data_3S8W
# 
_entry.id   3S8W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3S8W         
RCSB  RCSB065908   
WWPDB D_1000065908 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3S98 . unspecified 
PDB 3S9D . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3S8W 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Thomas, C.'   1 
'Garcia, K.C.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Structural linkage between ligand discrimination and receptor activation by type I interferons.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            146 
_citation.page_first                621 
_citation.page_last                 632 
_citation.year                      2011 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21854986 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2011.06.048 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Thomas, C.'      1  
primary 'Moraga, I.'      2  
primary 'Levin, D.'       3  
primary 'Krutzik, P.O.'   4  
primary 'Podoplelova, Y.' 5  
primary 'Trejo, A.'       6  
primary 'Lee, C.'         7  
primary 'Yarden, G.'      8  
primary 'Vleck, S.E.'     9  
primary 'Glenn, J.S.'     10 
primary 'Nolan, G.P.'     11 
primary 'Piehler, J.'     12 
primary 'Schreiber, G.'   13 
primary 'Garcia, K.C.'    14 
# 
_cell.entry_id           3S8W 
_cell.length_a           82.660 
_cell.length_b           82.660 
_cell.length_c           225.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3S8W 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Interferon alpha/beta receptor 2' 12047.274 3  ? ? 'UNP Residues 131-232' ? 
2 non-polymer syn 'CHLORIDE ION'                     35.453    2  ? ? ?                      ? 
3 water       nat water                              18.015    35 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'IFN-R-2, IFN-alpha binding protein, IFN-alpha/beta receptor 2, Interferon alpha binding protein, Type I interferon receptor 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;ADPD(MSE)SFEPPEFEIVGFTNHINV(MSE)VKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGN(MSE)SGNFTY
IIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADPDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYC
VSVYLEHSDEQAVIKSPLKCTLLPP
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   PRO n 
1 4   ASP n 
1 5   MSE n 
1 6   SER n 
1 7   PHE n 
1 8   GLU n 
1 9   PRO n 
1 10  PRO n 
1 11  GLU n 
1 12  PHE n 
1 13  GLU n 
1 14  ILE n 
1 15  VAL n 
1 16  GLY n 
1 17  PHE n 
1 18  THR n 
1 19  ASN n 
1 20  HIS n 
1 21  ILE n 
1 22  ASN n 
1 23  VAL n 
1 24  MSE n 
1 25  VAL n 
1 26  LYS n 
1 27  PHE n 
1 28  PRO n 
1 29  SER n 
1 30  ILE n 
1 31  VAL n 
1 32  GLU n 
1 33  GLU n 
1 34  GLU n 
1 35  LEU n 
1 36  GLN n 
1 37  PHE n 
1 38  ASP n 
1 39  LEU n 
1 40  SER n 
1 41  LEU n 
1 42  VAL n 
1 43  ILE n 
1 44  GLU n 
1 45  GLU n 
1 46  GLN n 
1 47  SER n 
1 48  GLU n 
1 49  GLY n 
1 50  ILE n 
1 51  VAL n 
1 52  LYS n 
1 53  LYS n 
1 54  HIS n 
1 55  LYS n 
1 56  PRO n 
1 57  GLU n 
1 58  ILE n 
1 59  LYS n 
1 60  GLY n 
1 61  ASN n 
1 62  MSE n 
1 63  SER n 
1 64  GLY n 
1 65  ASN n 
1 66  PHE n 
1 67  THR n 
1 68  TYR n 
1 69  ILE n 
1 70  ILE n 
1 71  ASP n 
1 72  LYS n 
1 73  LEU n 
1 74  ILE n 
1 75  PRO n 
1 76  ASN n 
1 77  THR n 
1 78  ASN n 
1 79  TYR n 
1 80  CYS n 
1 81  VAL n 
1 82  SER n 
1 83  VAL n 
1 84  TYR n 
1 85  LEU n 
1 86  GLU n 
1 87  HIS n 
1 88  SER n 
1 89  ASP n 
1 90  GLU n 
1 91  GLN n 
1 92  ALA n 
1 93  VAL n 
1 94  ILE n 
1 95  LYS n 
1 96  SER n 
1 97  PRO n 
1 98  LEU n 
1 99  LYS n 
1 100 CYS n 
1 101 THR n 
1 102 LEU n 
1 103 LEU n 
1 104 PRO n 
1 105 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'IFNAR2, IFNABR, IFNARB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INAR2_HUMAN 
_struct_ref.pdbx_db_accession          P48551 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSV
YLEHSDEQAVIKSPLKCTLLPP
;
_struct_ref.pdbx_align_begin           131 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3S8W A 4 ? 105 ? P48551 131 ? 232 ? 104 205 
2 1 3S8W B 4 ? 105 ? P48551 131 ? 232 ? 104 205 
3 1 3S8W C 4 ? 105 ? P48551 131 ? 232 ? 104 205 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3S8W ALA A 1 ? UNP P48551 ? ? 'CLONING ARTIFACT' 101 1 
1 3S8W ASP A 2 ? UNP P48551 ? ? 'CLONING ARTIFACT' 102 2 
1 3S8W PRO A 3 ? UNP P48551 ? ? 'CLONING ARTIFACT' 103 3 
2 3S8W ALA B 1 ? UNP P48551 ? ? 'CLONING ARTIFACT' 101 4 
2 3S8W ASP B 2 ? UNP P48551 ? ? 'CLONING ARTIFACT' 102 5 
2 3S8W PRO B 3 ? UNP P48551 ? ? 'CLONING ARTIFACT' 103 6 
3 3S8W ALA C 1 ? UNP P48551 ? ? 'CLONING ARTIFACT' 101 7 
3 3S8W ASP C 2 ? UNP P48551 ? ? 'CLONING ARTIFACT' 102 8 
3 3S8W PRO C 3 ? UNP P48551 ? ? 'CLONING ARTIFACT' 103 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3S8W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;31% (w/v) PEG 4000, 200 mM Li2SO4, 100 mM Tris pH 8.5, 5% (v/v) MPD, 10 mM Na acetate, 1.5% (w/v) PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-10-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9791 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_wavelength             0.9791 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3S8W 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.925 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   26344 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              9.0 
_reflns.pdbx_netI_over_sigmaI        16.3 
_reflns.B_iso_Wilson_estimate        45.4 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.6 
_reflns_shell.d_res_low              2.7 
_reflns_shell.percent_possible_all   99.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        66.4 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        5.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3S8W 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     26342 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.43 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.925 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.60 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  1329 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               51.2 
_refine.aniso_B[1][1]                            8.80 
_refine.aniso_B[2][2]                            8.80 
_refine.aniso_B[3][3]                            -17.59 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.34 
_refine.solvent_model_param_bsol                 45.30 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'ANOMALOUS SCATTERER GROUP USED FOR ATOM SE WITH FP = -3.6227 AND FDP = 5.4465' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1950 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               1987 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        19.925 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.017  ? ? 2001 'X-RAY DIFFRACTION' ? 
f_angle_d          1.220  ? ? 2716 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.257 ? ? 735  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.084  ? ? 324  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 342  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.6000 2.7039  2769 0.3029 99.00  0.3817 . . 147 . . . . 
'X-RAY DIFFRACTION' . 2.7039 2.8266  2771 0.2650 99.00  0.2869 . . 143 . . . . 
'X-RAY DIFFRACTION' . 2.8266 2.9752  2753 0.2657 99.00  0.3157 . . 150 . . . . 
'X-RAY DIFFRACTION' . 2.9752 3.1609  2783 0.2449 100.00 0.2590 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.1609 3.4038  2793 0.2179 100.00 0.3020 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.4038 3.7443  2794 0.1996 100.00 0.3145 . . 153 . . . . 
'X-RAY DIFFRACTION' . 3.7443 4.2815  2769 0.1928 100.00 0.2300 . . 145 . . . . 
'X-RAY DIFFRACTION' . 4.2815 5.3766  2778 0.1611 100.00 0.2076 . . 147 . . . . 
'X-RAY DIFFRACTION' . 5.3766 19.9252 2805 0.2498 100.00 0.2699 . . 147 . . . . 
# 
_struct.entry_id                  3S8W 
_struct.title                     'D2 domain of human IFNAR2' 
_struct.pdbx_descriptor           'Interferon alpha/beta receptor 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3S8W 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN RECEPTOR' 
_struct_keywords.text            
;human, type I interferons, receptor chain, IFNAR2, fibronectin type III module, part of type I interferon receptor chain, interferon, extracellular space, SIGNALING PROTEIN RECEPTOR
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 80 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 180 A CYS 200 1_555 ? ? ? ? ? ? ? 2.085 ? 
disulf2 disulf ? ? B CYS 80 SG ? ? ? 1_555 B CYS 100 SG ? ? B CYS 180 B CYS 200 1_555 ? ? ? ? ? ? ? 2.082 ? 
disulf3 disulf ? ? C CYS 80 SG ? ? ? 1_555 C CYS 100 SG ? ? C CYS 180 C CYS 200 1_555 ? ? ? ? ? ? ? 2.059 ? 
covale1 covale ? ? A VAL 23 C  ? ? ? 1_555 A MSE 24  N  ? ? A VAL 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale ? ? A MSE 24 C  ? ? ? 1_555 A VAL 25  N  ? ? A MSE 124 A VAL 125 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale3 covale ? ? B VAL 23 C  ? ? ? 1_555 B MSE 24  N  ? ? B VAL 123 B MSE 124 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4 covale ? ? B MSE 24 C  ? ? ? 1_555 B VAL 25  N  ? ? B MSE 124 B VAL 125 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale5 covale ? ? C VAL 23 C  ? ? ? 1_555 C MSE 24  N  ? ? C VAL 123 C MSE 124 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6 covale ? ? C MSE 24 C  ? ? ? 1_555 C VAL 25  N  ? ? C MSE 124 C VAL 125 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7 covale ? ? C ASN 61 C  ? ? ? 1_555 C MSE 62  N  ? ? C ASN 161 C MSE 162 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale8 covale ? ? C MSE 62 C  ? ? ? 1_555 C SER 63  N  ? ? C MSE 162 C SER 163 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 8 ? 
C ? 3 ? 
D ? 3 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 11 ? GLY A 16  ? GLU A 111 GLY A 116 
A 2 ILE A 21 ? LYS A 26  ? ILE A 121 LYS A 126 
A 3 PHE A 66 ? ILE A 70  ? PHE A 166 ILE A 170 
A 4 GLU C 57 ? ILE C 58  ? GLU C 157 ILE C 158 
B 1 VAL A 51 ? HIS A 54  ? VAL A 151 HIS A 154 
B 2 LEU A 41 ? GLN A 46  ? LEU A 141 GLN A 146 
B 3 ASN A 78 ? LEU A 85  ? ASN A 178 LEU A 185 
B 4 LYS A 99 ? LEU A 102 ? LYS A 199 LEU A 202 
B 5 LEU B 98 ? LEU B 102 ? LEU B 198 LEU B 202 
B 6 ASN B 78 ? GLU B 86  ? ASN B 178 GLU B 186 
B 7 SER B 40 ? SER B 47  ? SER B 140 SER B 147 
B 8 ILE B 50 ? HIS B 54  ? ILE B 150 HIS B 154 
C 1 GLU B 11 ? GLY B 16  ? GLU B 111 GLY B 116 
C 2 ILE B 21 ? LYS B 26  ? ILE B 121 LYS B 126 
C 3 PHE B 66 ? ILE B 70  ? PHE B 166 ILE B 170 
D 1 GLU C 11 ? GLY C 16  ? GLU C 111 GLY C 116 
D 2 ILE C 21 ? PHE C 27  ? ILE C 121 PHE C 127 
D 3 GLY C 64 ? ILE C 70  ? GLY C 164 ILE C 170 
E 1 ILE C 50 ? HIS C 54  ? ILE C 150 HIS C 154 
E 2 SER C 40 ? SER C 47  ? SER C 140 SER C 147 
E 3 ASN C 78 ? GLU C 86  ? ASN C 178 GLU C 186 
E 4 LYS C 99 ? LEU C 102 ? LYS C 199 LEU C 202 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 13  ? N GLU A 113 O MSE A 24  ? O MSE A 124 
A 2 3 N VAL A 23  ? N VAL A 123 O TYR A 68  ? O TYR A 168 
A 3 4 N ILE A 69  ? N ILE A 169 O GLU C 57  ? O GLU C 157 
B 1 2 O LYS A 52  ? O LYS A 152 N GLU A 45  ? N GLU A 145 
B 2 3 N VAL A 42  ? N VAL A 142 O TYR A 84  ? O TYR A 184 
B 3 4 N VAL A 81  ? N VAL A 181 O LYS A 99  ? O LYS A 199 
B 4 5 N CYS A 100 ? N CYS A 200 O CYS B 100 ? O CYS B 200 
B 5 6 O THR B 101 ? O THR B 201 N TYR B 79  ? N TYR B 179 
B 6 7 O SER B 82  ? O SER B 182 N GLU B 44  ? N GLU B 144 
B 7 8 N ILE B 43  ? N ILE B 143 O HIS B 54  ? O HIS B 154 
C 1 2 N GLU B 11  ? N GLU B 111 O LYS B 26  ? O LYS B 126 
C 2 3 N VAL B 25  ? N VAL B 125 O PHE B 66  ? O PHE B 166 
D 1 2 N GLU C 13  ? N GLU C 113 O MSE C 24  ? O MSE C 124 
D 2 3 N ILE C 21  ? N ILE C 121 O ILE C 70  ? O ILE C 170 
E 1 2 O LYS C 52  ? O LYS C 152 N GLU C 45  ? N GLU C 145 
E 2 3 N GLU C 44  ? N GLU C 144 O SER C 82  ? O SER C 182 
E 3 4 N VAL C 81  ? N VAL C 181 O LYS C 99  ? O LYS C 199 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 1' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL C 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 1 LYS A 72 ? LYS A 172 . ? 1_555 ? 
2 AC2 1 THR A 67 ? THR A 167 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3S8W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3S8W 
_atom_sites.fract_transf_matrix[1][1]   0.012098 
_atom_sites.fract_transf_matrix[1][2]   0.006985 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013969 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004438 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 6   ? 45.507 -43.533 12.392  1.00 61.90  ? 106 SER A N   1 
ATOM   2    C  CA  . SER A 1 6   ? 45.218 -43.151 11.000  1.00 66.76  ? 106 SER A CA  1 
ATOM   3    C  C   . SER A 1 6   ? 43.752 -43.382 10.600  1.00 63.65  ? 106 SER A C   1 
ATOM   4    O  O   . SER A 1 6   ? 43.167 -44.435 10.900  1.00 66.34  ? 106 SER A O   1 
ATOM   5    C  CB  . SER A 1 6   ? 46.152 -43.877 10.021  1.00 70.54  ? 106 SER A CB  1 
ATOM   6    O  OG  . SER A 1 6   ? 45.577 -43.941 8.717   1.00 69.37  ? 106 SER A OG  1 
ATOM   7    N  N   . PHE A 1 7   ? 43.171 -42.400 9.913   1.00 55.07  ? 107 PHE A N   1 
ATOM   8    C  CA  . PHE A 1 7   ? 41.741 -42.424 9.612   1.00 53.48  ? 107 PHE A CA  1 
ATOM   9    C  C   . PHE A 1 7   ? 41.334 -41.410 8.519   1.00 50.17  ? 107 PHE A C   1 
ATOM   10   O  O   . PHE A 1 7   ? 42.111 -40.510 8.161   1.00 41.86  ? 107 PHE A O   1 
ATOM   11   C  CB  . PHE A 1 7   ? 40.959 -42.073 10.877  1.00 52.14  ? 107 PHE A CB  1 
ATOM   12   C  CG  . PHE A 1 7   ? 40.999 -40.612 11.197  1.00 53.75  ? 107 PHE A CG  1 
ATOM   13   C  CD1 . PHE A 1 7   ? 40.014 -39.740 10.700  1.00 52.35  ? 107 PHE A CD1 1 
ATOM   14   C  CD2 . PHE A 1 7   ? 42.059 -40.087 11.936  1.00 52.99  ? 107 PHE A CD2 1 
ATOM   15   C  CE1 . PHE A 1 7   ? 40.070 -38.366 10.969  1.00 51.57  ? 107 PHE A CE1 1 
ATOM   16   C  CE2 . PHE A 1 7   ? 42.127 -38.717 12.216  1.00 53.27  ? 107 PHE A CE2 1 
ATOM   17   C  CZ  . PHE A 1 7   ? 41.131 -37.852 11.734  1.00 53.57  ? 107 PHE A CZ  1 
ATOM   18   N  N   . GLU A 1 8   ? 40.097 -41.544 8.032   1.00 50.89  ? 108 GLU A N   1 
ATOM   19   C  CA  . GLU A 1 8   ? 39.536 -40.632 7.038   1.00 48.88  ? 108 GLU A CA  1 
ATOM   20   C  C   . GLU A 1 8   ? 38.513 -39.678 7.670   1.00 45.20  ? 108 GLU A C   1 
ATOM   21   O  O   . GLU A 1 8   ? 37.451 -40.117 8.135   1.00 52.11  ? 108 GLU A O   1 
ATOM   22   C  CB  . GLU A 1 8   ? 38.848 -41.423 5.909   1.00 55.59  ? 108 GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 8   ? 39.733 -42.386 5.111   1.00 62.41  ? 108 GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 8   ? 38.982 -43.048 3.951   1.00 66.86  ? 108 GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 8   ? 38.585 -44.230 4.096   1.00 70.76  ? 108 GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 8   ? 38.780 -42.382 2.903   1.00 61.94  ? 108 GLU A OE2 1 
ATOM   27   N  N   . PRO A 1 9   ? 38.811 -38.365 7.663   1.00 39.69  ? 109 PRO A N   1 
ATOM   28   C  CA  . PRO A 1 9   ? 37.871 -37.330 8.140   1.00 39.85  ? 109 PRO A CA  1 
ATOM   29   C  C   . PRO A 1 9   ? 36.716 -37.080 7.147   1.00 40.45  ? 109 PRO A C   1 
ATOM   30   O  O   . PRO A 1 9   ? 36.858 -37.287 5.934   1.00 37.97  ? 109 PRO A O   1 
ATOM   31   C  CB  . PRO A 1 9   ? 38.748 -36.071 8.251   1.00 36.93  ? 109 PRO A CB  1 
ATOM   32   C  CG  . PRO A 1 9   ? 39.800 -36.273 7.170   1.00 43.45  ? 109 PRO A CG  1 
ATOM   33   C  CD  . PRO A 1 9   ? 40.066 -37.787 7.143   1.00 43.02  ? 109 PRO A CD  1 
ATOM   34   N  N   . PRO A 1 10  ? 35.577 -36.604 7.664   1.00 38.39  ? 110 PRO A N   1 
ATOM   35   C  CA  . PRO A 1 10  ? 34.336 -36.478 6.901   1.00 37.93  ? 110 PRO A CA  1 
ATOM   36   C  C   . PRO A 1 10  ? 34.535 -35.526 5.733   1.00 43.66  ? 110 PRO A C   1 
ATOM   37   O  O   . PRO A 1 10  ? 35.325 -34.576 5.873   1.00 43.43  ? 110 PRO A O   1 
ATOM   38   C  CB  . PRO A 1 10  ? 33.382 -35.819 7.896   1.00 39.63  ? 110 PRO A CB  1 
ATOM   39   C  CG  . PRO A 1 10  ? 34.087 -35.867 9.233   1.00 42.07  ? 110 PRO A CG  1 
ATOM   40   C  CD  . PRO A 1 10  ? 35.520 -35.852 8.924   1.00 38.28  ? 110 PRO A CD  1 
ATOM   41   N  N   . GLU A 1 11  ? 33.857 -35.776 4.611   1.00 44.92  ? 111 GLU A N   1 
ATOM   42   C  CA  . GLU A 1 11  ? 33.841 -34.807 3.521   1.00 43.96  ? 111 GLU A CA  1 
ATOM   43   C  C   . GLU A 1 11  ? 32.531 -34.041 3.584   1.00 42.68  ? 111 GLU A C   1 
ATOM   44   O  O   . GLU A 1 11  ? 31.544 -34.518 4.180   1.00 44.35  ? 111 GLU A O   1 
ATOM   45   C  CB  . GLU A 1 11  ? 34.029 -35.471 2.154   1.00 45.07  ? 111 GLU A CB  1 
ATOM   46   C  CG  . GLU A 1 11  ? 35.371 -36.164 1.980   1.00 49.64  ? 111 GLU A CG  1 
ATOM   47   C  CD  . GLU A 1 11  ? 35.571 -36.725 0.569   1.00 50.71  ? 111 GLU A CD  1 
ATOM   48   O  OE1 . GLU A 1 11  ? 34.606 -37.314 0.012   1.00 47.44  ? 111 GLU A OE1 1 
ATOM   49   O  OE2 . GLU A 1 11  ? 36.697 -36.569 0.020   1.00 47.50  ? 111 GLU A OE2 1 
ATOM   50   N  N   . PHE A 1 12  ? 32.516 -32.849 2.992   1.00 35.77  ? 112 PHE A N   1 
ATOM   51   C  CA  . PHE A 1 12  ? 31.304 -32.052 3.054   1.00 30.66  ? 112 PHE A CA  1 
ATOM   52   C  C   . PHE A 1 12  ? 31.172 -30.966 1.989   1.00 29.85  ? 112 PHE A C   1 
ATOM   53   O  O   . PHE A 1 12  ? 32.155 -30.445 1.450   1.00 25.63  ? 112 PHE A O   1 
ATOM   54   C  CB  . PHE A 1 12  ? 31.130 -31.450 4.467   1.00 26.86  ? 112 PHE A CB  1 
ATOM   55   C  CG  . PHE A 1 12  ? 31.952 -30.220 4.720   1.00 25.09  ? 112 PHE A CG  1 
ATOM   56   C  CD1 . PHE A 1 12  ? 31.371 -28.962 4.642   1.00 29.72  ? 112 PHE A CD1 1 
ATOM   57   C  CD2 . PHE A 1 12  ? 33.299 -30.316 5.063   1.00 29.24  ? 112 PHE A CD2 1 
ATOM   58   C  CE1 . PHE A 1 12  ? 32.129 -27.804 4.898   1.00 36.33  ? 112 PHE A CE1 1 
ATOM   59   C  CE2 . PHE A 1 12  ? 34.063 -29.165 5.329   1.00 29.34  ? 112 PHE A CE2 1 
ATOM   60   C  CZ  . PHE A 1 12  ? 33.477 -27.908 5.242   1.00 31.83  ? 112 PHE A CZ  1 
ATOM   61   N  N   . GLU A 1 13  ? 29.919 -30.635 1.714   1.00 30.29  ? 113 GLU A N   1 
ATOM   62   C  CA  . GLU A 1 13  ? 29.570 -29.547 0.829   1.00 35.15  ? 113 GLU A CA  1 
ATOM   63   C  C   . GLU A 1 13  ? 28.623 -28.620 1.580   1.00 35.68  ? 113 GLU A C   1 
ATOM   64   O  O   . GLU A 1 13  ? 27.877 -29.053 2.474   1.00 33.59  ? 113 GLU A O   1 
ATOM   65   C  CB  . GLU A 1 13  ? 28.896 -30.086 -0.450  1.00 41.09  ? 113 GLU A CB  1 
ATOM   66   C  CG  . GLU A 1 13  ? 29.832 -30.902 -1.342  1.00 51.60  ? 113 GLU A CG  1 
ATOM   67   C  CD  . GLU A 1 13  ? 31.190 -30.215 -1.548  1.00 64.80  ? 113 GLU A CD  1 
ATOM   68   O  OE1 . GLU A 1 13  ? 31.232 -28.956 -1.570  1.00 66.06  ? 113 GLU A OE1 1 
ATOM   69   O  OE2 . GLU A 1 13  ? 32.219 -30.928 -1.686  1.00 67.68  ? 113 GLU A OE2 1 
ATOM   70   N  N   . ILE A 1 14  ? 28.669 -27.340 1.237   1.00 32.31  ? 114 ILE A N   1 
ATOM   71   C  CA  . ILE A 1 14  ? 27.658 -26.416 1.706   1.00 29.86  ? 114 ILE A CA  1 
ATOM   72   C  C   . ILE A 1 14  ? 27.032 -25.710 0.518   1.00 33.63  ? 114 ILE A C   1 
ATOM   73   O  O   . ILE A 1 14  ? 27.706 -25.436 -0.487  1.00 34.84  ? 114 ILE A O   1 
ATOM   74   C  CB  . ILE A 1 14  ? 28.258 -25.348 2.610   1.00 21.39  ? 114 ILE A CB  1 
ATOM   75   C  CG1 . ILE A 1 14  ? 29.217 -24.487 1.806   1.00 18.52  ? 114 ILE A CG1 1 
ATOM   76   C  CG2 . ILE A 1 14  ? 28.980 -26.000 3.774   1.00 27.64  ? 114 ILE A CG2 1 
ATOM   77   C  CD1 . ILE A 1 14  ? 29.587 -23.201 2.475   1.00 25.60  ? 114 ILE A CD1 1 
ATOM   78   N  N   . VAL A 1 15  ? 25.744 -25.413 0.634   1.00 31.81  ? 115 VAL A N   1 
ATOM   79   C  CA  . VAL A 1 15  ? 25.126 -24.414 -0.237  1.00 31.93  ? 115 VAL A CA  1 
ATOM   80   C  C   . VAL A 1 15  ? 24.420 -23.364 0.623   1.00 32.44  ? 115 VAL A C   1 
ATOM   81   O  O   . VAL A 1 15  ? 23.718 -23.701 1.600   1.00 32.41  ? 115 VAL A O   1 
ATOM   82   C  CB  . VAL A 1 15  ? 24.164 -25.032 -1.293  1.00 31.38  ? 115 VAL A CB  1 
ATOM   83   C  CG1 . VAL A 1 15  ? 23.416 -26.200 -0.705  1.00 43.45  ? 115 VAL A CG1 1 
ATOM   84   C  CG2 . VAL A 1 15  ? 23.194 -23.975 -1.786  1.00 22.49  ? 115 VAL A CG2 1 
ATOM   85   N  N   . GLY A 1 16  ? 24.633 -22.094 0.281   1.00 29.80  ? 116 GLY A N   1 
ATOM   86   C  CA  . GLY A 1 16  ? 24.093 -21.013 1.086   1.00 31.58  ? 116 GLY A CA  1 
ATOM   87   C  C   . GLY A 1 16  ? 22.799 -20.394 0.596   1.00 35.68  ? 116 GLY A C   1 
ATOM   88   O  O   . GLY A 1 16  ? 22.670 -20.056 -0.557  1.00 47.20  ? 116 GLY A O   1 
ATOM   89   N  N   . PHE A 1 17  ? 21.835 -20.221 1.486   1.00 38.20  ? 117 PHE A N   1 
ATOM   90   C  CA  . PHE A 1 17  ? 20.593 -19.545 1.123   1.00 30.78  ? 117 PHE A CA  1 
ATOM   91   C  C   . PHE A 1 17  ? 20.484 -18.233 1.877   1.00 37.22  ? 117 PHE A C   1 
ATOM   92   O  O   . PHE A 1 17  ? 21.356 -17.908 2.684   1.00 40.86  ? 117 PHE A O   1 
ATOM   93   C  CB  . PHE A 1 17  ? 19.398 -20.459 1.393   1.00 27.15  ? 117 PHE A CB  1 
ATOM   94   C  CG  . PHE A 1 17  ? 19.444 -21.729 0.593   1.00 34.00  ? 117 PHE A CG  1 
ATOM   95   C  CD1 . PHE A 1 17  ? 18.818 -21.803 -0.654  1.00 38.28  ? 117 PHE A CD1 1 
ATOM   96   C  CD2 . PHE A 1 17  ? 20.171 -22.827 1.042   1.00 31.64  ? 117 PHE A CD2 1 
ATOM   97   C  CE1 . PHE A 1 17  ? 18.876 -22.969 -1.421  1.00 32.83  ? 117 PHE A CE1 1 
ATOM   98   C  CE2 . PHE A 1 17  ? 20.240 -24.000 0.288   1.00 33.04  ? 117 PHE A CE2 1 
ATOM   99   C  CZ  . PHE A 1 17  ? 19.586 -24.073 -0.950  1.00 33.64  ? 117 PHE A CZ  1 
ATOM   100  N  N   . THR A 1 18  ? 19.419 -17.480 1.627   1.00 41.18  ? 118 THR A N   1 
ATOM   101  C  CA  . THR A 1 18  ? 19.366 -16.101 2.096   1.00 45.49  ? 118 THR A CA  1 
ATOM   102  C  C   . THR A 1 18  ? 19.532 -16.008 3.616   1.00 46.21  ? 118 THR A C   1 
ATOM   103  O  O   . THR A 1 18  ? 20.205 -15.095 4.112   1.00 48.79  ? 118 THR A O   1 
ATOM   104  C  CB  . THR A 1 18  ? 18.093 -15.365 1.607   1.00 44.82  ? 118 THR A CB  1 
ATOM   105  O  OG1 . THR A 1 18  ? 18.212 -13.962 1.888   1.00 46.83  ? 118 THR A OG1 1 
ATOM   106  C  CG2 . THR A 1 18  ? 16.841 -15.937 2.274   1.00 41.97  ? 118 THR A CG2 1 
ATOM   107  N  N   . ASN A 1 19  ? 18.955 -16.954 4.353   1.00 41.71  ? 119 ASN A N   1 
ATOM   108  C  CA  . ASN A 1 19  ? 19.150 -16.968 5.806   1.00 45.67  ? 119 ASN A CA  1 
ATOM   109  C  C   . ASN A 1 19  ? 19.434 -18.342 6.402   1.00 46.20  ? 119 ASN A C   1 
ATOM   110  O  O   . ASN A 1 19  ? 19.173 -18.568 7.595   1.00 48.18  ? 119 ASN A O   1 
ATOM   111  C  CB  . ASN A 1 19  ? 17.957 -16.344 6.528   1.00 47.72  ? 119 ASN A CB  1 
ATOM   112  C  CG  . ASN A 1 19  ? 16.658 -17.003 6.158   1.00 52.57  ? 119 ASN A CG  1 
ATOM   113  O  OD1 . ASN A 1 19  ? 16.607 -18.212 5.894   1.00 52.89  ? 119 ASN A OD1 1 
ATOM   114  N  ND2 . ASN A 1 19  ? 15.594 -16.206 6.100   1.00 55.00  ? 119 ASN A ND2 1 
ATOM   115  N  N   . HIS A 1 20  ? 19.965 -19.260 5.596   1.00 37.03  ? 120 HIS A N   1 
ATOM   116  C  CA  . HIS A 1 20  ? 20.372 -20.546 6.146   1.00 32.96  ? 120 HIS A CA  1 
ATOM   117  C  C   . HIS A 1 20  ? 21.380 -21.218 5.232   1.00 34.75  ? 120 HIS A C   1 
ATOM   118  O  O   . HIS A 1 20  ? 21.425 -20.939 4.028   1.00 38.35  ? 120 HIS A O   1 
ATOM   119  C  CB  . HIS A 1 20  ? 19.154 -21.446 6.367   1.00 27.19  ? 120 HIS A CB  1 
ATOM   120  C  CG  . HIS A 1 20  ? 18.435 -21.813 5.101   1.00 33.04  ? 120 HIS A CG  1 
ATOM   121  N  ND1 . HIS A 1 20  ? 18.846 -22.847 4.270   1.00 30.18  ? 120 HIS A ND1 1 
ATOM   122  C  CD2 . HIS A 1 20  ? 17.331 -21.286 4.517   1.00 33.80  ? 120 HIS A CD2 1 
ATOM   123  C  CE1 . HIS A 1 20  ? 18.017 -22.941 3.248   1.00 35.10  ? 120 HIS A CE1 1 
ATOM   124  N  NE2 . HIS A 1 20  ? 17.089 -22.000 3.368   1.00 31.34  ? 120 HIS A NE2 1 
ATOM   125  N  N   . ILE A 1 21  ? 22.188 -22.104 5.805   1.00 24.89  ? 121 ILE A N   1 
ATOM   126  C  CA  . ILE A 1 21  ? 23.156 -22.856 5.021   1.00 23.61  ? 121 ILE A CA  1 
ATOM   127  C  C   . ILE A 1 21  ? 22.858 -24.354 5.075   1.00 30.83  ? 121 ILE A C   1 
ATOM   128  O  O   . ILE A 1 21  ? 22.701 -24.925 6.154   1.00 38.70  ? 121 ILE A O   1 
ATOM   129  C  CB  . ILE A 1 21  ? 24.569 -22.621 5.543   1.00 23.54  ? 121 ILE A CB  1 
ATOM   130  C  CG1 . ILE A 1 21  ? 24.974 -21.162 5.298   1.00 27.63  ? 121 ILE A CG1 1 
ATOM   131  C  CG2 . ILE A 1 21  ? 25.551 -23.585 4.882   1.00 19.25  ? 121 ILE A CG2 1 
ATOM   132  C  CD1 . ILE A 1 21  ? 26.406 -20.829 5.688   1.00 22.67  ? 121 ILE A CD1 1 
ATOM   133  N  N   . ASN A 1 22  ? 22.774 -24.998 3.919   1.00 32.06  ? 122 ASN A N   1 
ATOM   134  C  CA  . ASN A 1 22  ? 22.566 -26.445 3.910   1.00 34.58  ? 122 ASN A CA  1 
ATOM   135  C  C   . ASN A 1 22  ? 23.876 -27.202 3.859   1.00 37.65  ? 122 ASN A C   1 
ATOM   136  O  O   . ASN A 1 22  ? 24.596 -27.156 2.851   1.00 44.47  ? 122 ASN A O   1 
ATOM   137  C  CB  . ASN A 1 22  ? 21.647 -26.872 2.763   1.00 23.98  ? 122 ASN A CB  1 
ATOM   138  C  CG  . ASN A 1 22  ? 20.254 -26.322 2.928   1.00 25.97  ? 122 ASN A CG  1 
ATOM   139  O  OD1 . ASN A 1 22  ? 20.026 -25.371 3.718   1.00 30.84  ? 122 ASN A OD1 1 
ATOM   140  N  ND2 . ASN A 1 22  ? 19.301 -26.914 2.212   1.00 24.83  ? 122 ASN A ND2 1 
ATOM   141  N  N   . VAL A 1 23  ? 24.179 -27.895 4.952   1.00 28.43  ? 123 VAL A N   1 
ATOM   142  C  CA  . VAL A 1 23  ? 25.437 -28.624 5.048   1.00 29.16  ? 123 VAL A CA  1 
ATOM   143  C  C   . VAL A 1 23  ? 25.245 -30.123 4.776   1.00 33.52  ? 123 VAL A C   1 
ATOM   144  O  O   . VAL A 1 23  ? 24.462 -30.802 5.451   1.00 37.52  ? 123 VAL A O   1 
ATOM   145  C  CB  . VAL A 1 23  ? 26.126 -28.396 6.406   1.00 25.19  ? 123 VAL A CB  1 
ATOM   146  C  CG1 . VAL A 1 23  ? 27.464 -29.104 6.434   1.00 20.97  ? 123 VAL A CG1 1 
ATOM   147  C  CG2 . VAL A 1 23  ? 26.301 -26.905 6.651   1.00 21.07  ? 123 VAL A CG2 1 
HETATM 148  N  N   . MSE A 1 24  ? 25.964 -30.609 3.765   1.00 33.51  ? 124 MSE A N   1 
HETATM 149  C  CA  A MSE A 1 24  ? 25.871 -31.999 3.344   0.59 31.64  ? 124 MSE A CA  1 
HETATM 150  C  CA  B MSE A 1 24  ? 25.887 -31.994 3.324   0.41 32.03  ? 124 MSE A CA  1 
HETATM 151  C  C   . MSE A 1 24  ? 27.162 -32.728 3.694   1.00 34.35  ? 124 MSE A C   1 
HETATM 152  O  O   . MSE A 1 24  ? 28.230 -32.424 3.135   1.00 37.57  ? 124 MSE A O   1 
HETATM 153  C  CB  A MSE A 1 24  ? 25.613 -32.089 1.840   0.59 32.66  ? 124 MSE A CB  1 
HETATM 154  C  CB  B MSE A 1 24  ? 25.740 -32.037 1.807   0.41 32.60  ? 124 MSE A CB  1 
HETATM 155  C  CG  A MSE A 1 24  ? 24.149 -31.860 1.396   0.59 32.30  ? 124 MSE A CG  1 
HETATM 156  C  CG  B MSE A 1 24  ? 24.726 -33.065 1.309   0.41 33.52  ? 124 MSE A CG  1 
HETATM 157  SE SE  A MSE A 1 24  ? 23.525 -30.010 1.443   0.59 54.05  ? 124 MSE A SE  1 
HETATM 158  SE SE  B MSE A 1 24  ? 24.814 -33.516 -0.595  0.41 62.70  ? 124 MSE A SE  1 
HETATM 159  C  CE  A MSE A 1 24  ? 24.856 -29.221 0.253   0.59 22.16  ? 124 MSE A CE  1 
HETATM 160  C  CE  B MSE A 1 24  ? 23.271 -34.715 -0.609  0.41 38.26  ? 124 MSE A CE  1 
ATOM   161  N  N   . VAL A 1 25  ? 27.057 -33.693 4.617   1.00 31.22  ? 125 VAL A N   1 
ATOM   162  C  CA  . VAL A 1 25  ? 28.203 -34.460 5.133   1.00 26.61  ? 125 VAL A CA  1 
ATOM   163  C  C   . VAL A 1 25  ? 28.212 -35.875 4.565   1.00 34.70  ? 125 VAL A C   1 
ATOM   164  O  O   . VAL A 1 25  ? 27.154 -36.517 4.467   1.00 34.57  ? 125 VAL A O   1 
ATOM   165  C  CB  . VAL A 1 25  ? 28.102 -34.622 6.689   1.00 31.15  ? 125 VAL A CB  1 
ATOM   166  C  CG1 . VAL A 1 25  ? 29.322 -35.384 7.270   1.00 29.23  ? 125 VAL A CG1 1 
ATOM   167  C  CG2 . VAL A 1 25  ? 27.884 -33.279 7.380   1.00 20.87  ? 125 VAL A CG2 1 
ATOM   168  N  N   . LYS A 1 26  ? 29.391 -36.375 4.204   1.00 44.23  ? 126 LYS A N   1 
ATOM   169  C  CA  . LYS A 1 26  ? 29.531 -37.792 3.865   1.00 54.02  ? 126 LYS A CA  1 
ATOM   170  C  C   . LYS A 1 26  ? 30.451 -38.499 4.860   1.00 64.12  ? 126 LYS A C   1 
ATOM   171  O  O   . LYS A 1 26  ? 31.677 -38.300 4.825   1.00 63.79  ? 126 LYS A O   1 
ATOM   172  C  CB  . LYS A 1 26  ? 30.066 -37.956 2.439   1.00 53.36  ? 126 LYS A CB  1 
ATOM   173  N  N   . PHE A 1 27  ? 29.860 -39.316 5.740   1.00 72.19  ? 127 PHE A N   1 
ATOM   174  C  CA  . PHE A 1 27  ? 30.620 -40.019 6.783   1.00 73.92  ? 127 PHE A CA  1 
ATOM   175  C  C   . PHE A 1 27  ? 31.081 -41.396 6.309   1.00 79.18  ? 127 PHE A C   1 
ATOM   176  O  O   . PHE A 1 27  ? 31.914 -42.034 6.950   1.00 84.55  ? 127 PHE A O   1 
ATOM   177  C  CB  . PHE A 1 27  ? 29.811 -40.133 8.084   1.00 68.53  ? 127 PHE A CB  1 
ATOM   178  N  N   . SER A 1 40  ? 30.645 -36.159 19.067  1.00 61.11  ? 140 SER A N   1 
ATOM   179  C  CA  . SER A 1 40  ? 31.866 -36.577 18.375  1.00 63.56  ? 140 SER A CA  1 
ATOM   180  C  C   . SER A 1 40  ? 32.042 -35.912 16.989  1.00 62.75  ? 140 SER A C   1 
ATOM   181  O  O   . SER A 1 40  ? 33.130 -35.407 16.692  1.00 64.17  ? 140 SER A O   1 
ATOM   182  C  CB  . SER A 1 40  ? 31.964 -38.108 18.290  1.00 60.67  ? 140 SER A CB  1 
ATOM   183  N  N   . LEU A 1 41  ? 31.003 -35.892 16.149  1.00 55.56  ? 141 LEU A N   1 
ATOM   184  C  CA  . LEU A 1 41  ? 31.098 -35.122 14.891  1.00 51.79  ? 141 LEU A CA  1 
ATOM   185  C  C   . LEU A 1 41  ? 30.599 -33.666 15.022  1.00 41.90  ? 141 LEU A C   1 
ATOM   186  O  O   . LEU A 1 41  ? 29.481 -33.403 15.497  1.00 36.65  ? 141 LEU A O   1 
ATOM   187  C  CB  . LEU A 1 41  ? 30.420 -35.824 13.710  1.00 52.64  ? 141 LEU A CB  1 
ATOM   188  C  CG  . LEU A 1 41  ? 30.477 -35.053 12.377  1.00 56.12  ? 141 LEU A CG  1 
ATOM   189  C  CD1 . LEU A 1 41  ? 30.847 -35.939 11.187  1.00 56.56  ? 141 LEU A CD1 1 
ATOM   190  C  CD2 . LEU A 1 41  ? 29.165 -34.332 12.105  1.00 58.05  ? 141 LEU A CD2 1 
ATOM   191  N  N   . VAL A 1 42  ? 31.435 -32.725 14.587  1.00 35.03  ? 142 VAL A N   1 
ATOM   192  C  CA  . VAL A 1 42  ? 31.161 -31.314 14.815  1.00 38.27  ? 142 VAL A CA  1 
ATOM   193  C  C   . VAL A 1 42  ? 31.077 -30.493 13.518  1.00 38.53  ? 142 VAL A C   1 
ATOM   194  O  O   . VAL A 1 42  ? 31.911 -30.631 12.607  1.00 35.13  ? 142 VAL A O   1 
ATOM   195  C  CB  . VAL A 1 42  ? 32.220 -30.701 15.754  1.00 42.38  ? 142 VAL A CB  1 
ATOM   196  C  CG1 . VAL A 1 42  ? 31.970 -29.217 15.955  1.00 46.18  ? 142 VAL A CG1 1 
ATOM   197  C  CG2 . VAL A 1 42  ? 32.233 -31.436 17.085  1.00 40.97  ? 142 VAL A CG2 1 
ATOM   198  N  N   . ILE A 1 43  ? 30.051 -29.648 13.450  1.00 36.07  ? 143 ILE A N   1 
ATOM   199  C  CA  . ILE A 1 43  ? 29.926 -28.680 12.377  1.00 31.71  ? 143 ILE A CA  1 
ATOM   200  C  C   . ILE A 1 43  ? 30.093 -27.292 12.966  1.00 33.72  ? 143 ILE A C   1 
ATOM   201  O  O   . ILE A 1 43  ? 29.239 -26.805 13.718  1.00 39.71  ? 143 ILE A O   1 
ATOM   202  C  CB  . ILE A 1 43  ? 28.572 -28.779 11.664  1.00 29.48  ? 143 ILE A CB  1 
