.720  -57.393  96.547  1.00 142.13 ? 1121 GLU A OE1   1 
ATOM   8649  O  OE2   . GLU A 1  1121 ? 30.472  -58.670  96.153  1.00 143.50 ? 1121 GLU A OE2   1 
ATOM   8650  N  N     . PRO A 1  1122 ? 26.649  -59.871  91.934  1.00 119.52 ? 1122 PRO A N     1 
ATOM   8651  C  CA    . PRO A 1  1122 ? 25.600  -60.922  91.875  1.00 121.09 ? 1122 PRO A CA    1 
ATOM   8652  C  C     . PRO A 1  1122 ? 24.579  -61.015  93.020  1.00 129.57 ? 1122 PRO A C     1 
ATOM   8653  O  O     . PRO A 1  1122 ? 23.403  -60.690  92.803  1.00 127.99 ? 1122 PRO A O     1 
ATOM   8654  C  CB    . PRO A 1  1122 ? 26.400  -62.214  91.659  1.00 122.82 ? 1122 PRO A CB    1 
ATOM   8655  C  CG    . PRO A 1  1122 ? 27.628  -61.778  90.938  1.00 126.34 ? 1122 PRO A CG    1 
ATOM   8656  C  CD    . PRO A 1  1122 ? 27.911  -60.338  91.314  1.00 121.67 ? 1122 PRO A CD    1 
ATOM   8657  N  N     . GLY A 1  1123 ? 25.054  -61.439  94.201  1.00 131.06 ? 1123 GLY A N     1 
ATOM   8658  C  CA    . GLY A 1  1123 ? 24.315  -61.597  95.455  1.00 133.72 ? 1123 GLY A CA    1 
ATOM   8659  C  C     . GLY A 1  1123 ? 22.836  -61.243  95.442  1.00 141.24 ? 1123 GLY A C     1 
ATOM   8660  O  O     . GLY A 1  1123 ? 22.039  -62.135  95.148  1.00 141.63 ? 1123 GLY A O     1 
ATOM   8661  N  N     . HIS A 1  1124 ? 22.390  -59.974  95.738  1.00 139.05 ? 1124 HIS A N     1 
ATOM   8662  C  CA    . HIS A 1  1124 ? 23.001  -58.671  96.112  1.00 139.34 ? 1124 HIS A CA    1 
ATOM   8663  C  C     . HIS A 1  1124 ? 22.425  -57.590  95.223  1.00 142.94 ? 1124 HIS A C     1 
ATOM   8664  O  O     . HIS A 1  1124 ? 22.219  -56.463  95.679  1.00 143.12 ? 1124 HIS A O     1 
ATOM   8665  C  CB    . HIS A 1  1124 ? 24.531  -58.617  96.047  1.00 140.04 ? 1124 HIS A CB    1 
ATOM   8666  C  CG    . HIS A 1  1124 ? 25.184  -58.613  97.383  1.00 144.72 ? 1124 HIS A CG    1 
ATOM   8667  N  ND1   . HIS A 1  1124 ? 25.837  -59.728  97.865  1.00 146.96 ? 1124 HIS A ND1   1 
ATOM   8668  C  CD2   . HIS A 1  1124 ? 25.263  -57.624  98.301  1.00 147.71 ? 1124 HIS A CD2   1 
ATOM   8669  C  CE1   . HIS A 1  1124 ? 26.296  -59.384  99.057  1.00 147.82 ? 1124 HIS A CE1   1 
ATOM   8670  N  NE2   . HIS A 1  1124 ? 25.973  -58.125  99.363  1.00 148.54 ? 1124 HIS A NE2   1 
ATOM   8671  N  N     . ALA A 1  1125 ? 22.175  -57.945  93.942  1.00 138.45 ? 1125 ALA A N     1 
ATOM   8672  C  CA    . ALA A 1  1125 ? 21.582  -57.074  92.925  1.00 137.33 ? 1125 ALA A CA    1 
ATOM   8673  C  C     . ALA A 1  1125 ? 20.054  -56.968  93.114  1.00 140.98 ? 1125 ALA A C     1 
ATOM   8674  O  O     . ALA A 1  1125 ? 19.444  -56.028  92.605  1.00 140.76 ? 1125 ALA A O     1 
ATOM   8675  C  CB    . ALA A 1  1125 ? 21.912  -57.593  91.530  1.00 136.84 ? 1125 ALA A CB    1 
ATOM   8676  N  N     . ALA A 1  1126 ? 19.448  -57.918  93.859  1.00 136.88 ? 1126 ALA A N     1 
ATOM   8677  C  CA    . ALA A 1  1126 ? 18.013  -57.953  94.154  1.00 136.27 ? 1126 ALA A CA    1 
ATOM   8678  C  C     . ALA A 1  1126 ? 17.618  -57.078  95.373  1.00 138.71 ? 1126 ALA A C     1 
ATOM   8679  O  O     . ALA A 1  1126 ? 16.427  -56.854  95.604  1.00 138.65 ? 1126 ALA A O     1 
ATOM   8680  C  CB    . ALA A 1  1126 ? 17.563  -59.392  94.358  1.00 137.38 ? 1126 ALA A CB    1 
ATOM   8681  N  N     . ASP A 1  1127 ? 18.612  -56.571  96.130  1.00 133.97 ? 1127 ASP A N     1 
ATOM   8682  C  CA    . ASP A 1  1127 ? 18.387  -55.714  97.294  1.00 134.30 ? 1127 ASP A CA    1 
ATOM   8683  C  C     . ASP A 1  1127 ? 18.364  -54.234  96.885  1.00 135.07 ? 1127 ASP A C     1 
ATOM   8684  O  O     . ASP A 1  1127 ? 19.330  -53.752  96.283  1.00 133.87 ? 1127 ASP A O     1 
ATOM   8685  C  CB    . ASP A 1  1127 ? 19.456  -55.976  98.375  1.00 137.38 ? 1127 ASP A CB    1 
ATOM   8686  C  CG    . ASP A 1  1127 ? 19.348  -55.108  99.622  1.00 152.57 ? 1127 ASP A CG    1 
ATOM   8687  O  OD1   . ASP A 1  1127 ? 18.215  -54.664  99.948  1.00 153.91 ? 1127 ASP A OD1   1 
ATOM   8688  O  OD2   . ASP A 1  1127 ? 20.388  -54.900  100.291 1.00 160.31 ? 1127 ASP A OD2   1 
ATOM   8689  N  N     . GLN A 1  1128 ? 17.266  -53.516  97.222  1.00 129.90 ? 1128 GLN A N     1 
ATOM   8690  C  CA    . GLN A 1  1128 ? 17.095  -52.098  96.883  1.00 128.29 ? 1128 GLN A CA    1 
ATOM   8691  C  C     . GLN A 1  1128 ? 18.040  -51.189  97.663  1.00 130.44 ? 1128 GLN A C     1 
ATOM   8692  O  O     . GLN A 1  1128 ? 18.604  -50.271  97.068  1.00 129.02 ? 1128 GLN A O     1 
ATOM   8693  C  CB    . GLN A 1  1128 ? 15.633  -51.638  97.051  1.00 130.05 ? 1128 GLN A CB    1 
ATOM   8694  C  CG    . GLN A 1  1128 ? 15.342  -50.277  96.396  1.00 138.50 ? 1128 GLN A CG    1 
ATOM   8695  C  CD    . GLN A 1  1128 ? 14.127  -49.537  96.918  1.00 153.87 ? 1128 GLN A CD    1 
ATOM   8696  O  OE1   . GLN A 1  1128 ? 13.744  -49.636  98.093  1.00 152.76 ? 1128 GLN A OE1   1 
ATOM   8697  N  NE2   . GLN A 1  1128 ? 13.533  -48.712  96.066  1.00 139.08 ? 1128 GLN A NE2   1 
ATOM   8698  N  N     . GLU A 1  1129 ? 18.205  -51.429  98.984  1.00 127.09 ? 1129 GLU A N     1 
ATOM   8699  C  CA    . GLU A 1  1129 ? 19.070  -50.600  99.836  1.00 126.96 ? 1129 GLU A CA    1 
ATOM   8700  C  C     . GLU A 1  1129 ? 20.542  -50.604  99.431  1.00 126.25 ? 1129 GLU A C     1 
ATOM   8701  O  O     . GLU A 1  1129 ? 21.165  -49.539  99.417  1.00 125.81 ? 1129 GLU A O     1 
ATOM   8702  C  CB    . GLU A 1  1129 ? 18.834  -50.828  101.343 1.00 130.19 ? 1129 GLU A CB    1 
ATOM   8703  C  CG    . GLU A 1  1129 ? 19.236  -52.191  101.881 1.00 144.34 ? 1129 GLU A CG    1 
ATOM   8704  C  CD    . GLU A 1  1129 ? 18.651  -52.548  103.237 1.00 178.82 ? 1129 GLU A CD    1 
ATOM   8705  O  OE1   . GLU A 1  1129 ? 17.944  -53.579  103.318 1.00 179.25 ? 1129 GLU A OE1   1 
ATOM   8706  O  OE2   . GLU A 1  1129 ? 18.899  -51.806  104.217 1.00 178.41 ? 1129 GLU A OE2   1 
