data_3S67
# 
_entry.id   3S67 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3S67         
RCSB  RCSB065811   
WWPDB D_1000065811 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1G96 'Dimeric Form With 3D Domain Swapping'                               unspecified 
PDB 1R4C 'N-Truncated Human Cystatin C; Dimeric Form With 3D Domain Swapping' unspecified 
PDB 1TIJ 'Dimeric form of human cystatin C'                                   unspecified 
PDB 3GAX 'monomeric form of human cystatin C (stab1)'                         unspecified 
PDB 3NX0 'monomeric form of V57N human cystatin C'                            unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3S67 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Orlikowska, M.' 1 
'Szymanska, A.'  2 
'Borek, D.'      3 
'Otwinowski, Z.' 4 
'Skowron, P.'    5 
'Jankowska, E.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Structural characterization of V57D and V57P mutants of human cystatin C, an amyloidogenic protein.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            69 
_citation.page_first                577 
_citation.page_last                 586 
_citation.year                      2013 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23519666 
_citation.pdbx_database_id_DOI      10.1107/S0907444912051657 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Orlikowska, M.' 1 
primary 'Szymanska, A.'  2 
primary 'Borek, D.'      3 
primary 'Otwinowski, Z.' 4 
primary 'Skowron, P.'    5 
primary 'Jankowska, E.'  6 
# 
_cell.entry_id           3S67 
_cell.length_a           140.135 
_cell.length_b           140.135 
_cell.length_c           140.135 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3S67 
_symmetry.space_group_name_H-M             'I 4 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                211 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Cystatin-C              13363.124 1  ? V57P ? ? 
2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120   3  ? ?    ? ? 
3 non-polymer syn IMIDAZOLE               69.085    2  ? ?    ? ? 
4 non-polymer syn 'ACETATE ION'           59.044    3  ? ?    ? ? 
5 non-polymer syn 'CHLORIDE ION'          35.453    1  ? ?    ? ? 
6 water       nat water                   18.015    67 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cystatin-3, Gamma-trace, Neuroendocrine basic polypeptide, Post-gamma-globulin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIPAGVNYFLDVELGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIPAGVNYFLDVELGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   SER n 
1 3   PRO n 
1 4   GLY n 
1 5   LYS n 
1 6   PRO n 
1 7   PRO n 
1 8   ARG n 
1 9   LEU n 
1 10  VAL n 
1 11  GLY n 
1 12  GLY n 
1 13  PRO n 
1 14  MET n 
1 15  ASP n 
1 16  ALA n 
1 17  SER n 
1 18  VAL n 
1 19  GLU n 
1 20  GLU n 
1 21  GLU n 
1 22  GLY n 
1 23  VAL n 
1 24  ARG n 
1 25  ARG n 
1 26  ALA n 
1 27  LEU n 
1 28  ASP n 
1 29  PHE n 
1 30  ALA n 
1 31  VAL n 
1 32  GLY n 
1 33  GLU n 
1 34  TYR n 
1 35  ASN n 
1 36  LYS n 
1 37  ALA n 
1 38  SER n 
1 39  ASN n 
1 40  ASP n 
1 41  MET n 
1 42  TYR n 
1 43  HIS n 
1 44  SER n 
1 45  ARG n 
1 46  ALA n 
1 47  LEU n 
1 48  GLN n 
1 49  VAL n 
1 50  VAL n 
1 51  ARG n 
1 52  ALA n 
1 53  ARG n 
1 54  LYS n 
1 55  GLN n 
1 56  ILE n 
1 57  PRO n 
1 58  ALA n 
1 59  GLY n 
1 60  VAL n 
1 61  ASN n 
1 62  TYR n 
1 63  PHE n 
1 64  LEU n 
1 65  ASP n 
1 66  VAL n 
1 67  GLU n 
1 68  LEU n 
1 69  GLY n 
1 70  ARG n 
1 71  THR n 
1 72  THR n 
1 73  CYS n 
1 74  THR n 
1 75  LYS n 
1 76  THR n 
1 77  GLN n 
1 78  PRO n 
1 79  ASN n 
1 80  LEU n 
1 81  ASP n 
1 82  ASN n 
1 83  CYS n 
1 84  PRO n 
1 85  PHE n 
1 86  HIS n 
1 87  ASP n 
1 88  GLN n 
1 89  PRO n 
1 90  HIS n 
1 91  LEU n 
1 92  LYS n 
1 93  ARG n 
1 94  LYS n 
1 95  ALA n 
1 96  PHE n 
1 97  CYS n 
1 98  SER n 
1 99  PHE n 
1 100 GLN n 
1 101 ILE n 
1 102 TYR n 
1 103 ALA n 
1 104 VAL n 
1 105 PRO n 
1 106 TRP n 
1 107 GLN n 
1 108 GLY n 
1 109 THR n 
1 110 MET n 
1 111 THR n 
1 112 LEU n 
1 113 SER n 
1 114 LYS n 
1 115 SER n 
1 116 THR n 
1 117 CYS n 
1 118 GLN n 
1 119 ASP n 
1 120 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CST3 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               C41 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHD313 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CYTC_HUMAN 
_struct_ref.pdbx_db_accession          P01034 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNL
DNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
;
_struct_ref.pdbx_align_begin           27 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3S67 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 120 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01034 
_struct_ref_seq.db_align_beg                  27 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3S67 
_struct_ref_seq_dif.mon_id                       PRO 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      57 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P01034 
_struct_ref_seq_dif.db_mon_id                    VAL 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          83 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            57 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'           ? 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'          ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
IMD non-polymer         . IMIDAZOLE               ? 'C3 H5 N2 1'     69.085  
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3S67 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.29 
_exptl_crystal.density_percent_sol   71.33 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
;0.1M Imidazole pH=6.5  
0.9M Sodium acetate,  
additive 2.0M NDSB-221, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.pdbx_collection_date   2010-07-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97923 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97923 
# 
_reflns.entry_id                     3S67 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.26 
_reflns.number_obs                   11234 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_netI_over_sigmaI        36.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_Rsym_value              ? 
# 
_reflns_shell.d_res_high             2.26 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.16 
_reflns_shell.pdbx_redundancy        12.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3S67 
_refine.ls_number_reflns_obs                     10697 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.48 
_refine.ls_d_res_high                            2.26 
_refine.ls_percent_reflns_obs                    99.35 
_refine.ls_R_factor_obs                          0.18869 
_refine.ls_R_factor_R_work                       0.18667 
_refine.ls_R_factor_R_free                       0.22890 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  537 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.B_iso_mean                               46.279 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1G96' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.160 
_refine.overall_SU_ML                            0.104 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.080 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        871 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             67 
_refine_hist.number_atoms_total               982 
_refine_hist.d_res_high                       2.26 
_refine_hist.d_res_low                        27.48 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.016  0.022  ? 929  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 3    ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.657  1.973  ? 1243 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.323  3.000  ? 6    ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.770  5.000  ? 110  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       38.882 23.864 ? 44   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       17.230 15.000 ? 147  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       25.564 15.000 ? 7    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.116  0.200  ? 129  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.007  0.021  ? 716  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  3.815  1.500  ? 563  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 5.187  2.000  ? 898  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  9.689  3.000  ? 366  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 12.602 4.500  ? 345  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?    ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.26 
_refine_ls_shell.d_res_low                        2.322 
_refine_ls_shell.number_reflns_R_work             774 
_refine_ls_shell.R_factor_R_work                  0.279 
_refine_ls_shell.percent_reflns_obs               99.76 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3S67 
_struct.title                     'Crystal structure of V57P mutant of human cystatin C' 
_struct.pdbx_descriptor           Cystatin-C 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3S67 
_struct_keywords.pdbx_keywords   'HYDROLASE INHIBITOR' 
_struct_keywords.text            'HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 4 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 20 ? SER A 38 ? GLU A 20 SER A 38 1 ? 19 
HELX_P HELX_P2 2 ASN A 79 ? CYS A 83 ? ASN A 79 CYS A 83 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 73 SG ? ? ? 1_555 A CYS 83  SG ? ? A CYS 73 A CYS 83  1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf2 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.128 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 14  ? ASP A 15  ? MET A 14  ASP A 15  
A 2 ARG A 53  ? LYS A 54  ? ARG A 53  LYS A 54  
B 1 VAL A 60  ? GLY A 69  ? VAL A 60  GLY A 69  
B 2 LYS A 94  ? VAL A 104 ? LYS A 94  VAL A 104 
B 3 THR A 109 ? ASP A 119 ? THR A 109 ASP A 119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 14  ? N MET A 14  O LYS A 54  ? O LYS A 54  
B 1 2 N LEU A 68  ? N LEU A 68  O ALA A 95  ? O ALA A 95  
B 2 3 N TYR A 102 ? N TYR A 102 O THR A 111 ? O THR A 111 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PEG A 121' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE PEG A 122' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PEG A 123' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE IMD A 125' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACT A 127' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 128'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3 ARG A 51  ? ARG A 51  . ? 1_555  ? 
2  AC1 3 ARG A 53  ? ARG A 53  . ? 1_555  ? 
3  AC1 3 PEG D .   ? PEG A 123 . ? 1_555  ? 
4  AC2 6 ARG A 25  ? ARG A 25  . ? 2_655  ? 
5  AC2 6 VAL A 104 ? VAL A 104 . ? 1_555  ? 
6  AC2 6 GLY A 108 ? GLY A 108 . ? 1_555  ? 
7  AC2 6 THR A 109 ? THR A 109 . ? 1_555  ? 
8  AC2 6 MET A 110 ? MET A 110 . ? 1_555  ? 
9  AC2 6 HOH K .   ? HOH A 180 . ? 2_655  ? 
10 AC3 5 TYR A 42  ? TYR A 42  . ? 17_555 ? 
11 AC3 5 ARG A 51  ? ARG A 51  . ? 1_555  ? 
12 AC3 5 LEU A 91  ? LEU A 91  . ? 18_655 ? 
13 AC3 5 PEG B .   ? PEG A 121 . ? 1_555  ? 
14 AC3 5 HOH K .   ? HOH A 191 . ? 1_555  ? 
15 AC4 4 HOH K .   ? HOH A 182 . ? 1_555  ? 
16 AC4 4 HOH K .   ? HOH A 182 . ? 37_545 ? 
17 AC4 4 HOH K .   ? HOH A 184 . ? 1_555  ? 
18 AC4 4 HOH K .   ? HOH A 184 . ? 37_545 ? 
19 AC5 1 HOH K .   ? HOH A 175 . ? 19_655 ? 
20 AC6 1 LYS A 54  ? LYS A 54  . ? 1_555  ? 
# 
_database_PDB_matrix.entry_id          3S67 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3S67 
_atom_sites.fract_transf_matrix[1][1]   0.007136 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007136 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007136 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . VAL A 1 10  ? 87.301 8.609   35.195 1.00 121.42 ? 10  VAL A N   1 
ATOM   2   C  CA  . VAL A 1 10  ? 87.199 8.149   33.774 1.00 114.71 ? 10  VAL A CA  1 
ATOM   3   C  C   . VAL A 1 10  ? 85.734 7.928   33.328 1.00 105.22 ? 10  VAL A C   1 
ATOM   4   O  O   . VAL A 1 10  ? 85.279 8.552   32.365 1.00 105.59 ? 10  VAL A O   1 
ATOM   5   C  CB  . VAL A 1 10  ? 88.138 6.924   33.474 1.00 113.61 ? 10  VAL A CB  1 
ATOM   6   C  CG1 . VAL A 1 10  ? 89.587 7.259   33.861 1.00 120.37 ? 10  VAL A CG1 1 
ATOM   7   C  CG2 . VAL A 1 10  ? 87.665 5.619   34.180 1.00 111.73 ? 10  VAL A CG2 1 
ATOM   8   N  N   . GLY A 1 11  ? 85.011 7.057   34.039 1.00 97.83  ? 11  GLY A N   1 
ATOM   9   C  CA  . GLY A 1 11  ? 83.576 6.804   33.808 1.00 91.60  ? 11  GLY A CA  1 
ATOM   10  C  C   . GLY A 1 11  ? 83.201 5.879   32.649 1.00 79.22  ? 11  GLY A C   1 
ATOM   11  O  O   . GLY A 1 11  ? 82.027 5.771   32.274 1.00 80.20  ? 11  GLY A O   1 
ATOM   12  N  N   . GLY A 1 12  ? 84.196 5.213   32.073 1.00 67.79  ? 12  GLY A N   1 
ATOM   13  C  CA  . GLY A 1 12  ? 83.972 4.382   30.907 1.00 56.26  ? 12  GLY A CA  1 
ATOM   14  C  C   . GLY A 1 12  ? 83.854 2.912   31.255 1.00 49.47  ? 12  GLY A C   1 
ATOM   15  O  O   . GLY A 1 12  ? 83.745 2.553   32.438 1.00 57.19  ? 12  GLY A O   1 
ATOM   16  N  N   . PRO A 1 13  ? 83.875 2.052   30.227 1.00 43.06  ? 13  PRO A N   1 
ATOM   17  C  CA  . PRO A 1 13  ? 83.810 0.596   30.397 1.00 44.45  ? 13  PRO A CA  1 
ATOM   18  C  C   . PRO A 1 13  ? 85.061 0.091   31.093 1.00 42.09  ? 13  PRO A C   1 
ATOM   19  O  O   . PRO A 1 13  ? 86.104 0.690   30.963 1.00 46.21  ? 13  PRO A O   1 
ATOM   20  C  CB  . PRO A 1 13  ? 83.755 0.057   28.959 1.00 38.41  ? 13  PRO A CB  1 
ATOM   21  C  CG  . PRO A 1 13  ? 83.423 1.243   28.091 1.00 47.62  ? 13  PRO A CG  1 
ATOM   22  C  CD  . PRO A 1 13  ? 83.930 2.448   28.806 1.00 40.59  ? 13  PRO A CD  1 
ATOM   23  N  N   . MET A 1 14  ? 84.915 -0.997  31.839 1.00 41.24  ? 14  MET A N   1 
ATOM   24  C  CA  . MET A 1 14  ? 85.947 -1.548  32.705 1.00 48.24  ? 14  MET A CA  1 
ATOM   25  C  C   . MET A 1 14  ? 86.379 -2.847  32.029 1.00 48.77  ? 14  MET A C   1 
ATOM   26  O  O   . MET A 1 14  ? 85.550 -3.552  31.443 1.00 39.62  ? 14  MET A O   1 
ATOM   27  C  CB  . MET A 1 14  ? 85.343 -1.855  34.084 1.00 52.64  ? 14  MET A CB  1 
ATOM   28  C  CG  . MET A 1 14  ? 84.624 -0.626  34.756 1.00 83.14  ? 14  MET A CG  1 
ATOM   29  S  SD  . MET A 1 14  ? 85.703 0.456   35.764 1.00 115.35 ? 14  MET A SD  1 
ATOM   30  C  CE  . MET A 1 14  ? 85.438 2.123   35.110 1.00 114.71 ? 14  MET A CE  1 
ATOM   31  N  N   . ASP A 1 15  ? 87.673 -3.141  32.072 1.00 48.25  ? 15  ASP A N   1 
ATOM   32  C  CA  . ASP A 1 15  ? 88.191 -4.395  31.537 1.00 47.57  ? 15  ASP A CA  1 
ATOM   33  C  C   . ASP A 1 15  ? 87.492 -5.592  32.152 1.00 44.52  ? 15  ASP A C   1 
ATOM   34  O  O   . ASP A 1 15  ? 87.188 -5.592  33.339 1.00 45.05  ? 15  ASP A O   1 
ATOM   35  C  CB  . ASP A 1 15  ? 89.695 -4.485  31.811 1.00 52.24  ? 15  ASP A CB  1 
ATOM   36  C  CG  . ASP A 1 15  ? 90.481 -3.617  30.878 1.00 68.41  ? 15  ASP A CG  1 
ATOM   37  O  OD1 . ASP A 1 15  ? 90.408 -3.889  29.657 1.00 57.53  ? 15  ASP A OD1 1 
ATOM   38  O  OD2 . ASP A 1 15  ? 91.135 -2.657  31.352 1.00 71.06  ? 15  ASP A OD2 1 
ATOM   39  N  N   . ALA A 1 16  ? 87.307 -6.635  31.358 1.00 40.69  ? 16  ALA A N   1 
ATOM   40  C  CA  . ALA A 1 16  ? 86.654 -7.841  31.842 1.00 43.98  ? 16  ALA A CA  1 
ATOM   41  C  C   . ALA A 1 16  ? 87.288 -9.056  31.137 1.00 44.41  ? 16  ALA A C   1 
ATOM   42  O  O   . ALA A 1 16  ? 87.506 -9.011  29.956 1.00 52.16  ? 16  ALA A O   1 
ATOM   43  C  CB  . ALA A 1 16  ? 85.168 -7.743  31.555 1.00 29.26  ? 16  ALA A CB  1 
ATOM   44  N  N   . SER A 1 17  ? 87.624 -10.106 31.883 1.00 51.30  ? 17  SER A N   1 
ATOM   45  C  CA  . SER A 1 17  ? 88.351 -11.256 31.360 1.00 47.41  ? 17  SER A CA  1 
ATOM   46  C  C   . SER A 1 17  ? 87.569 -11.987 30.275 1.00 49.56  ? 17  SER A C   1 
ATOM   47  O  O   . SER A 1 17  ? 86.354 -12.172 30.375 1.00 45.16  ? 17  SER A O   1 
ATOM   48  C  CB  . SER A 1 17  ? 88.668 -12.241 32.498 1.00 54.16  ? 17  SER A CB  1 
ATOM   49  O  OG  . SER A 1 17  ? 89.169 -13.455 31.958 1.00 67.18  ? 17  SER A OG  1 
ATOM   50  N  N   . VAL A 1 18  ? 88.267 -12.420 29.236 1.00 57.21  ? 18  VAL A N   1 
ATOM   51  C  CA  . VAL A 1 18  ? 87.591 -13.131 28.166 1.00 48.55  ? 18  VAL A CA  1 
ATOM   52  C  C   . VAL A 1 18  ? 87.079 -14.511 28.646 1.00 54.95  ? 18  VAL A C   1 
ATOM   53  O  O   . VAL A 1 18  ? 86.249 -15.124 27.973 1.00 51.52  ? 18  VAL A O   1 
ATOM   54  C  CB  . VAL A 1 18  ? 88.490 -13.221 26.925 1.00 57.47  ? 18  VAL A CB  1 
ATOM   55  C  CG1 . VAL A 1 18  ? 89.802 -13.970 27.257 1.00 70.34  ? 18  VAL A CG1 1 
ATOM   56  C  CG2 . VAL A 1 18  ? 87.734 -13.845 25.777 1.00 54.78  ? 18  VAL A CG2 1 
ATOM   57  N  N   . GLU A 1 19  ? 87.557 -14.977 29.809 1.00 55.16  ? 19  GLU A N   1 
ATOM   58  C  CA  . GLU A 1 19  ? 87.030 -16.203 30.449 1.00 65.04  ? 19  GLU A CA  1 
ATOM   59  C  C   . GLU A 1 19  ? 85.681 -16.077 31.141 1.00 58.19  ? 19  GLU A C   1 
ATOM   60  O  O   . GLU A 1 19  ? 85.106 -17.078 31.555 1.00 65.69  ? 19  GLU A O   1 
ATOM   61  C  CB  . GLU A 1 19  ? 87.981 -16.749 31.515 1.00 67.27  ? 19  GLU A CB  1 
ATOM   62  C  CG  . GLU A 1 19  ? 88.759 -17.929 31.070 1.00 94.97  ? 19  GLU A CG  1 
ATOM   63  C  CD  . GLU A 1 19  ? 90.211 -17.595 30.967 1.00 112.18 ? 19  GLU A CD  1 
ATOM   64  O  OE1 . GLU A 1 19  ? 90.591 -16.915 29.986 1.00 115.41 ? 19  GLU A OE1 1 
ATOM   65  O  OE2 . GLU A 1 19  ? 90.960 -18.002 31.881 1.00 105.78 ? 19  GLU A OE2 1 
ATOM   66  N  N   . GLU A 1 20  ? 85.227 -14.856 31.344 1.00 49.97  ? 20  GLU A N   1 
ATOM   67  C  CA  . GLU A 1 20  ? 84.004 -14.592 32.096 1.00 53.42  ? 20  GLU A CA  1 
ATOM   68  C  C   . GLU A 1 20  ? 82.865 -15.014 31.185 1.00 46.53  ? 20  GLU A C   1 
ATOM   69  O  O   . GLU A 1 20  ? 82.905 -14.719 29.991 1.00 41.95  ? 20  GLU A O   1 
ATOM   70  C  CB  . GLU A 1 20  ? 83.971 -13.091 32.358 1.00 48.37  ? 20  GLU A CB  1 
ATOM   71  C  CG  . GLU A 1 20  ? 82.802 -12.538 33.100 1.00 62.55  ? 20  GLU A CG  1 
ATOM   72  C  CD  . GLU A 1 20  ? 83.127 -11.134 33.628 1.00 75.30  ? 20  GLU A CD  1 
ATOM   73  O  OE1 . GLU A 1 20  ? 82.240 -10.257 33.543 1.00 61.69  ? 20  GLU A OE1 1 
ATOM   74  O  OE2 . GLU A 1 20  ? 84.271 -10.908 34.116 1.00 61.66  ? 20  GLU A OE2 1 
ATOM   75  N  N   . GLU A 1 21  ? 81.853 -15.686 31.720 1.00 47.18  ? 21  GLU A N   1 
ATOM   76  C  CA  . GLU A 1 21  ? 80.827 -16.294 30.864 1.00 49.85  ? 21  GLU A CA  1 
ATOM   77  C  C   . GLU A 1 21  ? 80.079 -15.285 29.955 1.00 43.94  ? 21  GLU A C   1 
ATOM   78  O  O   . GLU A 1 21  ? 79.790 -15.583 28.799 1.00 46.02  ? 21  GLU A O   1 
ATOM   79  C  CB  . GLU A 1 21  ? 79.851 -17.169 31.667 1.00 55.02  ? 21  GLU A CB  1 
ATOM   80  C  CG  . GLU A 1 21  ? 78.411 -17.041 31.177 1.00 67.33  ? 21  GLU A CG  1 
ATOM   81  C  CD  . GLU A 1 21  ? 77.648 -18.333 31.253 1.00 104.96 ? 21  GLU A CD  1 
ATOM   82  O  OE1 . GLU A 1 21  ? 77.943 -19.236 30.433 1.00 122.96 ? 21  GLU A OE1 1 
ATOM   83  O  OE2 . GLU A 1 21  ? 76.747 -18.445 32.117 1.00 100.18 ? 21  GLU A OE2 1 
ATOM   84  N  N   . GLY A 1 22  ? 79.768 -14.112 30.479 1.00 37.34  ? 22  GLY A N   1 
ATOM   85  C  CA  . GLY A 1 22  ? 79.082 -13.098 29.690 1.00 36.04  ? 22  GLY A CA  1 
ATOM   86  C  C   . GLY A 1 22  ? 79.924 -12.583 28.535 1.00 36.35  ? 22  GLY A C   1 
ATOM   87  O  O   . GLY A 1 22  ? 79.409 -12.344 27.431 1.00 35.94  ? 22  GLY A O   1 
ATOM   88  N  N   . VAL A 1 23  ? 81.224 -12.407 28.787 1.00 35.24  ? 23  VAL A N   1 
ATOM   89  C  CA  . VAL A 1 23  ? 82.139 -11.891 27.779 1.00 25.83  ? 23  VAL A CA  1 
ATOM   90  C  C   . VAL A 1 23  ? 82.265 -12.916 26.645 1.00 30.36  ? 23  VAL A C   1 
ATOM   91  O  O   . VAL A 1 23  ? 82.156 -12.591 25.465 1.00 37.30  ? 23  VAL A O   1 
ATOM   92  C  CB  . VAL A 1 23  ? 83.538 -11.568 28.381 1.00 32.35  ? 23  VAL A CB  1 
ATOM   93  C  CG1 . VAL A 1 23  ? 84.486 -11.112 27.289 1.00 27.50  ? 23  VAL A CG1 1 
ATOM   94  C  CG2 . VAL A 1 23  ? 83.429 -10.491 29.400 1.00 29.37  ? 23  VAL A CG2 1 
ATOM   95  N  N   . ARG A 1 24  ? 82.451 -14.171 27.013 1.00 28.61  ? 24  ARG A N   1 
ATOM   96  C  CA  . ARG A 1 24  ? 82.599 -15.234 26.027 1.00 33.71  ? 24  ARG A CA  1 
ATOM   97  C  C   . ARG A 1 24  ? 81.302 -15.427 25.227 1.00 31.06  ? 24  ARG A C   1 
ATOM   98  O  O   . ARG A 1 24  ? 81.351 -15.682 24.027 1.00 36.26  ? 24  ARG A O   1 
ATOM   99  C  CB  . ARG A 1 24  ? 83.058 -16.541 26.707 1.00 35.67  ? 24  ARG A CB  1 
ATOM   100 C  CG  . ARG A 1 24  ? 83.335 -17.695 25.742 1.00 53.32  ? 24  ARG A CG  1 
ATOM   101 C  CD  . ARG A 1 24  ? 84.277 -17.322 24.540 1.00 57.86  ? 24  ARG A CD  1 
ATOM   102 N  NE  . ARG A 1 24  ? 84.487 -18.455 23.617 1.00 78.58  ? 24  ARG A NE  1 
ATOM   103 C  CZ  . ARG A 1 24  ? 85.130 -19.578 23.943 1.00 95.07  ? 24  ARG A CZ  1 
ATOM   104 N  NH1 . ARG A 1 24  ? 85.634 -19.724 25.165 1.00 87.15  ? 24  ARG A NH1 1 
ATOM   105 N  NH2 . ARG A 1 24  ? 85.275 -20.557 23.051 1.00 111.68 ? 24  ARG A NH2 1 
ATOM   106 N  N   . ARG A 1 25  ? 80.142 -15.308 25.880 1.00 30.16  ? 25  ARG A N   1 
ATOM   107 C  CA  . ARG A 1 25  ? 78.877 -15.434 25.137 1.00 33.83  ? 25  ARG A CA  1 
ATOM   108 C  C   . ARG A 1 25  ? 78.775 -14.297 24.150 1.00 34.31  ? 25  ARG A C   1 
ATOM   109 O  O   . ARG A 1 25  ? 78.321 -14.490 23.035 1.00 32.74  ? 25  ARG A O   1 
ATOM   110 C  CB  . ARG A 1 25  ? 77.680 -15.384 26.076 1.00 37.93  ? 25  ARG A CB  1 
ATOM   111 C  CG  . ARG A 1 25  ? 77.601 -16.576 26.972 1.00 44.64  ? 25  ARG A CG  1 
ATOM   112 C  CD  . ARG A 1 25  ? 76.220 -16.683 27.658 1.00 69.25  ? 25  ARG A CD  1 
ATOM   113 N  NE  . ARG A 1 25  ? 75.583 -17.910 27.175 1.00 110.96 ? 25  ARG A NE  1 
ATOM   114 C  CZ  . ARG A 1 25  ? 75.156 -18.924 27.933 1.00 120.42 ? 25  ARG A CZ  1 
ATOM   115 N  NH1 . ARG A 1 25  ? 75.226 -18.867 29.257 1.00 113.32 ? 25  ARG A NH1 1 
ATOM   116 N  NH2 . ARG A 1 25  ? 74.610 -19.990 27.357 1.00 122.50 ? 25  ARG A NH2 1 
ATOM   117 N  N   . ALA A 1 26  ? 79.238 -13.116 24.554 1.00 28.19  ? 26  ALA A N   1 
ATOM   118 C  CA  . ALA A 1 26  ? 79.110 -11.921 23.694 1.00 28.67  ? 26  ALA A CA  1 
ATOM   119 C  C   . ALA A 1 26  ? 80.054 -12.032 22.511 1.00 26.75  ? 26  ALA A C   1 
ATOM   120 O  O   . ALA A 1 26  ? 79.704 -11.650 21.396 1.00 30.28  ? 26  ALA A O   1 
ATOM   121 C  CB  . ALA A 1 26  ? 79.447 -10.660 24.510 1.00 22.64  ? 26  ALA A CB  1 