ATOM   203  C  CG1 . ILE A 1 43  ? 28.434 -30.152 10.997  1.00 31.73  ? 143 ILE A CG1 1 
ATOM   204  C  CG2 . ILE A 1 43  ? 28.424 -27.657 10.631  1.00 25.51  ? 143 ILE A CG2 1 
ATOM   205  C  CD1 . ILE A 1 43  ? 27.076 -30.405 10.384  1.00 28.59  ? 143 ILE A CD1 1 
ATOM   206  N  N   . GLU A 1 44  ? 31.208 -26.667 12.618  1.00 29.83  ? 144 GLU A N   1 
ATOM   207  C  CA  . GLU A 1 44  ? 31.590 -25.375 13.165  1.00 30.61  ? 144 GLU A CA  1 
ATOM   208  C  C   . GLU A 1 44  ? 31.158 -24.282 12.194  1.00 32.41  ? 144 GLU A C   1 
ATOM   209  O  O   . GLU A 1 44  ? 31.456 -24.356 10.986  1.00 41.44  ? 144 GLU A O   1 
ATOM   210  C  CB  . GLU A 1 44  ? 33.101 -25.364 13.322  1.00 32.67  ? 144 GLU A CB  1 
ATOM   211  C  CG  . GLU A 1 44  ? 33.640 -24.555 14.447  1.00 38.42  ? 144 GLU A CG  1 
ATOM   212  C  CD  . GLU A 1 44  ? 35.163 -24.568 14.463  1.00 53.91  ? 144 GLU A CD  1 
ATOM   213  O  OE1 . GLU A 1 44  ? 35.754 -25.432 15.166  1.00 61.71  ? 144 GLU A OE1 1 
ATOM   214  O  OE2 . GLU A 1 44  ? 35.772 -23.720 13.761  1.00 55.54  ? 144 GLU A OE2 1 
ATOM   215  N  N   . GLU A 1 45  ? 30.445 -23.287 12.721  1.00 28.69  ? 145 GLU A N   1 
ATOM   216  C  CA  . GLU A 1 45  ? 29.925 -22.157 11.944  1.00 31.74  ? 145 GLU A CA  1 
ATOM   217  C  C   . GLU A 1 45  ? 30.668 -20.892 12.350  1.00 37.62  ? 145 GLU A C   1 
ATOM   218  O  O   . GLU A 1 45  ? 30.501 -20.419 13.473  1.00 42.48  ? 145 GLU A O   1 
ATOM   219  C  CB  . GLU A 1 45  ? 28.436 -21.967 12.259  1.00 32.52  ? 145 GLU A CB  1 
ATOM   220  C  CG  . GLU A 1 45  ? 27.843 -20.634 11.784  1.00 35.87  ? 145 GLU A CG  1 
ATOM   221  C  CD  . GLU A 1 45  ? 26.711 -20.102 12.704  1.00 46.95  ? 145 GLU A CD  1 
ATOM   222  O  OE1 . GLU A 1 45  ? 25.914 -20.911 13.257  1.00 41.36  ? 145 GLU A OE1 1 
ATOM   223  O  OE2 . GLU A 1 45  ? 26.610 -18.862 12.871  1.00 47.99  ? 145 GLU A OE2 1 
ATOM   224  N  N   . GLN A 1 46  ? 31.474 -20.322 11.461  1.00 39.57  ? 146 GLN A N   1 
ATOM   225  C  CA  . GLN A 1 46  ? 32.164 -19.072 11.800  1.00 39.92  ? 146 GLN A CA  1 
ATOM   226  C  C   . GLN A 1 46  ? 31.578 -17.857 11.078  1.00 44.60  ? 146 GLN A C   1 
ATOM   227  O  O   . GLN A 1 46  ? 31.382 -17.869 9.855   1.00 47.56  ? 146 GLN A O   1 
ATOM   228  C  CB  . GLN A 1 46  ? 33.659 -19.167 11.496  1.00 39.12  ? 146 GLN A CB  1 
ATOM   229  C  CG  . GLN A 1 46  ? 34.262 -20.545 11.750  1.00 46.69  ? 146 GLN A CG  1 
ATOM   230  C  CD  . GLN A 1 46  ? 35.774 -20.574 11.572  1.00 52.37  ? 146 GLN A CD  1 
ATOM   231  O  OE1 . GLN A 1 46  ? 36.379 -19.619 11.067  1.00 57.31  ? 146 GLN A OE1 1 
ATOM   232  N  NE2 . GLN A 1 46  ? 36.395 -21.675 11.992  1.00 52.07  ? 146 GLN A NE2 1 
ATOM   233  N  N   . SER A 1 47  ? 31.271 -16.821 11.847  1.00 48.12  ? 147 SER A N   1 
ATOM   234  C  CA  . SER A 1 47  ? 30.987 -15.507 11.292  1.00 51.01  ? 147 SER A CA  1 
ATOM   235  C  C   . SER A 1 47  ? 32.141 -14.633 11.778  1.00 56.70  ? 147 SER A C   1 
ATOM   236  O  O   . SER A 1 47  ? 33.093 -15.152 12.367  1.00 56.27  ? 147 SER A O   1 
ATOM   237  C  CB  . SER A 1 47  ? 29.645 -14.980 11.783  1.00 55.28  ? 147 SER A CB  1 
ATOM   238  O  OG  . SER A 1 47  ? 29.126 -14.039 10.860  1.00 64.40  ? 147 SER A OG  1 
ATOM   239  N  N   . GLU A 1 48  ? 32.095 -13.329 11.537  1.00 60.26  ? 148 GLU A N   1 
ATOM   240  C  CA  . GLU A 1 48  ? 33.220 -12.501 11.946  1.00 61.67  ? 148 GLU A CA  1 
ATOM   241  C  C   . GLU A 1 48  ? 33.229 -12.234 13.457  1.00 61.52  ? 148 GLU A C   1 
ATOM   242  O  O   . GLU A 1 48  ? 32.302 -11.633 14.009  1.00 61.84  ? 148 GLU A O   1 
ATOM   243  C  CB  . GLU A 1 48  ? 33.246 -11.201 11.175  1.00 69.63  ? 148 GLU A CB  1 
ATOM   244  C  CG  . GLU A 1 48  ? 34.469 -10.381 11.457  1.00 79.13  ? 148 GLU A CG  1 
ATOM   245  C  CD  . GLU A 1 48  ? 34.148 -8.913  11.449  1.00 89.82  ? 148 GLU A CD  1 
ATOM   246  O  OE1 . GLU A 1 48  ? 33.013 -8.559  11.845  1.00 90.76  ? 148 GLU A OE1 1 
ATOM   247  O  OE2 . GLU A 1 48  ? 35.017 -8.118  11.033  1.00 95.64  ? 148 GLU A OE2 1 
ATOM   248  N  N   . GLY A 1 49  ? 34.297 -12.683 14.111  1.00 57.26  ? 149 GLY A N   1 
ATOM   249  C  CA  . GLY A 1 49  ? 34.391 -12.649 15.556  1.00 54.68  ? 149 GLY A CA  1 
ATOM   250  C  C   . GLY A 1 49  ? 33.798 -13.874 16.237  1.00 53.70  ? 149 GLY A C   1 
ATOM   251  O  O   . GLY A 1 49  ? 34.184 -14.213 17.349  1.00 60.25  ? 149 GLY A O   1 
ATOM   252  N  N   . ILE A 1 50  ? 32.870 -14.549 15.569  1.00 46.46  ? 150 ILE A N   1 
ATOM   253  C  CA  . ILE A 1 50  ? 32.077 -15.583 16.220  1.00 41.33  ? 150 ILE A CA  1 
ATOM   254  C  C   . ILE A 1 50  ? 32.297 -16.998 15.689  1.00 42.94  ? 150 ILE A C   1 
ATOM   255  O  O   . ILE A 1 50  ? 32.413 -17.213 14.488  1.00 48.63  ? 150 ILE A O   1 
ATOM   256  C  CB  . ILE A 1 50  ? 30.588 -15.234 16.129  1.00 36.54  ? 150 ILE A CB  1 
ATOM   257  C  CG1 . ILE A 1 50  ? 30.380 -13.758 16.483  1.00 34.54  ? 150 ILE A CG1 1 
ATOM   258  C  CG2 . ILE A 1 50  ? 29.767 -16.131 17.034  1.00 38.82  ? 150 ILE A CG2 1 
ATOM   259  C  CD1 . ILE A 1 50  ? 28.924 -13.377 16.690  1.00 35.14  ? 150 ILE A CD1 1 
ATOM   260  N  N   . VAL A 1 51  ? 32.355 -17.958 16.609  1.00 42.79  ? 151 VAL A N   1 
ATOM   261  C  CA  . VAL A 1 51  ? 32.402 -19.378 16.265  1.00 35.08  ? 151 VAL A CA  1 
ATOM   262  C  C   . VAL A 1 51  ? 31.340 -20.135 17.050  1.00 36.15  ? 151 VAL A C   1 
ATOM   263  O  O   . VAL A 1 51  ? 31.361 -20.130 18.292  1.00 40.89  ? 151 VAL A O   1 
ATOM   264  C  CB  . VAL A 1 51  ? 33.778 -19.996 16.576  1.00 28.10  ? 151 VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 51  ? 33.710 -21.513 16.475  1.00 25.57  ? 151 VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 51  ? 34.831 -19.450 15.625  1.00 28.36  ? 151 VAL A CG2 1 
ATOM   267  N  N   . LYS A 1 52  ? 30.414 -20.771 16.330  1.00 30.59  ? 152 LYS A N   1 
ATOM   268  C  CA  . LYS A 1 52  ? 29.384 -21.608 16.953  1.00 28.75  ? 152 LYS A CA  1 
ATOM   269  C  C   . LYS A 1 52  ? 29.663 -23.070 16.646  1.00 36.02  ? 152 LYS A C   1 
ATOM   270  O  O   . LYS A 1 52  ? 29.986 -23.415 15.503  1.00 37.28  ? 152 LYS A O   1 
ATOM   271  C  CB  . LYS A 1 52  ? 27.979 -21.223 16.467  1.00 26.19  ? 152 LYS A CB  1 
ATOM   272  C  CG  . LYS A 1 52  ? 27.746 -19.706 16.429  1.00 35.48  ? 152 LYS A CG  1 
ATOM   273  C  CD  . LYS A 1 52  ? 26.277 -19.335 16.663  1.00 45.26  ? 152 LYS A CD  1 
ATOM   274  C  CE  . LYS A 1 52  ? 26.066 -17.808 16.590  1.00 52.68  ? 152 LYS A CE  1 
ATOM   275  N  NZ  . LYS A 1 52  ? 24.668 -17.390 16.954  1.00 56.82  ? 152 LYS A NZ  1 
ATOM   276  N  N   . LYS A 1 53  ? 29.568 -23.932 17.662  1.00 42.69  ? 153 LYS A N   1 
ATOM   277  C  CA  . LYS A 1 53  ? 29.757 -25.370 17.443  1.00 41.81  ? 153 LYS A CA  1 
ATOM   278  C  C   . LYS A 1 53  ? 28.433 -26.130 17.439  1.00 42.57  ? 153 LYS A C   1 
ATOM   279  O  O   . LYS A 1 53  ? 27.740 -26.176 18.457  1.00 44.77  ? 153 LYS A O   1 
ATOM   280  C  CB  . LYS A 1 53  ? 30.745 -25.965 18.442  1.00 42.55  ? 153 LYS A CB  1 
ATOM   281  C  CG  . LYS A 1 53  ? 32.194 -25.852 17.967  1.00 53.83  ? 153 LYS A CG  1 
ATOM   282  C  CD  . LYS A 1 53  ? 33.210 -26.059 19.088  1.00 61.26  ? 153 LYS A CD  1 
ATOM   283  C  CE  . LYS A 1 53  ? 33.443 -27.533 19.387  1.00 68.61  ? 153 LYS A CE  1 
ATOM   284  N  NZ  . LYS A 1 53  ? 34.740 -27.721 20.105  1.00 72.70  ? 153 LYS A NZ  1 
ATOM   285  N  N   . HIS A 1 54  ? 28.081 -26.714 16.289  1.00 39.25  ? 154 HIS A N   1 
ATOM   286  C  CA  . HIS A 1 54  ? 26.841 -27.483 16.174  1.00 31.78  ? 154 HIS A CA  1 
ATOM   287  C  C   . HIS A 1 54  ? 27.118 -28.990 16.242  1.00 33.53  ? 154 HIS A C   1 
ATOM   288  O  O   . HIS A 1 54  ? 28.160 -29.476 15.753  1.00 34.65  ? 154 HIS A O   1 
ATOM   289  C  CB  . HIS A 1 54  ? 26.091 -27.120 14.890  1.00 34.50  ? 154 HIS A CB  1 
ATOM   290  C  CG  . HIS A 1 54  ? 25.884 -25.646 14.709  1.00 41.76  ? 154 HIS A CG  1 
ATOM   291  N  ND1 . HIS A 1 54  ? 24.796 -24.976 15.224  1.00 48.00  ? 154 HIS A ND1 1 
ATOM   292  C  CD2 . HIS A 1 54  ? 26.624 -24.713 14.063  1.00 45.43  ? 154 HIS A CD2 1 
ATOM   293  C  CE1 . HIS A 1 54  ? 24.877 -23.694 14.911  1.00 45.77  ? 154 HIS A CE1 1 
ATOM   294  N  NE2 . HIS A 1 54  ? 25.975 -23.508 14.204  1.00 45.90  ? 154 HIS A NE2 1 
ATOM   295  N  N   . LYS A 1 55  ? 26.176 -29.711 16.852  1.00 37.53  ? 155 LYS A N   1 
ATOM   296  C  CA  . LYS A 1 55  ? 26.263 -31.157 17.079  1.00 45.01  ? 155 LYS A CA  1 
ATOM   297  C  C   . LYS A 1 55  ? 25.105 -31.898 16.401  1.00 44.35  ? 155 LYS A C   1 
ATOM   298  O  O   . LYS A 1 55  ? 24.034 -32.074 16.986  1.00 43.12  ? 155 LYS A O   1 
ATOM   299  C  CB  . LYS A 1 55  ? 26.206 -31.448 18.579  1.00 53.96  ? 155 LYS A CB  1 
ATOM   300  C  CG  . LYS A 1 55  ? 27.351 -30.873 19.382  1.00 60.74  ? 155 LYS A CG  1 
ATOM   301  C  CD  . LYS A 1 55  ? 28.557 -31.798 19.340  1.00 71.28  ? 155 LYS A CD  1 
ATOM   302  C  CE  . LYS A 1 55  ? 29.776 -31.185 20.037  1.00 82.87  ? 155 LYS A CE  1 
ATOM   303  N  NZ  . LYS A 1 55  ? 29.554 -29.782 20.511  1.00 88.69  ? 155 LYS A NZ  1 
ATOM   304  N  N   . PRO A 1 56  ? 25.341 -32.404 15.218  1.00 46.53  ? 156 PRO A N   1 
ATOM   305  C  CA  . PRO A 1 56  ? 24.292 -33.072 14.500  1.00 45.48  ? 156 PRO A CA  1 
ATOM   306  C  C   . PRO A 1 56  ? 24.028 -34.425 15.049  1.00 43.15  ? 156 PRO A C   1 
ATOM   307  O  O   . PRO A 1 56  ? 24.942 -35.075 15.419  1.00 39.18  ? 156 PRO A O   1 
ATOM   308  C  CB  . PRO A 1 56  ? 24.892 -33.179 13.113  1.00 43.50  ? 156 PRO A CB  1 
ATOM   309  C  CG  . PRO A 1 56  ? 25.899 -32.264 13.077  1.00 40.35  ? 156 PRO A CG  1 
ATOM   310  C  CD  . PRO A 1 56  ? 26.496 -32.246 14.342  1.00 42.70  ? 156 PRO A CD  1 
ATOM   311  N  N   . GLU A 1 57  ? 22.780 -34.837 15.064  1.00 48.47  ? 157 GLU A N   1 
ATOM   312  C  CA  . GLU A 1 57  ? 22.413 -36.160 15.505  1.00 58.43  ? 157 GLU A CA  1 
ATOM   313  C  C   . GLU A 1 57  ? 22.898 -37.227 14.568  1.00 61.80  ? 157 GLU A C   1 
ATOM   314  O  O   . GLU A 1 57  ? 22.315 -37.473 13.575  1.00 63.54  ? 157 GLU A O   1 
ATOM   315  C  CB  . GLU A 1 57  ? 20.909 -36.271 15.657  1.00 68.76  ? 157 GLU A CB  1 
ATOM   316  C  CG  . GLU A 1 57  ? 20.400 -35.735 16.960  1.00 84.63  ? 157 GLU A CG  1 
ATOM   317  C  CD  . GLU A 1 57  ? 18.897 -35.954 17.187  1.00 100.75 ? 157 GLU A CD  1 
ATOM   318  O  OE1 . GLU A 1 57  ? 18.160 -34.958 17.339  1.00 105.26 ? 157 GLU A OE1 1 
ATOM   319  O  OE2 . GLU A 1 57  ? 18.443 -37.113 17.251  1.00 105.61 ? 157 GLU A OE2 1 
ATOM   320  N  N   . ILE A 1 58  ? 23.988 -37.867 14.904  1.00 65.59  ? 158 ILE A N   1 
ATOM   321  C  CA  . ILE A 1 58  ? 24.579 -38.845 14.043  1.00 69.84  ? 158 ILE A CA  1 
ATOM   322  C  C   . ILE A 1 58  ? 24.324 -40.238 14.565  1.00 70.05  ? 158 ILE A C   1 
ATOM   323  O  O   . ILE A 1 58  ? 23.192 -40.664 14.663  1.00 67.33  ? 158 ILE A O   1 
ATOM   324  C  CB  . ILE A 1 58  ? 26.082 -38.622 13.943  1.00 54.94  ? 158 ILE A CB  1 
ATOM   325  N  N   . ASN A 1 65  ? 25.822 -40.156 5.219   1.00 75.82  ? 165 ASN A N   1 
ATOM   326  C  CA  . ASN A 1 65  ? 25.253 -39.152 4.342   1.00 76.97  ? 165 ASN A CA  1 
ATOM   327  C  C   . ASN A 1 65  ? 24.030 -38.426 4.851   1.00 72.38  ? 165 ASN A C   1 
ATOM   328  O  O   . ASN A 1 65  ? 22.943 -38.734 4.442   1.00 77.55  ? 165 ASN A O   1 
ATOM   329  C  CB  . ASN A 1 65  ? 24.883 -39.795 3.040   1.00 83.27  ? 165 ASN A CB  1 
ATOM   330  C  CG  . ASN A 1 65  ? 25.892 -39.556 1.983   1.00 92.67  ? 165 ASN A CG  1 
ATOM   331  O  OD1 . ASN A 1 65  ? 25.771 -38.635 1.193   1.00 92.33  ? 165 ASN A OD1 1 
ATOM   332  N  ND2 . ASN A 1 65  ? 26.903 -40.383 1.951   1.00 97.61  ? 165 ASN A ND2 1 
ATOM   333  N  N   . PHE A 1 66  ? 24.204 -37.425 5.692   1.00 57.92  ? 166 PHE A N   1 
ATOM   334  C  CA  . PHE A 1 66  ? 23.088 -36.655 6.199   1.00 48.49  ? 166 PHE A CA  1 
ATOM   335  C  C   . PHE A 1 66  ? 23.165 -35.189 5.809   1.00 44.42  ? 166 PHE A C   1 
ATOM   336  O  O   . PHE A 1 66  ? 24.198 -34.694 5.482   1.00 46.65  ? 166 PHE A O   1 
ATOM   337  C  CB  . PHE A 1 66  ? 23.024 -36.793 7.729   1.00 43.04  ? 166 PHE A CB  1 
ATOM   338  C  CG  . PHE A 1 66  ? 24.160 -36.168 8.422   1.00 33.96  ? 166 PHE A CG  1 
ATOM   339  C  CD1 . PHE A 1 66  ? 24.098 -34.899 8.829   1.00 30.34  ? 166 PHE A CD1 1 
ATOM   340  C  CD2 . PHE A 1 66  ? 25.300 -36.845 8.611   1.00 37.51  ? 166 PHE A CD2 1 
ATOM   341  C  CE1 . PHE A 1 66  ? 25.113 -34.351 9.387   1.00 37.53  ? 166 PHE A CE1 1 
ATOM   342  C  CE2 . PHE A 1 66  ? 26.312 -36.286 9.182   1.00 35.07  ? 166 PHE A CE2 1 
ATOM   343  C  CZ  . PHE A 1 66  ? 26.230 -35.047 9.576   1.00 37.94  ? 166 PHE A CZ  1 
ATOM   344  N  N   . THR A 1 67  ? 22.056 -34.488 5.881   1.00 36.86  ? 167 THR A N   1 
ATOM   345  C  CA  . THR A 1 67  ? 22.102 -33.028 5.716   1.00 31.34  ? 167 THR A CA  1 
ATOM   346  C  C   . THR A 1 67  ? 21.746 -32.273 7.009   1.00 27.78  ? 167 THR A C   1 
ATOM   347  O  O   . THR A 1 67  ? 20.750 -32.578 7.676   1.00 28.04  ? 167 THR A O   1 
ATOM   348  C  CB  . THR A 1 67  ? 21.152 -32.537 4.600   1.00 32.40  ? 167 THR A CB  1 
ATOM   349  O  OG1 . THR A 1 67  ? 21.584 -33.043 3.331   1.00 37.41  ? 167 THR A OG1 1 
ATOM   350  C  CG2 . THR A 1 67  ? 21.138 -31.015 4.542   1.00 28.26  ? 167 THR A CG2 1 
ATOM   351  N  N   . TYR A 1 68  ? 22.547 -31.268 7.349   1.00 27.78  ? 168 TYR A N   1 
ATOM   352  C  CA  . TYR A 1 68  ? 22.260 -30.454 8.525   1.00 29.10  ? 168 TYR A CA  1 
ATOM   353  C  C   . TYR A 1 68  ? 22.171 -28.995 8.130   1.00 27.98  ? 168 TYR A C   1 
ATOM   354  O  O   . TYR A 1 68  ? 23.041 -28.471 7.423   1.00 32.82  ? 168 TYR A O   1 
ATOM   355  C  CB  . TYR A 1 68  ? 23.317 -30.673 9.599   1.00 33.19  ? 168 TYR A CB  1 
ATOM   356  C  CG  . TYR A 1 68  ? 23.111 -29.884 10.867  1.00 36.52  ? 168 TYR A CG  1 
ATOM   357  C  CD1 . TYR A 1 68  ? 22.551 -30.480 12.004  1.00 40.08  ? 168 TYR A CD1 1 
ATOM   358  C  CD2 . TYR A 1 68  ? 23.497 -28.550 10.946  1.00 31.85  ? 168 TYR A CD2 1 
ATOM   359  C  CE1 . TYR A 1 68  ? 22.371 -29.759 13.185  1.00 36.74  ? 168 TYR A CE1 1 
ATOM   360  C  CE2 . TYR A 1 68  ? 23.321 -27.824 12.113  1.00 37.93  ? 168 TYR A CE2 1 
ATOM   361  C  CZ  . TYR A 1 68  ? 22.761 -28.433 13.236  1.00 39.34  ? 168 TYR A CZ  1 
ATOM   362  O  OH  . TYR A 1 68  ? 22.591 -27.711 14.402  1.00 36.91  ? 168 TYR A OH  1 
ATOM   363  N  N   . ILE A 1 69  ? 21.115 -28.346 8.607   1.00 25.18  ? 169 ILE A N   1 
ATOM   364  C  CA  . ILE A 1 69  ? 20.777 -27.000 8.188   1.00 27.50  ? 169 ILE A CA  1 
ATOM   365  C  C   . ILE A 1 69  ? 20.984 -25.967 9.282   1.00 35.66  ? 169 ILE A C   1 
ATOM   366  O  O   . ILE A 1 69  ? 20.314 -26.000 10.327  1.00 37.01  ? 169 ILE A O   1 
ATOM   367  C  CB  . ILE A 1 69  ? 19.320 -26.948 7.699   1.00 31.06  ? 169 ILE A CB  1 
ATOM   368  C  CG1 . ILE A 1 69  ? 19.154 -27.904 6.493   1.00 40.31  ? 169 ILE A CG1 1 
ATOM   369  C  CG2 . ILE A 1 69  ? 18.922 -25.495 7.362   1.00 25.22  ? 169 ILE A CG2 1 
ATOM   370  C  CD1 . ILE A 1 69  ? 17.839 -27.757 5.721   1.00 43.63  ? 169 ILE A CD1 1 
ATOM   371  N  N   . ILE A 1 70  ? 21.919 -25.051 9.036   1.00 34.40  ? 170 ILE A N   1 
ATOM   372  C  CA  . ILE A 1 70  ? 22.197 -23.958 9.960   1.00 30.10  ? 170 ILE A CA  1 
ATOM   373  C  C   . ILE A 1 70  ? 21.308 -22.793 9.555   1.00 35.80  ? 170 ILE A C   1 
ATOM   374  O  O   . ILE A 1 70  ? 21.404 -22.282 8.427   1.00 43.89  ? 170 ILE A O   1 
ATOM   375  C  CB  . ILE A 1 70  ? 23.668 -23.526 9.873   1.00 29.20  ? 170 ILE A CB  1 
ATOM   376  C  CG1 . ILE A 1 70  ? 24.610 -24.713 10.135  1.00 29.45  ? 170 ILE A CG1 1 
ATOM   377  C  CG2 . ILE A 1 70  ? 23.960 -22.387 10.838  1.00 23.75  ? 170 ILE A CG2 1 
ATOM   378  C  CD1 . ILE A 1 70  ? 26.060 -24.443 9.678   1.00 25.43  ? 170 ILE A CD1 1 
ATOM   379  N  N   . ASP A 1 71  ? 20.450 -22.374 10.478  1.00 37.42  ? 171 ASP A N   1 
ATOM   380  C  CA  . ASP A 1 71  ? 19.370 -21.420 10.201  1.00 41.02  ? 171 ASP A CA  1 
ATOM   381  C  C   . ASP A 1 71  ? 19.531 -20.099 10.979  1.00 37.08  ? 171 ASP A C   1 
ATOM   382  O  O   . ASP A 1 71  ? 20.546 -19.871 11.641  1.00 29.83  ? 171 ASP A O   1 
ATOM   383  C  CB  . ASP A 1 71  ? 18.038 -22.053 10.593  1.00 43.99  ? 171 ASP A CB  1 
ATOM   384  C  CG  . ASP A 1 71  ? 17.967 -22.344 12.097  1.00 47.81  ? 171 ASP A CG  1 
ATOM   385  O  OD1 . ASP A 1 71  ? 19.045 -22.421 12.738  1.00 45.63  ? 171 ASP A OD1 1 
ATOM   386  O  OD2 . ASP A 1 71  ? 16.849 -22.490 12.640  1.00 51.36  ? 171 ASP A OD2 1 
ATOM   387  N  N   . LYS A 1 72  ? 18.512 -19.243 10.901  1.00 42.02  ? 172 LYS A N   1 
ATOM   388  C  CA  . LYS A 1 72  ? 18.526 -17.951 11.596  1.00 46.14  ? 172 LYS A CA  1 
ATOM   389  C  C   . LYS A 1 72  ? 19.796 -17.165 11.266  1.00 41.63  ? 172 LYS A C   1 
ATOM   390  O  O   . LYS A 1 72  ? 20.412 -16.571 12.163  1.00 38.88  ? 172 LYS A O   1 
ATOM   391  C  CB  . LYS A 1 72  ? 18.408 -18.119 13.138  1.00 46.43  ? 172 LYS A CB  1 
ATOM   392  C  CG  . LYS A 1 72  ? 17.344 -19.119 13.615  1.00 49.13  ? 172 LYS A CG  1 
ATOM   393  C  CD  . LYS A 1 72  ? 16.191 -18.440 14.371  1.00 54.60  ? 172 LYS A CD  1 
ATOM   394  C  CE  . LYS A 1 72  ? 15.100 -19.440 14.815  1.00 56.89  ? 172 LYS A CE  1 
ATOM   395  N  NZ  . LYS A 1 72  ? 15.602 -20.510 15.730  1.00 58.19  ? 172 LYS A NZ  1 
ATOM   396  N  N   . LEU A 1 73  ? 20.196 -17.159 9.996   1.00 38.09  ? 173 LEU A N   1 
ATOM   397  C  CA  . LEU A 1 73  ? 21.394 -16.412 9.620   1.00 35.84  ? 173 LEU A CA  1 
ATOM   398  C  C   . LEU A 1 73  ? 21.072 -15.059 8.963   1.00 38.78  ? 173 LEU A C   1 
ATOM   399  O  O   . LEU A 1 73  ? 19.913 -14.784 8.618   1.00 39.70  ? 173 LEU A O   1 
ATOM   400  C  CB  . LEU A 1 73  ? 22.301 -17.251 8.728   1.00 32.34  ? 173 LEU A CB  1 
ATOM   401  C  CG  . LEU A 1 73  ? 22.694 -18.645 9.204   1.00 30.38  ? 173 LEU A CG  1 
ATOM   402  C  CD1 . LEU A 1 73  ? 23.671 -19.298 8.180   1.00 27.87  ? 173 LEU A CD1 1 
ATOM   403  C  CD2 . LEU A 1 73  ? 23.324 -18.577 10.599  1.00 22.46  ? 173 LEU A CD2 1 
ATOM   404  N  N   . ILE A 1 74  ? 22.103 -14.226 8.800   1.00 38.71  ? 174 ILE A N   1 
ATOM   405  C  CA  . ILE A 1 74  ? 21.952 -12.881 8.246   1.00 41.82  ? 174 ILE A CA  1 
ATOM   406  C  C   . ILE A 1 74  ? 22.296 -12.856 6.770   1.00 46.21  ? 174 ILE A C   1 
ATOM   407  O  O   . ILE A 1 74  ? 23.430 -13.188 6.394   1.00 48.38  ? 174 ILE A O   1 
ATOM   408  C  CB  . ILE A 1 74  ? 22.923 -11.883 8.896   1.00 41.13  ? 174 ILE A CB  1 
ATOM   409  C  CG1 . ILE A 1 74  ? 23.075 -12.147 10.399  1.00 42.18  ? 174 ILE A CG1 1 
ATOM   410  C  CG2 . ILE A 1 74  ? 22.514 -10.447 8.569   1.00 33.27  ? 174 ILE A CG2 1 
ATOM   411  C  CD1 . ILE A 1 74  ? 21.816 -11.965 11.160  1.00 42.32  ? 174 ILE A CD1 1 
ATOM   412  N  N   . PRO A 1 75  ? 21.363 -12.381 5.975   1.00 41.65  ? 175 PRO A N   1 
ATOM   413  C  CA  . PRO A 1 75  ? 21.558 -12.142 4.574   1.00 38.22  ? 175 PRO A CA  1 
ATOM   414  C  C   . PRO A 1 75  ? 22.654 -11.185 4.284   1.00 37.24  ? 175 PRO A C   1 
ATOM   415  O  O   . PRO A 1 75  ? 22.764 -10.184 4.887   1.00 36.13  ? 175 PRO A O   1 
ATOM   416  C  CB  . PRO A 1 75  ? 20.256 -11.498 4.199   1.00 38.39  ? 175 PRO A CB  1 
ATOM   417  C  CG  . PRO A 1 75  ? 19.361 -12.059 5.021   1.00 39.89  ? 175 PRO A CG  1 
ATOM   418  C  CD  . PRO A 1 75  ? 19.966 -12.195 6.312   1.00 37.28  ? 175 PRO A CD  1 
ATOM   419  N  N   . ASN A 1 76  ? 23.448 -11.517 3.305   1.00 39.64  ? 176 ASN A N   1 
ATOM   420  C  CA  . ASN A 1 76  ? 24.494 -10.675 2.844   1.00 42.86  ? 176 ASN A CA  1 
ATOM   421  C  C   . ASN A 1 76  ? 25.613 -10.643 3.783   1.00 43.47  ? 176 ASN A C   1 
ATOM   422  O  O   . ASN A 1 76  ? 26.241 -9.657  3.935   1.00 44.36  ? 176 ASN A O   1 
ATOM   423  C  CB  . ASN A 1 76  ? 24.006 -9.285  2.614   1.00 50.20  ? 176 ASN A CB  1 
ATOM   424  C  CG  . ASN A 1 76  ? 24.756 -8.604  1.549   1.00 61.14  ? 176 ASN A CG  1 
ATOM   425  O  OD1 . ASN A 1 76  ? 25.280 -9.231  0.661   1.00 67.43  ? 176 ASN A OD1 1 
ATOM   426  N  ND2 . ASN A 1 76  ? 24.822 -7.316  1.623   1.00 60.15  ? 176 ASN A ND2 1 
ATOM   427  N  N   . THR A 1 77  ? 25.869 -11.776 4.386   1.00 43.82  ? 177 THR A N   1 
ATOM   428  C  CA  . THR A 1 77  ? 26.882 -11.933 5.375   1.00 36.01  ? 177 THR A CA  1 
ATOM   429  C  C   . THR A 1 77  ? 27.708 -13.092 4.958   1.00 32.91  ? 177 THR A C   1 
ATOM   430  O  O   . THR A 1 77  ? 27.224 -14.002 4.389   1.00 32.25  ? 177 THR A O   1 
ATOM   431  C  CB  . THR A 1 77  ? 26.234 -12.268 6.706   1.00 37.76  ? 177 THR A CB  1 
ATOM   432  O  OG1 . THR A 1 77  ? 25.361 -11.230 7.068   1.00 45.74  ? 177 THR A OG1 1 
ATOM   433  C  CG2 . THR A 1 77  ? 27.215 -12.406 7.749   1.00 31.52  ? 177 THR A CG2 1 
ATOM   434  N  N   . ASN A 1 78  ? 28.968 -13.049 5.291   1.00 29.65  ? 178 ASN A N   1 
ATOM   435  C  CA  . ASN A 1 78  ? 29.848 -14.193 5.076   1.00 30.22  ? 178 ASN A CA  1 
ATOM   436  C  C   . ASN A 1 78  ? 29.866 -15.146 6.274   1.00 32.92  ? 178 ASN A C   1 
ATOM   437  O  O   . ASN A 1 78  ? 29.916 -14.716 7.431   1.00 33.80  ? 178 ASN A O   1 
ATOM   438  C  CB  . ASN A 1 78  ? 31.265 -13.747 4.730   1.00 34.37  ? 178 ASN A CB  1 
ATOM   439  C  CG  . ASN A 1 78  ? 31.345 -13.067 3.364   1.00 48.95  ? 178 ASN A CG  1 
ATOM   440  O  OD1 . ASN A 1 78  ? 31.458 -13.733 2.320   1.00 62.09  ? 178 ASN A OD1 1 
ATOM   441  N  ND2 . ASN A 1 78  ? 31.281 -11.733 3.361   1.00 41.15  ? 178 ASN A ND2 1 
ATOM   442  N  N   . TYR A 1 79  ? 29.797 -16.442 5.975   1.00 30.71  ? 179 TYR A N   1 
ATOM   443  C  CA  . TYR A 1 79  ? 29.913 -17.492 6.973   1.00 30.19  ? 179 TYR A CA  1 
ATOM   444  C  C   . TYR A 1 79  ? 30.923 -18.532 6.484   1.00 32.34  ? 179 TYR A C   1 
ATOM   445  O  O   . TYR A 1 79  ? 31.065 -18.740 5.278   1.00 35.43  ? 179 TYR A O   1 
ATOM   446  C  CB  . TYR A 1 79  ? 28.556 -18.155 7.214   1.00 29.69  ? 179 TYR A CB  1 
ATOM   447  C  CG  . TYR A 1 79  ? 27.527 -17.246 7.842   1.00 39.92  ? 179 TYR A CG  1 
ATOM   448  C  CD1 . TYR A 1 79  ? 27.419 -17.141 9.231   1.00 42.65  ? 179 TYR A CD1 1 
ATOM   449  C  CD2 . TYR A 1 79  ? 26.654 -16.494 7.053   1.00 43.20  ? 179 TYR A CD2 1 
ATOM   450  C  CE1 . TYR A 1 79  ? 26.465 -16.313 9.822   1.00 43.74  ? 179 TYR A CE1 1 
ATOM   451  C  CE2 . TYR A 1 79  ? 25.692 -15.657 7.637   1.00 43.96  ? 179 TYR A CE2 1 
ATOM   452  C  CZ  . TYR A 1 79  ? 25.606 -15.572 9.020   1.00 45.12  ? 179 TYR A CZ  1 
ATOM   453  O  OH  . TYR A 1 79  ? 24.667 -14.756 9.613   1.00 45.96  ? 179 TYR A OH  1 
ATOM   454  N  N   . CYS A 1 80  ? 31.639 -19.176 7.404   1.00 31.78  ? 180 CYS A N   1 
ATOM   455  C  CA  . CYS A 1 80  ? 32.556 -20.249 7.015   1.00 30.38  ? 180 CYS A CA  1 
ATOM   456  C  C   . CYS A 1 80  ? 32.196 -21.522 7.766   1.00 31.67  ? 180 CYS A C   1 
ATOM   457  O  O   . CYS A 1 80  ? 31.713 -21.469 8.890   1.00 32.20  ? 180 CYS A O   1 
ATOM   458  C  CB  . CYS A 1 80  ? 34.019 -19.857 7.254   1.00 20.06  ? 180 CYS A CB  1 
ATOM   459  S  SG  . CYS A 1 80  ? 34.671 -18.668 6.069   1.00 47.93  ? 180 CYS A SG  1 
ATOM   460  N  N   . VAL A 1 81  ? 32.408 -22.668 7.137   1.00 30.12  ? 181 VAL A N   1 
ATOM   461  C  CA  . VAL A 1 81  ? 32.043 -23.916 7.774   1.00 23.38  ? 181 VAL A CA  1 
ATOM   462  C  C   . VAL A 1 81  ? 33.190 -24.904 7.752   1.00 28.53  ? 181 VAL A C   1 
ATOM   463  O  O   . VAL A 1 81  ? 33.955 -24.983 6.783   1.00 34.06  ? 181 VAL A O   1 
ATOM   464  C  CB  . VAL A 1 81  ? 30.774 -24.532 7.167   1.00 21.78  ? 181 VAL A CB  1 
ATOM   465  C  CG1 . VAL A 1 81  ? 30.461 -25.878 7.820   1.00 24.35  ? 181 VAL A CG1 1 
ATOM   466  C  CG2 . VAL A 1 81  ? 29.616 -23.574 7.365   1.00 23.92  ? 181 VAL A CG2 1 
ATOM   467  N  N   . SER A 1 82  ? 33.299 -25.628 8.863   1.00 32.56  ? 182 SER A N   1 
ATOM   468  C  CA  . SER A 1 82  ? 34.328 -26.630 9.068   1.00 34.18  ? 182 SER A CA  1 
ATOM   469  C  C   . SER A 1 82  ? 33.677 -27.849 9.702   1.00 32.79  ? 182 SER A C   1 
ATOM   470  O  O   . SER A 1 82  ? 32.788 -27.719 10.548  1.00 31.01  ? 182 SER A O   1 
ATOM   471  C  CB  . SER A 1 82  ? 35.417 -26.095 10.004  1.00 35.30  ? 182 SER A CB  1 
ATOM   472  O  OG  . SER A 1 82  ? 36.467 -27.040 10.106  1.00 35.26  ? 182 SER A OG  1 
ATOM   473  N  N   . VAL A 1 83  ? 34.112 -29.032 9.289   1.00 34.80  ? 183 VAL A N   1 
ATOM   474  C  CA  . VAL A 1 83  ? 33.501 -30.265 9.765   1.00 41.37  ? 183 VAL A CA  1 
ATOM   475  C  C   . VAL A 1 83  ? 34.621 -31.182 10.210  1.00 47.08  ? 183 VAL A C   1 
ATOM   476  O  O   . VAL A 1 83  ? 35.663 -31.278 9.545   1.00 52.50  ? 183 VAL A O   1 
ATOM   477  C  CB  . VAL A 1 83  ? 32.643 -30.960 8.677   1.00 27.34  ? 183 VAL A CB  1 
ATOM   478  C  CG1 . VAL A 1 83  ? 31.946 -32.193 9.259   1.00 29.44  ? 183 VAL A CG1 1 
ATOM   479  C  CG2 . VAL A 1 83  ? 31.615 -29.987 8.096   1.00 23.70  ? 183 VAL A CG2 1 
ATOM   480  N  N   . TYR A 1 84  ? 34.423 -31.843 11.341  1.00 43.70  ? 184 TYR A N   1 
ATOM   481  C  CA  . TYR A 1 84  ? 35.510 -32.631 11.906  1.00 50.44  ? 184 TYR A CA  1 
ATOM   482  C  C   . TYR A 1 84  ? 35.078 -33.527 13.063  1.00 50.80  ? 184 TYR A C   1 
ATOM   483  O  O   . TYR A 1 84  ? 34.083 -33.248 13.747  1.00 46.65  ? 184 TYR A O   1 
ATOM   484  C  CB  . TYR A 1 84  ? 36.675 -31.724 12.332  1.00 51.38  ? 184 TYR A CB  1 
ATOM   485  C  CG  . TYR A 1 84  ? 36.337 -30.701 13.398  1.00 54.49  ? 184 TYR A CG  1 
ATOM   486  C  CD1 . TYR A 1 84  ? 36.174 -29.355 13.072  1.00 54.53  ? 184 TYR A CD1 1 
ATOM   487  C  CD2 . TYR A 1 84  ? 36.209 -31.075 14.737  1.00 54.59  ? 184 TYR A CD2 1 
ATOM   488  C  CE1 . TYR A 1 84  ? 35.886 -28.408 14.050  1.00 56.13  ? 184 TYR A CE1 1 
ATOM   489  C  CE2 . TYR A 1 84  ? 35.917 -30.134 15.722  1.00 55.07  ? 184 TYR A CE2 1 
ATOM   490  C  CZ  . TYR A 1 84  ? 35.756 -28.803 15.374  1.00 55.95  ? 184 TYR A CZ  1 
ATOM   491  O  OH  . TYR A 1 84  ? 35.464 -27.868 16.348  1.00 53.67  ? 184 TYR A OH  1 
ATOM   492  N  N   . LEU A 1 85  ? 35.826 -34.611 13.258  1.00 53.06  ? 185 LEU A N   1 
ATOM   493  C  CA  . LEU A 1 85  ? 35.597 -35.503 14.392  1.00 55.56  ? 185 LEU A CA  1 
ATOM   494  C  C   . LEU A 1 85  ? 36.367 -35.017 15.626  1.00 57.15  ? 185 LEU A C   1 
ATOM   495  O  O   . LEU A 1 85  ? 37.494 -34.500 15.498  1.00 48.45  ? 185 LEU A O   1 
ATOM   496  C  CB  . LEU A 1 85  ? 35.982 -36.935 14.023  1.00 54.64  ? 185 LEU A CB  1 
ATOM   497  C  CG  . LEU A 1 85  ? 35.205 -37.514 12.827  1.00 54.17  ? 185 LEU A CG  1 
ATOM   498  C  CD1 . LEU A 1 85  ? 35.685 -38.921 12.485  1.00 55.09  ? 185 LEU A CD1 1 
ATOM   499  C  CD2 . LEU A 1 85  ? 33.700 -37.508 13.090  1.00 52.57  ? 185 LEU A CD2 1 
ATOM   500  N  N   . GLU A 1 86  ? 35.746 -35.158 16.806  1.00 67.62  ? 186 GLU A N   1 
ATOM   501  C  CA  . GLU A 1 86  ? 36.342 -34.720 18.072  1.00 73.20  ? 186 GLU A CA  1 
ATOM   502  C  C   . GLU A 1 86  ? 36.680 -35.941 18.936  1.00 78.57  ? 186 GLU A C   1 
ATOM   503  O  O   . GLU A 1 86  ? 35.963 -36.947 18.903  1.00 77.90  ? 186 GLU A O   1 
ATOM   504  C  CB  . GLU A 1 86  ? 35.416 -33.731 18.800  1.00 77.09  ? 186 GLU A CB  1 
ATOM   505  C  CG  . GLU A 1 86  ? 36.160 -32.575 19.515  1.00 80.60  ? 186 GLU A CG  1 
ATOM   506  C  CD  . GLU A 1 86  ? 35.293 -31.334 19.782  1.00 79.23  ? 186 GLU A CD  1 
ATOM   507  O  OE1 . GLU A 1 86  ? 34.118 -31.477 20.208  1.00 76.45  ? 186 GLU A OE1 1 
ATOM   508  O  OE2 . GLU A 1 86  ? 35.807 -30.208 19.572  1.00 77.24  ? 186 GLU A OE2 1 
ATOM   509  N  N   . HIS A 1 87  ? 37.773 -35.845 19.699  1.00 85.45  ? 187 HIS A N   1 
ATOM   510  C  CA  . HIS A 1 87  ? 38.372 -37.000 20.387  1.00 88.46  ? 187 HIS A CA  1 
ATOM   511  C  C   . HIS A 1 87  ? 38.464 -36.833 21.918  1.00 91.81  ? 187 HIS A C   1 
ATOM   512  O  O   . HIS A 1 87  ? 38.904 -37.742 22.644  1.00 92.10  ? 187 HIS A O   1 
ATOM   513  C  CB  . HIS A 1 87  ? 39.754 -37.315 19.787  1.00 84.22  ? 187 HIS A CB  1 
ATOM   514  N  N   . VAL A 1 93  ? 42.607 -33.477 16.959  1.00 62.51  ? 193 VAL A N   1 
ATOM   515  C  CA  . VAL A 1 93  ? 41.518 -32.805 16.240  1.00 68.73  ? 193 VAL A CA  1 
ATOM   516  C  C   . VAL A 1 93  ? 41.996 -32.112 14.952  1.00 67.76  ? 193 VAL A C   1 
ATOM   517  O  O   . VAL A 1 93  ? 42.769 -31.151 15.002  1.00 71.43  ? 193 VAL A O   1 
ATOM   518  C  CB  . VAL A 1 93  ? 40.741 -31.801 17.157  1.00 65.09  ? 193 VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 93  ? 40.057 -30.710 16.338  1.00 61.86  ? 193 VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 93  ? 39.718 -32.542 18.003  1.00 67.26  ? 193 VAL A CG2 1 
ATOM   521  N  N   . ILE A 1 94  ? 41.547 -32.605 13.801  1.00 60.54  ? 194 ILE A N   1 
ATOM   522  C  CA  . ILE A 1 94  ? 41.881 -31.933 12.553  1.00 64.01  ? 194 ILE A CA  1 
ATOM   523  C  C   . ILE A 1 94  ? 40.679 -31.172 12.018  1.00 61.11  ? 194 ILE A C   1 
ATOM   524  O  O   . ILE A 1 94  ? 39.752 -31.767 11.460  1.00 60.86  ? 194 ILE A O   1 
ATOM   525  C  CB  . ILE A 1 94  ? 42.386 -32.912 11.470  1.00 68.54  ? 194 ILE A CB  1 
ATOM   526  C  CG1 . ILE A 1 94  ? 43.572 -33.721 11.997  1.00 71.19  ? 194 ILE A CG1 1 
ATOM   527  C  CG2 . ILE A 1 94  ? 42.770 -32.162 10.188  1.00 65.91  ? 194 ILE A CG2 1 
ATOM   528  C  CD1 . ILE A 1 94  ? 43.185 -35.103 12.492  1.00 72.23  ? 194 ILE A CD1 1 
ATOM   529  N  N   . LYS A 1 95  ? 40.691 -29.856 12.191  1.00 58.86  ? 195 LYS A N   1 
ATOM   530  C  CA  . LYS A 1 95  ? 39.630 -29.043 11.626  1.00 60.47  ? 195 LYS A CA  1 
ATOM   531  C  C   . LYS A 1 95  ? 39.762 -29.062 10.115  1.00 61.62  ? 195 LYS A C   1 
ATOM   532  O  O   . LYS A 1 95  ? 40.855 -28.854 9.575   1.00 67.20  ? 195 LYS A O   1 
ATOM   533  C  CB  . LYS A 1 95  ? 39.689 -27.611 12.148  1.00 63.38  ? 195 LYS A CB  1 
ATOM   534  C  CG  . LYS A 1 95  ? 39.399 -27.465 13.637  1.00 67.90  ? 195 LYS A CG  1 
ATOM   535  C  CD  . LYS A 1 95  ? 39.062 -26.018 13.950  1.00 72.49  ? 195 LYS A CD  1 
ATOM   536  C  CE  . LYS A 1 95  ? 38.916 -25.778 15.441  1.00 77.91  ? 195 LYS A CE  1 
ATOM   537  N  NZ  . LYS A 1 95  ? 40.233 -25.546 16.112  1.00 80.94  ? 195 LYS A NZ  1 
ATOM   538  N  N   . SER A 1 96  ? 38.657 -29.333 9.429   1.00 57.99  ? 196 SER A N   1 
ATOM   539  C  CA  . SER A 1 96  ? 38.671 -29.377 7.969   1.00 49.24  ? 196 SER A CA  1 
ATOM   540  C  C   . SER A 1 96  ? 39.105 -28.021 7.420   1.00 46.16  ? 196 SER A C   1 
ATOM   541  O  O   . SER A 1 96  ? 39.137 -27.023 8.150   1.00 45.71  ? 196 SER A O   1 
ATOM   542  C  CB  . SER A 1 96  ? 37.285 -29.732 7.432   1.00 42.24  ? 196 SER A CB  1 
ATOM   543  O  OG  . SER A 1 96  ? 36.443 -28.590 7.394   1.00 41.73  ? 196 SER A OG  1 
ATOM   544  N  N   . PRO A 1 97  ? 39.487 -27.983 6.142   1.00 43.32  ? 197 PRO A N   1 
ATOM   545  C  CA  . PRO A 1 97  ? 39.629 -26.643 5.565   1.00 40.59  ? 197 PRO A CA  1 