ATOM   8707  N  N     . GLN A 1  1130 ? 21.059  -51.788  99.027  1.00 119.02 ? 1130 GLN A N     1 
ATOM   8708  C  CA    . GLN A 1  1130 ? 22.425  -52.016  98.540  1.00 116.57 ? 1130 GLN A CA    1 
ATOM   8709  C  C     . GLN A 1  1130 ? 22.694  -51.106  97.345  1.00 114.19 ? 1130 GLN A C     1 
ATOM   8710  O  O     . GLN A 1  1130 ? 23.734  -50.455  97.296  1.00 113.82 ? 1130 GLN A O     1 
ATOM   8711  C  CB    . GLN A 1  1130 ? 22.613  -53.510  98.165  1.00 117.49 ? 1130 GLN A CB    1 
ATOM   8712  C  CG    . GLN A 1  1130 ? 23.769  -53.841  97.196  1.00 129.68 ? 1130 GLN A CG    1 
ATOM   8713  C  CD    . GLN A 1  1130 ? 25.041  -54.343  97.850  1.00 143.09 ? 1130 GLN A CD    1 
ATOM   8714  O  OE1   . GLN A 1  1130 ? 25.125  -54.529  99.074  1.00 139.20 ? 1130 GLN A OE1   1 
ATOM   8715  N  NE2   . GLN A 1  1130 ? 26.056  -54.620  97.032  1.00 127.83 ? 1130 GLN A NE2   1 
ATOM   8716  N  N     . ALA A 1  1131 ? 21.730  -51.032  96.417  1.00 106.38 ? 1131 ALA A N     1 
ATOM   8717  C  CA    . ALA A 1  1131 ? 21.808  -50.223  95.205  1.00 103.74 ? 1131 ALA A CA    1 
ATOM   8718  C  C     . ALA A 1  1131 ? 21.971  -48.728  95.476  1.00 104.41 ? 1131 ALA A C     1 
ATOM   8719  O  O     . ALA A 1  1131 ? 22.908  -48.138  94.942  1.00 102.96 ? 1131 ALA A O     1 
ATOM   8720  C  CB    . ALA A 1  1131 ? 20.598  -50.483  94.324  1.00 103.65 ? 1131 ALA A CB    1 
ATOM   8721  N  N     . LYS A 1  1132 ? 21.099  -48.135  96.340  1.00 99.91  ? 1132 LYS A N     1 
ATOM   8722  C  CA    . LYS A 1  1132 ? 21.114  -46.713  96.733  1.00 99.46  ? 1132 LYS A CA    1 
ATOM   8723  C  C     . LYS A 1  1132 ? 22.521  -46.289  97.158  1.00 102.94 ? 1132 LYS A C     1 
ATOM   8724  O  O     . LYS A 1  1132 ? 22.963  -45.194  96.803  1.00 101.98 ? 1132 LYS A O     1 
ATOM   8725  C  CB    . LYS A 1  1132 ? 20.136  -46.424  97.891  1.00 102.51 ? 1132 LYS A CB    1 
ATOM   8726  C  CG    . LYS A 1  1132 ? 18.728  -46.999  97.775  1.00 110.95 ? 1132 LYS A CG    1 
ATOM   8727  C  CD    . LYS A 1  1132 ? 18.058  -46.991  99.153  1.00 121.35 ? 1132 LYS A CD    1 
ATOM   8728  C  CE    . LYS A 1  1132 ? 16.733  -47.714  99.233  1.00 124.55 ? 1132 LYS A CE    1 
ATOM   8729  N  NZ    . LYS A 1  1132 ? 16.400  -48.083  100.639 1.00 125.65 ? 1132 LYS A NZ    1 
ATOM   8730  N  N     . LEU A 1  1133 ? 23.222  -47.174  97.910  1.00 99.82  ? 1133 LEU A N     1 
ATOM   8731  C  CA    . LEU A 1  1133 ? 24.593  -46.972  98.393  1.00 100.11 ? 1133 LEU A CA    1 
ATOM   8732  C  C     . LEU A 1  1133 ? 25.574  -46.918  97.214  1.00 100.81 ? 1133 LEU A C     1 
ATOM   8733  O  O     . LEU A 1  1133 ? 26.462  -46.071  97.195  1.00 100.95 ? 1133 LEU A O     1 
ATOM   8734  C  CB    . LEU A 1  1133 ? 25.014  -48.082  99.383  1.00 101.01 ? 1133 LEU A CB    1 
ATOM   8735  C  CG    . LEU A 1  1133 ? 24.178  -48.249  100.659 1.00 107.55 ? 1133 LEU A CG    1 
ATOM   8736  C  CD1   . LEU A 1  1133 ? 24.256  -49.679  101.179 1.00 107.64 ? 1133 LEU A CD1   1 
ATOM   8737  C  CD2   . LEU A 1  1133 ? 24.603  -47.266  101.737 1.00 111.84 ? 1133 LEU A CD2   1 
ATOM   8738  N  N     . ILE A 1  1134 ? 25.396  -47.800  96.222  1.00 94.33  ? 1134 ILE A N     1 
ATOM   8739  C  CA    . ILE A 1  1134 ? 26.267  -47.817  95.051  1.00 92.47  ? 1134 ILE A CA    1 
ATOM   8740  C  C     . ILE A 1  1134 ? 26.009  -46.591  94.153  1.00 97.39  ? 1134 ILE A C     1 
ATOM   8741  O  O     . ILE A 1  1134 ? 26.915  -46.138  93.448  1.00 97.93  ? 1134 ILE A O     1 
ATOM   8742  C  CB    . ILE A 1  1134 ? 26.230  -49.184  94.327  1.00 93.32  ? 1134 ILE A CB    1 
ATOM   8743  C  CG1   . ILE A 1  1134 ? 26.807  -50.265  95.252  1.00 94.04  ? 1134 ILE A CG1   1 
ATOM   8744  C  CG2   . ILE A 1  1134 ? 27.045  -49.137  93.045  1.00 91.91  ? 1134 ILE A CG2   1 
ATOM   8745  C  CD1   . ILE A 1  1134 ? 26.042  -51.490  95.347  1.00 101.38 ? 1134 ILE A CD1   1 
ATOM   8746  N  N     . ARG A 1  1135 ? 24.797  -46.023  94.231  1.00 92.71  ? 1135 ARG A N     1 
ATOM   8747  C  CA    . ARG A 1  1135 ? 24.449  -44.836  93.466  1.00 91.26  ? 1135 ARG A CA    1 
ATOM   8748  C  C     . ARG A 1  1135 ? 25.276  -43.674  93.998  1.00 92.45  ? 1135 ARG A C     1 
ATOM   8749  O  O     . ARG A 1  1135 ? 26.052  -43.095  93.236  1.00 90.13  ? 1135 ARG A O     1 
ATOM   8750  C  CB    . ARG A 1  1135 ? 22.925  -44.558  93.526  1.00 92.64  ? 1135 ARG A CB    1 
ATOM   8751  C  CG    . ARG A 1  1135 ? 22.505  -43.140  93.107  1.00 102.50 ? 1135 ARG A CG    1 
ATOM   8752  C  CD    . ARG A 1  1135 ? 21.773  -42.397  94.208  1.00 108.67 ? 1135 ARG A CD    1 
ATOM   8753  N  NE    . ARG A 1  1135 ? 20.357  -42.764  94.240  1.00 115.18 ? 1135 ARG A NE    1 
ATOM   8754  C  CZ    . ARG A 1  1135 ? 19.430  -42.125  94.946  1.00 132.52 ? 1135 ARG A CZ    1 
ATOM   8755  N  NH1   . ARG A 1  1135 ? 19.759  -41.074  95.692  1.00 125.89 ? 1135 ARG A NH1   1 
ATOM   8756  N  NH2   . ARG A 1  1135 ? 18.165  -42.528  94.910  1.00 113.12 ? 1135 ARG A NH2   1 
ATOM   8757  N  N     . SER A 1  1136 ? 25.155  -43.386  95.319  1.00 89.82  ? 1136 SER A N     1 
ATOM   8758  C  CA    . SER A 1  1136 ? 25.859  -42.281  95.988  1.00 90.31  ? 1136 SER A CA    1 
ATOM   8759  C  C     . SER A 1  1136 ? 27.382  -42.408  95.909  1.00 93.05  ? 1136 SER A C     1 
ATOM   8760  O  O     . SER A 1  1136 ? 28.072  -41.394  95.761  1.00 92.91  ? 1136 SER A O     1 
ATOM   8761  C  CB    . SER A 1  1136 ? 25.359  -42.079  97.416  1.00 94.10  ? 1136 SER A CB    1 
ATOM   8762  O  OG    . SER A 1  1136 ? 25.445  -43.256  98.199  1.00 102.21 ? 1136 SER A OG    1 
ATOM   8763  N  N     . ALA A 1  1137 ? 27.879  -43.663  95.887  1.00 88.20  ? 1137 ALA A N     1 
ATOM   8764  C  CA    . ALA A 1  1137 ? 29.289  -44.017  95.770  1.00 87.58  ? 1137 ALA A CA    1 