ATOM   122 N  N   . LEU A 1 27  ? 81.255 -12.577 22.772 1.00 28.49  ? 27  LEU A N   1 
ATOM   123 C  CA  . LEU A 1 27  ? 82.221 -12.867 21.742 1.00 31.96  ? 27  LEU A CA  1 
ATOM   124 C  C   . LEU A 1 27  ? 81.674 -13.918 20.754 1.00 34.83  ? 27  LEU A C   1 
ATOM   125 O  O   . LEU A 1 27  ? 81.681 -13.686 19.540 1.00 33.99  ? 27  LEU A O   1 
ATOM   126 C  CB  . LEU A 1 27  ? 83.547 -13.362 22.369 1.00 27.37  ? 27  LEU A CB  1 
ATOM   127 C  CG  . LEU A 1 27  ? 84.532 -13.797 21.283 1.00 34.44  ? 27  LEU A CG  1 
ATOM   128 C  CD1 . LEU A 1 27  ? 84.859 -12.552 20.467 1.00 31.86  ? 27  LEU A CD1 1 
ATOM   129 C  CD2 . LEU A 1 27  ? 85.819 -14.450 21.862 1.00 37.18  ? 27  LEU A CD2 1 
ATOM   130 N  N   . ASP A 1 28  ? 81.212 -15.070 21.253 1.00 30.21  ? 28  ASP A N   1 
ATOM   131 C  CA  . ASP A 1 28  ? 80.571 -16.054 20.344 1.00 35.56  ? 28  ASP A CA  1 
ATOM   132 C  C   . ASP A 1 28  ? 79.386 -15.459 19.547 1.00 36.58  ? 28  ASP A C   1 
ATOM   133 O  O   . ASP A 1 28  ? 79.250 -15.681 18.347 1.00 30.76  ? 28  ASP A O   1 
ATOM   134 C  CB  . ASP A 1 28  ? 80.108 -17.288 21.106 1.00 36.48  ? 28  ASP A CB  1 
ATOM   135 C  CG  . ASP A 1 28  ? 81.272 -18.106 21.649 1.00 51.41  ? 28  ASP A CG  1 
ATOM   136 O  OD1 . ASP A 1 28  ? 81.029 -18.930 22.561 1.00 64.06  ? 28  ASP A OD1 1 
ATOM   137 O  OD2 . ASP A 1 28  ? 82.427 -17.927 21.169 1.00 50.93  ? 28  ASP A OD2 1 
ATOM   138 N  N   . PHE A 1 29  ? 78.543 -14.681 20.217 1.00 30.70  ? 29  PHE A N   1 
ATOM   139 C  CA  . PHE A 1 29  ? 77.444 -14.015 19.527 1.00 31.52  ? 29  PHE A CA  1 
ATOM   140 C  C   . PHE A 1 29  ? 77.929 -13.116 18.372 1.00 32.47  ? 29  PHE A C   1 
ATOM   141 O  O   . PHE A 1 29  ? 77.400 -13.179 17.263 1.00 32.90  ? 29  PHE A O   1 
ATOM   142 C  CB  . PHE A 1 29  ? 76.589 -13.208 20.530 1.00 29.29  ? 29  PHE A CB  1 
ATOM   143 C  CG  . PHE A 1 29  ? 75.542 -12.348 19.868 1.00 37.04  ? 29  PHE A CG  1 
ATOM   144 C  CD1 . PHE A 1 29  ? 74.368 -12.918 19.395 1.00 27.29  ? 29  PHE A CD1 1 
ATOM   145 C  CD2 . PHE A 1 29  ? 75.740 -10.979 19.709 1.00 30.49  ? 29  PHE A CD2 1 
ATOM   146 C  CE1 . PHE A 1 29  ? 73.376 -12.142 18.775 1.00 42.29  ? 29  PHE A CE1 1 
ATOM   147 C  CE2 . PHE A 1 29  ? 74.752 -10.182 19.090 1.00 34.60  ? 29  PHE A CE2 1 
ATOM   148 C  CZ  . PHE A 1 29  ? 73.574 -10.770 18.632 1.00 30.67  ? 29  PHE A CZ  1 
ATOM   149 N  N   . ALA A 1 30  ? 78.915 -12.264 18.638 1.00 30.20  ? 30  ALA A N   1 
ATOM   150 C  CA  . ALA A 1 30  ? 79.329 -11.242 17.659 1.00 30.37  ? 30  ALA A CA  1 
ATOM   151 C  C   . ALA A 1 30  ? 79.979 -11.863 16.441 1.00 28.79  ? 30  ALA A C   1 
ATOM   152 O  O   . ALA A 1 30  ? 79.737 -11.450 15.301 1.00 32.52  ? 30  ALA A O   1 
ATOM   153 C  CB  . ALA A 1 30  ? 80.308 -10.246 18.300 1.00 27.44  ? 30  ALA A CB  1 
ATOM   154 N  N   . VAL A 1 31  ? 80.842 -12.825 16.697 1.00 26.60  ? 31  VAL A N   1 
ATOM   155 C  CA  . VAL A 1 31  ? 81.494 -13.593 15.631 1.00 30.35  ? 31  VAL A CA  1 
ATOM   156 C  C   . VAL A 1 31  ? 80.436 -14.361 14.819 1.00 32.18  ? 31  VAL A C   1 
ATOM   157 O  O   . VAL A 1 31  ? 80.510 -14.398 13.603 1.00 33.11  ? 31  VAL A O   1 
ATOM   158 C  CB  . VAL A 1 31  ? 82.562 -14.547 16.223 1.00 31.97  ? 31  VAL A CB  1 
ATOM   159 C  CG1 . VAL A 1 31  ? 83.105 -15.502 15.162 1.00 31.33  ? 31  VAL A CG1 1 
ATOM   160 C  CG2 . VAL A 1 31  ? 83.722 -13.717 16.807 1.00 32.51  ? 31  VAL A CG2 1 
ATOM   161 N  N   . GLY A 1 32  ? 79.414 -14.909 15.489 1.00 31.33  ? 32  GLY A N   1 
ATOM   162 C  CA  . GLY A 1 32  ? 78.315 -15.597 14.778 1.00 29.37  ? 32  GLY A CA  1 
ATOM   163 C  C   . GLY A 1 32  ? 77.570 -14.623 13.855 1.00 35.95  ? 32  GLY A C   1 
ATOM   164 O  O   . GLY A 1 32  ? 77.213 -14.991 12.720 1.00 36.37  ? 32  GLY A O   1 
ATOM   165 N  N   . GLU A 1 33  ? 77.332 -13.383 14.319 1.00 32.43  ? 33  GLU A N   1 
ATOM   166 C  CA  . GLU A 1 33  ? 76.665 -12.350 13.485 1.00 34.58  ? 33  GLU A CA  1 
ATOM   167 C  C   . GLU A 1 33  ? 77.554 -11.876 12.337 1.00 31.26  ? 33  GLU A C   1 
ATOM   168 O  O   . GLU A 1 33  ? 77.099 -11.627 11.231 1.00 32.38  ? 33  GLU A O   1 
ATOM   169 C  CB  . GLU A 1 33  ? 76.234 -11.139 14.312 1.00 33.87  ? 33  GLU A CB  1 
ATOM   170 C  CG  . GLU A 1 33  ? 75.158 -11.467 15.382 1.00 35.91  ? 33  GLU A CG  1 
ATOM   171 C  CD  . GLU A 1 33  ? 73.857 -11.958 14.769 1.00 53.10  ? 33  GLU A CD  1 
ATOM   172 O  OE1 . GLU A 1 33  ? 73.497 -13.129 15.016 1.00 54.85  ? 33  GLU A OE1 1 
ATOM   173 O  OE2 . GLU A 1 33  ? 73.200 -11.179 14.039 1.00 57.41  ? 33  GLU A OE2 1 
ATOM   174 N  N   . TYR A 1 34  ? 78.832 -11.717 12.619 1.00 25.65  ? 34  TYR A N   1 
ATOM   175 C  CA  . TYR A 1 34  ? 79.786 -11.396 11.583 1.00 29.38  ? 34  TYR A CA  1 
ATOM   176 C  C   . TYR A 1 34  ? 79.710 -12.446 10.454 1.00 29.06  ? 34  TYR A C   1 
ATOM   177 O  O   . TYR A 1 34  ? 79.603 -12.117 9.251  1.00 33.83  ? 34  TYR A O   1 
ATOM   178 C  CB  . TYR A 1 34  ? 81.215 -11.402 12.183 1.00 32.47  ? 34  TYR A CB  1 
ATOM   179 C  CG  . TYR A 1 34  ? 82.253 -11.068 11.135 1.00 30.45  ? 34  TYR A CG  1 
ATOM   180 C  CD1 . TYR A 1 34  ? 82.572 -9.739  10.850 1.00 39.25  ? 34  TYR A CD1 1 
ATOM   181 C  CD2 . TYR A 1 34  ? 82.850 -12.071 10.379 1.00 39.47  ? 34  TYR A CD2 1 
ATOM   182 C  CE1 . TYR A 1 34  ? 83.502 -9.410  9.891  1.00 46.64  ? 34  TYR A CE1 1 
ATOM   183 C  CE2 . TYR A 1 34  ? 83.780 -11.745 9.379  1.00 39.72  ? 34  TYR A CE2 1 
ATOM   184 C  CZ  . TYR A 1 34  ? 84.097 -10.420 9.153  1.00 50.96  ? 34  TYR A CZ  1 
ATOM   185 O  OH  . TYR A 1 34  ? 85.003 -10.109 8.180  1.00 63.27  ? 34  TYR A OH  1 
ATOM   186 N  N   . ASN A 1 35  ? 79.775 -13.717 10.826 1.00 27.11  ? 35  ASN A N   1 
ATOM   187 C  CA  . ASN A 1 35  ? 79.739 -14.783 9.813  1.00 26.98  ? 35  ASN A CA  1 
ATOM   188 C  C   . ASN A 1 35  ? 78.400 -14.854 9.115  1.00 33.03  ? 35  ASN A C   1 
ATOM   189 O  O   . ASN A 1 35  ? 78.348 -15.125 7.929  1.00 32.06  ? 35  ASN A O   1 
ATOM   190 C  CB  . ASN A 1 35  ? 80.062 -16.149 10.444 1.00 29.11  ? 35  ASN A CB  1 
ATOM   191 C  CG  . ASN A 1 35  ? 81.555 -16.373 10.603 1.00 32.99  ? 35  ASN A CG  1 
ATOM   192 O  OD1 . ASN A 1 35  ? 82.298 -16.268 9.631  1.00 28.40  ? 35  ASN A OD1 1 
ATOM   193 N  ND2 . ASN A 1 35  ? 82.007 -16.682 11.830 1.00 26.05  ? 35  ASN A ND2 1 
ATOM   194 N  N   . LYS A 1 36  ? 77.309 -14.646 9.848  1.00 30.31  ? 36  LYS A N   1 
ATOM   195 C  CA  . LYS A 1 36  ? 75.970 -14.711 9.222  1.00 40.64  ? 36  LYS A CA  1 
ATOM   196 C  C   . LYS A 1 36  ? 75.819 -13.613 8.168  1.00 46.82  ? 36  LYS A C   1 
ATOM   197 O  O   . LYS A 1 36  ? 75.256 -13.854 7.090  1.00 46.34  ? 36  LYS A O   1 
ATOM   198 C  CB  . LYS A 1 36  ? 74.853 -14.600 10.286 1.00 34.40  ? 36  LYS A CB  1 
ATOM   199 C  CG  . LYS A 1 36  ? 73.403 -14.465 9.749  1.00 62.83  ? 36  LYS A CG  1 
ATOM   200 C  CD  . LYS A 1 36  ? 72.347 -14.164 10.865 1.00 68.54  ? 36  LYS A CD  1 
ATOM   201 C  CE  . LYS A 1 36  ? 70.932 -13.859 10.258 1.00 75.64  ? 36  LYS A CE  1 
ATOM   202 N  NZ  . LYS A 1 36  ? 69.826 -13.532 11.279 1.00 63.52  ? 36  LYS A NZ  1 
ATOM   203 N  N   . ALA A 1 37  ? 76.314 -12.414 8.492  1.00 43.26  ? 37  ALA A N   1 
ATOM   204 C  CA  . ALA A 1 37  ? 76.243 -11.269 7.590  1.00 47.67  ? 37  ALA A CA  1 
ATOM   205 C  C   . ALA A 1 37  ? 77.328 -11.239 6.490  1.00 46.51  ? 37  ALA A C   1 
ATOM   206 O  O   . ALA A 1 37  ? 77.179 -10.491 5.527  1.00 45.94  ? 37  ALA A O   1 
ATOM   207 C  CB  . ALA A 1 37  ? 76.251 -9.942  8.392  1.00 45.70  ? 37  ALA A CB  1 
ATOM   208 N  N   . SER A 1 38  ? 78.404 -12.030 6.579  1.00 43.19  ? 38  SER A N   1 
ATOM   209 C  CA  . SER A 1 38  ? 79.390 -11.909 5.497  1.00 37.89  ? 38  SER A CA  1 
ATOM   210 C  C   . SER A 1 38  ? 78.943 -12.651 4.228  1.00 42.35  ? 38  SER A C   1 
ATOM   211 O  O   . SER A 1 38  ? 78.117 -13.558 4.269  1.00 44.23  ? 38  SER A O   1 
ATOM   212 C  CB  . SER A 1 38  ? 80.777 -12.339 5.914  1.00 32.76  ? 38  SER A CB  1 
ATOM   213 O  OG  . SER A 1 38  ? 80.823 -13.734 5.841  1.00 41.60  ? 38  SER A OG  1 
ATOM   214 N  N   . ASN A 1 39  ? 79.492 -12.259 3.095  1.00 40.11  ? 39  ASN A N   1 
ATOM   215 C  CA  . ASN A 1 39  ? 79.178 -12.924 1.857  1.00 38.01  ? 39  ASN A CA  1 
ATOM   216 C  C   . ASN A 1 39  ? 80.188 -14.031 1.586  1.00 31.59  ? 39  ASN A C   1 
ATOM   217 O  O   . ASN A 1 39  ? 80.278 -14.534 0.462  1.00 30.53  ? 39  ASN A O   1 
ATOM   218 C  CB  . ASN A 1 39  ? 79.252 -11.915 0.731  1.00 42.85  ? 39  ASN A CB  1 
ATOM   219 C  CG  . ASN A 1 39  ? 78.143 -10.868 0.801  1.00 71.03  ? 39  ASN A CG  1 
ATOM   220 O  OD1 . ASN A 1 39  ? 76.959 -11.201 0.827  1.00 69.98  ? 39  ASN A OD1 1 
ATOM   221 N  ND2 . ASN A 1 39  ? 78.527 -9.597  0.800  1.00 74.12  ? 39  ASN A ND2 1 
ATOM   222 N  N   . ASP A 1 40  ? 80.964 -14.390 2.598  1.00 29.98  ? 40  ASP A N   1 
ATOM   223 C  CA  . ASP A 1 40  ? 82.089 -15.306 2.438  1.00 25.80  ? 40  ASP A CA  1 
ATOM   224 C  C   . ASP A 1 40  ? 81.654 -16.745 2.632  1.00 32.69  ? 40  ASP A C   1 
ATOM   225 O  O   . ASP A 1 40  ? 80.912 -17.041 3.557  1.00 35.76  ? 40  ASP A O   1 
ATOM   226 C  CB  . ASP A 1 40  ? 83.191 -14.939 3.449  1.00 27.34  ? 40  ASP A CB  1 
ATOM   227 C  CG  . ASP A 1 40  ? 84.503 -15.665 3.181  1.00 33.53  ? 40  ASP A CG  1 
ATOM   228 O  OD1 . ASP A 1 40  ? 84.589 -16.479 2.254  1.00 30.53  ? 40  ASP A OD1 1 
ATOM   229 O  OD2 . ASP A 1 40  ? 85.460 -15.400 3.903  1.00 32.90  ? 40  ASP A OD2 1 
ATOM   230 N  N   . MET A 1 41  ? 82.115 -17.662 1.775  1.00 26.91  ? 41  MET A N   1 
ATOM   231 C  CA  . MET A 1 41  ? 81.707 -19.046 1.967  1.00 27.09  ? 41  MET A CA  1 
ATOM   232 C  C   . MET A 1 41  ? 82.521 -19.684 3.077  1.00 29.16  ? 41  MET A C   1 
ATOM   233 O  O   . MET A 1 41  ? 82.126 -20.738 3.615  1.00 31.17  ? 41  MET A O   1 
ATOM   234 C  CB  . MET A 1 41  ? 81.848 -19.866 0.689  1.00 29.31  ? 41  MET A CB  1 
ATOM   235 C  CG  . MET A 1 41  ? 83.316 -19.927 0.182  1.00 24.84  ? 41  MET A CG  1 
ATOM   236 S  SD  . MET A 1 41  ? 83.238 -20.536 -1.522 1.00 32.05  ? 41  MET A SD  1 
ATOM   237 C  CE  . MET A 1 41  ? 84.894 -21.186 -1.706 1.00 28.93  ? 41  MET A CE  1 
ATOM   238 N  N   . TYR A 1 42  ? 83.665 -19.078 3.414  1.00 28.04  ? 42  TYR A N   1 
ATOM   239 C  CA  . TYR A 1 42  ? 84.492 -19.585 4.505  1.00 26.86  ? 42  TYR A CA  1 
ATOM   240 C  C   . TYR A 1 42  ? 84.086 -18.971 5.836  1.00 23.65  ? 42  TYR A C   1 
ATOM   241 O  O   . TYR A 1 42  ? 83.671 -17.794 5.928  1.00 33.85  ? 42  TYR A O   1 
ATOM   242 C  CB  . TYR A 1 42  ? 85.975 -19.302 4.265  1.00 24.83  ? 42  TYR A CB  1 
ATOM   243 C  CG  . TYR A 1 42  ? 86.544 -20.071 3.099  1.00 28.06  ? 42  TYR A CG  1 
ATOM   244 C  CD1 . TYR A 1 42  ? 86.864 -21.415 3.224  1.00 29.93  ? 42  TYR A CD1 1 
ATOM   245 C  CD2 . TYR A 1 42  ? 86.766 -19.451 1.867  1.00 21.85  ? 42  TYR A CD2 1 
ATOM   246 C  CE1 . TYR A 1 42  ? 87.412 -22.145 2.142  1.00 27.17  ? 42  TYR A CE1 1 
ATOM   247 C  CE2 . TYR A 1 42  ? 87.307 -20.163 0.788  1.00 30.98  ? 42  TYR A CE2 1 
ATOM   248 C  CZ  . TYR A 1 42  ? 87.621 -21.504 0.939  1.00 29.22  ? 42  TYR A CZ  1 
ATOM   249 O  OH  . TYR A 1 42  ? 88.137 -22.213 -0.104 1.00 33.12  ? 42  TYR A OH  1 
ATOM   250 N  N   . HIS A 1 43  ? 84.267 -19.766 6.869  1.00 28.85  ? 43  HIS A N   1 
ATOM   251 C  CA  . HIS A 1 43  ? 84.039 -19.354 8.242  1.00 29.64  ? 43  HIS A CA  1 
ATOM   252 C  C   . HIS A 1 43  ? 85.236 -18.525 8.738  1.00 29.60  ? 43  HIS A C   1 
ATOM   253 O  O   . HIS A 1 43  ? 86.382 -18.893 8.464  1.00 29.28  ? 43  HIS A O   1 
ATOM   254 C  CB  . HIS A 1 43  ? 83.909 -20.641 9.055  1.00 30.08  ? 43  HIS A CB  1 
ATOM   255 C  CG  . HIS A 1 43  ? 83.735 -20.421 10.525 1.00 29.03  ? 43  HIS A CG  1 
ATOM   256 N  ND1 . HIS A 1 43  ? 82.533 -20.046 11.076 1.00 34.52  ? 43  HIS A ND1 1 
ATOM   257 C  CD2 . HIS A 1 43  ? 84.594 -20.589 11.569 1.00 31.10  ? 43  HIS A CD2 1 
ATOM   258 C  CE1 . HIS A 1 43  ? 82.664 -19.943 12.395 1.00 37.93  ? 43  HIS A CE1 1 
ATOM   259 N  NE2 . HIS A 1 43  ? 83.900 -20.278 12.722 1.00 31.51  ? 43  HIS A NE2 1 
ATOM   260 N  N   . SER A 1 44  ? 84.977 -17.419 9.450  1.00 33.31  ? 44  SER A N   1 
ATOM   261 C  CA  . SER A 1 44  ? 86.019 -16.678 10.208 1.00 30.04  ? 44  SER A CA  1 
ATOM   262 C  C   . SER A 1 44  ? 85.876 -16.877 11.717 1.00 35.12  ? 44  SER A C   1 
ATOM   263 O  O   . SER A 1 44  ? 84.757 -17.044 12.255 1.00 30.14  ? 44  SER A O   1 
ATOM   264 C  CB  . SER A 1 44  ? 85.949 -15.177 9.902  1.00 30.11  ? 44  SER A CB  1 
ATOM   265 O  OG  . SER A 1 44  ? 86.475 -14.931 8.606  1.00 28.93  ? 44  SER A OG  1 
ATOM   266 N  N   . ARG A 1 45  ? 86.997 -16.836 12.428 1.00 31.18  ? 45  ARG A N   1 
ATOM   267 C  CA  . ARG A 1 45  ? 86.924 -16.932 13.888 1.00 30.65  ? 45  ARG A CA  1 
ATOM   268 C  C   . ARG A 1 45  ? 88.018 -16.074 14.501 1.00 30.45  ? 45  ARG A C   1 
ATOM   269 O  O   . ARG A 1 45  ? 88.943 -15.669 13.781 1.00 32.12  ? 45  ARG A O   1 
ATOM   270 C  CB  . ARG A 1 45  ? 87.025 -18.398 14.361 1.00 26.79  ? 45  ARG A CB  1 
ATOM   271 C  CG  . ARG A 1 45  ? 88.354 -19.042 14.012 1.00 32.62  ? 45  ARG A CG  1 
ATOM   272 C  CD  . ARG A 1 45  ? 88.391 -20.493 14.485 1.00 35.67  ? 45  ARG A CD  1 
ATOM   273 N  NE  . ARG A 1 45  ? 89.637 -21.187 14.116 1.00 40.00  ? 45  ARG A NE  1 
ATOM   274 C  CZ  . ARG A 1 45  ? 90.743 -21.219 14.866 1.00 42.36  ? 45  ARG A CZ  1 
ATOM   275 N  NH1 . ARG A 1 45  ? 90.798 -20.578 16.030 1.00 46.34  ? 45  ARG A NH1 1 
ATOM   276 N  NH2 . ARG A 1 45  ? 91.808 -21.886 14.444 1.00 42.72  ? 45  ARG A NH2 1 
ATOM   277 N  N   . ALA A 1 46  ? 87.912 -15.795 15.807 1.00 30.57  ? 46  ALA A N   1 
ATOM   278 C  CA  . ALA A 1 46  ? 88.872 -14.958 16.523 1.00 30.09  ? 46  ALA A CA  1 
ATOM   279 C  C   . ALA A 1 46  ? 90.239 -15.573 16.513 1.00 35.70  ? 46  ALA A C   1 
ATOM   280 O  O   . ALA A 1 46  ? 90.394 -16.738 16.887 1.00 40.14  ? 46  ALA A O   1 
ATOM   281 C  CB  . ALA A 1 46  ? 88.428 -14.759 18.003 1.00 28.17  ? 46  ALA A CB  1 
ATOM   282 N  N   . LEU A 1 47  ? 91.224 -14.795 16.064 1.00 34.31  ? 47  LEU A N   1 
ATOM   283 C  CA  . LEU A 1 47  ? 92.648 -15.099 16.252 1.00 36.35  ? 47  LEU A CA  1 
ATOM   284 C  C   . LEU A 1 47  ? 93.105 -14.634 17.638 1.00 38.20  ? 47  LEU A C   1 
ATOM   285 O  O   . LEU A 1 47  ? 93.931 -15.260 18.280 1.00 44.92  ? 47  LEU A O   1 
ATOM   286 C  CB  . LEU A 1 47  ? 93.487 -14.305 15.240 1.00 44.11  ? 47  LEU A CB  1 
ATOM   287 C  CG  . LEU A 1 47  ? 93.945 -14.882 13.901 1.00 60.26  ? 47  LEU A CG  1 
ATOM   288 C  CD1 . LEU A 1 47  ? 94.123 -13.785 12.828 1.00 59.89  ? 47  LEU A CD1 1 
ATOM   289 C  CD2 . LEU A 1 47  ? 95.244 -15.619 14.121 1.00 71.67  ? 47  LEU A CD2 1 
ATOM   290 N  N   . GLN A 1 48  ? 92.568 -13.504 18.100 1.00 37.52  ? 48  GLN A N   1 
ATOM   291 C  CA  . GLN A 1 48  ? 93.061 -12.859 19.316 1.00 40.91  ? 48  GLN A CA  1 
ATOM   292 C  C   . GLN A 1 48  ? 91.995 -11.867 19.774 1.00 38.88  ? 48  GLN A C   1 
ATOM   293 O  O   . GLN A 1 48  ? 91.463 -11.111 18.973 1.00 39.68  ? 48  GLN A O   1 
ATOM   294 C  CB  . GLN A 1 48  ? 94.348 -12.111 18.952 1.00 38.39  ? 48  GLN A CB  1 
ATOM   295 C  CG  . GLN A 1 48  ? 95.046 -11.427 20.059 1.00 59.19  ? 48  GLN A CG  1 
ATOM   296 C  CD  . GLN A 1 48  ? 96.129 -10.480 19.579 1.00 69.20  ? 48  GLN A CD  1 
ATOM   297 O  OE1 . GLN A 1 48  ? 96.979 -10.072 20.363 1.00 89.63  ? 48  GLN A OE1 1 
ATOM   298 N  NE2 . GLN A 1 48  ? 96.101 -10.117 18.300 1.00 55.00  ? 48  GLN A NE2 1 
ATOM   299 N  N   . VAL A 1 49  ? 91.674 -11.859 21.053 1.00 43.36  ? 49  VAL A N   1 
ATOM   300 C  CA  . VAL A 1 49  ? 90.864 -10.781 21.594 1.00 38.81  ? 49  VAL A CA  1 
ATOM   301 C  C   . VAL A 1 49  ? 91.834 -9.736  22.106 1.00 43.15  ? 49  VAL A C   1 
ATOM   302 O  O   . VAL A 1 49  ? 92.592 -10.012 22.999 1.00 44.06  ? 49  VAL A O   1 
ATOM   303 C  CB  . VAL A 1 49  ? 89.948 -11.275 22.751 1.00 45.96  ? 49  VAL A CB  1 
ATOM   304 C  CG1 . VAL A 1 49  ? 89.139 -10.092 23.352 1.00 41.33  ? 49  VAL A CG1 1 
ATOM   305 C  CG2 . VAL A 1 49  ? 89.008 -12.391 22.243 1.00 34.83  ? 49  VAL A CG2 1 
ATOM   306 N  N   . VAL A 1 50  ? 91.815 -8.534  21.541 1.00 39.95  ? 50  VAL A N   1 
ATOM   307 C  CA  . VAL A 1 50  ? 92.763 -7.493  21.956 1.00 37.22  ? 50  VAL A CA  1 
ATOM   308 C  C   . VAL A 1 50  ? 92.307 -6.794  23.223 1.00 46.18  ? 50  VAL A C   1 
ATOM   309 O  O   . VAL A 1 50  ? 93.135 -6.451  24.069 1.00 44.97  ? 50  VAL A O   1 
ATOM   310 C  CB  . VAL A 1 50  ? 92.949 -6.466  20.814 1.00 48.98  ? 50  VAL A CB  1 
ATOM   311 C  CG1 . VAL A 1 50  ? 93.900 -5.350  21.221 1.00 48.88  ? 50  VAL A CG1 1 
ATOM   312 C  CG2 . VAL A 1 50  ? 93.483 -7.200  19.535 1.00 43.51  ? 50  VAL A CG2 1 
ATOM   313 N  N   . ARG A 1 51  ? 90.994 -6.574  23.366 1.00 33.09  ? 51  ARG A N   1 
ATOM   314 C  CA  . ARG A 1 51  ? 90.486 -5.859  24.525 1.00 39.62  ? 51  ARG A CA  1 
ATOM   315 C  C   . ARG A 1 51  ? 89.029 -6.300  24.727 1.00 37.70  ? 51  ARG A C   1 
ATOM   316 O  O   . ARG A 1 51  ? 88.289 -6.406  23.768 1.00 33.73  ? 51  ARG A O   1 
ATOM   317 C  CB  . ARG A 1 51  ? 90.582 -4.338  24.254 1.00 37.56  ? 51  ARG A CB  1 
ATOM   318 C  CG  . ARG A 1 51  ? 90.349 -3.447  25.470 1.00 35.39  ? 51  ARG A CG  1 
ATOM   319 C  CD  . ARG A 1 51  ? 91.635 -3.369  26.279 1.00 42.11  ? 51  ARG A CD  1 
ATOM   320 N  NE  . ARG A 1 51  ? 91.484 -2.613  27.525 1.00 51.07  ? 51  ARG A NE  1 
ATOM   321 C  CZ  . ARG A 1 51  ? 91.998 -1.396  27.754 1.00 52.47  ? 51  ARG A CZ  1 
ATOM   322 N  NH1 . ARG A 1 51  ? 92.719 -0.750  26.827 1.00 48.89  ? 51  ARG A NH1 1 
ATOM   323 N  NH2 . ARG A 1 51  ? 91.819 -0.831  28.937 1.00 42.96  ? 51  ARG A NH2 1 
ATOM   324 N  N   . ALA A 1 52  ? 88.630 -6.568  25.960 1.00 37.94  ? 52  ALA A N   1 
ATOM   325 C  CA  . ALA A 1 52  ? 87.259 -6.917  26.259 1.00 34.14  ? 52  ALA A CA  1 
ATOM   326 C  C   . ALA A 1 52  ? 86.833 -6.093  27.458 1.00 40.14  ? 52  ALA A C   1 
ATOM   327 O  O   . ALA A 1 52  ? 87.451 -6.203  28.528 1.00 38.63  ? 52  ALA A O   1 
ATOM   328 C  CB  . ALA A 1 52  ? 87.155 -8.421  26.589 1.00 37.31  ? 52  ALA A CB  1 
ATOM   329 N  N   . ARG A 1 53  ? 85.791 -5.271  27.296 1.00 31.67  ? 53  ARG A N   1 
ATOM   330 C  CA  . ARG A 1 53  ? 85.294 -4.425  28.403 1.00 27.00  ? 53  ARG A CA  1 
ATOM   331 C  C   . ARG A 1 53  ? 83.793 -4.457  28.546 1.00 31.65  ? 53  ARG A C   1 
ATOM   332 O  O   . ARG A 1 53  ? 83.083 -4.789  27.600 1.00 33.88  ? 53  ARG A O   1 
ATOM   333 C  CB  . ARG A 1 53  ? 85.746 -2.957  28.189 1.00 30.59  ? 53  ARG A CB  1 
ATOM   334 C  CG  . ARG A 1 53  ? 87.284 -2.899  28.218 1.00 39.15  ? 53  ARG A CG  1 
ATOM   335 C  CD  . ARG A 1 53  ? 87.816 -1.511  28.103 1.00 33.60  ? 53  ARG A CD  1 
ATOM   336 N  NE  . ARG A 1 53  ? 87.435 -0.946  26.828 1.00 43.48  ? 53  ARG A NE  1 
ATOM   337 C  CZ  . ARG A 1 53  ? 87.257 0.350   26.604 1.00 49.45  ? 53  ARG A CZ  1 
ATOM   338 N  NH1 . ARG A 1 53  ? 87.416 1.227   27.588 1.00 46.56  ? 53  ARG A NH1 1 
ATOM   339 N  NH2 . ARG A 1 53  ? 86.909 0.756   25.385 1.00 57.64  ? 53  ARG A NH2 1 
ATOM   340 N  N   . LYS A 1 54  ? 83.306 -4.037  29.711 1.00 30.57  ? 54  LYS A N   1 
ATOM   341 C  CA  . LYS A 1 54  ? 81.870 -4.012  29.941 1.00 34.41  ? 54  LYS A CA  1 
ATOM   342 C  C   . LYS A 1 54  ? 81.441 -2.771  30.722 1.00 31.11  ? 54  LYS A C   1 
ATOM   343 O  O   . LYS A 1 54  ? 82.238 -2.153  31.411 1.00 36.48  ? 54  LYS A O   1 
ATOM   344 C  CB  . LYS A 1 54  ? 81.353 -5.319  30.599 1.00 32.19  ? 54  LYS A CB  1 
ATOM   345 C  CG  . LYS A 1 54  ? 81.651 -5.420  32.033 1.00 36.90  ? 54  LYS A CG  1 
ATOM   346 C  CD  . LYS A 1 54  ? 81.343 -6.785  32.599 1.00 43.03  ? 54  LYS A CD  1 
ATOM   347 C  CE  . LYS A 1 54  ? 81.982 -6.840  34.022 1.00 50.01  ? 54  LYS A CE  1 
ATOM   348 N  NZ  . LYS A 1 54  ? 81.649 -8.087  34.812 1.00 37.98  ? 54  LYS A NZ  1 
ATOM   349 N  N   . GLN A 1 55  ? 80.178 -2.413  30.575 1.00 26.16  ? 55  GLN A N   1 
ATOM   350 C  CA  . GLN A 1 55  ? 79.618 -1.223  31.200 1.00 32.33  ? 55  GLN A CA  1 
ATOM   351 C  C   . GLN A 1 55  ? 78.122 -1.433  31.405 1.00 28.03  ? 55  GLN A C   1 
ATOM   352 O  O   . GLN A 1 55  ? 77.430 -1.878  30.497 1.00 29.32  ? 55  GLN A O   1 
ATOM   353 C  CB  . GLN A 1 55  ? 79.772 -0.048  30.244 1.00 27.66  ? 55  GLN A CB  1 
ATOM   354 C  CG  . GLN A 1 55  ? 79.686 1.293   30.948 1.00 34.03  ? 55  GLN A CG  1 
ATOM   355 C  CD  . GLN A 1 55  ? 79.726 2.469   29.992 1.00 54.79  ? 55  GLN A CD  1 
ATOM   356 O  OE1 . GLN A 1 55  ? 79.316 2.362   28.824 1.00 38.02  ? 55  GLN A OE1 1 
ATOM   357 N  NE2 . GLN A 1 55  ? 80.209 3.608   30.487 1.00 48.04  ? 55  GLN A NE2 1 
ATOM   358 N  N   . ILE A 1 56  ? 77.619 -1.092  32.579 1.00 25.85  ? 56  ILE A N   1 
ATOM   359 C  CA  . ILE A 1 56  ? 76.187 -1.101  32.803 1.00 25.35  ? 56  ILE A CA  1 
ATOM   360 C  C   . ILE A 1 56  ? 75.622 0.299   32.440 1.00 29.70  ? 56  ILE A C   1 
ATOM   361 O  O   . ILE A 1 56  ? 75.986 1.289   33.055 1.00 31.08  ? 56  ILE A O   1 
ATOM   362 C  CB  . ILE A 1 56  ? 75.887 -1.374  34.276 1.00 26.59  ? 56  ILE A CB  1 
ATOM   363 C  CG1 . ILE A 1 56  ? 76.505 -2.725  34.676 1.00 29.38  ? 56  ILE A CG1 1 
ATOM   364 C  CG2 . ILE A 1 56  ? 74.332 -1.340  34.486 1.00 22.48  ? 56  ILE A CG2 1 
ATOM   365 C  CD1 . ILE A 1 56  ? 76.538 -2.972  36.161 1.00 32.88  ? 56  ILE A CD1 1 
ATOM   366 N  N   . PRO A 1 57  ? 74.752 0.384   31.442 1.00 26.31  ? 57  PRO A N   1 
ATOM   367 C  CA  . PRO A 1 57  ? 74.259 1.701   31.061 1.00 22.72  ? 57  PRO A CA  1 
ATOM   368 C  C   . PRO A 1 57  ? 73.124 2.159   32.012 1.00 30.91  ? 57  PRO A C   1 
ATOM   369 O  O   . PRO A 1 57  ? 72.459 1.347   32.663 1.00 30.19  ? 57  PRO A O   1 
ATOM   370 C  CB  . PRO A 1 57  ? 73.731 1.460   29.626 1.00 28.22  ? 57  PRO A CB  1 
ATOM   371 C  CG  . PRO A 1 57  ? 73.194 0.000   29.710 1.00 27.81  ? 57  PRO A CG  1 
ATOM   372 C  CD  . PRO A 1 57  ? 74.203 -0.708  30.596 1.00 30.47  ? 57  PRO A CD  1 
ATOM   373 N  N   . ALA A 1 58  ? 72.932 3.464   32.130 1.00 24.75  ? 58  ALA A N   1 
ATOM   374 C  CA  . ALA A 1 58  ? 71.893 3.987   32.979 1.00 29.01  ? 58  ALA A CA  1 
ATOM   375 C  C   . ALA A 1 58  ? 70.851 4.683   32.084 1.00 29.33  ? 58  ALA A C   1 
ATOM   376 O  O   . ALA A 1 58  ? 70.732 5.917   32.073 1.00 31.40  ? 58  ALA A O   1 
ATOM   377 C  CB  . ALA A 1 58  ? 72.504 4.965   33.987 1.00 27.30  ? 58  ALA A CB  1 
ATOM   378 N  N   . GLY A 1 59  ? 70.081 3.902   31.344 1.00 26.62  ? 59  GLY A N   1 