ATOM   546  C  C   . PRO A 1 97  ? 38.253 -25.976 5.559   1.00 34.40  ? 197 PRO A C   1 
ATOM   547  O  O   . PRO A 1 97  ? 37.243 -26.650 5.360   1.00 33.09  ? 197 PRO A O   1 
ATOM   548  C  CB  . PRO A 1 97  ? 40.119 -26.929 4.134   1.00 39.33  ? 197 PRO A CB  1 
ATOM   549  C  CG  . PRO A 1 97  ? 40.807 -28.262 4.246   1.00 40.03  ? 197 PRO A CG  1 
ATOM   550  C  CD  . PRO A 1 97  ? 39.942 -29.039 5.223   1.00 40.81  ? 197 PRO A CD  1 
ATOM   551  N  N   . LEU A 1 98  ? 38.196 -24.698 5.748   1.00 33.96  ? 198 LEU A N   1 
ATOM   552  C  CA  . LEU A 1 98  ? 36.933 -24.035 5.742   1.00 33.36  ? 198 LEU A CA  1 
ATOM   553  C  C   . LEU A 1 98  ? 36.317 -23.904 4.380   1.00 37.96  ? 198 LEU A C   1 
ATOM   554  O  O   . LEU A 1 98  ? 36.974 -23.629 3.430   1.00 35.34  ? 198 LEU A O   1 
ATOM   555  C  CB  . LEU A 1 98  ? 37.094 -22.655 6.317   1.00 32.27  ? 198 LEU A CB  1 
ATOM   556  C  CG  . LEU A 1 98  ? 37.618 -22.588 7.729   1.00 38.58  ? 198 LEU A CG  1 
ATOM   557  C  CD1 . LEU A 1 98  ? 38.021 -21.224 7.974   1.00 32.98  ? 198 LEU A CD1 1 
ATOM   558  C  CD2 . LEU A 1 98  ? 36.593 -22.991 8.669   1.00 35.63  ? 198 LEU A CD2 1 
ATOM   559  N  N   . LYS A 1 99  ? 35.022 -24.098 4.320   1.00 33.44  ? 199 LYS A N   1 
ATOM   560  C  CA  . LYS A 1 99  ? 34.276 -23.767 3.110   1.00 28.56  ? 199 LYS A CA  1 
ATOM   561  C  C   . LYS A 1 99  ? 33.439 -22.532 3.431   1.00 27.66  ? 199 LYS A C   1 
ATOM   562  O  O   . LYS A 1 99  ? 32.744 -22.476 4.452   1.00 29.74  ? 199 LYS A O   1 
ATOM   563  C  CB  . LYS A 1 99  ? 33.388 -24.937 2.663   1.00 30.66  ? 199 LYS A CB  1 
ATOM   564  C  CG  . LYS A 1 99  ? 34.141 -26.101 2.004   1.00 30.03  ? 199 LYS A CG  1 
ATOM   565  C  CD  . LYS A 1 99  ? 33.182 -27.165 1.483   1.00 31.55  ? 199 LYS A CD  1 
ATOM   566  C  CE  . LYS A 1 99  ? 33.894 -28.191 0.608   1.00 32.52  ? 199 LYS A CE  1 
ATOM   567  N  NZ  . LYS A 1 99  ? 34.631 -29.185 1.423   1.00 37.83  ? 199 LYS A NZ  1 
ATOM   568  N  N   . CYS A 1 100 ? 33.516 -21.515 2.588   1.00 24.63  ? 200 CYS A N   1 
ATOM   569  C  CA  . CYS A 1 100 ? 32.812 -20.281 2.910   1.00 27.16  ? 200 CYS A CA  1 
ATOM   570  C  C   . CYS A 1 100 ? 31.853 -19.889 1.789   1.00 35.72  ? 200 CYS A C   1 
ATOM   571  O  O   . CYS A 1 100 ? 32.078 -20.232 0.612   1.00 33.84  ? 200 CYS A O   1 
ATOM   572  C  CB  . CYS A 1 100 ? 33.815 -19.154 3.157   1.00 20.78  ? 200 CYS A CB  1 
ATOM   573  S  SG  . CYS A 1 100 ? 35.163 -19.611 4.276   1.00 43.09  ? 200 CYS A SG  1 
ATOM   574  N  N   . THR A 1 101 ? 30.795 -19.165 2.153   1.00 35.64  ? 201 THR A N   1 
ATOM   575  C  CA  . THR A 1 101 ? 29.842 -18.669 1.163   1.00 34.85  ? 201 THR A CA  1 
ATOM   576  C  C   . THR A 1 101 ? 29.226 -17.334 1.579   1.00 37.63  ? 201 THR A C   1 
ATOM   577  O  O   . THR A 1 101 ? 29.235 -16.976 2.775   1.00 34.42  ? 201 THR A O   1 
ATOM   578  C  CB  . THR A 1 101 ? 28.734 -19.704 0.872   1.00 34.51  ? 201 THR A CB  1 
ATOM   579  O  OG1 . THR A 1 101 ? 27.912 -19.228 -0.192  1.00 42.62  ? 201 THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 101 ? 27.864 -19.936 2.093   1.00 32.42  ? 201 THR A CG2 1 
ATOM   581  N  N   . LEU A 1 102 ? 28.708 -16.593 0.595   1.00 35.00  ? 202 LEU A N   1 
ATOM   582  C  CA  . LEU A 1 102 ? 28.054 -15.310 0.875   1.00 33.09  ? 202 LEU A CA  1 
ATOM   583  C  C   . LEU A 1 102 ? 26.550 -15.465 0.697   1.00 35.37  ? 202 LEU A C   1 
ATOM   584  O  O   . LEU A 1 102 ? 26.065 -15.824 -0.389  1.00 39.76  ? 202 LEU A O   1 
ATOM   585  C  CB  . LEU A 1 102 ? 28.620 -14.195 -0.008  1.00 32.27  ? 202 LEU A CB  1 
ATOM   586  C  CG  . LEU A 1 102 ? 27.896 -12.843 -0.096  1.00 37.76  ? 202 LEU A CG  1 
ATOM   587  C  CD1 . LEU A 1 102 ? 27.491 -12.322 1.300   1.00 36.50  ? 202 LEU A CD1 1 
ATOM   588  C  CD2 . LEU A 1 102 ? 28.748 -11.802 -0.870  1.00 16.83  ? 202 LEU A CD2 1 
ATOM   589  N  N   . LEU A 1 103 ? 25.813 -15.250 1.781   1.00 34.60  ? 203 LEU A N   1 
ATOM   590  C  CA  . LEU A 1 103 ? 24.375 -15.423 1.722   1.00 36.59  ? 203 LEU A CA  1 
ATOM   591  C  C   . LEU A 1 103 ? 23.807 -14.355 0.791   1.00 41.90  ? 203 LEU A C   1 
ATOM   592  O  O   . LEU A 1 103 ? 24.255 -13.193 0.816   1.00 44.18  ? 203 LEU A O   1 
ATOM   593  C  CB  . LEU A 1 103 ? 23.753 -15.317 3.122   1.00 32.96  ? 203 LEU A CB  1 
ATOM   594  C  CG  . LEU A 1 103 ? 24.240 -16.300 4.192   1.00 29.64  ? 203 LEU A CG  1 
ATOM   595  C  CD1 . LEU A 1 103 ? 23.207 -16.457 5.310   1.00 31.50  ? 203 LEU A CD1 1 
ATOM   596  C  CD2 . LEU A 1 103 ? 24.528 -17.648 3.585   1.00 29.61  ? 203 LEU A CD2 1 
ATOM   597  N  N   . PRO A 1 104 ? 22.833 -14.747 -0.045  1.00 40.40  ? 204 PRO A N   1 
ATOM   598  C  CA  . PRO A 1 104 ? 22.155 -13.810 -0.956  1.00 42.46  ? 204 PRO A CA  1 
ATOM   599  C  C   . PRO A 1 104 ? 21.302 -12.828 -0.151  1.00 47.96  ? 204 PRO A C   1 
ATOM   600  O  O   . PRO A 1 104 ? 21.027 -13.101 1.031   1.00 44.58  ? 204 PRO A O   1 
ATOM   601  C  CB  . PRO A 1 104 ? 21.228 -14.717 -1.784  1.00 35.16  ? 204 PRO A CB  1 
ATOM   602  C  CG  . PRO A 1 104 ? 21.667 -16.130 -1.488  1.00 34.82  ? 204 PRO A CG  1 
ATOM   603  C  CD  . PRO A 1 104 ? 22.271 -16.107 -0.119  1.00 36.86  ? 204 PRO A CD  1 
ATOM   604  N  N   . PRO A 1 105 ? 20.875 -11.712 -0.779  1.00 50.15  ? 205 PRO A N   1 
ATOM   605  C  CA  . PRO A 1 105 ? 20.016 -10.715 -0.116  1.00 53.24  ? 205 PRO A CA  1 
ATOM   606  C  C   . PRO A 1 105 ? 18.569 -11.194 0.054   1.00 58.79  ? 205 PRO A C   1 
ATOM   607  O  O   . PRO A 1 105 ? 17.874 -10.731 0.977   1.00 54.60  ? 205 PRO A O   1 
ATOM   608  C  CB  . PRO A 1 105 ? 20.053 -9.516  -1.074  1.00 50.57  ? 205 PRO A CB  1 
ATOM   609  C  CG  . PRO A 1 105 ? 21.211 -9.776  -1.987  1.00 48.03  ? 205 PRO A CG  1 
ATOM   610  C  CD  . PRO A 1 105 ? 21.289 -11.262 -2.116  1.00 46.86  ? 205 PRO A CD  1 
ATOM   611  O  OXT . PRO A 1 105 ? 18.075 -12.049 -0.715  1.00 61.82  ? 205 PRO A OXT 1 
ATOM   612  N  N   . PHE B 1 7   ? 54.217 -16.726 1.942   1.00 69.43  ? 107 PHE B N   1 
ATOM   613  C  CA  . PHE B 1 7   ? 53.301 -15.619 1.650   1.00 75.61  ? 107 PHE B CA  1 
ATOM   614  C  C   . PHE B 1 7   ? 51.835 -15.885 1.988   1.00 80.21  ? 107 PHE B C   1 
ATOM   615  O  O   . PHE B 1 7   ? 51.254 -16.886 1.556   1.00 80.61  ? 107 PHE B O   1 
ATOM   616  C  CB  . PHE B 1 7   ? 53.410 -15.198 0.189   1.00 77.74  ? 107 PHE B CB  1 
ATOM   617  C  CG  . PHE B 1 7   ? 54.240 -13.978 -0.010  1.00 85.76  ? 107 PHE B CG  1 
ATOM   618  C  CD1 . PHE B 1 7   ? 53.690 -12.716 0.180   1.00 90.29  ? 107 PHE B CD1 1 
ATOM   619  C  CD2 . PHE B 1 7   ? 55.579 -14.081 -0.351  1.00 91.06  ? 107 PHE B CD2 1 
ATOM   620  C  CE1 . PHE B 1 7   ? 54.457 -11.569 0.014   1.00 91.94  ? 107 PHE B CE1 1 
ATOM   621  C  CE2 . PHE B 1 7   ? 56.354 -12.943 -0.519  1.00 94.19  ? 107 PHE B CE2 1 
ATOM   622  C  CZ  . PHE B 1 7   ? 55.791 -11.684 -0.337  1.00 94.02  ? 107 PHE B CZ  1 
ATOM   623  N  N   . GLU B 1 8   ? 51.250 -14.964 2.753   1.00 83.30  ? 108 GLU B N   1 
ATOM   624  C  CA  . GLU B 1 8   ? 49.839 -15.023 3.133   1.00 83.17  ? 108 GLU B CA  1 
ATOM   625  C  C   . GLU B 1 8   ? 48.963 -14.835 1.886   1.00 76.79  ? 108 GLU B C   1 
ATOM   626  O  O   . GLU B 1 8   ? 49.337 -14.082 0.973   1.00 73.61  ? 108 GLU B O   1 
ATOM   627  C  CB  . GLU B 1 8   ? 49.540 -13.938 4.177   1.00 87.08  ? 108 GLU B CB  1 
ATOM   628  C  CG  . GLU B 1 8   ? 48.536 -14.334 5.254   1.00 89.79  ? 108 GLU B CG  1 
ATOM   629  C  CD  . GLU B 1 8   ? 48.982 -15.533 6.078   1.00 90.96  ? 108 GLU B CD  1 
ATOM   630  O  OE1 . GLU B 1 8   ? 50.198 -15.663 6.356   1.00 93.51  ? 108 GLU B OE1 1 
ATOM   631  O  OE2 . GLU B 1 8   ? 48.106 -16.348 6.449   1.00 87.94  ? 108 GLU B OE2 1 
ATOM   632  N  N   . PRO B 1 9   ? 47.811 -15.540 1.828   1.00 70.44  ? 109 PRO B N   1 
ATOM   633  C  CA  . PRO B 1 9   ? 46.896 -15.462 0.676   1.00 63.62  ? 109 PRO B CA  1 
ATOM   634  C  C   . PRO B 1 9   ? 46.229 -14.092 0.554   1.00 59.96  ? 109 PRO B C   1 
ATOM   635  O  O   . PRO B 1 9   ? 45.938 -13.446 1.573   1.00 63.86  ? 109 PRO B O   1 
ATOM   636  C  CB  . PRO B 1 9   ? 45.823 -16.521 0.987   1.00 61.97  ? 109 PRO B CB  1 
ATOM   637  C  CG  . PRO B 1 9   ? 46.388 -17.370 2.068   1.00 63.64  ? 109 PRO B CG  1 
ATOM   638  C  CD  . PRO B 1 9   ? 47.337 -16.497 2.843   1.00 67.65  ? 109 PRO B CD  1 
ATOM   639  N  N   . PRO B 1 10  ? 45.988 -13.648 -0.688  1.00 53.69  ? 110 PRO B N   1 
ATOM   640  C  CA  . PRO B 1 10  ? 45.304 -12.378 -0.963  1.00 50.51  ? 110 PRO B CA  1 
ATOM   641  C  C   . PRO B 1 10  ? 43.801 -12.452 -0.686  1.00 50.91  ? 110 PRO B C   1 
ATOM   642  O  O   . PRO B 1 10  ? 43.275 -13.538 -0.399  1.00 49.39  ? 110 PRO B O   1 
ATOM   643  C  CB  . PRO B 1 10  ? 45.538 -12.174 -2.462  1.00 48.11  ? 110 PRO B CB  1 
ATOM   644  C  CG  . PRO B 1 10  ? 45.706 -13.558 -3.003  1.00 49.43  ? 110 PRO B CG  1 
ATOM   645  C  CD  . PRO B 1 10  ? 46.406 -14.336 -1.923  1.00 52.15  ? 110 PRO B CD  1 
ATOM   646  N  N   . GLU B 1 11  ? 43.133 -11.300 -0.762  1.00 53.24  ? 111 GLU B N   1 
ATOM   647  C  CA  . GLU B 1 11  ? 41.681 -11.224 -0.634  1.00 54.46  ? 111 GLU B CA  1 
ATOM   648  C  C   . GLU B 1 11  ? 41.025 -11.411 -2.002  1.00 50.18  ? 111 GLU B C   1 
ATOM   649  O  O   . GLU B 1 11  ? 41.588 -10.987 -3.024  1.00 52.67  ? 111 GLU B O   1 
ATOM   650  C  CB  . GLU B 1 11  ? 41.263 -9.877  -0.051  1.00 62.56  ? 111 GLU B CB  1 
ATOM   651  C  CG  . GLU B 1 11  ? 41.290 -9.820  1.467   1.00 76.88  ? 111 GLU B CG  1 
ATOM   652  C  CD  . GLU B 1 11  ? 40.720 -8.513  2.010   1.00 88.17  ? 111 GLU B CD  1 
ATOM   653  O  OE1 . GLU B 1 11  ? 41.193 -7.430  1.592   1.00 89.54  ? 111 GLU B OE1 1 
ATOM   654  O  OE2 . GLU B 1 11  ? 39.791 -8.567  2.849   1.00 92.49  ? 111 GLU B OE2 1 
ATOM   655  N  N   . PHE B 1 12  ? 39.843 -12.038 -2.015  1.00 42.20  ? 112 PHE B N   1 
ATOM   656  C  CA  . PHE B 1 12  ? 39.098 -12.299 -3.252  1.00 41.33  ? 112 PHE B CA  1 
ATOM   657  C  C   . PHE B 1 12  ? 37.614 -12.527 -2.988  1.00 40.52  ? 112 PHE B C   1 
ATOM   658  O  O   . PHE B 1 12  ? 37.218 -12.870 -1.876  1.00 40.43  ? 112 PHE B O   1 
ATOM   659  C  CB  . PHE B 1 12  ? 39.681 -13.504 -4.018  1.00 34.44  ? 112 PHE B CB  1 
ATOM   660  C  CG  . PHE B 1 12  ? 39.347 -14.840 -3.402  1.00 32.00  ? 112 PHE B CG  1 
ATOM   661  C  CD1 . PHE B 1 12  ? 38.492 -15.726 -4.050  1.00 30.26  ? 112 PHE B CD1 1 
ATOM   662  C  CD2 . PHE B 1 12  ? 39.879 -15.210 -2.170  1.00 29.49  ? 112 PHE B CD2 1 
ATOM   663  C  CE1 . PHE B 1 12  ? 38.177 -16.975 -3.481  1.00 32.90  ? 112 PHE B CE1 1 
ATOM   664  C  CE2 . PHE B 1 12  ? 39.569 -16.444 -1.595  1.00 31.21  ? 112 PHE B CE2 1 
ATOM   665  C  CZ  . PHE B 1 12  ? 38.710 -17.332 -2.251  1.00 33.48  ? 112 PHE B CZ  1 
ATOM   666  N  N   . GLU B 1 13  ? 36.805 -12.323 -4.027  1.00 38.70  ? 113 GLU B N   1 
ATOM   667  C  CA  . GLU B 1 13  ? 35.387 -12.633 -3.984  1.00 40.51  ? 113 GLU B CA  1 
ATOM   668  C  C   . GLU B 1 13  ? 35.035 -13.412 -5.252  1.00 36.49  ? 113 GLU B C   1 
ATOM   669  O  O   . GLU B 1 13  ? 35.751 -13.350 -6.248  1.00 41.96  ? 113 GLU B O   1 
ATOM   670  C  CB  . GLU B 1 13  ? 34.550 -11.355 -3.939  1.00 49.70  ? 113 GLU B CB  1 
ATOM   671  C  CG  . GLU B 1 13  ? 34.548 -10.629 -2.626  1.00 61.34  ? 113 GLU B CG  1 
ATOM   672  C  CD  . GLU B 1 13  ? 34.176 -9.169  -2.795  1.00 75.81  ? 113 GLU B CD  1 
ATOM   673  O  OE1 . GLU B 1 13  ? 33.025 -8.876  -3.202  1.00 78.73  ? 113 GLU B OE1 1 
ATOM   674  O  OE2 . GLU B 1 13  ? 35.051 -8.310  -2.545  1.00 83.00  ? 113 GLU B OE2 1 
ATOM   675  N  N   . ILE B 1 14  ? 33.925 -14.136 -5.222  1.00 29.37  ? 114 ILE B N   1 
ATOM   676  C  CA  . ILE B 1 14  ? 33.449 -14.814 -6.419  1.00 33.06  ? 114 ILE B CA  1 
ATOM   677  C  C   . ILE B 1 14  ? 31.961 -14.591 -6.625  1.00 33.22  ? 114 ILE B C   1 
ATOM   678  O  O   . ILE B 1 14  ? 31.217 -14.423 -5.662  1.00 36.98  ? 114 ILE B O   1 
ATOM   679  C  CB  . ILE B 1 14  ? 33.661 -16.328 -6.313  1.00 29.56  ? 114 ILE B CB  1 
ATOM   680  C  CG1 . ILE B 1 14  ? 32.782 -16.891 -5.189  1.00 25.84  ? 114 ILE B CG1 1 
ATOM   681  C  CG2 . ILE B 1 14  ? 35.130 -16.644 -6.076  1.00 28.57  ? 114 ILE B CG2 1 
ATOM   682  C  CD1 . ILE B 1 14  ? 32.917 -18.393 -4.994  1.00 25.84  ? 114 ILE B CD1 1 
ATOM   683  N  N   . VAL B 1 15  ? 31.518 -14.607 -7.873  1.00 32.58  ? 115 VAL B N   1 
ATOM   684  C  CA  . VAL B 1 15  ? 30.082 -14.764 -8.114  1.00 35.58  ? 115 VAL B CA  1 
ATOM   685  C  C   . VAL B 1 15  ? 29.823 -15.761 -9.240  1.00 37.66  ? 115 VAL B C   1 
ATOM   686  O  O   . VAL B 1 15  ? 30.535 -15.790 -10.263 1.00 38.02  ? 115 VAL B O   1 
ATOM   687  C  CB  . VAL B 1 15  ? 29.325 -13.406 -8.285  1.00 32.64  ? 115 VAL B CB  1 
ATOM   688  C  CG1 . VAL B 1 15  ? 30.304 -12.250 -8.398  1.00 33.18  ? 115 VAL B CG1 1 
ATOM   689  C  CG2 . VAL B 1 15  ? 28.363 -13.459 -9.465  1.00 27.65  ? 115 VAL B CG2 1 
ATOM   690  N  N   . GLY B 1 16  ? 28.832 -16.616 -9.017  1.00 36.29  ? 116 GLY B N   1 
ATOM   691  C  CA  . GLY B 1 16  ? 28.637 -17.764 -9.882  1.00 35.33  ? 116 GLY B CA  1 
ATOM   692  C  C   . GLY B 1 16  ? 27.576 -17.571 -10.948 1.00 37.33  ? 116 GLY B C   1 
ATOM   693  O  O   . GLY B 1 16  ? 26.539 -16.933 -10.709 1.00 34.96  ? 116 GLY B O   1 
ATOM   694  N  N   . PHE B 1 17  ? 27.830 -18.135 -12.126 1.00 36.19  ? 117 PHE B N   1 
ATOM   695  C  CA  . PHE B 1 17  ? 26.856 -18.106 -13.205 1.00 36.66  ? 117 PHE B CA  1 
ATOM   696  C  C   . PHE B 1 17  ? 26.656 -19.519 -13.747 1.00 36.44  ? 117 PHE B C   1 
ATOM   697  O  O   . PHE B 1 17  ? 27.376 -20.447 -13.347 1.00 39.84  ? 117 PHE B O   1 
ATOM   698  C  CB  . PHE B 1 17  ? 27.316 -17.146 -14.309 1.00 41.64  ? 117 PHE B CB  1 
ATOM   699  C  CG  . PHE B 1 17  ? 27.454 -15.717 -13.845 1.00 44.45  ? 117 PHE B CG  1 
ATOM   700  C  CD1 . PHE B 1 17  ? 26.351 -14.852 -13.853 1.00 43.70  ? 117 PHE B CD1 1 
ATOM   701  C  CD2 . PHE B 1 17  ? 28.681 -15.241 -13.370 1.00 42.66  ? 117 PHE B CD2 1 
ATOM   702  C  CE1 . PHE B 1 17  ? 26.476 -13.529 -13.405 1.00 46.02  ? 117 PHE B CE1 1 
ATOM   703  C  CE2 . PHE B 1 17  ? 28.817 -13.917 -12.924 1.00 40.79  ? 117 PHE B CE2 1 
ATOM   704  C  CZ  . PHE B 1 17  ? 27.710 -13.060 -12.943 1.00 43.14  ? 117 PHE B CZ  1 
ATOM   705  N  N   . THR B 1 18  ? 25.696 -19.676 -14.656 1.00 30.25  ? 118 THR B N   1 
ATOM   706  C  CA  . THR B 1 18  ? 25.386 -20.973 -15.256 1.00 34.81  ? 118 THR B CA  1 
ATOM   707  C  C   . THR B 1 18  ? 26.616 -21.766 -15.683 1.00 32.85  ? 118 THR B C   1 
ATOM   708  O  O   . THR B 1 18  ? 26.679 -22.981 -15.452 1.00 32.57  ? 118 THR B O   1 
ATOM   709  C  CB  . THR B 1 18  ? 24.487 -20.830 -16.502 1.00 41.87  ? 118 THR B CB  1 
ATOM   710  O  OG1 . THR B 1 18  ? 23.580 -19.732 -16.331 1.00 47.87  ? 118 THR B OG1 1 
ATOM   711  C  CG2 . THR B 1 18  ? 23.693 -22.105 -16.713 1.00 45.31  ? 118 THR B CG2 1 
ATOM   712  N  N   . ASN B 1 19  ? 27.590 -21.097 -16.306 1.00 25.58  ? 119 ASN B N   1 
ATOM   713  C  CA  . ASN B 1 19  ? 28.737 -21.826 -16.846 1.00 29.69  ? 119 ASN B CA  1 
ATOM   714  C  C   . ASN B 1 19  ? 30.098 -21.270 -16.490 1.00 32.17  ? 119 ASN B C   1 
ATOM   715  O  O   . ASN B 1 19  ? 31.132 -21.739 -16.981 1.00 41.78  ? 119 ASN B O   1 
ATOM   716  C  CB  . ASN B 1 19  ? 28.614 -21.935 -18.374 1.00 36.57  ? 119 ASN B CB  1 
ATOM   717  C  CG  . ASN B 1 19  ? 27.446 -22.798 -18.791 1.00 44.49  ? 119 ASN B CG  1 
ATOM   718  O  OD1 . ASN B 1 19  ? 26.437 -22.283 -19.276 1.00 51.51  ? 119 ASN B OD1 1 
ATOM   719  N  ND2 . ASN B 1 19  ? 27.575 -24.114 -18.622 1.00 44.32  ? 119 ASN B ND2 1 
ATOM   720  N  N   . HIS B 1 20  ? 30.119 -20.248 -15.660 1.00 22.34  ? 120 HIS B N   1 
ATOM   721  C  CA  . HIS B 1 20  ? 31.407 -19.743 -15.235 1.00 27.44  ? 120 HIS B CA  1 
ATOM   722  C  C   . HIS B 1 20  ? 31.298 -19.069 -13.867 1.00 28.44  ? 120 HIS B C   1 
ATOM   723  O  O   . HIS B 1 20  ? 30.200 -18.802 -13.364 1.00 24.37  ? 120 HIS B O   1 
ATOM   724  C  CB  . HIS B 1 20  ? 31.916 -18.740 -16.250 1.00 25.82  ? 120 HIS B CB  1 
ATOM   725  C  CG  . HIS B 1 20  ? 31.092 -17.498 -16.293 1.00 34.89  ? 120 HIS B CG  1 
ATOM   726  N  ND1 . HIS B 1 20  ? 29.814 -17.477 -16.813 1.00 42.73  ? 120 HIS B ND1 1 
ATOM   727  C  CD2 . HIS B 1 20  ? 31.330 -16.249 -15.824 1.00 39.66  ? 120 HIS B CD2 1 
ATOM   728  C  CE1 . HIS B 1 20  ? 29.316 -16.257 -16.700 1.00 44.38  ? 120 HIS B CE1 1 
ATOM   729  N  NE2 . HIS B 1 20  ? 30.216 -15.492 -16.105 1.00 42.10  ? 120 HIS B NE2 1 
ATOM   730  N  N   . ILE B 1 21  ? 32.460 -18.800 -13.291 1.00 28.79  ? 121 ILE B N   1 
ATOM   731  C  CA  . ILE B 1 21  ? 32.564 -18.088 -12.044 1.00 33.34  ? 121 ILE B CA  1 
ATOM   732  C  C   . ILE B 1 21  ? 33.475 -16.893 -12.234 1.00 34.62  ? 121 ILE B C   1 
ATOM   733  O  O   . ILE B 1 21  ? 34.615 -17.035 -12.713 1.00 37.30  ? 121 ILE B O   1 
ATOM   734  C  CB  . ILE B 1 21  ? 33.169 -18.971 -10.949 1.00 37.23  ? 121 ILE B CB  1 
ATOM   735  C  CG1 . ILE B 1 21  ? 32.172 -20.043 -10.510 1.00 32.42  ? 121 ILE B CG1 1 
ATOM   736  C  CG2 . ILE B 1 21  ? 33.566 -18.126 -9.756  1.00 36.55  ? 121 ILE B CG2 1 
ATOM   737  C  CD1 . ILE B 1 21  ? 32.793 -21.052 -9.601  1.00 25.86  ? 121 ILE B CD1 1 
ATOM   738  N  N   . ASN B 1 22  ? 32.961 -15.721 -11.862 1.00 31.48  ? 122 ASN B N   1 
ATOM   739  C  CA  . ASN B 1 22  ? 33.753 -14.499 -11.800 1.00 35.24  ? 122 ASN B CA  1 
ATOM   740  C  C   . ASN B 1 22  ? 34.580 -14.484 -10.530 1.00 36.85  ? 122 ASN B C   1 
ATOM   741  O  O   . ASN B 1 22  ? 34.045 -14.670 -9.425  1.00 34.74  ? 122 ASN B O   1 
ATOM   742  C  CB  . ASN B 1 22  ? 32.843 -13.278 -11.806 1.00 49.71  ? 122 ASN B CB  1 
ATOM   743  C  CG  . ASN B 1 22  ? 32.593 -12.748 -13.204 1.00 66.41  ? 122 ASN B CG  1 
ATOM   744  O  OD1 . ASN B 1 22  ? 31.713 -13.234 -13.920 1.00 67.87  ? 122 ASN B OD1 1 
ATOM   745  N  ND2 . ASN B 1 22  ? 33.374 -11.740 -13.603 1.00 73.89  ? 122 ASN B ND2 1 
ATOM   746  N  N   . VAL B 1 23  ? 35.882 -14.269 -10.680 1.00 37.24  ? 123 VAL B N   1 
ATOM   747  C  CA  . VAL B 1 23  ? 36.761 -14.158 -9.519  1.00 41.06  ? 123 VAL B CA  1 
ATOM   748  C  C   . VAL B 1 23  ? 37.463 -12.801 -9.488  1.00 44.91  ? 123 VAL B C   1 
ATOM   749  O  O   . VAL B 1 23  ? 38.127 -12.421 -10.463 1.00 48.36  ? 123 VAL B O   1 
ATOM   750  C  CB  . VAL B 1 23  ? 37.804 -15.292 -9.495  1.00 39.40  ? 123 VAL B CB  1 
ATOM   751  C  CG1 . VAL B 1 23  ? 38.604 -15.243 -8.195  1.00 39.86  ? 123 VAL B CG1 1 
ATOM   752  C  CG2 . VAL B 1 23  ? 37.103 -16.647 -9.652  1.00 33.30  ? 123 VAL B CG2 1 
HETATM 753  N  N   . MSE B 1 24  ? 37.289 -12.064 -8.388  1.00 45.20  ? 124 MSE B N   1 
HETATM 754  C  CA  . MSE B 1 24  ? 37.976 -10.778 -8.192  1.00 48.80  ? 124 MSE B CA  1 
HETATM 755  C  C   . MSE B 1 24  ? 39.002 -10.882 -7.079  1.00 50.49  ? 124 MSE B C   1 
HETATM 756  O  O   . MSE B 1 24  ? 38.663 -11.259 -5.949  1.00 51.51  ? 124 MSE B O   1 
HETATM 757  C  CB  . MSE B 1 24  ? 37.001 -9.667  -7.821  1.00 51.30  ? 124 MSE B CB  1 
HETATM 758  C  CG  . MSE B 1 24  ? 35.926 -9.370  -8.855  1.00 60.60  ? 124 MSE B CG  1 
HETATM 759  SE SE  . MSE B 1 24  ? 34.839 -7.835  -8.296  1.00 126.86 ? 124 MSE B SE  1 
HETATM 760  C  CE  . MSE B 1 24  ? 36.244 -6.472  -8.246  1.00 52.54  ? 124 MSE B CE  1 
ATOM   761  N  N   . VAL B 1 25  ? 40.250 -10.546 -7.386  1.00 48.93  ? 125 VAL B N   1 
ATOM   762  C  CA  . VAL B 1 25  ? 41.302 -10.569 -6.372  1.00 50.94  ? 125 VAL B CA  1 
ATOM   763  C  C   . VAL B 1 25  ? 41.837 -9.165  -6.103  1.00 53.62  ? 125 VAL B C   1 
ATOM   764  O  O   . VAL B 1 25  ? 41.946 -8.345  -7.021  1.00 53.45  ? 125 VAL B O   1 
ATOM   765  C  CB  . VAL B 1 25  ? 42.473 -11.489 -6.790  1.00 51.76  ? 125 VAL B CB  1 
ATOM   766  C  CG1 . VAL B 1 25  ? 43.551 -11.510 -5.715  1.00 49.02  ? 125 VAL B CG1 1 
ATOM   767  C  CG2 . VAL B 1 25  ? 41.964 -12.895 -7.088  1.00 51.55  ? 125 VAL B CG2 1 
ATOM   768  N  N   . LYS B 1 26  ? 42.155 -8.894  -4.840  1.00 58.04  ? 126 LYS B N   1 
ATOM   769  C  CA  . LYS B 1 26  ? 42.766 -7.626  -4.444  1.00 61.64  ? 126 LYS B CA  1 
ATOM   770  C  C   . LYS B 1 26  ? 44.131 -7.915  -3.824  1.00 66.32  ? 126 LYS B C   1 
ATOM   771  O  O   . LYS B 1 26  ? 44.319 -8.945  -3.173  1.00 67.15  ? 126 LYS B O   1 
ATOM   772  C  CB  . LYS B 1 26  ? 41.863 -6.856  -3.475  1.00 60.18  ? 126 LYS B CB  1 
ATOM   773  N  N   . PHE B 1 27  ? 45.084 -7.014  -4.045  1.00 72.47  ? 127 PHE B N   1 
ATOM   774  C  CA  . PHE B 1 27  ? 46.469 -7.242  -3.640  1.00 76.14  ? 127 PHE B CA  1 
ATOM   775  C  C   . PHE B 1 27  ? 46.960 -6.248  -2.595  1.00 75.94  ? 127 PHE B C   1 
ATOM   776  O  O   . PHE B 1 27  ? 47.948 -6.502  -1.900  1.00 76.42  ? 127 PHE B O   1 
ATOM   777  C  CB  . PHE B 1 27  ? 47.383 -7.189  -4.861  1.00 80.96  ? 127 PHE B CB  1 
ATOM   778  C  CG  . PHE B 1 27  ? 47.234 -8.365  -5.785  1.00 84.18  ? 127 PHE B CG  1 
ATOM   779  C  CD1 . PHE B 1 27  ? 47.848 -9.575  -5.488  1.00 84.90  ? 127 PHE B CD1 1 
ATOM   780  C  CD2 . PHE B 1 27  ? 46.494 -8.264  -6.963  1.00 86.43  ? 127 PHE B CD2 1 
ATOM   781  C  CE1 . PHE B 1 27  ? 47.726 -10.676 -6.349  1.00 84.49  ? 127 PHE B CE1 1 
ATOM   782  C  CE2 . PHE B 1 27  ? 46.366 -9.362  -7.833  1.00 84.38  ? 127 PHE B CE2 1 
ATOM   783  C  CZ  . PHE B 1 27  ? 46.982 -10.569 -7.521  1.00 82.53  ? 127 PHE B CZ  1 
ATOM   784  N  N   . LEU B 1 39  ? 56.793 -15.003 -7.444  1.00 66.02  ? 139 LEU B N   1 
ATOM   785  C  CA  . LEU B 1 39  ? 55.474 -15.332 -6.956  1.00 65.49  ? 139 LEU B CA  1 
ATOM   786  C  C   . LEU B 1 39  ? 54.425 -15.272 -8.049  1.00 68.12  ? 139 LEU B C   1 
ATOM   787  O  O   . LEU B 1 39  ? 54.223 -14.250 -8.656  1.00 69.36  ? 139 LEU B O   1 
ATOM   788  C  CB  . LEU B 1 39  ? 55.086 -14.419 -5.802  1.00 54.09  ? 139 LEU B CB  1 
ATOM   789  N  N   . SER B 1 40  ? 53.744 -16.380 -8.277  1.00 65.35  ? 140 SER B N   1 
ATOM   790  C  CA  . SER B 1 40  ? 52.616 -16.384 -9.172  1.00 67.21  ? 140 SER B CA  1 
ATOM   791  C  C   . SER B 1 40  ? 51.347 -16.502 -8.405  1.00 62.18  ? 140 SER B C   1 
ATOM   792  O  O   . SER B 1 40  ? 51.309 -17.093 -7.370  1.00 62.84  ? 140 SER B O   1 
ATOM   793  C  CB  . SER B 1 40  ? 52.698 -17.564 -10.109 1.00 71.95  ? 140 SER B CB  1 
ATOM   794  O  OG  . SER B 1 40  ? 53.813 -17.451 -10.952 1.00 78.78  ? 140 SER B OG  1 
ATOM   795  N  N   . LEU B 1 41  ? 50.290 -15.963 -8.951  1.00 56.10  ? 141 LEU B N   1 
ATOM   796  C  CA  . LEU B 1 41  ? 49.000 -16.156 -8.391  1.00 49.91  ? 141 LEU B CA  1 
ATOM   797  C  C   . LEU B 1 41  ? 48.342 -17.415 -8.913  1.00 46.55  ? 141 LEU B C   1 
ATOM   798  O  O   . LEU B 1 41  ? 48.300 -17.640 -10.073 1.00 49.31  ? 141 LEU B O   1 
ATOM   799  C  CB  . LEU B 1 41  ? 48.162 -14.949 -8.698  1.00 47.93  ? 141 LEU B CB  1 
ATOM   800  C  CG  . LEU B 1 41  ? 46.707 -15.144 -8.379  1.00 49.84  ? 141 LEU B CG  1 
ATOM   801  C  CD1 . LEU B 1 41  ? 46.507 -15.364 -6.954  1.00 47.89  ? 141 LEU B CD1 1 
ATOM   802  C  CD2 . LEU B 1 41  ? 45.991 -13.979 -8.814  1.00 52.13  ? 141 LEU B CD2 1 
ATOM   803  N  N   . VAL B 1 42  ? 47.856 -18.243 -8.021  1.00 39.75  ? 142 VAL B N   1 
ATOM   804  C  CA  . VAL B 1 42  ? 47.042 -19.399 -8.357  1.00 39.49  ? 142 VAL B CA  1 
ATOM   805  C  C   . VAL B 1 42  ? 45.585 -19.186 -7.944  1.00 43.06  ? 142 VAL B C   1 
ATOM   806  O  O   . VAL B 1 42  ? 45.291 -18.795 -6.796  1.00 42.72  ? 142 VAL B O   1 
ATOM   807  C  CB  . VAL B 1 42  ? 47.519 -20.664 -7.626  1.00 40.59  ? 142 VAL B CB  1 
ATOM   808  C  CG1 . VAL B 1 42  ? 46.677 -21.873 -8.058  1.00 39.71  ? 142 VAL B CG1 1 
ATOM   809  C  CG2 . VAL B 1 42  ? 49.003 -20.907 -7.871  1.00 39.53  ? 142 VAL B CG2 1 
ATOM   810  N  N   . ILE B 1 43  ? 44.678 -19.467 -8.874  1.00 40.08  ? 143 ILE B N   1 
ATOM   811  C  CA  . ILE B 1 43  ? 43.260 -19.492 -8.567  1.00 36.57  ? 143 ILE B CA  1 
ATOM   812  C  C   . ILE B 1 43  ? 42.807 -20.929 -8.721  1.00 36.49  ? 143 ILE B C   1 
ATOM   813  O  O   . ILE B 1 43  ? 42.798 -21.469 -9.832  1.00 41.70  ? 143 ILE B O   1 
ATOM   814  C  CB  . ILE B 1 43  ? 42.477 -18.597 -9.519  1.00 33.52  ? 143 ILE B CB  1 
ATOM   815  C  CG1 . ILE B 1 43  ? 42.884 -17.142 -9.301  1.00 33.65  ? 143 ILE B CG1 1 
ATOM   816  C  CG2 . ILE B 1 43  ? 40.990 -18.771 -9.311  1.00 33.49  ? 143 ILE B CG2 1 
ATOM   817  C  CD1 . ILE B 1 43  ? 42.133 -16.168 -10.172 1.00 34.14  ? 143 ILE B CD1 1 
ATOM   818  N  N   . GLU B 1 44  ? 42.447 -21.562 -7.613  1.00 32.03  ? 144 GLU B N   1 
ATOM   819  C  CA  . GLU B 1 44  ? 42.206 -22.999 -7.649  1.00 32.23  ? 144 GLU B CA  1 
ATOM   820  C  C   . GLU B 1 44  ? 40.719 -23.296 -7.495  1.00 34.16  ? 144 GLU B C   1 
ATOM   821  O  O   . GLU B 1 44  ? 40.013 -22.687 -6.664  1.00 41.54  ? 144 GLU B O   1 
ATOM   822  C  CB  . GLU B 1 44  ? 43.051 -23.718 -6.596  1.00 34.32  ? 144 GLU B CB  1 
ATOM   823  C  CG  . GLU B 1 44  ? 42.989 -25.233 -6.618  1.00 38.52  ? 144 GLU B CG  1 
ATOM   824  C  CD  . GLU B 1 44  ? 43.756 -25.838 -5.439  1.00 52.09  ? 144 GLU B CD  1 
ATOM   825  O  OE1 . GLU B 1 44  ? 44.999 -26.002 -5.543  1.00 52.44  ? 144 GLU B OE1 1 
ATOM   826  O  OE2 . GLU B 1 44  ? 43.113 -26.137 -4.397  1.00 60.05  ? 144 GLU B OE2 1 
ATOM   827  N  N   . GLU B 1 45  ? 40.263 -24.242 -8.308  1.00 27.22  ? 145 GLU B N   1 
ATOM   828  C  CA  . GLU B 1 45  ? 38.848 -24.494 -8.576  1.00 25.99  ? 145 GLU B CA  1 
ATOM   829  C  C   . GLU B 1 45  ? 38.645 -25.964 -8.244  1.00 26.91  ? 145 GLU B C   1 
ATOM   830  O  O   . GLU B 1 45  ? 39.520 -26.800 -8.546  1.00 33.69  ? 145 GLU B O   1 
ATOM   831  C  CB  . GLU B 1 45  ? 38.582 -24.261 -10.084 1.00 33.27  ? 145 GLU B CB  1 
ATOM   832  C  CG  . GLU B 1 45  ? 37.423 -25.076 -10.664 1.00 44.22  ? 145 GLU B CG  1 
ATOM   833  C  CD  . GLU B 1 45  ? 37.565 -25.428 -12.158 1.00 47.32  ? 145 GLU B CD  1 
ATOM   834  O  OE1 . GLU B 1 45  ? 38.353 -24.757 -12.881 1.00 42.33  ? 145 GLU B OE1 1 
ATOM   835  O  OE2 . GLU B 1 45  ? 36.871 -26.391 -12.604 1.00 50.58  ? 145 GLU B OE2 1 
ATOM   836  N  N   . GLN B 1 46  ? 37.511 -26.313 -7.650  1.00 25.55  ? 146 GLN B N   1 
ATOM   837  C  CA  . GLN B 1 46  ? 37.279 -27.728 -7.354  1.00 31.41  ? 146 GLN B CA  1 
ATOM   838  C  C   . GLN B 1 46  ? 35.826 -28.102 -7.162  1.00 30.87  ? 146 GLN B C   1 
ATOM   839  O  O   . GLN B 1 46  ? 34.992 -27.284 -6.754  1.00 32.71  ? 146 GLN B O   1 
ATOM   840  C  CB  . GLN B 1 46  ? 38.058 -28.164 -6.109  1.00 34.20  ? 146 GLN B CB  1 
ATOM   841  C  CG  . GLN B 1 46  ? 37.610 -27.455 -4.840  1.00 39.59  ? 146 GLN B CG  1 
ATOM   842  C  CD  . GLN B 1 46  ? 38.513 -27.774 -3.664  1.00 45.62  ? 146 GLN B CD  1 
ATOM   843  O  OE1 . GLN B 1 46  ? 39.596 -27.196 -3.529  1.00 46.04  ? 146 GLN B OE1 1 
ATOM   844  N  NE2 . GLN B 1 46  ? 38.068 -28.703 -2.801  1.00 46.30  ? 146 GLN B NE2 1 
ATOM   845  N  N   . SER B 1 47  ? 35.530 -29.330 -7.509  1.00 32.99  ? 147 SER B N   1 
ATOM   846  C  CA  . SER B 1 47  ? 34.225 -29.899 -7.406  1.00 33.74  ? 147 SER B CA  1 
ATOM   847  C  C   . SER B 1 47  ? 34.360 -31.382 -7.365  1.00 32.52  ? 147 SER B C   1 
ATOM   848  O  O   . SER B 1 47  ? 35.013 -31.933 -8.136  1.00 31.39  ? 147 SER B O   1 
ATOM   849  C  CB  . SER B 1 47  ? 33.394 -29.500 -8.581  1.00 34.64  ? 147 SER B CB  1 
ATOM   850  O  OG  . SER B 1 47  ? 32.064 -29.790 -8.367  1.00 39.45  ? 147 SER B OG  1 
ATOM   851  N  N   . GLU B 1 48  ? 33.733 -32.010 -6.408  1.00 36.81  ? 148 GLU B N   1 
ATOM   852  C  CA  . GLU B 1 48  ? 33.706 -33.446 -6.227  1.00 40.38  ? 148 GLU B CA  1 
ATOM   853  C  C   . GLU B 1 48  ? 34.967 -34.243 -6.290  1.00 37.57  ? 148 GLU B C   1 
ATOM   854  O  O   . GLU B 1 48  ? 34.950 -35.346 -6.729  1.00 37.79  ? 148 GLU B O   1 
ATOM   855  C  CB  . GLU B 1 48  ? 32.711 -34.080 -7.155  1.00 47.14  ? 148 GLU B CB  1 
ATOM   856  C  CG  . GLU B 1 48  ? 31.465 -33.347 -7.285  1.00 61.76  ? 148 GLU B CG  1 
ATOM   857  C  CD  . GLU B 1 48  ? 30.326 -34.251 -7.376  1.00 74.14  ? 148 GLU B CD  1 
ATOM   858  O  OE1 . GLU B 1 48  ? 30.497 -35.396 -7.010  1.00 79.36  ? 148 GLU B OE1 1 
ATOM   859  O  OE2 . GLU B 1 48  ? 29.252 -33.847 -7.799  1.00 76.18  ? 148 GLU B OE2 1 
ATOM   860  N  N   . GLY B 1 49  ? 36.055 -33.713 -5.814  1.00 33.59  ? 149 GLY B N   1 
ATOM   861  C  CA  . GLY B 1 49  ? 37.280 -34.444 -5.850  1.00 29.39  ? 149 GLY B CA  1 
ATOM   862  C  C   . GLY B 1 49  ? 38.185 -34.004 -6.947  1.00 35.44  ? 149 GLY B C   1 
ATOM   863  O  O   . GLY B 1 49  ? 39.325 -34.321 -6.960  1.00 36.73  ? 149 GLY B O   1 
ATOM   864  N  N   . ILE B 1 50  ? 37.643 -33.274 -7.886  1.00 31.91  ? 150 ILE B N   1 
ATOM   865  C  CA  . ILE B 1 50  ? 38.433 -32.871 -9.033  1.00 34.32  ? 150 ILE B CA  1 
ATOM   866  C  C   . ILE B 1 50  ? 38.926 -31.460 -8.781  1.00 33.40  ? 150 ILE B C   1 
ATOM   867  O  O   . ILE B 1 50  ? 38.156 -30.619 -8.316  1.00 37.61  ? 150 ILE B O   1 
ATOM   868  C  CB  . ILE B 1 50  ? 37.605 -32.952 -10.344 1.00 31.63  ? 150 ILE B CB  1 
ATOM   869  C  CG1 . ILE B 1 50  ? 37.140 -34.388 -10.573 1.00 38.08  ? 150 ILE B CG1 1 
ATOM   870  C  CG2 . ILE B 1 50  ? 38.404 -32.483 -11.541 1.00 20.19  ? 150 ILE B CG2 1 
ATOM   871  C  CD1 . ILE B 1 50  ? 36.201 -34.539 -11.758 1.00 35.42  ? 150 ILE B CD1 1 
ATOM   872  N  N   . VAL B 1 51  ? 40.195 -31.205 -9.113  1.00 28.26  ? 151 VAL B N   1 
ATOM   873  C  CA  . VAL B 1 51  ? 40.853 -29.948 -8.784  1.00 24.83  ? 151 VAL B CA  1 
ATOM   874  C  C   . VAL B 1 51  ? 41.689 -29.408 -9.954  1.00 31.02  ? 151 VAL B C   1 
ATOM   875  O  O   . VAL B 1 51  ? 42.340 -30.178 -10.680 1.00 30.47  ? 151 VAL B O   1 
ATOM   876  C  CB  . VAL B 1 51  ? 41.781 -30.157 -7.565  1.00 28.66  ? 151 VAL B CB  1 
ATOM   877  C  CG1 . VAL B 1 51  ? 42.564 -28.868 -7.239  1.00 12.21  ? 151 VAL B CG1 1 
ATOM   878  C  CG2 . VAL B 1 51  ? 40.970 -30.685 -6.350  1.00 12.19  ? 151 VAL B CG2 1 
ATOM   879  N  N   . LYS B 1 52  ? 41.681 -28.087 -10.125 1.00 25.96  ? 152 LYS B N   1 
ATOM   880  C  CA  . LYS B 1 52  ? 42.429 -27.474 -11.205 1.00 26.48  ? 152 LYS B CA  1 
ATOM   881  C  C   . LYS B 1 52  ? 42.976 -26.098 -10.829 1.00 30.36  ? 152 LYS B C   1 
ATOM   882  O  O   . LYS B 1 52  ? 42.216 -25.198 -10.458 1.00 29.96  ? 152 LYS B O   1 
ATOM   883  C  CB  . LYS B 1 52  ? 41.563 -27.351 -12.472 1.00 33.82  ? 152 LYS B CB  1 
ATOM   884  C  CG  . LYS B 1 52  ? 42.342 -26.856 -13.719 1.00 35.47  ? 152 LYS B CG  1 
ATOM   885  C  CD  . LYS B 1 52  ? 41.383 -26.430 -14.840 1.00 36.16  ? 152 LYS B CD  1 
ATOM   886  C  CE  . LYS B 1 52  ? 41.905 -26.704 -16.262 1.00 33.18  ? 152 LYS B CE  1 
ATOM   887  N  NZ  . LYS B 1 52  ? 43.275 -26.229 -16.556 1.00 34.26  ? 152 LYS B NZ  1 
ATOM   888  N  N   . LYS B 1 53  ? 44.292 -25.940 -10.960 1.00 36.20  ? 153 LYS B N   1 