ATOM   8765  C  C     . ALA A 1  1137 ? 29.856  -43.623  94.415  1.00 91.04  ? 1137 ALA A C     1 
ATOM   8766  O  O     . ALA A 1  1137 ? 31.049  -43.338  94.316  1.00 91.06  ? 1137 ALA A O     1 
ATOM   8767  C  CB    . ALA A 1  1137 ? 29.453  -45.511  95.965  1.00 87.66  ? 1137 ALA A CB    1 
ATOM   8768  N  N     . ILE A 1  1138 ? 29.013  -43.629  93.369  1.00 87.26  ? 1138 ILE A N     1 
ATOM   8769  C  CA    . ILE A 1  1138 ? 29.446  -43.324  92.009  1.00 86.65  ? 1138 ILE A CA    1 
ATOM   8770  C  C     . ILE A 1  1138 ? 29.001  -41.958  91.463  1.00 90.53  ? 1138 ILE A C     1 
ATOM   8771  O  O     . ILE A 1  1138 ? 29.713  -41.386  90.633  1.00 91.18  ? 1138 ILE A O     1 
ATOM   8772  C  CB    . ILE A 1  1138 ? 29.221  -44.502  91.012  1.00 88.77  ? 1138 ILE A CB    1 
ATOM   8773  C  CG1   . ILE A 1  1138 ? 27.749  -44.682  90.640  1.00 88.84  ? 1138 ILE A CG1   1 
ATOM   8774  C  CG2   . ILE A 1  1138 ? 29.822  -45.811  91.534  1.00 89.97  ? 1138 ILE A CG2   1 
ATOM   8775  C  CD1   . ILE A 1  1138 ? 27.553  -45.265  89.300  1.00 98.65  ? 1138 ILE A CD1   1 
ATOM   8776  N  N     . GLU A 1  1139 ? 27.835  -41.439  91.909  1.00 85.39  ? 1139 GLU A N     1 
ATOM   8777  C  CA    . GLU A 1  1139 ? 27.331  -40.143  91.448  1.00 84.49  ? 1139 GLU A CA    1 
ATOM   8778  C  C     . GLU A 1  1139 ? 28.174  -38.993  91.997  1.00 90.34  ? 1139 GLU A C     1 
ATOM   8779  O  O     . GLU A 1  1139 ? 28.393  -38.897  93.220  1.00 91.67  ? 1139 GLU A O     1 
ATOM   8780  C  CB    . GLU A 1  1139 ? 25.850  -39.964  91.800  1.00 85.53  ? 1139 GLU A CB    1 
ATOM   8781  C  CG    . GLU A 1  1139 ? 25.199  -38.820  91.047  1.00 92.22  ? 1139 GLU A CG    1 
ATOM   8782  C  CD    . GLU A 1  1139 ? 23.893  -38.332  91.635  1.00 114.03 ? 1139 GLU A CD    1 
ATOM   8783  O  OE1   . GLU A 1  1139 ? 22.957  -38.070  90.846  1.00 120.18 ? 1139 GLU A OE1   1 
ATOM   8784  O  OE2   . GLU A 1  1139 ? 23.807  -38.186  92.876  1.00 109.65 ? 1139 GLU A OE2   1 
ATOM   8785  N  N     . HIS A 1  1140 ? 28.646  -38.128  91.085  1.00 86.50  ? 1140 HIS A N     1 
ATOM   8786  C  CA    . HIS A 1  1140 ? 29.481  -36.983  91.429  1.00 88.25  ? 1140 HIS A CA    1 
ATOM   8787  C  C     . HIS A 1  1140 ? 28.730  -35.917  92.226  1.00 93.84  ? 1140 HIS A C     1 
ATOM   8788  O  O     . HIS A 1  1140 ? 27.681  -35.426  91.802  1.00 92.62  ? 1140 HIS A O     1 
ATOM   8789  C  CB    . HIS A 1  1140 ? 30.149  -36.399  90.180  1.00 89.04  ? 1140 HIS A CB    1 
ATOM   8790  C  CG    . HIS A 1  1140 ? 31.212  -35.383  90.450  1.00 94.03  ? 1140 HIS A CG    1 
ATOM   8791  N  ND1   . HIS A 1  1140 ? 32.073  -35.496  91.532  1.00 97.07  ? 1140 HIS A ND1   1 
ATOM   8792  C  CD2   . HIS A 1  1140 ? 31.558  -34.294  89.727  1.00 96.52  ? 1140 HIS A CD2   1 
ATOM   8793  C  CE1   . HIS A 1  1140 ? 32.881  -34.453  91.456  1.00 97.76  ? 1140 HIS A CE1   1 
ATOM   8794  N  NE2   . HIS A 1  1140 ? 32.616  -33.706  90.384  1.00 97.84  ? 1140 HIS A NE2   1 
ATOM   8795  N  N     . THR A 1  1141 ? 29.270  -35.592  93.407  1.00 93.18  ? 1141 THR A N     1 
ATOM   8796  C  CA    . THR A 1  1141 ? 28.700  -34.609  94.319  1.00 94.70  ? 1141 THR A CA    1 
ATOM   8797  C  C     . THR A 1  1141 ? 29.745  -33.587  94.744  1.00 100.64 ? 1141 THR A C     1 
ATOM   8798  O  O     . THR A 1  1141 ? 30.733  -33.927  95.395  1.00 100.15 ? 1141 THR A O     1 
ATOM   8799  C  CB    . THR A 1  1141 ? 28.028  -35.288  95.508  1.00 104.07 ? 1141 THR A CB    1 
ATOM   8800  O  OG1   . THR A 1  1141 ? 27.546  -36.582  95.122  1.00 106.92 ? 1141 THR A OG1   1 
ATOM   8801  C  CG2   . THR A 1  1141 ? 26.908  -34.448  96.082  1.00 101.64 ? 1141 THR A CG2   1 
ATOM   8802  N  N     . THR A 1  1142 ? 29.522  -32.337  94.332  1.00 91.14  ? 1142 THR A N     1 
ATOM   8803  C  CA    . THR A 1  1142 ? 30.352  -31.171  94.626  1.00 91.39  ? 1142 THR A CA    1 
ATOM   8804  C  C     . THR A 1  1142 ? 29.813  -30.505  95.902  1.00 95.66  ? 1142 THR A C     1 
ATOM   8805  O  O     . THR A 1  1142 ? 28.733  -30.881  96.365  1.00 95.95  ? 1142 THR A O     1 
ATOM   8806  C  CB    . THR A 1  1142 ? 30.367  -30.223  93.393  1.00 104.41 ? 1142 THR A CB    1 
ATOM   8807  O  OG1   . THR A 1  1142 ? 31.174  -29.077  93.665  1.00 108.93 ? 1142 THR A OG1   1 
ATOM   8808  C  CG2   . THR A 1  1142 ? 28.964  -29.780  92.946  1.00 102.08 ? 1142 THR A CG2   1 
ATOM   8809  N  N     . LEU A 1  1143 ? 30.542  -29.524  96.468  1.00 91.49  ? 1143 LEU A N     1 
ATOM   8810  C  CA    . LEU A 1  1143 ? 30.055  -28.798  97.644  1.00 90.79  ? 1143 LEU A CA    1 
ATOM   8811  C  C     . LEU A 1  1143 ? 28.877  -27.881  97.231  1.00 92.69  ? 1143 LEU A C     1 
ATOM   8812  O  O     . LEU A 1  1143 ? 27.900  -27.755  97.968  1.00 91.77  ? 1143 LEU A O     1 
ATOM   8813  C  CB    . LEU A 1  1143 ? 31.208  -28.018  98.310  1.00 91.14  ? 1143 LEU A CB    1 
ATOM   8814  C  CG    . LEU A 1  1143 ? 30.971  -27.326  99.669  1.00 94.98  ? 1143 LEU A CG    1 
ATOM   8815  C  CD1   . LEU A 1  1143 ? 30.255  -28.234  100.667 1.00 95.60  ? 1143 LEU A CD1   1 
ATOM   8816  C  CD2   . LEU A 1  1143 ? 32.283  -26.852  100.254 1.00 96.86  ? 1143 LEU A CD2   1 
ATOM   8817  N  N     . LYS A 1  1144 ? 28.946  -27.333  96.011  1.00 88.46  ? 1144 LYS A N     1 
ATOM   8818  C  CA    . LYS A 1  1144 ? 27.933  -26.481  95.398  1.00 87.83  ? 1144 LYS A CA    1 
ATOM   8819  C  C     . LYS A 1  1144 ? 26.541  -27.156  95.452  1.00 92.68  ? 1144 LYS A C     1 
ATOM   8820  O  O     . LYS A 1  1144 ? 25.556  -26.530  95.843  1.00 91.67  ? 1144 LYS A O     1 
ATOM   8821  C  CB    . LYS A 1  1144 ? 28.360  -26.190  93.942  1.00 90.48  ? 1144 LYS A CB    1 
ATOM   8822  C  CG    . LYS A 1  1144 ? 27.629  -25.055  93.223  1.00 108.64 ? 1144 LYS A CG    1 