ATOM   379 C  CA  . GLY A 1 59  ? 69.108 4.514   30.436 1.00 29.95  ? 59  GLY A CA  1 
ATOM   380 C  C   . GLY A 1 59  ? 67.660 4.231   30.758 1.00 31.92  ? 59  GLY A C   1 
ATOM   381 O  O   . GLY A 1 59  ? 67.364 3.505   31.709 1.00 30.89  ? 59  GLY A O   1 
ATOM   382 N  N   . VAL A 1 60  ? 66.753 4.829   29.974 1.00 33.31  ? 60  VAL A N   1 
ATOM   383 C  CA  . VAL A 1 60  ? 65.331 4.552   30.072 1.00 26.89  ? 60  VAL A CA  1 
ATOM   384 C  C   . VAL A 1 60  ? 64.705 4.479   28.668 1.00 32.17  ? 60  VAL A C   1 
ATOM   385 O  O   . VAL A 1 60  ? 65.103 5.221   27.790 1.00 32.58  ? 60  VAL A O   1 
ATOM   386 C  CB  . VAL A 1 60  ? 64.598 5.562   30.996 1.00 33.02  ? 60  VAL A CB  1 
ATOM   387 C  CG1 . VAL A 1 60  ? 64.727 6.993   30.519 1.00 32.89  ? 60  VAL A CG1 1 
ATOM   388 C  CG2 . VAL A 1 60  ? 63.118 5.219   31.096 1.00 29.04  ? 60  VAL A CG2 1 
ATOM   389 N  N   . ASN A 1 61  ? 63.762 3.549   28.470 1.00 29.76  ? 61  ASN A N   1 
ATOM   390 C  CA  . ASN A 1 61  ? 63.001 3.429   27.229 1.00 25.14  ? 61  ASN A CA  1 
ATOM   391 C  C   . ASN A 1 61  ? 61.645 4.096   27.350 1.00 27.12  ? 61  ASN A C   1 
ATOM   392 O  O   . ASN A 1 61  ? 60.959 3.937   28.385 1.00 27.06  ? 61  ASN A O   1 
ATOM   393 C  CB  . ASN A 1 61  ? 62.779 1.957   26.912 1.00 26.50  ? 61  ASN A CB  1 
ATOM   394 C  CG  . ASN A 1 61  ? 64.002 1.316   26.300 1.00 32.69  ? 61  ASN A CG  1 
ATOM   395 O  OD1 . ASN A 1 61  ? 64.703 1.952   25.559 1.00 32.76  ? 61  ASN A OD1 1 
ATOM   396 N  ND2 . ASN A 1 61  ? 64.267 0.074   26.639 1.00 28.36  ? 61  ASN A ND2 1 
ATOM   397 N  N   . TYR A 1 62  ? 61.297 4.868   26.325 1.00 21.11  ? 62  TYR A N   1 
ATOM   398 C  CA  . TYR A 1 62  ? 59.960 5.424   26.136 1.00 23.01  ? 62  TYR A CA  1 
ATOM   399 C  C   . TYR A 1 62  ? 59.338 4.739   24.966 1.00 26.01  ? 62  TYR A C   1 
ATOM   400 O  O   . TYR A 1 62  ? 59.985 4.562   23.925 1.00 27.39  ? 62  TYR A O   1 
ATOM   401 C  CB  . TYR A 1 62  ? 60.040 6.925   25.806 1.00 23.33  ? 62  TYR A CB  1 
ATOM   402 C  CG  . TYR A 1 62  ? 60.558 7.722   26.998 1.00 30.16  ? 62  TYR A CG  1 
ATOM   403 C  CD1 . TYR A 1 62  ? 61.900 8.103   27.092 1.00 28.15  ? 62  TYR A CD1 1 
ATOM   404 C  CD2 . TYR A 1 62  ? 59.719 8.019   28.059 1.00 28.46  ? 62  TYR A CD2 1 
ATOM   405 C  CE1 . TYR A 1 62  ? 62.381 8.793   28.232 1.00 31.86  ? 62  TYR A CE1 1 
ATOM   406 C  CE2 . TYR A 1 62  ? 60.174 8.705   29.182 1.00 30.19  ? 62  TYR A CE2 1 
ATOM   407 C  CZ  . TYR A 1 62  ? 61.492 9.081   29.263 1.00 33.94  ? 62  TYR A CZ  1 
ATOM   408 O  OH  . TYR A 1 62  ? 61.876 9.809   30.363 1.00 41.84  ? 62  TYR A OH  1 
ATOM   409 N  N   . PHE A 1 63  ? 58.060 4.419   25.105 1.00 28.03  ? 63  PHE A N   1 
ATOM   410 C  CA  . PHE A 1 63  ? 57.306 3.798   24.027 1.00 25.20  ? 63  PHE A CA  1 
ATOM   411 C  C   . PHE A 1 63  ? 56.108 4.674   23.715 1.00 30.71  ? 63  PHE A C   1 
ATOM   412 O  O   . PHE A 1 63  ? 55.222 4.839   24.559 1.00 29.82  ? 63  PHE A O   1 
ATOM   413 C  CB  . PHE A 1 63  ? 56.819 2.418   24.478 1.00 24.42  ? 63  PHE A CB  1 
ATOM   414 C  CG  . PHE A 1 63  ? 57.940 1.504   24.935 1.00 25.80  ? 63  PHE A CG  1 
ATOM   415 C  CD1 . PHE A 1 63  ? 58.453 1.574   26.224 1.00 25.28  ? 63  PHE A CD1 1 
ATOM   416 C  CD2 . PHE A 1 63  ? 58.469 0.589   24.076 1.00 25.71  ? 63  PHE A CD2 1 
ATOM   417 C  CE1 . PHE A 1 63  ? 59.490 0.723   26.650 1.00 27.57  ? 63  PHE A CE1 1 
ATOM   418 C  CE2 . PHE A 1 63  ? 59.521 -0.260  24.476 1.00 27.07  ? 63  PHE A CE2 1 
ATOM   419 C  CZ  . PHE A 1 63  ? 60.021 -0.198  25.759 1.00 24.32  ? 63  PHE A CZ  1 
ATOM   420 N  N   . LEU A 1 64  ? 56.045 5.234   22.503 1.00 26.25  ? 64  LEU A N   1 
ATOM   421 C  CA  . LEU A 1 64  ? 54.950 6.187   22.242 1.00 27.51  ? 64  LEU A CA  1 
ATOM   422 C  C   . LEU A 1 64  ? 54.122 5.713   21.074 1.00 29.58  ? 64  LEU A C   1 
ATOM   423 O  O   . LEU A 1 64  ? 54.662 5.320   20.058 1.00 32.13  ? 64  LEU A O   1 
ATOM   424 C  CB  . LEU A 1 64  ? 55.529 7.575   21.926 1.00 27.40  ? 64  LEU A CB  1 
ATOM   425 C  CG  . LEU A 1 64  ? 56.646 8.088   22.835 1.00 31.87  ? 64  LEU A CG  1 
ATOM   426 C  CD1 . LEU A 1 64  ? 57.158 9.439   22.345 1.00 31.26  ? 64  LEU A CD1 1 
ATOM   427 C  CD2 . LEU A 1 64  ? 56.169 8.243   24.250 1.00 30.19  ? 64  LEU A CD2 1 
ATOM   428 N  N   . ASP A 1 65  ? 52.807 5.742   21.222 1.00 35.10  ? 65  ASP A N   1 
ATOM   429 C  CA  . ASP A 1 65  ? 51.928 5.464   20.123 1.00 31.05  ? 65  ASP A CA  1 
ATOM   430 C  C   . ASP A 1 65  ? 51.234 6.770   19.798 1.00 35.76  ? 65  ASP A C   1 
ATOM   431 O  O   . ASP A 1 65  ? 50.608 7.364   20.673 1.00 31.23  ? 65  ASP A O   1 
ATOM   432 C  CB  . ASP A 1 65  ? 50.941 4.384   20.510 1.00 34.37  ? 65  ASP A CB  1 
ATOM   433 C  CG  . ASP A 1 65  ? 51.591 2.998   20.557 1.00 33.15  ? 65  ASP A CG  1 
ATOM   434 O  OD1 . ASP A 1 65  ? 51.954 2.443   19.488 1.00 40.49  ? 65  ASP A OD1 1 
ATOM   435 O  OD2 . ASP A 1 65  ? 51.710 2.458   21.669 1.00 37.11  ? 65  ASP A OD2 1 
ATOM   436 N  N   . VAL A 1 66  ? 51.433 7.259   18.570 1.00 36.56  ? 66  VAL A N   1 
ATOM   437 C  CA  . VAL A 1 66  ? 51.122 8.669   18.214 1.00 33.10  ? 66  VAL A CA  1 
ATOM   438 C  C   . VAL A 1 66  ? 50.444 8.700   16.854 1.00 36.41  ? 66  VAL A C   1 
ATOM   439 O  O   . VAL A 1 66  ? 50.863 7.997   15.933 1.00 41.49  ? 66  VAL A O   1 
ATOM   440 C  CB  . VAL A 1 66  ? 52.402 9.578   18.110 1.00 36.17  ? 66  VAL A CB  1 
ATOM   441 C  CG1 . VAL A 1 66  ? 52.019 11.078  18.202 1.00 42.49  ? 66  VAL A CG1 1 
ATOM   442 C  CG2 . VAL A 1 66  ? 53.381 9.297   19.193 1.00 44.50  ? 66  VAL A CG2 1 
ATOM   443 N  N   . GLU A 1 67  ? 49.392 9.501   16.724 1.00 36.08  ? 67  GLU A N   1 
ATOM   444 C  CA  . GLU A 1 67  ? 48.837 9.812   15.399 1.00 37.36  ? 67  GLU A CA  1 
ATOM   445 C  C   . GLU A 1 67  ? 49.508 11.088  14.887 1.00 33.84  ? 67  GLU A C   1 
ATOM   446 O  O   . GLU A 1 67  ? 49.534 12.084  15.588 1.00 34.11  ? 67  GLU A O   1 
ATOM   447 C  CB  . GLU A 1 67  ? 47.306 9.987   15.443 1.00 37.00  ? 67  GLU A CB  1 
ATOM   448 C  CG  . GLU A 1 67  ? 46.698 10.141  14.056 1.00 42.91  ? 67  GLU A CG  1 
ATOM   449 C  CD  . GLU A 1 67  ? 45.168 10.294  14.032 1.00 67.64  ? 67  GLU A CD  1 
ATOM   450 O  OE1 . GLU A 1 67  ? 44.516 10.512  15.100 1.00 57.27  ? 67  GLU A OE1 1 
ATOM   451 O  OE2 . GLU A 1 67  ? 44.621 10.199  12.912 1.00 79.26  ? 67  GLU A OE2 1 
ATOM   452 N  N   . LEU A 1 68  ? 50.081 11.042  13.684 1.00 34.78  ? 68  LEU A N   1 
ATOM   453 C  CA  . LEU A 1 68  ? 50.715 12.222  13.065 1.00 30.86  ? 68  LEU A CA  1 
ATOM   454 C  C   . LEU A 1 68  ? 49.853 12.692  11.917 1.00 29.74  ? 68  LEU A C   1 
ATOM   455 O  O   . LEU A 1 68  ? 49.248 11.892  11.218 1.00 37.29  ? 68  LEU A O   1 
ATOM   456 C  CB  . LEU A 1 68  ? 52.098 11.887  12.504 1.00 27.16  ? 68  LEU A CB  1 
ATOM   457 C  CG  . LEU A 1 68  ? 53.248 11.433  13.421 1.00 39.42  ? 68  LEU A CG  1 
ATOM   458 C  CD1 . LEU A 1 68  ? 54.541 11.560  12.664 1.00 41.82  ? 68  LEU A CD1 1 
ATOM   459 C  CD2 . LEU A 1 68  ? 53.329 12.293  14.624 1.00 37.46  ? 68  LEU A CD2 1 
ATOM   460 N  N   . GLY A 1 69  ? 49.849 13.987  11.693 1.00 29.18  ? 69  GLY A N   1 
ATOM   461 C  CA  . GLY A 1 69  ? 49.103 14.561  10.585 1.00 28.67  ? 69  GLY A CA  1 
ATOM   462 C  C   . GLY A 1 69  ? 50.043 15.499  9.868  1.00 31.85  ? 69  GLY A C   1 
ATOM   463 O  O   . GLY A 1 69  ? 50.882 16.150  10.492 1.00 30.21  ? 69  GLY A O   1 
ATOM   464 N  N   . ARG A 1 70  ? 49.897 15.553  8.555  1.00 30.45  ? 70  ARG A N   1 
ATOM   465 C  CA  . ARG A 1 70  ? 50.639 16.443  7.726  1.00 28.44  ? 70  ARG A CA  1 
ATOM   466 C  C   . ARG A 1 70  ? 50.083 17.882  7.823  1.00 25.73  ? 70  ARG A C   1 
ATOM   467 O  O   . ARG A 1 70  ? 48.873 18.106  7.639  1.00 34.33  ? 70  ARG A O   1 
ATOM   468 C  CB  . ARG A 1 70  ? 50.573 15.936  6.257  1.00 28.25  ? 70  ARG A CB  1 
ATOM   469 C  CG  . ARG A 1 70  ? 51.527 16.758  5.388  1.00 31.84  ? 70  ARG A CG  1 
ATOM   470 C  CD  . ARG A 1 70  ? 52.286 16.042  4.283  1.00 58.73  ? 70  ARG A CD  1 
ATOM   471 N  NE  . ARG A 1 70  ? 51.429 16.039  3.155  1.00 29.72  ? 70  ARG A NE  1 
ATOM   472 C  CZ  . ARG A 1 70  ? 51.710 16.005  1.838  1.00 50.55  ? 70  ARG A CZ  1 
ATOM   473 N  NH1 . ARG A 1 70  ? 52.914 15.981  1.309  1.00 30.33  ? 70  ARG A NH1 1 
ATOM   474 N  NH2 . ARG A 1 70  ? 50.682 16.025  0.997  1.00 29.53  ? 70  ARG A NH2 1 
ATOM   475 N  N   . THR A 1 71  ? 50.951 18.851  8.109  1.00 29.68  ? 71  THR A N   1 
ATOM   476 C  CA  . THR A 1 71  ? 50.519 20.266  8.217  1.00 28.86  ? 71  THR A CA  1 
ATOM   477 C  C   . THR A 1 71  ? 50.657 20.990  6.866  1.00 33.96  ? 71  THR A C   1 
ATOM   478 O  O   . THR A 1 71  ? 51.309 20.491  5.974  1.00 29.72  ? 71  THR A O   1 
ATOM   479 C  CB  . THR A 1 71  ? 51.307 21.049  9.295  1.00 28.18  ? 71  THR A CB  1 
ATOM   480 O  OG1 . THR A 1 71  ? 52.588 21.448  8.782  1.00 31.62  ? 71  THR A OG1 1 
ATOM   481 C  CG2 . THR A 1 71  ? 51.478 20.249  10.587 1.00 26.04  ? 71  THR A CG2 1 
ATOM   482 N  N   . THR A 1 72  ? 50.027 22.154  6.723  1.00 34.94  ? 72  THR A N   1 
ATOM   483 C  CA  . THR A 1 72  ? 50.185 22.995  5.543  1.00 33.82  ? 72  THR A CA  1 
ATOM   484 C  C   . THR A 1 72  ? 51.491 23.804  5.517  1.00 31.53  ? 72  THR A C   1 
ATOM   485 O  O   . THR A 1 72  ? 51.727 24.549  4.582  1.00 38.66  ? 72  THR A O   1 
ATOM   486 C  CB  . THR A 1 72  ? 49.045 24.021  5.441  1.00 40.08  ? 72  THR A CB  1 
ATOM   487 O  OG1 . THR A 1 72  ? 49.051 24.842  6.616  1.00 41.47  ? 72  THR A OG1 1 
ATOM   488 C  CG2 . THR A 1 72  ? 47.669 23.323  5.306  1.00 41.85  ? 72  THR A CG2 1 
ATOM   489 N  N   . CYS A 1 73  ? 52.351 23.646  6.509  1.00 36.95  ? 73  CYS A N   1 
ATOM   490 C  CA  . CYS A 1 73  ? 53.623 24.385  6.542  1.00 36.01  ? 73  CYS A CA  1 
ATOM   491 C  C   . CYS A 1 73  ? 54.746 23.566  5.963  1.00 31.45  ? 73  CYS A C   1 
ATOM   492 O  O   . CYS A 1 73  ? 54.849 22.378  6.240  1.00 35.02  ? 73  CYS A O   1 
ATOM   493 C  CB  . CYS A 1 73  ? 54.016 24.713  7.983  1.00 38.05  ? 73  CYS A CB  1 
ATOM   494 S  SG  . CYS A 1 73  ? 53.039 26.071  8.718  1.00 52.95  ? 73  CYS A SG  1 
ATOM   495 N  N   . THR A 1 74  ? 55.635 24.198  5.200  1.00 34.50  ? 74  THR A N   1 
ATOM   496 C  CA  . THR A 1 74  ? 56.891 23.533  4.791  1.00 30.65  ? 74  THR A CA  1 
ATOM   497 C  C   . THR A 1 74  ? 57.881 23.473  5.936  1.00 31.66  ? 74  THR A C   1 
ATOM   498 O  O   . THR A 1 74  ? 57.670 24.095  6.987  1.00 37.22  ? 74  THR A O   1 
ATOM   499 C  CB  . THR A 1 74  ? 57.538 24.205  3.566  1.00 28.23  ? 74  THR A CB  1 
ATOM   500 O  OG1 . THR A 1 74  ? 57.954 25.529  3.922  1.00 31.58  ? 74  THR A OG1 1 
ATOM   501 C  CG2 . THR A 1 74  ? 56.505 24.307  2.435  1.00 37.18  ? 74  THR A CG2 1 
ATOM   502 N  N   . LYS A 1 75  ? 58.942 22.682  5.779  1.00 35.58  ? 75  LYS A N   1 
ATOM   503 C  CA  . LYS A 1 75  ? 59.914 22.563  6.871  1.00 39.10  ? 75  LYS A CA  1 
ATOM   504 C  C   . LYS A 1 75  ? 60.771 23.825  6.928  1.00 46.54  ? 75  LYS A C   1 
ATOM   505 O  O   . LYS A 1 75  ? 61.518 24.043  7.890  1.00 43.14  ? 75  LYS A O   1 
ATOM   506 C  CB  . LYS A 1 75  ? 60.753 21.305  6.694  1.00 39.14  ? 75  LYS A CB  1 
ATOM   507 C  CG  . LYS A 1 75  ? 59.893 20.029  6.887  1.00 37.13  ? 75  LYS A CG  1 
ATOM   508 C  CD  . LYS A 1 75  ? 60.661 18.818  6.357  1.00 39.73  ? 75  LYS A CD  1 
ATOM   509 C  CE  . LYS A 1 75  ? 59.836 17.506  6.481  1.00 39.22  ? 75  LYS A CE  1 
ATOM   510 N  NZ  . LYS A 1 75  ? 60.632 16.394  5.828  1.00 43.70  ? 75  LYS A NZ  1 
ATOM   511 N  N   . THR A 1 76  ? 60.617 24.682  5.910  1.00 42.77  ? 76  THR A N   1 
ATOM   512 C  CA  . THR A 1 76  ? 61.439 25.897  5.792  1.00 46.91  ? 76  THR A CA  1 
ATOM   513 C  C   . THR A 1 76  ? 60.731 27.141  6.363  1.00 49.53  ? 76  THR A C   1 
ATOM   514 O  O   . THR A 1 76  ? 61.145 28.273  6.112  1.00 45.32  ? 76  THR A O   1 
ATOM   515 C  CB  . THR A 1 76  ? 61.740 26.180  4.323  1.00 48.58  ? 76  THR A CB  1 
ATOM   516 O  OG1 . THR A 1 76  ? 60.490 26.300  3.625  1.00 42.63  ? 76  THR A OG1 1 
ATOM   517 C  CG2 . THR A 1 76  ? 62.603 25.045  3.695  1.00 36.47  ? 76  THR A CG2 1 
ATOM   518 N  N   . GLN A 1 77  ? 59.637 26.962  7.098  1.00 46.67  ? 77  GLN A N   1 
ATOM   519 C  CA  . GLN A 1 77  ? 58.941 28.166  7.613  1.00 49.91  ? 77  GLN A CA  1 
ATOM   520 C  C   . GLN A 1 77  ? 58.810 28.099  9.158  1.00 39.59  ? 77  GLN A C   1 
ATOM   521 O  O   . GLN A 1 77  ? 59.022 27.033  9.712  1.00 40.61  ? 77  GLN A O   1 
ATOM   522 C  CB  . GLN A 1 77  ? 57.627 28.460  6.819  1.00 44.57  ? 77  GLN A CB  1 
ATOM   523 C  CG  . GLN A 1 77  ? 56.426 27.660  7.190  1.00 40.23  ? 77  GLN A CG  1 
ATOM   524 C  CD  . GLN A 1 77  ? 55.274 27.808  6.205  1.00 49.57  ? 77  GLN A CD  1 
ATOM   525 O  OE1 . GLN A 1 77  ? 55.198 27.080  5.217  1.00 39.82  ? 77  GLN A OE1 1 
ATOM   526 N  NE2 . GLN A 1 77  ? 54.358 28.740  6.483  1.00 41.83  ? 77  GLN A NE2 1 
ATOM   527 N  N   . PRO A 1 78  ? 58.571 29.241  9.841  1.00 42.07  ? 78  PRO A N   1 
ATOM   528 C  CA  . PRO A 1 78  ? 58.471 29.273  11.309 1.00 49.07  ? 78  PRO A CA  1 
ATOM   529 C  C   . PRO A 1 78  ? 57.119 28.817  11.870 1.00 51.10  ? 78  PRO A C   1 
ATOM   530 O  O   . PRO A 1 78  ? 56.211 28.480  11.094 1.00 49.22  ? 78  PRO A O   1 
ATOM   531 C  CB  . PRO A 1 78  ? 58.654 30.764  11.642 1.00 56.43  ? 78  PRO A CB  1 
ATOM   532 C  CG  . PRO A 1 78  ? 58.056 31.489  10.447 1.00 56.92  ? 78  PRO A CG  1 
ATOM   533 C  CD  . PRO A 1 78  ? 58.366 30.585  9.245  1.00 46.67  ? 78  PRO A CD  1 
ATOM   534 N  N   . ASN A 1 79  ? 57.004 28.860  13.206 1.00 56.70  ? 79  ASN A N   1 
ATOM   535 C  CA  . ASN A 1 79  ? 55.795 28.520  13.981 1.00 60.63  ? 79  ASN A CA  1 
ATOM   536 C  C   . ASN A 1 79  ? 55.201 27.158  13.620 1.00 57.60  ? 79  ASN A C   1 
ATOM   537 O  O   . ASN A 1 79  ? 53.994 27.075  13.387 1.00 54.79  ? 79  ASN A O   1 
ATOM   538 C  CB  . ASN A 1 79  ? 54.697 29.585  13.815 1.00 70.66  ? 79  ASN A CB  1 
ATOM   539 C  CG  . ASN A 1 79  ? 55.182 31.008  14.095 1.00 91.61  ? 79  ASN A CG  1 
ATOM   540 O  OD1 . ASN A 1 79  ? 55.751 31.294  15.153 1.00 93.60  ? 79  ASN A OD1 1 
ATOM   541 N  ND2 . ASN A 1 79  ? 54.935 31.915  13.142 1.00 92.56  ? 79  ASN A ND2 1 
ATOM   542 N  N   . LEU A 1 80  ? 56.040 26.111  13.589 1.00 51.03  ? 80  LEU A N   1 
ATOM   543 C  CA  . LEU A 1 80  ? 55.634 24.785  13.099 1.00 41.68  ? 80  LEU A CA  1 
ATOM   544 C  C   . LEU A 1 80  ? 54.707 23.997  14.034 1.00 46.82  ? 80  LEU A C   1 
ATOM   545 O  O   . LEU A 1 80  ? 53.951 23.145  13.568 1.00 45.76  ? 80  LEU A O   1 
ATOM   546 C  CB  . LEU A 1 80  ? 56.841 23.926  12.664 1.00 39.76  ? 80  LEU A CB  1 
ATOM   547 C  CG  . LEU A 1 80  ? 57.655 24.438  11.469 1.00 46.74  ? 80  LEU A CG  1 
ATOM   548 C  CD1 . LEU A 1 80  ? 58.840 23.541  11.058 1.00 38.54  ? 80  LEU A CD1 1 
ATOM   549 C  CD2 . LEU A 1 80  ? 56.696 24.610  10.347 1.00 30.77  ? 80  LEU A CD2 1 
ATOM   550 N  N   . ASP A 1 81  ? 54.757 24.297  15.325 1.00 49.60  ? 81  ASP A N   1 
ATOM   551 C  CA  . ASP A 1 81  ? 54.068 23.503  16.357 1.00 61.56  ? 81  ASP A CA  1 
ATOM   552 C  C   . ASP A 1 81  ? 52.559 23.683  16.402 1.00 57.97  ? 81  ASP A C   1 
ATOM   553 O  O   . ASP A 1 81  ? 51.872 22.823  16.915 1.00 66.00  ? 81  ASP A O   1 
ATOM   554 C  CB  . ASP A 1 81  ? 54.662 23.805  17.729 1.00 65.63  ? 81  ASP A CB  1 
ATOM   555 C  CG  . ASP A 1 81  ? 56.179 23.845  17.697 1.00 88.18  ? 81  ASP A CG  1 
ATOM   556 O  OD1 . ASP A 1 81  ? 56.781 22.915  17.105 1.00 100.59 ? 81  ASP A OD1 1 
ATOM   557 O  OD2 . ASP A 1 81  ? 56.774 24.808  18.234 1.00 97.51  ? 81  ASP A OD2 1 
ATOM   558 N  N   . ASN A 1 82  ? 52.052 24.811  15.907 1.00 60.38  ? 82  ASN A N   1 
ATOM   559 C  CA  . ASN A 1 82  ? 50.603 25.029  15.826 1.00 64.29  ? 82  ASN A CA  1 
ATOM   560 C  C   . ASN A 1 82  ? 50.145 25.313  14.388 1.00 57.27  ? 82  ASN A C   1 
ATOM   561 O  O   . ASN A 1 82  ? 49.122 25.955  14.153 1.00 66.57  ? 82  ASN A O   1 
ATOM   562 C  CB  . ASN A 1 82  ? 50.130 26.098  16.832 1.00 75.74  ? 82  ASN A CB  1 
ATOM   563 C  CG  . ASN A 1 82  ? 51.169 27.167  17.059 1.00 88.72  ? 82  ASN A CG  1 
ATOM   564 O  OD1 . ASN A 1 82  ? 51.849 27.599  16.115 1.00 96.22  ? 82  ASN A OD1 1 
ATOM   565 N  ND2 . ASN A 1 82  ? 51.331 27.582  18.316 1.00 75.81  ? 82  ASN A ND2 1 
ATOM   566 N  N   . CYS A 1 83  ? 50.904 24.793  13.432 1.00 49.84  ? 83  CYS A N   1 
ATOM   567 C  CA  . CYS A 1 83  ? 50.563 24.916  12.023 1.00 48.19  ? 83  CYS A CA  1 
ATOM   568 C  C   . CYS A 1 83  ? 49.319 24.072  11.689 1.00 45.12  ? 83  CYS A C   1 
ATOM   569 O  O   . CYS A 1 83  ? 49.246 22.926  12.094 1.00 42.84  ? 83  CYS A O   1 
ATOM   570 C  CB  . CYS A 1 83  ? 51.760 24.512  11.141 1.00 40.05  ? 83  CYS A CB  1 
ATOM   571 S  SG  . CYS A 1 83  ? 51.411 24.999  9.413  1.00 60.98  ? 83  CYS A SG  1 
ATOM   572 N  N   . PRO A 1 84  ? 48.328 24.640  10.971 1.00 43.57  ? 84  PRO A N   1 
ATOM   573 C  CA  . PRO A 1 84  ? 47.152 23.813  10.684 1.00 45.91  ? 84  PRO A CA  1 
ATOM   574 C  C   . PRO A 1 84  ? 47.457 22.600  9.815  1.00 38.55  ? 84  PRO A C   1 
ATOM   575 O  O   . PRO A 1 84  ? 48.409 22.587  9.056  1.00 39.96  ? 84  PRO A O   1 
ATOM   576 C  CB  . PRO A 1 84  ? 46.214 24.760  9.923  1.00 52.94  ? 84  PRO A CB  1 
ATOM   577 C  CG  . PRO A 1 84  ? 46.683 26.156  10.278 1.00 58.57  ? 84  PRO A CG  1 
ATOM   578 C  CD  . PRO A 1 84  ? 48.186 26.004  10.415 1.00 50.82  ? 84  PRO A CD  1 
ATOM   579 N  N   . PHE A 1 85  ? 46.640 21.579  9.983  1.00 34.59  ? 85  PHE A N   1 
ATOM   580 C  CA  . PHE A 1 85  ? 46.673 20.376  9.179  1.00 38.26  ? 85  PHE A CA  1 
ATOM   581 C  C   . PHE A 1 85  ? 46.057 20.578  7.800  1.00 36.94  ? 85  PHE A C   1 
ATOM   582 O  O   . PHE A 1 85  ? 45.076 21.284  7.675  1.00 43.75  ? 85  PHE A O   1 
ATOM   583 C  CB  . PHE A 1 85  ? 45.933 19.257  9.936  1.00 31.87  ? 85  PHE A CB  1 
ATOM   584 C  CG  . PHE A 1 85  ? 46.616 18.879  11.242 1.00 44.48  ? 85  PHE A CG  1 
ATOM   585 C  CD1 . PHE A 1 85  ? 46.027 19.170  12.479 1.00 44.51  ? 85  PHE A CD1 1 
ATOM   586 C  CD2 . PHE A 1 85  ? 47.878 18.282  11.227 1.00 28.90  ? 85  PHE A CD2 1 
ATOM   587 C  CE1 . PHE A 1 85  ? 46.674 18.838  13.680 1.00 45.48  ? 85  PHE A CE1 1 
ATOM   588 C  CE2 . PHE A 1 85  ? 48.536 17.925  12.420 1.00 25.86  ? 85  PHE A CE2 1 
ATOM   589 C  CZ  . PHE A 1 85  ? 47.943 18.227  13.654 1.00 37.73  ? 85  PHE A CZ  1 
ATOM   590 N  N   . HIS A 1 86  ? 46.615 19.933  6.773  1.00 33.82  ? 86  HIS A N   1 
ATOM   591 C  CA  . HIS A 1 86  ? 45.953 19.909  5.453  1.00 37.98  ? 86  HIS A CA  1 
ATOM   592 C  C   . HIS A 1 86  ? 44.484 19.506  5.577  1.00 44.40  ? 86  HIS A C   1 
ATOM   593 O  O   . HIS A 1 86  ? 44.164 18.603  6.342  1.00 52.42  ? 86  HIS A O   1 
ATOM   594 C  CB  . HIS A 1 86  ? 46.674 18.932  4.500  1.00 40.50  ? 86  HIS A CB  1 
ATOM   595 C  CG  . HIS A 1 86  ? 47.949 19.476  3.925  1.00 38.86  ? 86  HIS A CG  1 
ATOM   596 N  ND1 . HIS A 1 86  ? 47.966 20.397  2.899  1.00 44.32  ? 86  HIS A ND1 1 
ATOM   597 C  CD2 . HIS A 1 86  ? 49.246 19.221  4.219  1.00 27.95  ? 86  HIS A CD2 1 
ATOM   598 C  CE1 . HIS A 1 86  ? 49.218 20.688  2.586  1.00 43.64  ? 86  HIS A CE1 1 
ATOM   599 N  NE2 . HIS A 1 86  ? 50.016 19.998  3.381  1.00 36.07  ? 86  HIS A NE2 1 
ATOM   600 N  N   . ASP A 1 87  ? 43.596 20.160  4.825  1.00 52.10  ? 87  ASP A N   1 
ATOM   601 C  CA  . ASP A 1 87  ? 42.165 19.801  4.800  1.00 58.66  ? 87  ASP A CA  1 
ATOM   602 C  C   . ASP A 1 87  ? 41.754 19.286  3.411  1.00 65.44  ? 87  ASP A C   1 
ATOM   603 O  O   . ASP A 1 87  ? 40.714 18.637  3.248  1.00 63.30  ? 87  ASP A O   1 
ATOM   604 C  CB  . ASP A 1 87  ? 41.293 21.025  5.169  1.00 64.06  ? 87  ASP A CB  1 
ATOM   605 C  CG  . ASP A 1 87  ? 41.604 22.255  4.295  1.00 76.35  ? 87  ASP A CG  1 
ATOM   606 O  OD1 . ASP A 1 87  ? 42.782 22.689  4.243  1.00 95.04  ? 87  ASP A OD1 1 
ATOM   607 O  OD2 . ASP A 1 87  ? 40.674 22.787  3.654  1.00 110.09 ? 87  ASP A OD2 1 
ATOM   608 N  N   . GLN A 1 88  ? 42.569 19.612  2.411  1.00 66.01  ? 88  GLN A N   1 
ATOM   609 C  CA  . GLN A 1 88  ? 42.268 19.301  1.015  1.00 69.97  ? 88  GLN A CA  1 
ATOM   610 C  C   . GLN A 1 88  ? 42.427 17.807  0.803  1.00 71.96  ? 88  GLN A C   1 
ATOM   611 O  O   . GLN A 1 88  ? 43.441 17.228  1.222  1.00 64.96  ? 88  GLN A O   1 
ATOM   612 C  CB  . GLN A 1 88  ? 43.202 20.074  0.075  1.00 71.87  ? 88  GLN A CB  1 
ATOM   613 C  CG  . GLN A 1 88  ? 43.005 21.584  0.071  1.00 63.17  ? 88  GLN A CG  1 
ATOM   614 C  CD  . GLN A 1 88  ? 41.772 21.978  -0.648 1.00 79.82  ? 88  GLN A CD  1 
ATOM   615 O  OE1 . GLN A 1 88  ? 40.678 21.929  -0.082 1.00 80.98  ? 88  GLN A OE1 1 
ATOM   616 N  NE2 . GLN A 1 88  ? 41.918 22.357  -1.917 1.00 92.51  ? 88  GLN A NE2 1 
ATOM   617 N  N   . PRO A 1 89  ? 41.446 17.187  0.124  1.00 84.59  ? 89  PRO A N   1 
ATOM   618 C  CA  . PRO A 1 89  ? 41.325 15.726  0.104  1.00 89.27  ? 89  PRO A CA  1 
ATOM   619 C  C   . PRO A 1 89  ? 42.639 14.989  -0.250 1.00 82.96  ? 89  PRO A C   1 
ATOM   620 O  O   . PRO A 1 89  ? 43.055 14.108  0.504  1.00 83.80  ? 89  PRO A O   1 
ATOM   621 C  CB  . PRO A 1 89  ? 40.224 15.477  -0.937 1.00 99.36  ? 89  PRO A CB  1 
ATOM   622 C  CG  . PRO A 1 89  ? 40.227 16.704  -1.792 1.00 104.34 ? 89  PRO A CG  1 
ATOM   623 C  CD  . PRO A 1 89  ? 40.549 17.823  -0.858 1.00 91.45  ? 89  PRO A CD  1 
ATOM   624 N  N   . HIS A 1 90  ? 43.305 15.359  -1.341 1.00 74.56  ? 90  HIS A N   1 
ATOM   625 C  CA  . HIS A 1 90  ? 44.490 14.616  -1.757 1.00 74.57  ? 90  HIS A CA  1 
ATOM   626 C  C   . HIS A 1 90  ? 45.843 15.041  -1.146 1.00 72.47  ? 90  HIS A C   1 
ATOM   627 O  O   . HIS A 1 90  ? 46.886 14.483  -1.507 1.00 77.53  ? 90  HIS A O   1 
ATOM   628 C  CB  . HIS A 1 90  ? 44.575 14.606  -3.268 1.00 88.80  ? 90  HIS A CB  1 
ATOM   629 C  CG  . HIS A 1 90  ? 43.619 13.654  -3.913 1.00 103.86 ? 90  HIS A CG  1 
ATOM   630 N  ND1 . HIS A 1 90  ? 42.443 14.062  -4.509 1.00 126.93 ? 90  HIS A ND1 1 
ATOM   631 C  CD2 . HIS A 1 90  ? 43.669 12.309  -4.060 1.00 114.41 ? 90  HIS A CD2 1 
ATOM   632 C  CE1 . HIS A 1 90  ? 41.814 13.011  -5.005 1.00 137.86 ? 90  HIS A CE1 1 
ATOM   633 N  NE2 . HIS A 1 90  ? 42.536 11.935  -4.745 1.00 143.20 ? 90  HIS A NE2 1 
ATOM   634 N  N   . LEU A 1 91  ? 45.832 16.008  -0.230 1.00 56.36  ? 91  LEU A N   1 
ATOM   635 C  CA  . LEU A 1 91  ? 47.058 16.512  0.361  1.00 49.17  ? 91  LEU A CA  1 