ATOM   889  C  CA  . LYS B 1 53  ? 44.974 -24.678 -10.676 1.00 42.48  ? 153 LYS B CA  1 
ATOM   890  C  C   . LYS B 1 53  ? 45.035 -23.773 -11.924 1.00 41.58  ? 153 LYS B C   1 
ATOM   891  O  O   . LYS B 1 53  ? 45.527 -24.174 -12.986 1.00 44.20  ? 153 LYS B O   1 
ATOM   892  C  CB  . LYS B 1 53  ? 46.405 -24.947 -10.153 1.00 45.42  ? 153 LYS B CB  1 
ATOM   893  C  CG  . LYS B 1 53  ? 46.478 -25.872 -8.929  1.00 45.93  ? 153 LYS B CG  1 
ATOM   894  C  CD  . LYS B 1 53  ? 47.910 -26.375 -8.630  1.00 44.51  ? 153 LYS B CD  1 
ATOM   895  C  CE  . LYS B 1 53  ? 48.881 -25.225 -8.321  1.00 48.49  ? 153 LYS B CE  1 
ATOM   896  N  NZ  . LYS B 1 53  ? 50.285 -25.687 -8.036  1.00 50.88  ? 153 LYS B NZ  1 
ATOM   897  N  N   . HIS B 1 54  ? 44.530 -22.553 -11.801 1.00 38.16  ? 154 HIS B N   1 
ATOM   898  C  CA  . HIS B 1 54  ? 44.675 -21.584 -12.874 1.00 36.15  ? 154 HIS B CA  1 
ATOM   899  C  C   . HIS B 1 54  ? 45.807 -20.627 -12.522 1.00 42.23  ? 154 HIS B C   1 
ATOM   900  O  O   . HIS B 1 54  ? 45.868 -20.117 -11.396 1.00 37.54  ? 154 HIS B O   1 
ATOM   901  C  CB  . HIS B 1 54  ? 43.368 -20.828 -13.075 1.00 38.11  ? 154 HIS B CB  1 
ATOM   902  C  CG  . HIS B 1 54  ? 42.251 -21.695 -13.563 1.00 41.65  ? 154 HIS B CG  1 
ATOM   903  N  ND1 . HIS B 1 54  ? 41.593 -21.464 -14.756 1.00 43.93  ? 154 HIS B ND1 1 
ATOM   904  C  CD2 . HIS B 1 54  ? 41.682 -22.802 -13.031 1.00 43.81  ? 154 HIS B CD2 1 
ATOM   905  C  CE1 . HIS B 1 54  ? 40.665 -22.387 -14.931 1.00 44.56  ? 154 HIS B CE1 1 
ATOM   906  N  NE2 . HIS B 1 54  ? 40.697 -23.213 -13.895 1.00 45.50  ? 154 HIS B NE2 1 
ATOM   907  N  N   . LYS B 1 55  ? 46.717 -20.402 -13.472 1.00 48.03  ? 155 LYS B N   1 
ATOM   908  C  CA  . LYS B 1 55  ? 47.849 -19.502 -13.225 1.00 48.85  ? 155 LYS B CA  1 
ATOM   909  C  C   . LYS B 1 55  ? 47.906 -18.392 -14.269 1.00 48.92  ? 155 LYS B C   1 
ATOM   910  O  O   . LYS B 1 55  ? 48.783 -18.390 -15.127 1.00 48.47  ? 155 LYS B O   1 
ATOM   911  C  CB  . LYS B 1 55  ? 49.188 -20.269 -13.180 1.00 45.47  ? 155 LYS B CB  1 
ATOM   912  C  CG  . LYS B 1 55  ? 49.210 -21.511 -12.274 1.00 52.65  ? 155 LYS B CG  1 
ATOM   913  C  CD  . LYS B 1 55  ? 50.465 -21.553 -11.380 1.00 60.63  ? 155 LYS B CD  1 
ATOM   914  C  CE  . LYS B 1 55  ? 51.039 -22.965 -11.224 1.00 65.12  ? 155 LYS B CE  1 
ATOM   915  N  NZ  . LYS B 1 55  ? 52.083 -23.289 -12.251 1.00 71.29  ? 155 LYS B NZ  1 
ATOM   916  N  N   . PRO B 1 56  ? 46.979 -17.429 -14.186 1.00 55.43  ? 156 PRO B N   1 
ATOM   917  C  CA  . PRO B 1 56  ? 47.004 -16.349 -15.177 1.00 58.45  ? 156 PRO B CA  1 
ATOM   918  C  C   . PRO B 1 56  ? 48.326 -15.598 -15.096 1.00 65.81  ? 156 PRO B C   1 
ATOM   919  O  O   . PRO B 1 56  ? 48.980 -15.609 -14.031 1.00 68.08  ? 156 PRO B O   1 
ATOM   920  C  CB  . PRO B 1 56  ? 45.875 -15.414 -14.714 1.00 60.34  ? 156 PRO B CB  1 
ATOM   921  C  CG  . PRO B 1 56  ? 45.103 -16.176 -13.661 1.00 58.29  ? 156 PRO B CG  1 
ATOM   922  C  CD  . PRO B 1 56  ? 46.085 -17.127 -13.053 1.00 55.76  ? 156 PRO B CD  1 
ATOM   923  N  N   . GLU B 1 57  ? 48.713 -14.981 -16.214 1.00 68.05  ? 157 GLU B N   1 
ATOM   924  C  CA  . GLU B 1 57  ? 49.782 -13.988 -16.226 1.00 71.26  ? 157 GLU B CA  1 
ATOM   925  C  C   . GLU B 1 57  ? 49.162 -12.611 -15.980 1.00 72.78  ? 157 GLU B C   1 
ATOM   926  O  O   . GLU B 1 57  ? 47.980 -12.381 -16.285 1.00 69.38  ? 157 GLU B O   1 
ATOM   927  C  CB  . GLU B 1 57  ? 50.539 -14.005 -17.552 1.00 72.55  ? 157 GLU B CB  1 
ATOM   928  N  N   . ILE B 1 58  ? 49.960 -11.702 -15.426 1.00 75.35  ? 158 ILE B N   1 
ATOM   929  C  CA  . ILE B 1 58  ? 49.444 -10.422 -14.945 1.00 74.89  ? 158 ILE B CA  1 
ATOM   930  C  C   . ILE B 1 58  ? 50.377 -9.239  -15.267 1.00 72.51  ? 158 ILE B C   1 
ATOM   931  O  O   . ILE B 1 58  ? 49.951 -8.191  -15.770 1.00 68.99  ? 158 ILE B O   1 
ATOM   932  C  CB  . ILE B 1 58  ? 49.187 -10.502 -13.423 1.00 73.67  ? 158 ILE B CB  1 
ATOM   933  C  CG1 . ILE B 1 58  ? 50.322 -11.273 -12.735 1.00 76.10  ? 158 ILE B CG1 1 
ATOM   934  C  CG2 . ILE B 1 58  ? 47.877 -11.211 -13.138 1.00 69.94  ? 158 ILE B CG2 1 
ATOM   935  C  CD1 . ILE B 1 58  ? 51.679 -10.556 -12.730 1.00 75.22  ? 158 ILE B CD1 1 
ATOM   936  N  N   . ASN B 1 65  ? 43.125 -4.644  -8.333  1.00 78.67  ? 165 ASN B N   1 
ATOM   937  C  CA  . ASN B 1 65  ? 41.837 -5.306  -8.555  1.00 83.45  ? 165 ASN B CA  1 
ATOM   938  C  C   . ASN B 1 65  ? 41.807 -6.113  -9.856  1.00 83.86  ? 165 ASN B C   1 
ATOM   939  O  O   . ASN B 1 65  ? 41.278 -5.661  -10.878 1.00 87.00  ? 165 ASN B O   1 
ATOM   940  C  CB  . ASN B 1 65  ? 40.673 -4.298  -8.518  1.00 90.68  ? 165 ASN B CB  1 
ATOM   941  C  CG  . ASN B 1 65  ? 39.857 -4.367  -7.212  1.00 95.41  ? 165 ASN B CG  1 
ATOM   942  O  OD1 . ASN B 1 65  ? 40.277 -4.982  -6.225  1.00 96.05  ? 165 ASN B OD1 1 
ATOM   943  N  ND2 . ASN B 1 65  ? 38.687 -3.724  -7.211  1.00 95.81  ? 165 ASN B ND2 1 
ATOM   944  N  N   . PHE B 1 66  ? 42.371 -7.318  -9.796  1.00 78.01  ? 166 PHE B N   1 
ATOM   945  C  CA  . PHE B 1 66  ? 42.436 -8.234  -10.939 1.00 69.74  ? 166 PHE B CA  1 
ATOM   946  C  C   . PHE B 1 66  ? 41.178 -9.080  -11.046 1.00 63.34  ? 166 PHE B C   1 
ATOM   947  O  O   . PHE B 1 66  ? 40.597 -9.491  -10.035 1.00 63.42  ? 166 PHE B O   1 
ATOM   948  C  CB  . PHE B 1 66  ? 43.640 -9.161  -10.781 1.00 67.79  ? 166 PHE B CB  1 
ATOM   949  C  CG  . PHE B 1 66  ? 43.743 -10.229 -11.835 1.00 65.47  ? 166 PHE B CG  1 
ATOM   950  C  CD1 . PHE B 1 66  ? 44.141 -9.909  -13.127 1.00 68.70  ? 166 PHE B CD1 1 
ATOM   951  C  CD2 . PHE B 1 66  ? 43.487 -11.558 -11.529 1.00 63.83  ? 166 PHE B CD2 1 
ATOM   952  C  CE1 . PHE B 1 66  ? 44.265 -10.891 -14.115 1.00 65.68  ? 166 PHE B CE1 1 
ATOM   953  C  CE2 . PHE B 1 66  ? 43.606 -12.549 -12.509 1.00 66.82  ? 166 PHE B CE2 1 
ATOM   954  C  CZ  . PHE B 1 66  ? 43.998 -12.212 -13.806 1.00 66.49  ? 166 PHE B CZ  1 
ATOM   955  N  N   . THR B 1 67  ? 40.770 -9.361  -12.275 1.00 55.76  ? 167 THR B N   1 
ATOM   956  C  CA  . THR B 1 67  ? 39.586 -10.169 -12.498 1.00 53.03  ? 167 THR B CA  1 
ATOM   957  C  C   . THR B 1 67  ? 39.908 -11.318 -13.424 1.00 53.70  ? 167 THR B C   1 
ATOM   958  O  O   . THR B 1 67  ? 40.607 -11.158 -14.419 1.00 60.81  ? 167 THR B O   1 
ATOM   959  C  CB  . THR B 1 67  ? 38.444 -9.343  -13.103 1.00 58.62  ? 167 THR B CB  1 
ATOM   960  O  OG1 . THR B 1 67  ? 38.018 -8.358  -12.156 1.00 61.20  ? 167 THR B OG1 1 
ATOM   961  C  CG2 . THR B 1 67  ? 37.259 -10.239 -13.460 1.00 61.58  ? 167 THR B CG2 1 
ATOM   962  N  N   . TYR B 1 68  ? 39.383 -12.484 -13.097 1.00 50.20  ? 168 TYR B N   1 
ATOM   963  C  CA  . TYR B 1 68  ? 39.620 -13.663 -13.901 1.00 41.60  ? 168 TYR B CA  1 
ATOM   964  C  C   . TYR B 1 68  ? 38.331 -14.467 -14.001 1.00 44.44  ? 168 TYR B C   1 
ATOM   965  O  O   . TYR B 1 68  ? 37.474 -14.418 -13.111 1.00 48.30  ? 168 TYR B O   1 
ATOM   966  C  CB  . TYR B 1 68  ? 40.746 -14.497 -13.286 1.00 40.93  ? 168 TYR B CB  1 
ATOM   967  C  CG  . TYR B 1 68  ? 41.047 -15.780 -14.036 1.00 47.23  ? 168 TYR B CG  1 
ATOM   968  C  CD1 . TYR B 1 68  ? 41.921 -15.790 -15.126 1.00 46.23  ? 168 TYR B CD1 1 
ATOM   969  C  CD2 . TYR B 1 68  ? 40.465 -16.988 -13.650 1.00 46.69  ? 168 TYR B CD2 1 
ATOM   970  C  CE1 . TYR B 1 68  ? 42.202 -16.970 -15.811 1.00 44.50  ? 168 TYR B CE1 1 
ATOM   971  C  CE2 . TYR B 1 68  ? 40.739 -18.178 -14.328 1.00 48.48  ? 168 TYR B CE2 1 
ATOM   972  C  CZ  . TYR B 1 68  ? 41.606 -18.164 -15.408 1.00 49.47  ? 168 TYR B CZ  1 
ATOM   973  O  OH  . TYR B 1 68  ? 41.874 -19.343 -16.080 1.00 48.83  ? 168 TYR B OH  1 
ATOM   974  N  N   . ILE B 1 69  ? 38.179 -15.198 -15.095 1.00 44.69  ? 169 ILE B N   1 
ATOM   975  C  CA  . ILE B 1 69  ? 36.981 -15.993 -15.266 1.00 39.21  ? 169 ILE B CA  1 
ATOM   976  C  C   . ILE B 1 69  ? 37.305 -17.470 -15.293 1.00 37.67  ? 169 ILE B C   1 
ATOM   977  O  O   . ILE B 1 69  ? 38.224 -17.904 -15.990 1.00 39.47  ? 169 ILE B O   1 
ATOM   978  C  CB  . ILE B 1 69  ? 36.238 -15.595 -16.524 1.00 38.65  ? 169 ILE B CB  1 
ATOM   979  C  CG1 . ILE B 1 69  ? 35.589 -14.230 -16.304 1.00 46.05  ? 169 ILE B CG1 1 
ATOM   980  C  CG2 . ILE B 1 69  ? 35.186 -16.638 -16.880 1.00 33.52  ? 169 ILE B CG2 1 
ATOM   981  C  CD1 . ILE B 1 69  ? 34.750 -13.744 -17.481 1.00 50.17  ? 169 ILE B CD1 1 
ATOM   982  N  N   . ILE B 1 70  ? 36.561 -18.240 -14.503 1.00 32.57  ? 170 ILE B N   1 
ATOM   983  C  CA  . ILE B 1 70  ? 36.675 -19.681 -14.559 1.00 27.92  ? 170 ILE B CA  1 
ATOM   984  C  C   . ILE B 1 70  ? 35.550 -20.162 -15.445 1.00 32.04  ? 170 ILE B C   1 
ATOM   985  O  O   . ILE B 1 70  ? 34.363 -20.059 -15.079 1.00 28.72  ? 170 ILE B O   1 
ATOM   986  C  CB  . ILE B 1 70  ? 36.532 -20.306 -13.188 1.00 30.20  ? 170 ILE B CB  1 
ATOM   987  C  CG1 . ILE B 1 70  ? 37.660 -19.811 -12.284 1.00 34.44  ? 170 ILE B CG1 1 
ATOM   988  C  CG2 . ILE B 1 70  ? 36.529 -21.832 -13.301 1.00 22.95  ? 170 ILE B CG2 1 
ATOM   989  C  CD1 . ILE B 1 70  ? 37.549 -20.271 -10.825 1.00 30.77  ? 170 ILE B CD1 1 
ATOM   990  N  N   . ASP B 1 71  ? 35.911 -20.668 -16.622 1.00 30.82  ? 171 ASP B N   1 
ATOM   991  C  CA  . ASP B 1 71  ? 34.886 -21.015 -17.596 1.00 37.71  ? 171 ASP B CA  1 
ATOM   992  C  C   . ASP B 1 71  ? 34.701 -22.521 -17.694 1.00 37.27  ? 171 ASP B C   1 
ATOM   993  O  O   . ASP B 1 71  ? 35.244 -23.294 -16.886 1.00 30.33  ? 171 ASP B O   1 
ATOM   994  C  CB  . ASP B 1 71  ? 35.225 -20.454 -18.984 1.00 39.61  ? 171 ASP B CB  1 
ATOM   995  C  CG  . ASP B 1 71  ? 36.573 -20.947 -19.496 1.00 41.05  ? 171 ASP B CG  1 
ATOM   996  O  OD1 . ASP B 1 71  ? 37.012 -22.057 -19.082 1.00 38.90  ? 171 ASP B OD1 1 
ATOM   997  O  OD2 . ASP B 1 71  ? 37.203 -20.220 -20.307 1.00 37.37  ? 171 ASP B OD2 1 
ATOM   998  N  N   . LYS B 1 72  ? 33.918 -22.920 -18.692 1.00 33.20  ? 172 LYS B N   1 
ATOM   999  C  CA  . LYS B 1 72  ? 33.728 -24.323 -18.963 1.00 28.79  ? 172 LYS B CA  1 
ATOM   1000 C  C   . LYS B 1 72  ? 33.134 -25.114 -17.791 1.00 30.82  ? 172 LYS B C   1 
ATOM   1001 O  O   . LYS B 1 72  ? 33.453 -26.302 -17.602 1.00 31.09  ? 172 LYS B O   1 
ATOM   1002 C  CB  . LYS B 1 72  ? 35.043 -24.931 -19.461 1.00 25.02  ? 172 LYS B CB  1 
ATOM   1003 C  CG  . LYS B 1 72  ? 35.328 -24.547 -20.928 1.00 29.82  ? 172 LYS B CG  1 
ATOM   1004 C  CD  . LYS B 1 72  ? 36.733 -24.919 -21.388 1.00 29.80  ? 172 LYS B CD  1 
ATOM   1005 C  CE  . LYS B 1 72  ? 36.978 -26.422 -21.350 1.00 25.69  ? 172 LYS B CE  1 
ATOM   1006 N  NZ  . LYS B 1 72  ? 38.448 -26.656 -21.501 1.00 22.51  ? 172 LYS B NZ  1 
ATOM   1007 N  N   . LEU B 1 73  ? 32.236 -24.470 -17.044 1.00 29.34  ? 173 LEU B N   1 
ATOM   1008 C  CA  . LEU B 1 73  ? 31.622 -25.101 -15.872 1.00 33.94  ? 173 LEU B CA  1 
ATOM   1009 C  C   . LEU B 1 73  ? 30.177 -25.561 -16.109 1.00 38.72  ? 173 LEU B C   1 
ATOM   1010 O  O   . LEU B 1 73  ? 29.482 -25.029 -16.990 1.00 44.19  ? 173 LEU B O   1 
ATOM   1011 C  CB  . LEU B 1 73  ? 31.676 -24.156 -14.676 1.00 28.03  ? 173 LEU B CB  1 
ATOM   1012 C  CG  . LEU B 1 73  ? 33.081 -23.683 -14.300 1.00 29.43  ? 173 LEU B CG  1 
ATOM   1013 C  CD1 . LEU B 1 73  ? 33.027 -22.688 -13.137 1.00 27.16  ? 173 LEU B CD1 1 
ATOM   1014 C  CD2 . LEU B 1 73  ? 33.986 -24.861 -13.962 1.00 29.13  ? 173 LEU B CD2 1 
ATOM   1015 N  N   . ILE B 1 74  ? 29.738 -26.540 -15.309 1.00 30.85  ? 174 ILE B N   1 
ATOM   1016 C  CA  . ILE B 1 74  ? 28.410 -27.152 -15.430 1.00 32.02  ? 174 ILE B CA  1 
ATOM   1017 C  C   . ILE B 1 74  ? 27.354 -26.552 -14.483 1.00 33.72  ? 174 ILE B C   1 
ATOM   1018 O  O   . ILE B 1 74  ? 27.591 -26.419 -13.281 1.00 36.89  ? 174 ILE B O   1 
ATOM   1019 C  CB  . ILE B 1 74  ? 28.482 -28.654 -15.116 1.00 33.11  ? 174 ILE B CB  1 
ATOM   1020 C  CG1 . ILE B 1 74  ? 29.727 -29.282 -15.745 1.00 35.60  ? 174 ILE B CG1 1 
ATOM   1021 C  CG2 . ILE B 1 74  ? 27.208 -29.359 -15.566 1.00 28.22  ? 174 ILE B CG2 1 
ATOM   1022 C  CD1 . ILE B 1 74  ? 29.811 -29.076 -17.253 1.00 37.68  ? 174 ILE B CD1 1 
ATOM   1023 N  N   . PRO B 1 75  ? 26.170 -26.211 -15.025 1.00 35.56  ? 175 PRO B N   1 
ATOM   1024 C  CA  . PRO B 1 75  ? 25.064 -25.642 -14.222 1.00 32.53  ? 175 PRO B CA  1 
ATOM   1025 C  C   . PRO B 1 75  ? 24.649 -26.600 -13.123 1.00 30.86  ? 175 PRO B C   1 
ATOM   1026 O  O   . PRO B 1 75  ? 24.910 -27.800 -13.272 1.00 31.15  ? 175 PRO B O   1 
ATOM   1027 C  CB  . PRO B 1 75  ? 23.910 -25.511 -15.228 1.00 28.94  ? 175 PRO B CB  1 
ATOM   1028 C  CG  . PRO B 1 75  ? 24.576 -25.575 -16.614 1.00 23.95  ? 175 PRO B CG  1 
ATOM   1029 C  CD  . PRO B 1 75  ? 25.811 -26.418 -16.444 1.00 25.72  ? 175 PRO B CD  1 
ATOM   1030 N  N   . ASN B 1 76  ? 24.010 -26.084 -12.066 1.00 33.72  ? 176 ASN B N   1 
ATOM   1031 C  CA  . ASN B 1 76  ? 23.598 -26.878 -10.901 1.00 35.24  ? 176 ASN B CA  1 
ATOM   1032 C  C   . ASN B 1 76  ? 24.743 -27.727 -10.337 1.00 34.22  ? 176 ASN B C   1 
ATOM   1033 O  O   . ASN B 1 76  ? 24.521 -28.821 -9.817  1.00 38.83  ? 176 ASN B O   1 
ATOM   1034 C  CB  . ASN B 1 76  ? 22.370 -27.750 -11.200 1.00 43.27  ? 176 ASN B CB  1 
ATOM   1035 C  CG  . ASN B 1 76  ? 21.380 -27.076 -12.179 1.00 62.37  ? 176 ASN B CG  1 
ATOM   1036 O  OD1 . ASN B 1 76  ? 21.128 -25.869 -12.093 1.00 71.19  ? 176 ASN B OD1 1 
ATOM   1037 N  ND2 . ASN B 1 76  ? 20.830 -27.862 -13.122 1.00 60.72  ? 176 ASN B ND2 1 
ATOM   1038 N  N   . THR B 1 77  ? 25.966 -27.214 -10.431 1.00 28.61  ? 177 THR B N   1 
ATOM   1039 C  CA  . THR B 1 77  ? 27.121 -27.904 -9.868  1.00 29.84  ? 177 THR B CA  1 
ATOM   1040 C  C   . THR B 1 77  ? 27.760 -27.047 -8.782  1.00 28.05  ? 177 THR B C   1 
ATOM   1041 O  O   . THR B 1 77  ? 27.874 -25.821 -8.923  1.00 28.26  ? 177 THR B O   1 
ATOM   1042 C  CB  . THR B 1 77  ? 28.175 -28.209 -10.957 1.00 34.19  ? 177 THR B CB  1 
ATOM   1043 O  OG1 . THR B 1 77  ? 27.574 -28.985 -12.008 1.00 32.18  ? 177 THR B OG1 1 
ATOM   1044 C  CG2 . THR B 1 77  ? 29.398 -28.952 -10.354 1.00 16.01  ? 177 THR B CG2 1 
ATOM   1045 N  N   . ASN B 1 78  ? 28.187 -27.690 -7.704  1.00 26.81  ? 178 ASN B N   1 
ATOM   1046 C  CA  . ASN B 1 78  ? 28.763 -26.960 -6.586  1.00 27.76  ? 178 ASN B CA  1 
ATOM   1047 C  C   . ASN B 1 78  ? 30.267 -26.796 -6.765  1.00 28.60  ? 178 ASN B C   1 
ATOM   1048 O  O   . ASN B 1 78  ? 30.976 -27.787 -6.989  1.00 33.19  ? 178 ASN B O   1 
ATOM   1049 C  CB  . ASN B 1 78  ? 28.457 -27.696 -5.287  1.00 31.62  ? 178 ASN B CB  1 
ATOM   1050 C  CG  . ASN B 1 78  ? 28.537 -26.790 -4.071  1.00 38.07  ? 178 ASN B CG  1 
ATOM   1051 O  OD1 . ASN B 1 78  ? 29.186 -25.739 -4.098  1.00 47.37  ? 178 ASN B OD1 1 
ATOM   1052 N  ND2 . ASN B 1 78  ? 27.891 -27.205 -2.989  1.00 35.18  ? 178 ASN B ND2 1 
ATOM   1053 N  N   . TYR B 1 79  ? 30.764 -25.559 -6.680  1.00 22.88  ? 179 TYR B N   1 
ATOM   1054 C  CA  . TYR B 1 79  ? 32.208 -25.329 -6.826  1.00 22.03  ? 179 TYR B CA  1 
ATOM   1055 C  C   . TYR B 1 79  ? 32.802 -24.553 -5.637  1.00 27.73  ? 179 TYR B C   1 
ATOM   1056 O  O   . TYR B 1 79  ? 32.136 -23.681 -5.026  1.00 21.82  ? 179 TYR B O   1 
ATOM   1057 C  CB  . TYR B 1 79  ? 32.536 -24.575 -8.134  1.00 22.33  ? 179 TYR B CB  1 
ATOM   1058 C  CG  . TYR B 1 79  ? 32.223 -25.318 -9.418  1.00 33.07  ? 179 TYR B CG  1 
ATOM   1059 C  CD1 . TYR B 1 79  ? 33.205 -26.040 -10.085 1.00 34.87  ? 179 TYR B CD1 1 
ATOM   1060 C  CD2 . TYR B 1 79  ? 30.939 -25.281 -9.979  1.00 33.55  ? 179 TYR B CD2 1 
ATOM   1061 C  CE1 . TYR B 1 79  ? 32.913 -26.717 -11.287 1.00 34.24  ? 179 TYR B CE1 1 
ATOM   1062 C  CE2 . TYR B 1 79  ? 30.645 -25.952 -11.164 1.00 35.46  ? 179 TYR B CE2 1 
ATOM   1063 C  CZ  . TYR B 1 79  ? 31.631 -26.663 -11.809 1.00 38.31  ? 179 TYR B CZ  1 
ATOM   1064 O  OH  . TYR B 1 79  ? 31.323 -27.326 -12.975 1.00 44.10  ? 179 TYR B OH  1 
ATOM   1065 N  N   . CYS B 1 80  ? 34.059 -24.865 -5.325  1.00 26.94  ? 180 CYS B N   1 
ATOM   1066 C  CA  . CYS B 1 80  ? 34.796 -24.112 -4.319  1.00 29.92  ? 180 CYS B CA  1 
ATOM   1067 C  C   . CYS B 1 80  ? 36.073 -23.587 -4.970  1.00 29.59  ? 180 CYS B C   1 
ATOM   1068 O  O   . CYS B 1 80  ? 36.724 -24.305 -5.735  1.00 26.65  ? 180 CYS B O   1 
ATOM   1069 C  CB  . CYS B 1 80  ? 35.137 -24.987 -3.113  1.00 25.42  ? 180 CYS B CB  1 
ATOM   1070 S  SG  . CYS B 1 80  ? 33.732 -25.449 -2.117  1.00 42.68  ? 180 CYS B SG  1 
ATOM   1071 N  N   . VAL B 1 81  ? 36.405 -22.334 -4.662  1.00 24.27  ? 181 VAL B N   1 
ATOM   1072 C  CA  . VAL B 1 81  ? 37.585 -21.681 -5.189  1.00 26.75  ? 181 VAL B CA  1 
ATOM   1073 C  C   . VAL B 1 81  ? 38.519 -21.281 -4.053  1.00 34.22  ? 181 VAL B C   1 
ATOM   1074 O  O   . VAL B 1 81  ? 38.085 -20.888 -2.960  1.00 35.50  ? 181 VAL B O   1 
ATOM   1075 C  CB  . VAL B 1 81  ? 37.215 -20.423 -5.987  1.00 28.68  ? 181 VAL B CB  1 
ATOM   1076 C  CG1 . VAL B 1 81  ? 38.486 -19.753 -6.586  1.00 13.69  ? 181 VAL B CG1 1 
ATOM   1077 C  CG2 . VAL B 1 81  ? 36.223 -20.793 -7.092  1.00 23.73  ? 181 VAL B CG2 1 
ATOM   1078 N  N   . SER B 1 82  ? 39.811 -21.414 -4.312  1.00 37.86  ? 182 SER B N   1 
ATOM   1079 C  CA  . SER B 1 82  ? 40.834 -21.003 -3.365  1.00 37.91  ? 182 SER B CA  1 
ATOM   1080 C  C   . SER B 1 82  ? 41.806 -20.141 -4.150  1.00 37.48  ? 182 SER B C   1 
ATOM   1081 O  O   . SER B 1 82  ? 41.974 -20.316 -5.364  1.00 41.15  ? 182 SER B O   1 
ATOM   1082 C  CB  . SER B 1 82  ? 41.553 -22.225 -2.786  1.00 38.16  ? 182 SER B CB  1 
ATOM   1083 O  OG  . SER B 1 82  ? 42.430 -21.856 -1.735  1.00 39.31  ? 182 SER B OG  1 
ATOM   1084 N  N   . VAL B 1 83  ? 42.438 -19.204 -3.465  1.00 35.51  ? 183 VAL B N   1 
ATOM   1085 C  CA  . VAL B 1 83  ? 43.331 -18.265 -4.107  1.00 39.33  ? 183 VAL B CA  1 
ATOM   1086 C  C   . VAL B 1 83  ? 44.597 -18.132 -3.275  1.00 48.42  ? 183 VAL B C   1 
ATOM   1087 O  O   . VAL B 1 83  ? 44.526 -17.786 -2.092  1.00 59.62  ? 183 VAL B O   1 
ATOM   1088 C  CB  . VAL B 1 83  ? 42.685 -16.895 -4.164  1.00 40.74  ? 183 VAL B CB  1 
ATOM   1089 C  CG1 . VAL B 1 83  ? 43.692 -15.874 -4.628  1.00 48.25  ? 183 VAL B CG1 1 
ATOM   1090 C  CG2 . VAL B 1 83  ? 41.458 -16.918 -5.070  1.00 39.28  ? 183 VAL B CG2 1 
ATOM   1091 N  N   . TYR B 1 84  ? 45.758 -18.382 -3.871  1.00 44.84  ? 184 TYR B N   1 
ATOM   1092 C  CA  . TYR B 1 84  ? 46.999 -18.242 -3.114  1.00 42.80  ? 184 TYR B CA  1 
ATOM   1093 C  C   . TYR B 1 84  ? 48.215 -17.868 -3.961  1.00 44.31  ? 184 TYR B C   1 
ATOM   1094 O  O   . TYR B 1 84  ? 48.095 -17.593 -5.171  1.00 41.22  ? 184 TYR B O   1 
ATOM   1095 C  CB  . TYR B 1 84  ? 47.277 -19.512 -2.329  1.00 44.40  ? 184 TYR B CB  1 
ATOM   1096 C  CG  . TYR B 1 84  ? 47.262 -20.757 -3.184  1.00 45.03  ? 184 TYR B CG  1 
ATOM   1097 C  CD1 . TYR B 1 84  ? 46.070 -21.406 -3.478  1.00 42.94  ? 184 TYR B CD1 1 
ATOM   1098 C  CD2 . TYR B 1 84  ? 48.440 -21.286 -3.690  1.00 42.63  ? 184 TYR B CD2 1 
ATOM   1099 C  CE1 . TYR B 1 84  ? 46.051 -22.553 -4.253  1.00 43.99  ? 184 TYR B CE1 1 
ATOM   1100 C  CE2 . TYR B 1 84  ? 48.433 -22.432 -4.463  1.00 45.44  ? 184 TYR B CE2 1 
ATOM   1101 C  CZ  . TYR B 1 84  ? 47.232 -23.064 -4.747  1.00 46.23  ? 184 TYR B CZ  1 
ATOM   1102 O  OH  . TYR B 1 84  ? 47.203 -24.211 -5.523  1.00 44.89  ? 184 TYR B OH  1 
ATOM   1103 N  N   . LEU B 1 85  ? 49.379 -17.854 -3.307  1.00 44.21  ? 185 LEU B N   1 
ATOM   1104 C  CA  . LEU B 1 85  ? 50.614 -17.365 -3.919  1.00 46.52  ? 185 LEU B CA  1 
ATOM   1105 C  C   . LEU B 1 85  ? 51.777 -18.352 -3.835  1.00 54.31  ? 185 LEU B C   1 
ATOM   1106 O  O   . LEU B 1 85  ? 52.221 -18.701 -2.737  1.00 58.36  ? 185 LEU B O   1 
ATOM   1107 C  CB  . LEU B 1 85  ? 51.014 -16.047 -3.266  1.00 42.80  ? 185 LEU B CB  1 
ATOM   1108 C  CG  . LEU B 1 85  ? 50.079 -14.892 -3.611  1.00 41.15  ? 185 LEU B CG  1 
ATOM   1109 C  CD1 . LEU B 1 85  ? 50.328 -13.701 -2.717  1.00 40.04  ? 185 LEU B CD1 1 
ATOM   1110 C  CD2 . LEU B 1 85  ? 50.263 -14.515 -5.072  1.00 41.61  ? 185 LEU B CD2 1 
ATOM   1111 N  N   . GLU B 1 86  ? 52.288 -18.773 -4.993  1.00 57.04  ? 186 GLU B N   1 
ATOM   1112 C  CA  . GLU B 1 86  ? 53.370 -19.764 -5.045  1.00 63.80  ? 186 GLU B CA  1 
ATOM   1113 C  C   . GLU B 1 86  ? 54.562 -19.324 -5.902  1.00 68.40  ? 186 GLU B C   1 
ATOM   1114 O  O   . GLU B 1 86  ? 54.396 -18.562 -6.861  1.00 68.41  ? 186 GLU B O   1 
ATOM   1115 C  CB  . GLU B 1 86  ? 52.845 -21.105 -5.586  1.00 69.17  ? 186 GLU B CB  1 
ATOM   1116 C  CG  . GLU B 1 86  ? 52.429 -21.060 -7.064  1.00 73.35  ? 186 GLU B CG  1 
ATOM   1117 C  CD  . GLU B 1 86  ? 52.319 -22.441 -7.703  1.00 74.17  ? 186 GLU B CD  1 
ATOM   1118 O  OE1 . GLU B 1 86  ? 51.764 -23.360 -7.049  1.00 72.87  ? 186 GLU B OE1 1 
ATOM   1119 O  OE2 . GLU B 1 86  ? 52.794 -22.598 -8.859  1.00 74.40  ? 186 GLU B OE2 1 
ATOM   1120 N  N   . HIS B 1 87  ? 55.754 -19.822 -5.557  1.00 74.64  ? 187 HIS B N   1 
ATOM   1121 C  CA  . HIS B 1 87  ? 56.942 -19.700 -6.416  1.00 78.80  ? 187 HIS B CA  1 
ATOM   1122 C  C   . HIS B 1 87  ? 57.220 -20.997 -7.219  1.00 93.97  ? 187 HIS B C   1 
ATOM   1123 O  O   . HIS B 1 87  ? 57.817 -20.953 -8.301  1.00 89.57  ? 187 HIS B O   1 
ATOM   1124 C  CB  . HIS B 1 87  ? 58.167 -19.286 -5.592  1.00 76.03  ? 187 HIS B CB  1 
ATOM   1125 N  N   . SER B 1 88  ? 56.782 -22.136 -6.672  1.00 95.90  ? 188 SER B N   1 
ATOM   1126 C  CA  . SER B 1 88  ? 56.901 -23.458 -7.303  1.00 95.05  ? 188 SER B CA  1 
ATOM   1127 C  C   . SER B 1 88  ? 55.771 -24.351 -6.772  1.00 94.65  ? 188 SER B C   1 
ATOM   1128 O  O   . SER B 1 88  ? 54.978 -23.908 -5.941  1.00 94.62  ? 188 SER B O   1 
ATOM   1129 C  CB  . SER B 1 88  ? 58.265 -24.088 -6.997  1.00 95.39  ? 188 SER B CB  1 
ATOM   1130 N  N   . ASP B 1 89  ? 55.687 -25.600 -7.233  1.00 94.73  ? 189 ASP B N   1 
ATOM   1131 C  CA  . ASP B 1 89  ? 54.621 -26.502 -6.761  1.00 92.49  ? 189 ASP B CA  1 
ATOM   1132 C  C   . ASP B 1 89  ? 55.104 -27.629 -5.832  1.00 90.04  ? 189 ASP B C   1 
ATOM   1133 O  O   . ASP B 1 89  ? 56.298 -27.943 -5.763  1.00 88.33  ? 189 ASP B O   1 
ATOM   1134 C  CB  . ASP B 1 89  ? 53.817 -27.075 -7.940  1.00 89.74  ? 189 ASP B CB  1 
ATOM   1135 N  N   . GLN B 1 91  ? 56.906 -27.759 -3.117  1.00 58.92  ? 191 GLN B N   1 
ATOM   1136 C  CA  . GLN B 1 91  ? 57.007 -26.396 -2.587  1.00 64.51  ? 191 GLN B CA  1 
ATOM   1137 C  C   . GLN B 1 91  ? 55.870 -26.116 -1.605  1.00 70.96  ? 191 GLN B C   1 
ATOM   1138 O  O   . GLN B 1 91  ? 54.748 -26.597 -1.805  1.00 79.73  ? 191 GLN B O   1 
ATOM   1139 C  CB  . GLN B 1 91  ? 56.981 -25.370 -3.720  1.00 62.93  ? 191 GLN B CB  1 
ATOM   1140 N  N   . ALA B 1 92  ? 56.152 -25.352 -0.547  1.00 62.82  ? 192 ALA B N   1 
ATOM   1141 C  CA  . ALA B 1 92  ? 55.129 -25.037 0.454   1.00 59.40  ? 192 ALA B CA  1 
ATOM   1142 C  C   . ALA B 1 92  ? 54.321 -23.765 0.131   1.00 55.42  ? 192 ALA B C   1 
ATOM   1143 O  O   . ALA B 1 92  ? 54.881 -22.760 -0.336  1.00 53.88  ? 192 ALA B O   1 
ATOM   1144 C  CB  . ALA B 1 92  ? 55.739 -24.943 1.843   1.00 60.53  ? 192 ALA B CB  1 
ATOM   1145 N  N   . VAL B 1 93  ? 53.008 -23.829 0.389   1.00 50.44  ? 193 VAL B N   1 
ATOM   1146 C  CA  . VAL B 1 93  ? 52.076 -22.713 0.179   1.00 45.26  ? 193 VAL B CA  1 
ATOM   1147 C  C   . VAL B 1 93  ? 51.020 -22.684 1.288   1.00 48.62  ? 193 VAL B C   1 
ATOM   1148 O  O   . VAL B 1 93  ? 50.739 -23.719 1.911   1.00 52.24  ? 193 VAL B O   1 
ATOM   1149 C  CB  . VAL B 1 93  ? 51.352 -22.813 -1.190  1.00 46.46  ? 193 VAL B CB  1 
ATOM   1150 C  CG1 . VAL B 1 93  ? 52.349 -22.849 -2.339  1.00 42.46  ? 193 VAL B CG1 1 
ATOM   1151 C  CG2 . VAL B 1 93  ? 50.458 -24.046 -1.238  1.00 47.13  ? 193 VAL B CG2 1 
ATOM   1152 N  N   . ILE B 1 94  ? 50.458 -21.500 1.549   1.00 48.14  ? 194 ILE B N   1 
ATOM   1153 C  CA  . ILE B 1 94  ? 49.321 -21.348 2.469   1.00 45.04  ? 194 ILE B CA  1 
ATOM   1154 C  C   . ILE B 1 94  ? 48.054 -21.002 1.666   1.00 46.41  ? 194 ILE B C   1 
ATOM   1155 O  O   . ILE B 1 94  ? 48.008 -19.991 0.944   1.00 48.56  ? 194 ILE B O   1 
ATOM   1156 C  CB  . ILE B 1 94  ? 49.578 -20.255 3.540   1.00 46.98  ? 194 ILE B CB  1 
ATOM   1157 C  CG1 . ILE B 1 94  ? 50.707 -20.677 4.487   1.00 49.22  ? 194 ILE B CG1 1 
ATOM   1158 C  CG2 . ILE B 1 94  ? 48.290 -19.935 4.318   1.00 36.23  ? 194 ILE B CG2 1 
ATOM   1159 C  CD1 . ILE B 1 94  ? 51.429 -19.515 5.116   1.00 48.42  ? 194 ILE B CD1 1 
ATOM   1160 N  N   . LYS B 1 95  ? 47.031 -21.841 1.773   1.00 42.19  ? 195 LYS B N   1 
ATOM   1161 C  CA  . LYS B 1 95  ? 45.871 -21.696 0.902   1.00 43.42  ? 195 LYS B CA  1 
ATOM   1162 C  C   . LYS B 1 95  ? 44.789 -20.862 1.558   1.00 39.47  ? 195 LYS B C   1 
ATOM   1163 O  O   . LYS B 1 95  ? 44.629 -20.872 2.791   1.00 36.07  ? 195 LYS B O   1 
ATOM   1164 C  CB  . LYS B 1 95  ? 45.329 -23.065 0.442   1.00 48.68  ? 195 LYS B CB  1 
ATOM   1165 C  CG  . LYS B 1 95  ? 46.292 -23.832 -0.470  1.00 50.52  ? 195 LYS B CG  1 
ATOM   1166 C  CD  . LYS B 1 95  ? 45.565 -24.626 -1.543  1.00 52.94  ? 195 LYS B CD  1 
ATOM   1167 C  CE  . LYS B 1 95  ? 45.761 -26.132 -1.369  1.00 59.45  ? 195 LYS B CE  1 
ATOM   1168 N  NZ  . LYS B 1 95  ? 46.513 -26.789 -2.494  1.00 61.21  ? 195 LYS B NZ  1 
ATOM   1169 N  N   . SER B 1 96  ? 44.055 -20.112 0.742   1.00 38.56  ? 196 SER B N   1 
ATOM   1170 C  CA  . SER B 1 96  ? 42.979 -19.311 1.305   1.00 40.12  ? 196 SER B CA  1 
ATOM   1171 C  C   . SER B 1 96  ? 41.849 -20.243 1.733   1.00 42.74  ? 196 SER B C   1 
ATOM   1172 O  O   . SER B 1 96  ? 41.754 -21.381 1.249   1.00 42.50  ? 196 SER B O   1 
ATOM   1173 C  CB  . SER B 1 96  ? 42.444 -18.316 0.286   1.00 34.97  ? 196 SER B CB  1 
ATOM   1174 O  OG  . SER B 1 96  ? 41.646 -18.985 -0.676  1.00 36.07  ? 196 SER B OG  1 
ATOM   1175 N  N   . PRO B 1 97  ? 41.005 -19.787 2.674   1.00 36.39  ? 197 PRO B N   1 
ATOM   1176 C  CA  . PRO B 1 97  ? 39.748 -20.524 2.840   1.00 33.12  ? 197 PRO B CA  1 
ATOM   1177 C  C   . PRO B 1 97  ? 39.032 -20.629 1.499   1.00 31.58  ? 197 PRO B C   1 
ATOM   1178 O  O   . PRO B 1 97  ? 39.111 -19.701 0.684   1.00 28.96  ? 197 PRO B O   1 
ATOM   1179 C  CB  . PRO B 1 97  ? 38.947 -19.632 3.792   1.00 23.25  ? 197 PRO B CB  1 
ATOM   1180 C  CG  . PRO B 1 97  ? 39.996 -19.021 4.649   1.00 20.88  ? 197 PRO B CG  1 
ATOM   1181 C  CD  . PRO B 1 97  ? 41.210 -18.797 3.746   1.00 22.47  ? 197 PRO B CD  1 
ATOM   1182 N  N   . LEU B 1 98  ? 38.360 -21.754 1.284   1.00 28.87  ? 198 LEU B N   1 
ATOM   1183 C  CA  . LEU B 1 98  ? 37.572 -21.968 0.088   1.00 29.54  ? 198 LEU B CA  1 
ATOM   1184 C  C   . LEU B 1 98  ? 36.364 -21.038 0.062   1.00 36.13  ? 198 LEU B C   1 
ATOM   1185 O  O   . LEU B 1 98  ? 35.714 -20.808 1.092   1.00 38.11  ? 198 LEU B O   1 
ATOM   1186 C  CB  . LEU B 1 98  ? 37.085 -23.412 0.048   1.00 23.62  ? 198 LEU B CB  1 
ATOM   1187 C  CG  . LEU B 1 98  ? 38.255 -24.373 -0.048  1.00 28.16  ? 198 LEU B CG  1 
ATOM   1188 C  CD1 . LEU B 1 98  ? 37.778 -25.776 0.231   1.00 24.06  ? 198 LEU B CD1 1 
ATOM   1189 C  CD2 . LEU B 1 98  ? 38.875 -24.276 -1.448  1.00 36.04  ? 198 LEU B CD2 1 
ATOM   1190 N  N   . LYS B 1 99  ? 36.068 -20.499 -1.116  1.00 35.11  ? 199 LYS B N   1 
ATOM   1191 C  CA  . LYS B 1 99  ? 34.810 -19.793 -1.313  1.00 34.28  ? 199 LYS B CA  1 
ATOM   1192 C  C   . LYS B 1 99  ? 33.947 -20.623 -2.258  1.00 31.46  ? 199 LYS B C   1 
ATOM   1193 O  O   . LYS B 1 99  ? 34.381 -21.022 -3.342  1.00 31.72  ? 199 LYS B O   1 
ATOM   1194 C  CB  . LYS B 1 99  ? 35.043 -18.374 -1.831  1.00 33.21  ? 199 LYS B CB  1 
ATOM   1195 C  CG  . LYS B 1 99  ? 34.896 -17.310 -0.757  1.00 35.26  ? 199 LYS B CG  1 
ATOM   1196 C  CD  . LYS B 1 99  ? 35.526 -15.971 -1.146  1.00 37.82  ? 199 LYS B CD  1 
ATOM   1197 C  CE  . LYS B 1 99  ? 36.296 -15.367 0.034   1.00 39.04  ? 199 LYS B CE  1 
ATOM   1198 N  NZ  . LYS B 1 99  ? 35.755 -14.045 0.435   1.00 42.89  ? 199 LYS B NZ  1 
ATOM   1199 N  N   . CYS B 1 100 ? 32.726 -20.909 -1.836  1.00 29.64  ? 200 CYS B N   1 
ATOM   1200 C  CA  . CYS B 1 100 ? 31.926 -21.882 -2.551  1.00 30.05  ? 200 CYS B CA  1 
ATOM   1201 C  C   . CYS B 1 100 ? 30.640 -21.315 -3.137  1.00 33.90  ? 200 CYS B C   1 
ATOM   1202 O  O   . CYS B 1 100 ? 30.070 -20.330 -2.621  1.00 36.21  ? 200 CYS B O   1 
ATOM   1203 C  CB  . CYS B 1 100 ? 31.601 -23.060 -1.630  1.00 27.18  ? 200 CYS B CB  1 
ATOM   1204 S  SG  . CYS B 1 100 ? 33.070 -23.872 -0.929  1.00 40.54  ? 200 CYS B SG  1 
ATOM   1205 N  N   . THR B 1 101 ? 30.177 -21.956 -4.208  1.00 26.40  ? 201 THR B N   1 
ATOM   1206 C  CA  . THR B 1 101 ? 28.942 -21.544 -4.834  1.00 28.78  ? 201 THR B CA  1 
ATOM   1207 C  C   . THR B 1 101 ? 28.289 -22.643 -5.679  1.00 31.40  ? 201 THR B C   1 
ATOM   1208 O  O   . THR B 1 101 ? 28.960 -23.512 -6.277  1.00 31.47  ? 201 THR B O   1 
ATOM   1209 C  CB  . THR B 1 101 ? 29.155 -20.273 -5.684  1.00 35.90  ? 201 THR B CB  1 
ATOM   1210 O  OG1 . THR B 1 101 ? 27.886 -19.744 -6.082  1.00 44.67  ? 201 THR B OG1 1 
ATOM   1211 C  CG2 . THR B 1 101 ? 30.006 -20.584 -6.922  1.00 27.84  ? 201 THR B CG2 1 
ATOM   1212 N  N   . LEU B 1 102 ? 26.964 -22.597 -5.700  1.00 28.18  ? 202 LEU B N   1 
ATOM   1213 C  CA  . LEU B 1 102 ? 26.179 -23.518 -6.495  1.00 32.98  ? 202 LEU B CA  1 
ATOM   1214 C  C   . LEU B 1 102 ? 25.679 -22.760 -7.723  1.00 35.41  ? 202 LEU B C   1 
ATOM   1215 O  O   . LEU B 1 102 ? 24.917 -21.793 -7.584  1.00 38.26  ? 202 LEU B O   1 
ATOM   1216 C  CB  . LEU B 1 102 ? 24.994 -24.026 -5.672  1.00 29.16  ? 202 LEU B CB  1 
ATOM   1217 C  CG  . LEU B 1 102 ? 24.029 -24.944 -6.420  1.00 29.61  ? 202 LEU B CG  1 
ATOM   1218 C  CD1 . LEU B 1 102 ? 24.757 -26.222 -6.853  1.00 28.22  ? 202 LEU B CD1 1 
ATOM   1219 C  CD2 . LEU B 1 102 ? 22.766 -25.279 -5.590  1.00 21.41  ? 202 LEU B CD2 1 
ATOM   1220 N  N   . LEU B 1 103 ? 26.121 -23.179 -8.912  1.00 31.98  ? 203 LEU B N   1 
ATOM   1221 C  CA  . LEU B 1 103 ? 25.727 -22.517 -10.156 1.00 28.40  ? 203 LEU B CA  1 
ATOM   1222 C  C   . LEU B 1 103 ? 24.248 -22.742 -10.428 1.00 30.90  ? 203 LEU B C   1 
ATOM   1223 O  O   . LEU B 1 103 ? 23.731 -23.850 -10.231 1.00 31.85  ? 203 LEU B O   1 
ATOM   1224 C  CB  . LEU B 1 103 ? 26.527 -23.048 -11.337 1.00 28.42  ? 203 LEU B CB  1 
ATOM   1225 C  CG  . LEU B 1 103 ? 28.045 -23.013 -11.181 1.00 27.36  ? 203 LEU B CG  1 
ATOM   1226 C  CD1 . LEU B 1 103 ? 28.684 -23.335 -12.546 1.00 23.59  ? 203 LEU B CD1 1 
ATOM   1227 C  CD2 . LEU B 1 103 ? 28.498 -21.638 -10.657 1.00 21.01  ? 203 LEU B CD2 1 
ATOM   1228 N  N   . PRO B 1 104 ? 23.571 -21.686 -10.889 1.00 33.41  ? 204 PRO B N   1 
ATOM   1229 C  CA  . PRO B 1 104 ? 22.155 -21.662 -11.295 1.00 37.55  ? 204 PRO B CA  1 
ATOM   1230 C  C   . PRO B 1 104 ? 21.908 -22.507 -12.542 1.00 42.86  ? 204 PRO B C   1 
ATOM   1231 O  O   . PRO B 1 104 ? 22.858 -22.778 -13.295 1.00 41.37  ? 204 PRO B O   1 