ATOM   8823  C  CD    . LYS A 1  1144 ? 27.945  -25.067  91.708  1.00 120.72 ? 1144 LYS A CD    1 
ATOM   8824  C  CE    . LYS A 1  1144 ? 27.193  -24.025  90.899  1.00 126.05 ? 1144 LYS A CE    1 
ATOM   8825  N  NZ    . LYS A 1  1144 ? 27.319  -24.262  89.432  1.00 131.93 ? 1144 LYS A NZ    1 
ATOM   8826  N  N     . SER A 1  1145 ? 26.486  -28.447  95.126  1.00 91.13  ? 1145 SER A N     1 
ATOM   8827  C  CA    . SER A 1  1145 ? 25.249  -29.226  95.095  1.00 91.58  ? 1145 SER A CA    1 
ATOM   8828  C  C     . SER A 1  1145 ? 24.494  -29.309  96.422  1.00 97.45  ? 1145 SER A C     1 
ATOM   8829  O  O     . SER A 1  1145 ? 23.297  -29.590  96.407  1.00 98.04  ? 1145 SER A O     1 
ATOM   8830  C  CB    . SER A 1  1145 ? 25.493  -30.611  94.503  1.00 94.82  ? 1145 SER A CB    1 
ATOM   8831  O  OG    . SER A 1  1145 ? 26.611  -31.233  95.110  1.00 100.86 ? 1145 SER A OG    1 
ATOM   8832  N  N     . VAL A 1  1146 ? 25.165  -29.046  97.550  1.00 94.42  ? 1146 VAL A N     1 
ATOM   8833  C  CA    . VAL A 1  1146 ? 24.514  -29.106  98.863  1.00 95.34  ? 1146 VAL A CA    1 
ATOM   8834  C  C     . VAL A 1  1146 ? 24.437  -27.768  99.608  1.00 99.46  ? 1146 VAL A C     1 
ATOM   8835  O  O     . VAL A 1  1146 ? 23.851  -27.719  100.689 1.00 100.38 ? 1146 VAL A O     1 
ATOM   8836  C  CB    . VAL A 1  1146 ? 25.055  -30.234  99.769  1.00 100.95 ? 1146 VAL A CB    1 
ATOM   8837  C  CG1   . VAL A 1  1146 ? 24.573  -31.594  99.300  1.00 101.45 ? 1146 VAL A CG1   1 
ATOM   8838  C  CG2   . VAL A 1  1146 ? 26.577  -30.189  99.873  1.00 101.38 ? 1146 VAL A CG2   1 
ATOM   8839  N  N     . THR A 1  1147 ? 24.990  -26.688  99.031  1.00 94.06  ? 1147 THR A N     1 
ATOM   8840  C  CA    . THR A 1  1147 ? 25.007  -25.374  99.669  1.00 92.64  ? 1147 THR A CA    1 
ATOM   8841  C  C     . THR A 1  1147 ? 23.876  -24.439  99.235  1.00 94.85  ? 1147 THR A C     1 
ATOM   8842  O  O     . THR A 1  1147 ? 23.631  -24.251  98.035  1.00 93.94  ? 1147 THR A O     1 
ATOM   8843  C  CB    . THR A 1  1147 ? 26.364  -24.696  99.479  1.00 97.59  ? 1147 THR A CB    1 
ATOM   8844  O  OG1   . THR A 1  1147 ? 27.387  -25.676  99.345  1.00 96.85  ? 1147 THR A OG1   1 
ATOM   8845  C  CG2   . THR A 1  1147 ? 26.693  -23.737  100.604 1.00 97.28  ? 1147 THR A CG2   1 
ATOM   8846  N  N     . ILE A 1  1148 ? 23.242  -23.797  100.237 1.00 90.19  ? 1148 ILE A N     1 
ATOM   8847  C  CA    . ILE A 1  1148 ? 22.183  -22.800  100.078 1.00 87.78  ? 1148 ILE A CA    1 
ATOM   8848  C  C     . ILE A 1  1148 ? 22.850  -21.461  99.725  1.00 88.30  ? 1148 ILE A C     1 
ATOM   8849  O  O     . ILE A 1  1148 ? 22.515  -20.858  98.704  1.00 86.26  ? 1148 ILE A O     1 
ATOM   8850  C  CB    . ILE A 1  1148 ? 21.309  -22.703  101.369 1.00 91.42  ? 1148 ILE A CB    1 
ATOM   8851  C  CG1   . ILE A 1  1148 ? 20.510  -24.005  101.630 1.00 92.20  ? 1148 ILE A CG1   1 
ATOM   8852  C  CG2   . ILE A 1  1148 ? 20.387  -21.488  101.322 1.00 92.07  ? 1148 ILE A CG2   1 
ATOM   8853  C  CD1   . ILE A 1  1148 ? 19.801  -24.101  103.009 1.00 94.35  ? 1148 ILE A CD1   1 
ATOM   8854  N  N     . ALA A 1  1149 ? 23.789  -21.007  100.583 1.00 84.50  ? 1149 ALA A N     1 
ATOM   8855  C  CA    . ALA A 1  1149 ? 24.526  -19.742  100.446 1.00 83.54  ? 1149 ALA A CA    1 
ATOM   8856  C  C     . ALA A 1  1149 ? 25.837  -19.773  101.221 1.00 86.59  ? 1149 ALA A C     1 
ATOM   8857  O  O     . ALA A 1  1149 ? 26.012  -20.586  102.140 1.00 87.12  ? 1149 ALA A O     1 
ATOM   8858  C  CB    . ALA A 1  1149 ? 23.681  -18.584  100.959 1.00 84.22  ? 1149 ALA A CB    1 
ATOM   8859  N  N     . SER A 1  1150 ? 26.756  -18.877  100.839 1.00 81.12  ? 1150 SER A N     1 
ATOM   8860  C  CA    . SER A 1  1150 ? 28.043  -18.722  101.493 1.00 81.49  ? 1150 SER A CA    1 
ATOM   8861  C  C     . SER A 1  1150 ? 28.168  -17.262  101.894 1.00 88.25  ? 1150 SER A C     1 
ATOM   8862  O  O     . SER A 1  1150 ? 27.847  -16.365  101.107 1.00 86.95  ? 1150 SER A O     1 
ATOM   8863  C  CB    . SER A 1  1150 ? 29.197  -19.180  100.601 1.00 81.99  ? 1150 SER A CB    1 
ATOM   8864  O  OG    . SER A 1  1150 ? 29.381  -18.418  99.422  1.00 83.31  ? 1150 SER A OG    1 
ATOM   8865  N  N     . GLU A 1  1151 ? 28.561  -17.024  103.149 1.00 86.99  ? 1151 GLU A N     1 
ATOM   8866  C  CA    . GLU A 1  1151 ? 28.679  -15.668  103.658 1.00 87.07  ? 1151 GLU A CA    1 
ATOM   8867  C  C     . GLU A 1  1151 ? 30.045  -15.389  104.211 1.00 91.86  ? 1151 GLU A C     1 
ATOM   8868  O  O     . GLU A 1  1151 ? 30.742  -16.306  104.635 1.00 91.28  ? 1151 GLU A O     1 
ATOM   8869  C  CB    . GLU A 1  1151 ? 27.633  -15.409  104.745 1.00 89.18  ? 1151 GLU A CB    1 
ATOM   8870  C  CG    . GLU A 1  1151 ? 26.197  -15.440  104.257 1.00 99.18  ? 1151 GLU A CG    1 
ATOM   8871  C  CD    . GLU A 1  1151 ? 25.175  -15.660  105.353 1.00 116.68 ? 1151 GLU A CD    1 
ATOM   8872  O  OE1   . GLU A 1  1151 ? 25.220  -16.724  106.017 1.00 117.39 ? 1151 GLU A OE1   1 
ATOM   8873  O  OE2   . GLU A 1  1151 ? 24.304  -14.776  105.522 1.00 99.23  ? 1151 GLU A OE2   1 
ATOM   8874  N  N     . ILE A 1  1152 ? 30.428  -14.108  104.209 1.00 89.85  ? 1152 ILE A N     1 
ATOM   8875  C  CA    . ILE A 1  1152 ? 31.679  -13.656  104.794 1.00 90.97  ? 1152 ILE A CA    1 
ATOM   8876  C  C     . ILE A 1  1152 ? 31.307  -12.651  105.859 1.00 98.08  ? 1152 ILE A C     1 
ATOM   8877  O  O     . ILE A 1  1152 ? 30.818  -11.575  105.536 1.00 97.05  ? 1152 ILE A O     1 
ATOM   8878  C  CB    . ILE A 1  1152 ? 32.727  -13.120  103.781 1.00 92.89  ? 1152 ILE A CB    1 
ATOM   8879  C  CG1   . ILE A 1  1152 ? 33.075  -14.184  102.716 1.00 91.94  ? 1152 ILE A CG1   1 
ATOM   8880  C  CG2   . ILE A 1  1152 ? 33.982  -12.661  104.529 1.00 94.60  ? 1152 ILE A CG2   1 