ATOM   636 C  C   . LEU A 1 91  ? 47.201 16.072  1.815  1.00 45.50  ? 91  LEU A C   1 
ATOM   637 O  O   . LEU A 1 91  ? 48.303 16.063  2.364  1.00 46.73  ? 91  LEU A O   1 
ATOM   638 C  CB  . LEU A 1 91  ? 47.091 18.031  0.298  1.00 48.60  ? 91  LEU A CB  1 
ATOM   639 C  CG  . LEU A 1 91  ? 47.433 18.684  -1.038 1.00 62.54  ? 91  LEU A CG  1 
ATOM   640 C  CD1 . LEU A 1 91  ? 46.827 20.051  -1.075 1.00 62.07  ? 91  LEU A CD1 1 
ATOM   641 C  CD2 . LEU A 1 91  ? 48.913 18.799  -1.143 1.00 57.04  ? 91  LEU A CD2 1 
ATOM   642 N  N   . LYS A 1 92  ? 46.089 15.692  2.430  1.00 50.33  ? 92  LYS A N   1 
ATOM   643 C  CA  . LYS A 1 92  ? 46.118 15.286  3.814  1.00 47.52  ? 92  LYS A CA  1 
ATOM   644 C  C   . LYS A 1 92  ? 46.668 13.868  3.954  1.00 51.48  ? 92  LYS A C   1 
ATOM   645 O  O   . LYS A 1 92  ? 46.467 13.018  3.079  1.00 50.61  ? 92  LYS A O   1 
ATOM   646 C  CB  . LYS A 1 92  ? 44.726 15.447  4.455  1.00 48.14  ? 92  LYS A CB  1 
ATOM   647 C  CG  . LYS A 1 92  ? 43.710 14.431  4.086  1.00 62.09  ? 92  LYS A CG  1 
ATOM   648 C  CD  . LYS A 1 92  ? 42.495 14.513  5.034  1.00 77.23  ? 92  LYS A CD  1 
ATOM   649 C  CE  . LYS A 1 92  ? 41.508 15.591  4.598  1.00 82.24  ? 92  LYS A CE  1 
ATOM   650 N  NZ  . LYS A 1 92  ? 40.097 15.342  5.066  1.00 89.96  ? 92  LYS A NZ  1 
ATOM   651 N  N   . ARG A 1 93  ? 47.409 13.647  5.037  1.00 48.83  ? 93  ARG A N   1 
ATOM   652 C  CA  . ARG A 1 93  ? 47.990 12.348  5.363  1.00 51.72  ? 93  ARG A CA  1 
ATOM   653 C  C   . ARG A 1 93  ? 48.033 12.274  6.848  1.00 43.90  ? 93  ARG A C   1 
ATOM   654 O  O   . ARG A 1 93  ? 48.570 13.149  7.512  1.00 48.79  ? 93  ARG A O   1 
ATOM   655 C  CB  . ARG A 1 93  ? 49.422 12.198  4.844  1.00 54.31  ? 93  ARG A CB  1 
ATOM   656 C  CG  . ARG A 1 93  ? 49.551 11.917  3.363  1.00 77.37  ? 93  ARG A CG  1 
ATOM   657 C  CD  . ARG A 1 93  ? 50.663 12.794  2.778  1.00 90.04  ? 93  ARG A CD  1 
ATOM   658 N  NE  . ARG A 1 93  ? 51.900 12.081  2.458  1.00 92.99  ? 93  ARG A NE  1 
ATOM   659 C  CZ  . ARG A 1 93  ? 52.454 12.055  1.249  1.00 100.55 ? 93  ARG A CZ  1 
ATOM   660 N  NH1 . ARG A 1 93  ? 51.895 12.710  0.240  1.00 100.41 ? 93  ARG A NH1 1 
ATOM   661 N  NH2 . ARG A 1 93  ? 53.574 11.378  1.047  1.00 116.82 ? 93  ARG A NH2 1 
ATOM   662 N  N   . LYS A 1 94  ? 47.494 11.196  7.367  1.00 50.23  ? 94  LYS A N   1 
ATOM   663 C  CA  . LYS A 1 94  ? 47.490 10.935  8.781  1.00 54.00  ? 94  LYS A CA  1 
ATOM   664 C  C   . LYS A 1 94  ? 48.103 9.550   8.946  1.00 62.62  ? 94  LYS A C   1 
ATOM   665 O  O   . LYS A 1 94  ? 47.767 8.626   8.195  1.00 63.35  ? 94  LYS A O   1 
ATOM   666 C  CB  . LYS A 1 94  ? 46.046 10.938  9.275  1.00 58.45  ? 94  LYS A CB  1 
ATOM   667 C  CG  . LYS A 1 94  ? 45.431 12.325  9.336  1.00 65.78  ? 94  LYS A CG  1 
ATOM   668 C  CD  . LYS A 1 94  ? 43.908 12.261  9.152  1.00 93.24  ? 94  LYS A CD  1 
ATOM   669 C  CE  . LYS A 1 94  ? 43.201 11.536  10.303 1.00 93.65  ? 94  LYS A CE  1 
ATOM   670 N  NZ  . LYS A 1 94  ? 41.778 11.269  9.966  1.00 102.69 ? 94  LYS A NZ  1 
ATOM   671 N  N   . ALA A 1 95  ? 48.991 9.406   9.925  1.00 51.27  ? 95  ALA A N   1 
ATOM   672 C  CA  . ALA A 1 95  ? 49.688 8.141   10.169 1.00 48.39  ? 95  ALA A CA  1 
ATOM   673 C  C   . ALA A 1 95  ? 49.642 7.846   11.646 1.00 47.62  ? 95  ALA A C   1 
ATOM   674 O  O   . ALA A 1 95  ? 49.715 8.768   12.441 1.00 46.72  ? 95  ALA A O   1 
ATOM   675 C  CB  . ALA A 1 95  ? 51.149 8.241   9.697  1.00 45.28  ? 95  ALA A CB  1 
ATOM   676 N  N   . PHE A 1 96  ? 49.481 6.570   12.004 1.00 45.53  ? 96  PHE A N   1 
ATOM   677 C  CA  . PHE A 1 96  ? 49.657 6.127   13.367 1.00 43.64  ? 96  PHE A CA  1 
ATOM   678 C  C   . PHE A 1 96  ? 51.027 5.491   13.468 1.00 41.75  ? 96  PHE A C   1 
ATOM   679 O  O   . PHE A 1 96  ? 51.330 4.542   12.741 1.00 43.33  ? 96  PHE A O   1 
ATOM   680 C  CB  . PHE A 1 96  ? 48.601 5.111   13.762 1.00 42.57  ? 96  PHE A CB  1 
ATOM   681 C  CG  . PHE A 1 96  ? 47.354 5.724   14.286 1.00 48.00  ? 96  PHE A CG  1 
ATOM   682 C  CD1 . PHE A 1 96  ? 46.317 6.099   13.409 1.00 61.83  ? 96  PHE A CD1 1 
ATOM   683 C  CD2 . PHE A 1 96  ? 47.194 5.936   15.659 1.00 54.90  ? 96  PHE A CD2 1 
ATOM   684 C  CE1 . PHE A 1 96  ? 45.127 6.693   13.897 1.00 74.36  ? 96  PHE A CE1 1 
ATOM   685 C  CE2 . PHE A 1 96  ? 46.004 6.528   16.165 1.00 65.65  ? 96  PHE A CE2 1 
ATOM   686 C  CZ  . PHE A 1 96  ? 44.969 6.904   15.286 1.00 72.46  ? 96  PHE A CZ  1 
ATOM   687 N  N   . CYS A 1 97  ? 51.819 6.007   14.389 1.00 33.84  ? 97  CYS A N   1 
ATOM   688 C  CA  . CYS A 1 97  ? 53.236 5.638   14.534 1.00 35.39  ? 97  CYS A CA  1 
ATOM   689 C  C   . CYS A 1 97  ? 53.530 5.098   15.901 1.00 32.57  ? 97  CYS A C   1 
ATOM   690 O  O   . CYS A 1 97  ? 52.959 5.556   16.892 1.00 33.80  ? 97  CYS A O   1 
ATOM   691 C  CB  . CYS A 1 97  ? 54.073 6.891   14.320 1.00 35.88  ? 97  CYS A CB  1 
ATOM   692 S  SG  . CYS A 1 97  ? 53.851 7.589   12.619 1.00 44.00  ? 97  CYS A SG  1 
ATOM   693 N  N   . SER A 1 98  ? 54.430 4.133   15.956 1.00 30.14  ? 98  SER A N   1 
ATOM   694 C  CA  . SER A 1 98  ? 54.929 3.639   17.197 1.00 31.08  ? 98  SER A CA  1 
ATOM   695 C  C   . SER A 1 98  ? 56.406 3.951   17.256 1.00 32.00  ? 98  SER A C   1 
ATOM   696 O  O   . SER A 1 98  ? 57.136 3.587   16.359 1.00 30.30  ? 98  SER A O   1 
ATOM   697 C  CB  . SER A 1 98  ? 54.689 2.142   17.289 1.00 25.49  ? 98  SER A CB  1 
ATOM   698 O  OG  . SER A 1 98  ? 53.288 1.864   17.280 1.00 30.01  ? 98  SER A OG  1 
ATOM   699 N  N   . PHE A 1 99  ? 56.836 4.649   18.306 1.00 26.96  ? 99  PHE A N   1 
ATOM   700 C  CA  . PHE A 1 99  ? 58.220 5.110   18.419 1.00 25.12  ? 99  PHE A CA  1 
ATOM   701 C  C   . PHE A 1 99  ? 58.737 4.554   19.719 1.00 26.36  ? 99  PHE A C   1 
ATOM   702 O  O   . PHE A 1 99  ? 58.062 4.661   20.747 1.00 26.64  ? 99  PHE A O   1 
ATOM   703 C  CB  . PHE A 1 99  ? 58.295 6.656   18.511 1.00 21.96  ? 99  PHE A CB  1 
ATOM   704 C  CG  . PHE A 1 99  ? 57.806 7.369   17.282 1.00 29.17  ? 99  PHE A CG  1 
ATOM   705 C  CD1 . PHE A 1 99  ? 58.326 7.059   16.032 1.00 32.36  ? 99  PHE A CD1 1 
ATOM   706 C  CD2 . PHE A 1 99  ? 56.865 8.395   17.376 1.00 33.53  ? 99  PHE A CD2 1 
ATOM   707 C  CE1 . PHE A 1 99  ? 57.897 7.739   14.888 1.00 36.02  ? 99  PHE A CE1 1 
ATOM   708 C  CE2 . PHE A 1 99  ? 56.442 9.108   16.221 1.00 28.32  ? 99  PHE A CE2 1 
ATOM   709 C  CZ  . PHE A 1 99  ? 56.949 8.779   14.986 1.00 31.64  ? 99  PHE A CZ  1 
ATOM   710 N  N   . GLN A 1 100 ? 59.924 3.959   19.677 1.00 23.77  ? 100 GLN A N   1 
ATOM   711 C  CA  . GLN A 1 100 ? 60.619 3.536   20.895 1.00 23.52  ? 100 GLN A CA  1 
ATOM   712 C  C   . GLN A 1 100 ? 61.885 4.382   20.946 1.00 26.56  ? 100 GLN A C   1 
ATOM   713 O  O   . GLN A 1 100 ? 62.698 4.370   19.988 1.00 28.91  ? 100 GLN A O   1 
ATOM   714 C  CB  . GLN A 1 100 ? 61.000 2.043   20.872 1.00 23.38  ? 100 GLN A CB  1 
ATOM   715 C  CG  . GLN A 1 100 ? 61.867 1.617   22.107 1.00 30.23  ? 100 GLN A CG  1 
ATOM   716 C  CD  . GLN A 1 100 ? 62.155 0.113   22.122 1.00 32.28  ? 100 GLN A CD  1 
ATOM   717 O  OE1 . GLN A 1 100 ? 61.397 -0.669  21.590 1.00 33.72  ? 100 GLN A OE1 1 
ATOM   718 N  NE2 . GLN A 1 100 ? 63.225 -0.279  22.756 1.00 30.29  ? 100 GLN A NE2 1 
ATOM   719 N  N   . ILE A 1 101 ? 62.025 5.145   22.030 1.00 24.80  ? 101 ILE A N   1 
ATOM   720 C  CA  . ILE A 1 101 ? 63.162 6.066   22.210 1.00 26.38  ? 101 ILE A CA  1 
ATOM   721 C  C   . ILE A 1 101 ? 64.006 5.603   23.412 1.00 29.06  ? 101 ILE A C   1 
ATOM   722 O  O   . ILE A 1 101 ? 63.493 5.378   24.528 1.00 31.39  ? 101 ILE A O   1 
ATOM   723 C  CB  . ILE A 1 101 ? 62.687 7.523   22.448 1.00 25.61  ? 101 ILE A CB  1 
ATOM   724 C  CG1 . ILE A 1 101 ? 61.827 8.052   21.289 1.00 31.71  ? 101 ILE A CG1 1 
ATOM   725 C  CG2 . ILE A 1 101 ? 63.872 8.474   22.687 1.00 31.63  ? 101 ILE A CG2 1 
ATOM   726 C  CD1 . ILE A 1 101 ? 60.325 7.770   21.463 1.00 29.81  ? 101 ILE A CD1 1 
ATOM   727 N  N   . TYR A 1 102 ? 65.295 5.439   23.177 1.00 31.58  ? 102 TYR A N   1 
ATOM   728 C  CA  . TYR A 1 102 ? 66.196 5.104   24.236 1.00 31.70  ? 102 TYR A CA  1 
ATOM   729 C  C   . TYR A 1 102 ? 66.912 6.378   24.703 1.00 33.04  ? 102 TYR A C   1 
ATOM   730 O  O   . TYR A 1 102 ? 67.664 6.979   23.938 1.00 31.51  ? 102 TYR A O   1 
ATOM   731 C  CB  . TYR A 1 102 ? 67.207 4.053   23.748 1.00 30.36  ? 102 TYR A CB  1 
ATOM   732 C  CG  . TYR A 1 102 ? 68.228 3.732   24.802 1.00 36.87  ? 102 TYR A CG  1 
ATOM   733 C  CD1 . TYR A 1 102 ? 67.846 3.081   25.970 1.00 31.89  ? 102 TYR A CD1 1 
ATOM   734 C  CD2 . TYR A 1 102 ? 69.557 4.108   24.662 1.00 37.68  ? 102 TYR A CD2 1 
ATOM   735 C  CE1 . TYR A 1 102 ? 68.756 2.798   26.971 1.00 35.35  ? 102 TYR A CE1 1 
ATOM   736 C  CE2 . TYR A 1 102 ? 70.521 3.776   25.660 1.00 34.47  ? 102 TYR A CE2 1 
ATOM   737 C  CZ  . TYR A 1 102 ? 70.082 3.151   26.821 1.00 44.90  ? 102 TYR A CZ  1 
ATOM   738 O  OH  . TYR A 1 102 ? 70.941 2.842   27.829 1.00 48.21  ? 102 TYR A OH  1 
ATOM   739 N  N   . ALA A 1 103 ? 66.711 6.757   25.963 1.00 30.18  ? 103 ALA A N   1 
ATOM   740 C  CA  . ALA A 1 103 ? 67.304 8.003   26.516 1.00 31.94  ? 103 ALA A CA  1 
ATOM   741 C  C   . ALA A 1 103 ? 68.384 7.678   27.543 1.00 32.57  ? 103 ALA A C   1 
ATOM   742 O  O   . ALA A 1 103 ? 68.251 6.702   28.283 1.00 29.91  ? 103 ALA A O   1 
ATOM   743 C  CB  . ALA A 1 103 ? 66.233 8.879   27.163 1.00 29.67  ? 103 ALA A CB  1 
ATOM   744 N  N   . VAL A 1 104 ? 69.454 8.471   27.578 1.00 33.94  ? 104 VAL A N   1 
ATOM   745 C  CA  . VAL A 1 104 ? 70.465 8.323   28.614 1.00 29.15  ? 104 VAL A CA  1 
ATOM   746 C  C   . VAL A 1 104 ? 70.468 9.737   29.232 1.00 34.46  ? 104 VAL A C   1 
ATOM   747 O  O   . VAL A 1 104 ? 71.142 10.638  28.725 1.00 34.89  ? 104 VAL A O   1 
ATOM   748 C  CB  . VAL A 1 104 ? 71.837 7.880   28.040 1.00 36.51  ? 104 VAL A CB  1 
ATOM   749 C  CG1 . VAL A 1 104 ? 72.908 7.791   29.153 1.00 29.34  ? 104 VAL A CG1 1 
ATOM   750 C  CG2 . VAL A 1 104 ? 71.736 6.520   27.276 1.00 36.10  ? 104 VAL A CG2 1 
ATOM   751 N  N   . PRO A 1 105 ? 69.672 9.949   30.307 1.00 32.43  ? 105 PRO A N   1 
ATOM   752 C  CA  . PRO A 1 105 ? 69.526 11.285  30.934 1.00 29.52  ? 105 PRO A CA  1 
ATOM   753 C  C   . PRO A 1 105 ? 70.822 11.901  31.410 1.00 36.30  ? 105 PRO A C   1 
ATOM   754 O  O   . PRO A 1 105 ? 71.038 13.098  31.214 1.00 38.41  ? 105 PRO A O   1 
ATOM   755 C  CB  . PRO A 1 105 ? 68.564 11.031  32.110 1.00 32.01  ? 105 PRO A CB  1 
ATOM   756 C  CG  . PRO A 1 105 ? 67.599 9.960   31.484 1.00 25.62  ? 105 PRO A CG  1 
ATOM   757 C  CD  . PRO A 1 105 ? 68.685 8.994   30.835 1.00 27.58  ? 105 PRO A CD  1 
ATOM   758 N  N   . TRP A 1 106 ? 71.728 11.129  32.000 1.00 32.70  ? 106 TRP A N   1 
ATOM   759 C  CA  . TRP A 1 106 ? 72.911 11.807  32.509 1.00 31.08  ? 106 TRP A CA  1 
ATOM   760 C  C   . TRP A 1 106 ? 73.671 12.472  31.353 1.00 37.72  ? 106 TRP A C   1 
ATOM   761 O  O   . TRP A 1 106 ? 74.351 13.477  31.568 1.00 42.05  ? 106 TRP A O   1 
ATOM   762 C  CB  . TRP A 1 106 ? 73.848 10.886  33.341 1.00 27.89  ? 106 TRP A CB  1 
ATOM   763 C  CG  . TRP A 1 106 ? 74.524 9.805   32.525 1.00 47.81  ? 106 TRP A CG  1 
ATOM   764 C  CD1 . TRP A 1 106 ? 74.079 8.529   32.345 1.00 38.50  ? 106 TRP A CD1 1 
ATOM   765 C  CD2 . TRP A 1 106 ? 75.745 9.913   31.762 1.00 50.10  ? 106 TRP A CD2 1 
ATOM   766 N  NE1 . TRP A 1 106 ? 74.936 7.830   31.516 1.00 42.95  ? 106 TRP A NE1 1 
ATOM   767 C  CE2 . TRP A 1 106 ? 75.970 8.649   31.150 1.00 59.18  ? 106 TRP A CE2 1 
ATOM   768 C  CE3 . TRP A 1 106 ? 76.659 10.948  31.529 1.00 59.01  ? 106 TRP A CE3 1 
ATOM   769 C  CZ2 . TRP A 1 106 ? 77.078 8.389   30.319 1.00 55.80  ? 106 TRP A CZ2 1 
ATOM   770 C  CZ3 . TRP A 1 106 ? 77.778 10.684  30.708 1.00 61.88  ? 106 TRP A CZ3 1 
ATOM   771 C  CH2 . TRP A 1 106 ? 77.968 9.412   30.118 1.00 70.03  ? 106 TRP A CH2 1 
ATOM   772 N  N   . GLN A 1 107 ? 73.573 11.872  30.161 1.00 33.07  ? 107 GLN A N   1 
ATOM   773 C  CA  . GLN A 1 107 ? 74.374 12.225  28.966 1.00 35.50  ? 107 GLN A CA  1 
ATOM   774 C  C   . GLN A 1 107 ? 73.567 13.184  28.101 1.00 32.97  ? 107 GLN A C   1 
ATOM   775 O  O   . GLN A 1 107 ? 74.105 13.802  27.205 1.00 35.98  ? 107 GLN A O   1 
ATOM   776 C  CB  . GLN A 1 107 ? 74.677 10.936  28.141 1.00 33.28  ? 107 GLN A CB  1 
ATOM   777 C  CG  . GLN A 1 107 ? 75.968 10.902  27.272 1.00 51.29  ? 107 GLN A CG  1 
ATOM   778 C  CD  . GLN A 1 107 ? 76.081 9.648   26.307 1.00 64.34  ? 107 GLN A CD  1 
ATOM   779 O  OE1 . GLN A 1 107 ? 75.090 8.988   25.933 1.00 55.29  ? 107 GLN A OE1 1 
ATOM   780 N  NE2 . GLN A 1 107 ? 77.301 9.362   25.890 1.00 48.04  ? 107 GLN A NE2 1 
ATOM   781 N  N   . GLY A 1 108 ? 72.262 13.309  28.352 1.00 33.29  ? 108 GLY A N   1 
ATOM   782 C  CA  . GLY A 1 108 ? 71.444 14.211  27.535 1.00 28.96  ? 108 GLY A CA  1 
ATOM   783 C  C   . GLY A 1 108 ? 71.120 13.655  26.133 1.00 38.05  ? 108 GLY A C   1 
ATOM   784 O  O   . GLY A 1 108 ? 70.688 14.400  25.267 1.00 39.27  ? 108 GLY A O   1 
ATOM   785 N  N   . THR A 1 109 ? 71.306 12.358  25.885 1.00 32.28  ? 109 THR A N   1 
ATOM   786 C  CA  . THR A 1 109 ? 71.117 11.865  24.515 1.00 37.45  ? 109 THR A CA  1 
ATOM   787 C  C   . THR A 1 109 ? 69.830 11.053  24.341 1.00 39.31  ? 109 THR A C   1 
ATOM   788 O  O   . THR A 1 109 ? 69.316 10.458  25.314 1.00 32.25  ? 109 THR A O   1 
ATOM   789 C  CB  . THR A 1 109 ? 72.258 10.946  24.104 1.00 38.65  ? 109 THR A CB  1 
ATOM   790 O  OG1 . THR A 1 109 ? 72.321 9.867   25.049 1.00 40.30  ? 109 THR A OG1 1 
ATOM   791 C  CG2 . THR A 1 109 ? 73.608 11.716  24.064 1.00 37.39  ? 109 THR A CG2 1 
ATOM   792 N  N   . MET A 1 110 ? 69.347 10.986  23.097 1.00 37.49  ? 110 MET A N   1 
ATOM   793 C  CA  . MET A 1 110 ? 68.249 10.075  22.730 1.00 32.86  ? 110 MET A CA  1 
ATOM   794 C  C   . MET A 1 110 ? 68.558 9.430   21.402 1.00 31.19  ? 110 MET A C   1 
ATOM   795 O  O   . MET A 1 110 ? 69.182 10.047  20.524 1.00 35.61  ? 110 MET A O   1 
ATOM   796 C  CB  . MET A 1 110 ? 66.931 10.819  22.623 1.00 28.69  ? 110 MET A CB  1 
ATOM   797 C  CG  . MET A 1 110 ? 66.409 11.243  23.961 1.00 29.86  ? 110 MET A CG  1 
ATOM   798 S  SD  . MET A 1 110 ? 64.849 12.170  23.846 1.00 34.52  ? 110 MET A SD  1 
ATOM   799 C  CE  . MET A 1 110 ? 65.570 13.790  23.562 1.00 31.97  ? 110 MET A CE  1 
ATOM   800 N  N   . THR A 1 111 ? 68.088 8.192   21.252 1.00 28.59  ? 111 THR A N   1 
ATOM   801 C  CA  . THR A 1 111 ? 68.252 7.402   20.019 1.00 30.75  ? 111 THR A CA  1 
ATOM   802 C  C   . THR A 1 111 ? 66.897 6.823   19.704 1.00 32.83  ? 111 THR A C   1 
ATOM   803 O  O   . THR A 1 111 ? 66.210 6.405   20.632 1.00 27.78  ? 111 THR A O   1 
ATOM   804 C  CB  . THR A 1 111 ? 69.224 6.215   20.294 1.00 34.04  ? 111 THR A CB  1 
ATOM   805 O  OG1 . THR A 1 111 ? 70.442 6.784   20.777 1.00 45.47  ? 111 THR A OG1 1 
ATOM   806 C  CG2 . THR A 1 111 ? 69.543 5.422   19.000 1.00 36.77  ? 111 THR A CG2 1 
ATOM   807 N  N   . LEU A 1 112 ? 66.509 6.815   18.426 1.00 30.02  ? 112 LEU A N   1 
ATOM   808 C  CA  . LEU A 1 112 ? 65.224 6.250   18.023 1.00 30.66  ? 112 LEU A CA  1 
ATOM   809 C  C   . LEU A 1 112 ? 65.455 4.796   17.699 1.00 32.74  ? 112 LEU A C   1 
ATOM   810 O  O   . LEU A 1 112 ? 65.955 4.522   16.629 1.00 37.89  ? 112 LEU A O   1 
ATOM   811 C  CB  . LEU A 1 112 ? 64.710 6.939   16.746 1.00 25.36  ? 112 LEU A CB  1 
ATOM   812 C  CG  . LEU A 1 112 ? 63.282 6.617   16.319 1.00 41.29  ? 112 LEU A CG  1 
ATOM   813 C  CD1 . LEU A 1 112 ? 62.328 6.959   17.426 1.00 23.31  ? 112 LEU A CD1 1 
ATOM   814 C  CD2 . LEU A 1 112 ? 62.899 7.362   15.044 1.00 28.90  ? 112 LEU A CD2 1 
ATOM   815 N  N   . SER A 1 113 ? 65.103 3.876   18.603 1.00 27.44  ? 113 SER A N   1 
ATOM   816 C  CA  . SER A 1 113 ? 65.446 2.455   18.427 1.00 35.04  ? 113 SER A CA  1 
ATOM   817 C  C   . SER A 1 113 ? 64.474 1.740   17.459 1.00 34.97  ? 113 SER A C   1 
ATOM   818 O  O   . SER A 1 113 ? 64.844 0.776   16.814 1.00 41.01  ? 113 SER A O   1 
ATOM   819 C  CB  . SER A 1 113 ? 65.397 1.710   19.778 1.00 31.67  ? 113 SER A CB  1 
ATOM   820 O  OG  . SER A 1 113 ? 66.040 2.410   20.820 1.00 42.21  ? 113 SER A OG  1 
ATOM   821 N  N   . LYS A 1 114 ? 63.213 2.176   17.424 1.00 29.46  ? 114 LYS A N   1 
ATOM   822 C  CA  . LYS A 1 114 ? 62.180 1.539   16.601 1.00 31.51  ? 114 LYS A CA  1 
ATOM   823 C  C   . LYS A 1 114 ? 61.255 2.633   16.167 1.00 30.74  ? 114 LYS A C   1 
ATOM   824 O  O   . LYS A 1 114 ? 60.969 3.552   16.940 1.00 30.03  ? 114 LYS A O   1 
ATOM   825 C  CB  . LYS A 1 114 ? 61.344 0.544   17.403 1.00 23.56  ? 114 LYS A CB  1 
ATOM   826 C  CG  . LYS A 1 114 ? 62.144 -0.588  18.136 1.00 29.60  ? 114 LYS A CG  1 
ATOM   827 C  CD  . LYS A 1 114 ? 62.416 -1.740  17.211 1.00 43.09  ? 114 LYS A CD  1 
ATOM   828 C  CE  . LYS A 1 114 ? 63.186 -2.800  17.937 1.00 55.43  ? 114 LYS A CE  1 
ATOM   829 N  NZ  . LYS A 1 114 ? 64.271 -3.254  17.040 1.00 67.75  ? 114 LYS A NZ  1 
ATOM   830 N  N   . SER A 1 115 ? 60.745 2.512   14.952 1.00 33.96  ? 115 SER A N   1 
ATOM   831 C  CA  . SER A 1 115 ? 59.869 3.532   14.385 1.00 31.50  ? 115 SER A CA  1 
ATOM   832 C  C   . SER A 1 115 ? 59.140 2.828   13.269 1.00 36.28  ? 115 SER A C   1 
ATOM   833 O  O   . SER A 1 115 ? 59.776 2.377   12.330 1.00 38.26  ? 115 SER A O   1 
ATOM   834 C  CB  . SER A 1 115 ? 60.722 4.663   13.813 1.00 33.85  ? 115 SER A CB  1 
ATOM   835 O  OG  . SER A 1 115 ? 59.911 5.605   13.161 1.00 57.97  ? 115 SER A OG  1 
ATOM   836 N  N   . THR A 1 116 ? 57.817 2.701   13.369 1.00 30.02  ? 116 THR A N   1 
ATOM   837 C  CA  . THR A 1 116 ? 57.032 2.142   12.261 1.00 37.20  ? 116 THR A CA  1 
ATOM   838 C  C   . THR A 1 116 ? 55.730 2.923   12.194 1.00 35.37  ? 116 THR A C   1 
ATOM   839 O  O   . THR A 1 116 ? 55.203 3.290   13.237 1.00 38.20  ? 116 THR A O   1 
ATOM   840 C  CB  . THR A 1 116 ? 56.760 0.645   12.514 1.00 37.26  ? 116 THR A CB  1 
ATOM   841 O  OG1 . THR A 1 116 ? 56.092 0.080   11.394 1.00 48.39  ? 116 THR A OG1 1 
ATOM   842 C  CG2 . THR A 1 116 ? 55.875 0.451   13.714 1.00 35.43  ? 116 THR A CG2 1 
ATOM   843 N  N   . CYS A 1 117 ? 55.227 3.216   10.995 1.00 40.34  ? 117 CYS A N   1 
ATOM   844 C  CA  . CYS A 1 117 ? 53.976 4.006   10.828 1.00 39.48  ? 117 CYS A CA  1 
ATOM   845 C  C   . CYS A 1 117 ? 53.038 3.282   9.885  1.00 51.65  ? 117 CYS A C   1 
ATOM   846 O  O   . CYS A 1 117 ? 53.491 2.658   8.935  1.00 60.05  ? 117 CYS A O   1 
ATOM   847 C  CB  . CYS A 1 117 ? 54.280 5.423   10.279 1.00 49.25  ? 117 CYS A CB  1 
ATOM   848 S  SG  . CYS A 1 117 ? 55.253 6.485   11.460 1.00 58.69  ? 117 CYS A SG  1 
ATOM   849 N  N   . GLN A 1 118 ? 51.736 3.342   10.145 1.00 50.90  ? 118 GLN A N   1 
ATOM   850 C  CA  . GLN A 1 118 ? 50.746 2.812   9.198  1.00 67.33  ? 118 GLN A CA  1 
ATOM   851 C  C   . GLN A 1 118 ? 49.760 3.919   8.824  1.00 68.40  ? 118 GLN A C   1 
ATOM   852 O  O   . GLN A 1 118 ? 49.533 4.834   9.602  1.00 63.10  ? 118 GLN A O   1 
ATOM   853 C  CB  . GLN A 1 118 ? 50.014 1.562   9.758  1.00 74.15  ? 118 GLN A CB  1 
ATOM   854 C  CG  . GLN A 1 118 ? 49.364 1.739   11.170 1.00 73.06  ? 118 GLN A CG  1 
ATOM   855 C  CD  . GLN A 1 118 ? 48.425 0.589   11.603 1.00 98.23  ? 118 GLN A CD  1 
ATOM   856 O  OE1 . GLN A 1 118 ? 47.385 0.306   10.959 1.00 85.62  ? 118 GLN A OE1 1 
ATOM   857 N  NE2 . GLN A 1 118 ? 48.769 -0.046  12.733 1.00 70.31  ? 118 GLN A NE2 1 
ATOM   858 N  N   . ASP A 1 119 ? 49.182 3.857   7.635  1.00 81.00  ? 119 ASP A N   1 
ATOM   859 C  CA  . ASP A 1 119 ? 48.188 4.862   7.247  1.00 90.80  ? 119 ASP A CA  1 
ATOM   860 C  C   . ASP A 1 119 ? 46.956 4.854   8.154  1.00 93.15  ? 119 ASP A C   1 
ATOM   861 O  O   . ASP A 1 119 ? 46.607 3.822   8.728  1.00 93.02  ? 119 ASP A O   1 
ATOM   862 C  CB  . ASP A 1 119 ? 47.810 4.708   5.779  1.00 105.90 ? 119 ASP A CB  1 
ATOM   863 C  CG  . ASP A 1 119 ? 48.922 5.159   4.856  1.00 119.96 ? 119 ASP A CG  1 
ATOM   864 O  OD1 . ASP A 1 119 ? 49.861 5.842   5.340  1.00 110.16 ? 119 ASP A OD1 1 
ATOM   865 O  OD2 . ASP A 1 119 ? 48.859 4.830   3.653  1.00 138.12 ? 119 ASP A OD2 1 
ATOM   866 N  N   . ALA A 1 120 ? 46.330 6.017   8.318  1.00 99.42  ? 120 ALA A N   1 
ATOM   867 C  CA  . ALA A 1 120 ? 45.186 6.144   9.221  1.00 110.22 ? 120 ALA A CA  1 
ATOM   868 C  C   . ALA A 1 120 ? 43.865 6.155   8.456  1.00 126.87 ? 120 ALA A C   1 
ATOM   869 O  O   . ALA A 1 120 ? 43.032 7.068   8.568  1.00 137.29 ? 120 ALA A O   1 
ATOM   870 C  CB  . ALA A 1 120 ? 45.324 7.381   10.106 1.00 108.15 ? 120 ALA A CB  1 
ATOM   871 O  OXT . ALA A 1 120 ? 43.606 5.217   7.698  1.00 138.67 ? 120 ALA A OXT 1 
HETATM 872 C  C1  . PEG B 2 .   ? 90.487 2.166   26.498 1.00 68.13  ? 121 PEG A C1  1 
HETATM 873 O  O1  . PEG B 2 .   ? 90.719 1.714   25.160 1.00 54.39  ? 121 PEG A O1  1 
HETATM 874 C  C2  . PEG B 2 .   ? 91.593 3.126   26.919 1.00 71.59  ? 121 PEG A C2  1 
HETATM 875 O  O2  . PEG B 2 .   ? 92.671 2.420   27.536 1.00 82.25  ? 121 PEG A O2  1 
HETATM 876 C  C3  . PEG B 2 .   ? 92.780 2.766   28.920 1.00 91.12  ? 121 PEG A C3  1 
HETATM 877 C  C4  . PEG B 2 .   ? 94.242 2.692   29.332 1.00 89.66  ? 121 PEG A C4  1 
HETATM 878 O  O4  . PEG B 2 .   ? 94.501 1.348   29.742 1.00 77.46  ? 121 PEG A O4  1 
HETATM 879 C  C1  . PEG C 2 .   ? 67.197 17.092  26.081 1.00 97.10  ? 122 PEG A C1  1 
HETATM 880 O  O1  . PEG C 2 .   ? 66.552 17.485  24.854 1.00 86.29  ? 122 PEG A O1  1 
HETATM 881 C  C2  . PEG C 2 .   ? 67.883 15.736  25.955 1.00 89.21  ? 122 PEG A C2  1 
HETATM 882 O  O2  . PEG C 2 .   ? 67.176 14.760  26.726 1.00 72.97  ? 122 PEG A O2  1 
HETATM 883 C  C3  . PEG C 2 .   ? 67.919 14.295  27.849 1.00 80.38  ? 122 PEG A C3  1 
HETATM 884 C  C4  . PEG C 2 .   ? 67.571 12.832  28.085 1.00 70.71  ? 122 PEG A C4  1 
HETATM 885 O  O4  . PEG C 2 .   ? 68.356 12.025  27.216 1.00 51.05  ? 122 PEG A O4  1 
HETATM 886 C  C1  . PEG D 2 .   ? 95.893 -2.867  25.199 1.00 86.16  ? 123 PEG A C1  1 
HETATM 887 O  O1  . PEG D 2 .   ? 95.262 -3.410  26.370 1.00 82.22  ? 123 PEG A O1  1 
HETATM 888 C  C2  . PEG D 2 .   ? 94.905 -2.822  24.032 1.00 68.44  ? 123 PEG A C2  1 
HETATM 889 O  O2  . PEG D 2 .   ? 94.338 -1.515  23.935 1.00 80.48  ? 123 PEG A O2  1 
HETATM 890 C  C3  . PEG D 2 .   ? 92.976 -1.532  23.492 1.00 67.65  ? 123 PEG A C3  1 
HETATM 891 C  C4  . PEG D 2 .   ? 92.355 -0.135  23.473 1.00 52.47  ? 123 PEG A C4  1 
HETATM 892 O  O4  . PEG D 2 .   ? 91.014 -0.166  24.000 1.00 66.40  ? 123 PEG A O4  1 
HETATM 893 N  N1  . IMD E 3 .   ? 69.222 -0.363  22.419 0.50 110.89 ? 124 IMD A N1  1 