ATOM   1232 C  CB  . PRO B 1 104 ? 21.916 -20.191 -11.679 1.00 38.15  ? 204 PRO B CB  1 
ATOM   1233 C  CG  . PRO B 1 104 ? 23.174 -19.444 -11.301 1.00 38.93  ? 204 PRO B CG  1 
ATOM   1234 C  CD  . PRO B 1 104 ? 24.281 -20.446 -11.243 1.00 36.10  ? 204 PRO B CD  1 
ATOM   1235 N  N   . PRO B 1 105 ? 20.640 -22.899 -12.780 1.00 51.27  ? 205 PRO B N   1 
ATOM   1236 C  CA  . PRO B 1 105 ? 20.247 -23.581 -14.026 1.00 51.91  ? 205 PRO B CA  1 
ATOM   1237 C  C   . PRO B 1 105 ? 20.384 -22.652 -15.239 1.00 56.78  ? 205 PRO B C   1 
ATOM   1238 O  O   . PRO B 1 105 ? 20.612 -23.082 -16.377 1.00 59.17  ? 205 PRO B O   1 
ATOM   1239 C  CB  . PRO B 1 105 ? 18.765 -23.921 -13.796 1.00 52.03  ? 205 PRO B CB  1 
ATOM   1240 C  CG  . PRO B 1 105 ? 18.547 -23.812 -12.309 1.00 50.20  ? 205 PRO B CG  1 
ATOM   1241 C  CD  . PRO B 1 105 ? 19.511 -22.759 -11.841 1.00 51.17  ? 205 PRO B CD  1 
ATOM   1242 O  OXT . PRO B 1 105 ? 20.278 -21.428 -15.105 1.00 60.51  ? 205 PRO B OXT 1 
ATOM   1243 N  N   . SER C 1 6   ? 3.923  -33.896 15.602  1.00 63.07  ? 106 SER C N   1 
ATOM   1244 C  CA  . SER C 1 6   ? 2.921  -33.447 16.524  1.00 64.83  ? 106 SER C CA  1 
ATOM   1245 C  C   . SER C 1 6   ? 2.129  -32.325 15.955  1.00 71.25  ? 106 SER C C   1 
ATOM   1246 O  O   . SER C 1 6   ? 1.138  -31.904 16.514  1.00 78.29  ? 106 SER C O   1 
ATOM   1247 C  CB  . SER C 1 6   ? 3.569  -32.974 17.802  1.00 61.33  ? 106 SER C CB  1 
ATOM   1248 N  N   . PHE C 1 7   ? 2.556  -31.797 14.849  1.00 67.02  ? 107 PHE C N   1 
ATOM   1249 C  CA  . PHE C 1 7   ? 1.927  -30.593 14.414  1.00 66.34  ? 107 PHE C CA  1 
ATOM   1250 C  C   . PHE C 1 7   ? 1.561  -30.589 12.963  1.00 64.21  ? 107 PHE C C   1 
ATOM   1251 O  O   . PHE C 1 7   ? 1.789  -31.527 12.262  1.00 64.55  ? 107 PHE C O   1 
ATOM   1252 C  CB  . PHE C 1 7   ? 2.817  -29.410 14.741  1.00 69.31  ? 107 PHE C CB  1 
ATOM   1253 C  CG  . PHE C 1 7   ? 2.114  -28.134 14.659  1.00 74.82  ? 107 PHE C CG  1 
ATOM   1254 C  CD1 . PHE C 1 7   ? 0.844  -28.010 15.089  1.00 78.40  ? 107 PHE C CD1 1 
ATOM   1255 C  CD2 . PHE C 1 7   ? 2.724  -27.058 14.096  1.00 75.80  ? 107 PHE C CD2 1 
ATOM   1256 C  CE1 . PHE C 1 7   ? 0.235  -26.843 14.983  1.00 84.81  ? 107 PHE C CE1 1 
ATOM   1257 C  CE2 . PHE C 1 7   ? 2.106  -25.899 13.991  1.00 80.18  ? 107 PHE C CE2 1 
ATOM   1258 C  CZ  . PHE C 1 7   ? 0.869  -25.784 14.424  1.00 85.96  ? 107 PHE C CZ  1 
ATOM   1259 N  N   . GLU C 1 8   ? 0.978  -29.499 12.533  1.00 62.26  ? 108 GLU C N   1 
ATOM   1260 C  CA  . GLU C 1 8   ? 0.570  -29.353 11.165  1.00 64.00  ? 108 GLU C CA  1 
ATOM   1261 C  C   . GLU C 1 8   ? 1.706  -29.130 10.233  1.00 54.82  ? 108 GLU C C   1 
ATOM   1262 O  O   . GLU C 1 8   ? 2.698  -28.537 10.535  1.00 55.40  ? 108 GLU C O   1 
ATOM   1263 C  CB  . GLU C 1 8   ? -0.395 -28.205 11.001  1.00 71.35  ? 108 GLU C CB  1 
ATOM   1264 C  CG  . GLU C 1 8   ? -1.518 -28.256 11.936  1.00 79.94  ? 108 GLU C CG  1 
ATOM   1265 C  CD  . GLU C 1 8   ? -2.577 -29.159 11.476  1.00 87.18  ? 108 GLU C CD  1 
ATOM   1266 O  OE1 . GLU C 1 8   ? -3.693 -28.688 11.259  1.00 91.39  ? 108 GLU C OE1 1 
ATOM   1267 O  OE2 . GLU C 1 8   ? -2.304 -30.339 11.329  1.00 87.44  ? 108 GLU C OE2 1 
ATOM   1268 N  N   . PRO C 1 9   ? 1.493  -29.612 9.054   1.00 45.02  ? 109 PRO C N   1 
ATOM   1269 C  CA  . PRO C 1 9   ? 2.461  -29.555 7.953   1.00 41.57  ? 109 PRO C CA  1 
ATOM   1270 C  C   . PRO C 1 9   ? 2.767  -28.181 7.464   1.00 36.81  ? 109 PRO C C   1 
ATOM   1271 O  O   . PRO C 1 9   ? 1.897  -27.388 7.447   1.00 39.86  ? 109 PRO C O   1 
ATOM   1272 C  CB  . PRO C 1 9   ? 1.743  -30.281 6.841   1.00 43.74  ? 109 PRO C CB  1 
ATOM   1273 C  CG  . PRO C 1 9   ? 0.684  -30.972 7.438   1.00 45.23  ? 109 PRO C CG  1 
ATOM   1274 C  CD  . PRO C 1 9   ? 0.264  -30.259 8.621   1.00 43.76  ? 109 PRO C CD  1 
ATOM   1275 N  N   . PRO C 1 10  ? 3.973  -27.886 7.053   1.00 35.03  ? 110 PRO C N   1 
ATOM   1276 C  CA  . PRO C 1 10  ? 4.228  -26.527 6.665   1.00 36.20  ? 110 PRO C CA  1 
ATOM   1277 C  C   . PRO C 1 10  ? 3.662  -26.280 5.294   1.00 41.32  ? 110 PRO C C   1 
ATOM   1278 O  O   . PRO C 1 10  ? 3.348  -27.171 4.576   1.00 41.27  ? 110 PRO C O   1 
ATOM   1279 C  CB  . PRO C 1 10  ? 5.740  -26.444 6.655   1.00 33.79  ? 110 PRO C CB  1 
ATOM   1280 C  CG  . PRO C 1 10  ? 6.217  -27.669 6.994   1.00 34.02  ? 110 PRO C CG  1 
ATOM   1281 C  CD  . PRO C 1 10  ? 5.198  -28.592 7.383   1.00 34.61  ? 110 PRO C CD  1 
ATOM   1282 N  N   . GLU C 1 11  ? 3.519  -25.045 4.913   1.00 45.48  ? 111 GLU C N   1 
ATOM   1283 C  CA  . GLU C 1 11  ? 3.213  -24.823 3.514   1.00 48.15  ? 111 GLU C CA  1 
ATOM   1284 C  C   . GLU C 1 11  ? 4.459  -25.189 2.718   1.00 46.60  ? 111 GLU C C   1 
ATOM   1285 O  O   . GLU C 1 11  ? 5.584  -25.105 3.229   1.00 44.40  ? 111 GLU C O   1 
ATOM   1286 C  CB  . GLU C 1 11  ? 2.890  -23.357 3.275   1.00 56.87  ? 111 GLU C CB  1 
ATOM   1287 C  CG  . GLU C 1 11  ? 1.420  -23.023 3.241   1.00 69.16  ? 111 GLU C CG  1 
ATOM   1288 C  CD  . GLU C 1 11  ? 1.199  -21.525 3.262   1.00 79.64  ? 111 GLU C CD  1 
ATOM   1289 O  OE1 . GLU C 1 11  ? 1.056  -20.978 4.382   1.00 81.52  ? 111 GLU C OE1 1 
ATOM   1290 O  OE2 . GLU C 1 11  ? 1.203  -20.897 2.169   1.00 81.13  ? 111 GLU C OE2 1 
ATOM   1291 N  N   . PHE C 1 12  ? 4.276  -25.584 1.466   1.00 47.60  ? 112 PHE C N   1 
ATOM   1292 C  CA  . PHE C 1 12  ? 5.429  -25.819 0.611   1.00 44.08  ? 112 PHE C CA  1 
ATOM   1293 C  C   . PHE C 1 12  ? 5.073  -25.796 -0.872  1.00 43.87  ? 112 PHE C C   1 
ATOM   1294 O  O   . PHE C 1 12  ? 3.954  -26.152 -1.269  1.00 45.80  ? 112 PHE C O   1 
ATOM   1295 C  CB  . PHE C 1 12  ? 6.057  -27.165 0.941   1.00 40.04  ? 112 PHE C CB  1 
ATOM   1296 C  CG  . PHE C 1 12  ? 5.355  -28.314 0.300   1.00 38.93  ? 112 PHE C CG  1 
ATOM   1297 C  CD1 . PHE C 1 12  ? 5.862  -28.901 -0.853  1.00 40.31  ? 112 PHE C CD1 1 
ATOM   1298 C  CD2 . PHE C 1 12  ? 4.173  -28.798 0.831   1.00 38.49  ? 112 PHE C CD2 1 
ATOM   1299 C  CE1 . PHE C 1 12  ? 5.208  -29.967 -1.454  1.00 41.43  ? 112 PHE C CE1 1 
ATOM   1300 C  CE2 . PHE C 1 12  ? 3.515  -29.870 0.234   1.00 39.30  ? 112 PHE C CE2 1 
ATOM   1301 C  CZ  . PHE C 1 12  ? 4.033  -30.452 -0.909  1.00 39.07  ? 112 PHE C CZ  1 
ATOM   1302 N  N   . GLU C 1 13  ? 6.049  -25.384 -1.678  1.00 36.42  ? 113 GLU C N   1 
ATOM   1303 C  CA  . GLU C 1 13  ? 5.936  -25.426 -3.121  1.00 37.25  ? 113 GLU C CA  1 
ATOM   1304 C  C   . GLU C 1 13  ? 7.179  -26.142 -3.663  1.00 41.40  ? 113 GLU C C   1 
ATOM   1305 O  O   . GLU C 1 13  ? 8.225  -26.167 -3.003  1.00 42.63  ? 113 GLU C O   1 
ATOM   1306 C  CB  . GLU C 1 13  ? 5.817  -24.003 -3.698  1.00 32.75  ? 113 GLU C CB  1 
ATOM   1307 N  N   . ILE C 1 14  ? 7.061  -26.752 -4.840  1.00 39.00  ? 114 ILE C N   1 
ATOM   1308 C  CA  . ILE C 1 14  ? 8.222  -27.362 -5.478  1.00 42.36  ? 114 ILE C CA  1 
ATOM   1309 C  C   . ILE C 1 14  ? 8.436  -26.840 -6.895  1.00 46.66  ? 114 ILE C C   1 
ATOM   1310 O  O   . ILE C 1 14  ? 7.474  -26.572 -7.643  1.00 48.51  ? 114 ILE C O   1 
ATOM   1311 C  CB  . ILE C 1 14  ? 8.128  -28.914 -5.545  1.00 31.51  ? 114 ILE C CB  1 
ATOM   1312 C  CG1 . ILE C 1 14  ? 7.012  -29.355 -6.513  1.00 34.34  ? 114 ILE C CG1 1 
ATOM   1313 C  CG2 . ILE C 1 14  ? 7.949  -29.500 -4.169  1.00 20.63  ? 114 ILE C CG2 1 
ATOM   1314 C  CD1 . ILE C 1 14  ? 6.836  -30.878 -6.634  1.00 32.00  ? 114 ILE C CD1 1 
ATOM   1315 N  N   . VAL C 1 15  ? 9.699  -26.706 -7.275  1.00 42.02  ? 115 VAL C N   1 
ATOM   1316 C  CA  . VAL C 1 15  ? 9.988  -26.436 -8.676  1.00 42.33  ? 115 VAL C CA  1 
ATOM   1317 C  C   . VAL C 1 15  ? 11.006 -27.439 -9.236  1.00 38.91  ? 115 VAL C C   1 
ATOM   1318 O  O   . VAL C 1 15  ? 12.062 -27.689 -8.636  1.00 38.44  ? 115 VAL C O   1 
ATOM   1319 C  CB  . VAL C 1 15  ? 10.382 -24.957 -8.916  1.00 45.91  ? 115 VAL C CB  1 
ATOM   1320 C  CG1 . VAL C 1 15  ? 11.121 -24.397 -7.711  1.00 49.25  ? 115 VAL C CG1 1 
ATOM   1321 C  CG2 . VAL C 1 15  ? 11.198 -24.810 -10.205 1.00 41.08  ? 115 VAL C CG2 1 
ATOM   1322 N  N   . GLY C 1 16  ? 10.652 -28.044 -10.365 1.00 38.86  ? 116 GLY C N   1 
ATOM   1323 C  CA  . GLY C 1 16  ? 11.454 -29.112 -10.921 1.00 41.87  ? 116 GLY C CA  1 
ATOM   1324 C  C   . GLY C 1 16  ? 12.403 -28.632 -11.995 1.00 46.90  ? 116 GLY C C   1 
ATOM   1325 O  O   . GLY C 1 16  ? 12.033 -27.833 -12.852 1.00 43.17  ? 116 GLY C O   1 
ATOM   1326 N  N   . PHE C 1 17  ? 13.637 -29.120 -11.947 1.00 56.76  ? 117 PHE C N   1 
ATOM   1327 C  CA  . PHE C 1 17  ? 14.595 -28.869 -13.024 1.00 61.45  ? 117 PHE C CA  1 
ATOM   1328 C  C   . PHE C 1 17  ? 15.025 -30.178 -13.672 1.00 64.06  ? 117 PHE C C   1 
ATOM   1329 O  O   . PHE C 1 17  ? 14.516 -31.240 -13.327 1.00 68.76  ? 117 PHE C O   1 
ATOM   1330 C  CB  . PHE C 1 17  ? 15.799 -28.101 -12.485 1.00 57.94  ? 117 PHE C CB  1 
ATOM   1331 C  CG  . PHE C 1 17  ? 15.438 -26.761 -11.928 1.00 57.13  ? 117 PHE C CG  1 
ATOM   1332 C  CD1 . PHE C 1 17  ? 15.336 -25.653 -12.764 1.00 53.56  ? 117 PHE C CD1 1 
ATOM   1333 C  CD2 . PHE C 1 17  ? 15.167 -26.609 -10.571 1.00 54.65  ? 117 PHE C CD2 1 
ATOM   1334 C  CE1 . PHE C 1 17  ? 14.988 -24.404 -12.253 1.00 50.29  ? 117 PHE C CE1 1 
ATOM   1335 C  CE2 . PHE C 1 17  ? 14.824 -25.370 -10.052 1.00 49.07  ? 117 PHE C CE2 1 
ATOM   1336 C  CZ  . PHE C 1 17  ? 14.733 -24.265 -10.894 1.00 50.21  ? 117 PHE C CZ  1 
ATOM   1337 N  N   . THR C 1 18  ? 15.973 -30.105 -14.596 1.00 64.25  ? 118 THR C N   1 
ATOM   1338 C  CA  . THR C 1 18  ? 16.414 -31.297 -15.320 1.00 67.32  ? 118 THR C CA  1 
ATOM   1339 C  C   . THR C 1 18  ? 16.823 -32.463 -14.411 1.00 60.60  ? 118 THR C C   1 
ATOM   1340 O  O   . THR C 1 18  ? 16.420 -33.610 -14.651 1.00 56.06  ? 118 THR C O   1 
ATOM   1341 C  CB  . THR C 1 18  ? 17.571 -30.984 -16.292 1.00 70.52  ? 118 THR C CB  1 
ATOM   1342 O  OG1 . THR C 1 18  ? 17.312 -29.746 -16.966 1.00 73.75  ? 118 THR C OG1 1 
ATOM   1343 C  CG2 . THR C 1 18  ? 17.718 -32.095 -17.320 1.00 69.73  ? 118 THR C CG2 1 
ATOM   1344 N  N   . ASN C 1 19  ? 17.618 -32.183 -13.378 1.00 54.70  ? 119 ASN C N   1 
ATOM   1345 C  CA  . ASN C 1 19  ? 18.096 -33.268 -12.524 1.00 53.25  ? 119 ASN C CA  1 
ATOM   1346 C  C   . ASN C 1 19  ? 17.866 -33.046 -11.033 1.00 55.73  ? 119 ASN C C   1 
ATOM   1347 O  O   . ASN C 1 19  ? 18.251 -33.879 -10.202 1.00 53.66  ? 119 ASN C O   1 
ATOM   1348 C  CB  . ASN C 1 19  ? 19.575 -33.579 -12.795 1.00 54.54  ? 119 ASN C CB  1 
ATOM   1349 C  CG  . ASN C 1 19  ? 19.840 -33.946 -14.253 1.00 59.31  ? 119 ASN C CG  1 
ATOM   1350 O  OD1 . ASN C 1 19  ? 19.361 -34.974 -14.750 1.00 64.48  ? 119 ASN C OD1 1 
ATOM   1351 N  ND2 . ASN C 1 19  ? 20.605 -33.106 -14.945 1.00 53.73  ? 119 ASN C ND2 1 
ATOM   1352 N  N   . HIS C 1 20  ? 17.218 -31.938 -10.691 1.00 56.17  ? 120 HIS C N   1 
ATOM   1353 C  CA  . HIS C 1 20  ? 16.951 -31.649 -9.285  1.00 53.02  ? 120 HIS C CA  1 
ATOM   1354 C  C   . HIS C 1 20  ? 15.612 -30.946 -9.081  1.00 49.62  ? 120 HIS C C   1 
ATOM   1355 O  O   . HIS C 1 20  ? 14.977 -30.477 -10.057 1.00 49.41  ? 120 HIS C O   1 
ATOM   1356 C  CB  . HIS C 1 20  ? 18.066 -30.791 -8.690  1.00 53.01  ? 120 HIS C CB  1 
ATOM   1357 C  CG  . HIS C 1 20  ? 17.972 -29.340 -9.055  1.00 56.41  ? 120 HIS C CG  1 
ATOM   1358 N  ND1 . HIS C 1 20  ? 18.477 -28.832 -10.238 1.00 55.35  ? 120 HIS C ND1 1 
ATOM   1359 C  CD2 . HIS C 1 20  ? 17.428 -28.287 -8.397  1.00 58.16  ? 120 HIS C CD2 1 
ATOM   1360 C  CE1 . HIS C 1 20  ? 18.253 -27.533 -10.286 1.00 56.43  ? 120 HIS C CE1 1 
ATOM   1361 N  NE2 . HIS C 1 20  ? 17.620 -27.174 -9.179  1.00 58.89  ? 120 HIS C NE2 1 
ATOM   1362 N  N   . ILE C 1 21  ? 15.198 -30.895 -7.811  1.00 41.23  ? 121 ILE C N   1 
ATOM   1363 C  CA  . ILE C 1 21  ? 13.972 -30.216 -7.398  1.00 40.58  ? 121 ILE C CA  1 
ATOM   1364 C  C   . ILE C 1 21  ? 14.246 -29.318 -6.198  1.00 40.44  ? 121 ILE C C   1 
ATOM   1365 O  O   . ILE C 1 21  ? 14.844 -29.762 -5.198  1.00 33.47  ? 121 ILE C O   1 
ATOM   1366 C  CB  . ILE C 1 21  ? 12.874 -31.206 -6.962  1.00 39.32  ? 121 ILE C CB  1 
ATOM   1367 C  CG1 . ILE C 1 21  ? 12.368 -32.018 -8.150  1.00 35.96  ? 121 ILE C CG1 1 
ATOM   1368 C  CG2 . ILE C 1 21  ? 11.698 -30.458 -6.330  1.00 42.15  ? 121 ILE C CG2 1 
ATOM   1369 C  CD1 . ILE C 1 21  ? 11.288 -32.999 -7.784  1.00 31.21  ? 121 ILE C CD1 1 
ATOM   1370 N  N   . ASN C 1 22  ? 13.802 -28.064 -6.295  1.00 42.00  ? 122 ASN C N   1 
ATOM   1371 C  CA  . ASN C 1 22  ? 13.807 -27.169 -5.147  1.00 42.36  ? 122 ASN C CA  1 
ATOM   1372 C  C   . ASN C 1 22  ? 12.531 -27.293 -4.340  1.00 42.79  ? 122 ASN C C   1 
ATOM   1373 O  O   . ASN C 1 22  ? 11.420 -27.152 -4.880  1.00 49.69  ? 122 ASN C O   1 
ATOM   1374 C  CB  . ASN C 1 22  ? 14.014 -25.713 -5.571  1.00 45.74  ? 122 ASN C CB  1 
ATOM   1375 C  CG  . ASN C 1 22  ? 15.420 -25.451 -6.045  1.00 52.05  ? 122 ASN C CG  1 
ATOM   1376 O  OD1 . ASN C 1 22  ? 16.361 -26.128 -5.615  1.00 59.76  ? 122 ASN C OD1 1 
ATOM   1377 N  ND2 . ASN C 1 22  ? 15.582 -24.479 -6.947  1.00 50.37  ? 122 ASN C ND2 1 
ATOM   1378 N  N   . VAL C 1 23  ? 12.696 -27.557 -3.048  1.00 34.34  ? 123 VAL C N   1 
ATOM   1379 C  CA  . VAL C 1 23  ? 11.556 -27.602 -2.151  1.00 37.39  ? 123 VAL C CA  1 
ATOM   1380 C  C   . VAL C 1 23  ? 11.611 -26.403 -1.204  1.00 37.73  ? 123 VAL C C   1 
ATOM   1381 O  O   . VAL C 1 23  ? 12.583 -26.225 -0.477  1.00 37.82  ? 123 VAL C O   1 
ATOM   1382 C  CB  . VAL C 1 23  ? 11.556 -28.907 -1.354  1.00 36.36  ? 123 VAL C CB  1 
ATOM   1383 C  CG1 . VAL C 1 23  ? 10.302 -29.015 -0.490  1.00 32.61  ? 123 VAL C CG1 1 
ATOM   1384 C  CG2 . VAL C 1 23  ? 11.678 -30.087 -2.309  1.00 31.53  ? 123 VAL C CG2 1 
HETATM 1385 N  N   . MSE C 1 24  ? 10.585 -25.561 -1.247  1.00 38.33  ? 124 MSE C N   1 
HETATM 1386 C  CA  . MSE C 1 24  ? 10.522 -24.403 -0.371  1.00 41.10  ? 124 MSE C CA  1 
HETATM 1387 C  C   . MSE C 1 24  ? 9.441  -24.627 0.674   1.00 44.24  ? 124 MSE C C   1 
HETATM 1388 O  O   . MSE C 1 24  ? 8.258  -24.743 0.337   1.00 48.67  ? 124 MSE C O   1 
HETATM 1389 C  CB  . MSE C 1 24  ? 10.204 -23.130 -1.153  1.00 46.36  ? 124 MSE C CB  1 
HETATM 1390 C  CG  . MSE C 1 24  ? 11.406 -22.507 -1.874  1.00 56.39  ? 124 MSE C CG  1 
HETATM 1391 SE SE  . MSE C 1 24  ? 11.836 -23.317 -3.611  1.00 96.37  ? 124 MSE C SE  1 
HETATM 1392 C  CE  . MSE C 1 24  ? 10.033 -23.391 -4.381  1.00 66.58  ? 124 MSE C CE  1 
ATOM   1393 N  N   . VAL C 1 25  ? 9.834  -24.695 1.940   1.00 40.28  ? 125 VAL C N   1 
ATOM   1394 C  CA  . VAL C 1 25  ? 8.836  -24.796 2.996   1.00 40.79  ? 125 VAL C CA  1 
ATOM   1395 C  C   . VAL C 1 25  ? 8.750  -23.516 3.809   1.00 43.19  ? 125 VAL C C   1 
ATOM   1396 O  O   . VAL C 1 25  ? 9.768  -22.856 4.072   1.00 41.30  ? 125 VAL C O   1 
ATOM   1397 C  CB  . VAL C 1 25  ? 9.084  -25.997 3.904   1.00 39.15  ? 125 VAL C CB  1 
ATOM   1398 C  CG1 . VAL C 1 25  ? 9.185  -27.267 3.058   1.00 39.89  ? 125 VAL C CG1 1 
ATOM   1399 C  CG2 . VAL C 1 25  ? 10.353 -25.793 4.704   1.00 41.65  ? 125 VAL C CG2 1 
ATOM   1400 N  N   . LYS C 1 26  ? 7.519  -23.147 4.160   1.00 48.64  ? 126 LYS C N   1 
ATOM   1401 C  CA  . LYS C 1 26  ? 7.284  -22.016 5.051   1.00 52.49  ? 126 LYS C CA  1 
ATOM   1402 C  C   . LYS C 1 26  ? 6.783  -22.510 6.407   1.00 49.08  ? 126 LYS C C   1 
ATOM   1403 O  O   . LYS C 1 26  ? 5.753  -23.198 6.502   1.00 45.12  ? 126 LYS C O   1 
ATOM   1404 C  CB  . LYS C 1 26  ? 6.288  -21.022 4.452   1.00 59.65  ? 126 LYS C CB  1 
ATOM   1405 C  CG  . LYS C 1 26  ? 6.106  -19.749 5.287   1.00 70.94  ? 126 LYS C CG  1 
ATOM   1406 C  CD  . LYS C 1 26  ? 4.967  -18.879 4.741   1.00 81.50  ? 126 LYS C CD  1 
ATOM   1407 C  CE  . LYS C 1 26  ? 5.099  -17.417 5.178   1.00 87.55  ? 126 LYS C CE  1 
ATOM   1408 N  NZ  . LYS C 1 26  ? 5.353  -16.486 4.026   1.00 88.97  ? 126 LYS C NZ  1 
ATOM   1409 N  N   . PHE C 1 27  ? 7.546  -22.184 7.446   1.00 49.65  ? 127 PHE C N   1 
ATOM   1410 C  CA  . PHE C 1 27  ? 7.096  -22.350 8.815   1.00 56.69  ? 127 PHE C CA  1 
ATOM   1411 C  C   . PHE C 1 27  ? 6.614  -20.997 9.327   1.00 67.70  ? 127 PHE C C   1 
ATOM   1412 O  O   . PHE C 1 27  ? 7.144  -19.951 8.919   1.00 70.26  ? 127 PHE C O   1 
ATOM   1413 C  CB  . PHE C 1 27  ? 8.248  -22.820 9.689   1.00 54.51  ? 127 PHE C CB  1 
ATOM   1414 C  CG  . PHE C 1 27  ? 8.671  -24.236 9.436   1.00 50.57  ? 127 PHE C CG  1 
ATOM   1415 C  CD1 . PHE C 1 27  ? 8.034  -25.290 10.081  1.00 45.10  ? 127 PHE C CD1 1 
ATOM   1416 C  CD2 . PHE C 1 27  ? 9.729  -24.518 8.574   1.00 50.50  ? 127 PHE C CD2 1 
ATOM   1417 C  CE1 . PHE C 1 27  ? 8.437  -26.601 9.868   1.00 43.13  ? 127 PHE C CE1 1 
ATOM   1418 C  CE2 . PHE C 1 27  ? 10.136 -25.834 8.349   1.00 44.38  ? 127 PHE C CE2 1 
ATOM   1419 C  CZ  . PHE C 1 27  ? 9.490  -26.873 8.996   1.00 42.93  ? 127 PHE C CZ  1 
ATOM   1420 N  N   . PRO C 1 28  ? 5.610  -21.008 10.227  1.00 73.68  ? 128 PRO C N   1 
ATOM   1421 C  CA  . PRO C 1 28  ? 5.104  -19.775 10.854  1.00 74.77  ? 128 PRO C CA  1 
ATOM   1422 C  C   . PRO C 1 28  ? 6.212  -18.980 11.549  1.00 76.55  ? 128 PRO C C   1 
ATOM   1423 O  O   . PRO C 1 28  ? 7.317  -19.508 11.718  1.00 77.77  ? 128 PRO C O   1 
ATOM   1424 C  CB  . PRO C 1 28  ? 4.104  -20.300 11.885  1.00 71.98  ? 128 PRO C CB  1 
ATOM   1425 C  CG  . PRO C 1 28  ? 3.617  -21.596 11.302  1.00 70.96  ? 128 PRO C CG  1 
ATOM   1426 C  CD  . PRO C 1 28  ? 4.825  -22.195 10.622  1.00 71.16  ? 128 PRO C CD  1 
ATOM   1427 N  N   . PHE C 1 37  ? 7.798  -31.206 21.883  1.00 77.14  ? 137 PHE C N   1 
ATOM   1428 C  CA  . PHE C 1 37  ? 9.166  -31.723 21.904  1.00 77.96  ? 137 PHE C CA  1 
ATOM   1429 C  C   . PHE C 1 37  ? 9.900  -31.343 20.619  1.00 81.87  ? 137 PHE C C   1 
ATOM   1430 O  O   . PHE C 1 37  ? 9.465  -30.438 19.903  1.00 85.12  ? 137 PHE C O   1 
ATOM   1431 C  CB  . PHE C 1 37  ? 9.171  -33.241 22.098  1.00 74.85  ? 137 PHE C CB  1 
ATOM   1432 N  N   . ASP C 1 38  ? 11.008 -32.027 20.328  1.00 80.59  ? 138 ASP C N   1 
ATOM   1433 C  CA  . ASP C 1 38  ? 11.814 -31.720 19.137  1.00 76.82  ? 138 ASP C CA  1 
ATOM   1434 C  C   . ASP C 1 38  ? 11.258 -32.356 17.861  1.00 70.27  ? 138 ASP C C   1 
ATOM   1435 O  O   . ASP C 1 38  ? 11.159 -33.583 17.759  1.00 70.37  ? 138 ASP C O   1 
ATOM   1436 C  CB  . ASP C 1 38  ? 13.270 -32.150 19.344  1.00 77.44  ? 138 ASP C CB  1 
ATOM   1437 N  N   . LEU C 1 39  ? 10.918 -31.517 16.883  1.00 64.99  ? 139 LEU C N   1 
ATOM   1438 C  CA  . LEU C 1 39  ? 10.289 -31.991 15.643  1.00 56.47  ? 139 LEU C CA  1 
ATOM   1439 C  C   . LEU C 1 39  ? 11.198 -31.975 14.408  1.00 57.84  ? 139 LEU C C   1 
ATOM   1440 O  O   . LEU C 1 39  ? 11.927 -31.013 14.163  1.00 61.64  ? 139 LEU C O   1 
ATOM   1441 C  CB  . LEU C 1 39  ? 9.019  -31.190 15.368  1.00 49.12  ? 139 LEU C CB  1 
ATOM   1442 C  CG  . LEU C 1 39  ? 7.863  -31.514 16.313  1.00 49.67  ? 139 LEU C CG  1 
ATOM   1443 C  CD1 . LEU C 1 39  ? 6.688  -30.576 16.096  1.00 46.37  ? 139 LEU C CD1 1 
ATOM   1444 C  CD2 . LEU C 1 39  ? 7.432  -32.969 16.159  1.00 52.74  ? 139 LEU C CD2 1 
ATOM   1445 N  N   . SER C 1 40  ? 11.133 -33.043 13.625  1.00 53.71  ? 140 SER C N   1 
ATOM   1446 C  CA  . SER C 1 40  ? 11.923 -33.138 12.417  1.00 46.85  ? 140 SER C CA  1 
ATOM   1447 C  C   . SER C 1 40  ? 11.082 -32.878 11.185  1.00 46.43  ? 140 SER C C   1 
ATOM   1448 O  O   . SER C 1 40  ? 9.910  -33.259 11.131  1.00 47.20  ? 140 SER C O   1 
ATOM   1449 C  CB  . SER C 1 40  ? 12.567 -34.519 12.318  1.00 48.86  ? 140 SER C CB  1 
ATOM   1450 O  OG  . SER C 1 40  ? 13.681 -34.601 13.183  1.00 52.70  ? 140 SER C OG  1 
ATOM   1451 N  N   . LEU C 1 41  ? 11.687 -32.223 10.197  1.00 42.62  ? 141 LEU C N   1 
ATOM   1452 C  CA  . LEU C 1 41  ? 11.049 -32.048 8.908   1.00 36.74  ? 141 LEU C CA  1 
ATOM   1453 C  C   . LEU C 1 41  ? 11.321 -33.265 8.025   1.00 40.49  ? 141 LEU C C   1 
ATOM   1454 O  O   . LEU C 1 41  ? 12.469 -33.694 7.854   1.00 47.12  ? 141 LEU C O   1 
ATOM   1455 C  CB  . LEU C 1 41  ? 11.549 -30.785 8.201   1.00 34.80  ? 141 LEU C CB  1 
ATOM   1456 C  CG  . LEU C 1 41  ? 11.185 -30.672 6.705   1.00 32.55  ? 141 LEU C CG  1 
ATOM   1457 C  CD1 . LEU C 1 41  ? 9.668  -30.788 6.490   1.00 29.34  ? 141 LEU C CD1 1 
ATOM   1458 C  CD2 . LEU C 1 41  ? 11.702 -29.362 6.111   1.00 31.65  ? 141 LEU C CD2 1 
ATOM   1459 N  N   . VAL C 1 42  ? 10.255 -33.821 7.470   1.00 32.69  ? 142 VAL C N   1 
ATOM   1460 C  CA  . VAL C 1 42  ? 10.398 -34.923 6.554   1.00 32.10  ? 142 VAL C CA  1 
ATOM   1461 C  C   . VAL C 1 42  ? 9.875  -34.518 5.178   1.00 36.64  ? 142 VAL C C   1 
ATOM   1462 O  O   . VAL C 1 42  ? 8.777  -33.948 5.049   1.00 35.27  ? 142 VAL C O   1 
ATOM   1463 C  CB  . VAL C 1 42  ? 9.661  -36.155 7.055   1.00 32.35  ? 142 VAL C CB  1 
ATOM   1464 C  CG1 . VAL C 1 42  ? 9.892  -37.338 6.088   1.00 36.16  ? 142 VAL C CG1 1 
ATOM   1465 C  CG2 . VAL C 1 42  ? 10.126 -36.495 8.462   1.00 26.88  ? 142 VAL C CG2 1 
ATOM   1466 N  N   . ILE C 1 43  ? 10.684 -34.793 4.159   1.00 35.40  ? 143 ILE C N   1 
ATOM   1467 C  CA  . ILE C 1 43  ? 10.312 -34.517 2.785   1.00 36.02  ? 143 ILE C CA  1 
ATOM   1468 C  C   . ILE C 1 43  ? 10.231 -35.840 2.056   1.00 38.28  ? 143 ILE C C   1 
ATOM   1469 O  O   . ILE C 1 43  ? 11.255 -36.474 1.776   1.00 39.29  ? 143 ILE C O   1 
ATOM   1470 C  CB  . ILE C 1 43  ? 11.333 -33.610 2.096   1.00 35.03  ? 143 ILE C CB  1 
ATOM   1471 C  CG1 . ILE C 1 43  ? 11.300 -32.215 2.732   1.00 36.41  ? 143 ILE C CG1 1 
ATOM   1472 C  CG2 . ILE C 1 43  ? 11.041 -33.525 0.600   1.00 32.09  ? 143 ILE C CG2 1 
ATOM   1473 C  CD1 . ILE C 1 43  ? 12.586 -31.444 2.565   1.00 33.02  ? 143 ILE C CD1 1 
ATOM   1474 N  N   . GLU C 1 44  ? 9.000  -36.258 1.777   1.00 36.04  ? 144 GLU C N   1 
ATOM   1475 C  CA  . GLU C 1 44  ? 8.720  -37.538 1.133   1.00 34.17  ? 144 GLU C CA  1 
ATOM   1476 C  C   . GLU C 1 44  ? 8.762  -37.400 -0.399  1.00 39.67  ? 144 GLU C C   1 
ATOM   1477 O  O   . GLU C 1 44  ? 8.030  -36.586 -0.993  1.00 36.92  ? 144 GLU C O   1 
ATOM   1478 C  CB  . GLU C 1 44  ? 7.349  -38.051 1.591   1.00 30.79  ? 144 GLU C CB  1 
ATOM   1479 C  CG  . GLU C 1 44  ? 6.915  -39.370 0.985   1.00 39.19  ? 144 GLU C CG  1 
ATOM   1480 C  CD  . GLU C 1 44  ? 5.846  -40.065 1.830   1.00 48.57  ? 144 GLU C CD  1 
ATOM   1481 O  OE1 . GLU C 1 44  ? 5.955  -40.002 3.089   1.00 52.15  ? 144 GLU C OE1 1 
ATOM   1482 O  OE2 . GLU C 1 44  ? 4.902  -40.675 1.249   1.00 41.46  ? 144 GLU C OE2 1 
ATOM   1483 N  N   . GLU C 1 45  ? 9.615  -38.200 -1.033  1.00 43.35  ? 145 GLU C N   1 
ATOM   1484 C  CA  . GLU C 1 45  ? 9.749  -38.201 -2.488  1.00 43.38  ? 145 GLU C CA  1 
ATOM   1485 C  C   . GLU C 1 45  ? 9.213  -39.510 -3.054  1.00 45.47  ? 145 GLU C C   1 
ATOM   1486 O  O   . GLU C 1 45  ? 9.559  -40.593 -2.571  1.00 44.12  ? 145 GLU C O   1 
ATOM   1487 C  CB  . GLU C 1 45  ? 11.222 -38.056 -2.855  1.00 48.96  ? 145 GLU C CB  1 
ATOM   1488 C  CG  . GLU C 1 45  ? 11.535 -38.154 -4.343  1.00 54.18  ? 145 GLU C CG  1 
ATOM   1489 C  CD  . GLU C 1 45  ? 12.875 -38.833 -4.611  1.00 57.96  ? 145 GLU C CD  1 
ATOM   1490 O  OE1 . GLU C 1 45  ? 13.896 -38.429 -4.002  1.00 53.66  ? 145 GLU C OE1 1 
ATOM   1491 O  OE2 . GLU C 1 45  ? 12.902 -39.787 -5.422  1.00 64.38  ? 145 GLU C OE2 1 
ATOM   1492 N  N   . GLN C 1 46  ? 8.369  -39.426 -4.076  1.00 49.30  ? 146 GLN C N   1 
ATOM   1493 C  CA  . GLN C 1 46  ? 7.923  -40.643 -4.742  1.00 51.57  ? 146 GLN C CA  1 
ATOM   1494 C  C   . GLN C 1 46  ? 7.885  -40.535 -6.267  1.00 50.22  ? 146 GLN C C   1 
ATOM   1495 O  O   . GLN C 1 46  ? 7.374  -39.563 -6.830  1.00 45.55  ? 146 GLN C O   1 
ATOM   1496 C  CB  . GLN C 1 46  ? 6.583  -41.143 -4.175  1.00 51.76  ? 146 GLN C CB  1 
ATOM   1497 C  CG  . GLN C 1 46  ? 5.505  -40.085 -4.038  1.00 52.58  ? 146 GLN C CG  1 
ATOM   1498 C  CD  . GLN C 1 46  ? 4.500  -40.420 -2.935  1.00 51.34  ? 146 GLN C CD  1 
ATOM   1499 O  OE1 . GLN C 1 46  ? 4.611  -39.932 -1.804  1.00 52.24  ? 146 GLN C OE1 1 
ATOM   1500 N  NE2 . GLN C 1 46  ? 3.518  -41.265 -3.265  1.00 43.23  ? 146 GLN C NE2 1 
ATOM   1501 N  N   . SER C 1 47  ? 8.463  -41.541 -6.916  1.00 53.47  ? 147 SER C N   1 
ATOM   1502 C  CA  . SER C 1 47  ? 8.360  -41.705 -8.359  1.00 56.50  ? 147 SER C CA  1 
ATOM   1503 C  C   . SER C 1 47  ? 8.524  -43.184 -8.705  1.00 58.02  ? 147 SER C C   1 
ATOM   1504 O  O   . SER C 1 47  ? 9.170  -43.937 -7.954  1.00 52.38  ? 147 SER C O   1 
ATOM   1505 C  CB  . SER C 1 47  ? 9.394  -40.835 -9.098  1.00 60.25  ? 147 SER C CB  1 
ATOM   1506 O  OG  . SER C 1 47  ? 10.721 -41.281 -8.884  1.00 63.97  ? 147 SER C OG  1 
ATOM   1507 N  N   . GLU C 1 48  ? 7.912  -43.596 -9.819  1.00 63.84  ? 148 GLU C N   1 
ATOM   1508 C  CA  . GLU C 1 48  ? 8.015  -44.972 -10.313 1.00 62.13  ? 148 GLU C CA  1 
ATOM   1509 C  C   . GLU C 1 48  ? 7.604  -46.019 -9.268  1.00 61.68  ? 148 GLU C C   1 
ATOM   1510 O  O   . GLU C 1 48  ? 8.159  -47.116 -9.224  1.00 64.03  ? 148 GLU C O   1 
ATOM   1511 C  CB  . GLU C 1 48  ? 9.438  -45.254 -10.816 1.00 54.75  ? 148 GLU C CB  1 
ATOM   1512 N  N   . GLY C 1 49  ? 6.625  -45.686 -8.438  1.00 58.02  ? 149 GLY C N   1 
ATOM   1513 C  CA  . GLY C 1 49  ? 6.206  -46.584 -7.378  1.00 60.67  ? 149 GLY C CA  1 
ATOM   1514 C  C   . GLY C 1 49  ? 7.262  -46.838 -6.309  1.00 60.35  ? 149 GLY C C   1 
ATOM   1515 O  O   . GLY C 1 49  ? 7.313  -47.930 -5.740  1.00 63.84  ? 149 GLY C O   1 
ATOM   1516 N  N   . ILE C 1 50  ? 8.097  -45.835 -6.039  1.00 55.13  ? 150 ILE C N   1 
ATOM   1517 C  CA  . ILE C 1 50  ? 9.103  -45.909 -4.981  1.00 53.10  ? 150 ILE C CA  1 
ATOM   1518 C  C   . ILE C 1 50  ? 9.035  -44.663 -4.092  1.00 53.57  ? 150 ILE C C   1 
ATOM   1519 O  O   . ILE C 1 50  ? 8.964  -43.534 -4.599  1.00 53.30  ? 150 ILE C O   1 
ATOM   1520 C  CB  . ILE C 1 50  ? 10.541 -46.045 -5.560  1.00 69.43  ? 150 ILE C CB  1 
ATOM   1521 C  CG1 . ILE C 1 50  ? 10.895 -47.510 -5.842  1.00 68.11  ? 150 ILE C CG1 1 
ATOM   1522 C  CG2 . ILE C 1 50  ? 11.568 -45.462 -4.598  1.00 68.46  ? 150 ILE C CG2 1 
ATOM   1523 C  CD1 . ILE C 1 50  ? 10.225 -48.093 -7.067  1.00 66.61  ? 150 ILE C CD1 1 
ATOM   1524 N  N   . VAL C 1 51  ? 9.065  -44.877 -2.773  1.00 50.20  ? 151 VAL C N   1 
ATOM   1525 C  CA  . VAL C 1 51  ? 9.012  -43.796 -1.788  1.00 43.55  ? 151 VAL C CA  1 
ATOM   1526 C  C   . VAL C 1 51  ? 10.357 -43.656 -1.078  1.00 46.93  ? 151 VAL C C   1 
ATOM   1527 O  O   . VAL C 1 51  ? 10.798 -44.585 -0.400  1.00 54.04  ? 151 VAL C O   1 
ATOM   1528 C  CB  . VAL C 1 51  ? 7.922  -44.080 -0.722  1.00 41.31  ? 151 VAL C CB  1 
ATOM   1529 C  CG1 . VAL C 1 51  ? 7.937  -43.016 0.403   1.00 37.27  ? 151 VAL C CG1 1 
ATOM   1530 C  CG2 . VAL C 1 51  ? 6.533  -44.179 -1.373  1.00 34.49  ? 151 VAL C CG2 1 
ATOM   1531 N  N   . LYS C 1 52  ? 11.019 -42.515 -1.244  1.00 47.62  ? 152 LYS C N   1 
ATOM   1532 C  CA  . LYS C 1 52  ? 12.239 -42.220 -0.495  1.00 49.30  ? 152 LYS C CA  1 
ATOM   1533 C  C   . LYS C 1 52  ? 11.891 -41.140 0.506   1.00 47.65  ? 152 LYS C C   1 
ATOM   1534 O  O   . LYS C 1 52  ? 11.055 -40.286 0.220   1.00 49.13  ? 152 LYS C O   1 
ATOM   1535 C  CB  . LYS C 1 52  ? 13.350 -41.712 -1.424  1.00 53.99  ? 152 LYS C CB  1 
ATOM   1536 C  CG  . LYS C 1 52  ? 14.299 -42.781 -1.949  1.00 65.02  ? 152 LYS C CG  1 
ATOM   1537 C  CD  . LYS C 1 52  ? 15.213 -42.202 -3.051  1.00 74.59  ? 152 LYS C CD  1 
ATOM   1538 C  CE  . LYS C 1 52  ? 16.045 -43.278 -3.765  1.00 78.59  ? 152 LYS C CE  1 
ATOM   1539 N  NZ  . LYS C 1 52  ? 17.518 -43.173 -3.486  1.00 80.50  ? 152 LYS C NZ  1 
ATOM   1540 N  N   . LYS C 1 53  ? 12.527 -41.154 1.672   1.00 50.11  ? 153 LYS C N   1 
ATOM   1541 C  CA  . LYS C 1 53  ? 12.267 -40.125 2.684   1.00 51.01  ? 153 LYS C CA  1 
ATOM   1542 C  C   . LYS C 1 53  ? 13.513 -39.268 2.928   1.00 52.51  ? 153 LYS C C   1 
ATOM   1543 O  O   . LYS C 1 53  ? 14.616 -39.798 3.104   1.00 54.66  ? 153 LYS C O   1 
ATOM   1544 C  CB  . LYS C 1 53  ? 11.782 -40.768 3.992   1.00 54.05  ? 153 LYS C CB  1 
ATOM   1545 C  CG  . LYS C 1 53  ? 10.319 -40.465 4.322   1.00 61.09  ? 153 LYS C CG  1 
ATOM   1546 C  CD  . LYS C 1 53  ? 9.639  -41.575 5.138   1.00 64.42  ? 153 LYS C CD  1 
ATOM   1547 C  CE  . LYS C 1 53  ? 8.181  -41.751 4.667   1.00 68.21  ? 153 LYS C CE  1 
ATOM   1548 N  NZ  . LYS C 1 53  ? 7.466  -42.932 5.239   1.00 71.52  ? 153 LYS C NZ  1 
ATOM   1549 N  N   . HIS C 1 54  ? 13.351 -37.948 2.928   1.00 49.23  ? 154 HIS C N   1 
ATOM   1550 C  CA  . HIS C 1 54  ? 14.470 -37.074 3.260   1.00 45.62  ? 154 HIS C CA  1 
ATOM   1551 C  C   . HIS C 1 54  ? 14.276 -36.408 4.634   1.00 45.94  ? 154 HIS C C   1 
ATOM   1552 O  O   . HIS C 1 54  ? 13.287 -35.704 4.860   1.00 50.23  ? 154 HIS C O   1 
ATOM   1553 C  CB  . HIS C 1 54  ? 14.658 -36.037 2.163   1.00 46.92  ? 154 HIS C CB  1 
ATOM   1554 C  CG  . HIS C 1 54  ? 14.948 -36.631 0.823   1.00 56.20  ? 154 HIS C CG  1 
ATOM   1555 N  ND1 . HIS C 1 54  ? 16.180 -37.158 0.496   1.00 61.09  ? 154 HIS C ND1 1 
ATOM   1556 C  CD2 . HIS C 1 54  ? 14.169 -36.783 -0.277  1.00 59.71  ? 154 HIS C CD2 1 
ATOM   1557 C  CE1 . HIS C 1 54  ? 16.147 -37.604 -0.749  1.00 62.42  ? 154 HIS C CE1 1 
ATOM   1558 N  NE2 . HIS C 1 54  ? 14.939 -37.390 -1.239  1.00 60.41  ? 154 HIS C NE2 1 
ATOM   1559 N  N   . LYS C 1 55  ? 15.209 -36.634 5.558   1.00 42.51  ? 155 LYS C N   1 
ATOM   1560 C  CA  . LYS C 1 55  ? 15.077 -36.057 6.891   1.00 41.17  ? 155 LYS C CA  1 
ATOM   1561 C  C   . LYS C 1 55  ? 16.271 -35.199 7.286   1.00 37.20  ? 155 LYS C C   1 
ATOM   1562 O  O   . LYS C 1 55  ? 17.124 -35.622 8.071   1.00 45.43  ? 155 LYS C O   1 
ATOM   1563 C  CB  . LYS C 1 55  ? 14.834 -37.148 7.948   1.00 44.75  ? 155 LYS C CB  1 
ATOM   1564 C  CG  . LYS C 1 55  ? 13.715 -38.121 7.605   1.00 53.24  ? 155 LYS C CG  1 
ATOM   1565 C  CD  . LYS C 1 55  ? 13.404 -39.071 8.766   1.00 58.57  ? 155 LYS C CD  1 
ATOM   1566 C  CE  . LYS C 1 55  ? 12.321 -40.083 8.373   1.00 64.09  ? 155 LYS C CE  1 
ATOM   1567 N  NZ  . LYS C 1 55  ? 12.180 -41.228 9.328   1.00 66.53  ? 155 LYS C NZ  1 
ATOM   1568 N  N   . PRO C 1 56  ? 16.325 -33.972 6.770   1.00 30.71  ? 156 PRO C N   1 
ATOM   1569 C  CA  . PRO C 1 56  ? 17.412 -33.073 7.180   1.00 37.70  ? 156 PRO C CA  1 
ATOM   1570 C  C   . PRO C 1 56  ? 17.195 -32.536 8.598   1.00 39.81  ? 156 PRO C C   1 
ATOM   1571 O  O   . PRO C 1 56  ? 16.082 -32.114 8.940   1.00 42.91  ? 156 PRO C O   1 
ATOM   1572 C  CB  . PRO C 1 56  ? 17.312 -31.924 6.169   1.00 37.01  ? 156 PRO C CB  1 
ATOM   1573 C  CG  . PRO C 1 56  ? 15.850 -31.873 5.824   1.00 36.10  ? 156 PRO C CG  1 
ATOM   1574 C  CD  . PRO C 1 56  ? 15.359 -33.317 5.874   1.00 31.22  ? 156 PRO C CD  1 