ATOM   8881  C  CD1   . ILE A 1  1152 ? 33.806  -13.663  101.499 1.00 94.22  ? 1152 ILE A CD1   1 
ATOM   8882  N  N     . TYR A 1  1153 ? 31.466  -13.035  107.124 1.00 98.89  ? 1153 TYR A N     1 
ATOM   8883  C  CA    . TYR A 1  1153 ? 31.161  -12.170  108.262 1.00 101.33 ? 1153 TYR A CA    1 
ATOM   8884  C  C     . TYR A 1  1153 ? 32.444  -11.691  108.913 1.00 106.37 ? 1153 TYR A C     1 
ATOM   8885  O  O     . TYR A 1  1153 ? 33.429  -12.439  108.992 1.00 106.22 ? 1153 TYR A O     1 
ATOM   8886  C  CB    . TYR A 1  1153 ? 30.369  -12.928  109.338 1.00 105.13 ? 1153 TYR A CB    1 
ATOM   8887  C  CG    . TYR A 1  1153 ? 28.931  -13.240  109.006 1.00 108.82 ? 1153 TYR A CG    1 
ATOM   8888  C  CD1   . TYR A 1  1153 ? 28.585  -14.431  108.373 1.00 111.17 ? 1153 TYR A CD1   1 
ATOM   8889  C  CD2   . TYR A 1  1153 ? 27.901  -12.404  109.428 1.00 110.15 ? 1153 TYR A CD2   1 
ATOM   8890  C  CE1   . TYR A 1  1153 ? 27.252  -14.764  108.132 1.00 112.44 ? 1153 TYR A CE1   1 
ATOM   8891  C  CE2   . TYR A 1  1153 ? 26.564  -12.719  109.180 1.00 110.86 ? 1153 TYR A CE2   1 
ATOM   8892  C  CZ    . TYR A 1  1153 ? 26.245  -13.900  108.526 1.00 119.65 ? 1153 TYR A CZ    1 
ATOM   8893  O  OH    . TYR A 1  1153 ? 24.934  -14.231  108.273 1.00 122.02 ? 1153 TYR A OH    1 
ATOM   8894  N  N     . TYR A 1  1154 ? 32.419  -10.471  109.446 1.00 103.93 ? 1154 TYR A N     1 
ATOM   8895  C  CA    . TYR A 1  1154 ? 33.569  -10.013  110.191 1.00 105.56 ? 1154 TYR A CA    1 
ATOM   8896  C  C     . TYR A 1  1154 ? 33.362  -10.504  111.628 1.00 111.00 ? 1154 TYR A C     1 
ATOM   8897  O  O     . TYR A 1  1154 ? 32.694  -9.835   112.421 1.00 110.28 ? 1154 TYR A O     1 
ATOM   8898  C  CB    . TYR A 1  1154 ? 33.794  -8.491   110.087 1.00 107.17 ? 1154 TYR A CB    1 
ATOM   8899  C  CG    . TYR A 1  1154 ? 34.929  -8.037   110.978 1.00 111.48 ? 1154 TYR A CG    1 
ATOM   8900  C  CD1   . TYR A 1  1154 ? 36.250  -8.358   110.676 1.00 114.09 ? 1154 TYR A CD1   1 
ATOM   8901  C  CD2   . TYR A 1  1154 ? 34.678  -7.365   112.173 1.00 113.92 ? 1154 TYR A CD2   1 
ATOM   8902  C  CE1   . TYR A 1  1154 ? 37.293  -8.007   111.532 1.00 117.53 ? 1154 TYR A CE1   1 
ATOM   8903  C  CE2   . TYR A 1  1154 ? 35.715  -6.992   113.027 1.00 116.57 ? 1154 TYR A CE2   1 
ATOM   8904  C  CZ    . TYR A 1  1154 ? 37.020  -7.324   112.708 1.00 123.67 ? 1154 TYR A CZ    1 
ATOM   8905  O  OH    . TYR A 1  1154 ? 38.039  -6.977   113.558 1.00 124.27 ? 1154 TYR A OH    1 
ATOM   8906  N  N     . ASP A 1  1155 ? 33.844  -11.738  111.917 1.00 109.83 ? 1155 ASP A N     1 
ATOM   8907  C  CA    . ASP A 1  1155 ? 33.748  -12.377  113.238 1.00 111.82 ? 1155 ASP A CA    1 
ATOM   8908  C  C     . ASP A 1  1155 ? 35.143  -12.402  113.915 1.00 119.04 ? 1155 ASP A C     1 
ATOM   8909  O  O     . ASP A 1  1155 ? 35.941  -13.322  113.657 1.00 119.23 ? 1155 ASP A O     1 
ATOM   8910  C  CB    . ASP A 1  1155 ? 33.083  -13.765  113.160 1.00 112.89 ? 1155 ASP A CB    1 
ATOM   8911  C  CG    . ASP A 1  1155 ? 32.419  -14.182  114.459 1.00 123.76 ? 1155 ASP A CG    1 
ATOM   8912  O  OD1   . ASP A 1  1155 ? 31.932  -13.296  115.191 1.00 125.85 ? 1155 ASP A OD1   1 
ATOM   8913  O  OD2   . ASP A 1  1155 ? 32.429  -15.382  114.766 1.00 129.35 ? 1155 ASP A OD2   1 
ATOM   8914  N  N     . PRO A 1  1156 ? 35.471  -11.350  114.724 1.00 116.83 ? 1156 PRO A N     1 
ATOM   8915  C  CA    . PRO A 1  1156 ? 36.825  -11.243  115.269 1.00 118.46 ? 1156 PRO A CA    1 
ATOM   8916  C  C     . PRO A 1  1156 ? 37.146  -11.997  116.555 1.00 126.46 ? 1156 PRO A C     1 
ATOM   8917  O  O     . PRO A 1  1156 ? 38.331  -12.177  116.852 1.00 126.92 ? 1156 PRO A O     1 
ATOM   8918  C  CB    . PRO A 1  1156 ? 37.053  -9.732   115.348 1.00 120.08 ? 1156 PRO A CB    1 
ATOM   8919  C  CG    . PRO A 1  1156 ? 35.697  -9.150   115.516 1.00 123.42 ? 1156 PRO A CG    1 
ATOM   8920  C  CD    . PRO A 1  1156 ? 34.669  -10.159  115.079 1.00 118.02 ? 1156 PRO A CD    1 
ATOM   8921  N  N     . ASP A 1  1157 ? 36.132  -12.448  117.308 1.00 125.92 ? 1157 ASP A N     1 
ATOM   8922  C  CA    . ASP A 1  1157 ? 36.405  -13.222  118.518 1.00 129.41 ? 1157 ASP A CA    1 
ATOM   8923  C  C     . ASP A 1  1157 ? 36.121  -14.706  118.234 1.00 136.56 ? 1157 ASP A C     1 
ATOM   8924  O  O     . ASP A 1  1157 ? 34.945  -15.066  118.084 1.00 135.91 ? 1157 ASP A O     1 
ATOM   8925  C  CB    . ASP A 1  1157 ? 35.602  -12.703  119.726 1.00 132.74 ? 1157 ASP A CB    1 
ATOM   8926  C  CG    . ASP A 1  1157 ? 36.042  -13.266  121.073 1.00 146.55 ? 1157 ASP A CG    1 
ATOM   8927  O  OD1   . ASP A 1  1157 ? 36.162  -14.508  121.191 1.00 147.21 ? 1157 ASP A OD1   1 
ATOM   8928  O  OD2   . ASP A 1  1157 ? 36.223  -12.467  122.022 1.00 154.06 ? 1157 ASP A OD2   1 
ATOM   8929  N  N     . PRO A 1  1158 ? 37.165  -15.584  118.144 1.00 135.69 ? 1158 PRO A N     1 
ATOM   8930  C  CA    . PRO A 1  1158 ? 36.908  -17.010  117.851 1.00 135.74 ? 1158 PRO A CA    1 
ATOM   8931  C  C     . PRO A 1  1158 ? 35.965  -17.686  118.847 1.00 141.85 ? 1158 PRO A C     1 
ATOM   8932  O  O     . PRO A 1  1158 ? 35.208  -18.572  118.440 1.00 141.82 ? 1158 PRO A O     1 
ATOM   8933  C  CB    . PRO A 1  1158 ? 38.309  -17.636  117.855 1.00 138.45 ? 1158 PRO A CB    1 
ATOM   8934  C  CG    . PRO A 1  1158 ? 39.220  -16.513  117.530 1.00 142.84 ? 1158 PRO A CG    1 
ATOM   8935  C  CD    . PRO A 1  1158 ? 38.615  -15.333  118.261 1.00 138.63 ? 1158 PRO A CD    1 
ATOM   8936  N  N     . ARG A 1  1159 ? 35.966  -17.224  120.124 1.00 138.97 ? 1159 ARG A N     1 
ATOM   8937  C  CA    . ARG A 1  1159 ? 35.100  -17.734  121.192 1.00 139.57 ? 1159 ARG A CA    1 
ATOM   8938  C  C     . ARG A 1  1159 ? 33.715  -17.054  121.205 1.00 143.22 ? 1159 ARG A C     1 