HETATM 894 C  C2  . IMD E 3 .   ? 70.488 0.123   22.391 0.50 111.93 ? 124 IMD A C2  1 
HETATM 895 N  N3  . IMD E 3 .   ? 70.909 0.326   23.658 0.50 110.79 ? 124 IMD A N3  1 
HETATM 896 C  C4  . IMD E 3 .   ? 69.898 -0.031  24.482 0.50 111.21 ? 124 IMD A C4  1 
HETATM 897 C  C5  . IMD E 3 .   ? 68.833 -0.466  23.707 0.50 109.98 ? 124 IMD A C5  1 
HETATM 898 N  N1  . IMD F 3 .   ? 75.978 6.858   35.814 0.50 53.04  ? 125 IMD A N1  1 
HETATM 899 C  C2  . IMD F 3 .   ? 76.549 6.157   34.806 0.50 62.74  ? 125 IMD A C2  1 
HETATM 900 N  N3  . IMD F 3 .   ? 77.663 6.820   34.392 0.50 79.74  ? 125 IMD A N3  1 
HETATM 901 C  C4  . IMD F 3 .   ? 77.798 7.945   35.140 0.50 74.83  ? 125 IMD A C4  1 
HETATM 902 C  C5  . IMD F 3 .   ? 76.732 7.967   36.038 0.50 71.64  ? 125 IMD A C5  1 
HETATM 903 C  C   . ACT G 4 .   ? 89.784 -16.752 21.670 1.00 74.09  ? 126 ACT A C   1 
HETATM 904 O  O   . ACT G 4 .   ? 88.766 -17.327 21.219 1.00 78.50  ? 126 ACT A O   1 
HETATM 905 O  OXT . ACT G 4 .   ? 89.633 -16.249 22.809 1.00 77.56  ? 126 ACT A OXT 1 
HETATM 906 C  CH3 . ACT G 4 .   ? 91.079 -16.684 20.909 1.00 62.09  ? 126 ACT A CH3 1 
HETATM 907 C  C   . ACT H 4 .   ? 64.931 4.125   12.568 1.00 86.79  ? 127 ACT A C   1 
HETATM 908 O  O   . ACT H 4 .   ? 65.837 4.933   12.863 1.00 87.75  ? 127 ACT A O   1 
HETATM 909 O  OXT . ACT H 4 .   ? 64.872 3.099   13.295 1.00 79.86  ? 127 ACT A OXT 1 
HETATM 910 C  CH3 . ACT H 4 .   ? 63.994 4.384   11.410 1.00 84.96  ? 127 ACT A CH3 1 
HETATM 911 CL CL  . CL  I 5 .   ? 78.843 -7.152  35.540 1.00 84.02  ? 128 CL  A CL  1 
HETATM 912 C  C   . ACT J 4 .   ? 74.399 -23.379 15.656 1.00 73.56  ? 129 ACT A C   1 
HETATM 913 O  O   . ACT J 4 .   ? 74.116 -24.321 16.457 1.00 65.82  ? 129 ACT A O   1 
HETATM 914 O  OXT . ACT J 4 .   ? 73.529 -22.465 15.485 1.00 72.13  ? 129 ACT A OXT 1 
HETATM 915 C  CH3 . ACT J 4 .   ? 75.728 -23.365 14.941 1.00 64.38  ? 129 ACT A CH3 1 
HETATM 916 O  O   . HOH K 6 .   ? 76.531 -11.868 27.046 1.00 23.12  ? 130 HOH A O   1 
HETATM 917 O  O   . HOH K 6 .   ? 76.815 -16.679 22.421 1.00 25.64  ? 131 HOH A O   1 
HETATM 918 O  O   . HOH K 6 .   ? 80.233 -17.799 17.156 1.00 19.46  ? 132 HOH A O   1 
HETATM 919 O  O   . HOH K 6 .   ? 75.201 -14.730 16.355 1.00 20.17  ? 133 HOH A O   1 
HETATM 920 O  O   . HOH K 6 .   ? 79.838 -19.807 10.456 1.00 16.83  ? 134 HOH A O   1 
HETATM 921 O  O   . HOH K 6 .   ? 80.361 -18.046 14.195 1.00 34.87  ? 135 HOH A O   1 
HETATM 922 O  O   . HOH K 6 .   ? 80.164 -9.633  8.121  1.00 30.20  ? 136 HOH A O   1 
HETATM 923 O  O   . HOH K 6 .   ? 82.362 -15.398 7.203  1.00 25.27  ? 137 HOH A O   1 
HETATM 924 O  O   . HOH K 6 .   ? 84.813 -14.794 6.526  1.00 16.80  ? 138 HOH A O   1 
HETATM 925 O  O   . HOH K 6 .   ? 88.122 -12.453 8.228  1.00 26.48  ? 139 HOH A O   1 
HETATM 926 O  O   . HOH K 6 .   ? 79.540 -21.634 3.110  1.00 13.85  ? 140 HOH A O   1 
HETATM 927 O  O   . HOH K 6 .   ? 88.853 -18.831 17.728 1.00 23.15  ? 141 HOH A O   1 
HETATM 928 O  O   . HOH K 6 .   ? 85.854 -17.129 17.451 1.00 22.69  ? 142 HOH A O   1 
HETATM 929 O  O   . HOH K 6 .   ? 94.188 2.218   24.798 1.00 57.62  ? 143 HOH A O   1 
HETATM 930 O  O   . HOH K 6 .   ? 79.345 -0.597  34.830 1.00 20.36  ? 144 HOH A O   1 
HETATM 931 O  O   . HOH K 6 .   ? 78.375 0.972   36.869 1.00 9.14   ? 145 HOH A O   1 
HETATM 932 O  O   . HOH K 6 .   ? 71.185 -1.340  32.888 1.00 21.61  ? 146 HOH A O   1 
HETATM 933 O  O   . HOH K 6 .   ? 70.915 0.708   34.592 0.50 21.97  ? 147 HOH A O   1 
HETATM 934 O  O   . HOH K 6 .   ? 52.949 3.072   24.174 1.00 15.64  ? 148 HOH A O   1 
HETATM 935 O  O   . HOH K 6 .   ? 46.945 16.073  6.956  1.00 14.95  ? 149 HOH A O   1 
HETATM 936 O  O   . HOH K 6 .   ? 60.905 26.571  11.777 1.00 28.21  ? 150 HOH A O   1 
HETATM 937 O  O   . HOH K 6 .   ? 58.857 26.196  14.362 1.00 13.93  ? 151 HOH A O   1 
HETATM 938 O  O   . HOH K 6 .   ? 52.281 13.595  -1.761 1.00 3.12   ? 152 HOH A O   1 
HETATM 939 O  O   . HOH K 6 .   ? 57.948 0.730   16.383 1.00 22.37  ? 153 HOH A O   1 
HETATM 940 O  O   . HOH K 6 .   ? 70.572 7.673   23.728 1.00 29.34  ? 154 HOH A O   1 
HETATM 941 O  O   . HOH K 6 .   ? 72.995 16.902  30.707 1.00 42.38  ? 155 HOH A O   1 
HETATM 942 O  O   . HOH K 6 .   ? 74.934 5.037   30.618 1.00 30.74  ? 156 HOH A O   1 
HETATM 943 O  O   . HOH K 6 .   ? 68.363 8.069   16.464 1.00 22.40  ? 157 HOH A O   1 
HETATM 944 O  O   . HOH K 6 .   ? 56.869 2.264   8.805  1.00 13.72  ? 158 HOH A O   1 
HETATM 945 O  O   . HOH K 6 .   ? 69.816 -0.759  29.219 0.50 15.08  ? 159 HOH A O   1 
HETATM 946 O  O   . HOH K 6 .   ? 44.136 22.196  11.821 1.00 24.11  ? 160 HOH A O   1 
HETATM 947 O  O   . HOH K 6 .   ? 71.524 12.404  20.878 1.00 41.08  ? 161 HOH A O   1 
HETATM 948 O  O   . HOH K 6 .   ? 90.590 -6.420  28.146 1.00 17.17  ? 162 HOH A O   1 
HETATM 949 O  O   . HOH K 6 .   ? 66.601 -1.750  25.951 1.00 37.33  ? 163 HOH A O   1 
HETATM 950 O  O   . HOH K 6 .   ? 70.222 10.558  17.974 1.00 30.36  ? 164 HOH A O   1 
HETATM 951 O  O   . HOH K 6 .   ? 69.128 1.945   20.059 1.00 41.15  ? 165 HOH A O   1 
HETATM 952 O  O   . HOH K 6 .   ? 77.369 1.347   28.584 1.00 32.51  ? 166 HOH A O   1 
HETATM 953 O  O   . HOH K 6 .   ? 76.217 -18.003 6.984  1.00 39.77  ? 167 HOH A O   1 
HETATM 954 O  O   . HOH K 6 .   ? 77.443 -18.424 9.616  1.00 27.47  ? 168 HOH A O   1 
HETATM 955 O  O   . HOH K 6 .   ? 76.826 -17.613 12.114 1.00 20.22  ? 169 HOH A O   1 
HETATM 956 O  O   . HOH K 6 .   ? 92.971 -13.748 22.753 1.00 20.34  ? 170 HOH A O   1 
HETATM 957 O  O   . HOH K 6 .   ? 85.636 -7.578  7.349  1.00 23.42  ? 171 HOH A O   1 
HETATM 958 O  O   . HOH K 6 .   ? 80.599 -3.008  34.703 1.00 26.54  ? 172 HOH A O   1 
HETATM 959 O  O   . HOH K 6 .   ? 50.099 3.708   16.944 1.00 30.14  ? 173 HOH A O   1 
HETATM 960 O  O   . HOH K 6 .   ? 72.410 5.744   23.217 1.00 38.11  ? 174 HOH A O   1 
HETATM 961 O  O   . HOH K 6 .   ? 77.169 -13.354 -0.746 1.00 25.70  ? 175 HOH A O   1 
HETATM 962 O  O   . HOH K 6 .   ? 69.704 13.734  21.397 1.00 36.00  ? 176 HOH A O   1 
HETATM 963 O  O   . HOH K 6 .   ? 69.748 12.676  16.702 1.00 31.51  ? 177 HOH A O   1 
HETATM 964 O  O   . HOH K 6 .   ? 78.284 2.072   34.541 1.00 30.01  ? 178 HOH A O   1 
HETATM 965 O  O   . HOH K 6 .   ? 65.239 -2.568  23.236 1.00 33.09  ? 179 HOH A O   1 
HETATM 966 O  O   . HOH K 6 .   ? 74.683 -11.963 28.903 1.00 10.90  ? 180 HOH A O   1 
HETATM 967 O  O   . HOH K 6 .   ? 77.823 -7.722  11.230 1.00 57.45  ? 181 HOH A O   1 
HETATM 968 O  O   . HOH K 6 .   ? 80.516 9.171   35.404 0.50 46.30  ? 182 HOH A O   1 
HETATM 969 O  O   . HOH K 6 .   ? 87.128 -9.937  34.828 1.00 35.97  ? 183 HOH A O   1 
HETATM 970 O  O   . HOH K 6 .   ? 76.725 4.313   32.414 1.00 41.84  ? 184 HOH A O   1 
HETATM 971 O  O   . HOH K 6 .   ? 64.312 10.811  30.497 1.00 33.24  ? 185 HOH A O   1 
HETATM 972 O  O   . HOH K 6 .   ? 60.434 10.324  32.375 1.00 40.96  ? 186 HOH A O   1 
HETATM 973 O  O   . HOH K 6 .   ? 76.448 -19.028 16.841 1.00 65.47  ? 187 HOH A O   1 
HETATM 974 O  O   . HOH K 6 .   ? 72.878 -8.559  13.927 1.00 31.88  ? 188 HOH A O   1 
HETATM 975 O  O   . HOH K 6 .   ? 84.307 -20.361 15.565 1.00 34.93  ? 189 HOH A O   1 
HETATM 976 O  O   . HOH K 6 .   ? 51.726 28.737  4.734  1.00 29.99  ? 190 HOH A O   1 
HETATM 977 O  O   . HOH K 6 .   ? 94.506 -4.432  29.027 1.00 31.81  ? 191 HOH A O   1 
HETATM 978 O  O   . HOH K 6 .   ? 59.859 22.458  15.098 1.00 25.30  ? 192 HOH A O   1 
HETATM 979 O  O   . HOH K 6 .   ? 58.989 5.163   10.137 1.00 31.29  ? 193 HOH A O   1 
HETATM 980 O  O   . HOH K 6 .   ? 91.788 -19.609 19.483 1.00 41.54  ? 194 HOH A O   1 
HETATM 981 O  O   . HOH K 6 .   ? 90.818 -22.292 19.657 1.00 46.74  ? 195 HOH A O   1 
HETATM 982 O  O   . HOH K 6 .   ? 42.260 14.642  10.853 1.00 31.01  ? 196 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . VAL A 10  ? 2.2453 0.9247 1.4433 -0.4450 -0.4059 -0.0366 10  VAL A N   
2   C CA  . VAL A 10  ? 1.9530 0.9637 1.4417 -0.4496 -0.3296 0.0310  10  VAL A CA  
3   C C   . VAL A 10  ? 1.8256 0.8438 1.3286 -0.3621 -0.1856 0.0297  10  VAL A C   
4   O O   . VAL A 10  ? 1.7744 0.8403 1.3972 -0.3691 -0.1606 0.0681  10  VAL A O   
5   C CB  . VAL A 10  ? 1.7983 1.0749 1.4436 -0.4626 -0.3598 0.0583  10  VAL A CB  
6   C CG1 . VAL A 10  ? 1.8481 1.1402 1.5851 -0.5530 -0.5189 0.0679  10  VAL A CG1 
7   C CG2 . VAL A 10  ? 1.8285 1.0806 1.3361 -0.3773 -0.3090 0.0191  10  VAL A CG2 
8   N N   . GLY A 11  ? 1.7894 0.7442 1.1837 -0.2828 -0.1012 -0.0087 11  GLY A N   
9   C CA  . GLY A 11  ? 1.6844 0.6396 1.1565 -0.2009 0.0337  -0.0114 11  GLY A CA  
10  C C   . GLY A 11  ? 1.3625 0.5804 1.0669 -0.1817 0.0589  0.0306  11  GLY A C   
11  O O   . GLY A 11  ? 1.3230 0.5585 1.1657 -0.1267 0.1280  0.0363  11  GLY A O   
12  N N   . GLY A 12  ? 1.1365 0.5435 0.8956 -0.2227 -0.0043 0.0582  12  GLY A N   
13  C CA  . GLY A 12  ? 0.8750 0.4783 0.7842 -0.2032 0.0056  0.0916  12  GLY A CA  
14  C C   . GLY A 12  ? 0.7627 0.4420 0.6749 -0.1582 0.0416  0.0729  12  GLY A C   
15  O O   . GLY A 12  ? 0.9400 0.5014 0.7316 -0.1346 0.0797  0.0396  12  GLY A O   
16  N N   . PRO A 13  ? 0.5975 0.4325 0.6061 -0.1428 0.0296  0.0946  13  PRO A N   
17  C CA  . PRO A 13  ? 0.5872 0.4925 0.6093 -0.1023 0.0500  0.0797  13  PRO A CA  
18  C C   . PRO A 13  ? 0.5748 0.5150 0.5096 -0.1192 0.0185  0.0695  13  PRO A C   
19  O O   . PRO A 13  ? 0.6090 0.5969 0.5498 -0.1670 -0.0314 0.0848  13  PRO A O   
20  C CB  . PRO A 13  ? 0.4481 0.4681 0.5433 -0.0876 0.0176  0.1025  13  PRO A CB  
21  C CG  . PRO A 13  ? 0.5750 0.5479 0.6864 -0.1097 -0.0118 0.1323  13  PRO A CG  
22  C CD  . PRO A 13  ? 0.5261 0.4277 0.5883 -0.1587 -0.0066 0.1351  13  PRO A CD  
23  N N   . MET A 14  ? 0.5946 0.4997 0.4725 -0.0813 0.0416  0.0491  14  MET A N   
24  C CA  . MET A 14  ? 0.7249 0.6093 0.4986 -0.0832 -0.0109 0.0368  14  MET A CA  
25  C C   . MET A 14  ? 0.6477 0.6920 0.5132 -0.0498 -0.0237 0.0439  14  MET A C   
26  O O   . MET A 14  ? 0.5037 0.5756 0.4262 -0.0155 0.0200  0.0441  14  MET A O   
27  C CB  . MET A 14  ? 0.9238 0.5794 0.4970 -0.0527 0.0387  0.0134  14  MET A CB  
28  C CG  . MET A 14  ? 1.4219 0.8659 0.8712 -0.0607 0.0973  -0.0024 14  MET A CG  
29  S SD  . MET A 14  ? 1.9782 1.2187 1.1861 -0.1064 -0.0234 -0.0282 14  MET A SD  
30  C CE  . MET A 14  ? 1.9343 1.1764 1.2479 -0.1525 -0.0244 -0.0230 14  MET A CE  
31  N N   . ASP A 15  ? 0.5950 0.7380 0.5003 -0.0576 -0.0921 0.0488  15  ASP A N   
32  C CA  . ASP A 15  ? 0.5165 0.7902 0.5008 -0.0110 -0.0965 0.0497  15  ASP A CA  
33  C C   . ASP A 15  ? 0.5489 0.7125 0.4303 0.0395  -0.0769 0.0320  15  ASP A C   
34  O O   . ASP A 15  ? 0.6667 0.6530 0.3918 0.0392  -0.0800 0.0236  15  ASP A O   
35  C CB  . ASP A 15  ? 0.5058 0.8856 0.5935 -0.0206 -0.1781 0.0578  15  ASP A CB  
36  C CG  . ASP A 15  ? 0.5957 1.1373 0.8661 -0.0657 -0.1595 0.0902  15  ASP A CG  
37  O OD1 . ASP A 15  ? 0.4074 1.0484 0.7301 -0.0399 -0.0758 0.1047  15  ASP A OD1 
38  O OD2 . ASP A 15  ? 0.6087 1.1450 0.9461 -0.1281 -0.2270 0.1029  15  ASP A OD2 
39  N N   . ALA A 16  ? 0.4559 0.6931 0.3969 0.0838  -0.0554 0.0280  16  ALA A N   
40  C CA  . ALA A 16  ? 0.5540 0.6873 0.4298 0.1238  -0.0384 0.0183  16  ALA A CA  
41  C C   . ALA A 16  ? 0.5095 0.7376 0.4402 0.1795  -0.0666 0.0075  16  ALA A C   
42  O O   . ALA A 16  ? 0.5505 0.8827 0.5488 0.1933  -0.0546 0.0038  16  ALA A O   
43  C CB  . ALA A 16  ? 0.3762 0.4413 0.2941 0.1146  0.0256  0.0207  16  ALA A CB  
44  N N   . SER A 17  ? 0.6413 0.7995 0.5085 0.2179  -0.1009 0.0032  17  SER A N   
45  C CA  . SER A 17  ? 0.5508 0.7805 0.4700 0.2830  -0.1320 -0.0108 17  SER A CA  
46  C C   . SER A 17  ? 0.5788 0.7932 0.5112 0.3121  -0.1006 -0.0296 17  SER A C   
47  O O   . SER A 17  ? 0.5650 0.6710 0.4798 0.2892  -0.0806 -0.0270 17  SER A O   
48  C CB  . SER A 17  ? 0.7132 0.8135 0.5313 0.3185  -0.1894 -0.0070 17  SER A CB  
49  O OG  . SER A 17  ? 0.8460 0.9886 0.7180 0.3914  -0.2133 -0.0241 17  SER A OG  
50  N N   . VAL A 18  ? 0.6259 0.9822 0.5657 0.1577  -0.0433 0.0800  18  VAL A N   
51  C CA  . VAL A 18  ? 0.5399 0.8326 0.4723 0.2012  -0.0080 0.0304  18  VAL A CA  
52  C C   . VAL A 18  ? 0.7043 0.7936 0.5899 0.2813  -0.0045 0.0030  18  VAL A C   
53  O O   . VAL A 18  ? 0.7136 0.6788 0.5652 0.2890  0.0127  -0.0402 18  VAL A O   
54  C CB  . VAL A 18  ? 0.5524 1.0991 0.5320 0.2310  0.0113  0.0091  18  VAL A CB  
55  C CG1 . VAL A 18  ? 0.6371 1.3623 0.6733 0.3496  0.0075  -0.0027 18  VAL A CG1 
56  C CG2 . VAL A 18  ? 0.5498 1.0356 0.4958 0.2543  0.0447  -0.0582 18  VAL A CG2 
57  N N   . GLU A 19  ? 0.7248 0.7733 0.5975 0.3182  -0.0363 0.0427  19  GLU A N   
58  C CA  . GLU A 19  ? 0.9480 0.7672 0.7562 0.3537  -0.0627 0.0579  19  GLU A CA  
59  C C   . GLU A 19  ? 0.9335 0.6132 0.6644 0.2451  -0.0538 0.0811  19  GLU A C   
60  O O   . GLU A 19  ? 1.1105 0.6127 0.7729 0.2306  -0.0804 0.1113  19  GLU A O   
61  C CB  . GLU A 19  ? 0.9688 0.8038 0.7833 0.4147  -0.1205 0.1235  19  GLU A CB  
62  C CG  . GLU A 19  ? 1.3199 1.1074 1.1811 0.5746  -0.1590 0.0971  19  GLU A CG  
63  C CD  . GLU A 19  ? 1.3967 1.4921 1.3734 0.6649  -0.1660 0.0971  19  GLU A CD  
64  O OE1 . GLU A 19  ? 1.3382 1.6719 1.3750 0.6593  -0.1129 0.0410  19  GLU A OE1 
65  O OE2 . GLU A 19  ? 1.2952 1.4230 1.3010 0.7250  -0.2317 0.1684  19  GLU A OE2 
66  N N   . GLU A 20  ? 0.7950 0.5659 0.5377 0.1682  -0.0270 0.0697  20  GLU A N   
67  C CA  . GLU A 20  ? 0.8689 0.5986 0.5620 0.0863  -0.0084 0.0679  20  GLU A CA  
68  C C   . GLU A 20  ? 0.8075 0.4585 0.5021 0.0660  0.0145  0.0398  20  GLU A C   
69  O O   . GLU A 20  ? 0.7242 0.4008 0.4687 0.0897  0.0246  0.0055  20  GLU A O   
70  C CB  . GLU A 20  ? 0.7589 0.5915 0.4872 0.0522  0.0016  0.0296  20  GLU A CB  
71  C CG  . GLU A 20  ? 0.9382 0.7935 0.6449 0.0040  0.0281  -0.0156 20  GLU A CG  
72  C CD  . GLU A 20  ? 1.0796 0.9818 0.7997 -0.0064 0.0117  -0.0706 20  GLU A CD  
73  O OE1 . GLU A 20  ? 0.8938 0.7933 0.6567 0.0017  0.0215  -0.1434 20  GLU A OE1 
74  O OE2 . GLU A 20  ? 0.9055 0.8404 0.5970 -0.0194 -0.0225 -0.0445 20  GLU A OE2 
75  N N   . GLU A 21  ? 0.8573 0.4454 0.4900 0.0004  0.0171  0.0641  21  GLU A N   
76  C CA  . GLU A 21  ? 0.9199 0.4329 0.5413 -0.0398 0.0234  0.0504  21  GLU A CA  
77  C C   . GLU A 21  ? 0.7774 0.4078 0.4845 -0.0457 0.0556  -0.0017 21  GLU A C   
78  O O   . GLU A 21  ? 0.8130 0.4068 0.5286 -0.0484 0.0516  -0.0220 21  GLU A O   
79  C CB  . GLU A 21  ? 1.0309 0.4947 0.5651 -0.1494 0.0101  0.1091  21  GLU A CB  
80  C CG  . GLU A 21  ? 1.1460 0.7054 0.7068 -0.2309 0.0397  0.0881  21  GLU A CG  
81  C CD  . GLU A 21  ? 1.6982 1.1312 1.1584 -0.3539 -0.0006 0.1528  21  GLU A CD  
82  O OE1 . GLU A 21  ? 2.0224 1.2183 1.4314 -0.3391 -0.0498 0.1466  21  GLU A OE1 
83  O OE2 . GLU A 21  ? 1.6003 1.1803 1.0256 -0.4735 0.0125  0.2036  21  GLU A OE2 
84  N N   . GLY A 22  ? 0.6315 0.3907 0.3966 -0.0441 0.0750  -0.0266 22  GLY A N   
85  C CA  . GLY A 22  ? 0.5563 0.3953 0.4179 -0.0310 0.0780  -0.0624 22  GLY A CA  
86  C C   . GLY A 22  ? 0.5557 0.3718 0.4536 0.0015  0.0504  -0.0552 22  GLY A C   
87  O O   . GLY A 22  ? 0.5261 0.3723 0.4669 -0.0124 0.0370  -0.0511 22  GLY A O   
88  N N   . VAL A 23  ? 0.5517 0.3572 0.4301 0.0284  0.0373  -0.0424 23  VAL A N   
89  C CA  . VAL A 23  ? 0.4057 0.2629 0.3128 0.0332  0.0134  -0.0232 23  VAL A CA  
90  C C   . VAL A 23  ? 0.4707 0.3380 0.3449 0.0435  0.0288  -0.0346 23  VAL A C   
91  O O   . VAL A 23  ? 0.5283 0.4696 0.4193 0.0147  0.0193  -0.0284 23  VAL A O   
92  C CB  . VAL A 23  ? 0.4744 0.3813 0.3733 0.0459  -0.0035 -0.0027 23  VAL A CB  
93  C CG1 . VAL A 23  ? 0.3609 0.3963 0.2877 0.0238  -0.0242 0.0295  23  VAL A CG1 
94  C CG2 . VAL A 23  ? 0.4437 0.3205 0.3517 0.0231  -0.0284 -0.0139 23  VAL A CG2 
95  N N   . ARG A 24  ? 0.4978 0.2758 0.3135 0.0805  0.0417  -0.0543 24  ARG A N   
96  C CA  . ARG A 24  ? 0.5915 0.3280 0.3612 0.1108  0.0473  -0.1010 24  ARG A CA  
97  C C   . ARG A 24  ? 0.5781 0.2783 0.3238 0.0405  0.0480  -0.1172 24  ARG A C   
98  O O   . ARG A 24  ? 0.6367 0.3858 0.3551 0.0340  0.0513  -0.1599 24  ARG A O   
99  C CB  . ARG A 24  ? 0.6900 0.2623 0.4031 0.1770  0.0299  -0.1147 24  ARG A CB  
100 C CG  . ARG A 24  ? 0.9627 0.4389 0.6243 0.2428  0.0217  -0.1988 24  ARG A CG  
101 C CD  . ARG A 24  ? 0.9273 0.6423 0.6289 0.3006  0.0534  -0.2653 24  ARG A CD  
102 N NE  . ARG A 24  ? 1.2355 0.8735 0.8768 0.3806  0.0525  -0.3887 24  ARG A NE  
103 C CZ  . ARG A 24  ? 1.5056 0.9755 1.1312 0.5151  0.0195  -0.4514 24  ARG A CZ  
104 N NH1 . ARG A 24  ? 1.4186 0.8083 1.0846 0.5681  -0.0173 -0.3748 24  ARG A NH1 
105 N NH2 . ARG A 24  ? 1.7678 1.1416 1.3341 0.6022  0.0122  -0.5956 24  ARG A NH2 
106 N N   . ARG A 25  ? 0.4896 0.3427 0.3136 0.0374  0.0938  0.0038  25  ARG A N   
107 C CA  . ARG A 25  ? 0.5197 0.3878 0.3780 -0.0119 0.1133  -0.0105 25  ARG A CA  
108 C C   . ARG A 25  ? 0.4607 0.4213 0.4216 -0.0066 0.0902  -0.0196 25  ARG A C   
109 O O   . ARG A 25  ? 0.4262 0.4044 0.4135 -0.0196 0.0907  -0.0264 25  ARG A O   
110 C CB  . ARG A 25  ? 0.5729 0.4479 0.4202 -0.0557 0.1416  -0.0307 25  ARG A CB  
111 C CG  . ARG A 25  ? 0.7443 0.4938 0.4582 -0.0760 0.1756  -0.0231 25  ARG A CG  
112 C CD  . ARG A 25  ? 1.0555 0.8204 0.7555 -0.1461 0.2168  -0.0549 25  ARG A CD  
113 N NE  . ARG A 25  ? 1.6390 1.3223 1.2547 -0.2074 0.2600  -0.0685 25  ARG A NE  
114 C CZ  . ARG A 25  ? 1.8516 1.4019 1.3219 -0.2630 0.3114  -0.0744 25  ARG A CZ  
115 N NH1 . ARG A 25  ? 1.8066 1.2966 1.2025 -0.2610 0.3242  -0.0666 25  ARG A NH1 
116 N NH2 . ARG A 25  ? 1.9324 1.4020 1.3199 -0.3288 0.3552  -0.0917 25  ARG A NH2 
117 N N   . ALA A 26  ? 0.3549 0.3600 0.3560 0.0130  0.0717  -0.0206 26  ALA A N   
118 C CA  . ALA A 26  ? 0.3262 0.3774 0.3859 0.0189  0.0545  -0.0283 26  ALA A CA  
119 C C   . ALA A 26  ? 0.3037 0.3468 0.3660 0.0287  0.0422  -0.0174 26  ALA A C   
120 O O   . ALA A 26  ? 0.3385 0.3897 0.4224 0.0282  0.0352  -0.0203 26  ALA A O   
121 C CB  . ALA A 26  ? 0.2400 0.3086 0.3116 0.0281  0.0461  -0.0340 26  ALA A CB  
122 N N   . LEU A 27  ? 0.3382 0.3721 0.3722 0.0436  0.0385  -0.0092 27  LEU A N   
123 C CA  . LEU A 27  ? 0.3786 0.4222 0.4135 0.0532  0.0290  -0.0062 27  LEU A CA  
124 C C   . LEU A 27  ? 0.4313 0.4392 0.4531 0.0486  0.0352  0.0016  27  LEU A C   
125 O O   . LEU A 27  ? 0.4076 0.4286 0.4551 0.0418  0.0293  0.0012  27  LEU A O   
126 C CB  . LEU A 27  ? 0.3236 0.3899 0.3265 0.0849  0.0204  -0.0110 27  LEU A CB  
127 C CG  . LEU A 27  ? 0.4024 0.4984 0.4075 0.0991  0.0105  -0.0167 27  LEU A CG  
128 C CD1 . LEU A 27  ? 0.3392 0.4805 0.3910 0.0629  0.0111  -0.0296 27  LEU A CD1 
129 C CD2 . LEU A 27  ? 0.4350 0.5758 0.4018 0.1508  -0.0041 -0.0322 27  LEU A CD2 
130 N N   . ASP A 28  ? 0.4097 0.3608 0.3772 0.0474  0.0508  0.0066  28  ASP A N   
131 C CA  . ASP A 28  ? 0.4978 0.4090 0.4442 0.0280  0.0647  0.0070  28  ASP A CA  
132 C C   . ASP A 28  ? 0.4712 0.4375 0.4810 -0.0011 0.0667  -0.0090 28  ASP A C   
133 O O   . ASP A 28  ? 0.3876 0.3659 0.4154 -0.0057 0.0629  -0.0117 28  ASP A O   
134 C CB  . ASP A 28  ? 0.5735 0.3882 0.4242 0.0132  0.0930  0.0092  28  ASP A CB  
135 C CG  . ASP A 28  ? 0.8215 0.5566 0.5752 0.0645  0.0862  0.0247  28  ASP A CG  
136 O OD1 . ASP A 28  ? 1.0547 0.6812 0.6978 0.0634  0.1084  0.0304  28  ASP A OD1 
137 O OD2 . ASP A 28  ? 0.7924 0.5736 0.5690 0.1084  0.0594  0.0263  28  ASP A OD2 
138 N N   . PHE A 29  ? 0.3731 0.3806 0.4129 -0.0114 0.0693  -0.0237 29  PHE A N   
139 C CA  . PHE A 29  ? 0.3435 0.4193 0.4350 -0.0161 0.0630  -0.0470 29  PHE A CA  
140 C C   . PHE A 29  ? 0.3447 0.4300 0.4591 0.0128  0.0373  -0.0383 29  PHE A C   
141 O O   . PHE A 29  ? 0.3358 0.4483 0.4659 0.0166  0.0308  -0.0491 29  PHE A O   
142 C CB  . PHE A 29  ? 0.2920 0.4157 0.4050 -0.0159 0.0648  -0.0681 29  PHE A CB  
143 C CG  . PHE A 29  ? 0.3498 0.5525 0.5051 0.0062  0.0484  -0.0978 29  PHE A CG  
144 C CD1 . PHE A 29  ? 0.1914 0.4745 0.3708 -0.0148 0.0596  -0.1368 29  PHE A CD1 
145 C CD2 . PHE A 29  ? 0.2705 0.4627 0.4253 0.0507  0.0230  -0.0924 29  PHE A CD2 
146 C CE1 . PHE A 29  ? 0.3378 0.7169 0.5520 0.0238  0.0377  -0.1739 29  PHE A CE1 
147 C CE2 . PHE A 29  ? 0.3009 0.5477 0.4662 0.0930  0.0026  -0.1212 29  PHE A CE2 
148 C CZ  . PHE A 29  ? 0.2041 0.5567 0.4046 0.0873  0.0060  -0.1632 29  PHE A CZ  
149 N N   . ALA A 30  ? 0.3271 0.3877 0.4326 0.0279  0.0263  -0.0235 30  ALA A N   
150 C CA  . ALA A 30  ? 0.3377 0.3803 0.4359 0.0422  0.0116  -0.0189 30  ALA A CA  
151 C C   . ALA A 30  ? 0.3224 0.3550 0.4164 0.0366  0.0097  -0.0093 30  ALA A C   
152 O O   . ALA A 30  ? 0.3765 0.3980 0.4613 0.0464  0.0007  -0.0101 30  ALA A O   
153 C CB  . ALA A 30  ? 0.3168 0.3323 0.3934 0.0379  0.0120  -0.0144 30  ALA A CB  
154 N N   . VAL A 31  ? 0.2966 0.3284 0.3859 0.0291  0.0165  -0.0018 31  VAL A N   
155 C CA  . VAL A 31  ? 0.3467 0.3755 0.4309 0.0286  0.0149  0.0035  31  VAL A CA  
156 C C   . VAL A 31  ? 0.3670 0.3970 0.4589 0.0228  0.0187  -0.0015 31  VAL A C   
157 O O   . VAL A 31  ? 0.3762 0.4097 0.4723 0.0238  0.0125  -0.0008 31  VAL A O   
158 C CB  . VAL A 31  ? 0.3755 0.4025 0.4366 0.0413  0.0173  0.0064  31  VAL A CB  
159 C CG1 . VAL A 31  ? 0.3733 0.3950 0.4221 0.0497  0.0151  0.0081  31  VAL A CG1 
160 C CG2 . VAL A 31  ? 0.3678 0.4344 0.4330 0.0439  0.0121  -0.0028 31  VAL A CG2 
161 N N   . GLY A 32  ? 0.3546 0.3897 0.4460 0.0097  0.0322  -0.0128 32  GLY A N   
162 C CA  . GLY A 32  ? 0.3177 0.3789 0.4192 -0.0101 0.0421  -0.0326 32  GLY A CA  
163 C C   . GLY A 32  ? 0.3707 0.4896 0.5057 0.0105  0.0224  -0.0482 32  GLY A C   
164 O O   . GLY A 32  ? 0.3642 0.5094 0.5084 0.0094  0.0188  -0.0591 32  GLY A O   
165 N N   . GLU A 33  ? 0.3213 0.4508 0.4602 0.0365  0.0084  -0.0509 33  GLU A N   
166 C CA  . GLU A 33  ? 0.3419 0.4955 0.4766 0.0778  -0.0150 -0.0646 33  GLU A CA  
167 C C   . GLU A 33  ? 0.3345 0.4228 0.4304 0.0918  -0.0265 -0.0411 33  GLU A C   
168 O O   . GLU A 33  ? 0.3516 0.4479 0.4308 0.1197  -0.0417 -0.0494 33  GLU A O   
169 C CB  . GLU A 33  ? 0.3388 0.4892 0.4588 0.1101  -0.0259 -0.0730 33  GLU A CB  
170 C CG  . GLU A 33  ? 0.3225 0.5594 0.4824 0.0981  -0.0150 -0.1067 33  GLU A CG  
171 C CD  . GLU A 33  ? 0.4885 0.8442 0.6849 0.1019  -0.0172 -0.1547 33  GLU A CD  
172 O OE1 . GLU A 33  ? 0.4869 0.8889 0.7085 0.0450  0.0111  -0.1743 33  GLU A OE1 
173 O OE2 . GLU A 33  ? 0.5321 0.9308 0.7185 0.1622  -0.0456 -0.1773 33  GLU A OE2 
174 N N   . TYR A 34  ? 0.2891 0.3203 0.3650 0.0716  -0.0180 -0.0174 34  TYR A N   