ATOM   1575 N  N   . GLU C 1 57  ? 18.245 -32.549 9.412   1.00 36.63  ? 157 GLU C N   1 
ATOM   1576 C  CA  . GLU C 1 57  ? 18.192 -31.880 10.714  1.00 36.89  ? 157 GLU C CA  1 
ATOM   1577 C  C   . GLU C 1 57  ? 18.267 -30.352 10.557  1.00 40.06  ? 157 GLU C C   1 
ATOM   1578 O  O   . GLU C 1 57  ? 19.130 -29.828 9.850   1.00 40.98  ? 157 GLU C O   1 
ATOM   1579 C  CB  . GLU C 1 57  ? 19.315 -32.391 11.630  1.00 35.92  ? 157 GLU C CB  1 
ATOM   1580 C  CG  . GLU C 1 57  ? 19.275 -31.857 13.048  1.00 42.45  ? 157 GLU C CG  1 
ATOM   1581 C  CD  . GLU C 1 57  ? 20.322 -32.516 13.952  1.00 50.61  ? 157 GLU C CD  1 
ATOM   1582 O  OE1 . GLU C 1 57  ? 20.364 -32.179 15.163  1.00 54.48  ? 157 GLU C OE1 1 
ATOM   1583 O  OE2 . GLU C 1 57  ? 21.100 -33.370 13.450  1.00 52.54  ? 157 GLU C OE2 1 
ATOM   1584 N  N   . ILE C 1 58  ? 17.331 -29.640 11.132  1.00 45.46  ? 158 ILE C N   1 
ATOM   1585 C  CA  . ILE C 1 58  ? 17.390 -28.208 11.200  1.00 42.96  ? 158 ILE C CA  1 
ATOM   1586 C  C   . ILE C 1 58  ? 17.691 -27.883 12.631  1.00 48.43  ? 158 ILE C C   1 
ATOM   1587 O  O   . ILE C 1 58  ? 17.181 -28.487 13.527  1.00 52.32  ? 158 ILE C O   1 
ATOM   1588 C  CB  . ILE C 1 58  ? 16.088 -27.565 10.912  1.00 33.60  ? 158 ILE C CB  1 
ATOM   1589 C  CG1 . ILE C 1 58  ? 15.585 -27.983 9.581   1.00 30.19  ? 158 ILE C CG1 1 
ATOM   1590 C  CG2 . ILE C 1 58  ? 16.228 -26.124 10.911  1.00 28.11  ? 158 ILE C CG2 1 
ATOM   1591 C  CD1 . ILE C 1 58  ? 14.840 -26.944 8.933   1.00 36.32  ? 158 ILE C CD1 1 
ATOM   1592 N  N   . LYS C 1 59  ? 18.544 -26.918 12.834  1.00 52.52  ? 159 LYS C N   1 
ATOM   1593 C  CA  . LYS C 1 59  ? 19.021 -26.634 14.130  1.00 54.78  ? 159 LYS C CA  1 
ATOM   1594 C  C   . LYS C 1 59  ? 17.952 -25.963 14.950  1.00 58.78  ? 159 LYS C C   1 
ATOM   1595 O  O   . LYS C 1 59  ? 17.377 -24.983 14.552  1.00 60.39  ? 159 LYS C O   1 
ATOM   1596 C  CB  . LYS C 1 59  ? 20.267 -25.795 14.018  1.00 57.44  ? 159 LYS C CB  1 
ATOM   1597 C  CG  . LYS C 1 59  ? 20.771 -25.309 15.297  1.00 67.12  ? 159 LYS C CG  1 
ATOM   1598 C  CD  . LYS C 1 59  ? 21.995 -24.492 15.120  1.00 73.59  ? 159 LYS C CD  1 
ATOM   1599 C  CE  . LYS C 1 59  ? 21.640 -23.249 14.434  1.00 79.28  ? 159 LYS C CE  1 
ATOM   1600 N  NZ  . LYS C 1 59  ? 20.757 -22.509 15.350  1.00 78.18  ? 159 LYS C NZ  1 
ATOM   1601 N  N   . GLY C 1 60  ? 17.673 -26.542 16.103  1.00 52.83  ? 160 GLY C N   1 
ATOM   1602 C  CA  . GLY C 1 60  ? 16.723 -25.991 17.008  1.00 50.07  ? 160 GLY C CA  1 
ATOM   1603 C  C   . GLY C 1 60  ? 15.330 -25.998 16.502  1.00 51.37  ? 160 GLY C C   1 
ATOM   1604 O  O   . GLY C 1 60  ? 14.940 -26.870 15.815  1.00 53.51  ? 160 GLY C O   1 
ATOM   1605 N  N   . ASN C 1 61  ? 14.570 -25.010 16.904  1.00 53.91  ? 161 ASN C N   1 
ATOM   1606 C  CA  . ASN C 1 61  ? 13.222 -24.825 16.370  1.00 58.81  ? 161 ASN C CA  1 
ATOM   1607 C  C   . ASN C 1 61  ? 13.277 -24.292 14.938  1.00 55.98  ? 161 ASN C C   1 
ATOM   1608 O  O   . ASN C 1 61  ? 14.333 -23.827 14.473  1.00 55.87  ? 161 ASN C O   1 
ATOM   1609 C  CB  . ASN C 1 61  ? 12.401 -23.884 17.263  1.00 66.74  ? 161 ASN C CB  1 
ATOM   1610 C  CG  . ASN C 1 61  ? 12.347 -24.345 18.722  1.00 76.54  ? 161 ASN C CG  1 
ATOM   1611 O  OD1 . ASN C 1 61  ? 12.157 -25.534 19.008  1.00 80.12  ? 161 ASN C OD1 1 
ATOM   1612 N  ND2 . ASN C 1 61  ? 12.518 -23.400 19.653  1.00 77.09  ? 161 ASN C ND2 1 
HETATM 1613 N  N   . MSE C 1 62  ? 12.142 -24.354 14.246  1.00 50.96  ? 162 MSE C N   1 
HETATM 1614 C  CA  . MSE C 1 62  ? 12.088 -23.946 12.849  1.00 47.50  ? 162 MSE C CA  1 
HETATM 1615 C  C   . MSE C 1 62  ? 11.052 -22.873 12.594  1.00 50.10  ? 162 MSE C C   1 
HETATM 1616 O  O   . MSE C 1 62  ? 9.898  -22.987 13.038  1.00 52.74  ? 162 MSE C O   1 
HETATM 1617 C  CB  . MSE C 1 62  ? 11.782 -25.142 11.955  1.00 43.84  ? 162 MSE C CB  1 
HETATM 1618 C  CG  . MSE C 1 62  ? 12.800 -26.239 12.087  1.00 47.70  ? 162 MSE C CG  1 
HETATM 1619 SE SE  . MSE C 1 62  ? 11.997 -27.812 12.890  1.00 105.18 ? 162 MSE C SE  1 
HETATM 1620 C  CE  . MSE C 1 62  ? 11.027 -28.385 11.311  1.00 40.19  ? 162 MSE C CE  1 
ATOM   1621 N  N   . SER C 1 63  ? 11.459 -21.839 11.861  1.00 45.59  ? 163 SER C N   1 
ATOM   1622 C  CA  . SER C 1 63  ? 10.520 -20.804 11.458  1.00 45.78  ? 163 SER C CA  1 
ATOM   1623 C  C   . SER C 1 63  ? 11.029 -20.122 10.205  1.00 44.72  ? 163 SER C C   1 
ATOM   1624 O  O   . SER C 1 63  ? 12.236 -20.100 9.939   1.00 39.48  ? 163 SER C O   1 
ATOM   1625 C  CB  . SER C 1 63  ? 10.306 -19.788 12.580  1.00 43.01  ? 163 SER C CB  1 
ATOM   1626 O  OG  . SER C 1 63  ? 11.551 -19.244 12.975  1.00 46.70  ? 163 SER C OG  1 
ATOM   1627 N  N   . GLY C 1 64  ? 10.097 -19.561 9.442   1.00 43.09  ? 164 GLY C N   1 
ATOM   1628 C  CA  . GLY C 1 64  ? 10.441 -18.916 8.200   1.00 40.69  ? 164 GLY C CA  1 
ATOM   1629 C  C   . GLY C 1 64  ? 10.646 -19.937 7.100   1.00 42.71  ? 164 GLY C C   1 
ATOM   1630 O  O   . GLY C 1 64  ? 10.326 -21.126 7.246   1.00 45.91  ? 164 GLY C O   1 
ATOM   1631 N  N   . ASN C 1 65  ? 11.202 -19.461 5.996   1.00 40.81  ? 165 ASN C N   1 
ATOM   1632 C  CA  . ASN C 1 65  ? 11.341 -20.264 4.795   1.00 39.31  ? 165 ASN C CA  1 
ATOM   1633 C  C   . ASN C 1 65  ? 12.636 -21.048 4.762   1.00 41.91  ? 165 ASN C C   1 
ATOM   1634 O  O   . ASN C 1 65  ? 13.662 -20.613 5.298   1.00 43.83  ? 165 ASN C O   1 
ATOM   1635 C  CB  . ASN C 1 65  ? 11.241 -19.359 3.568   1.00 39.73  ? 165 ASN C CB  1 
ATOM   1636 C  CG  . ASN C 1 65  ? 9.907  -18.647 3.491   1.00 48.73  ? 165 ASN C CG  1 
ATOM   1637 O  OD1 . ASN C 1 65  ? 8.932  -19.071 4.123   1.00 51.94  ? 165 ASN C OD1 1 
ATOM   1638 N  ND2 . ASN C 1 65  ? 9.850  -17.562 2.722   1.00 57.06  ? 165 ASN C ND2 1 
ATOM   1639 N  N   . PHE C 1 66  ? 12.579 -22.219 4.138   1.00 43.45  ? 166 PHE C N   1 
ATOM   1640 C  CA  . PHE C 1 66  ? 13.784 -22.985 3.873   1.00 45.28  ? 166 PHE C CA  1 
ATOM   1641 C  C   . PHE C 1 66  ? 13.684 -23.616 2.523   1.00 48.31  ? 166 PHE C C   1 
ATOM   1642 O  O   . PHE C 1 66  ? 12.587 -23.865 2.013   1.00 52.45  ? 166 PHE C O   1 
ATOM   1643 C  CB  . PHE C 1 66  ? 13.967 -24.096 4.893   1.00 42.60  ? 166 PHE C CB  1 
ATOM   1644 C  CG  . PHE C 1 66  ? 14.089 -23.607 6.284   1.00 52.04  ? 166 PHE C CG  1 
ATOM   1645 C  CD1 . PHE C 1 66  ? 15.335 -23.309 6.822   1.00 58.59  ? 166 PHE C CD1 1 
ATOM   1646 C  CD2 . PHE C 1 66  ? 12.956 -23.444 7.075   1.00 57.79  ? 166 PHE C CD2 1 
ATOM   1647 C  CE1 . PHE C 1 66  ? 15.449 -22.857 8.151   1.00 60.70  ? 166 PHE C CE1 1 
ATOM   1648 C  CE2 . PHE C 1 66  ? 13.059 -22.996 8.391   1.00 58.25  ? 166 PHE C CE2 1 
ATOM   1649 C  CZ  . PHE C 1 66  ? 14.304 -22.701 8.928   1.00 58.22  ? 166 PHE C CZ  1 
ATOM   1650 N  N   . THR C 1 67  ? 14.844 -23.902 1.955   1.00 45.27  ? 167 THR C N   1 
ATOM   1651 C  CA  . THR C 1 67  ? 14.887 -24.684 0.743   1.00 38.67  ? 167 THR C CA  1 
ATOM   1652 C  C   . THR C 1 67  ? 15.687 -25.939 1.013   1.00 35.30  ? 167 THR C C   1 
ATOM   1653 O  O   . THR C 1 67  ? 16.649 -25.932 1.784   1.00 40.43  ? 167 THR C O   1 
ATOM   1654 C  CB  . THR C 1 67  ? 15.493 -23.896 -0.403  1.00 40.67  ? 167 THR C CB  1 
ATOM   1655 O  OG1 . THR C 1 67  ? 14.758 -22.675 -0.557  1.00 42.76  ? 167 THR C OG1 1 
ATOM   1656 C  CG2 . THR C 1 67  ? 15.429 -24.716 -1.703  1.00 40.67  ? 167 THR C CG2 1 
ATOM   1657 N  N   . TYR C 1 68  ? 15.242 -27.028 0.418   1.00 32.79  ? 168 TYR C N   1 
ATOM   1658 C  CA  . TYR C 1 68  ? 15.973 -28.265 0.466   1.00 36.82  ? 168 TYR C CA  1 
ATOM   1659 C  C   . TYR C 1 68  ? 16.040 -28.761 -0.974  1.00 41.88  ? 168 TYR C C   1 
ATOM   1660 O  O   . TYR C 1 68  ? 15.033 -28.752 -1.714  1.00 40.58  ? 168 TYR C O   1 
ATOM   1661 C  CB  . TYR C 1 68  ? 15.270 -29.288 1.358   1.00 37.53  ? 168 TYR C CB  1 
ATOM   1662 C  CG  . TYR C 1 68  ? 15.996 -30.612 1.404   1.00 43.77  ? 168 TYR C CG  1 
ATOM   1663 C  CD1 . TYR C 1 68  ? 16.961 -30.860 2.369   1.00 48.14  ? 168 TYR C CD1 1 
ATOM   1664 C  CD2 . TYR C 1 68  ? 15.727 -31.610 0.475   1.00 42.98  ? 168 TYR C CD2 1 
ATOM   1665 C  CE1 . TYR C 1 68  ? 17.639 -32.065 2.412   1.00 51.65  ? 168 TYR C CE1 1 
ATOM   1666 C  CE2 . TYR C 1 68  ? 16.398 -32.819 0.508   1.00 47.16  ? 168 TYR C CE2 1 
ATOM   1667 C  CZ  . TYR C 1 68  ? 17.354 -33.039 1.476   1.00 53.40  ? 168 TYR C CZ  1 
ATOM   1668 O  OH  . TYR C 1 68  ? 18.025 -34.242 1.512   1.00 59.46  ? 168 TYR C OH  1 
ATOM   1669 N  N   . ILE C 1 69  ? 17.237 -29.163 -1.384  1.00 43.84  ? 169 ILE C N   1 
ATOM   1670 C  CA  . ILE C 1 69  ? 17.437 -29.643 -2.744  1.00 40.02  ? 169 ILE C CA  1 
ATOM   1671 C  C   . ILE C 1 69  ? 17.437 -31.162 -2.816  1.00 36.22  ? 169 ILE C C   1 
ATOM   1672 O  O   . ILE C 1 69  ? 18.210 -31.840 -2.111  1.00 34.28  ? 169 ILE C O   1 
ATOM   1673 C  CB  . ILE C 1 69  ? 18.739 -29.117 -3.328  1.00 36.83  ? 169 ILE C CB  1 
ATOM   1674 C  CG1 . ILE C 1 69  ? 18.609 -27.612 -3.562  1.00 35.23  ? 169 ILE C CG1 1 
ATOM   1675 C  CG2 . ILE C 1 69  ? 19.081 -29.856 -4.632  1.00 37.55  ? 169 ILE C CG2 1 
ATOM   1676 C  CD1 . ILE C 1 69  ? 19.939 -26.918 -3.808  1.00 31.13  ? 169 ILE C CD1 1 
ATOM   1677 N  N   . ILE C 1 70  ? 16.542 -31.679 -3.652  1.00 33.63  ? 170 ILE C N   1 
ATOM   1678 C  CA  . ILE C 1 70  ? 16.531 -33.095 -4.005  1.00 41.64  ? 170 ILE C CA  1 
ATOM   1679 C  C   . ILE C 1 70  ? 17.242 -33.232 -5.349  1.00 43.06  ? 170 ILE C C   1 
ATOM   1680 O  O   . ILE C 1 70  ? 16.702 -32.812 -6.382  1.00 39.67  ? 170 ILE C O   1 
ATOM   1681 C  CB  . ILE C 1 70  ? 15.082 -33.621 -4.160  1.00 36.11  ? 170 ILE C CB  1 
ATOM   1682 C  CG1 . ILE C 1 70  ? 14.299 -33.457 -2.848  1.00 33.33  ? 170 ILE C CG1 1 
ATOM   1683 C  CG2 . ILE C 1 70  ? 15.083 -35.084 -4.615  1.00 26.62  ? 170 ILE C CG2 1 
ATOM   1684 C  CD1 . ILE C 1 70  ? 12.834 -33.874 -2.976  1.00 32.45  ? 170 ILE C CD1 1 
ATOM   1685 N  N   . ASP C 1 71  ? 18.443 -33.802 -5.356  1.00 49.82  ? 171 ASP C N   1 
ATOM   1686 C  CA  . ASP C 1 71  ? 19.228 -33.822 -6.602  1.00 58.57  ? 171 ASP C CA  1 
ATOM   1687 C  C   . ASP C 1 71  ? 19.436 -35.224 -7.145  1.00 49.96  ? 171 ASP C C   1 
ATOM   1688 O  O   . ASP C 1 71  ? 18.831 -36.182 -6.654  1.00 49.01  ? 171 ASP C O   1 
ATOM   1689 C  CB  . ASP C 1 71  ? 20.596 -33.172 -6.391  1.00 67.49  ? 171 ASP C CB  1 
ATOM   1690 C  CG  . ASP C 1 71  ? 21.425 -33.899 -5.346  1.00 74.58  ? 171 ASP C CG  1 
ATOM   1691 O  OD1 . ASP C 1 71  ? 20.821 -34.543 -4.455  1.00 72.70  ? 171 ASP C OD1 1 
ATOM   1692 O  OD2 . ASP C 1 71  ? 22.674 -33.820 -5.409  1.00 80.34  ? 171 ASP C OD2 1 
ATOM   1693 N  N   . LYS C 1 72  ? 20.309 -35.339 -8.144  1.00 46.35  ? 172 LYS C N   1 
ATOM   1694 C  CA  . LYS C 1 72  ? 20.675 -36.652 -8.649  1.00 48.30  ? 172 LYS C CA  1 
ATOM   1695 C  C   . LYS C 1 72  ? 19.370 -37.340 -9.086  1.00 48.27  ? 172 LYS C C   1 
ATOM   1696 O  O   . LYS C 1 72  ? 19.002 -38.414 -8.566  1.00 47.52  ? 172 LYS C O   1 
ATOM   1697 C  CB  . LYS C 1 72  ? 21.411 -37.456 -7.551  1.00 45.48  ? 172 LYS C CB  1 
ATOM   1698 N  N   . LEU C 1 73  ? 18.666 -36.697 -10.022 1.00 39.90  ? 173 LEU C N   1 
ATOM   1699 C  CA  . LEU C 1 73  ? 17.345 -37.148 -10.441 1.00 39.81  ? 173 LEU C CA  1 
ATOM   1700 C  C   . LEU C 1 73  ? 17.307 -37.488 -11.943 1.00 49.48  ? 173 LEU C C   1 
ATOM   1701 O  O   . LEU C 1 73  ? 18.287 -37.279 -12.659 1.00 57.40  ? 173 LEU C O   1 
ATOM   1702 C  CB  . LEU C 1 73  ? 16.269 -36.117 -10.063 1.00 35.22  ? 173 LEU C CB  1 
ATOM   1703 C  CG  . LEU C 1 73  ? 16.005 -35.858 -8.552  1.00 38.87  ? 173 LEU C CG  1 
ATOM   1704 C  CD1 . LEU C 1 73  ? 14.840 -34.866 -8.325  1.00 36.06  ? 173 LEU C CD1 1 
ATOM   1705 C  CD2 . LEU C 1 73  ? 15.774 -37.154 -7.740  1.00 29.76  ? 173 LEU C CD2 1 
ATOM   1706 N  N   . ILE C 1 74  ? 16.183 -38.022 -12.413 1.00 47.64  ? 174 ILE C N   1 
ATOM   1707 C  CA  . ILE C 1 74  ? 16.089 -38.502 -13.789 1.00 53.09  ? 174 ILE C CA  1 
ATOM   1708 C  C   . ILE C 1 74  ? 15.279 -37.546 -14.658 1.00 55.46  ? 174 ILE C C   1 
ATOM   1709 O  O   . ILE C 1 74  ? 14.097 -37.304 -14.390 1.00 57.12  ? 174 ILE C O   1 
ATOM   1710 C  CB  . ILE C 1 74  ? 15.433 -39.909 -13.881 1.00 52.75  ? 174 ILE C CB  1 
ATOM   1711 C  CG1 . ILE C 1 74  ? 16.098 -40.906 -12.929 1.00 47.58  ? 174 ILE C CG1 1 
ATOM   1712 C  CG2 . ILE C 1 74  ? 15.481 -40.408 -15.326 1.00 53.29  ? 174 ILE C CG2 1 
ATOM   1713 C  CD1 . ILE C 1 74  ? 17.629 -40.868 -12.972 1.00 51.74  ? 174 ILE C CD1 1 
ATOM   1714 N  N   . PRO C 1 75  ? 15.914 -36.990 -15.697 1.00 52.68  ? 175 PRO C N   1 
ATOM   1715 C  CA  . PRO C 1 75  ? 15.187 -36.101 -16.607 1.00 51.82  ? 175 PRO C CA  1 
ATOM   1716 C  C   . PRO C 1 75  ? 13.928 -36.760 -17.132 1.00 52.52  ? 175 PRO C C   1 
ATOM   1717 O  O   . PRO C 1 75  ? 13.841 -37.990 -17.168 1.00 53.82  ? 175 PRO C O   1 
ATOM   1718 C  CB  . PRO C 1 75  ? 16.195 -35.867 -17.742 1.00 51.67  ? 175 PRO C CB  1 
ATOM   1719 C  CG  . PRO C 1 75  ? 17.539 -35.954 -17.040 1.00 51.32  ? 175 PRO C CG  1 
ATOM   1720 C  CD  . PRO C 1 75  ? 17.361 -37.034 -15.993 1.00 54.25  ? 175 PRO C CD  1 
ATOM   1721 N  N   . ASN C 1 76  ? 12.958 -35.943 -17.525 1.00 56.31  ? 176 ASN C N   1 
ATOM   1722 C  CA  . ASN C 1 76  ? 11.717 -36.443 -18.117 1.00 63.80  ? 176 ASN C CA  1 
ATOM   1723 C  C   . ASN C 1 76  ? 11.029 -37.489 -17.243 1.00 66.41  ? 176 ASN C C   1 
ATOM   1724 O  O   . ASN C 1 76  ? 10.503 -38.487 -17.746 1.00 67.36  ? 176 ASN C O   1 
ATOM   1725 C  CB  . ASN C 1 76  ? 11.962 -37.004 -19.519 1.00 62.45  ? 176 ASN C CB  1 
ATOM   1726 C  CG  . ASN C 1 76  ? 10.685 -37.101 -20.331 1.00 68.05  ? 176 ASN C CG  1 
ATOM   1727 O  OD1 . ASN C 1 76  ? 10.357 -38.153 -20.885 1.00 71.09  ? 176 ASN C OD1 1 
ATOM   1728 N  ND2 . ASN C 1 76  ? 9.944  -35.999 -20.387 1.00 68.43  ? 176 ASN C ND2 1 
ATOM   1729 N  N   . THR C 1 77  ? 11.036 -37.255 -15.934 1.00 63.37  ? 177 THR C N   1 
ATOM   1730 C  CA  . THR C 1 77  ? 10.426 -38.195 -15.007 1.00 57.79  ? 177 THR C CA  1 
ATOM   1731 C  C   . THR C 1 77  ? 9.525  -37.492 -14.006 1.00 54.74  ? 177 THR C C   1 
ATOM   1732 O  O   . THR C 1 77  ? 9.853  -36.414 -13.494 1.00 57.28  ? 177 THR C O   1 
ATOM   1733 C  CB  . THR C 1 77  ? 11.486 -39.040 -14.278 1.00 51.74  ? 177 THR C CB  1 
ATOM   1734 O  OG1 . THR C 1 77  ? 12.280 -39.737 -15.249 1.00 53.42  ? 177 THR C OG1 1 
ATOM   1735 C  CG2 . THR C 1 77  ? 10.813 -40.048 -13.366 1.00 43.27  ? 177 THR C CG2 1 
ATOM   1736 N  N   . ASN C 1 78  ? 8.376  -38.103 -13.748 1.00 51.86  ? 178 ASN C N   1 
ATOM   1737 C  CA  . ASN C 1 78  ? 7.451  -37.572 -12.760 1.00 51.68  ? 178 ASN C CA  1 
ATOM   1738 C  C   . ASN C 1 78  ? 7.910  -37.804 -11.325 1.00 49.50  ? 178 ASN C C   1 
ATOM   1739 O  O   . ASN C 1 78  ? 8.225  -38.934 -10.927 1.00 53.18  ? 178 ASN C O   1 
ATOM   1740 C  CB  . ASN C 1 78  ? 6.064  -38.168 -12.954 1.00 52.97  ? 178 ASN C CB  1 
ATOM   1741 C  CG  . ASN C 1 78  ? 5.305  -37.502 -14.080 1.00 59.01  ? 178 ASN C CG  1 
ATOM   1742 O  OD1 . ASN C 1 78  ? 5.223  -36.266 -14.144 1.00 62.03  ? 178 ASN C OD1 1 
ATOM   1743 N  ND2 . ASN C 1 78  ? 4.748  -38.315 -14.984 1.00 54.59  ? 178 ASN C ND2 1 
ATOM   1744 N  N   . TYR C 1 79  ? 7.948  -36.728 -10.550 1.00 38.78  ? 179 TYR C N   1 
ATOM   1745 C  CA  . TYR C 1 79  ? 8.142  -36.859 -9.113  1.00 42.49  ? 179 TYR C CA  1 
ATOM   1746 C  C   . TYR C 1 79  ? 6.967  -36.268 -8.333  1.00 42.26  ? 179 TYR C C   1 
ATOM   1747 O  O   . TYR C 1 79  ? 6.269  -35.354 -8.802  1.00 43.96  ? 179 TYR C O   1 
ATOM   1748 C  CB  . TYR C 1 79  ? 9.463  -36.223 -8.670  1.00 41.52  ? 179 TYR C CB  1 
ATOM   1749 C  CG  . TYR C 1 79  ? 10.691 -36.954 -9.177  1.00 45.88  ? 179 TYR C CG  1 
ATOM   1750 C  CD1 . TYR C 1 79  ? 11.408 -37.803 -8.342  1.00 47.26  ? 179 TYR C CD1 1 
ATOM   1751 C  CD2 . TYR C 1 79  ? 11.136 -36.797 -10.498 1.00 44.36  ? 179 TYR C CD2 1 
ATOM   1752 C  CE1 . TYR C 1 79  ? 12.541 -38.472 -8.792  1.00 47.47  ? 179 TYR C CE1 1 
ATOM   1753 C  CE2 . TYR C 1 79  ? 12.265 -37.465 -10.960 1.00 41.49  ? 179 TYR C CE2 1 
ATOM   1754 C  CZ  . TYR C 1 79  ? 12.968 -38.299 -10.101 1.00 48.12  ? 179 TYR C CZ  1 
ATOM   1755 O  OH  . TYR C 1 79  ? 14.095 -38.971 -10.536 1.00 51.61  ? 179 TYR C OH  1 
ATOM   1756 N  N   . CYS C 1 80  ? 6.743  -36.821 -7.150  1.00 37.79  ? 180 CYS C N   1 
ATOM   1757 C  CA  . CYS C 1 80  ? 5.756  -36.282 -6.225  1.00 41.62  ? 180 CYS C CA  1 
ATOM   1758 C  C   . CYS C 1 80  ? 6.405  -36.086 -4.873  1.00 40.83  ? 180 CYS C C   1 
ATOM   1759 O  O   . CYS C 1 80  ? 7.252  -36.883 -4.439  1.00 41.10  ? 180 CYS C O   1 
ATOM   1760 C  CB  . CYS C 1 80  ? 4.531  -37.187 -6.108  1.00 41.96  ? 180 CYS C CB  1 
ATOM   1761 S  SG  . CYS C 1 80  ? 3.494  -37.168 -7.591  1.00 57.36  ? 180 CYS C SG  1 
ATOM   1762 N  N   . VAL C 1 81  ? 6.021  -35.000 -4.221  1.00 38.81  ? 181 VAL C N   1 
ATOM   1763 C  CA  . VAL C 1 81  ? 6.606  -34.650 -2.944  1.00 39.31  ? 181 VAL C CA  1 
ATOM   1764 C  C   . VAL C 1 81  ? 5.523  -34.396 -1.908  1.00 40.80  ? 181 VAL C C   1 
ATOM   1765 O  O   . VAL C 1 81  ? 4.422  -33.935 -2.236  1.00 40.59  ? 181 VAL C O   1 
ATOM   1766 C  CB  . VAL C 1 81  ? 7.491  -33.404 -3.076  1.00 39.64  ? 181 VAL C CB  1 
ATOM   1767 C  CG1 . VAL C 1 81  ? 7.946  -32.878 -1.701  1.00 36.52  ? 181 VAL C CG1 1 
ATOM   1768 C  CG2 . VAL C 1 81  ? 8.673  -33.718 -3.960  1.00 37.42  ? 181 VAL C CG2 1 
ATOM   1769 N  N   . SER C 1 82  ? 5.847  -34.697 -0.652  1.00 42.75  ? 182 SER C N   1 
ATOM   1770 C  CA  . SER C 1 82  ? 4.947  -34.466 0.471   1.00 36.41  ? 182 SER C CA  1 
ATOM   1771 C  C   . SER C 1 82  ? 5.813  -34.077 1.654   1.00 35.00  ? 182 SER C C   1 
ATOM   1772 O  O   . SER C 1 82  ? 6.938  -34.573 1.789   1.00 34.80  ? 182 SER C O   1 
ATOM   1773 C  CB  . SER C 1 82  ? 4.162  -35.735 0.783   1.00 32.99  ? 182 SER C CB  1 
ATOM   1774 O  OG  . SER C 1 82  ? 3.513  -35.610 2.038   1.00 42.61  ? 182 SER C OG  1 
ATOM   1775 N  N   . VAL C 1 83  ? 5.310  -33.195 2.513   1.00 33.40  ? 183 VAL C N   1 
ATOM   1776 C  CA  . VAL C 1 83  ? 6.079  -32.819 3.697   1.00 34.68  ? 183 VAL C CA  1 
ATOM   1777 C  C   . VAL C 1 83  ? 5.335  -33.094 4.992   1.00 39.79  ? 183 VAL C C   1 
ATOM   1778 O  O   . VAL C 1 83  ? 4.092  -33.097 5.039   1.00 42.18  ? 183 VAL C O   1 
ATOM   1779 C  CB  . VAL C 1 83  ? 6.510  -31.345 3.676   1.00 32.30  ? 183 VAL C CB  1 
ATOM   1780 C  CG1 . VAL C 1 83  ? 7.411  -31.108 2.498   1.00 36.94  ? 183 VAL C CG1 1 
ATOM   1781 C  CG2 . VAL C 1 83  ? 5.287  -30.450 3.575   1.00 33.13  ? 183 VAL C CG2 1 
ATOM   1782 N  N   . TYR C 1 84  ? 6.102  -33.330 6.048   1.00 39.02  ? 184 TYR C N   1 
ATOM   1783 C  CA  . TYR C 1 84  ? 5.500  -33.465 7.359   1.00 34.62  ? 184 TYR C CA  1 
ATOM   1784 C  C   . TYR C 1 84  ? 6.492  -33.414 8.507   1.00 36.59  ? 184 TYR C C   1 
ATOM   1785 O  O   . TYR C 1 84  ? 7.704  -33.590 8.335   1.00 32.96  ? 184 TYR C O   1 
ATOM   1786 C  CB  . TYR C 1 84  ? 4.634  -34.719 7.455   1.00 32.97  ? 184 TYR C CB  1 
ATOM   1787 C  CG  . TYR C 1 84  ? 5.374  -36.005 7.219   1.00 38.94  ? 184 TYR C CG  1 
ATOM   1788 C  CD1 . TYR C 1 84  ? 5.923  -36.733 8.283   1.00 41.08  ? 184 TYR C CD1 1 
ATOM   1789 C  CD2 . TYR C 1 84  ? 5.513  -36.508 5.939   1.00 42.89  ? 184 TYR C CD2 1 
ATOM   1790 C  CE1 . TYR C 1 84  ? 6.584  -37.924 8.064   1.00 43.16  ? 184 TYR C CE1 1 
ATOM   1791 C  CE2 . TYR C 1 84  ? 6.180  -37.692 5.705   1.00 45.67  ? 184 TYR C CE2 1 
ATOM   1792 C  CZ  . TYR C 1 84  ? 6.708  -38.398 6.760   1.00 47.64  ? 184 TYR C CZ  1 
ATOM   1793 O  OH  . TYR C 1 84  ? 7.366  -39.579 6.496   1.00 51.86  ? 184 TYR C OH  1 
ATOM   1794 N  N   . LEU C 1 85  ? 5.941  -33.149 9.688   1.00 41.41  ? 185 LEU C N   1 
ATOM   1795 C  CA  . LEU C 1 85  ? 6.717  -33.082 10.904  1.00 38.43  ? 185 LEU C CA  1 
ATOM   1796 C  C   . LEU C 1 85  ? 6.495  -34.375 11.664  1.00 40.17  ? 185 LEU C C   1 
ATOM   1797 O  O   . LEU C 1 85  ? 5.386  -34.917 11.660  1.00 44.90  ? 185 LEU C O   1 
ATOM   1798 C  CB  . LEU C 1 85  ? 6.277  -31.877 11.724  1.00 38.08  ? 185 LEU C CB  1 
ATOM   1799 C  CG  . LEU C 1 85  ? 6.305  -30.587 10.894  1.00 37.85  ? 185 LEU C CG  1 
ATOM   1800 C  CD1 . LEU C 1 85  ? 5.764  -29.391 11.660  1.00 36.28  ? 185 LEU C CD1 1 
ATOM   1801 C  CD2 . LEU C 1 85  ? 7.718  -30.306 10.387  1.00 36.53  ? 185 LEU C CD2 1 
ATOM   1802 N  N   . GLU C 1 86  ? 7.528  -34.883 12.285  1.00 39.22  ? 186 GLU C N   1 
ATOM   1803 C  CA  . GLU C 1 86  ? 7.410  -36.026 13.135  1.00 37.78  ? 186 GLU C CA  1 
ATOM   1804 C  C   . GLU C 1 86  ? 8.361  -35.862 14.274  1.00 39.83  ? 186 GLU C C   1 
ATOM   1805 O  O   . GLU C 1 86  ? 9.302  -35.147 14.178  1.00 44.27  ? 186 GLU C O   1 
ATOM   1806 C  CB  . GLU C 1 86  ? 7.744  -37.292 12.392  1.00 33.35  ? 186 GLU C CB  1 
ATOM   1807 C  CG  . GLU C 1 86  ? 9.178  -37.496 12.215  1.00 39.13  ? 186 GLU C CG  1 
ATOM   1808 C  CD  . GLU C 1 86  ? 9.536  -38.708 11.433  1.00 48.36  ? 186 GLU C CD  1 
ATOM   1809 O  OE1 . GLU C 1 86  ? 10.684 -39.099 11.470  1.00 48.35  ? 186 GLU C OE1 1 
ATOM   1810 O  OE2 . GLU C 1 86  ? 8.700  -39.274 10.768  1.00 51.43  ? 186 GLU C OE2 1 
ATOM   1811 N  N   . HIS C 1 87  ? 8.107  -36.554 15.358  1.00 36.84  ? 187 HIS C N   1 
ATOM   1812 C  CA  . HIS C 1 87  ? 9.053  -36.660 16.405  1.00 40.46  ? 187 HIS C CA  1 
ATOM   1813 C  C   . HIS C 1 87  ? 9.702  -37.969 16.168  1.00 43.13  ? 187 HIS C C   1 
ATOM   1814 O  O   . HIS C 1 87  ? 10.855 -38.132 16.347  1.00 48.97  ? 187 HIS C O   1 
ATOM   1815 C  CB  . HIS C 1 87  ? 8.344  -36.623 17.764  1.00 46.78  ? 187 HIS C CB  1 
ATOM   1816 C  CG  . HIS C 1 87  ? 9.168  -37.132 18.898  1.00 52.06  ? 187 HIS C CG  1 
ATOM   1817 N  ND1 . HIS C 1 87  ? 10.140 -36.382 19.500  1.00 54.33  ? 187 HIS C ND1 1 
ATOM   1818 C  CD2 . HIS C 1 87  ? 9.177  -38.325 19.522  1.00 54.19  ? 187 HIS C CD2 1 
ATOM   1819 C  CE1 . HIS C 1 87  ? 10.724 -37.094 20.434  1.00 57.43  ? 187 HIS C CE1 1 
ATOM   1820 N  NE2 . HIS C 1 87  ? 10.158 -38.278 20.465  1.00 57.83  ? 187 HIS C NE2 1 
ATOM   1821 N  N   . SER C 1 88  ? 8.933  -38.914 15.720  1.00 44.45  ? 188 SER C N   1 
ATOM   1822 C  CA  . SER C 1 88  ? 9.399  -40.249 15.636  1.00 49.32  ? 188 SER C CA  1 
ATOM   1823 C  C   . SER C 1 88  ? 8.890  -40.911 14.408  1.00 57.97  ? 188 SER C C   1 
ATOM   1824 O  O   . SER C 1 88  ? 7.839  -40.607 13.953  1.00 62.78  ? 188 SER C O   1 
ATOM   1825 C  CB  . SER C 1 88  ? 8.865  -41.003 16.815  1.00 49.39  ? 188 SER C CB  1 
ATOM   1826 O  OG  . SER C 1 88  ? 9.015  -42.370 16.647  1.00 51.71  ? 188 SER C OG  1 
ATOM   1827 N  N   . ASP C 1 89  ? 9.645  -41.855 13.889  1.00 59.77  ? 189 ASP C N   1 
ATOM   1828 C  CA  . ASP C 1 89  ? 9.270  -42.593 12.698  1.00 59.10  ? 189 ASP C CA  1 
ATOM   1829 C  C   . ASP C 1 89  ? 7.946  -43.345 12.877  1.00 55.99  ? 189 ASP C C   1 
ATOM   1830 O  O   . ASP C 1 89  ? 7.172  -43.483 11.929  1.00 57.55  ? 189 ASP C O   1 
ATOM   1831 C  CB  . ASP C 1 89  ? 10.374 -43.590 12.346  1.00 63.14  ? 189 ASP C CB  1 
ATOM   1832 C  CG  . ASP C 1 89  ? 10.065 -44.376 11.084  1.00 69.16  ? 189 ASP C CG  1 
ATOM   1833 O  OD1 . ASP C 1 89  ? 10.300 -45.608 11.066  1.00 71.14  ? 189 ASP C OD1 1 
ATOM   1834 O  OD2 . ASP C 1 89  ? 9.593  -43.756 10.102  1.00 71.64  ? 189 ASP C OD2 1 
ATOM   1835 N  N   . GLU C 1 90  ? 7.682  -43.835 14.083  1.00 47.59  ? 190 GLU C N   1 
ATOM   1836 C  CA  . GLU C 1 90  ? 6.504  -44.666 14.295  1.00 44.72  ? 190 GLU C CA  1 
ATOM   1837 C  C   . GLU C 1 90  ? 5.298  -43.923 14.876  1.00 41.51  ? 190 GLU C C   1 
ATOM   1838 O  O   . GLU C 1 90  ? 4.297  -44.551 15.236  1.00 36.62  ? 190 GLU C O   1 
ATOM   1839 C  CB  . GLU C 1 90  ? 6.842  -45.882 15.166  1.00 54.32  ? 190 GLU C CB  1 
ATOM   1840 C  CG  . GLU C 1 90  ? 8.010  -46.717 14.638  1.00 67.81  ? 190 GLU C CG  1 
ATOM   1841 C  CD  . GLU C 1 90  ? 8.216  -48.050 15.374  1.00 76.45  ? 190 GLU C CD  1 
ATOM   1842 O  OE1 . GLU C 1 90  ? 9.385  -48.504 15.426  1.00 79.60  ? 190 GLU C OE1 1 
ATOM   1843 O  OE2 . GLU C 1 90  ? 7.228  -48.654 15.876  1.00 76.79  ? 190 GLU C OE2 1 
ATOM   1844 N  N   . GLN C 1 91  ? 5.365  -42.596 14.970  1.00 45.49  ? 191 GLN C N   1 
ATOM   1845 C  CA  . GLN C 1 91  ? 4.198  -41.861 15.465  1.00 48.44  ? 191 GLN C CA  1 
ATOM   1846 C  C   . GLN C 1 91  ? 3.197  -41.557 14.347  1.00 45.72  ? 191 GLN C C   1 
ATOM   1847 O  O   . GLN C 1 91  ? 3.535  -41.577 13.150  1.00 41.29  ? 191 GLN C O   1 
ATOM   1848 C  CB  . GLN C 1 91  ? 4.597  -40.545 16.141  1.00 51.87  ? 191 GLN C CB  1 
ATOM   1849 C  CG  . GLN C 1 91  ? 4.760  -39.365 15.164  1.00 53.41  ? 191 GLN C CG  1 
ATOM   1850 C  CD  . GLN C 1 91  ? 4.821  -38.000 15.870  1.00 59.45  ? 191 GLN C CD  1 
ATOM   1851 O  OE1 . GLN C 1 91  ? 5.900  -37.540 16.258  1.00 66.69  ? 191 GLN C OE1 1 
ATOM   1852 N  NE2 . GLN C 1 91  ? 3.665  -37.339 16.012  1.00 53.10  ? 191 GLN C NE2 1 
ATOM   1853 N  N   . ALA C 1 92  ? 1.964  -41.283 14.764  1.00 44.47  ? 192 ALA C N   1 
ATOM   1854 C  CA  . ALA C 1 92  ? 0.950  -40.706 13.899  1.00 35.04  ? 192 ALA C CA  1 
ATOM   1855 C  C   . ALA C 1 92  ? 1.498  -39.392 13.344  1.00 37.10  ? 192 ALA C C   1 
ATOM   1856 O  O   . ALA C 1 92  ? 2.145  -38.629 14.048  1.00 36.26  ? 192 ALA C O   1 
ATOM   1857 C  CB  . ALA C 1 92  ? -0.318 -40.462 14.677  1.00 27.03  ? 192 ALA C CB  1 
ATOM   1858 N  N   . VAL C 1 93  ? 1.236  -39.130 12.072  1.00 38.56  ? 193 VAL C N   1 
ATOM   1859 C  CA  . VAL C 1 93  ? 1.854  -38.005 11.407  1.00 30.95  ? 193 VAL C CA  1 
ATOM   1860 C  C   . VAL C 1 93  ? 0.836  -37.370 10.436  1.00 34.44  ? 193 VAL C C   1 
ATOM   1861 O  O   . VAL C 1 93  ? -0.038 -38.065 9.851   1.00 29.93  ? 193 VAL C O   1 
ATOM   1862 C  CB  . VAL C 1 93  ? 3.152  -38.492 10.724  1.00 32.98  ? 193 VAL C CB  1 
ATOM   1863 C  CG1 . VAL C 1 93  ? 3.180  -38.173 9.214   1.00 30.28  ? 193 VAL C CG1 1 
ATOM   1864 C  CG2 . VAL C 1 93  ? 4.369  -37.951 11.456  1.00 29.83  ? 193 VAL C CG2 1 
ATOM   1865 N  N   . ILE C 1 94  ? 0.915  -36.050 10.293  1.00 26.82  ? 194 ILE C N   1 
ATOM   1866 C  CA  . ILE C 1 94  ? -0.026 -35.366 9.431   1.00 29.67  ? 194 ILE C CA  1 
ATOM   1867 C  C   . ILE C 1 94  ? 0.638  -34.965 8.095   1.00 34.74  ? 194 ILE C C   1 
ATOM   1868 O  O   . ILE C 1 94  ? 1.444  -34.029 8.033   1.00 34.41  ? 194 ILE C O   1 
ATOM   1869 C  CB  . ILE C 1 94  ? -0.612 -34.155 10.136  1.00 30.75  ? 194 ILE C CB  1 
ATOM   1870 C  CG1 . ILE C 1 94  ? -1.084 -34.554 11.537  1.00 30.20  ? 194 ILE C CG1 1 
ATOM   1871 C  CG2 . ILE C 1 94  ? -1.755 -33.579 9.300   1.00 30.42  ? 194 ILE C CG2 1 
ATOM   1872 C  CD1 . ILE C 1 94  ? -1.615 -33.410 12.372  1.00 27.30  ? 194 ILE C CD1 1 
ATOM   1873 N  N   . LYS C 1 95  ? 0.308  -35.680 7.026   1.00 31.13  ? 195 LYS C N   1 
ATOM   1874 C  CA  . LYS C 1 95  ? 1.013  -35.458 5.777   1.00 38.21  ? 195 LYS C CA  1 
ATOM   1875 C  C   . LYS C 1 95  ? 0.321  -34.439 4.883   1.00 40.05  ? 195 LYS C C   1 
ATOM   1876 O  O   . LYS C 1 95  ? -0.878 -34.553 4.597   1.00 41.54  ? 195 LYS C O   1 
ATOM   1877 C  CB  . LYS C 1 95  ? 1.200  -36.777 5.012   1.00 40.74  ? 195 LYS C CB  1 
ATOM   1878 C  CG  . LYS C 1 95  ? 2.301  -37.669 5.573   1.00 37.83  ? 195 LYS C CG  1 
ATOM   1879 C  CD  . LYS C 1 95  ? 2.298  -39.017 4.872   1.00 35.43  ? 195 LYS C CD  1 
ATOM   1880 C  CE  . LYS C 1 95  ? 3.403  -39.906 5.402   1.00 36.10  ? 195 LYS C CE  1 
ATOM   1881 N  NZ  . LYS C 1 95  ? 3.731  -41.019 4.460   1.00 34.56  ? 195 LYS C NZ  1 
ATOM   1882 N  N   . SER C 1 96  ? 1.083  -33.448 4.433   1.00 34.12  ? 196 SER C N   1 
ATOM   1883 C  CA  . SER C 1 96  ? 0.585  -32.547 3.407   1.00 32.80  ? 196 SER C CA  1 
ATOM   1884 C  C   . SER C 1 96  ? 0.125  -33.346 2.204   1.00 36.15  ? 196 SER C C   1 
ATOM   1885 O  O   . SER C 1 96  ? 0.620  -34.449 1.940   1.00 37.16  ? 196 SER C O   1 
ATOM   1886 C  CB  . SER C 1 96  ? 1.678  -31.574 2.957   1.00 33.34  ? 196 SER C CB  1 
ATOM   1887 O  OG  . SER C 1 96  ? 2.504  -32.154 1.962   1.00 38.18  ? 196 SER C OG  1 
ATOM   1888 N  N   . PRO C 1 97  ? -0.839 -32.789 1.469   1.00 41.82  ? 197 PRO C N   1 
ATOM   1889 C  CA  . PRO C 1 97  ? -1.210 -33.288 0.131   1.00 41.02  ? 197 PRO C CA  1 
ATOM   1890 C  C   . PRO C 1 97  ? 0.026  -33.288 -0.772  1.00 42.29  ? 197 PRO C C   1 
ATOM   1891 O  O   . PRO C 1 97  ? 0.987  -32.568 -0.473  1.00 41.28  ? 197 PRO C O   1 
ATOM   1892 C  CB  . PRO C 1 97  ? -2.210 -32.241 -0.376  1.00 40.26  ? 197 PRO C CB  1 
ATOM   1893 C  CG  . PRO C 1 97  ? -2.784 -31.607 0.892   1.00 46.64  ? 197 PRO C CG  1 
ATOM   1894 C  CD  . PRO C 1 97  ? -1.670 -31.655 1.924   1.00 41.91  ? 197 PRO C CD  1 
ATOM   1895 N  N   . LEU C 1 98  ? -0.001 -34.074 -1.851  1.00 41.39  ? 198 LEU C N   1 
ATOM   1896 C  CA  . LEU C 1 98  ? 1.138  -34.188 -2.749  1.00 43.36  ? 198 LEU C CA  1 
ATOM   1897 C  C   . LEU C 1 98  ? 1.252  -32.998 -3.698  1.00 44.24  ? 198 LEU C C   1 
ATOM   1898 O  O   . LEU C 1 98  ? 0.248  -32.421 -4.123  1.00 44.84  ? 198 LEU C O   1 
ATOM   1899 C  CB  . LEU C 1 98  ? 1.033  -35.457 -3.606  1.00 46.34  ? 198 LEU C CB  1 
ATOM   1900 C  CG  . LEU C 1 98  ? 0.955  -36.833 -2.953  1.00 41.08  ? 198 LEU C CG  1 
ATOM   1901 C  CD1 . LEU C 1 98  ? 0.936  -37.890 -4.061  1.00 43.67  ? 198 LEU C CD1 1 
ATOM   1902 C  CD2 . LEU C 1 98  ? 2.147  -37.033 -2.061  1.00 36.05  ? 198 LEU C CD2 1 
ATOM   1903 N  N   . LYS C 1 99  ? 2.483  -32.641 -4.036  1.00 42.04  ? 199 LYS C N   1 
ATOM   1904 C  CA  . LYS C 1 99  ? 2.712  -31.754 -5.160  1.00 42.51  ? 199 LYS C CA  1 
ATOM   1905 C  C   . LYS C 1 99  ? 3.611  -32.492 -6.153  1.00 41.65  ? 199 LYS C C   1 
ATOM   1906 O  O   . LYS C 1 99  ? 4.559  -33.186 -5.762  1.00 39.98  ? 199 LYS C O   1 
ATOM   1907 C  CB  . LYS C 1 99  ? 3.289  -30.405 -4.714  1.00 43.11  ? 199 LYS C CB  1 
ATOM   1908 C  CG  . LYS C 1 99  ? 2.269  -29.486 -4.042  1.00 40.90  ? 199 LYS C CG  1 
ATOM   1909 C  CD  . LYS C 1 99  ? 2.748  -28.032 -3.992  1.00 43.16  ? 199 LYS C CD  1 
ATOM   1910 C  CE  . LYS C 1 99  ? 1.770  -27.154 -3.216  1.00 44.32  ? 199 LYS C CE  1 
ATOM   1911 N  NZ  . LYS C 1 99  ? 1.678  -27.568 -1.785  1.00 41.56  ? 199 LYS C NZ  1 
ATOM   1912 N  N   . CYS C 1 100 ? 3.284  -32.382 -7.436  1.00 44.68  ? 200 CYS C N   1 
ATOM   1913 C  CA  . CYS C 1 100 ? 3.931  -33.219 -8.440  1.00 42.41  ? 200 CYS C CA  1 
ATOM   1914 C  C   . CYS C 1 100 ? 4.487  -32.381 -9.569  1.00 40.50  ? 200 CYS C C   1 
ATOM   1915 O  O   . CYS C 1 100 ? 3.942  -31.312 -9.895  1.00 37.64  ? 200 CYS C O   1 
ATOM   1916 C  CB  . CYS C 1 100 ? 2.953  -34.256 -8.998  1.00 44.43  ? 200 CYS C CB  1 
ATOM   1917 S  SG  . CYS C 1 100 ? 2.352  -35.465 -7.774  1.00 55.35  ? 200 CYS C SG  1 