ATOM   8939  O  O     . ARG A 1  1159 ? 32.715  -17.727  121.462 1.00 142.99 ? 1159 ARG A O     1 
ATOM   8940  C  CB    . ARG A 1  1159 ? 35.785  -17.607  122.561 1.00 140.62 ? 1159 ARG A CB    1 
ATOM   8941  C  CG    . ARG A 1  1159 ? 37.052  -18.444  122.685 1.00 150.29 ? 1159 ARG A CG    1 
ATOM   8942  C  CD    . ARG A 1  1159 ? 37.646  -18.417  124.079 1.00 160.29 ? 1159 ARG A CD    1 
ATOM   8943  N  NE    . ARG A 1  1159 ? 38.664  -19.457  124.232 1.00 166.67 ? 1159 ARG A NE    1 
ATOM   8944  C  CZ    . ARG A 1  1159 ? 39.381  -19.661  125.332 1.00 180.66 ? 1159 ARG A CZ    1 
ATOM   8945  N  NH1   . ARG A 1  1159 ? 39.206  -18.892  126.402 1.00 168.57 ? 1159 ARG A NH1   1 
ATOM   8946  N  NH2   . ARG A 1  1159 ? 40.282  -20.632  125.371 1.00 166.92 ? 1159 ARG A NH2   1 
ATOM   8947  N  N     . SER A 1  1160 ? 33.657  -15.731  120.929 1.00 139.26 ? 1160 SER A N     1 
ATOM   8948  C  CA    . SER A 1  1160 ? 32.405  -14.969  120.926 1.00 138.51 ? 1160 SER A CA    1 
ATOM   8949  C  C     . SER A 1  1160 ? 31.971  -14.539  119.526 1.00 140.32 ? 1160 SER A C     1 
ATOM   8950  O  O     . SER A 1  1160 ? 32.440  -13.528  118.986 1.00 139.29 ? 1160 SER A O     1 
ATOM   8951  C  CB    . SER A 1  1160 ? 32.483  -13.778  121.878 1.00 143.73 ? 1160 SER A CB    1 
ATOM   8952  O  OG    . SER A 1  1160 ? 32.202  -14.152  123.217 1.00 156.04 ? 1160 SER A OG    1 
ATOM   8953  N  N     . THR A 1  1161 ? 31.061  -15.318  118.945 1.00 135.81 ? 1161 THR A N     1 
ATOM   8954  C  CA    . THR A 1  1161 ? 30.523  -15.062  117.611 1.00 133.28 ? 1161 THR A CA    1 
ATOM   8955  C  C     . THR A 1  1161 ? 29.547  -13.882  117.619 1.00 134.99 ? 1161 THR A C     1 
ATOM   8956  O  O     . THR A 1  1161 ? 28.810  -13.684  118.587 1.00 134.68 ? 1161 THR A O     1 
ATOM   8957  C  CB    . THR A 1  1161 ? 29.961  -16.372  117.012 1.00 142.63 ? 1161 THR A CB    1 
ATOM   8958  O  OG1   . THR A 1  1161 ? 31.025  -17.319  116.970 1.00 147.97 ? 1161 THR A OG1   1 
ATOM   8959  C  CG2   . THR A 1  1161 ? 29.394  -16.210  115.607 1.00 136.01 ? 1161 THR A CG2   1 
ATOM   8960  N  N     . VAL A 1  1162 ? 29.574  -13.093  116.534 1.00 129.81 ? 1162 VAL A N     1 
ATOM   8961  C  CA    . VAL A 1  1162 ? 28.670  -11.968  116.302 1.00 128.61 ? 1162 VAL A CA    1 
ATOM   8962  C  C     . VAL A 1  1162 ? 27.284  -12.534  115.936 1.00 132.09 ? 1162 VAL A C     1 
ATOM   8963  O  O     . VAL A 1  1162 ? 26.273  -11.937  116.308 1.00 131.61 ? 1162 VAL A O     1 
ATOM   8964  C  CB    . VAL A 1  1162 ? 29.204  -10.948  115.257 1.00 130.80 ? 1162 VAL A CB    1 
ATOM   8965  C  CG1   . VAL A 1  1162 ? 30.496  -10.290  115.732 1.00 131.38 ? 1162 VAL A CG1   1 
ATOM   8966  C  CG2   . VAL A 1  1162 ? 29.398  -11.585  113.882 1.00 129.02 ? 1162 VAL A CG2   1 
ATOM   8967  N  N     . ILE A 1  1163 ? 27.254  -13.708  115.233 1.00 128.50 ? 1163 ILE A N     1 
ATOM   8968  C  CA    . ILE A 1  1163 ? 26.045  -14.451  114.840 1.00 127.98 ? 1163 ILE A CA    1 
ATOM   8969  C  C     . ILE A 1  1163 ? 25.547  -15.174  116.101 1.00 135.52 ? 1163 ILE A C     1 
ATOM   8970  O  O     . ILE A 1  1163 ? 26.288  -15.981  116.678 1.00 135.98 ? 1163 ILE A O     1 
ATOM   8971  C  CB    . ILE A 1  1163 ? 26.278  -15.420  113.645 1.00 129.32 ? 1163 ILE A CB    1 
ATOM   8972  C  CG1   . ILE A 1  1163 ? 26.808  -14.678  112.401 1.00 127.58 ? 1163 ILE A CG1   1 
ATOM   8973  C  CG2   . ILE A 1  1163 ? 25.006  -16.195  113.308 1.00 129.63 ? 1163 ILE A CG2   1 
ATOM   8974  C  CD1   . ILE A 1  1163 ? 28.062  -15.248  111.862 1.00 131.37 ? 1163 ILE A CD1   1 
ATOM   8975  N  N     . PRO A 1  1164 ? 24.326  -14.846  116.583 1.00 134.17 ? 1164 PRO A N     1 
ATOM   8976  C  CA    . PRO A 1  1164 ? 23.858  -15.438  117.849 1.00 136.23 ? 1164 PRO A CA    1 
ATOM   8977  C  C     . PRO A 1  1164 ? 23.404  -16.889  117.772 1.00 140.51 ? 1164 PRO A C     1 
ATOM   8978  O  O     . PRO A 1  1164 ? 23.497  -17.590  118.778 1.00 141.96 ? 1164 PRO A O     1 
ATOM   8979  C  CB    . PRO A 1  1164 ? 22.736  -14.494  118.308 1.00 138.59 ? 1164 PRO A CB    1 
ATOM   8980  C  CG    . PRO A 1  1164 ? 22.671  -13.376  117.272 1.00 141.27 ? 1164 PRO A CG    1 
ATOM   8981  C  CD    . PRO A 1  1164 ? 23.339  -13.888  116.043 1.00 134.92 ? 1164 PRO A CD    1 
ATOM   8982  N  N     . GLU A 1  1165 ? 22.923  -17.342  116.601 1.00 135.13 ? 1165 GLU A N     1 
ATOM   8983  C  CA    . GLU A 1  1165 ? 22.464  -18.723  116.430 1.00 135.13 ? 1165 GLU A CA    1 
ATOM   8984  C  C     . GLU A 1  1165 ? 23.596  -19.785  116.403 1.00 138.48 ? 1165 GLU A C     1 
ATOM   8985  O  O     . GLU A 1  1165 ? 23.346  -20.970  116.649 1.00 138.52 ? 1165 GLU A O     1 
ATOM   8986  C  CB    . GLU A 1  1165 ? 21.473  -18.852  115.261 1.00 135.05 ? 1165 GLU A CB    1 
ATOM   8987  C  CG    . GLU A 1  1165 ? 21.903  -18.177  113.972 1.00 143.80 ? 1165 GLU A CG    1 
ATOM   8988  C  CD    . GLU A 1  1165 ? 21.845  -19.089  112.763 1.00 164.61 ? 1165 GLU A CD    1 
ATOM   8989  O  OE1   . GLU A 1  1165 ? 21.062  -18.792  111.831 1.00 154.84 ? 1165 GLU A OE1   1 
ATOM   8990  O  OE2   . GLU A 1  1165 ? 22.575  -20.108  112.752 1.00 159.93 ? 1165 GLU A OE2   1 
ATOM   8991  N  N     . ASP A 1  1166 ? 24.842  -19.335  116.169 1.00 134.10 ? 1166 ASP A N     1 
ATOM   8992  C  CA    . ASP A 1  1166 ? 26.045  -20.166  116.132 1.00 133.80 ? 1166 ASP A CA    1 
ATOM   8993  C  C     . ASP A 1  1166 ? 26.625  -20.441  117.529 1.00 140.56 ? 1166 ASP A C     1 
ATOM   8994  O  O     . ASP A 1  1166 ? 27.536  -21.258  117.642 1.00 140.92 ? 1166 ASP A O     1 
ATOM   8995  C  CB    . ASP A 1  1166 ? 27.121  -19.513  115.236 1.00 133.68 ? 1166 ASP A CB    1 
ATOM   8996  C  CG    . ASP A 1  1166 ? 26.823  -19.444  113.744 1.00 134.51 ? 1166 ASP A CG    1 