175 C CA  . TYR A 34  ? 0.3657 0.3463 0.4044 0.0654  -0.0193 -0.0028 34  TYR A CA  
176 C C   . TYR A 34  ? 0.3444 0.3557 0.4040 0.0602  -0.0205 -0.0046 34  TYR A C   
177 O O   . TYR A 34  ? 0.4221 0.4119 0.4512 0.0749  -0.0301 -0.0033 34  TYR A O   
178 C CB  . TYR A 34  ? 0.4104 0.3775 0.4458 0.0339  -0.0054 0.0061  34  TYR A CB  
179 C CG  . TYR A 34  ? 0.4078 0.3430 0.4063 0.0128  0.0004  0.0099  34  TYR A CG  
180 C CD1 . TYR A 34  ? 0.5708 0.4262 0.4942 -0.0005 0.0080  0.0106  34  TYR A CD1 
181 C CD2 . TYR A 34  ? 0.5021 0.4737 0.5241 0.0034  0.0020  0.0098  34  TYR A CD2 
182 C CE1 . TYR A 34  ? 0.6932 0.5118 0.5672 -0.0351 0.0221  0.0086  34  TYR A CE1 
183 C CE2 . TYR A 34  ? 0.5217 0.4768 0.5105 -0.0218 0.0102  0.0071  34  TYR A CE2 
184 C CZ  . TYR A 34  ? 0.7130 0.5945 0.6288 -0.0464 0.0224  0.0055  34  TYR A CZ  
185 O OH  . TYR A 34  ? 0.8919 0.7507 0.7613 -0.0857 0.0389  -0.0022 34  TYR A OH  
186 N N   . ASN A 35  ? 0.2969 0.3417 0.3912 0.0407  -0.0091 -0.0075 35  ASN A N   
187 C CA  . ASN A 35  ? 0.2868 0.3475 0.3907 0.0315  -0.0061 -0.0111 35  ASN A CA  
188 C C   . ASN A 35  ? 0.3409 0.4530 0.4612 0.0419  -0.0134 -0.0349 35  ASN A C   
189 O O   . ASN A 35  ? 0.3258 0.4487 0.4436 0.0458  -0.0195 -0.0385 35  ASN A O   
190 C CB  . ASN A 35  ? 0.3184 0.3671 0.4205 0.0122  0.0116  -0.0102 35  ASN A CB  
191 C CG  . ASN A 35  ? 0.3818 0.4063 0.4652 0.0194  0.0110  0.0039  35  ASN A CG  
192 O OD1 . ASN A 35  ? 0.3217 0.3536 0.4039 0.0212  0.0049  0.0063  35  ASN A OD1 
193 N ND2 . ASN A 35  ? 0.3057 0.3131 0.3710 0.0265  0.0168  0.0072  35  ASN A ND2 
194 N N   . LYS A 36  ? 0.2835 0.4451 0.4231 0.0467  -0.0129 -0.0584 36  LYS A N   
195 C CA  . LYS A 36  ? 0.3756 0.6295 0.5392 0.0605  -0.0215 -0.0981 36  LYS A CA  
196 C C   . LYS A 36  ? 0.4682 0.7131 0.5977 0.1193  -0.0526 -0.0964 36  LYS A C   
197 O O   . LYS A 36  ? 0.4419 0.7423 0.5766 0.1366  -0.0642 -0.1183 36  LYS A O   
198 C CB  . LYS A 36  ? 0.2605 0.5937 0.4529 0.0553  -0.0144 -0.1347 36  LYS A CB  
199 C CG  . LYS A 36  ? 0.5625 1.0374 0.7874 0.0799  -0.0279 -0.1937 36  LYS A CG  
200 C CD  . LYS A 36  ? 0.5912 1.1659 0.8469 0.0796  -0.0224 -0.2385 36  LYS A CD  
201 C CE  . LYS A 36  ? 0.6102 1.3634 0.9005 0.1242  -0.0448 -0.3110 36  LYS A CE  
202 N NZ  . LYS A 36  ? 0.3989 1.2877 0.7268 0.1289  -0.0414 -0.3701 36  LYS A NZ  
203 N N   . ALA A 37  ? 0.4674 0.6303 0.5459 0.1494  -0.0636 -0.0727 37  ALA A N   
204 C CA  . ALA A 37  ? 0.5710 0.6699 0.5704 0.2069  -0.0878 -0.0661 37  ALA A CA  
205 C C   . ALA A 37  ? 0.6033 0.6126 0.5511 0.1895  -0.0828 -0.0361 37  ALA A C   
206 O O   . ALA A 37  ? 0.6447 0.5909 0.5099 0.2335  -0.0995 -0.0324 37  ALA A O   
207 C CB  . ALA A 37  ? 0.5946 0.6128 0.5292 0.2411  -0.0949 -0.0576 37  ALA A CB  
208 N N   . SER A 38  ? 0.5525 0.5540 0.5346 0.1323  -0.0609 -0.0187 38  SER A N   
209 C CA  . SER A 38  ? 0.5234 0.4597 0.4566 0.1157  -0.0556 -0.0001 38  SER A CA  
210 C C   . SER A 38  ? 0.5584 0.5432 0.5076 0.1273  -0.0655 -0.0111 38  SER A C   
211 O O   . SER A 38  ? 0.5296 0.6083 0.5428 0.1275  -0.0681 -0.0346 38  SER A O   
212 C CB  . SER A 38  ? 0.4537 0.3820 0.4091 0.0633  -0.0334 0.0123  38  SER A CB  
213 O OG  . SER A 38  ? 0.5214 0.5174 0.5416 0.0482  -0.0287 0.0057  38  SER A OG  
214 N N   . ASN A 39  ? 0.5743 0.4928 0.4570 0.1291  -0.0666 0.0020  39  ASN A N   
215 C CA  . ASN A 39  ? 0.5300 0.4911 0.4233 0.1392  -0.0757 -0.0076 39  ASN A CA  
216 C C   . ASN A 39  ? 0.4226 0.4112 0.3665 0.0868  -0.0563 -0.0019 39  ASN A C   
217 O O   . ASN A 39  ? 0.4048 0.4087 0.3464 0.0844  -0.0586 -0.0051 39  ASN A O   
218 C CB  . ASN A 39  ? 0.6652 0.5236 0.4392 0.1730  -0.0865 0.0043  39  ASN A CB  
219 C CG  . ASN A 39  ? 1.0608 0.8814 0.7567 0.2526  -0.1140 -0.0058 39  ASN A CG  
220 O OD1 . ASN A 39  ? 0.9925 0.9265 0.7400 0.2993  -0.1373 -0.0377 39  ASN A OD1 
221 N ND2 . ASN A 39  ? 1.1991 0.8594 0.7576 0.2688  -0.1096 0.0148  39  ASN A ND2 
222 N N   . ASP A 40  ? 0.3878 0.3829 0.3685 0.0539  -0.0397 0.0039  40  ASP A N   
223 C CA  . ASP A 40  ? 0.3187 0.3341 0.3274 0.0219  -0.0255 0.0056  40  ASP A CA  
224 C C   . ASP A 40  ? 0.3724 0.4368 0.4328 0.0188  -0.0218 -0.0064 40  ASP A C   
225 O O   . ASP A 40  ? 0.3988 0.4789 0.4812 0.0200  -0.0188 -0.0141 40  ASP A O   
226 C CB  . ASP A 40  ? 0.3421 0.3476 0.3491 0.0004  -0.0127 0.0096  40  ASP A CB  
227 C CG  . ASP A 40  ? 0.4019 0.4468 0.4254 -0.0187 -0.0030 0.0010  40  ASP A CG  
228 O OD1 . ASP A 40  ? 0.3542 0.4186 0.3873 -0.0161 -0.0049 -0.0033 40  ASP A OD1 
229 O OD2 . ASP A 40  ? 0.3853 0.4534 0.4114 -0.0329 0.0055  -0.0073 40  ASP A OD2 
230 N N   . MET A 41  ? 0.2932 0.3700 0.3593 0.0099  -0.0177 -0.0106 41  MET A N   
231 C CA  . MET A 41  ? 0.2860 0.3734 0.3701 0.0017  -0.0075 -0.0231 41  MET A CA  
232 C C   . MET A 41  ? 0.3258 0.3835 0.3986 0.0041  0.0028  -0.0177 41  MET A C   
233 O O   . MET A 41  ? 0.3688 0.3929 0.4226 -0.0024 0.0169  -0.0245 41  MET A O   
234 C CB  . MET A 41  ? 0.3117 0.4092 0.3928 -0.0041 -0.0060 -0.0317 41  MET A CB  
235 C CG  . MET A 41  ? 0.2608 0.3540 0.3290 -0.0001 -0.0065 -0.0246 41  MET A CG  
236 S SD  . MET A 41  ? 0.3470 0.4587 0.4121 -0.0057 -0.0084 -0.0351 41  MET A SD  
237 C CE  . MET A 41  ? 0.3076 0.4289 0.3627 0.0029  -0.0041 -0.0402 41  MET A CE  
238 N N   . TYR A 42  ? 0.3101 0.3757 0.3796 0.0126  -0.0015 -0.0106 42  TYR A N   
239 C CA  . TYR A 42  ? 0.3027 0.3600 0.3579 0.0310  0.0014  -0.0118 42  TYR A CA  
240 C C   . TYR A 42  ? 0.2647 0.3105 0.3233 0.0303  0.0029  -0.0054 42  TYR A C   
241 O O   . TYR A 42  ? 0.3858 0.4414 0.4590 0.0180  -0.0006 -0.0009 42  TYR A O   
242 C CB  . TYR A 42  ? 0.2578 0.3693 0.3162 0.0395  -0.0035 -0.0233 42  TYR A CB  
243 C CG  . TYR A 42  ? 0.2939 0.4257 0.3465 0.0474  -0.0051 -0.0348 42  TYR A CG  
244 C CD1 . TYR A 42  ? 0.3382 0.4425 0.3567 0.0853  -0.0068 -0.0422 42  TYR A CD1 
245 C CD2 . TYR A 42  ? 0.2018 0.3636 0.2649 0.0197  -0.0035 -0.0387 42  TYR A CD2 
246 C CE1 . TYR A 42  ? 0.3005 0.4227 0.3092 0.0987  -0.0093 -0.0558 42  TYR A CE1 
247 C CE2 . TYR A 42  ? 0.3095 0.4978 0.3697 0.0257  -0.0043 -0.0518 42  TYR A CE2 
248 C CZ  . TYR A 42  ? 0.2980 0.4739 0.3383 0.0662  -0.0083 -0.0613 42  TYR A CZ  
249 O OH  . TYR A 42  ? 0.3420 0.5412 0.3753 0.0776  -0.0101 -0.0763 42  TYR A OH  
250 N N   . HIS A 43  ? 0.3502 0.3752 0.3706 0.0275  0.0324  -0.0175 43  HIS A N   
251 C CA  . HIS A 43  ? 0.3526 0.3941 0.3793 0.0202  0.0337  -0.0171 43  HIS A CA  
252 C C   . HIS A 43  ? 0.3632 0.3771 0.3844 0.0269  0.0340  -0.0030 43  HIS A C   
253 O O   . HIS A 43  ? 0.3635 0.3566 0.3922 0.0245  0.0370  0.0006  43  HIS A O   
254 C CB  . HIS A 43  ? 0.3639 0.3954 0.3837 -0.0090 0.0441  -0.0150 43  HIS A CB  
255 C CG  . HIS A 43  ? 0.3600 0.3828 0.3603 -0.0239 0.0501  -0.0134 43  HIS A CG  
256 N ND1 . HIS A 43  ? 0.4107 0.4788 0.4221 -0.0404 0.0634  -0.0390 43  HIS A ND1 
257 C CD2 . HIS A 43  ? 0.4151 0.3863 0.3804 -0.0240 0.0431  0.0035  43  HIS A CD2 
258 C CE1 . HIS A 43  ? 0.4754 0.5131 0.4525 -0.0570 0.0716  -0.0318 43  HIS A CE1 
259 N NE2 . HIS A 43  ? 0.4281 0.3999 0.3693 -0.0440 0.0559  -0.0035 43  HIS A NE2 
260 N N   . SER A 44  ? 0.4087 0.4315 0.4254 0.0346  0.0314  -0.0051 44  SER A N   
261 C CA  . SER A 44  ? 0.3716 0.3793 0.3906 0.0347  0.0342  0.0007  44  SER A CA  
262 C C   . SER A 44  ? 0.4313 0.4506 0.4524 0.0269  0.0289  0.0038  44  SER A C   
263 O O   . SER A 44  ? 0.3639 0.4034 0.3781 0.0166  0.0323  -0.0023 44  SER A O   
264 C CB  . SER A 44  ? 0.3894 0.3741 0.3804 0.0477  0.0377  -0.0029 44  SER A CB  
265 O OG  . SER A 44  ? 0.4033 0.3374 0.3587 0.0469  0.0504  -0.0047 44  SER A OG  
266 N N   . ARG A 45  ? 0.3837 0.3899 0.4112 0.0303  0.0218  0.0039  45  ARG A N   
267 C CA  . ARG A 45  ? 0.3889 0.3826 0.3930 0.0282  0.0119  0.0076  45  ARG A CA  
268 C C   . ARG A 45  ? 0.3767 0.3780 0.4025 0.0415  0.0025  -0.0035 45  ARG A C   
269 O O   . ARG A 45  ? 0.3801 0.3970 0.4435 0.0447  0.0090  -0.0204 45  ARG A O   
270 C CB  . ARG A 45  ? 0.3737 0.3141 0.3300 0.0242  -0.0006 0.0137  45  ARG A CB  
271 C CG  . ARG A 45  ? 0.4479 0.3713 0.4203 0.0486  -0.0253 0.0025  45  ARG A CG  
272 C CD  . ARG A 45  ? 0.5404 0.3796 0.4352 0.0543  -0.0463 0.0092  45  ARG A CD  
273 N NE  . ARG A 45  ? 0.5924 0.4198 0.5075 0.0897  -0.0808 -0.0127 45  ARG A NE  
274 C CZ  . ARG A 45  ? 0.6283 0.4395 0.5416 0.1310  -0.1249 -0.0393 45  ARG A CZ  
275 N NH1 . ARG A 45  ? 0.6938 0.4897 0.5772 0.1400  -0.1383 -0.0394 45  ARG A NH1 
276 N NH2 . ARG A 45  ? 0.6192 0.4371 0.5669 0.1677  -0.1597 -0.0750 45  ARG A NH2 
277 N N   . ALA A 46  ? 0.3902 0.3805 0.3909 0.0434  -0.0071 -0.0013 46  ALA A N   
278 C CA  . ALA A 46  ? 0.3712 0.3762 0.3957 0.0567  -0.0185 -0.0182 46  ALA A CA  
279 C C   . ALA A 46  ? 0.4323 0.4390 0.4850 0.0797  -0.0457 -0.0462 46  ALA A C   
280 O O   . ALA A 46  ? 0.5193 0.4782 0.5275 0.0977  -0.0756 -0.0439 46  ALA A O   
281 C CB  . ALA A 46  ? 0.3715 0.3518 0.3472 0.0563  -0.0283 -0.0101 46  ALA A CB  
282 N N   . LEU A 47  ? 0.3760 0.4313 0.4962 0.0780  -0.0342 -0.0811 47  LEU A N   
283 C CA  . LEU A 47  ? 0.3703 0.4621 0.5489 0.1020  -0.0614 -0.1354 47  LEU A CA  
284 C C   . LEU A 47  ? 0.3913 0.4913 0.5690 0.1260  -0.0931 -0.1569 47  LEU A C   
285 O O   . LEU A 47  ? 0.4741 0.5741 0.6584 0.1683  -0.1444 -0.1938 47  LEU A O   
286 C CB  . LEU A 47  ? 0.4243 0.5723 0.6794 0.0728  -0.0188 -0.1803 47  LEU A CB  
287 C CG  . LEU A 47  ? 0.6117 0.7753 0.9024 0.0579  0.0029  -0.2034 47  LEU A CG  
288 C CD1 . LEU A 47  ? 0.6069 0.7668 0.9020 0.0059  0.0701  -0.2187 47  LEU A CD1 
289 C CD2 . LEU A 47  ? 0.7095 0.9338 1.0800 0.0894  -0.0342 -0.2754 47  LEU A CD2 
290 N N   . GLN A 48  ? 0.3861 0.4888 0.5506 0.1052  -0.0682 -0.1383 48  GLN A N   
291 C CA  . GLN A 48  ? 0.4199 0.5404 0.5939 0.1221  -0.0907 -0.1637 48  GLN A CA  
292 C C   . GLN A 48  ? 0.4154 0.5155 0.5465 0.0979  -0.0624 -0.1235 48  GLN A C   
293 O O   . GLN A 48  ? 0.4226 0.5262 0.5590 0.0695  -0.0211 -0.1080 48  GLN A O   
294 C CB  . GLN A 48  ? 0.3259 0.5286 0.6041 0.1124  -0.0739 -0.2352 48  GLN A CB  
295 C CG  . GLN A 48  ? 0.5639 0.8075 0.8775 0.1294  -0.0963 -0.2803 48  GLN A CG  
296 C CD  . GLN A 48  ? 0.6273 0.9560 1.0459 0.0961  -0.0548 -0.3569 48  GLN A CD  
297 O OE1 . GLN A 48  ? 0.8452 1.2356 1.3248 0.1124  -0.0766 -0.4209 48  GLN A OE1 
298 N NE2 . GLN A 48  ? 0.4451 0.7693 0.8753 0.0455  0.0085  -0.3569 48  GLN A NE2 
299 N N   . VAL A 49  ? 0.5004 0.5691 0.5780 0.1128  -0.0875 -0.1110 49  VAL A N   
300 C CA  . VAL A 49  ? 0.4491 0.5183 0.5071 0.0928  -0.0627 -0.0906 49  VAL A CA  
301 C C   . VAL A 49  ? 0.4700 0.5859 0.5835 0.0974  -0.0650 -0.1327 49  VAL A C   
302 O O   . VAL A 49  ? 0.4794 0.6000 0.5946 0.1273  -0.1059 -0.1625 49  VAL A O   
303 C CB  . VAL A 49  ? 0.5913 0.5992 0.5558 0.0940  -0.0765 -0.0611 49  VAL A CB  
304 C CG1 . VAL A 49  ? 0.5279 0.5537 0.4886 0.0746  -0.0510 -0.0522 49  VAL A CG1 
305 C CG2 . VAL A 49  ? 0.4833 0.4460 0.3942 0.0781  -0.0649 -0.0320 49  VAL A CG2 
306 N N   . VAL A 50  ? 0.4106 0.5497 0.5577 0.0697  -0.0230 -0.1402 50  VAL A N   
307 C CA  . VAL A 50  ? 0.3443 0.5257 0.5444 0.0617  -0.0128 -0.1882 50  VAL A CA  
308 C C   . VAL A 50  ? 0.4712 0.6439 0.6394 0.0689  -0.0241 -0.1759 50  VAL A C   
309 O O   . VAL A 50  ? 0.4324 0.6408 0.6354 0.0813  -0.0438 -0.2177 50  VAL A O   
310 C CB  . VAL A 50  ? 0.4915 0.6640 0.7056 0.0199  0.0460  -0.2020 50  VAL A CB  
311 C CG1 . VAL A 50  ? 0.4627 0.6703 0.7242 -0.0031 0.0708  -0.2584 50  VAL A CG1 
312 C CG2 . VAL A 50  ? 0.4107 0.5896 0.6529 0.0068  0.0626  -0.2205 50  VAL A CG2 
313 N N   . ARG A 51  ? 0.3379 0.4723 0.4471 0.0623  -0.0129 -0.1287 51  ARG A N   
314 C CA  . ARG A 51  ? 0.4315 0.5612 0.5127 0.0641  -0.0170 -0.1214 51  ARG A CA  
315 C C   . ARG A 51  ? 0.4363 0.5367 0.4593 0.0599  -0.0137 -0.0828 51  ARG A C   
316 O O   . ARG A 51  ? 0.3884 0.4841 0.4092 0.0525  0.0034  -0.0674 51  ARG A O   
317 C CB  . ARG A 51  ? 0.3969 0.5321 0.4981 0.0448  0.0177  -0.1361 51  ARG A CB  
318 C CG  . ARG A 51  ? 0.3713 0.5128 0.4604 0.0471  0.0136  -0.1409 51  ARG A CG  
319 C CD  . ARG A 51  ? 0.4281 0.6098 0.5622 0.0555  -0.0070 -0.1868 51  ARG A CD  
320 N NE  . ARG A 51  ? 0.5446 0.7317 0.6640 0.0601  -0.0157 -0.1929 51  ARG A NE  
321 C CZ  . ARG A 51  ? 0.5447 0.7522 0.6969 0.0443  0.0060  -0.2254 51  ARG A CZ  
322 N NH1 . ARG A 51  ? 0.4843 0.6978 0.6755 0.0150  0.0453  -0.2582 51  ARG A NH1 
323 N NH2 . ARG A 51  ? 0.4277 0.6405 0.5640 0.0517  -0.0064 -0.2292 51  ARG A NH2 
324 N N   . ALA A 52  ? 0.4050 0.5753 0.4613 0.0998  -0.0195 -0.0216 52  ALA A N   
325 C CA  . ALA A 52  ? 0.3704 0.5102 0.4167 0.0976  -0.0215 -0.0236 52  ALA A CA  
326 C C   . ALA A 52  ? 0.4565 0.5701 0.4986 0.0862  -0.0209 -0.0130 52  ALA A C   
327 O O   . ALA A 52  ? 0.4404 0.5441 0.4832 0.0866  -0.0258 -0.0135 52  ALA A O   
328 C CB  . ALA A 52  ? 0.4154 0.5377 0.4645 0.1073  -0.0307 -0.0371 52  ALA A CB  
329 N N   . ARG A 53  ? 0.3532 0.4589 0.3911 0.0782  -0.0160 -0.0054 53  ARG A N   
330 C CA  . ARG A 53  ? 0.3021 0.3867 0.3372 0.0696  -0.0166 0.0010  53  ARG A CA  
331 C C   . ARG A 53  ? 0.3714 0.4351 0.3960 0.0665  -0.0146 0.0031  53  ARG A C   
332 O O   . ARG A 53  ? 0.3990 0.4664 0.4217 0.0683  -0.0119 0.0013  53  ARG A O   
333 C CB  . ARG A 53  ? 0.3370 0.4364 0.3889 0.0609  -0.0134 0.0096  53  ARG A CB  
334 C CG  . ARG A 53  ? 0.4329 0.5533 0.5015 0.0630  -0.0157 0.0081  53  ARG A CG  
335 C CD  . ARG A 53  ? 0.3484 0.4823 0.4458 0.0538  -0.0139 0.0178  53  ARG A CD  
336 N NE  . ARG A 53  ? 0.4643 0.6174 0.5702 0.0506  -0.0040 0.0331  53  ARG A NE  
337 C CZ  . ARG A 53  ? 0.5300 0.6872 0.6617 0.0410  -0.0006 0.0475  53  ARG A CZ  
338 N NH1 . ARG A 53  ? 0.4909 0.6325 0.6455 0.0336  -0.0084 0.0434  53  ARG A NH1 
339 N NH2 . ARG A 53  ? 0.6245 0.8041 0.7615 0.0408  0.0095  0.0654  53  ARG A NH2 
340 N N   . LYS A 54  ? 0.3655 0.4119 0.3842 0.0632  -0.0165 0.0058  54  LYS A N   
341 C CA  . LYS A 54  ? 0.4228 0.4520 0.4327 0.0605  -0.0138 0.0091  54  LYS A CA  
342 C C   . LYS A 54  ? 0.3830 0.4072 0.3919 0.0551  -0.0143 0.0111  54  LYS A C   
343 O O   . LYS A 54  ? 0.4468 0.4773 0.4620 0.0556  -0.0193 0.0073  54  LYS A O   
344 C CB  . LYS A 54  ? 0.4016 0.4153 0.4063 0.0668  -0.0153 0.0107  54  LYS A CB  
345 C CG  . LYS A 54  ? 0.4648 0.4751 0.4621 0.0718  -0.0182 0.0149  54  LYS A CG  
346 C CD  . LYS A 54  ? 0.5453 0.5451 0.5446 0.0790  -0.0185 0.0231  54  LYS A CD  
347 C CE  . LYS A 54  ? 0.6346 0.6418 0.6237 0.0881  -0.0217 0.0289  54  LYS A CE  
348 N NZ  . LYS A 54  ? 0.4832 0.4839 0.4760 0.0967  -0.0203 0.0455  54  LYS A NZ  
349 N N   . GLN A 55  ? 0.3250 0.3395 0.3294 0.0510  -0.0107 0.0142  55  GLN A N   
350 C CA  . GLN A 55  ? 0.4039 0.4144 0.4100 0.0470  -0.0121 0.0133  55  GLN A CA  
351 C C   . GLN A 55  ? 0.3574 0.3554 0.3523 0.0467  -0.0081 0.0166  55  GLN A C   
352 O O   . GLN A 55  ? 0.3750 0.3691 0.3698 0.0445  -0.0038 0.0196  55  GLN A O   
353 C CB  . GLN A 55  ? 0.3359 0.3544 0.3605 0.0391  -0.0107 0.0167  55  GLN A CB  
354 C CG  . GLN A 55  ? 0.4122 0.4286 0.4523 0.0357  -0.0165 0.0119  55  GLN A CG  
355 C CD  . GLN A 55  ? 0.6640 0.6864 0.7313 0.0272  -0.0147 0.0206  55  GLN A CD  
356 O OE1 . GLN A 55  ? 0.4506 0.4785 0.5156 0.0249  -0.0071 0.0320  55  GLN A OE1 
357 N NE2 . GLN A 55  ? 0.5680 0.5919 0.6653 0.0239  -0.0225 0.0155  55  GLN A NE2 
358 N N   . ILE A 56  ? 0.3331 0.3290 0.3202 0.0503  -0.0101 0.0147  56  ILE A N   
359 C CA  . ILE A 56  ? 0.3319 0.3201 0.3113 0.0498  -0.0056 0.0187  56  ILE A CA  
360 C C   . ILE A 56  ? 0.3843 0.3712 0.3729 0.0435  -0.0070 0.0139  56  ILE A C   
361 O O   . ILE A 56  ? 0.3973 0.3899 0.3937 0.0450  -0.0137 0.0050  56  ILE A O   
362 C CB  . ILE A 56  ? 0.3498 0.3446 0.3158 0.0599  -0.0059 0.0207  56  ILE A CB  
363 C CG1 . ILE A 56  ? 0.3859 0.3825 0.3478 0.0669  -0.0047 0.0299  56  ILE A CG1 
364 C CG2 . ILE A 56  ? 0.3009 0.2916 0.2617 0.0593  0.0003  0.0269  56  ILE A CG2 
365 C CD1 . ILE A 56  ? 0.4297 0.4420 0.3777 0.0805  -0.0051 0.0354  56  ILE A CD1 
366 N N   . PRO A 57  ? 0.3425 0.3232 0.3339 0.0375  -0.0023 0.0184  57  PRO A N   
367 C CA  . PRO A 57  ? 0.2935 0.2730 0.2966 0.0322  -0.0038 0.0167  57  PRO A CA  
368 C C   . PRO A 57  ? 0.4005 0.3767 0.3972 0.0353  -0.0047 0.0115  57  PRO A C   
369 O O   . PRO A 57  ? 0.3964 0.3722 0.3784 0.0403  -0.0007 0.0144  57  PRO A O   
370 C CB  . PRO A 57  ? 0.3627 0.3422 0.3674 0.0281  0.0018  0.0240  57  PRO A CB  
371 C CG  . PRO A 57  ? 0.3633 0.3375 0.3560 0.0320  0.0052  0.0242  57  PRO A CG  
372 C CD  . PRO A 57  ? 0.3978 0.3738 0.3862 0.0370  0.0029  0.0233  57  PRO A CD  
373 N N   . ALA A 58  ? 0.3175 0.2936 0.3293 0.0333  -0.0104 0.0047  58  ALA A N   
374 C CA  . ALA A 58  ? 0.3725 0.3496 0.3799 0.0382  -0.0126 -0.0037 58  ALA A CA  
375 C C   . ALA A 58  ? 0.3761 0.3446 0.3936 0.0315  -0.0103 0.0004  58  ALA A C   
376 O O   . ALA A 58  ? 0.3958 0.3625 0.4349 0.0298  -0.0173 -0.0062 58  ALA A O   
377 C CB  . ALA A 58  ? 0.3431 0.3296 0.3646 0.0449  -0.0248 -0.0215 58  ALA A CB  
378 N N   . GLY A 59  ? 0.3472 0.3110 0.3533 0.0286  -0.0019 0.0102  59  GLY A N   
379 C CA  . GLY A 59  ? 0.3883 0.3472 0.4024 0.0240  -0.0001 0.0141  59  GLY A CA  
380 C C   . GLY A 59  ? 0.4175 0.3741 0.4211 0.0261  0.0040  0.0124  59  GLY A C   
381 O O   . GLY A 59  ? 0.4073 0.3678 0.3985 0.0312  0.0071  0.0115  59  GLY A O   
382 N N   . VAL A 60  ? 0.4339 0.3869 0.4448 0.0230  0.0045  0.0144  60  VAL A N   
383 C CA  . VAL A 60  ? 0.3550 0.3068 0.3598 0.0241  0.0086  0.0132  60  VAL A CA  
384 C C   . VAL A 60  ? 0.4209 0.3717 0.4296 0.0210  0.0108  0.0185  60  VAL A C   
385 O O   . VAL A 60  ? 0.4222 0.3754 0.4402 0.0193  0.0084  0.0239  60  VAL A O   
386 C CB  . VAL A 60  ? 0.4306 0.3846 0.4395 0.0282  0.0045  0.0035  60  VAL A CB  
387 C CG1 . VAL A 60  ? 0.4234 0.3726 0.4537 0.0258  -0.0034 0.0004  60  VAL A CG1 
388 C CG2 . VAL A 60  ? 0.3813 0.3372 0.3849 0.0295  0.0102  0.0039  60  VAL A CG2 
389 N N   . ASN A 61  ? 0.3916 0.3423 0.3966 0.0215  0.0150  0.0179  61  ASN A N   
390 C CA  . ASN A 61  ? 0.3307 0.2848 0.3397 0.0216  0.0150  0.0177  61  ASN A CA  
391 C C   . ASN A 61  ? 0.3550 0.3073 0.3682 0.0217  0.0149  0.0146  61  ASN A C   
392 O O   . ASN A 61  ? 0.3550 0.3056 0.3677 0.0221  0.0177  0.0120  61  ASN A O   
393 C CB  . ASN A 61  ? 0.3465 0.3019 0.3585 0.0228  0.0167  0.0143  61  ASN A CB  
394 C CG  . ASN A 61  ? 0.4236 0.3849 0.4336 0.0250  0.0149  0.0142  61  ASN A CG  
395 O OD1 . ASN A 61  ? 0.4225 0.3931 0.4290 0.0266  0.0133  0.0178  61  ASN A OD1 
396 N ND2 . ASN A 61  ? 0.3679 0.3257 0.3838 0.0256  0.0153  0.0119  61  ASN A ND2 
397 N N   . TYR A 62  ? 0.2759 0.2326 0.2934 0.0227  0.0123  0.0168  62  TYR A N   
398 C CA  . TYR A 62  ? 0.2983 0.2550 0.3210 0.0239  0.0113  0.0136  62  TYR A CA  
399 C C   . TYR A 62  ? 0.3327 0.2995 0.3560 0.0275  0.0108  0.0103  62  TYR A C   
400 O O   . TYR A 62  ? 0.3473 0.3262 0.3672 0.0316  0.0093  0.0136  62  TYR A O   
401 C CB  . TYR A 62  ? 0.2995 0.2554 0.3316 0.0243  0.0070  0.0199  62  TYR A CB  
402 C CG  . TYR A 62  ? 0.3862 0.3335 0.4260 0.0227  0.0036  0.0163  62  TYR A CG  
403 C CD1 . TYR A 62  ? 0.3586 0.3046 0.4063 0.0207  0.0009  0.0217  62  TYR A CD1 
404 C CD2 . TYR A 62  ? 0.3653 0.3101 0.4059 0.0248  0.0024  0.0052  62  TYR A CD2 
405 C CE1 . TYR A 62  ? 0.4037 0.3445 0.4625 0.0212  -0.0051 0.0126  62  TYR A CE1 
406 C CE2 . TYR A 62  ? 0.3854 0.3289 0.4329 0.0273  -0.0030 -0.0040 62  TYR A CE2 
407 C CZ  . TYR A 62  ? 0.4305 0.3712 0.4879 0.0256  -0.0077 -0.0019 62  TYR A CZ  
408 O OH  . TYR A 62  ? 0.5262 0.4680 0.5954 0.0301  -0.0161 -0.0163 62  TYR A OH  
409 N N   . PHE A 63  ? 0.3565 0.3226 0.3860 0.0277  0.0113  0.0028  63  PHE A N   
410 C CA  . PHE A 63  ? 0.3149 0.2921 0.3505 0.0325  0.0082  -0.0056 63  PHE A CA  
411 C C   . PHE A 63  ? 0.3823 0.3628 0.4218 0.0350  0.0061  -0.0073 63  PHE A C   
412 O O   . PHE A 63  ? 0.3712 0.3446 0.4172 0.0316  0.0085  -0.0101 63  PHE A O   
413 C CB  . PHE A 63  ? 0.3013 0.2746 0.3519 0.0299  0.0096  -0.0140 63  PHE A CB  
414 C CG  . PHE A 63  ? 0.3205 0.2886 0.3710 0.0276  0.0116  -0.0110 63  PHE A CG  
415 C CD1 . PHE A 63  ? 0.3191 0.2778 0.3635 0.0231  0.0174  -0.0013 63  PHE A CD1 
416 C CD2 . PHE A 63  ? 0.3147 0.2908 0.3713 0.0323  0.0065  -0.0197 63  PHE A CD2 
417 C CE1 . PHE A 63  ? 0.3494 0.3043 0.3938 0.0221  0.0188  0.0026  63  PHE A CE1 
418 C CE2 . PHE A 63  ? 0.3330 0.3039 0.3916 0.0309  0.0073  -0.0174 63  PHE A CE2 
419 C CZ  . PHE A 63  ? 0.3041 0.2632 0.3567 0.0252  0.0139  -0.0049 63  PHE A CZ  
420 N N   . LEU A 64  ? 0.3221 0.3175 0.3578 0.0425  0.0019  -0.0045 64  LEU A N   
421 C CA  . LEU A 64  ? 0.3357 0.3335 0.3759 0.0455  -0.0005 -0.0038 64  LEU A CA  
422 C C   . LEU A 64  ? 0.3543 0.3726 0.3970 0.0553  -0.0058 -0.0147 64  LEU A C   
423 O O   . LEU A 64  ? 0.3821 0.4208 0.4178 0.0642  -0.0088 -0.0158 64  LEU A O   
424 C CB  . LEU A 64  ? 0.3343 0.3332 0.3737 0.0472  -0.0013 0.0140  64  LEU A CB  
425 C CG  . LEU A 64  ? 0.3950 0.3786 0.4372 0.0399  0.0008  0.0227  64  LEU A CG  
426 C CD1 . LEU A 64  ? 0.3823 0.3684 0.4370 0.0415  -0.0014 0.0418  64  LEU A CD1 
427 C CD2 . LEU A 64  ? 0.3777 0.3447 0.4246 0.0343  0.0014  0.0127  64  LEU A CD2 
428 N N   . ASP A 65  ? 0.3580 0.3775 0.5981 0.0728  -0.0145 0.0362  65  ASP A N   
429 C CA  . ASP A 65  ? 0.3157 0.3183 0.5457 0.0596  -0.0137 0.0256  65  ASP A CA  
430 C C   . ASP A 65  ? 0.3667 0.3960 0.5961 0.0574  -0.0199 0.0250  65  ASP A C   
431 O O   . ASP A 65  ? 0.3084 0.3496 0.5287 0.0739  -0.0149 0.0394  65  ASP A O   
432 C CB  . ASP A 65  ? 0.3631 0.3523 0.5908 0.0413  -0.0191 0.0391  65  ASP A CB  
433 C CG  . ASP A 65  ? 0.3846 0.3012 0.5736 0.0465  -0.0094 0.0358  65  ASP A CG  
434 O OD1 . ASP A 65  ? 0.5293 0.3598 0.6492 0.0483  -0.0019 0.0236  65  ASP A OD1 
435 O OD2 . ASP A 65  ? 0.4255 0.3525 0.6323 0.0567  -0.0042 0.0482  65  ASP A OD2 
436 N N   . VAL A 66  ? 0.3807 0.4059 0.6026 0.0500  -0.0227 0.0126  66  VAL A N   
437 C CA  . VAL A 66  ? 0.3361 0.3747 0.5467 0.0555  -0.0250 0.0115  66  VAL A CA  
438 C C   . VAL A 66  ? 0.3716 0.4244 0.5874 0.0378  -0.0300 0.0103  66  VAL A C   
439 O O   . VAL A 66  ? 0.4540 0.4717 0.6508 0.0232  -0.0331 -0.0031 66  VAL A O   
440 C CB  . VAL A 66  ? 0.3862 0.4096 0.5787 0.0533  -0.0346 0.0057  66  VAL A CB  