ATOM   1918 N  N   . THR C 1 101 ? 5.576  -32.869 -10.162 1.00 41.69  ? 201 THR C N   1 
ATOM   1919 C  CA  . THR C 1 101 ? 6.216  -32.174 -11.275 1.00 41.78  ? 201 THR C CA  1 
ATOM   1920 C  C   . THR C 1 101 ? 6.975  -33.133 -12.206 1.00 39.60  ? 201 THR C C   1 
ATOM   1921 O  O   . THR C 1 101 ? 7.558  -34.139 -11.774 1.00 35.98  ? 201 THR C O   1 
ATOM   1922 C  CB  . THR C 1 101 ? 7.147  -31.044 -10.741 1.00 53.77  ? 201 THR C CB  1 
ATOM   1923 O  OG1 . THR C 1 101 ? 7.418  -30.082 -11.771 1.00 53.99  ? 201 THR C OG1 1 
ATOM   1924 C  CG2 . THR C 1 101 ? 8.455  -31.624 -10.173 1.00 50.46  ? 201 THR C CG2 1 
ATOM   1925 N  N   . LEU C 1 102 ? 6.954  -32.816 -13.494 1.00 46.07  ? 202 LEU C N   1 
ATOM   1926 C  CA  . LEU C 1 102 ? 7.656  -33.615 -14.488 1.00 42.03  ? 202 LEU C CA  1 
ATOM   1927 C  C   . LEU C 1 102 ? 8.968  -32.931 -14.824 1.00 42.56  ? 202 LEU C C   1 
ATOM   1928 O  O   . LEU C 1 102 ? 8.961  -31.819 -15.352 1.00 49.92  ? 202 LEU C O   1 
ATOM   1929 C  CB  . LEU C 1 102 ? 6.800  -33.743 -15.739 1.00 40.07  ? 202 LEU C CB  1 
ATOM   1930 C  CG  . LEU C 1 102 ? 7.467  -34.387 -16.967 1.00 45.29  ? 202 LEU C CG  1 
ATOM   1931 C  CD1 . LEU C 1 102 ? 7.980  -35.810 -16.670 1.00 45.50  ? 202 LEU C CD1 1 
ATOM   1932 C  CD2 . LEU C 1 102 ? 6.516  -34.373 -18.172 1.00 36.24  ? 202 LEU C CD2 1 
ATOM   1933 N  N   . LEU C 1 103 ? 10.092 -33.569 -14.509 1.00 40.23  ? 203 LEU C N   1 
ATOM   1934 C  CA  . LEU C 1 103 ? 11.390 -32.962 -14.806 1.00 45.06  ? 203 LEU C CA  1 
ATOM   1935 C  C   . LEU C 1 103 ? 11.549 -32.758 -16.313 1.00 53.69  ? 203 LEU C C   1 
ATOM   1936 O  O   . LEU C 1 103 ? 11.225 -33.649 -17.099 1.00 59.35  ? 203 LEU C O   1 
ATOM   1937 C  CB  . LEU C 1 103 ? 12.539 -33.822 -14.280 1.00 42.44  ? 203 LEU C CB  1 
ATOM   1938 C  CG  . LEU C 1 103 ? 12.644 -33.970 -12.768 1.00 44.57  ? 203 LEU C CG  1 
ATOM   1939 C  CD1 . LEU C 1 103 ? 14.094 -34.220 -12.359 1.00 43.36  ? 203 LEU C CD1 1 
ATOM   1940 C  CD2 . LEU C 1 103 ? 12.098 -32.726 -12.068 1.00 46.58  ? 203 LEU C CD2 1 
ATOM   1941 N  N   . PRO C 1 104 ? 12.037 -31.576 -16.714 1.00 56.40  ? 204 PRO C N   1 
ATOM   1942 C  CA  . PRO C 1 104 ? 12.342 -31.236 -18.112 1.00 58.86  ? 204 PRO C CA  1 
ATOM   1943 C  C   . PRO C 1 104 ? 13.424 -32.144 -18.712 1.00 60.30  ? 204 PRO C C   1 
ATOM   1944 O  O   . PRO C 1 104 ? 14.319 -32.596 -17.982 1.00 61.25  ? 204 PRO C O   1 
ATOM   1945 C  CB  . PRO C 1 104 ? 12.891 -29.804 -18.013 1.00 58.19  ? 204 PRO C CB  1 
ATOM   1946 C  CG  . PRO C 1 104 ? 12.353 -29.269 -16.733 1.00 59.78  ? 204 PRO C CG  1 
ATOM   1947 C  CD  . PRO C 1 104 ? 12.288 -30.447 -15.800 1.00 60.08  ? 204 PRO C CD  1 
ATOM   1948 N  N   . PRO C 1 105 ? 13.354 -32.395 -20.033 1.00 58.04  ? 205 PRO C N   1 
ATOM   1949 C  CA  . PRO C 1 105 ? 14.400 -33.163 -20.720 1.00 56.92  ? 205 PRO C CA  1 
ATOM   1950 C  C   . PRO C 1 105 ? 15.620 -32.291 -20.969 1.00 58.31  ? 205 PRO C C   1 
ATOM   1951 O  O   . PRO C 1 105 ? 16.711 -32.823 -21.216 1.00 62.65  ? 205 PRO C O   1 
ATOM   1952 C  CB  . PRO C 1 105 ? 13.745 -33.529 -22.052 1.00 57.33  ? 205 PRO C CB  1 
ATOM   1953 C  CG  . PRO C 1 105 ? 12.816 -32.384 -22.318 1.00 56.84  ? 205 PRO C CG  1 
ATOM   1954 C  CD  . PRO C 1 105 ? 12.306 -31.934 -20.963 1.00 57.23  ? 205 PRO C CD  1 
ATOM   1955 O  OXT . PRO C 1 105 ? 15.532 -31.049 -20.913 1.00 53.07  ? 205 PRO C OXT 1 
HETATM 1956 CL CL  . CL  D 2 .   ? 16.644 -21.993 17.695  1.00 79.60  ? 1   CL  A CL  1 
HETATM 1957 CL CL  . CL  E 2 .   ? 19.001 -36.135 4.894   1.00 62.98  ? 1   CL  C CL  1 
HETATM 1958 O  O   . HOH F 3 .   ? 30.587 -26.548 -0.886  1.00 34.21  ? 5   HOH A O   1 
HETATM 1959 O  O   . HOH F 3 .   ? 27.856 -23.719 -2.306  1.00 31.17  ? 6   HOH A O   1 
HETATM 1960 O  O   . HOH F 3 .   ? 26.813 -21.761 -1.873  1.00 21.74  ? 7   HOH A O   1 
HETATM 1961 O  O   . HOH F 3 .   ? 35.229 -32.013 2.262   1.00 38.18  ? 14  HOH A O   1 
HETATM 1962 O  O   . HOH F 3 .   ? 33.100 -12.129 0.061   1.00 49.26  ? 18  HOH A O   1 
HETATM 1963 O  O   . HOH F 3 .   ? 15.403 -20.355 1.420   1.00 41.71  ? 20  HOH A O   1 
HETATM 1964 O  O   . HOH F 3 .   ? 29.601 -17.424 -2.070  1.00 31.77  ? 26  HOH A O   1 
HETATM 1965 O  O   . HOH F 3 .   ? 32.513 -16.077 1.245   1.00 58.34  ? 28  HOH A O   1 
HETATM 1966 O  O   . HOH F 3 .   ? 32.776 -22.567 19.468  1.00 48.35  ? 30  HOH A O   1 
HETATM 1967 O  O   . HOH F 3 .   ? 16.701 -18.533 -0.526  1.00 43.73  ? 32  HOH A O   1 
HETATM 1968 O  O   . HOH F 3 .   ? 21.799 -30.457 16.830  1.00 42.40  ? 34  HOH A O   1 
HETATM 1969 O  O   . HOH F 3 .   ? 25.105 -16.337 13.275  1.00 44.83  ? 35  HOH A O   1 
HETATM 1970 O  O   . HOH F 3 .   ? 24.175 -28.426 18.278  1.00 41.58  ? 206 HOH A O   1 
HETATM 1971 O  O   . HOH G 3 .   ? 27.675 -16.776 -5.897  1.00 37.03  ? 2   HOH B O   1 
HETATM 1972 O  O   . HOH G 3 .   ? 45.826 -28.325 -11.277 1.00 39.47  ? 3   HOH B O   1 
HETATM 1973 O  O   . HOH G 3 .   ? 28.091 -30.787 -7.228  1.00 44.18  ? 4   HOH B O   1 
HETATM 1974 O  O   . HOH G 3 .   ? 49.299 -17.858 -0.156  1.00 42.46  ? 11  HOH B O   1 
HETATM 1975 O  O   . HOH G 3 .   ? 25.417 -20.299 -4.222  1.00 31.14  ? 12  HOH B O   1 
HETATM 1976 O  O   . HOH G 3 .   ? 39.047 -23.746 -18.170 1.00 33.66  ? 15  HOH B O   1 
HETATM 1977 O  O   . HOH G 3 .   ? 38.980 -20.282 -17.187 1.00 47.85  ? 16  HOH B O   1 
HETATM 1978 O  O   . HOH G 3 .   ? 43.229 -24.560 -19.350 1.00 31.73  ? 21  HOH B O   1 
HETATM 1979 O  O   . HOH G 3 .   ? 47.092 -23.808 3.352   1.00 46.61  ? 24  HOH B O   1 
HETATM 1980 O  O   . HOH G 3 .   ? 34.928 -15.444 3.433   1.00 44.70  ? 29  HOH B O   1 
HETATM 1981 O  O   . HOH G 3 .   ? 51.567 -19.592 -0.078  1.00 50.12  ? 31  HOH B O   1 
HETATM 1982 O  O   . HOH G 3 .   ? 21.406 -25.039 -9.228  1.00 38.42  ? 33  HOH B O   1 
HETATM 1983 O  O   . HOH H 3 .   ? 3.280  -32.239 9.595   1.00 29.67  ? 8   HOH C O   1 
HETATM 1984 O  O   . HOH H 3 .   ? 14.613 -34.161 9.772   1.00 43.56  ? 9   HOH C O   1 
HETATM 1985 O  O   . HOH H 3 .   ? 2.762  -34.804 12.001  1.00 38.14  ? 10  HOH C O   1 
HETATM 1986 O  O   . HOH H 3 .   ? 19.980 -35.349 8.864   1.00 45.15  ? 13  HOH C O   1 
HETATM 1987 O  O   . HOH H 3 .   ? 1.003  -25.645 0.786   1.00 43.67  ? 17  HOH C O   1 
HETATM 1988 O  O   . HOH H 3 .   ? 4.610  -25.707 -5.888  1.00 36.77  ? 19  HOH C O   1 
HETATM 1989 O  O   . HOH H 3 .   ? 1.033  -28.362 3.711   1.00 41.89  ? 22  HOH C O   1 
HETATM 1990 O  O   . HOH H 3 .   ? 8.053  -41.191 20.320  1.00 43.03  ? 23  HOH C O   1 
HETATM 1991 O  O   . HOH H 3 .   ? 16.796 -38.575 -4.080  1.00 49.09  ? 25  HOH C O   1 
HETATM 1992 O  O   . HOH H 3 .   ? 1.539  -42.347 3.187   1.00 46.74  ? 27  HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . SER A 6   ? 0.7188 0.8376 0.7957 0.1157  0.0249  0.0803  106 SER A N   
2    C  CA  . SER A 6   ? 0.7842 0.8897 0.8628 0.1074  0.0274  0.0691  106 SER A CA  
3    C  C   . SER A 6   ? 0.7566 0.8352 0.8268 0.1004  0.0322  0.0628  106 SER A C   
4    O  O   . SER A 6   ? 0.7976 0.8594 0.8637 0.1054  0.0393  0.0679  106 SER A O   
5    C  CB  . SER A 6   ? 0.8296 0.9328 0.9177 0.1148  0.0344  0.0713  106 SER A CB  
6    O  OG  . SER A 6   ? 0.8218 0.9046 0.9093 0.1079  0.0400  0.0620  106 SER A OG  
7    N  N   . PHE A 7   ? 0.6498 0.7249 0.7176 0.0888  0.0287  0.0518  107 PHE A N   
8    C  CA  . PHE A 7   ? 0.6393 0.6937 0.6991 0.0811  0.0316  0.0455  107 PHE A CA  
9    C  C   . PHE A 7   ? 0.5983 0.6499 0.6581 0.0699  0.0290  0.0340  107 PHE A C   
10   O  O   . PHE A 7   ? 0.4866 0.5528 0.5511 0.0670  0.0237  0.0305  107 PHE A O   
11   C  CB  . PHE A 7   ? 0.6240 0.6814 0.6758 0.0788  0.0267  0.0473  107 PHE A CB  
12   C  CG  . PHE A 7   ? 0.6394 0.7129 0.6900 0.0709  0.0172  0.0416  107 PHE A CG  
13   C  CD1 . PHE A 7   ? 0.6258 0.6912 0.6719 0.0604  0.0151  0.0321  107 PHE A CD1 
14   C  CD2 . PHE A 7   ? 0.6207 0.7179 0.6747 0.0737  0.0107  0.0456  107 PHE A CD2 
15   C  CE1 . PHE A 7   ? 0.6121 0.6905 0.6569 0.0532  0.0075  0.0267  107 PHE A CE1 
16   C  CE2 . PHE A 7   ? 0.6203 0.7313 0.6725 0.0653  0.0029  0.0396  107 PHE A CE2 
17   C  CZ  . PHE A 7   ? 0.6291 0.7296 0.6767 0.0553  0.0016  0.0301  107 PHE A CZ  
18   N  N   . GLU A 8   ? 0.6154 0.6489 0.6693 0.0635  0.0327  0.0284  108 GLU A N   
19   C  CA  . GLU A 8   ? 0.5913 0.6215 0.6443 0.0532  0.0305  0.0186  108 GLU A CA  
20   C  C   . GLU A 8   ? 0.5466 0.5783 0.5926 0.0462  0.0245  0.0148  108 GLU A C   
21   O  O   . GLU A 8   ? 0.6398 0.6606 0.6794 0.0452  0.0270  0.0155  108 GLU A O   
22   C  CB  . GLU A 8   ? 0.6832 0.6940 0.7349 0.0501  0.0391  0.0144  108 GLU A CB  
23   C  CG  . GLU A 8   ? 0.7691 0.7749 0.8272 0.0557  0.0468  0.0166  108 GLU A CG  
24   C  CD  . GLU A 8   ? 0.8325 0.8196 0.8884 0.0503  0.0554  0.0109  108 GLU A CD  
25   O  OE1 . GLU A 8   ? 0.8880 0.8599 0.9407 0.0537  0.0640  0.0140  108 GLU A OE1 
26   O  OE2 . GLU A 8   ? 0.7696 0.7574 0.8263 0.0421  0.0538  0.0032  108 GLU A OE2 
27   N  N   . PRO A 9   ? 0.4721 0.5167 0.5191 0.0410  0.0172  0.0105  109 PRO A N   
28   C  CA  . PRO A 9   ? 0.4759 0.5213 0.5169 0.0341  0.0122  0.0061  109 PRO A CA  
29   C  C   . PRO A 9   ? 0.4889 0.5210 0.5270 0.0268  0.0146  -0.0008 109 PRO A C   
30   O  O   . PRO A 9   ? 0.4582 0.4849 0.4996 0.0249  0.0180  -0.0040 109 PRO A O   
31   C  CB  . PRO A 9   ? 0.4324 0.4945 0.4761 0.0310  0.0054  0.0035  109 PRO A CB  
32   C  CG  . PRO A 9   ? 0.5115 0.5769 0.5627 0.0328  0.0074  0.0027  109 PRO A CG  
33   C  CD  . PRO A 9   ? 0.5075 0.5657 0.5614 0.0412  0.0142  0.0092  109 PRO A CD  
34   N  N   . PRO A 10  ? 0.4660 0.4944 0.4980 0.0226  0.0127  -0.0030 110 PRO A N   
35   C  CA  . PRO A 10  ? 0.4650 0.4824 0.4938 0.0165  0.0151  -0.0083 110 PRO A CA  
36   C  C   . PRO A 10  ? 0.5355 0.5558 0.5675 0.0112  0.0130  -0.0139 110 PRO A C   
37   O  O   . PRO A 10  ? 0.5283 0.5592 0.5627 0.0105  0.0082  -0.0149 110 PRO A O   
38   C  CB  . PRO A 10  ? 0.4880 0.5066 0.5110 0.0139  0.0115  -0.0091 110 PRO A CB  
39   C  CG  . PRO A 10  ? 0.5160 0.5441 0.5382 0.0187  0.0084  -0.0038 110 PRO A CG  
40   C  CD  . PRO A 10  ? 0.4626 0.5006 0.4912 0.0221  0.0071  -0.0018 110 PRO A CD  
41   N  N   . GLU A 11  ? 0.5544 0.5662 0.5862 0.0071  0.0168  -0.0176 111 GLU A N   
42   C  CA  . GLU A 11  ? 0.5407 0.5550 0.5745 0.0015  0.0147  -0.0227 111 GLU A CA  
43   C  C   . GLU A 11  ? 0.5268 0.5389 0.5560 -0.0032 0.0128  -0.0256 111 GLU A C   
44   O  O   . GLU A 11  ? 0.5511 0.5579 0.5760 -0.0031 0.0146  -0.0246 111 GLU A O   
45   C  CB  . GLU A 11  ? 0.5556 0.5645 0.5924 -0.0004 0.0199  -0.0248 111 GLU A CB  
46   C  CG  . GLU A 11  ? 0.6109 0.6222 0.6531 0.0047  0.0223  -0.0222 111 GLU A CG  
47   C  CD  . GLU A 11  ? 0.6253 0.6312 0.6705 0.0018  0.0277  -0.0253 111 GLU A CD  
48   O  OE1 . GLU A 11  ? 0.5879 0.5846 0.6298 -0.0020 0.0326  -0.0276 111 GLU A OE1 
49   O  OE2 . GLU A 11  ? 0.5809 0.5925 0.6314 0.0030  0.0273  -0.0258 111 GLU A OE2 
50   N  N   . PHE A 12  ? 0.4377 0.4538 0.4678 -0.0072 0.0095  -0.0289 112 PHE A N   
51   C  CA  . PHE A 12  ? 0.3746 0.3893 0.4011 -0.0107 0.0079  -0.0310 112 PHE A CA  
52   C  C   . PHE A 12  ? 0.3632 0.3799 0.3909 -0.0150 0.0062  -0.0342 112 PHE A C   
53   O  O   . PHE A 12  ? 0.3075 0.3281 0.3384 -0.0158 0.0047  -0.0352 112 PHE A O   
54   C  CB  . PHE A 12  ? 0.3265 0.3443 0.3498 -0.0090 0.0045  -0.0297 112 PHE A CB  
55   C  CG  . PHE A 12  ? 0.3014 0.3261 0.3257 -0.0099 0.0004  -0.0310 112 PHE A CG  
56   C  CD1 . PHE A 12  ? 0.3607 0.3852 0.3831 -0.0131 -0.0015 -0.0337 112 PHE A CD1 
57   C  CD2 . PHE A 12  ? 0.3508 0.3824 0.3779 -0.0076 -0.0012 -0.0295 112 PHE A CD2 
58   C  CE1 . PHE A 12  ? 0.4429 0.4722 0.4653 -0.0148 -0.0043 -0.0355 112 PHE A CE1 
59   C  CE2 . PHE A 12  ? 0.3496 0.3884 0.3769 -0.0097 -0.0047 -0.0314 112 PHE A CE2 
60   C  CZ  . PHE A 12  ? 0.3827 0.4193 0.4073 -0.0136 -0.0059 -0.0347 112 PHE A CZ  
61   N  N   . GLU A 13  ? 0.3704 0.3849 0.3956 -0.0177 0.0067  -0.0353 113 GLU A N   
62   C  CA  . GLU A 13  ? 0.4311 0.4475 0.4568 -0.0210 0.0052  -0.0372 113 GLU A CA  
63   C  C   . GLU A 13  ? 0.4389 0.4554 0.4616 -0.0207 0.0033  -0.0371 113 GLU A C   
64   O  O   . GLU A 13  ? 0.4139 0.4286 0.4339 -0.0193 0.0040  -0.0361 113 GLU A O   
65   C  CB  . GLU A 13  ? 0.5064 0.5220 0.5327 -0.0246 0.0082  -0.0383 113 GLU A CB  
66   C  CG  . GLU A 13  ? 0.6388 0.6538 0.6681 -0.0257 0.0109  -0.0393 113 GLU A CG  
67   C  CD  . GLU A 13  ? 0.8038 0.8221 0.8363 -0.0249 0.0083  -0.0397 113 GLU A CD  
68   O  OE1 . GLU A 13  ? 0.8191 0.8398 0.8511 -0.0259 0.0051  -0.0402 113 GLU A OE1 
69   O  OE2 . GLU A 13  ? 0.8393 0.8576 0.8747 -0.0234 0.0100  -0.0395 113 GLU A OE2 
70   N  N   . ILE A 14  ? 0.3956 0.4134 0.4186 -0.0219 0.0014  -0.0380 114 ILE A N   
71   C  CA  . ILE A 14  ? 0.3657 0.3827 0.3863 -0.0216 0.0008  -0.0378 114 ILE A CA  
72   C  C   . ILE A 14  ? 0.4127 0.4307 0.4342 -0.0234 0.0012  -0.0376 114 ILE A C   
73   O  O   . ILE A 14  ? 0.4271 0.4462 0.4506 -0.0253 0.0009  -0.0381 114 ILE A O   
74   C  CB  . ILE A 14  ? 0.2590 0.2755 0.2781 -0.0209 -0.0011 -0.0388 114 ILE A CB  
75   C  CG1 . ILE A 14  ? 0.2219 0.2390 0.2426 -0.0229 -0.0019 -0.0400 114 ILE A CG1 
76   C  CG2 . ILE A 14  ? 0.3380 0.3561 0.3561 -0.0193 -0.0020 -0.0384 114 ILE A CG2 
77   C  CD1 . ILE A 14  ? 0.3129 0.3284 0.3313 -0.0237 -0.0026 -0.0416 114 ILE A CD1 
78   N  N   . VAL A 15  ? 0.3899 0.4085 0.4102 -0.0227 0.0019  -0.0366 115 VAL A N   
79   C  CA  . VAL A 15  ? 0.3906 0.4109 0.4116 -0.0230 0.0020  -0.0353 115 VAL A CA  
80   C  C   . VAL A 15  ? 0.3985 0.4163 0.4178 -0.0202 0.0022  -0.0346 115 VAL A C   
81   O  O   . VAL A 15  ? 0.3987 0.4163 0.4165 -0.0188 0.0027  -0.0348 115 VAL A O   
82   C  CB  . VAL A 15  ? 0.3814 0.4075 0.4035 -0.0250 0.0032  -0.0342 115 VAL A CB  
83   C  CG1 . VAL A 15  ? 0.5344 0.5615 0.5551 -0.0253 0.0047  -0.0347 115 VAL A CG1 
84   C  CG2 . VAL A 15  ? 0.2675 0.2970 0.2901 -0.0236 0.0032  -0.0315 115 VAL A CG2 
85   N  N   . GLY A 16  ? 0.3659 0.3811 0.3852 -0.0197 0.0023  -0.0340 116 GLY A N   
86   C  CA  . GLY A 16  ? 0.3904 0.4014 0.4080 -0.0171 0.0036  -0.0338 116 GLY A CA  
87   C  C   . GLY A 16  ? 0.4412 0.4544 0.4599 -0.0143 0.0052  -0.0304 116 GLY A C   
88   O  O   . GLY A 16  ? 0.5856 0.6017 0.6060 -0.0143 0.0053  -0.0279 116 GLY A O   
89   N  N   . PHE A 17  ? 0.4737 0.4864 0.4915 -0.0116 0.0065  -0.0301 117 PHE A N   
90   C  CA  . PHE A 17  ? 0.3781 0.3939 0.3976 -0.0080 0.0084  -0.0265 117 PHE A CA  
91   C  C   . PHE A 17  ? 0.4631 0.4703 0.4810 -0.0049 0.0113  -0.0267 117 PHE A C   
92   O  O   . PHE A 17  ? 0.5125 0.5123 0.5275 -0.0067 0.0117  -0.0303 117 PHE A O   
93   C  CB  . PHE A 17  ? 0.3292 0.3529 0.3496 -0.0074 0.0083  -0.0259 117 PHE A CB  
94   C  CG  . PHE A 17  ? 0.4131 0.4443 0.4344 -0.0112 0.0066  -0.0261 117 PHE A CG  
95   C  CD1 . PHE A 17  ? 0.4633 0.5039 0.4871 -0.0118 0.0065  -0.0231 117 PHE A CD1 
96   C  CD2 . PHE A 17  ? 0.3846 0.4135 0.4043 -0.0143 0.0057  -0.0292 117 PHE A CD2 
97   C  CE1 . PHE A 17  ? 0.3921 0.4392 0.4161 -0.0164 0.0058  -0.0241 117 PHE A CE1 
98   C  CE2 . PHE A 17  ? 0.4004 0.4342 0.4206 -0.0180 0.0054  -0.0298 117 PHE A CE2 
99   C  CZ  . PHE A 17  ? 0.4044 0.4471 0.4266 -0.0196 0.0056  -0.0277 117 PHE A CZ  
100  N  N   . THR A 18  ? 0.5122 0.5208 0.5318 -0.0004 0.0137  -0.0230 118 THR A N   
101  C  CA  . THR A 18  ? 0.5705 0.5691 0.5887 0.0028  0.0178  -0.0227 118 THR A CA  
102  C  C   . THR A 18  ? 0.5831 0.5748 0.5979 0.0016  0.0194  -0.0275 118 THR A C   
103  O  O   . THR A 18  ? 0.6202 0.6016 0.6319 0.0005  0.0222  -0.0302 118 THR A O   
104  C  CB  . THR A 18  ? 0.5598 0.5619 0.5811 0.0092  0.0207  -0.0169 118 THR A CB  
105  O  OG1 . THR A 18  ? 0.5900 0.5797 0.6096 0.0124  0.0258  -0.0163 118 THR A OG1 
106  C  CG2 . THR A 18  ? 0.5205 0.5305 0.5436 0.0115  0.0209  -0.0166 118 THR A CG2 
107  N  N   . ASN A 19  ? 0.5241 0.5215 0.5390 0.0011  0.0179  -0.0289 119 ASN A N   
108  C  CA  . ASN A 19  ? 0.5772 0.5695 0.5884 -0.0006 0.0190  -0.0334 119 ASN A CA  
109  C  C   . ASN A 19  ? 0.5827 0.5802 0.5925 -0.0040 0.0154  -0.0357 119 ASN A C   
110  O  O   . ASN A 19  ? 0.6089 0.6055 0.6163 -0.0047 0.0161  -0.0382 119 ASN A O   
111  C  CB  . ASN A 19  ? 0.6037 0.5942 0.6152 0.0034  0.0231  -0.0329 119 ASN A CB  
112  C  CG  . ASN A 19  ? 0.6603 0.6616 0.6756 0.0065  0.0222  -0.0294 119 ASN A CG  
113  O  OD1 . ASN A 19  ? 0.6614 0.6708 0.6774 0.0040  0.0187  -0.0294 119 ASN A OD1 
114  N  ND2 . ASN A 19  ? 0.6899 0.6918 0.7078 0.0119  0.0259  -0.0264 119 ASN A ND2 
115  N  N   . HIS A 20  ? 0.4643 0.4669 0.4756 -0.0062 0.0122  -0.0348 120 HIS A N   
116  C  CA  . HIS A 20  ? 0.4124 0.4180 0.4221 -0.0089 0.0096  -0.0365 120 HIS A CA  
117  C  C   . HIS A 20  ? 0.4338 0.4416 0.4449 -0.0113 0.0071  -0.0362 120 HIS A C   
118  O  O   . HIS A 20  ? 0.4780 0.4875 0.4916 -0.0111 0.0070  -0.0342 120 HIS A O   
119  C  CB  . HIS A 20  ? 0.3371 0.3487 0.3474 -0.0080 0.0099  -0.0355 120 HIS A CB  
120  C  CG  . HIS A 20  ? 0.4075 0.4265 0.4213 -0.0075 0.0096  -0.0325 120 HIS A CG  
121  N  ND1 . HIS A 20  ? 0.3697 0.3926 0.3843 -0.0104 0.0080  -0.0323 120 HIS A ND1 
122  C  CD2 . HIS A 20  ? 0.4144 0.4387 0.4310 -0.0047 0.0111  -0.0297 120 HIS A CD2 
123  C  CE1 . HIS A 20  ? 0.4286 0.4592 0.4459 -0.0102 0.0083  -0.0299 120 HIS A CE1 
124  N  NE2 . HIS A 20  ? 0.3799 0.4124 0.3986 -0.0065 0.0099  -0.0279 120 HIS A NE2 
125  N  N   . ILE A 21  ? 0.3094 0.3175 0.3188 -0.0133 0.0054  -0.0378 121 ILE A N   
126  C  CA  . ILE A 21  ? 0.2919 0.3020 0.3030 -0.0152 0.0036  -0.0375 121 ILE A CA  
127  C  C   . ILE A 21  ? 0.3825 0.3956 0.3935 -0.0158 0.0034  -0.0369 121 ILE A C   
128  O  O   . ILE A 21  ? 0.4831 0.4956 0.4916 -0.0154 0.0035  -0.0373 121 ILE A O   
129  C  CB  . ILE A 21  ? 0.2922 0.3003 0.3019 -0.0167 0.0022  -0.0395 121 ILE A CB  
130  C  CG1 . ILE A 21  ? 0.3455 0.3495 0.3547 -0.0174 0.0032  -0.0407 121 ILE A CG1 
131  C  CG2 . ILE A 21  ? 0.2363 0.2472 0.2480 -0.0179 0.0006  -0.0390 121 ILE A CG2 
132  C  CD1 . ILE A 21  ? 0.2833 0.2870 0.2911 -0.0201 0.0021  -0.0432 121 ILE A CD1 
133  N  N   . ASN A 22  ? 0.3962 0.4124 0.4095 -0.0170 0.0036  -0.0359 122 ASN A N   
134  C  CA  . ASN A 22  ? 0.4279 0.4453 0.4406 -0.0183 0.0046  -0.0358 122 ASN A CA  
135  C  C   . ASN A 22  ? 0.4673 0.4827 0.4804 -0.0188 0.0040  -0.0361 122 ASN A C   
136  O  O   . ASN A 22  ? 0.5526 0.5689 0.5683 -0.0201 0.0037  -0.0363 122 ASN A O   
137  C  CB  . ASN A 22  ? 0.2916 0.3138 0.3058 -0.0203 0.0061  -0.0352 122 ASN A CB  
138  C  CG  . ASN A 22  ? 0.3154 0.3417 0.3295 -0.0192 0.0068  -0.0343 122 ASN A CG  
139  O  OD1 . ASN A 22  ? 0.3781 0.4023 0.3915 -0.0165 0.0064  -0.0341 122 ASN A OD1 
140  N  ND2 . ASN A 22  ? 0.2987 0.3314 0.3133 -0.0215 0.0082  -0.0339 122 ASN A ND2 
141  N  N   . VAL A 23  ? 0.3520 0.3654 0.3629 -0.0176 0.0041  -0.0358 123 VAL A N   
142  C  CA  . VAL A 23  ? 0.3613 0.3738 0.3730 -0.0169 0.0038  -0.0352 123 VAL A CA  
143  C  C   . VAL A 23  ? 0.4174 0.4275 0.4286 -0.0173 0.0069  -0.0343 123 VAL A C   
144  O  O   . VAL A 23  ? 0.4698 0.4778 0.4780 -0.0170 0.0087  -0.0338 123 VAL A O   
145  C  CB  . VAL A 23  ? 0.3115 0.3245 0.3211 -0.0149 0.0019  -0.0347 123 VAL A CB  
146  C  CG1 . VAL A 23  ? 0.2569 0.2714 0.2683 -0.0134 0.0014  -0.0332 123 VAL A CG1 
147  C  CG2 . VAL A 23  ? 0.2590 0.2733 0.2684 -0.0157 -0.0001 -0.0364 123 VAL A CG2 
148  N  N   . MSE A 24  ? 0.4164 0.4262 0.4305 -0.0182 0.0081  -0.0346 124 MSE A N   
149  C  CA  A MSE A 24  ? 0.3941 0.4003 0.4078 -0.0192 0.0123  -0.0344 124 MSE A CA  
150  C  CA  B MSE A 24  ? 0.3990 0.4052 0.4128 -0.0192 0.0123  -0.0344 124 MSE A CA  
151  C  C   . MSE A 24  ? 0.4287 0.4326 0.4438 -0.0159 0.0130  -0.0324 124 MSE A C   
152  O  O   . MSE A 24  ? 0.4676 0.4739 0.4862 -0.0155 0.0117  -0.0327 124 MSE A O   
153  C  CB  A MSE A 24  ? 0.4059 0.4136 0.4216 -0.0234 0.0142  -0.0363 124 MSE A CB  
154  C  CB  B MSE A 24  ? 0.4050 0.4128 0.4209 -0.0232 0.0140  -0.0363 124 MSE A CB  
155  C  CG  A MSE A 24  ? 0.4008 0.4119 0.4148 -0.0268 0.0150  -0.0375 124 MSE A CG  
156  C  CG  B MSE A 24  ? 0.4180 0.4239 0.4317 -0.0270 0.0187  -0.0376 124 MSE A CG  
157  SE SE  A MSE A 24  ? 0.6738 0.6911 0.6889 -0.0257 0.0104  -0.0370 124 MSE A SE  
158  SE SE  B MSE A 24  ? 0.7861 0.7942 0.8020 -0.0331 0.0222  -0.0405 124 MSE A SE  
159  C  CE  A MSE A 24  ? 0.2680 0.2868 0.2871 -0.0264 0.0083  -0.0374 124 MSE A CE  
160  C  CE  B MSE A 24  ? 0.4788 0.4853 0.4896 -0.0384 0.0281  -0.0425 124 MSE A CE  
161  N  N   . VAL A 25  ? 0.3914 0.3911 0.4036 -0.0134 0.0153  -0.0302 125 VAL A N   
162  C  CA  . VAL A 25  ? 0.3331 0.3313 0.3465 -0.0089 0.0163  -0.0270 125 VAL A CA  
163  C  C   . VAL A 25  ? 0.4383 0.4288 0.4515 -0.0090 0.0228  -0.0264 125 VAL A C   
164  O  O   . VAL A 25  ? 0.4397 0.4246 0.4492 -0.0119 0.0268  -0.0276 125 VAL A O   
165  C  CB  . VAL A 25  ? 0.3919 0.3903 0.4015 -0.0054 0.0149  -0.0237 125 VAL A CB  
166  C  CG1 . VAL A 25  ? 0.3668 0.3659 0.3780 0.0002  0.0156  -0.0191 125 VAL A CG1 
167  C  CG2 . VAL A 25  ? 0.2600 0.2646 0.2685 -0.0063 0.0098  -0.0250 125 VAL A CG2 
168  N  N   . LYS A 26  ? 0.5579 0.5478 0.5749 -0.0060 0.0244  -0.0248 126 LYS A N   
169  C  CA  . LYS A 26  ? 0.6850 0.6658 0.7016 -0.0048 0.0317  -0.0237 126 LYS A CA  
170  C  C   . LYS A 26  ? 0.8132 0.7927 0.8304 0.0028  0.0328  -0.0178 126 LYS A C   
171  O  O   . LYS A 26  ? 0.8054 0.7909 0.8275 0.0067  0.0306  -0.0157 126 LYS A O   
172  C  CB  . LYS A 26  ? 0.6756 0.6556 0.6963 -0.0076 0.0346  -0.0267 126 LYS A CB  
173  N  N   . PHE A 27  ? 0.9194 0.8919 0.9316 0.0047  0.0361  -0.0149 127 PHE A N   
174  C  CA  . PHE A 27  ? 0.9416 0.9132 0.9536 0.0124  0.0373  -0.0082 127 PHE A CA  
175  C  C   . PHE A 27  ? 1.0116 0.9722 1.0247 0.0158  0.0460  -0.0058 127 PHE A C   
176  O  O   . PHE A 27  ? 1.0793 1.0394 1.0938 0.0234  0.0477  0.0006  127 PHE A O   
177  C  CB  . PHE A 27  ? 0.8760 0.8460 0.8817 0.0133  0.0362  -0.0055 127 PHE A CB  
178  N  N   . SER A 40  ? 0.7653 0.8133 0.7434 0.0203  -0.0023 0.0158  140 SER A N   
179  C  CA  . SER A 40  ? 0.7925 0.8450 0.7773 0.0256  -0.0021 0.0196  140 SER A CA  
180  C  C   . SER A 40  ? 0.7812 0.8308 0.7720 0.0224  -0.0022 0.0130  140 SER A C   
181  O  O   . SER A 40  ? 0.7940 0.8546 0.7897 0.0229  -0.0053 0.0127  140 SER A O   
182  C  CB  . SER A 40  ? 0.7591 0.8020 0.7439 0.0330  0.0034  0.0273  140 SER A CB  
183  N  N   . LEU A 41  ? 0.6947 0.7311 0.6850 0.0190  0.0010  0.0079  141 LEU A N   
184  C  CA  . LEU A 41  ? 0.6459 0.6809 0.6411 0.0153  0.0004  0.0018  141 LEU A CA  
185  C  C   . LEU A 41  ? 0.5199 0.5586 0.5134 0.0088  -0.0031 -0.0049 141 LEU A C   
186  O  O   . LEU A 41  ? 0.4565 0.4905 0.4454 0.0058  -0.0025 -0.0074 141 LEU A O   
187  C  CB  . LEU A 41  ? 0.6607 0.6819 0.6573 0.0150  0.0057  0.0000  141 LEU A CB  
188  C  CG  . LEU A 41  ? 0.7036 0.7240 0.7049 0.0111  0.0051  -0.0059 141 LEU A CG  
189  C  CD1 . LEU A 41  ? 0.7100 0.7235 0.7155 0.0132  0.0096  -0.0051 141 LEU A CD1 
190  C  CD2 . LEU A 41  ? 0.7305 0.7459 0.7291 0.0055  0.0052  -0.0115 141 LEU A CD2 
191  N  N   . VAL A 42  ? 0.4289 0.4756 0.4263 0.0068  -0.0061 -0.0079 142 VAL A N   
192  C  CA  . VAL A 42  ? 0.4695 0.5197 0.4650 0.0010  -0.0088 -0.0137 142 VAL A CA  
193  C  C   . VAL A 42  ? 0.4730 0.5188 0.4722 -0.0022 -0.0084 -0.0189 142 VAL A C   
194  O  O   . VAL A 42  ? 0.4277 0.4752 0.4319 -0.0009 -0.0084 -0.0186 142 VAL A O   
195  C  CB  . VAL A 42  ? 0.5169 0.5819 0.5115 -0.0002 -0.0127 -0.0131 142 VAL A CB  
196  C  CG1 . VAL A 42  ? 0.5652 0.6320 0.5573 -0.0069 -0.0142 -0.0198 142 VAL A CG1 
197  C  CG2 . VAL A 42  ? 0.4986 0.5692 0.4888 0.0027  -0.0134 -0.0075 142 VAL A CG2 
198  N  N   . ILE A 43  ? 0.4445 0.4848 0.4413 -0.0061 -0.0078 -0.0234 143 ILE A N   
199  C  CA  . ILE A 43  ? 0.3894 0.4264 0.3889 -0.0091 -0.0076 -0.0279 143 ILE A CA  
200  C  C   . ILE A 43  ? 0.4144 0.4556 0.4114 -0.0134 -0.0092 -0.0320 143 ILE A C   
201  O  O   . ILE A 43  ? 0.4925 0.5312 0.4853 -0.0153 -0.0085 -0.0339 143 ILE A O   
202  C  CB  . ILE A 43  ? 0.3644 0.3919 0.3637 -0.0097 -0.0048 -0.0294 143 ILE A CB  
203  C  CG1 . ILE A 43  ? 0.3939 0.4167 0.3952 -0.0069 -0.0022 -0.0263 143 ILE A CG1 
204  C  CG2 . ILE A 43  ? 0.3141 0.3394 0.3159 -0.0125 -0.0047 -0.0332 143 ILE A CG2 
205  C  CD1 . ILE A 43  ? 0.3566 0.3723 0.3571 -0.0082 0.0007  -0.0277 143 ILE A CD1 
206  N  N   . GLU A 44  ? 0.3623 0.4095 0.3616 -0.0152 -0.0109 -0.0336 144 GLU A N   
207  C  CA  . GLU A 44  ? 0.3717 0.4231 0.3682 -0.0202 -0.0118 -0.0380 144 GLU A CA  
208  C  C   . GLU A 44  ? 0.3970 0.4402 0.3944 -0.0229 -0.0099 -0.0421 144 GLU A C   
209  O  O   . GLU A 44  ? 0.5108 0.5516 0.5123 -0.0221 -0.0096 -0.0419 144 GLU A O   
210  C  CB  . GLU A 44  ? 0.3931 0.4569 0.3914 -0.0210 -0.0144 -0.0373 144 GLU A CB  
211  C  CG  . GLU A 44  ? 0.4642 0.5375 0.4581 -0.0259 -0.0157 -0.0402 144 GLU A CG  
212  C  CD  . GLU A 44  ? 0.6547 0.7425 0.6512 -0.0270 -0.0184 -0.0395 144 GLU A CD  
213  O  OE1 . GLU A 44  ? 0.7494 0.8486 0.7465 -0.0237 -0.0206 -0.0346 144 GLU A OE1 
214  O  OE2 . GLU A 44  ? 0.6747 0.7629 0.6726 -0.0309 -0.0180 -0.0435 144 GLU A OE2 
215  N  N   . GLU A 45  ? 0.3527 0.3913 0.3461 -0.0259 -0.0081 -0.0457 145 GLU A N   
216  C  CA  . GLU A 45  ? 0.3941 0.4241 0.3878 -0.0278 -0.0055 -0.0489 145 GLU A CA  
217  C  C   . GLU A 45  ? 0.4690 0.5007 0.4595 -0.0334 -0.0046 -0.0537 145 GLU A C   
218  O  O   . GLU A 45  ? 0.5318 0.5647 0.5175 -0.0364 -0.0036 -0.0563 145 GLU A O   
219  C  CB  . GLU A 45  ? 0.4073 0.4296 0.3989 -0.0265 -0.0029 -0.0492 145 GLU A CB  
220  C  CG  . GLU A 45  ? 0.4527 0.4665 0.4437 -0.0280 0.0005  -0.0523 145 GLU A CG  
221  C  CD  . GLU A 45  ? 0.5958 0.6049 0.5832 -0.0282 0.0035  -0.0541 145 GLU A CD  
222  O  OE1 . GLU A 45  ? 0.5248 0.5351 0.5115 -0.0260 0.0031  -0.0522 145 GLU A OE1 
223  O  OE2 . GLU A 45  ? 0.6117 0.6150 0.5966 -0.0308 0.0069  -0.0577 145 GLU A OE2 
224  N  N   . GLN A 46  ? 0.4932 0.5246 0.4857 -0.0355 -0.0045 -0.0554 146 GLN A N   
225  C  CA  . GLN A 46  ? 0.4987 0.5305 0.4874 -0.0418 -0.0027 -0.0606 146 GLN A CA  
226  C  C   . GLN A 46  ? 0.5627 0.5816 0.5504 -0.0431 0.0017  -0.0632 146 GLN A C   
227  O  O   . GLN A 46  ? 0.6006 0.6144 0.5919 -0.0405 0.0020  -0.0612 146 GLN A O   
228  C  CB  . GLN A 46  ? 0.4845 0.5267 0.4752 -0.0445 -0.0052 -0.0613 146 GLN A CB  
229  C  CG  . GLN A 46  ? 0.5751 0.6294 0.5693 -0.0406 -0.0094 -0.0566 146 GLN A CG  
230  C  CD  . GLN A 46  ? 0.6422 0.7089 0.6386 -0.0432 -0.0117 -0.0573 146 GLN A CD  
231  O  OE1 . GLN A 46  ? 0.7054 0.7711 0.7011 -0.0482 -0.0103 -0.0614 146 GLN A OE1 
232  N  NE2 . GLN A 46  ? 0.6335 0.7123 0.6327 -0.0396 -0.0149 -0.0530 146 GLN A NE2 
233  N  N   . SER A 47  ? 0.6108 0.6244 0.5933 -0.0471 0.0056  -0.0675 147 SER A N   
234  C  CA  . SER A 47  ? 0.6522 0.6533 0.6327 -0.0491 0.0108  -0.0704 147 SER A CA  
235  C  C   . SER A 47  ? 0.7248 0.7289 0.7005 -0.0574 0.0127  -0.0763 147 SER A C   
236  O  O   . SER A 47  ? 0.7151 0.7327 0.6904 -0.0605 0.0090  -0.0771 147 SER A O   
237  C  CB  . SER A 47  ? 0.7104 0.7015 0.6886 -0.0470 0.0152  -0.0709 147 SER A CB  
238  O  OG  . SER A 47  ? 0.8298 0.8085 0.8086 -0.0452 0.0197  -0.0705 147 SER A OG  
239  N  N   . GLU A 48  ? 0.7751 0.7676 0.7471 -0.0611 0.0185  -0.0803 148 GLU A N   
240  C  CA  . GLU A 48  ? 0.7937 0.7890 0.7606 -0.0702 0.0209  -0.0866 148 GLU A CA  
241  C  C   . GLU A 48  ? 0.7923 0.7921 0.7531 -0.0760 0.0228  -0.0915 148 GLU A C   
242  O  O   . GLU A 48  ? 0.8011 0.7904 0.7583 -0.0761 0.0280  -0.0936 148 GLU A O   
243  C  CB  . GLU A 48  ? 0.9005 0.8806 0.8646 -0.0729 0.0275  -0.0894 148 GLU A CB  
244  C  CG  . GLU A 48  ? 1.0216 1.0046 0.9803 -0.0832 0.0303  -0.0963 148 GLU A CG  
245  C  CD  . GLU A 48  ? 1.1647 1.1301 1.1178 -0.0864 0.0395  -0.0996 148 GLU A CD  
246  O  OE1 . GLU A 48  ? 1.1812 1.1349 1.1323 -0.0836 0.0440  -0.1001 148 GLU A OE1 
247  O  OE2 . GLU A 48  ? 1.2398 1.2033 1.1909 -0.0909 0.0425  -0.1009 148 GLU A OE2 
248  N  N   . GLY A 49  ? 0.7332 0.7498 0.6927 -0.0810 0.0188  -0.0932 149 GLY A N   
249  C  CA  . GLY A 49  ? 0.6994 0.7248 0.6535 -0.0866 0.0191  -0.0970 149 GLY A CA  
250  C  C   . GLY A 49  ? 0.6833 0.7172 0.6399 -0.0805 0.0141  -0.0916 149 GLY A C   
251  O  O   . GLY A 49  ? 0.7628 0.8102 0.7163 -0.0844 0.0118  -0.0928 149 GLY A O   
252  N  N   . ILE A 50  ? 0.5922 0.6190 0.5541 -0.0715 0.0125  -0.0857 150 ILE A N   
253  C  CA  . ILE A 50  ? 0.5254 0.5563 0.4886 -0.0661 0.0095  -0.0813 150 ILE A CA  
254  C  C   . ILE A 50  ? 0.5408 0.5802 0.5104 -0.0591 0.0033  -0.0743 150 ILE A C   
255  O  O   . ILE A 50  ? 0.6125 0.6482 0.5872 -0.0553 0.0023  -0.0716 150 ILE A O   
256  C  CB  . ILE A 50  ? 0.4698 0.4856 0.4329 -0.0619 0.0138  -0.0809 150 ILE A CB  
257  C  CG1 . ILE A 50  ? 0.4502 0.4546 0.4075 -0.0680 0.0213  -0.0877 150 ILE A CG1 
258  C  CG2 . ILE A 50  ? 0.4975 0.5175 0.4601 -0.0585 0.0117  -0.0780 150 ILE A CG2 
259  C  CD1 . ILE A 50  ? 0.4623 0.4539 0.4190 -0.0641 0.0262  -0.0876 150 ILE A CD1 
260  N  N   . VAL A 51  ? 0.5355 0.5860 0.5045 -0.0576 -0.0003 -0.0713 151 VAL A N   
261  C  CA  . VAL A 51  ? 0.4342 0.4904 0.4084 -0.0505 -0.0049 -0.0643 151 VAL A CA  
262  C  C   . VAL A 51  ? 0.4488 0.5034 0.4214 -0.0468 -0.0052 -0.0612 151 VAL A C   
263  O  O   . VAL A 51  ? 0.5081 0.5698 0.4758 -0.0501 -0.0055 -0.0624 151 VAL A O   
264  C  CB  . VAL A 51  ? 0.3395 0.4133 0.3151 -0.0515 -0.0093 -0.0621 151 VAL A CB  
265  C  CG1 . VAL A 51  ? 0.3045 0.3828 0.2844 -0.0436 -0.0128 -0.0545 151 VAL A CG1 
266  C  CG2 . VAL A 51  ? 0.3411 0.4171 0.3194 -0.0543 -0.0094 -0.0644 151 VAL A CG2 
267  N  N   . LYS A 52  ? 0.3800 0.4261 0.3563 -0.0407 -0.0049 -0.0575 152 LYS A N   
268  C  CA  . LYS A 52  ? 0.3577 0.4019 0.3327 -0.0371 -0.0049 -0.0544 152 LYS A CA  
269  C  C   . LYS A 52  ? 0.4470 0.4960 0.4257 -0.0315 -0.0081 -0.0481 152 LYS A C   
270  O  O   . LYS A 52  ? 0.4620 0.5090 0.4457 -0.0287 -0.0087 -0.0461 152 LYS A O   
271  C  CB  . LYS A 52  ? 0.3294 0.3607 0.3051 -0.0349 -0.0013 -0.0555 152 LYS A CB  
272  C  CG  . LYS A 52  ? 0.4503 0.4740 0.4238 -0.0390 0.0030  -0.0611 152 LYS A CG  
273  C  CD  . LYS A 52  ? 0.5776 0.5921 0.5499 -0.0373 0.0069  -0.0622 152 LYS A CD  
274  C  CE  . LYS A 52  ? 0.6754 0.6806 0.6455 -0.0405 0.0123  -0.0673 152 LYS A CE  
275  N  NZ  . LYS A 52  ? 0.7308 0.7282 0.7001 -0.0384 0.0166  -0.0684 152 LYS A NZ  
276  N  N   . LYS A 53  ? 0.5303 0.5853 0.5063 -0.0300 -0.0096 -0.0448 153 LYS A N   
277  C  CA  . LYS A 53  ? 0.5174 0.5748 0.4962 -0.0243 -0.0114 -0.0383 153 LYS A CA  