ATOM   8997  O  OD1   . ASP A 1  1166 ? 25.823  -20.064  113.301 1.00 132.95 ? 1166 ASP A OD1   1 
ATOM   8998  O  OD2   . ASP A 1  1166 ? 27.605  -18.795  113.017 1.00 136.27 ? 1166 ASP A OD2   1 
ATOM   8999  N  N     . GLU A 1  1167 ? 26.113  -19.765  118.585 1.00 139.05 ? 1167 GLU A N     1 
ATOM   9000  C  CA    . GLU A 1  1167 ? 26.569  -19.918  119.981 1.00 141.54 ? 1167 GLU A CA    1 
ATOM   9001  C  C     . GLU A 1  1167 ? 26.676  -21.380  120.443 1.00 146.66 ? 1167 GLU A C     1 
ATOM   9002  O  O     . GLU A 1  1167 ? 27.606  -21.732  121.172 1.00 147.85 ? 1167 GLU A O     1 
ATOM   9003  C  CB    . GLU A 1  1167 ? 25.676  -19.122  120.948 1.00 144.33 ? 1167 GLU A CB    1 
ATOM   9004  C  CG    . GLU A 1  1167 ? 26.007  -17.640  121.036 1.00 154.49 ? 1167 GLU A CG    1 
ATOM   9005  C  CD    . GLU A 1  1167 ? 25.106  -16.830  121.952 1.00 176.65 ? 1167 GLU A CD    1 
ATOM   9006  O  OE1   . GLU A 1  1167 ? 24.897  -17.253  123.112 1.00 174.18 ? 1167 GLU A OE1   1 
ATOM   9007  O  OE2   . GLU A 1  1167 ? 24.633  -15.754  121.519 1.00 170.69 ? 1167 GLU A OE2   1 
ATOM   9008  N  N     . GLU A 1  1168 ? 25.731  -22.223  120.001 1.00 142.56 ? 1168 GLU A N     1 
ATOM   9009  C  CA    . GLU A 1  1168 ? 25.693  -23.645  120.322 1.00 143.62 ? 1168 GLU A CA    1 
ATOM   9010  C  C     . GLU A 1  1168 ? 26.815  -24.418  119.625 1.00 147.27 ? 1168 GLU A C     1 
ATOM   9011  O  O     . GLU A 1  1168 ? 27.277  -25.428  120.152 1.00 148.61 ? 1168 GLU A O     1 
ATOM   9012  C  CB    . GLU A 1  1168 ? 24.329  -24.232  119.944 1.00 144.75 ? 1168 GLU A CB    1 
ATOM   9013  C  CG    . GLU A 1  1168 ? 23.500  -24.677  121.136 1.00 156.94 ? 1168 GLU A CG    1 
ATOM   9014  C  CD    . GLU A 1  1168 ? 23.886  -26.020  121.726 1.00 174.87 ? 1168 GLU A CD    1 
ATOM   9015  O  OE1   . GLU A 1  1168 ? 23.605  -27.058  121.083 1.00 151.63 ? 1168 GLU A OE1   1 
ATOM   9016  O  OE2   . GLU A 1  1168 ? 24.449  -26.035  122.845 1.00 173.33 ? 1168 GLU A OE2   1 
ATOM   9017  N  N     . ILE A 1  1169 ? 27.252  -23.940  118.449 1.00 141.90 ? 1169 ILE A N     1 
ATOM   9018  C  CA    . ILE A 1  1169 ? 28.310  -24.562  117.641 1.00 141.10 ? 1169 ILE A CA    1 
ATOM   9019  C  C     . ILE A 1  1169 ? 29.700  -24.214  118.214 1.00 147.86 ? 1169 ILE A C     1 
ATOM   9020  O  O     . ILE A 1  1169 ? 30.698  -24.821  117.820 1.00 147.22 ? 1169 ILE A O     1 
ATOM   9021  C  CB    . ILE A 1  1169 ? 28.103  -24.262  116.112 1.00 141.20 ? 1169 ILE A CB    1 
ATOM   9022  C  CG1   . ILE A 1  1169 ? 26.759  -24.838  115.611 1.00 140.84 ? 1169 ILE A CG1   1 
ATOM   9023  C  CG2   . ILE A 1  1169 ? 29.242  -24.783  115.227 1.00 140.30 ? 1169 ILE A CG2   1 
ATOM   9024  C  CD1   . ILE A 1  1169 ? 25.521  -23.928  115.758 1.00 148.14 ? 1169 ILE A CD1   1 
ATOM   9025  N  N     . ILE A 1  1170 ? 29.745  -23.276  119.185 1.00 147.41 ? 1170 ILE A N     1 
ATOM   9026  C  CA    . ILE A 1  1170 ? 30.971  -22.878  119.887 1.00 149.78 ? 1170 ILE A CA    1 
ATOM   9027  C  C     . ILE A 1  1170 ? 31.230  -23.873  121.043 1.00 160.08 ? 1170 ILE A C     1 
ATOM   9028  O  O     . ILE A 1  1170 ? 32.385  -24.147  121.391 1.00 160.30 ? 1170 ILE A O     1 
ATOM   9029  C  CB    . ILE A 1  1170 ? 30.952  -21.379  120.298 1.00 152.57 ? 1170 ILE A CB    1 
ATOM   9030  C  CG1   . ILE A 1  1170 ? 30.482  -20.444  119.132 1.00 150.07 ? 1170 ILE A CG1   1 
ATOM   9031  C  CG2   . ILE A 1  1170 ? 32.298  -20.932  120.873 1.00 154.74 ? 1170 ILE A CG2   1 
ATOM   9032  C  CD1   . ILE A 1  1170 ? 31.293  -20.489  117.764 1.00 149.67 ? 1170 ILE A CD1   1 
ATOM   9033  N  N     . GLN A 1  1171 ? 30.138  -24.475  121.566 1.00 161.18 ? 1171 GLN A N     1 
ATOM   9034  C  CA    . GLN A 1  1171 ? 30.172  -25.556  122.553 1.00 165.03 ? 1171 GLN A CA    1 
ATOM   9035  C  C     . GLN A 1  1171 ? 30.667  -26.804  121.809 1.00 172.62 ? 1171 GLN A C     1 
ATOM   9036  O  O     . GLN A 1  1171 ? 31.372  -27.629  122.378 1.00 173.20 ? 1171 GLN A O     1 
ATOM   9037  C  CB    . GLN A 1  1171 ? 28.774  -25.805  123.138 1.00 167.20 ? 1171 GLN A CB    1 
ATOM   9038  C  CG    . GLN A 1  1171 ? 28.771  -26.053  124.646 1.00 181.09 ? 1171 GLN A CG    1 
ATOM   9039  C  CD    . GLN A 1  1171 ? 28.985  -24.799  125.469 1.00 192.19 ? 1171 GLN A CD    1 
ATOM   9040  O  OE1   . GLN A 1  1171 ? 28.903  -23.663  124.977 1.00 187.76 ? 1171 GLN A OE1   1 
ATOM   9041  N  NE2   . GLN A 1  1171 ? 29.246  -24.982  126.757 1.00 184.40 ? 1171 GLN A NE2   1 
ATOM   9042  N  N     . LEU A 1  1172 ? 30.314  -26.911  120.515 1.00 171.17 ? 1172 LEU A N     1 
ATOM   9043  C  CA    . LEU A 1  1172 ? 30.794  -27.952  119.611 1.00 172.52 ? 1172 LEU A CA    1 
ATOM   9044  C  C     . LEU A 1  1172 ? 32.248  -27.569  119.263 1.00 180.56 ? 1172 LEU A C     1 
ATOM   9045  O  O     . LEU A 1  1172 ? 32.599  -26.387  119.368 1.00 179.88 ? 1172 LEU A O     1 
ATOM   9046  C  CB    . LEU A 1  1172 ? 29.938  -27.985  118.324 1.00 170.45 ? 1172 LEU A CB    1 
ATOM   9047  C  CG    . LEU A 1  1172 ? 29.027  -29.205  118.102 1.00 175.80 ? 1172 LEU A CG    1 
ATOM   9048  C  CD1   . LEU A 1  1172 ? 27.889  -28.871  117.142 1.00 174.13 ? 1172 LEU A CD1   1 
ATOM   9049  C  CD2   . LEU A 1  1172 ? 29.810  -30.402  117.574 1.00 179.10 ? 1172 LEU A CD2   1 
ATOM   9050  N  N     . HIS A 1  1173 ? 33.087  -28.567  118.876 1.00 180.72 ? 1173 HIS A N     1 
ATOM   9051  C  CA    . HIS A 1  1173 ? 34.510  -28.411  118.513 1.00 181.74 ? 1173 HIS A CA    1 
ATOM   9052  C  C     . HIS A 1  1173 ? 35.235  -27.341  119.418 1.00 188.47 ? 1173 HIS A C     1 
ATOM   9053  O  O     . HIS A 1  1173 ? 35.481  -26.206  118.986 1.00 186.35 ? 1173 HIS A O     1 
ATOM   9054  C  CB    . HIS A 1  1173 ? 34.678  -28.142  116.984 1.00 180.13 ? 1173 HIS A CB    1 
ATOM   9055  C  CG    . HIS A 1  1173 ? 34.055  -29.159  116.048 1.00 182.31 ? 1173 HIS A CG    1 