441 C CG1 . VAL A 66  ? 0.4989 0.4838 0.6320 0.0592  -0.0402 0.0052  66  VAL A CG1 
442 C CG2 . VAL A 66  ? 0.4929 0.5131 0.6849 0.0484  -0.0450 0.0207  66  VAL A CG2 
443 N N   . GLU A 67  ? 0.3513 0.4445 0.5751 0.0455  -0.0268 0.0325  67  GLU A N   
444 C CA  . GLU A 67  ? 0.3566 0.4759 0.5871 0.0244  -0.0373 0.0394  67  GLU A CA  
445 C C   . GLU A 67  ? 0.3282 0.4242 0.5334 0.0439  -0.0297 0.0176  67  GLU A C   
446 O O   . GLU A 67  ? 0.3508 0.4232 0.5219 0.0753  -0.0166 0.0221  67  GLU A O   
447 C CB  . GLU A 67  ? 0.3071 0.5192 0.5796 0.0236  -0.0369 0.1014  67  GLU A CB  
448 C CG  . GLU A 67  ? 0.3648 0.6166 0.6489 -0.0163 -0.0611 0.1218  67  GLU A CG  
449 C CD  . GLU A 67  ? 0.6086 1.0005 0.9609 -0.0246 -0.0662 0.2160  67  GLU A CD  
450 O OE1 . GLU A 67  ? 0.4390 0.9064 0.8304 0.0271  -0.0328 0.2721  67  GLU A OE1 
451 O OE2 . GLU A 67  ? 0.7387 1.1712 1.1017 -0.0810 -0.1029 0.2462  67  GLU A OE2 
452 N N   . LEU A 68  ? 0.3488 0.4274 0.5454 0.0254  -0.0382 -0.0030 68  LEU A N   
453 C CA  . LEU A 68  ? 0.3071 0.3767 0.4887 0.0346  -0.0360 -0.0143 68  LEU A CA  
454 C C   . LEU A 68  ? 0.2819 0.3811 0.4669 0.0256  -0.0397 -0.0050 68  LEU A C   
455 O O   . LEU A 68  ? 0.3744 0.4825 0.5600 -0.0046 -0.0545 0.0031  68  LEU A O   
456 C CB  . LEU A 68  ? 0.2657 0.3198 0.4465 0.0324  -0.0341 -0.0258 68  LEU A CB  
457 C CG  . LEU A 68  ? 0.4144 0.4725 0.6107 0.0396  -0.0316 -0.0137 68  LEU A CG  
458 C CD1 . LEU A 68  ? 0.4277 0.5183 0.6428 0.0491  -0.0226 0.0081  68  LEU A CD1 
459 C CD2 . LEU A 68  ? 0.4003 0.4444 0.5786 0.0302  -0.0496 -0.0048 68  LEU A CD2 
460 N N   . GLY A 69  ? 0.2812 0.3781 0.4494 0.0438  -0.0328 -0.0023 69  GLY A N   
461 C CA  . GLY A 69  ? 0.2594 0.3943 0.4357 0.0406  -0.0336 0.0126  69  GLY A CA  
462 C C   . GLY A 69  ? 0.3198 0.4203 0.4699 0.0414  -0.0350 -0.0086 69  GLY A C   
463 O O   . GLY A 69  ? 0.3269 0.3781 0.4427 0.0465  -0.0375 -0.0156 69  GLY A O   
464 N N   . ARG A 70  ? 0.2923 0.4149 0.4497 0.0260  -0.0412 -0.0106 70  ARG A N   
465 C CA  . ARG A 70  ? 0.2763 0.3851 0.4190 0.0270  -0.0409 -0.0205 70  ARG A CA  
466 C C   . ARG A 70  ? 0.2565 0.3522 0.3690 0.0507  -0.0322 -0.0047 70  ARG A C   
467 O O   . ARG A 70  ? 0.3468 0.4867 0.4709 0.0696  -0.0204 0.0239  70  ARG A O   
468 C CB  . ARG A 70  ? 0.2736 0.3902 0.4095 0.0089  -0.0465 -0.0274 70  ARG A CB  
469 C CG  . ARG A 70  ? 0.3220 0.4363 0.4515 0.0165  -0.0401 -0.0313 70  ARG A CG  
470 C CD  . ARG A 70  ? 0.6812 0.7708 0.7795 0.0236  -0.0275 -0.0380 70  ARG A CD  
471 N NE  . ARG A 70  ? 0.3331 0.4054 0.3908 0.0058  -0.0389 -0.0430 70  ARG A NE  
472 C CZ  . ARG A 70  ? 0.6280 0.6633 0.6291 0.0111  -0.0315 -0.0476 70  ARG A CZ  
473 N NH1 . ARG A 70  ? 0.3822 0.4050 0.3653 0.0501  0.0007  -0.0410 70  ARG A NH1 
474 N NH2 . ARG A 70  ? 0.3803 0.4010 0.3407 -0.0239 -0.0578 -0.0457 70  ARG A NH2 
475 N N   . THR A 71  ? 0.3767 0.4338 0.3171 -0.0086 -0.0535 0.0471  71  THR A N   
476 C CA  . THR A 71  ? 0.3510 0.4244 0.3211 0.0110  -0.0356 0.0386  71  THR A CA  
477 C C   . THR A 71  ? 0.4180 0.4701 0.4021 0.0257  -0.0354 0.0491  71  THR A C   
478 O O   . THR A 71  ? 0.3746 0.4092 0.3455 0.0170  -0.0436 0.0554  71  THR A O   
479 C CB  . THR A 71  ? 0.3471 0.4063 0.3172 0.0127  -0.0240 0.0160  71  THR A CB  
480 O OG1 . THR A 71  ? 0.4042 0.4263 0.3710 0.0133  -0.0251 0.0123  71  THR A OG1 
481 C CG2 . THR A 71  ? 0.3217 0.3998 0.2680 -0.0103 -0.0298 0.0107  71  THR A CG2 
482 N N   . THR A 72  ? 0.4219 0.4754 0.4303 0.0481  -0.0275 0.0504  72  THR A N   
483 C CA  . THR A 72  ? 0.4166 0.4381 0.4302 0.0580  -0.0322 0.0670  72  THR A CA  
484 C C   . THR A 72  ? 0.4119 0.3767 0.4094 0.0491  -0.0271 0.0571  72  THR A C   
485 O O   . THR A 72  ? 0.5156 0.4468 0.5066 0.0468  -0.0326 0.0734  72  THR A O   
486 C CB  . THR A 72  ? 0.4826 0.5122 0.5279 0.0925  -0.0317 0.0753  72  THR A CB  
487 O OG1 . THR A 72  ? 0.5036 0.5131 0.5591 0.1116  -0.0158 0.0460  72  THR A OG1 
488 C CG2 . THR A 72  ? 0.4706 0.5818 0.5377 0.0981  -0.0376 0.0882  72  THR A CG2 
489 N N   . CYS A 73  ? 0.4859 0.4457 0.4724 0.0371  -0.0194 0.0339  73  CYS A N   
490 C CA  . CYS A 73  ? 0.4920 0.4148 0.4615 0.0196  -0.0146 0.0232  73  CYS A CA  
491 C C   . CYS A 73  ? 0.4293 0.3772 0.3884 -0.0009 -0.0207 0.0235  73  CYS A C   
492 O O   . CYS A 73  ? 0.4634 0.4424 0.4248 0.0014  -0.0268 0.0193  73  CYS A O   
493 C CB  . CYS A 73  ? 0.5213 0.4398 0.4847 0.0137  -0.0035 -0.0045 73  CYS A CB  
494 S SG  . CYS A 73  ? 0.7218 0.5971 0.6931 0.0386  0.0112  -0.0231 73  CYS A SG  
495 N N   . THR A 74  ? 0.4771 0.4114 0.4225 -0.0217 -0.0195 0.0265  74  THR A N   
496 C CA  . THR A 74  ? 0.4145 0.3934 0.3568 -0.0394 -0.0204 0.0157  74  THR A CA  
497 C C   . THR A 74  ? 0.4187 0.4210 0.3634 -0.0469 -0.0175 -0.0063 74  THR A C   
498 O O   . THR A 74  ? 0.4995 0.4759 0.4387 -0.0487 -0.0125 -0.0140 74  THR A O   
499 C CB  . THR A 74  ? 0.3895 0.3697 0.3134 -0.0698 -0.0185 0.0251  74  THR A CB  
500 O OG1 . THR A 74  ? 0.4538 0.3893 0.3566 -0.0945 -0.0139 0.0255  74  THR A OG1 
501 C CG2 . THR A 74  ? 0.5118 0.4717 0.4292 -0.0660 -0.0261 0.0533  74  THR A CG2 
502 N N   . LYS A 75  ? 0.4462 0.5048 0.4010 -0.0487 -0.0213 -0.0190 75  LYS A N   
503 C CA  . LYS A 75  ? 0.4757 0.5723 0.4375 -0.0538 -0.0240 -0.0354 75  LYS A CA  
504 C C   . LYS A 75  ? 0.5738 0.6762 0.5185 -0.0945 -0.0137 -0.0429 75  LYS A C   
505 O O   . LYS A 75  ? 0.5212 0.6537 0.4643 -0.1107 -0.0144 -0.0556 75  LYS A O   
506 C CB  . LYS A 75  ? 0.4480 0.6058 0.4334 -0.0320 -0.0354 -0.0467 75  LYS A CB  
507 C CG  . LYS A 75  ? 0.4322 0.5587 0.4198 0.0010  -0.0502 -0.0381 75  LYS A CG  
508 C CD  . LYS A 75  ? 0.4469 0.6090 0.4536 0.0294  -0.0616 -0.0527 75  LYS A CD  
509 C CE  . LYS A 75  ? 0.4624 0.5702 0.4575 0.0550  -0.0798 -0.0435 75  LYS A CE  
510 N NZ  . LYS A 75  ? 0.5075 0.6339 0.5191 0.0888  -0.0895 -0.0656 75  LYS A NZ  
511 N N   . THR A 76  ? 0.5441 0.6124 0.4686 -0.1174 -0.0069 -0.0317 76  THR A N   
512 C CA  . THR A 76  ? 0.6095 0.6692 0.5037 -0.1682 0.0002  -0.0344 76  THR A CA  
513 C C   . THR A 76  ? 0.6885 0.6425 0.5508 -0.1788 0.0039  -0.0295 76  THR A C   
514 O O   . THR A 76  ? 0.6643 0.5703 0.4874 -0.2227 0.0066  -0.0256 76  THR A O   
515 C CB  . THR A 76  ? 0.6313 0.7055 0.5091 -0.1973 0.0020  -0.0210 76  THR A CB  
516 O OG1 . THR A 76  ? 0.5815 0.5865 0.4519 -0.1766 -0.0035 0.0042  76  THR A OG1 
517 C CG2 . THR A 76  ? 0.4290 0.6187 0.3381 -0.1886 0.0037  -0.0384 76  THR A CG2 
518 N N   . GLN A 77  ? 0.6615 0.5752 0.5366 -0.1401 0.0040  -0.0313 77  GLN A N   
519 C CA  . GLN A 77  ? 0.7434 0.5592 0.5937 -0.1402 0.0100  -0.0356 77  GLN A CA  
520 C C   . GLN A 77  ? 0.6091 0.4334 0.4617 -0.1335 0.0185  -0.0640 77  GLN A C   
521 O O   . GLN A 77  ? 0.5898 0.4887 0.4645 -0.1236 0.0143  -0.0685 77  GLN A O   
522 C CB  . GLN A 77  ? 0.6937 0.4478 0.5519 -0.1043 0.0041  -0.0118 77  GLN A CB  
523 C CG  . GLN A 77  ? 0.6172 0.3992 0.5120 -0.0559 0.0040  -0.0119 77  GLN A CG  
524 C CD  . GLN A 77  ? 0.7400 0.4947 0.6487 -0.0254 -0.0057 0.0163  77  GLN A CD  
525 O OE1 . GLN A 77  ? 0.6001 0.3957 0.5171 -0.0265 -0.0148 0.0377  77  GLN A OE1 
526 N NE2 . GLN A 77  ? 0.6621 0.3523 0.5748 0.0044  -0.0044 0.0141  77  GLN A NE2 
527 N N   . PRO A 78  ? 0.5801 0.3564 0.6621 -0.1146 -0.0148 -0.0773 78  PRO A N   
528 C CA  . PRO A 78  ? 0.6937 0.4580 0.7129 -0.1417 -0.0163 -0.1471 78  PRO A CA  
529 C C   . PRO A 78  ? 0.7418 0.4782 0.7217 -0.0952 0.0080  -0.1654 78  PRO A C   
530 O O   . PRO A 78  ? 0.7089 0.4366 0.7246 -0.0404 0.0210  -0.1228 78  PRO A O   
531 C CB  . PRO A 78  ? 0.8182 0.4709 0.8547 -0.1966 0.0110  -0.2026 78  PRO A CB  
532 C CG  . PRO A 78  ? 0.8287 0.3886 0.9452 -0.1593 0.0405  -0.1481 78  PRO A CG  
533 C CD  . PRO A 78  ? 0.6571 0.3236 0.7926 -0.1291 0.0140  -0.0638 78  PRO A CD  
534 N N   . ASN A 79  ? 0.8375 0.5745 0.7422 -0.1276 0.0148  -0.2300 79  ASN A N   
535 C CA  . ASN A 79  ? 0.9071 0.6331 0.7635 -0.1013 0.0491  -0.2601 79  ASN A CA  
536 C C   . ASN A 79  ? 0.8462 0.6386 0.7037 -0.0517 0.0335  -0.1947 79  ASN A C   
537 O O   . ASN A 79  ? 0.8071 0.5775 0.6969 -0.0096 0.0677  -0.1880 79  ASN A O   
538 C CB  . ASN A 79  ? 1.0508 0.6653 0.9687 -0.0690 0.1131  -0.2986 79  ASN A CB  
539 C CG  . ASN A 79  ? 1.3466 0.8521 1.2820 -0.1161 0.1406  -0.3703 79  ASN A CG  
540 O OD1 . ASN A 79  ? 1.3984 0.9078 1.2500 -0.1850 0.1410  -0.4497 79  ASN A OD1 
541 N ND2 . ASN A 79  ? 1.3559 0.7614 1.3997 -0.0851 0.1624  -0.3397 79  ASN A ND2 
542 N N   . LEU A 80  ? 0.7430 0.6159 0.5799 -0.0578 -0.0160 -0.1488 80  LEU A N   
543 C CA  . LEU A 80  ? 0.6068 0.5175 0.4593 -0.0155 -0.0296 -0.0905 80  LEU A CA  
544 C C   . LEU A 80  ? 0.6874 0.6135 0.4782 -0.0143 -0.0153 -0.0876 80  LEU A C   
545 O O   . LEU A 80  ? 0.6647 0.5925 0.4816 0.0155  -0.0086 -0.0532 80  LEU A O   
546 C CB  . LEU A 80  ? 0.5518 0.5263 0.4325 -0.0100 -0.0758 -0.0448 80  LEU A CB  
547 C CG  . LEU A 80  ? 0.6138 0.5965 0.5657 -0.0074 -0.0794 -0.0353 80  LEU A CG  
548 C CD1 . LEU A 80  ? 0.4671 0.5306 0.4668 0.0062  -0.1105 -0.0005 80  LEU A CD1 
549 C CD2 . LEU A 80  ? 0.4153 0.3531 0.4006 0.0237  -0.0504 -0.0232 80  LEU A CD2 
550 N N   . ASP A 81  ? 0.7458 0.6889 0.4498 -0.0571 -0.0084 -0.1262 81  ASP A N   
551 C CA  . ASP A 81  ? 0.9123 0.8918 0.5351 -0.0722 0.0034  -0.1124 81  ASP A CA  
552 C C   . ASP A 81  ? 0.8691 0.8244 0.5090 -0.0530 0.0692  -0.1405 81  ASP A C   
553 O O   . ASP A 81  ? 0.9722 0.9618 0.5737 -0.0602 0.0822  -0.1100 81  ASP A O   
554 C CB  . ASP A 81  ? 0.9870 1.0171 0.4897 -0.1370 -0.0115 -0.1461 81  ASP A CB  
555 C CG  . ASP A 81  ? 1.2538 1.3335 0.7631 -0.1611 -0.0800 -0.1238 81  ASP A CG  
556 O OD1 . ASP A 81  ? 1.3795 1.4887 0.9537 -0.1256 -0.1248 -0.0474 81  ASP A OD1 
557 O OD2 . ASP A 81  ? 1.3835 1.4757 0.8459 -0.2167 -0.0854 -0.1884 81  ASP A OD2 
558 N N   . ASN A 82  ? 0.8945 0.7965 0.6032 -0.0295 0.1116  -0.1918 82  ASN A N   
559 C CA  . ASN A 82  ? 0.9253 0.8244 0.6930 0.0030  0.1729  -0.2108 82  ASN A CA  
560 C C   . ASN A 82  ? 0.8009 0.6745 0.7005 0.0578  0.1672  -0.1751 82  ASN A C   
561 O O   . ASN A 82  ? 0.8921 0.7583 0.8788 0.0945  0.2117  -0.1920 82  ASN A O   
562 C CB  . ASN A 82  ? 1.0890 0.9651 0.8238 -0.0139 0.2439  -0.3072 82  ASN A CB  
563 C CG  . ASN A 82  ? 1.2860 1.0967 0.9882 -0.0471 0.2357  -0.3696 82  ASN A CG  
564 O OD1 . ASN A 82  ? 1.3750 1.1357 1.1451 -0.0324 0.2002  -0.3434 82  ASN A OD1 
565 N ND2 . ASN A 82  ? 1.1577 0.9764 0.7464 -0.1042 0.2685  -0.4542 82  ASN A ND2 
566 N N   . CYS A 83  ? 0.7008 0.5759 0.6169 0.0630  0.1123  -0.1219 83  CYS A N   
567 C CA  . CYS A 83  ? 0.6493 0.5232 0.6585 0.0996  0.0979  -0.0804 83  CYS A CA  
568 C C   . CYS A 83  ? 0.5765 0.5093 0.6284 0.1154  0.1053  -0.0502 83  CYS A C   
569 O O   . CYS A 83  ? 0.5545 0.5148 0.5585 0.0927  0.0963  -0.0362 83  CYS A O   
570 C CB  . CYS A 83  ? 0.5491 0.4245 0.5480 0.0912  0.0488  -0.0459 83  CYS A CB  
571 S SG  . CYS A 83  ? 0.7833 0.6660 0.8677 0.1208  0.0361  0.0007  83  CYS A SG  
572 N N   . PRO A 84  ? 0.5158 0.4721 0.6677 0.1508  0.1189  -0.0335 84  PRO A N   
573 C CA  . PRO A 84  ? 0.5024 0.5401 0.7020 0.1525  0.1198  -0.0070 84  PRO A CA  
574 C C   . PRO A 84  ? 0.4121 0.4722 0.5803 0.1265  0.0723  0.0258  84  PRO A C   
575 O O   . PRO A 84  ? 0.4487 0.4802 0.5894 0.1241  0.0402  0.0367  84  PRO A O   
576 C CB  . PRO A 84  ? 0.5354 0.6117 0.8645 0.1995  0.1271  0.0191  84  PRO A CB  
577 C CG  . PRO A 84  ? 0.6291 0.6159 0.9806 0.2275  0.1571  -0.0106 84  PRO A CG  
578 C CD  . PRO A 84  ? 0.5916 0.5092 0.8300 0.1883  0.1304  -0.0275 84  PRO A CD  
579 N N   . PHE A 85  ? 0.3432 0.4528 0.5183 0.1020  0.0768  0.0335  85  PHE A N   
580 C CA  . PHE A 85  ? 0.3909 0.5124 0.5506 0.0709  0.0427  0.0490  85  PHE A CA  
581 C C   . PHE A 85  ? 0.3282 0.5237 0.5515 0.0739  0.0124  0.0700  85  PHE A C   
582 O O   . PHE A 85  ? 0.3605 0.6310 0.6708 0.0963  0.0196  0.0891  85  PHE A O   
583 C CB  . PHE A 85  ? 0.3072 0.4460 0.4579 0.0308  0.0625  0.0517  85  PHE A CB  
584 C CG  . PHE A 85  ? 0.5157 0.5921 0.5824 0.0178  0.0804  0.0510  85  PHE A CG  
585 C CD1 . PHE A 85  ? 0.5110 0.6198 0.5603 0.0079  0.1263  0.0441  85  PHE A CD1 
586 C CD2 . PHE A 85  ? 0.3629 0.3647 0.3706 0.0166  0.0516  0.0595  85  PHE A CD2 
587 C CE1 . PHE A 85  ? 0.5687 0.6404 0.5190 -0.0145 0.1345  0.0526  85  PHE A CE1 
588 C CE2 . PHE A 85  ? 0.3602 0.3263 0.2959 0.0047  0.0536  0.0778  85  PHE A CE2 
589 C CZ  . PHE A 85  ? 0.5120 0.5152 0.4063 -0.0156 0.0907  0.0772  85  PHE A CZ  
590 N N   . HIS A 86  ? 0.3052 0.4916 0.4882 0.0507  -0.0204 0.0666  86  HIS A N   
591 C CA  . HIS A 86  ? 0.3155 0.5960 0.5314 0.0317  -0.0555 0.0841  86  HIS A CA  
592 C C   . HIS A 86  ? 0.3384 0.7189 0.6297 0.0055  -0.0565 0.0941  86  HIS A C   
593 O O   . HIS A 86  ? 0.4507 0.8060 0.7350 -0.0264 -0.0336 0.0742  86  HIS A O   
594 C CB  . HIS A 86  ? 0.3807 0.6353 0.5227 -0.0081 -0.0750 0.0514  86  HIS A CB  
595 C CG  . HIS A 86  ? 0.3888 0.6066 0.4811 0.0128  -0.0786 0.0511  86  HIS A CG  
596 N ND1 . HIS A 86  ? 0.4350 0.7204 0.5286 0.0185  -0.1025 0.0891  86  HIS A ND1 
597 C CD2 . HIS A 86  ? 0.2921 0.4281 0.3417 0.0257  -0.0616 0.0263  86  HIS A CD2 
598 C CE1 . HIS A 86  ? 0.4563 0.6990 0.5028 0.0270  -0.0933 0.0824  86  HIS A CE1 
599 N NE2 . HIS A 86  ? 0.3944 0.5538 0.4222 0.0342  -0.0687 0.0411  86  HIS A NE2 
600 N N   . ASP A 87  ? 0.3678 0.8721 0.7398 0.0158  -0.0853 0.1348  87  ASP A N   
601 C CA  . ASP A 87  ? 0.3730 1.0140 0.8419 -0.0133 -0.0945 0.1500  87  ASP A CA  
602 C C   . ASP A 87  ? 0.4254 1.1790 0.8820 -0.0732 -0.1564 0.1576  87  ASP A C   
603 O O   . ASP A 87  ? 0.3416 1.2086 0.8548 -0.1281 -0.1742 0.1546  87  ASP A O   
604 C CB  . ASP A 87  ? 0.3643 1.0942 0.9754 0.0543  -0.0783 0.1976  87  ASP A CB  
605 C CG  . ASP A 87  ? 0.5045 1.2493 1.1470 0.1085  -0.1130 0.2559  87  ASP A CG  
606 O OD1 . ASP A 87  ? 0.8112 1.4319 1.3682 0.1267  -0.1061 0.2472  87  ASP A OD1 
607 O OD2 . ASP A 87  ? 0.8447 1.7327 1.6056 0.1302  -0.1498 0.3203  87  ASP A OD2 
608 N N   . GLN A 88  ? 0.3846 1.3569 0.7665 -0.0354 -0.0576 0.1459  88  GLN A N   
609 C CA  . GLN A 88  ? 0.4279 1.4575 0.7731 -0.0768 -0.1226 0.1607  88  GLN A CA  
610 C C   . GLN A 88  ? 0.5057 1.4782 0.7500 -0.1270 -0.1365 0.1039  88  GLN A C   
611 O O   . GLN A 88  ? 0.4730 1.3525 0.6427 -0.1195 -0.0966 0.0576  88  GLN A O   
612 C CB  . GLN A 88  ? 0.4835 1.4999 0.7475 -0.0580 -0.1338 0.1863  88  GLN A CB  
613 C CG  . GLN A 88  ? 0.3184 1.3851 0.6966 -0.0172 -0.1504 0.2541  88  GLN A CG  
614 C CD  . GLN A 88  ? 0.4644 1.6322 0.9363 -0.0385 -0.2231 0.3108  88  GLN A CD  
615 O OE1 . GLN A 88  ? 0.4080 1.6356 1.0332 -0.0348 -0.2247 0.3194  88  GLN A OE1 
616 N NE2 . GLN A 88  ? 0.6458 1.8347 1.0342 -0.0638 -0.2843 0.3614  88  GLN A NE2 
617 N N   . PRO A 89  ? 0.6472 1.6617 0.9050 -0.1802 -0.2103 0.1112  89  PRO A N   
618 C CA  . PRO A 89  ? 0.7471 1.6957 0.9490 -0.2329 -0.2432 0.0590  89  PRO A CA  
619 C C   . PRO A 89  ? 0.7712 1.5897 0.7910 -0.2226 -0.2131 -0.0195 89  PRO A C   
620 O O   . PRO A 89  ? 0.8016 1.5496 0.8326 -0.2297 -0.1864 -0.0594 89  PRO A O   
621 C CB  . PRO A 89  ? 0.8576 1.8464 1.0711 -0.2917 -0.3642 0.0873  89  PRO A CB  
622 C CG  . PRO A 89  ? 0.9151 1.9546 1.0945 -0.2682 -0.3903 0.1377  89  PRO A CG  
623 C CD  . PRO A 89  ? 0.6897 1.7880 0.9967 -0.2006 -0.2956 0.1720  89  PRO A CD  
624 N N   . HIS A 90  ? 0.7251 1.5136 0.5941 -0.2026 -0.2073 -0.0326 90  HIS A N   
625 C CA  . HIS A 90  ? 0.8120 1.4872 0.5342 -0.1818 -0.1553 -0.1062 90  HIS A CA  
626 C C   . HIS A 90  ? 0.7693 1.4303 0.5538 -0.1247 -0.0568 -0.0981 90  HIS A C   
627 O O   . HIS A 90  ? 0.8808 1.4670 0.5981 -0.0977 0.0018  -0.1463 90  HIS A O   
628 C CB  . HIS A 90  ? 1.0843 1.7120 0.5778 -0.1875 -0.1772 -0.1296 90  HIS A CB  
629 C CG  . HIS A 90  ? 1.3405 1.8913 0.7146 -0.2496 -0.2935 -0.1766 90  HIS A CG  
630 N ND1 . HIS A 90  ? 1.6200 2.2187 0.9842 -0.3014 -0.4147 -0.1205 90  HIS A ND1 
631 C CD2 . HIS A 90  ? 1.5528 1.9659 0.8286 -0.2720 -0.3276 -0.2701 90  HIS A CD2 
632 C CE1 . HIS A 90  ? 1.8308 2.3202 1.0868 -0.3592 -0.5281 -0.1746 90  HIS A CE1 
633 N NE2 . HIS A 90  ? 1.9600 2.3294 1.1515 -0.3408 -0.4760 -0.2711 90  HIS A NE2 
634 N N   . LEU A 91  ? 0.4999 1.2195 0.4219 -0.1044 -0.0434 -0.0378 91  LEU A N   
635 C CA  . LEU A 91  ? 0.3948 1.0847 0.3888 -0.0619 0.0114  -0.0160 91  LEU A CA  
636 C C   . LEU A 91  ? 0.3434 0.9662 0.4191 -0.0692 0.0043  -0.0280 91  LEU A C   
637 O O   . LEU A 91  ? 0.3627 0.9190 0.4937 -0.0492 0.0219  -0.0216 91  LEU A O   
638 C CB  . LEU A 91  ? 0.3443 1.1026 0.3998 -0.0340 0.0097  0.0610  91  LEU A CB  
639 C CG  . LEU A 91  ? 0.5267 1.3381 0.5114 -0.0223 0.0289  0.1049  91  LEU A CG  
640 C CD1 . LEU A 91  ? 0.4712 1.3571 0.5301 -0.0151 -0.0158 0.1819  91  LEU A CD1 
641 C CD2 . LEU A 91  ? 0.4501 1.2354 0.4816 0.0117  0.0996  0.1269  91  LEU A CD2 
642 N N   . LYS A 92  ? 0.3953 1.0332 0.4838 -0.1025 -0.0253 -0.0333 92  LYS A N   
643 C CA  . LYS A 92  ? 0.3731 0.9400 0.4925 -0.1157 -0.0251 -0.0335 92  LYS A CA  
644 C C   . LYS A 92  ? 0.4573 0.9321 0.5666 -0.1457 -0.0401 -0.0785 92  LYS A C   
645 O O   . LYS A 92  ? 0.4580 0.9316 0.5334 -0.1658 -0.0566 -0.1224 92  LYS A O   
646 C CB  . LYS A 92  ? 0.3481 0.9792 0.5018 -0.1344 -0.0222 -0.0059 92  LYS A CB  
647 C CG  . LYS A 92  ? 0.4976 1.1793 0.6823 -0.1883 -0.0533 -0.0130 92  LYS A CG  
648 C CD  . LYS A 92  ? 0.6386 1.3870 0.9088 -0.2037 -0.0225 0.0354  92  LYS A CD  
649 C CE  . LYS A 92  ? 0.6241 1.5050 0.9956 -0.1759 -0.0128 0.0792  92  LYS A CE  
650 N NZ  . LYS A 92  ? 0.6337 1.6239 1.1603 -0.2018 0.0124  0.1346  92  LYS A NZ  
651 N N   . ARG A 93  ? 0.4500 0.8245 0.5810 -0.1478 -0.0482 -0.0680 93  ARG A N   
652 C CA  . ARG A 93  ? 0.5113 0.7847 0.6693 -0.1765 -0.0764 -0.0960 93  ARG A CA  
653 C C   . ARG A 93  ? 0.4490 0.6307 0.5882 -0.2041 -0.1052 -0.0565 93  ARG A C   
654 O O   . ARG A 93  ? 0.5364 0.6639 0.6536 -0.1819 -0.1135 -0.0247 93  ARG A O   
655 C CB  . ARG A 93  ? 0.5370 0.7605 0.7661 -0.1381 -0.0615 -0.1141 93  ARG A CB  
656 C CG  . ARG A 93  ? 0.8243 1.0930 1.0225 -0.1094 -0.0147 -0.1678 93  ARG A CG  
657 C CD  . ARG A 93  ? 0.9522 1.2583 1.2106 -0.0519 0.0462  -0.1377 93  ARG A CD  
658 N NE  . ARG A 93  ? 0.9722 1.2215 1.3395 -0.0158 0.0914  -0.1624 93  ARG A NE  
659 C CZ  . ARG A 93  ? 1.0646 1.3461 1.4097 0.0345  0.1856  -0.1906 93  ARG A CZ  
660 N NH1 . ARG A 93  ? 1.0896 1.4474 1.2781 0.0429  0.2242  -0.1916 93  ARG A NH1 
661 N NH2 . ARG A 93  ? 1.2421 1.4747 1.7219 0.0786  0.2463  -0.2121 93  ARG A NH2 
662 N N   . LYS A 94  ? 0.5439 0.6878 0.6768 -0.2581 -0.1314 -0.0547 94  LYS A N   
663 C CA  . LYS A 94  ? 0.6459 0.6855 0.7202 -0.2967 -0.1578 -0.0089 94  LYS A CA  
664 C C   . LYS A 94  ? 0.7659 0.7024 0.9112 -0.3396 -0.2233 -0.0162 94  LYS A C   
665 O O   . LYS A 94  ? 0.7428 0.7103 0.9539 -0.3583 -0.2355 -0.0545 94  LYS A O   
666 C CB  . LYS A 94  ? 0.6936 0.8099 0.7175 -0.3277 -0.1127 0.0257  94  LYS A CB  
667 C CG  . LYS A 94  ? 0.7761 0.9732 0.7499 -0.2769 -0.0446 0.0368  94  LYS A CG  
668 C CD  . LYS A 94  ? 1.0518 1.3997 1.0913 -0.2933 0.0105  0.0646  94  LYS A CD  
669 C CE  . LYS A 94  ? 1.0768 1.3997 1.0817 -0.3465 0.0455  0.1228  94  LYS A CE  
670 N NZ  . LYS A 94  ? 1.0845 1.5776 1.2396 -0.3728 0.0866  0.1672  94  LYS A NZ  
671 N N   . ALA A 95  ? 0.6408 0.5854 0.7217 0.0200  -0.2916 0.0742  95  ALA A N   
672 C CA  . ALA A 95  ? 0.6056 0.5707 0.6623 0.0109  -0.2496 0.0623  95  ALA A CA  
673 C C   . ALA A 95  ? 0.5688 0.5618 0.6787 0.0223  -0.2183 0.0453  95  ALA A C   
674 O O   . ALA A 95  ? 0.5473 0.5415 0.6863 0.0339  -0.2166 0.0445  95  ALA A O   
675 C CB  . ALA A 95  ? 0.5939 0.5459 0.5806 -0.0054 -0.2315 0.0766  95  ALA A CB  
676 N N   . PHE A 96  ? 0.5314 0.5456 0.6530 0.0169  -0.1982 0.0321  96  PHE A N   
677 C CA  . PHE A 96  ? 0.4884 0.5279 0.6417 0.0178  -0.1674 0.0239  96  PHE A CA  
678 C C   . PHE A 96  ? 0.4848 0.5074 0.5941 0.0110  -0.1432 0.0270  96  PHE A C   
679 O O   . PHE A 96  ? 0.5184 0.5287 0.5991 0.0043  -0.1459 0.0218  96  PHE A O   
680 C CB  . PHE A 96  ? 0.4498 0.5213 0.6462 0.0092  -0.1671 0.0141  96  PHE A CB  
681 C CG  . PHE A 96  ? 0.4821 0.5984 0.7432 0.0175  -0.1763 0.0029  96  PHE A CG  
682 C CD1 . PHE A 96  ? 0.6480 0.7679 0.9335 0.0247  -0.2114 -0.0022 96  PHE A CD1 
683 C CD2 . PHE A 96  ? 0.5407 0.7039 0.8411 0.0187  -0.1517 -0.0067 96  PHE A CD2 
684 C CE1 . PHE A 96  ? 0.7648 0.9368 1.1239 0.0376  -0.2226 -0.0208 96  PHE A CE1 
685 C CE2 . PHE A 96  ? 0.6340 0.8576 1.0029 0.0294  -0.1580 -0.0279 96  PHE A CE2 
686 C CZ  . PHE A 96  ? 0.7068 0.9360 1.1103 0.0409  -0.1937 -0.0370 96  PHE A CZ  
687 N N   . CYS A 97  ? 0.3834 0.4088 0.4934 0.0152  -0.1225 0.0303  97  CYS A N   
688 C CA  . CYS A 97  ? 0.4187 0.4323 0.4937 0.0122  -0.1019 0.0322  97  CYS A CA  
689 C C   . CYS A 97  ? 0.3713 0.3983 0.4680 0.0109  -0.0810 0.0302  97  CYS A C   
690 O O   . CYS A 97  ? 0.3679 0.4189 0.4973 0.0126  -0.0750 0.0293  97  CYS A O   
691 C CB  . CYS A 97  ? 0.4371 0.4389 0.4873 0.0137  -0.1014 0.0433  97  CYS A CB  
692 S SG  . CYS A 97  ? 0.5604 0.5429 0.5687 0.0044  -0.1320 0.0573  97  CYS A SG  
693 N N   . SER A 98  ? 0.3502 0.3656 0.4293 0.0082  -0.0727 0.0271  98  SER A N   
694 C CA  . SER A 98  ? 0.3569 0.3764 0.4474 0.0048  -0.0590 0.0307  98  SER A CA  
695 C C   . SER A 98  ? 0.3789 0.3909 0.4462 0.0121  -0.0466 0.0290  98  SER A C   
696 O O   . SER A 98  ? 0.3670 0.3713 0.4130 0.0163  -0.0487 0.0187  98  SER A O   
697 C CB  . SER A 98  ? 0.2880 0.2929 0.3877 -0.0048 -0.0705 0.0297  98  SER A CB  
698 O OG  . SER A 98  ? 0.3317 0.3512 0.4571 -0.0173 -0.0816 0.0334  98  SER A OG  
699 N N   . PHE A 99  ? 0.3094 0.3319 0.3829 0.0131  -0.0335 0.0354  99  PHE A N   
700 C CA  . PHE A 99  ? 0.2922 0.3131 0.3493 0.0178  -0.0227 0.0348  99  PHE A CA  
701 C C   . PHE A 99  ? 0.3039 0.3268 0.3709 0.0162  -0.0163 0.0383  99  PHE A C   
702 O O   . PHE A 99  ? 0.2984 0.3350 0.3789 0.0093  -0.0131 0.0449  99  PHE A O   
703 C CB  . PHE A 99  ? 0.2515 0.2763 0.3066 0.0190  -0.0205 0.0406  99  PHE A CB  
704 C CG  . PHE A 99  ? 0.3503 0.3658 0.3924 0.0167  -0.0351 0.0452  99  PHE A CG  
705 C CD1 . PHE A 99  ? 0.4014 0.4158 0.4122 0.0104  -0.0372 0.0449  99  PHE A CD1 
706 C CD2 . PHE A 99  ? 0.4008 0.4116 0.4617 0.0208  -0.0498 0.0478  99  PHE A CD2 
707 C CE1 . PHE A 99  ? 0.4579 0.4640 0.4468 0.0021  -0.0542 0.0551  99  PHE A CE1 
708 C CE2 . PHE A 99  ? 0.3453 0.3384 0.3925 0.0170  -0.0727 0.0576  99  PHE A CE2 
709 C CZ  . PHE A 99  ? 0.4021 0.3915 0.4087 0.0046  -0.0750 0.0653  99  PHE A CZ  
710 N N   . GLN A 100 ? 0.2755 0.2910 0.3366 0.0217  -0.0159 0.0323  100 GLN A N   
711 C CA  . GLN A 100 ? 0.2709 0.2837 0.3390 0.0207  -0.0159 0.0383  100 GLN A CA  
712 C C   . GLN A 100 ? 0.3070 0.3329 0.3694 0.0272  -0.0046 0.0333  100 GLN A C   
713 O O   . GLN A 100 ? 0.3353 0.3702 0.3928 0.0338  -0.0016 0.0199  100 GLN A O   
714 C CB  . GLN A 100 ? 0.2741 0.2626 0.3517 0.0244  -0.0351 0.0334  100 GLN A CB  
715 C CG  . GLN A 100 ? 0.3618 0.3412 0.4455 0.0234  -0.0435 0.0433  100 GLN A CG  
716 C CD  . GLN A 100 ? 0.3949 0.3371 0.4944 0.0278  -0.0749 0.0405  100 GLN A CD  
717 O OE1 . GLN A 100 ? 0.4184 0.3390 0.5237 0.0236  -0.0909 0.0387  100 GLN A OE1 
718 N NE2 . GLN A 100 ? 0.3700 0.3010 0.4800 0.0363  -0.0892 0.0398  100 GLN A NE2 
719 N N   . ILE A 101 ? 0.2815 0.3161 0.3446 0.0230  0.0022  0.0416  101 ILE A N   
720 C CA  . ILE A 101 ? 0.2987 0.3442 0.3595 0.0252  0.0099  0.0391  101 ILE A CA  
721 C C   . ILE A 101 ? 0.3303 0.3768 0.3968 0.0262  0.0058  0.0419  101 ILE A C   
722 O O   . ILE A 101 ? 0.3613 0.4070 0.4245 0.0187  0.0023  0.0517  101 ILE A O   
723 C CB  . ILE A 101 ? 0.2884 0.3373 0.3475 0.0212  0.0136  0.0421  101 ILE A CB  
724 C CG1 . ILE A 101 ? 0.3697 0.4108 0.4245 0.0199  0.0087  0.0433  101 ILE A CG1 
725 C CG2 . ILE A 101 ? 0.3629 0.4172 0.4216 0.0187  0.0164  0.0420  101 ILE A CG2 
726 C CD1 . ILE A 101 ? 0.3413 0.3840 0.4073 0.0215  0.0040  0.0415  101 ILE A CD1 
727 N N   . TYR A 102 ? 0.3565 0.4117 0.4316 0.0335  0.0050  0.0330  102 TYR A N   
728 C CA  . TYR A 102 ? 0.3549 0.4107 0.4388 0.0362  -0.0040 0.0351  102 TYR A CA  
729 C C   . TYR A 102 ? 0.3664 0.4399 0.4491 0.0312  0.0050  0.0352  102 TYR A C   
730 O O   . TYR A 102 ? 0.3386 0.4311 0.4277 0.0302  0.0132  0.0277  102 TYR A O   
731 C CB  . TYR A 102 ? 0.3294 0.3879 0.4362 0.0518  -0.0164 0.0184  102 TYR A CB  
732 C CG  . TYR A 102 ? 0.4070 0.4648 0.5289 0.0571  -0.0324 0.0203  102 TYR A CG  
733 C CD1 . TYR A 102 ? 0.3569 0.3856 0.4692 0.0494  -0.0533 0.0412  102 TYR A CD1 
734 C CD2 . TYR A 102 ? 0.3990 0.4897 0.5431 0.0654  -0.0285 0.0040  102 TYR A CD2 
735 C CE1 . TYR A 102 ? 0.3993 0.4234 0.5202 0.0518  -0.0739 0.0472  102 TYR A CE1 
736 C CE2 . TYR A 102 ? 0.3522 0.4423 0.5152 0.0722  -0.0489 0.0048  102 TYR A CE2 
737 C CZ  . TYR A 102 ? 0.5018 0.5541 0.6500 0.0657  -0.0730 0.0279  102 TYR A CZ  
738 O OH  . TYR A 102 ? 0.5420 0.5884 0.7013 0.0690  -0.0984 0.0341  102 TYR A OH  
739 N N   . ALA A 103 ? 0.3339 0.4052 0.4076 0.0248  0.0020  0.0431  103 ALA A N   
740 C CA  . ALA A 103 ? 0.3525 0.4350 0.4262 0.0205  0.0054  0.0396  103 ALA A CA  
741 C C   . ALA A 103 ? 0.3565 0.4457 0.4353 0.0215  -0.0064 0.0407  103 ALA A C   
742 O O   . ALA A 103 ? 0.3284 0.4086 0.3996 0.0208  -0.0192 0.0501  103 ALA A O   
743 C CB  . ALA A 103 ? 0.3278 0.4098 0.3896 0.0159  0.0091  0.0371  103 ALA A CB  
744 N N   . VAL A 104 ? 0.3648 0.4683 0.4566 0.0198  -0.0064 0.0342  104 VAL A N   
745 C CA  . VAL A 104 ? 0.2990 0.4110 0.3976 0.0205  -0.0206 0.0339  104 VAL A CA  
746 C C   . VAL A 104 ? 0.3683 0.4826 0.4584 0.0111  -0.0188 0.0286  104 VAL A C   
747 O O   . VAL A 104 ? 0.3658 0.4880 0.4720 0.0048  -0.0165 0.0243  104 VAL A O   
748 C CB  . VAL A 104 ? 0.3726 0.5081 0.5064 0.0289  -0.0256 0.0244  104 VAL A CB  
749 C CG1 . VAL A 104 ? 0.2746 0.4193 0.4210 0.0308  -0.0458 0.0236  104 VAL A CG1 
750 C CG2 . VAL A 104 ? 0.3639 0.4952 0.5124 0.0442  -0.0307 0.0185  104 VAL A CG2 
751 N N   . PRO A 105 ? 0.3521 0.4628 0.4175 0.0079  -0.0211 0.0271  105 PRO A N   
752 C CA  . PRO A 105 ? 0.3162 0.4286 0.3767 0.0044  -0.0230 0.0115  105 PRO A CA  
753 C C   . PRO A 105 ? 0.3960 0.5140 0.4694 -0.0002 -0.0362 0.0060  105 PRO A C   
754 O O   . PRO A 105 ? 0.4213 0.5304 0.5076 -0.0047 -0.0409 -0.0039 105 PRO A O   
755 C CB  . PRO A 105 ? 0.3526 0.4803 0.3832 0.0019  -0.0213 0.0061  105 PRO A CB  
756 C CG  . PRO A 105 ? 0.2747 0.3989 0.2998 0.0015  -0.0114 0.0213  105 PRO A CG  
757 C CD  . PRO A 105 ? 0.2989 0.4085 0.3407 0.0052  -0.0208 0.0371  105 PRO A CD  
758 N N   . TRP A 106 ? 0.3461 0.4754 0.4210 -0.0002 -0.0477 0.0133  106 TRP A N   
759 C CA  . TRP A 106 ? 0.3172 0.4561 0.4077 -0.0054 -0.0621 0.0056  106 TRP A CA  
760 C C   . TRP A 106 ? 0.3875 0.5322 0.5135 -0.0123 -0.0570 0.0057  106 TRP A C   
761 O O   . TRP A 106 ? 0.4369 0.5836 0.5772 -0.0233 -0.0672 -0.0008 106 TRP A O   
762 C CB  . TRP A 106 ? 0.2721 0.4232 0.3642 -0.0031 -0.0820 0.0132  106 TRP A CB  
763 C CG  . TRP A 106 ? 0.5107 0.6699 0.6358 0.0073  -0.0849 0.0206  106 TRP A CG  
764 C CD1 . TRP A 106 ? 0.3992 0.5450 0.5186 0.0163  -0.0895 0.0319  106 TRP A CD1 
765 C CD2 . TRP A 106 ? 0.5139 0.7024 0.6875 0.0099  -0.0848 0.0119  106 TRP A CD2 
766 N NE1 . TRP A 106 ? 0.4357 0.5966 0.5995 0.0304  -0.0945 0.0247  106 TRP A NE1 
767 C CE2 . TRP A 106 ? 0.6185 0.8140 0.8161 0.0266  -0.0887 0.0109  106 TRP A CE2 
768 C CE3 . TRP A 106 ? 0.6089 0.8229 0.8103 -0.0025 -0.0830 0.0034  106 TRP A CE3 
769 C CZ2 . TRP A 106 ? 0.5434 0.7827 0.7942 0.0353  -0.0868 -0.0056 106 TRP A CZ2 
770 C CZ3 . TRP A 106 ? 0.6132 0.8735 0.8645 -0.0009 -0.0794 -0.0053 106 TRP A CZ3 
771 C CH2 . TRP A 106 ? 0.7022 0.9802 0.9783 0.0200  -0.0793 -0.0132 106 TRP A CH2 
772 N N   . GLN A 107 ? 0.3223 0.4739 0.4604 -0.0093 -0.0428 0.0134  107 GLN A N   
773 C CA  . GLN A 107 ? 0.3352 0.5115 0.5021 -0.0210 -0.0340 0.0158  107 GLN A CA  
774 C C   . GLN A 107 ? 0.3154 0.4681 0.4693 -0.0341 -0.0267 0.0235  107 GLN A C   
775 O O   . GLN A 107 ? 0.3443 0.5119 0.5110 -0.0544 -0.0233 0.0321  107 GLN A O   
776 C CB  . GLN A 107 ? 0.2920 0.4963 0.4763 -0.0081 -0.0241 0.0129  107 GLN A CB  
777 C CG  . GLN A 107 ? 0.4870 0.7500 0.7117 -0.0159 -0.0160 0.0042  107 GLN A CG  
778 C CD  . GLN A 107 ? 0.6353 0.9305 0.8787 0.0024  -0.0054 -0.0109 107 GLN A CD  
779 O OE1 . GLN A 107 ? 0.5374 0.8041 0.7593 0.0142  -0.0015 -0.0093 107 GLN A OE1 
780 N NE2 . GLN A 107 ? 0.3923 0.7525 0.6804 0.0046  -0.0019 -0.0301 107 GLN A NE2 
781 N N   . GLY A 108 ? 0.3385 0.4581 0.4683 -0.0248 -0.0269 0.0215  108 GLY A N   
782 C CA  . GLY A 108 ? 0.2952 0.3869 0.4184 -0.0331 -0.0282 0.0276  108 GLY A CA  
783 C C   . GLY A 108 ? 0.4090 0.5098 0.5268 -0.0367 -0.0134 0.0401  108 GLY A C   
784 O O   . GLY A 108 ? 0.4332 0.5143 0.5447 -0.0499 -0.0182 0.0519  108 GLY A O   
785 N N   . THR A 109 ? 0.3267 0.4536 0.4463 -0.0251 -0.0003 0.0368  109 THR A N   
786 C CA  . THR A 109 ? 0.3888 0.5310 0.5033 -0.0286 0.0128  0.0417  109 THR A CA  
787 C C   . THR A 109 ? 0.4247 0.5454 0.5234 -0.0122 0.0160  0.0397  109 THR A C   
788 O O   . THR A 109 ? 0.3407 0.4484 0.4361 0.0017  0.0118  0.0349  109 THR A O   
789 C CB  . THR A 109 ? 0.3795 0.5729 0.5160 -0.0247 0.0227  0.0303  109 THR A CB  
790 O OG1 . THR A 109 ? 0.3991 0.5866 0.5457 -0.0013 0.0146  0.0193  109 THR A OG1 
791 C CG2 . THR A 109 ? 0.3428 0.5761 0.5015 -0.0465 0.0231  0.0320  109 THR A CG2 
792 N N   . MET A 110 ? 0.4051 0.5273 0.4921 -0.0181 0.0225  0.0452  110 MET A N   
793 C CA  . MET A 110 ? 0.3545 0.4631 0.4309 -0.0045 0.0249  0.0418  110 MET A CA  
794 C C   . MET A 110 ? 0.3252 0.4625 0.3975 -0.0070 0.0349  0.0359  110 MET A C   
795 O O   . MET A 110 ? 0.3743 0.5389 0.4400 -0.0268 0.0414  0.0418  110 MET A O   
796 C CB  . MET A 110 ? 0.3167 0.3922 0.3810 -0.0063 0.0168  0.0498  110 MET A CB  
797 C CG  . MET A 110 ? 0.3347 0.3948 0.4052 0.0021  0.0096  0.0434  110 MET A CG  
798 S SD  . MET A 110 ? 0.4020 0.4353 0.4746 0.0073  -0.0031 0.0402  110 MET A SD  
799 C CE  . MET A 110 ? 0.3761 0.3847 0.4540 -0.0082 -0.0228 0.0489  110 MET A CE  
800 N N   . THR A 111 ? 0.2927 0.4261 0.3674 0.0100  0.0344  0.0241  111 THR A N   
801 C CA  . THR A 111 ? 0.3118 0.4726 0.3840 0.0139  0.0413  0.0080  111 THR A CA  
802 C C   . THR A 111 ? 0.3535 0.4814 0.4125 0.0209  0.0339  0.0099  111 THR A C   
803 O O   . THR A 111 ? 0.2977 0.3950 0.3629 0.0289  0.0244  0.0155  111 THR A O   
804 C CB  . THR A 111 ? 0.3348 0.5201 0.4387 0.0348  0.0380  -0.0185 111 THR A CB  
805 O OG1 . THR A 111 ? 0.4624 0.6801 0.5851 0.0286  0.0425  -0.0198 111 THR A OG1 
806 C CG2 . THR A 111 ? 0.3540 0.5806 0.4626 0.0435  0.0449  -0.0487 111 THR A CG2 
807 N N   . LEU A 112 ? 0.3206 0.4600 0.3598 0.0140  0.0376  0.0067  112 LEU A N   
808 C CA  . LEU A 112 ? 0.3413 0.4527 0.3708 0.0197  0.0282  0.0067  112 LEU A CA  
809 C C   . LEU A 112 ? 0.3602 0.4793 0.4043 0.0380  0.0231  -0.0214 112 LEU A C   
810 O O   . LEU A 112 ? 0.4158 0.5715 0.4524 0.0389  0.0300  -0.0431 112 LEU A O   
811 C CB  . LEU A 112 ? 0.2826 0.4004 0.2805 0.0027  0.0284  0.0167  112 LEU A CB  
812 C CG  . LEU A 112 ? 0.4970 0.5857 0.4862 0.0060  0.0151  0.0201  112 LEU A CG  
813 C CD1 . LEU A 112 ? 0.2740 0.3301 0.2815 0.0108  0.0065  0.0335  112 LEU A CD1 
814 C CD2 . LEU A 112 ? 0.3498 0.4439 0.3042 -0.0129 0.0095  0.0334  112 LEU A CD2 
815 N N   . SER A 113 ? 0.2973 0.3838 0.3615 0.0503  0.0082  -0.0219 113 SER A N   
816 C CA  . SER A 113 ? 0.3879 0.4685 0.4748 0.0698  -0.0077 -0.0490 113 SER A CA  
817 C C   . SER A 113 ? 0.3954 0.4602 0.4731 0.0722  -0.0186 -0.0612 113 SER A C   
818 O O   . SER A 113 ? 0.4648 0.5366 0.5570 0.0892  -0.0298 -0.0951 113 SER A O   
819 C CB  . SER A 113 ? 0.3514 0.3927 0.4591 0.0746  -0.0289 -0.0359 113 SER A CB  
820 O OG  . SER A 113 ? 0.4813 0.5312 0.5913 0.0693  -0.0221 -0.0203 113 SER A OG  
821 N N   . LYS A 114 ? 0.2498 0.4352 0.4342 0.0227  0.0175  -0.0941 114 LYS A N   
822 C CA  . LYS A 114 ? 0.2929 0.4462 0.4581 0.0135  0.0261  -0.0693 114 LYS A CA  
823 C C   . LYS A 114 ? 0.3155 0.4341 0.4182 -0.0292 0.0460  -0.0147 114 LYS A C   
824 O O   . LYS A 114 ? 0.3285 0.4032 0.4094 -0.0222 0.0352  0.0111  114 LYS A O   
825 C CB  . LYS A 114 ? 0.2129 0.2823 0.4000 0.0503  -0.0049 -0.0140 114 LYS A CB  
826 C CG  . LYS A 114 ? 0.2768 0.3205 0.5274 0.1023  -0.0613 -0.0282 114 LYS A CG  
827 C CD  . LYS A 114 ? 0.4130 0.4464 0.7777 0.1218  -0.1197 -0.1116 114 LYS A CD  
828 C CE  . LYS A 114 ? 0.5608 0.5336 1.0119 0.1821  -0.2083 -0.1264 114 LYS A CE  
829 N NZ  . LYS A 114 ? 0.6527 0.7248 1.1967 0.2341  -0.2506 -0.3035 114 LYS A NZ  
830 N N   . SER A 115 ? 0.3584 0.4983 0.4336 -0.0521 0.0531  -0.0153 115 SER A N   
831 C CA  . SER A 115 ? 0.3634 0.4579 0.3755 -0.0852 0.0492  0.0408  115 SER A CA  
832 C C   . SER A 115 ? 0.4239 0.5429 0.4115 -0.0712 0.0318  0.0145  115 SER A C   
833 O O   . SER A 115 ? 0.4214 0.6535 0.3788 -0.0635 0.0421  -0.0396 115 SER A O   
834 C CB  . SER A 115 ? 0.3869 0.5266 0.3728 -0.1504 0.0662  0.0839  115 SER A CB  
835 O OG  . SER A 115 ? 0.7369 0.8041 0.6616 -0.1813 0.0364  0.1575  115 SER A OG  
836 N N   . THR A 116 ? 0.3582 0.4073 0.3753 -0.0548 -0.0015 0.0318  116 THR A N   
837 C CA  . THR A 116 ? 0.4436 0.5086 0.4611 -0.0345 -0.0485 -0.0120 116 THR A CA  
838 C C   . THR A 116 ? 0.4423 0.4463 0.4553 -0.0358 -0.0809 0.0329  116 THR A C   
839 O O   . THR A 116 ? 0.4668 0.4407 0.5440 -0.0334 -0.0673 0.0699  116 THR A O   
840 C CB  . THR A 116 ? 0.3968 0.4450 0.5738 -0.0058 -0.0938 -0.0701 116 THR A CB  
841 O OG1 . THR A 116 ? 0.5213 0.5862 0.7312 0.0277  -0.1710 -0.1527 116 THR A OG1 
842 C CG2 . THR A 116 ? 0.3493 0.3448 0.6522 -0.0247 -0.0855 0.0119  116 THR A CG2 
843 N N   . CYS A 117 ? 0.5302 0.5435 0.4590 -0.0228 -0.1297 0.0202  117 CYS A N   
844 C CA  . CYS A 117 ? 0.5384 0.4888 0.4728 -0.0084 -0.1879 0.0488  117 CYS A CA  
845 C C   . CYS A 117 ? 0.6685 0.6472 0.6466 0.0343  -0.2691 -0.0269 117 CYS A C   
846 O O   . CYS A 117 ? 0.7782 0.8247 0.6787 0.0623  -0.2936 -0.0932 117 CYS A O   
847 C CB  . CYS A 117 ? 0.7335 0.6263 0.5114 -0.0323 -0.2086 0.1359  117 CYS A CB  
848 S SG  . CYS A 117 ? 0.8658 0.6899 0.6742 -0.0792 -0.1671 0.2005  117 CYS A SG  
849 N N   . GLN A 118 ? 0.6174 0.5768 0.7396 0.0524  -0.3200 -0.0401 118 GLN A N   
850 C CA  . GLN A 118 ? 0.7935 0.7754 0.9892 0.0968  -0.4276 -0.1243 118 GLN A CA  
851 C C   . GLN A 118 ? 0.8350 0.7763 0.9875 0.1326  -0.5024 -0.1047 118 GLN A C   
852 O O   . GLN A 118 ? 0.7713 0.6778 0.9486 0.1263  -0.4761 -0.0507 118 GLN A O   
853 C CB  . GLN A 118 ? 0.7625 0.7824 1.2727 0.0785  -0.4498 -0.1714 118 GLN A CB  
854 C CG  . GLN A 118 ? 0.6672 0.7405 1.3682 0.0360  -0.3720 -0.0869 118 GLN A CG  
855 C CD  . GLN A 118 ? 0.8433 0.9930 1.8959 -0.0087 -0.3962 -0.0798 118 GLN A CD  
856 O OE1 . GLN A 118 ? 0.6106 0.7923 1.8503 0.0047  -0.4986 -0.1485 118 GLN A OE1 
857 N NE2 . GLN A 118 ? 0.4407 0.6277 1.6031 -0.0678 -0.3100 0.0210  118 GLN A NE2 
858 N N   . ASP A 119 ? 1.0139 0.9618 1.1018 0.1899  -0.6174 -0.1668 119 ASP A N   
859 C CA  . ASP A 119 ? 1.1648 1.0590 1.2261 0.2385  -0.7198 -0.1536 119 ASP A CA  
860 C C   . ASP A 119 ? 1.0739 1.0179 1.4476 0.2464  -0.7336 -0.1980 119 ASP A C   
861 O O   . ASP A 119 ? 0.9545 0.9959 1.5838 0.2120  -0.6936 -0.2392 119 ASP A O   
862 C CB  . ASP A 119 ? 1.3997 1.3125 1.3113 0.3158  -0.8553 -0.2188 119 ASP A CB  
863 C CG  . ASP A 119 ? 1.6962 1.6185 1.2433 0.3167  -0.8299 -0.1272 119 ASP A CG  
864 O OD1 . ASP A 119 ? 1.6202 1.4963 1.0692 0.2435  -0.7270 0.0055  119 ASP A OD1 
865 O OD2 . ASP A 119 ? 1.9569 1.9637 1.3274 0.3930  -0.9148 -0.1890 119 ASP A OD2 
866 N N   . ALA A 120 ? 1.1700 1.0649 1.5425 0.2904  -0.7922 -0.1801 120 ALA A N   
867 C CA  . ALA A 120 ? 1.1682 1.1843 1.8354 0.3183  -0.7912 -0.2384 120 ALA A CA  
868 C C   . ALA A 120 ? 1.3133 1.3748 2.1324 0.3911  -0.9450 -0.3369 120 ALA A C   
869 O O   . ALA A 120 ? 1.4155 1.4844 2.3163 0.4670  -1.0320 -0.3805 120 ALA A O   
870 C CB  . ALA A 120 ? 1.1671 1.1421 1.7998 0.3507  -0.7700 -0.2105 120 ALA A CB  
871 O OXT . ALA A 120 ? 1.4293 1.5247 2.3149 0.3883  -1.0065 -0.3978 120 ALA A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   PRO 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   PRO 6   6   ?   ?   ?   A . n 
A 1 7   PRO 7   7   ?   ?   ?   A . n 
A 1 8   ARG 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  PRO 13  13  13  PRO PRO A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  ASP 15  15  15  ASP ASP A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ASP 28  28  28  ASP ASP A . n 
A 1 29  PHE 29  29  29  PHE PHE A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  HIS 43  43  43  HIS HIS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ALA 46  46  46  ALA ALA A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  ARG 51  51  51  ARG ARG A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  TYR 62  62  62  TYR TYR A . n 
A 1 63  PHE 63  63  63  PHE PHE A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  GLU 67  67  67  GLU GLU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  CYS 73  73  73  CYS CYS A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  ASN 82  82  82  ASN ASN A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  CYS 97  97  97  CYS CYS A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 GLN 100 100 100 GLN GLN A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 VAL 104 104 104 VAL VAL A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 GLN 107 107 107 GLN GLN A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 MET 110 110 110 MET MET A . n 
A 1 111 THR 111 111 111 THR THR A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 CYS 117 117 117 CYS CYS A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z -1.0000000000 0.0000000000 0.0000000000 140.1350000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-05-30 
2 'Structure model' 1 1 2013-02-27 
3 'Structure model' 1 2 2013-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Derived calculations' 
2 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 86.2928 -1.1012  31.9856 0.3541 0.3332 0.2142 -0.1079 -0.0310 0.0530  9.8423  47.8849 13.1069 
-4.3298  3.7089  -3.2346  -0.2229 0.2907  1.0622  3.1208  -0.0680 -0.5079 -1.2556 1.9481  0.2910  
'X-RAY DIFFRACTION' 2  ? refined 83.3255 -15.3786 29.2776 0.5239 0.1612 0.2642 0.1342  0.0177  -0.0078 33.2098 11.3053 37.8472 
9.8231   14.5918 -1.4197  0.5404  -0.0766 -1.8005 0.6180  -0.3681 -0.5202 3.0064  1.3054  -0.1723 
'X-RAY DIFFRACTION' 3  ? refined 79.8345 -14.4843 12.3260 0.1199 0.1693 0.2256 0.0253  0.0066  -0.0083 2.2045  3.8731  19.8714 
-0.8076  -2.4809 7.9555   -0.1163 0.0864  -0.0131 0.0100  -0.3013 0.3458  -0.0309 -0.6458 0.4176  
'X-RAY DIFFRACTION' 4  ? refined 89.9975 -13.1293 17.4707 0.1584 0.2061 0.2326 0.0642  -0.0184 -0.0513 1.3879  11.4761 12.8123 
0.1541   -0.1933 11.4698  0.1434  -0.3069 -0.0331 0.5285  0.6693  -0.9852 0.5036  0.4885  -0.8127 
'X-RAY DIFFRACTION' 5  ? refined 70.8104 1.5215   28.6190 0.1618 0.1308 0.1604 0.0252  0.0087  0.0264  6.2909  1.4820  0.9303  
-2.1912  0.9358  0.0904   -0.0434 0.0634  0.1396  0.0899  -0.0007 -0.0636 0.0232  0.1344  0.0441  
'X-RAY DIFFRACTION' 6  ? refined 50.5107 11.2783  13.2768 0.1394 0.2080 0.3288 0.0257  -0.0379 -0.0124 1.8788  12.7665 23.5324 
-0.8066  0.4061  -16.6517 -0.1602 0.1219  -0.3498 -0.1862 0.5038  0.2389  0.3220  -0.6883 -0.3436 
'X-RAY DIFFRACTION' 7  ? refined 56.1082 23.9250  6.4092  0.2077 0.1577 0.1556 -0.0225 -0.0157 0.0061  7.9741  3.5816  12.6619 
4.2990   1.9063  0.8164   0.0526  0.0064  0.7055  -0.0462 0.2209  0.1808  -0.9368 0.4120  -0.2734 
'X-RAY DIFFRACTION' 8  ? refined 50.6099 23.8439  10.9942 0.2517 0.1636 0.2760 0.1052  0.0599  -0.0291 21.9503 12.5288 14.7007 
6.1527   -2.6181 -1.7138  0.5480  -0.9372 1.4697  1.1572  -0.2283 0.9830  -0.7387 -0.5554 -0.3198 
'X-RAY DIFFRACTION' 9  ? refined 45.1968 14.9427  2.0058  0.2759 0.9389 0.3400 -0.1421 -0.0587 -0.0551 17.6528 33.7309 9.4055  
1.5035   7.6093  -9.7281  0.2768  2.1379  -0.7070 -1.5498 0.3022  0.6831  1.3766  -1.5593 -0.5791 
'X-RAY DIFFRACTION' 10 ? refined 64.6266 7.4261   22.3964 0.0882 0.1495 0.1486 0.0224  0.0178  0.0380  8.4471  4.3787  6.0554  
2.1699   5.0249  1.8618   0.0257  0.1903  -0.1208 -0.1273 0.0779  -0.0958 0.0299  0.2891  -0.1037 
'X-RAY DIFFRACTION' 11 ? refined 53.7079 3.0352   11.5055 0.2648 0.2380 0.3516 -0.0036 -0.1741 0.0144  48.5988 23.1265 22.5676 
-10.9614 21.3520 5.4226   0.3380  2.3709  -1.6631 -2.1714 -0.3806 2.2597  -0.8225 0.2700  0.0426  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 10  ? ? A 17  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 18  ? ? A 24  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 25  ? ? A 42  ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 43  ? ? A 51  ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 52  ? ? A 64  ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 65  ? ? A 70  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 71  ? ? A 77  ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 78  ? ? A 87  ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 88  ? ? A 94  ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 95  ? ? A 113 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 A 114 ? ? A 120 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-3000 'data collection' .        ? 1 
MOLREP   phasing           .        ? 2 
REFMAC   refinement        5.5.0102 ? 3 
HKL-3000 'data reduction'  .        ? 4 
HKL-3000 'data scaling'    .        ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 125.78 120.30 5.48  0.50 N 
2 1 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH2 A ARG 70 ? ? 117.20 120.30 -3.10 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 58  ? ? -114.05 71.85  
2 1 SER A 115 ? ? -160.51 116.56 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1 ? A SER 1 
2 1 Y 1 A SER 2 ? A SER 2 
3 1 Y 1 A PRO 3 ? A PRO 3 
4 1 Y 1 A GLY 4 ? A GLY 4 
5 1 Y 1 A LYS 5 ? A LYS 5 
6 1 Y 1 A PRO 6 ? A PRO 6 
7 1 Y 1 A PRO 7 ? A PRO 7 
8 1 Y 1 A ARG 8 ? A ARG 8 
9 1 Y 1 A LEU 9 ? A LEU 9 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DI(HYDROXYETHYL)ETHER' PEG 
3 IMIDAZOLE               IMD 
4 'ACETATE ION'           ACT 
5 'CHLORIDE ION'          CL  
6 water                   HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PEG 1  121 1  PEG PEG A . 
C 2 PEG 1  122 2  PEG PEG A . 
D 2 PEG 1  123 3  PEG PEG A . 
E 3 IMD 1  124 1  IMD IMD A . 
F 3 IMD 1  125 2  IMD IMD A . 
G 4 ACT 1  126 1  ACT ACT A . 
H 4 ACT 1  127 2  ACT ACT A . 
I 5 CL  1  128 1  CL  CL  A . 
J 4 ACT 1  129 3  ACT ACT A . 
K 6 HOH 1  130 1  HOH HOH A . 
K 6 HOH 2  131 2  HOH HOH A . 
K 6 HOH 3  132 3  HOH HOH A . 
K 6 HOH 4  133 4  HOH HOH A . 
K 6 HOH 5  134 5  HOH HOH A . 
K 6 HOH 6  135 6  HOH HOH A . 
K 6 HOH 7  136 7  HOH HOH A . 
K 6 HOH 8  137 8  HOH HOH A . 
K 6 HOH 9  138 9  HOH HOH A . 
K 6 HOH 10 139 10 HOH HOH A . 
K 6 HOH 11 140 11 HOH HOH A . 
K 6 HOH 12 141 12 HOH HOH A . 
K 6 HOH 13 142 13 HOH HOH A . 
K 6 HOH 14 143 15 HOH HOH A . 
K 6 HOH 15 144 16 HOH HOH A . 
K 6 HOH 16 145 17 HOH HOH A . 
K 6 HOH 17 146 18 HOH HOH A . 
K 6 HOH 18 147 19 HOH HOH A . 
K 6 HOH 19 148 20 HOH HOH A . 
K 6 HOH 20 149 21 HOH HOH A . 
K 6 HOH 21 150 22 HOH HOH A . 
K 6 HOH 22 151 23 HOH HOH A . 
K 6 HOH 23 152 25 HOH HOH A . 
K 6 HOH 24 153 26 HOH HOH A . 
K 6 HOH 25 154 27 HOH HOH A . 
K 6 HOH 26 155 28 HOH HOH A . 
K 6 HOH 27 156 29 HOH HOH A . 
K 6 HOH 28 157 32 HOH HOH A . 
K 6 HOH 29 158 33 HOH HOH A . 
K 6 HOH 30 159 34 HOH HOH A . 
K 6 HOH 31 160 35 HOH HOH A . 
K 6 HOH 32 161 36 HOH HOH A . 
K 6 HOH 33 162 37 HOH HOH A . 
K 6 HOH 34 163 41 HOH HOH A . 
K 6 HOH 35 164 43 HOH HOH A . 
K 6 HOH 36 165 46 HOH HOH A . 
K 6 HOH 37 166 48 HOH HOH A . 
K 6 HOH 38 167 53 HOH HOH A . 
K 6 HOH 39 168 54 HOH HOH A . 
K 6 HOH 40 169 56 HOH HOH A . 
K 6 HOH 41 170 57 HOH HOH A . 
K 6 HOH 42 171 60 HOH HOH A . 
K 6 HOH 43 172 61 HOH HOH A . 
K 6 HOH 44 173 62 HOH HOH A . 
K 6 HOH 45 174 63 HOH HOH A . 
K 6 HOH 46 175 66 HOH HOH A . 
K 6 HOH 47 176 67 HOH HOH A . 
K 6 HOH 48 177 68 HOH HOH A . 
K 6 HOH 49 178 69 HOH HOH A . 
K 6 HOH 50 179 70 HOH HOH A . 
K 6 HOH 51 180 71 HOH HOH A . 
K 6 HOH 52 181 72 HOH HOH A . 
K 6 HOH 53 182 73 HOH HOH A . 
K 6 HOH 54 183 74 HOH HOH A . 
K 6 HOH 55 184 75 HOH HOH A . 
K 6 HOH 56 185 76 HOH HOH A . 
K 6 HOH 57 186 77 HOH HOH A . 
K 6 HOH 58 187 78 HOH HOH A . 
K 6 HOH 59 188 79 HOH HOH A . 
K 6 HOH 60 189 80 HOH HOH A . 
K 6 HOH 61 190 81 HOH HOH A . 
K 6 HOH 62 191 82 HOH HOH A . 
K 6 HOH 63 192 83 HOH HOH A . 
K 6 HOH 64 193 84 HOH HOH A . 
K 6 HOH 65 194 85 HOH HOH A . 
K 6 HOH 66 195 86 HOH HOH A . 
K 6 HOH 67 196 87 HOH HOH A . 
#