ATOM   9056  N  ND1   . HIS A 1  1173 ? 32.967  -28.836  115.244 1.00 181.80 ? 1173 HIS A ND1   1 
ATOM   9057  C  CD2   . HIS A 1  1173 ? 34.437  -30.429  115.760 1.00 184.40 ? 1173 HIS A CD2   1 
ATOM   9058  C  CE1   . HIS A 1  1173 ? 32.704  -29.922  114.533 1.00 180.55 ? 1173 HIS A CE1   1 
ATOM   9059  N  NE2   . HIS A 1  1173 ? 33.559  -30.906  114.806 1.00 182.45 ? 1173 HIS A NE2   1 
ATOM   9060  N  N     . PHE A 1  1174 ? 35.505  -27.706  120.697 1.00 188.87 ? 1174 PHE A N     1 
ATOM   9061  C  CA    . PHE A 1  1174 ? 36.107  -26.802  121.693 1.00 190.48 ? 1174 PHE A CA    1 
ATOM   9062  C  C     . PHE A 1  1174 ? 37.434  -27.278  122.367 1.00 195.25 ? 1174 PHE A C     1 
ATOM   9063  O  O     . PHE A 1  1174 ? 38.428  -26.546  122.322 1.00 195.18 ? 1174 PHE A O     1 
ATOM   9064  C  CB    . PHE A 1  1174 ? 35.048  -26.365  122.739 1.00 193.16 ? 1174 PHE A CB    1 
ATOM   9065  C  CG    . PHE A 1  1174 ? 34.739  -27.364  123.839 1.00 194.62 ? 1174 PHE A CG    1 
ATOM   9066  C  CD1   . PHE A 1  1174 ? 35.150  -27.132  125.146 1.00 196.68 ? 1174 PHE A CD1   1 
ATOM   9067  C  CD2   . PHE A 1  1174 ? 34.080  -28.559  123.557 1.00 195.89 ? 1174 PHE A CD2   1 
ATOM   9068  C  CE1   . PHE A 1  1174 ? 34.883  -28.062  126.156 1.00 197.15 ? 1174 PHE A CE1   1 
ATOM   9069  C  CE2   . PHE A 1  1174 ? 33.809  -29.484  124.569 1.00 197.38 ? 1174 PHE A CE2   1 
ATOM   9070  C  CZ    . PHE A 1  1174 ? 34.214  -29.230  125.861 1.00 196.14 ? 1174 PHE A CZ    1 
ATOM   9071  N  N     . SER A 1  1175 ? 37.435  -28.475  123.008 1.00 193.77 ? 1175 SER A N     1 
ATOM   9072  C  CA    . SER A 1  1175 ? 38.592  -29.046  123.715 1.00 193.71 ? 1175 SER A CA    1 
ATOM   9073  C  C     . SER A 1  1175 ? 38.523  -30.595  123.709 1.00 195.74 ? 1175 SER A C     1 
ATOM   9074  O  O     . SER A 1  1175 ? 38.059  -31.161  122.714 1.00 195.59 ? 1175 SER A O     1 
ATOM   9075  C  CB    . SER A 1  1175 ? 38.681  -28.484  125.135 1.00 195.87 ? 1175 SER A CB    1 
ATOM   9076  O  OG    . SER A 1  1175 ? 40.026  -28.306  125.547 1.00 200.67 ? 1175 SER A OG    1 
ATOM   9077  N  N     . LEU A 1  1176 ? 38.992  -31.271  124.796 1.00 193.01 ? 1176 LEU A N     1 
ATOM   9078  C  CA    . LEU A 1  1176 ? 39.011  -32.736  124.952 1.00 207.54 ? 1176 LEU A CA    1 
ATOM   9079  C  C     . LEU A 1  1176 ? 37.591  -33.311  124.988 1.00 225.58 ? 1176 LEU A C     1 
ATOM   9080  O  O     . LEU A 1  1176 ? 37.377  -34.453  124.585 1.00 197.73 ? 1176 LEU A O     1 
ATOM   9081  C  CB    . LEU A 1  1176 ? 39.789  -33.135  126.229 1.00 207.75 ? 1176 LEU A CB    1 
ATOM   9082  C  CG    . LEU A 1  1176 ? 40.277  -34.593  126.333 1.00 210.91 ? 1176 LEU A CG    1 
ATOM   9083  C  CD1   . LEU A 1  1176 ? 41.708  -34.657  126.825 1.00 211.08 ? 1176 LEU A CD1   1 
ATOM   9084  C  CD2   . LEU A 1  1176 ? 39.383  -35.412  127.247 1.00 212.38 ? 1176 LEU A CD2   1 
ATOM   9085  N  N     . GLN A 1  1187 ? 46.117  -15.788  116.058 1.00 137.50 ? 1187 GLN A N     1 
ATOM   9086  C  CA    . GLN A 1  1187 ? 46.357  -17.128  115.509 1.00 137.57 ? 1187 GLN A CA    1 
ATOM   9087  C  C     . GLN A 1  1187 ? 45.565  -17.447  114.206 1.00 139.23 ? 1187 GLN A C     1 
ATOM   9088  O  O     . GLN A 1  1187 ? 46.170  -17.701  113.154 1.00 138.61 ? 1187 GLN A O     1 
ATOM   9089  C  CB    . GLN A 1  1187 ? 46.184  -18.231  116.584 1.00 140.29 ? 1187 GLN A CB    1 
ATOM   9090  C  CG    . GLN A 1  1187 ? 45.004  -18.038  117.560 1.00 148.35 ? 1187 GLN A CG    1 
ATOM   9091  C  CD    . GLN A 1  1187 ? 44.056  -19.223  117.661 1.00 157.59 ? 1187 GLN A CD    1 
ATOM   9092  O  OE1   . GLN A 1  1187 ? 44.370  -20.374  117.298 1.00 149.09 ? 1187 GLN A OE1   1 
ATOM   9093  N  NE2   . GLN A 1  1187 ? 42.868  -18.964  118.193 1.00 144.96 ? 1187 GLN A NE2   1 
ATOM   9094  N  N     . GLN A 1  1188 ? 44.221  -17.413  114.285 1.00 133.47 ? 1188 GLN A N     1 
ATOM   9095  C  CA    . GLN A 1  1188 ? 43.307  -17.708  113.182 1.00 130.44 ? 1188 GLN A CA    1 
ATOM   9096  C  C     . GLN A 1  1188 ? 43.204  -16.520  112.207 1.00 132.24 ? 1188 GLN A C     1 
ATOM   9097  O  O     . GLN A 1  1188 ? 44.214  -16.129  111.608 1.00 132.19 ? 1188 GLN A O     1 
ATOM   9098  C  CB    . GLN A 1  1188 ? 41.923  -18.101  113.747 1.00 130.81 ? 1188 GLN A CB    1 
ATOM   9099  C  CG    . GLN A 1  1188 ? 41.851  -19.525  114.293 1.00 141.21 ? 1188 GLN A CG    1 
ATOM   9100  C  CD    . GLN A 1  1188 ? 40.661  -19.792  115.190 1.00 151.50 ? 1188 GLN A CD    1 
ATOM   9101  O  OE1   . GLN A 1  1188 ? 39.651  -19.073  115.195 1.00 140.78 ? 1188 GLN A OE1   1 
ATOM   9102  N  NE2   . GLN A 1  1188 ? 40.755  -20.864  115.963 1.00 144.81 ? 1188 GLN A NE2   1 
ATOM   9103  N  N     . SER A 1  1189 ? 41.962  -15.987  112.029 1.00 126.31 ? 1189 SER A N     1 
ATOM   9104  C  CA    . SER A 1  1189 ? 41.568  -14.836  111.207 1.00 123.69 ? 1189 SER A CA    1 
ATOM   9105  C  C     . SER A 1  1189 ? 40.236  -14.232  111.721 1.00 124.67 ? 1189 SER A C     1 
ATOM   9106  O  O     . SER A 1  1189 ? 39.321  -14.977  112.092 1.00 123.22 ? 1189 SER A O     1 
ATOM   9107  C  CB    . SER A 1  1189 ? 41.442  -15.225  109.737 1.00 125.31 ? 1189 SER A CB    1 
ATOM   9108  O  OG    . SER A 1  1189 ? 40.959  -14.145  108.954 1.00 130.87 ? 1189 SER A OG    1 
ATOM   9109  N  N     . PRO A 1  1190 ? 40.088  -12.885  111.725 1.00 120.34 ? 1190 PRO A N     1 
ATOM   9110  C  CA    . PRO A 1  1190 ? 38.816  -12.296  112.174 1.00 119.40 ? 1190 PRO A CA    1 
ATOM   9111  C  C     . PRO A 1  1190 ? 37.750  -12.392  111.072 1.00 122.20 ? 1190 PRO A C     1 
ATOM   9112  O  O     . PRO A 1  1190 ? 36.652  -11.840  111.187 1.00 122.32 ? 1190 PRO A O     1 
ATOM   9113  C  CB    . PRO A 1  1190 ? 39.206  -10.846  112.458 1.00 121.51 ?