278  C  C   . LYS A 53  ? 0.5304 0.5787 0.5084 -0.0210 -0.0093 -0.0362 153 LYS A C   
279  O  O   . LYS A 53  ? 0.5599 0.6080 0.5331 -0.0222 -0.0086 -0.0365 153 LYS A O   
280  C  CB  . LYS A 53  ? 0.5228 0.5941 0.4998 -0.0238 -0.0144 -0.0345 153 LYS A CB  
281  C  CG  . LYS A 53  ? 0.6609 0.7424 0.6418 -0.0240 -0.0168 -0.0338 153 LYS A CG  
282  C  CD  . LYS A 53  ? 0.7501 0.8490 0.7286 -0.0252 -0.0200 -0.0312 153 LYS A CD  
283  C  CE  . LYS A 53  ? 0.8411 0.9446 0.8212 -0.0179 -0.0213 -0.0226 153 LYS A CE  
284  N  NZ  . LYS A 53  ? 0.8862 1.0095 0.8665 -0.0177 -0.0248 -0.0189 153 LYS A NZ  
285  N  N   . HIS A 54  ? 0.4892 0.5306 0.4715 -0.0176 -0.0082 -0.0344 154 HIS A N   
286  C  CA  . HIS A 54  ? 0.3975 0.4311 0.3790 -0.0154 -0.0059 -0.0328 154 HIS A CA  
287  C  C   . HIS A 54  ? 0.4193 0.4535 0.4012 -0.0112 -0.0058 -0.0270 154 HIS A C   
288  O  O   . HIS A 54  ? 0.4311 0.4688 0.4165 -0.0087 -0.0069 -0.0242 154 HIS A O   
289  C  CB  . HIS A 54  ? 0.4333 0.4593 0.4185 -0.0153 -0.0039 -0.0349 154 HIS A CB  
290  C  CG  . HIS A 54  ? 0.5258 0.5500 0.5111 -0.0183 -0.0031 -0.0396 154 HIS A CG  
291  N  ND1 . HIS A 54  ? 0.6070 0.6274 0.5896 -0.0197 -0.0010 -0.0423 154 HIS A ND1 
292  C  CD2 . HIS A 54  ? 0.5713 0.5960 0.5588 -0.0201 -0.0036 -0.0420 154 HIS A CD2 
293  C  CE1 . HIS A 54  ? 0.5792 0.5972 0.5625 -0.0218 0.0002  -0.0458 154 HIS A CE1 
294  N  NE2 . HIS A 54  ? 0.5793 0.5995 0.5652 -0.0223 -0.0014 -0.0458 154 HIS A NE2 
295  N  N   . LYS A 55  ? 0.4726 0.5027 0.4507 -0.0103 -0.0040 -0.0253 155 LYS A N   
296  C  CA  . LYS A 55  ? 0.5684 0.5966 0.5453 -0.0065 -0.0027 -0.0197 155 LYS A CA  
297  C  C   . LYS A 55  ? 0.5633 0.5815 0.5402 -0.0062 0.0012  -0.0200 155 LYS A C   
298  O  O   . LYS A 55  ? 0.5502 0.5650 0.5230 -0.0076 0.0029  -0.0208 155 LYS A O   
299  C  CB  . LYS A 55  ? 0.6822 0.7150 0.6531 -0.0065 -0.0036 -0.0170 155 LYS A CB  
300  C  CG  . LYS A 55  ? 0.7642 0.8093 0.7342 -0.0074 -0.0073 -0.0163 155 LYS A CG  
301  C  CD  . LYS A 55  ? 0.8949 0.9461 0.8675 -0.0023 -0.0085 -0.0097 155 LYS A CD  
302  C  CE  . LYS A 55  ? 1.0365 1.1032 1.0089 -0.0037 -0.0126 -0.0091 155 LYS A CE  
303  N  NZ  . LYS A 55  ? 1.1099 1.1805 1.0795 -0.0106 -0.0138 -0.0160 155 LYS A NZ  
304  N  N   . PRO A 56  ? 0.5908 0.6050 0.5721 -0.0050 0.0028  -0.0197 156 PRO A N   
305  C  CA  . PRO A 56  ? 0.5803 0.5864 0.5613 -0.0058 0.0068  -0.0205 156 PRO A CA  
306  C  C   . PRO A 56  ? 0.5541 0.5547 0.5306 -0.0039 0.0102  -0.0165 156 PRO A C   
307  O  O   . PRO A 56  ? 0.5035 0.5053 0.4799 -0.0001 0.0100  -0.0117 156 PRO A O   
308  C  CB  . PRO A 56  ? 0.5540 0.5585 0.5405 -0.0052 0.0076  -0.0209 156 PRO A CB  
309  C  CG  . PRO A 56  ? 0.5104 0.5222 0.5003 -0.0045 0.0036  -0.0211 156 PRO A CG  
310  C  CD  . PRO A 56  ? 0.5394 0.5572 0.5259 -0.0034 0.0012  -0.0189 156 PRO A CD  
311  N  N   . GLU A 57  ? 0.6245 0.6197 0.5976 -0.0063 0.0134  -0.0181 157 GLU A N   
312  C  CA  . GLU A 57  ? 0.7547 0.7421 0.7233 -0.0054 0.0181  -0.0148 157 GLU A CA  
313  C  C   . GLU A 57  ? 0.7986 0.7798 0.7698 -0.0035 0.0218  -0.0128 157 GLU A C   
314  O  O   . GLU A 57  ? 0.8201 0.7995 0.7946 -0.0062 0.0236  -0.0163 157 GLU A O   
315  C  CB  . GLU A 57  ? 0.8880 0.8716 0.8529 -0.0096 0.0213  -0.0182 157 GLU A CB  
316  C  CG  . GLU A 57  ? 1.0900 1.0759 1.0496 -0.0106 0.0202  -0.0181 157 GLU A CG  
317  C  CD  . GLU A 57  ? 1.2914 1.2852 1.2513 -0.0086 0.0151  -0.0167 157 GLU A CD  
318  O  OE1 . GLU A 57  ? 1.3495 1.3442 1.3058 -0.0059 0.0145  -0.0119 157 GLU A OE1 
319  O  OE2 . GLU A 57  ? 1.3500 1.3494 1.3134 -0.0100 0.0119  -0.0204 157 GLU A OE2 
320  N  N   . ILE A 58  ? 0.8478 0.8263 0.8179 0.0012  0.0234  -0.0071 158 ILE A N   
321  C  CA  . ILE A 58  ? 0.9029 0.8748 0.8758 0.0038  0.0277  -0.0049 158 ILE A CA  
322  C  C   . ILE A 58  ? 0.9113 0.8715 0.8787 0.0057  0.0346  -0.0008 158 ILE A C   
323  O  O   . ILE A 58  ? 0.8806 0.8358 0.8421 0.0024  0.0373  -0.0021 158 ILE A O   
324  C  CB  . ILE A 58  ? 0.7100 0.6892 0.6882 0.0090  0.0242  -0.0013 158 ILE A CB  
325  N  N   . ASN A 65  ? 0.9760 0.9323 0.9727 -0.0124 0.0464  -0.0246 165 ASN A N   
326  C  CA  . ASN A 65  ? 0.9868 0.9516 0.9860 -0.0179 0.0426  -0.0293 165 ASN A CA  
327  C  C   . ASN A 65  ? 0.9277 0.8982 0.9240 -0.0212 0.0391  -0.0311 165 ASN A C   
328  O  O   . ASN A 65  ? 0.9942 0.9645 0.9877 -0.0271 0.0423  -0.0345 165 ASN A O   
329  C  CB  . ASN A 65  ? 1.0677 1.0289 1.0672 -0.0239 0.0486  -0.0334 165 ASN A CB  
330  C  CG  . ASN A 65  ? 1.1866 1.1442 1.1904 -0.0211 0.0513  -0.0326 165 ASN A CG  
331  O  OD1 . ASN A 65  ? 1.1808 1.1402 1.1871 -0.0256 0.0529  -0.0361 165 ASN A OD1 
332  N  ND2 . ASN A 65  ? 1.2500 1.2037 1.2550 -0.0136 0.0518  -0.0275 165 ASN A ND2 
333  N  N   . PHE A 66  ? 0.7425 0.7189 0.7394 -0.0176 0.0329  -0.0291 166 PHE A N   
334  C  CA  . PHE A 66  ? 0.6219 0.6037 0.6167 -0.0198 0.0297  -0.0307 166 PHE A CA  
335  C  C   . PHE A 66  ? 0.5660 0.5568 0.5650 -0.0199 0.0238  -0.0321 166 PHE A C   
336  O  O   . PHE A 66  ? 0.5922 0.5851 0.5952 -0.0180 0.0213  -0.0315 166 PHE A O   
337  C  CB  . PHE A 66  ? 0.5548 0.5349 0.5457 -0.0162 0.0284  -0.0277 166 PHE A CB  
338  C  CG  . PHE A 66  ? 0.4377 0.4217 0.4309 -0.0111 0.0235  -0.0247 166 PHE A CG  
339  C  CD1 . PHE A 66  ? 0.3890 0.3803 0.3834 -0.0109 0.0181  -0.0257 166 PHE A CD1 
340  C  CD2 . PHE A 66  ? 0.4832 0.4642 0.4777 -0.0067 0.0249  -0.0209 166 PHE A CD2 
341  C  CE1 . PHE A 66  ? 0.4780 0.4740 0.4741 -0.0075 0.0140  -0.0236 166 PHE A CE1 
342  C  CE2 . PHE A 66  ? 0.4494 0.4368 0.4463 -0.0025 0.0203  -0.0182 166 PHE A CE2 
343  C  CZ  . PHE A 66  ? 0.4829 0.4781 0.4804 -0.0035 0.0148  -0.0199 166 PHE A CZ  
344  N  N   . THR A 67  ? 0.4689 0.4646 0.4670 -0.0220 0.0219  -0.0337 167 THR A N   
345  C  CA  . THR A 67  ? 0.3957 0.3980 0.3969 -0.0212 0.0171  -0.0344 167 THR A CA  
346  C  C   . THR A 67  ? 0.3509 0.3547 0.3499 -0.0189 0.0143  -0.0337 167 THR A C   
347  O  O   . THR A 67  ? 0.3555 0.3587 0.3511 -0.0198 0.0159  -0.0340 167 THR A O   
348  C  CB  . THR A 67  ? 0.4067 0.4148 0.4096 -0.0250 0.0174  -0.0364 167 THR A CB  
349  O  OG1 . THR A 67  ? 0.4695 0.4776 0.4745 -0.0278 0.0195  -0.0375 167 THR A OG1 
350  C  CG2 . THR A 67  ? 0.3517 0.3648 0.3573 -0.0232 0.0132  -0.0362 167 THR A CG2 
351  N  N   . TYR A 68  ? 0.3497 0.3555 0.3504 -0.0167 0.0107  -0.0333 168 TYR A N   
352  C  CA  . TYR A 68  ? 0.3666 0.3738 0.3652 -0.0154 0.0086  -0.0335 168 TYR A CA  
353  C  C   . TYR A 68  ? 0.3507 0.3609 0.3517 -0.0156 0.0065  -0.0350 168 TYR A C   
354  O  O   . TYR A 68  ? 0.4107 0.4217 0.4146 -0.0155 0.0050  -0.0352 168 TYR A O   
355  C  CB  . TYR A 68  ? 0.4192 0.4258 0.4160 -0.0130 0.0070  -0.0316 168 TYR A CB  
356  C  CG  . TYR A 68  ? 0.4618 0.4702 0.4555 -0.0127 0.0052  -0.0322 168 TYR A CG  
357  C  CD1 . TYR A 68  ? 0.5089 0.5161 0.4981 -0.0124 0.0063  -0.0312 168 TYR A CD1 
358  C  CD2 . TYR A 68  ? 0.4014 0.4124 0.3964 -0.0132 0.0030  -0.0342 168 TYR A CD2 
359  C  CE1 . TYR A 68  ? 0.4669 0.4761 0.4529 -0.0127 0.0049  -0.0322 168 TYR A CE1 
360  C  CE2 . TYR A 68  ? 0.4791 0.4912 0.4708 -0.0137 0.0022  -0.0355 168 TYR A CE2 
361  C  CZ  . TYR A 68  ? 0.4985 0.5103 0.4859 -0.0135 0.0030  -0.0345 168 TYR A CZ  
362  O  OH  . TYR A 68  ? 0.4684 0.4818 0.4522 -0.0146 0.0025  -0.0362 168 TYR A OH  
363  N  N   . ILE A 69  ? 0.3151 0.3265 0.3149 -0.0156 0.0069  -0.0360 169 ILE A N   
364  C  CA  . ILE A 69  ? 0.3432 0.3563 0.3452 -0.0151 0.0063  -0.0369 169 ILE A CA  
365  C  C   . ILE A 69  ? 0.4479 0.4593 0.4479 -0.0142 0.0055  -0.0382 169 ILE A C   
366  O  O   . ILE A 69  ? 0.4660 0.4771 0.4630 -0.0140 0.0064  -0.0388 169 ILE A O   
367  C  CB  . ILE A 69  ? 0.3868 0.4034 0.3898 -0.0155 0.0081  -0.0368 169 ILE A CB  
368  C  CG1 . ILE A 69  ? 0.5026 0.5219 0.5073 -0.0178 0.0092  -0.0362 169 ILE A CG1 
369  C  CG2 . ILE A 69  ? 0.3117 0.3296 0.3171 -0.0136 0.0080  -0.0367 169 ILE A CG2 
370  C  CD1 . ILE A 69  ? 0.5417 0.5680 0.5482 -0.0188 0.0106  -0.0359 169 ILE A CD1 
371  N  N   . ILE A 70  ? 0.4318 0.4422 0.4330 -0.0143 0.0043  -0.0389 170 ILE A N   
372  C  CA  . ILE A 70  ? 0.3788 0.3872 0.3777 -0.0147 0.0044  -0.0410 170 ILE A CA  
373  C  C   . ILE A 70  ? 0.4512 0.4574 0.4515 -0.0135 0.0066  -0.0415 170 ILE A C   
374  O  O   . ILE A 70  ? 0.5528 0.5587 0.5561 -0.0129 0.0068  -0.0406 170 ILE A O   
375  C  CB  . ILE A 70  ? 0.3673 0.3757 0.3663 -0.0162 0.0026  -0.0420 170 ILE A CB  
376  C  CG1 . ILE A 70  ? 0.3694 0.3813 0.3682 -0.0162 0.0005  -0.0404 170 ILE A CG1 
377  C  CG2 . ILE A 70  ? 0.3001 0.3066 0.2959 -0.0179 0.0034  -0.0450 170 ILE A CG2 
378  C  CD1 . ILE A 70  ? 0.3172 0.3313 0.3178 -0.0173 -0.0013 -0.0409 170 ILE A CD1 
379  N  N   . ASP A 71  ? 0.4728 0.4778 0.4710 -0.0128 0.0086  -0.0427 171 ASP A N   
380  C  CA  . ASP A 71  ? 0.5183 0.5219 0.5183 -0.0104 0.0115  -0.0425 171 ASP A CA  
381  C  C   . ASP A 71  ? 0.4712 0.4687 0.4688 -0.0107 0.0142  -0.0453 171 ASP A C   
382  O  O   . ASP A 71  ? 0.3813 0.3766 0.3756 -0.0137 0.0136  -0.0478 171 ASP A O   
383  C  CB  . ASP A 71  ? 0.5547 0.5621 0.5547 -0.0092 0.0126  -0.0417 171 ASP A CB  
384  C  CG  . ASP A 71  ? 0.6050 0.6112 0.6003 -0.0108 0.0130  -0.0440 171 ASP A CG  
385  O  OD1 . ASP A 71  ? 0.5789 0.5835 0.5712 -0.0131 0.0115  -0.0454 171 ASP A OD1 
386  O  OD2 . ASP A 71  ? 0.6497 0.6576 0.6443 -0.0100 0.0149  -0.0444 171 ASP A OD2 
387  N  N   . LYS A 72  ? 0.5341 0.5293 0.5332 -0.0077 0.0178  -0.0448 172 LYS A N   
388  C  CA  . LYS A 72  ? 0.5895 0.5772 0.5863 -0.0078 0.0219  -0.0477 172 LYS A CA  
389  C  C   . LYS A 72  ? 0.5347 0.5168 0.5300 -0.0104 0.0222  -0.0494 172 LYS A C   
390  O  O   . LYS A 72  ? 0.5029 0.4805 0.4939 -0.0140 0.0241  -0.0535 172 LYS A O   
391  C  CB  . LYS A 72  ? 0.5950 0.5822 0.5870 -0.0106 0.0229  -0.0513 172 LYS A CB  
392  C  CG  . LYS A 72  ? 0.6271 0.6203 0.6193 -0.0094 0.0221  -0.0502 172 LYS A CG  
393  C  CD  . LYS A 72  ? 0.6972 0.6881 0.6890 -0.0075 0.0268  -0.0519 172 LYS A CD  
394  C  CE  . LYS A 72  ? 0.7240 0.7215 0.7159 -0.0069 0.0261  -0.0510 172 LYS A CE  
395  N  NZ  . LYS A 72  ? 0.7413 0.7413 0.7284 -0.0109 0.0232  -0.0523 172 LYS A NZ  
396  N  N   . LEU A 73  ? 0.4886 0.4715 0.4871 -0.0094 0.0206  -0.0466 173 LEU A N   
397  C  CA  . LEU A 73  ? 0.4623 0.4401 0.4593 -0.0122 0.0211  -0.0483 173 LEU A CA  
398  C  C   . LEU A 73  ? 0.5020 0.4714 0.5000 -0.0094 0.0260  -0.0471 173 LEU A C   
399  O  O   . LEU A 73  ? 0.5127 0.4821 0.5136 -0.0044 0.0283  -0.0438 173 LEU A O   
400  C  CB  . LEU A 73  ? 0.4155 0.3988 0.4145 -0.0137 0.0164  -0.0467 173 LEU A CB  
401  C  CG  . LEU A 73  ? 0.3883 0.3789 0.3869 -0.0154 0.0122  -0.0468 173 LEU A CG  
402  C  CD1 . LEU A 73  ? 0.3544 0.3489 0.3556 -0.0165 0.0088  -0.0454 173 LEU A CD1 
403  C  CD2 . LEU A 73  ? 0.2896 0.2803 0.2835 -0.0190 0.0121  -0.0506 173 LEU A CD2 
404  N  N   . ILE A 74  ? 0.5043 0.4669 0.4996 -0.0128 0.0278  -0.0496 174 ILE A N   
405  C  CA  . ILE A 74  ? 0.5472 0.4994 0.5422 -0.0107 0.0334  -0.0486 174 ILE A CA  
406  C  C   . ILE A 74  ? 0.6014 0.5549 0.5995 -0.0092 0.0315  -0.0444 174 ILE A C   
407  O  O   . ILE A 74  ? 0.6282 0.5843 0.6256 -0.0134 0.0282  -0.0460 174 ILE A O   
408  C  CB  . ILE A 74  ? 0.5437 0.4863 0.5329 -0.0164 0.0376  -0.0544 174 ILE A CB  
409  C  CG1 . ILE A 74  ? 0.5577 0.5024 0.5427 -0.0209 0.0377  -0.0598 174 ILE A CG1 
410  C  CG2 . ILE A 74  ? 0.4491 0.3779 0.4371 -0.0136 0.0455  -0.0536 174 ILE A CG2 
411  C  CD1 . ILE A 74  ? 0.5602 0.5024 0.5453 -0.0173 0.0414  -0.0597 174 ILE A CD1 
412  N  N   . PRO A 75  ? 0.5427 0.4953 0.5443 -0.0031 0.0337  -0.0390 175 PRO A N   
413  C  CA  . PRO A 75  ? 0.4981 0.4517 0.5023 -0.0014 0.0327  -0.0344 175 PRO A CA  
414  C  C   . PRO A 75  ? 0.4905 0.4336 0.4908 -0.0054 0.0356  -0.0370 175 PRO A C   
415  O  O   . PRO A 75  ? 0.4814 0.4142 0.4773 -0.0078 0.0406  -0.0413 175 PRO A O   
416  C  CB  . PRO A 75  ? 0.4995 0.4521 0.5070 0.0062  0.0366  -0.0285 175 PRO A CB  
417  C  CG  . PRO A 75  ? 0.5167 0.4737 0.5252 0.0085  0.0370  -0.0294 175 PRO A CG  
418  C  CD  . PRO A 75  ? 0.4872 0.4387 0.4906 0.0027  0.0376  -0.0367 175 PRO A CD  
419  N  N   . ASN A 76  ? 0.5195 0.4655 0.5211 -0.0067 0.0329  -0.0348 176 ASN A N   
420  C  CA  . ASN A 76  ? 0.5647 0.5014 0.5625 -0.0109 0.0356  -0.0372 176 ASN A CA  
421  C  C   . ASN A 76  ? 0.5745 0.5092 0.5679 -0.0183 0.0353  -0.0447 176 ASN A C   
422  O  O   . ASN A 76  ? 0.5908 0.5152 0.5794 -0.0223 0.0401  -0.0483 176 ASN A O   
423  C  CB  . ASN A 76  ? 0.6630 0.5857 0.6587 -0.0072 0.0434  -0.0348 176 ASN A CB  
424  C  CG  . ASN A 76  ? 0.8042 0.7206 0.7983 -0.0086 0.0451  -0.0327 176 ASN A CG  
425  O  OD1 . ASN A 76  ? 0.8897 0.7920 0.8802 -0.0077 0.0523  -0.0322 176 ASN A OD1 
426  N  ND2 . ASN A 76  ? 0.7876 0.7140 0.7840 -0.0111 0.0391  -0.0316 176 ASN A ND2 
427  N  N   . THR A 77  ? 0.5750 0.5202 0.5697 -0.0202 0.0301  -0.0468 177 THR A N   
428  C  CA  . THR A 77  ? 0.4767 0.4238 0.4677 -0.0267 0.0289  -0.0531 177 THR A CA  
429  C  C   . THR A 77  ? 0.4325 0.3914 0.4264 -0.0289 0.0223  -0.0529 177 THR A C   
430  O  O   . THR A 77  ? 0.4204 0.3863 0.4187 -0.0254 0.0186  -0.0488 177 THR A O   
431  C  CB  . THR A 77  ? 0.4985 0.4479 0.4881 -0.0263 0.0292  -0.0553 177 THR A CB  
432  O  OG1 . THR A 77  ? 0.6041 0.5425 0.5915 -0.0238 0.0359  -0.0556 177 THR A OG1 
433  C  CG2 . THR A 77  ? 0.4192 0.3733 0.4050 -0.0331 0.0274  -0.0611 177 THR A CG2 
434  N  N   . ASN A 78  ? 0.3913 0.3526 0.3825 -0.0350 0.0213  -0.0574 178 ASN A N   
435  C  CA  . ASN A 78  ? 0.3936 0.3666 0.3878 -0.0366 0.0155  -0.0574 178 ASN A CA  
436  C  C   . ASN A 78  ? 0.4251 0.4066 0.4191 -0.0367 0.0124  -0.0585 178 ASN A C   
437  O  O   . ASN A 78  ? 0.4380 0.4183 0.4279 -0.0395 0.0143  -0.0621 178 ASN A O   
438  C  CB  . ASN A 78  ? 0.4464 0.4205 0.4390 -0.0425 0.0155  -0.0608 178 ASN A CB  
439  C  CG  . ASN A 78  ? 0.6332 0.6004 0.6264 -0.0422 0.0176  -0.0588 178 ASN A CG  
440  O  OD1 . ASN A 78  ? 0.7966 0.7688 0.7940 -0.0404 0.0145  -0.0556 178 ASN A OD1 
441  N  ND2 . ASN A 78  ? 0.5399 0.4950 0.5285 -0.0441 0.0235  -0.0606 178 ASN A ND2 
442  N  N   . TYR A 79  ? 0.3930 0.3827 0.3912 -0.0338 0.0080  -0.0554 179 TYR A N   
443  C  CA  . TYR A 79  ? 0.3836 0.3815 0.3819 -0.0334 0.0050  -0.0554 179 TYR A CA  
444  C  C   . TYR A 79  ? 0.4067 0.4135 0.4087 -0.0335 0.0011  -0.0541 179 TYR A C   
445  O  O   . TYR A 79  ? 0.4448 0.4512 0.4501 -0.0326 0.0005  -0.0523 179 TYR A O   
446  C  CB  . TYR A 79  ? 0.3771 0.3742 0.3766 -0.0287 0.0050  -0.0523 179 TYR A CB  
447  C  CG  . TYR A 79  ? 0.5101 0.4998 0.5066 -0.0279 0.0089  -0.0535 179 TYR A CG  
448  C  CD1 . TYR A 79  ? 0.5459 0.5362 0.5384 -0.0297 0.0098  -0.0562 179 TYR A CD1 
449  C  CD2 . TYR A 79  ? 0.5537 0.5363 0.5514 -0.0251 0.0121  -0.0515 179 TYR A CD2 
450  C  CE1 . TYR A 79  ? 0.5630 0.5461 0.5530 -0.0290 0.0142  -0.0576 179 TYR A CE1 
451  C  CE2 . TYR A 79  ? 0.5664 0.5420 0.5620 -0.0234 0.0164  -0.0522 179 TYR A CE2 
452  C  CZ  . TYR A 79  ? 0.5824 0.5578 0.5741 -0.0255 0.0177  -0.0556 179 TYR A CZ  
453  O  OH  . TYR A 79  ? 0.5961 0.5643 0.5858 -0.0240 0.0226  -0.0567 179 TYR A OH  
454  N  N   . CYS A 80  ? 0.3970 0.4122 0.3984 -0.0345 -0.0014 -0.0547 180 CYS A N   
455  C  CA  . CYS A 80  ? 0.3750 0.3988 0.3804 -0.0334 -0.0045 -0.0528 180 CYS A CA  
456  C  C   . CYS A 80  ? 0.3896 0.4180 0.3957 -0.0296 -0.0063 -0.0496 180 CYS A C   
457  O  O   . CYS A 80  ? 0.3974 0.4260 0.3999 -0.0297 -0.0060 -0.0501 180 CYS A O   
458  C  CB  . CYS A 80  ? 0.2419 0.2736 0.2468 -0.0378 -0.0057 -0.0557 180 CYS A CB  
459  S  SG  . CYS A 80  ? 0.5966 0.6233 0.6014 -0.0423 -0.0037 -0.0588 180 CYS A SG  
460  N  N   . VAL A 81  ? 0.3677 0.3988 0.3778 -0.0266 -0.0075 -0.0465 181 VAL A N   
461  C  CA  . VAL A 81  ? 0.2815 0.3150 0.2919 -0.0228 -0.0082 -0.0432 181 VAL A CA  
462  C  C   . VAL A 81  ? 0.3428 0.3844 0.3567 -0.0208 -0.0099 -0.0408 181 VAL A C   
463  O  O   . VAL A 81  ? 0.4111 0.4545 0.4287 -0.0211 -0.0100 -0.0411 181 VAL A O   
464  C  CB  . VAL A 81  ? 0.2632 0.2899 0.2745 -0.0203 -0.0064 -0.0413 181 VAL A CB  
465  C  CG1 . VAL A 81  ? 0.2955 0.3234 0.3064 -0.0170 -0.0063 -0.0381 181 VAL A CG1 
466  C  CG2 . VAL A 81  ? 0.2932 0.3139 0.3016 -0.0214 -0.0048 -0.0429 181 VAL A CG2 
467  N  N   . SER A 82  ? 0.3927 0.4393 0.4050 -0.0184 -0.0109 -0.0383 182 SER A N   
468  C  CA  . SER A 82  ? 0.4094 0.4645 0.4248 -0.0150 -0.0122 -0.0347 182 SER A CA  
469  C  C   . SER A 82  ? 0.3931 0.4456 0.4073 -0.0105 -0.0111 -0.0303 182 SER A C   
470  O  O   . SER A 82  ? 0.3729 0.4225 0.3826 -0.0111 -0.0109 -0.0305 182 SER A O   
471  C  CB  . SER A 82  ? 0.4198 0.4875 0.4340 -0.0172 -0.0148 -0.0355 182 SER A CB  
472  O  OG  . SER A 82  ? 0.4147 0.4921 0.4328 -0.0132 -0.0160 -0.0314 182 SER A OG  
473  N  N   . VAL A 83  ? 0.4172 0.4700 0.4350 -0.0062 -0.0099 -0.0265 183 VAL A N   
474  C  CA  . VAL A 83  ? 0.5025 0.5505 0.5187 -0.0019 -0.0077 -0.0223 183 VAL A CA  
475  C  C   . VAL A 83  ? 0.5712 0.6274 0.5902 0.0033  -0.0081 -0.0170 183 VAL A C   
476  O  O   . VAL A 83  ? 0.6365 0.6978 0.6605 0.0045  -0.0083 -0.0166 183 VAL A O   
477  C  CB  . VAL A 83  ? 0.3282 0.3649 0.3456 -0.0017 -0.0038 -0.0227 183 VAL A CB  
478  C  CG1 . VAL A 83  ? 0.3577 0.3884 0.3723 0.0017  -0.0008 -0.0189 183 VAL A CG1 
479  C  CG2 . VAL A 83  ? 0.2846 0.3158 0.3003 -0.0063 -0.0037 -0.0272 183 VAL A CG2 
480  N  N   . TYR A 84  ? 0.5289 0.5868 0.5447 0.0066  -0.0081 -0.0126 184 TYR A N   
481  C  CA  . TYR A 84  ? 0.6101 0.6778 0.6284 0.0123  -0.0087 -0.0065 184 TYR A CA  
482  C  C   . TYR A 84  ? 0.6165 0.6831 0.6305 0.0165  -0.0077 -0.0007 184 TYR A C   
483  O  O   . TYR A 84  ? 0.5672 0.6296 0.5755 0.0136  -0.0080 -0.0023 184 TYR A O   
484  C  CB  . TYR A 84  ? 0.6160 0.7003 0.6359 0.0101  -0.0133 -0.0076 184 TYR A CB  
485  C  CG  . TYR A 84  ? 0.6554 0.7456 0.6695 0.0048  -0.0164 -0.0107 184 TYR A CG  
486  C  CD1 . TYR A 84  ? 0.6566 0.7458 0.6692 -0.0022 -0.0175 -0.0177 184 TYR A CD1 
487  C  CD2 . TYR A 84  ? 0.6560 0.7524 0.6658 0.0067  -0.0176 -0.0065 184 TYR A CD2 
488  C  CE1 . TYR A 84  ? 0.6773 0.7708 0.6844 -0.0074 -0.0193 -0.0211 184 TYR A CE1 
489  C  CE2 . TYR A 84  ? 0.6620 0.7641 0.6662 0.0011  -0.0200 -0.0099 184 TYR A CE2 
490  C  CZ  . TYR A 84  ? 0.6742 0.7744 0.6771 -0.0060 -0.0205 -0.0175 184 TYR A CZ  
491  O  OH  . TYR A 84  ? 0.6459 0.7502 0.6429 -0.0119 -0.0217 -0.0214 184 TYR A OH  
492  N  N   . LEU A 85  ? 0.6430 0.7131 0.6598 0.0235  -0.0060 0.0062  185 LEU A N   
493  C  CA  . LEU A 85  ? 0.6760 0.7462 0.6888 0.0284  -0.0050 0.0131  185 LEU A CA  
494  C  C   . LEU A 85  ? 0.6903 0.7794 0.7016 0.0287  -0.0102 0.0161  185 LEU A C   
495  O  O   . LEU A 85  ? 0.5738 0.6774 0.5896 0.0285  -0.0134 0.0158  185 LEU A O   
496  C  CB  . LEU A 85  ? 0.6656 0.7290 0.6816 0.0365  0.0003  0.0198  185 LEU A CB  
497  C  CG  . LEU A 85  ? 0.6655 0.7104 0.6821 0.0352  0.0064  0.0163  185 LEU A CG  
498  C  CD1 . LEU A 85  ? 0.6787 0.7162 0.6984 0.0430  0.0128  0.0226  185 LEU A CD1 
499  C  CD2 . LEU A 85  ? 0.6516 0.6845 0.6613 0.0306  0.0082  0.0131  185 LEU A CD2 
500  N  N   . GLU A 86  ? 0.8249 0.9146 0.8297 0.0285  -0.0110 0.0187  186 GLU A N   
501  C  CA  . GLU A 86  ? 0.8903 0.9985 0.8924 0.0277  -0.0157 0.0214  186 GLU A CA  
502  C  C   . GLU A 86  ? 0.9571 1.0700 0.9581 0.0361  -0.0146 0.0321  186 GLU A C   
503  O  O   . GLU A 86  ? 0.9545 1.0523 0.9531 0.0402  -0.0098 0.0358  186 GLU A O   
504  C  CB  . GLU A 86  ? 0.9423 1.0495 0.9373 0.0196  -0.0178 0.0152  186 GLU A CB  
505  C  CG  . GLU A 86  ? 0.9809 1.1072 0.9746 0.0138  -0.0228 0.0119  186 GLU A CG  
506  C  CD  . GLU A 86  ? 0.9668 1.0885 0.9552 0.0046  -0.0234 0.0031  186 GLU A CD  
507  O  OE1 . GLU A 86  ? 0.9369 1.0476 0.9201 0.0035  -0.0214 0.0021  186 GLU A OE1 
508  O  OE2 . GLU A 86  ? 0.9388 1.0677 0.9281 -0.0014 -0.0253 -0.0030 186 GLU A OE2 
509  N  N   . HIS A 87  ? 1.0367 1.1708 1.0392 0.0386  -0.0186 0.0372  187 HIS A N   
510  C  CA  . HIS A 87  ? 1.0720 1.2138 1.0752 0.0483  -0.0177 0.0490  187 HIS A CA  
511  C  C   . HIS A 87  ? 1.1109 1.2696 1.1080 0.0472  -0.0219 0.0535  187 HIS A C   
512  O  O   . HIS A 87  ? 1.1119 1.2787 1.1086 0.0553  -0.0215 0.0642  187 HIS A O   
513  C  CB  . HIS A 87  ? 1.0111 1.1653 1.0235 0.0549  -0.0180 0.0536  187 HIS A CB  
514  N  N   . VAL A 93  ? 0.7182 0.9084 0.7486 0.0331  -0.0283 0.0263  193 VAL A N   
515  C  CA  . VAL A 93  ? 0.8049 0.9747 0.8319 0.0259  -0.0263 0.0173  193 VAL A CA  
516  C  C   . VAL A 93  ? 0.7917 0.9593 0.8237 0.0217  -0.0260 0.0103  193 VAL A C   
517  O  O   . VAL A 93  ? 0.8331 1.0153 0.8658 0.0158  -0.0292 0.0060  193 VAL A O   
518  C  CB  . VAL A 93  ? 0.7615 0.9317 0.7799 0.0172  -0.0287 0.0117  193 VAL A CB  
519  C  CG1 . VAL A 93  ? 0.7259 0.8822 0.7424 0.0089  -0.0277 0.0016  193 VAL A CG1 
520  C  CG2 . VAL A 93  ? 0.7941 0.9548 0.8067 0.0205  -0.0271 0.0164  193 VAL A CG2 
521  N  N   . ILE A 94  ? 0.7052 0.8549 0.7402 0.0241  -0.0217 0.0092  194 ILE A N   
522  C  CA  . ILE A 94  ? 0.7490 0.8953 0.7879 0.0196  -0.0212 0.0026  194 ILE A CA  
523  C  C   . ILE A 94  ? 0.7196 0.8486 0.7538 0.0126  -0.0199 -0.0048 194 ILE A C   
524  O  O   . ILE A 94  ? 0.7223 0.8343 0.7557 0.0146  -0.0162 -0.0046 194 ILE A O   
525  C  CB  . ILE A 94  ? 0.8056 0.9466 0.8519 0.0262  -0.0173 0.0058  194 ILE A CB  
526  C  CG1 . ILE A 94  ? 0.8316 0.9900 0.8835 0.0347  -0.0180 0.0142  194 ILE A CG1 
527  C  CG2 . ILE A 94  ? 0.7718 0.9106 0.8218 0.0208  -0.0171 -0.0013 194 ILE A CG2 
528  C  CD1 . ILE A 94  ? 0.8475 0.9981 0.8989 0.0441  -0.0142 0.0230  194 ILE A CD1 
529  N  N   . LYS A 95  ? 0.6908 0.8242 0.7215 0.0045  -0.0225 -0.0113 195 LYS A N   
530  C  CA  . LYS A 95  ? 0.7176 0.8355 0.7446 -0.0014 -0.0210 -0.0178 195 LYS A CA  
531  C  C   . LYS A 95  ? 0.7334 0.8427 0.7652 -0.0016 -0.0187 -0.0203 195 LYS A C   
532  O  O   . LYS A 95  ? 0.7994 0.9179 0.8359 -0.0023 -0.0196 -0.0213 195 LYS A O   
533  C  CB  . LYS A 95  ? 0.7542 0.8777 0.7763 -0.0098 -0.0232 -0.0240 195 LYS A CB  
534  C  CG  . LYS A 95  ? 0.8110 0.9418 0.8272 -0.0113 -0.0250 -0.0228 195 LYS A CG  
535  C  CD  . LYS A 95  ? 0.8716 1.0005 0.8821 -0.0204 -0.0251 -0.0304 195 LYS A CD  
536  C  CE  . LYS A 95  ? 0.9393 1.0775 0.9436 -0.0233 -0.0267 -0.0303 195 LYS A CE  
537  N  NZ  . LYS A 95  ? 0.9700 1.1308 0.9746 -0.0262 -0.0299 -0.0298 195 LYS A NZ  
538  N  N   . SER A 96  ? 0.6932 0.7861 0.7239 -0.0013 -0.0157 -0.0214 196 SER A N   
539  C  CA  . SER A 96  ? 0.5838 0.6687 0.6185 -0.0022 -0.0134 -0.0238 196 SER A CA  
540  C  C   . SER A 96  ? 0.5439 0.6317 0.5783 -0.0090 -0.0150 -0.0298 196 SER A C   
541  O  O   . SER A 96  ? 0.5379 0.6305 0.5683 -0.0135 -0.0171 -0.0327 196 SER A O   
542  C  CB  . SER A 96  ? 0.5012 0.5701 0.5335 -0.0023 -0.0102 -0.0245 196 SER A CB  
543  O  OG  . SER A 96  ? 0.4980 0.5614 0.5260 -0.0078 -0.0110 -0.0291 196 SER A OG  
544  N  N   . PRO A 97  ? 0.5075 0.5924 0.5460 -0.0101 -0.0136 -0.0317 197 PRO A N   
545  C  CA  . PRO A 97  ? 0.4738 0.5577 0.5107 -0.0169 -0.0143 -0.0374 197 PRO A CA  
546  C  C   . PRO A 97  ? 0.4013 0.4727 0.4329 -0.0197 -0.0133 -0.0396 197 PRO A C   
547  O  O   . PRO A 97  ? 0.3879 0.4504 0.4190 -0.0170 -0.0114 -0.0376 197 PRO A O   
548  C  CB  . PRO A 97  ? 0.4569 0.5385 0.4989 -0.0169 -0.0125 -0.0383 197 PRO A CB  
549  C  CG  . PRO A 97  ? 0.4620 0.5498 0.5093 -0.0103 -0.0116 -0.0335 197 PRO A CG  
550  C  CD  . PRO A 97  ? 0.4743 0.5577 0.5187 -0.0058 -0.0110 -0.0293 197 PRO A CD  
551  N  N   . LEU A 98  ? 0.3972 0.4683 0.4248 -0.0251 -0.0140 -0.0437 198 LEU A N   
552  C  CA  . LEU A 98  ? 0.3950 0.4546 0.4181 -0.0271 -0.0125 -0.0456 198 LEU A CA  
553  C  C   . LEU A 98  ? 0.4558 0.5058 0.4806 -0.0274 -0.0105 -0.0459 198 LEU A C   
554  O  O   . LEU A 98  ? 0.4213 0.4726 0.4490 -0.0292 -0.0102 -0.0473 198 LEU A O   
555  C  CB  . LEU A 98  ? 0.3826 0.4427 0.4009 -0.0330 -0.0125 -0.0501 198 LEU A CB  
556  C  CG  . LEU A 98  ? 0.4618 0.5282 0.4757 -0.0348 -0.0135 -0.0511 198 LEU A CG  
557  C  CD1 . LEU A 98  ? 0.3892 0.4602 0.4036 -0.0295 -0.0150 -0.0463 198 LEU A CD1 
558  C  CD2 . LEU A 98  ? 0.4207 0.4992 0.4339 -0.0399 -0.0148 -0.0543 198 LEU A CD2 
559  N  N   . LYS A 99  ? 0.4020 0.4435 0.4251 -0.0257 -0.0091 -0.0446 199 LYS A N   
560  C  CA  . LYS A 99  ? 0.3426 0.3765 0.3662 -0.0268 -0.0074 -0.0451 199 LYS A CA  
561  C  C   . LYS A 99  ? 0.3346 0.3624 0.3539 -0.0287 -0.0064 -0.0468 199 LYS A C   
562  O  O   . LYS A 99  ? 0.3625 0.3888 0.3788 -0.0276 -0.0063 -0.0465 199 LYS A O   
563  C  CB  . LYS A 99  ? 0.3698 0.4003 0.3950 -0.0238 -0.0060 -0.0424 199 LYS A CB  
564  C  CG  . LYS A 99  ? 0.3592 0.3928 0.3888 -0.0222 -0.0052 -0.0412 199 LYS A CG  
565  C  CD  . LYS A 99  ? 0.3799 0.4086 0.4101 -0.0208 -0.0027 -0.0395 199 LYS A CD  
566  C  CE  . LYS A 99  ? 0.3906 0.4203 0.4249 -0.0202 -0.0006 -0.0391 199 LYS A CE  
567  N  NZ  . LYS A 99  ? 0.4561 0.4890 0.4922 -0.0158 -0.0002 -0.0366 199 LYS A NZ  
568  N  N   . CYS A 100 ? 0.2978 0.3215 0.3165 -0.0315 -0.0053 -0.0484 200 CYS A N   
569  C  CA  . CYS A 100 ? 0.3335 0.3504 0.3482 -0.0329 -0.0035 -0.0498 200 CYS A CA  
570  C  C   . CYS A 100 ? 0.4438 0.4544 0.4590 -0.0319 -0.0017 -0.0479 200 CYS A C   
571  O  O   . CYS A 100 ? 0.4186 0.4306 0.4367 -0.0323 -0.0020 -0.0468 200 CYS A O   
572  C  CB  . CYS A 100 ? 0.2536 0.2705 0.2655 -0.0375 -0.0028 -0.0536 200 CYS A CB  
573  S  SG  . CYS A 100 ? 0.5321 0.5610 0.5441 -0.0395 -0.0054 -0.0556 200 CYS A SG  
574  N  N   . THR A 101 ? 0.4457 0.4502 0.4582 -0.0305 0.0003  -0.0473 201 THR A N   
575  C  CA  . THR A 101 ? 0.4370 0.4371 0.4501 -0.0289 0.0020  -0.0446 201 THR A CA  
576  C  C   . THR A 101 ? 0.4761 0.4680 0.4858 -0.0283 0.0054  -0.0449 201 THR A C   
577  O  O   . THR A 101 ? 0.4372 0.4267 0.4438 -0.0289 0.0065  -0.0474 201 THR A O   
578  C  CB  . THR A 101 ? 0.4307 0.4343 0.4462 -0.0258 0.0013  -0.0415 201 THR A CB  
579  O  OG1 . THR A 101 ? 0.5335 0.5358 0.5500 -0.0246 0.0026  -0.0386 201 THR A OG1 
580  C  CG2 . THR A 101 ? 0.4050 0.4080 0.4188 -0.0234 0.0017  -0.0415 201 THR A CG2 
581  N  N   . LEU A 102 ? 0.4441 0.4316 0.4540 -0.0270 0.0074  -0.0423 202 LEU A N   
582  C  CA  . LEU A 102 ? 0.4239 0.4023 0.4309 -0.0253 0.0116  -0.0417 202 LEU A CA  
583  C  C   . LEU A 102 ? 0.4516 0.4315 0.4608 -0.0200 0.0124  -0.0372 202 LEU A C   
584  O  O   . LEU A 102 ? 0.5046 0.4894 0.5166 -0.0183 0.0111  -0.0333 202 LEU A O   
585  C  CB  . LEU A 102 ? 0.4165 0.3879 0.4217 -0.0272 0.0143  -0.0414 202 LEU A CB  
586  C  CG  . LEU A 102 ? 0.4906 0.4511 0.4932 -0.0244 0.0198  -0.0391 202 LEU A CG  
587  C  CD1 . LEU A 102 ? 0.4778 0.4318 0.4772 -0.0238 0.0232  -0.0421 202 LEU A CD1 
588  C  CD2 . LEU A 102 ? 0.2291 0.1816 0.2288 -0.0276 0.0228  -0.0397 202 LEU A CD2 
589  N  N   . LEU A 103 ? 0.4433 0.4203 0.4509 -0.0178 0.0143  -0.0380 203 LEU A N   
590  C  CA  . LEU A 103 ? 0.4669 0.4468 0.4767 -0.0128 0.0150  -0.0341 203 LEU A CA  
591  C  C   . LEU A 103 ? 0.5354 0.5109 0.5459 -0.0093 0.0183  -0.0295 203 LEU A C   
592  O  O   . LEU A 103 ? 0.5686 0.5338 0.5762 -0.0099 0.0222  -0.0304 203 LEU A O   
593  C  CB  . LEU A 103 ? 0.4224 0.3996 0.4303 -0.0115 0.0169  -0.0362 203 LEU A CB  
594  C  CG  . LEU A 103 ? 0.3793 0.3608 0.3859 -0.0145 0.0140  -0.0400 203 LEU A CG  
595  C  CD1 . LEU A 103 ? 0.4033 0.3849 0.4088 -0.0122 0.0154  -0.0405 203 LEU A CD1 
596  C  CD2 . LEU A 103 ? 0.3752 0.3654 0.3845 -0.0155 0.0097  -0.0388 203 LEU A CD2 
597  N  N   . PRO A 104 ? 0.5124 0.4960 0.5266 -0.0058 0.0171  -0.0245 204 PRO A N   
598  C  CA  . PRO A 104 ? 0.5386 0.5207 0.5540 -0.0013 0.0199  -0.0186 204 PRO A CA  
599  C  C   . PRO A 104 ? 0.6111 0.5854 0.6256 0.0038  0.0250  -0.0174 204 PRO A C   
600  O  O   . PRO A 104 ? 0.5690 0.5422 0.5826 0.0036  0.0255  -0.0210 204 PRO A O   
601  C  CB  . PRO A 104 ? 0.4400 0.4365 0.4595 0.0003  0.0168  -0.0144 204 PRO A CB  
602  C  CG  . PRO A 104 ? 0.4334 0.4364 0.4533 -0.0044 0.0128  -0.0186 204 PRO A CG  
603  C  CD  . PRO A 104 ? 0.4628 0.4579 0.4797 -0.0062 0.0134  -0.0240 204 PRO A CD  
604  N  N   . PRO A 105 ? 0.6405 0.6095 0.6554 0.0086  0.0292  -0.0122 205 PRO A N   
605  C  CA  . PRO A 105 ? 0.6825 0.6432 0.6971 0.0145  0.0353  -0.0103 205 PRO A CA  
606  C  C   . PRO A 105 ? 0.7474 0.7197 0.7665 0.0201  0.0345  -0.0064 205 PRO A C   
607  O  O   . PRO A 105 ? 0.6960 0.6633 0.7151 0.0238  0.0386  -0.0070 205 PRO A O   
608  C  CB  . PRO A 105 ? 0.6516 0.6043 0.6655 0.0184  0.0397  -0.0045 205 PRO A CB  
609  C  CG  . PRO A 105 ? 0.6197 0.5734 0.6319 0.0125  0.0363  -0.0057 205 PRO A CG  
610  C  CD  . PRO A 105 ? 0.5989 0.5677 0.6139 0.0086  0.0292  -0.0079 205 PRO A CD  
611  O  OXT . PRO A 105 ? 0.7796 0.7668 0.8024 0.0204  0.0300  -0.0030 205 PRO A OXT 
612  N  N   . PHE B 7   ? 0.8049 0.9974 0.8356 -0.0896 -0.0087 -0.0853 107 PHE B N   
613  C  CA  . PHE B 7   ? 0.8937 1.0630 0.9162 -0.0937 -0.0047 -0.0876 107 PHE B CA  
614  C  C   . PHE B 7   ? 0.9566 1.1128 0.9783 -0.0901 -0.0059 -0.0855 107 PHE B C   
615  O  O   . PHE B 7   ? 0.9602 1.1144 0.9881 -0.0841 -0.0087 -0.0825 107 PHE B O   
616  C  CB  . PHE B 7   ? 0.9252 1.0813 0.9472 -0.0949 -0.0018 -0.0884 107 PHE B CB  
617  C  CG  . PHE B 7   ? 1.0294 1.1843 1.0449 -0.1023 0.0028  -0.0923 107 PHE B CG  
618  C  CD1 . PHE B 7   ? 1.0948 1.2343 1.1016 -0.1075 0.0073  -0.0946 107 PHE B CD1 
619  C  CD2 . PHE B 7   ? 1.0906 1.2604 1.1088 -0.1042 0.0030  -0.0937 107 PHE B CD2 
620  C  CE1 . PHE B 7   ? 1.1180 1.2565 1.1187 -0.1148 0.0123  -0.0983 107 PHE B CE1 
621  C  CE2 . PHE B 7   ? 1.1325 1.3018 1.1444 -0.1117 0.0077  -0.0976 107 PHE B CE2 
622  C  CZ  . PHE B 7   ? 1.1386 1.2920 1.1417 -0.1171 0.0124  -0.0999 107 PHE B CZ  
623  N  N   . GLU B 8   ? 1.0012 1.1486 1.0152 -0.0943 -0.0033 -0.0876 108 GLU B N   
624  C  CA  . GLU B 8   ? 1.0047 1.1386 1.0166 -0.0917 -0.0037 -0.0863 108 GLU B CA  
625  C  C   . GLU B 8   ? 0.9307 1.0445 0.9424 -0.0896 -0.0019 -0.0852 108 GLU B C   
626  O  O   . GLU B 8   ? 0.8939 0.9998 0.9031 -0.0927 0.0014  -0.0865 108 GLU B O   
627  C  CB  . GLU B 8   ? 1.0588 1.1878 1.0622 -0.0975 -0.0001 -0.0894 108 GLU B CB  
628  C  CG  . GLU B 8   ? 1.0937 1.2219 1.0960 -0.0950 -0.0022 -0.0882 108 GLU B CG  
629  C  CD  . GLU B 8   ? 1.0995 1.2493 1.1074 -0.0911 -0.0076 -0.0854 108 GLU B CD  
630  O  OE1 . GLU B 8   ? 1.1250 1.2932 1.1348 -0.0929 -0.0086 -0.0856 108 GLU B OE1 
631  O  OE2 . GLU B 8   ? 1.0606 1.2096 1.0711 -0.0860 -0.0107 -0.0826 108 GLU B OE2 
632  N  N   . PRO B 9   ? 0.8518 0.9584 0.8663 -0.0844 -0.0040 -0.0826 109 PRO B N   
633  C  CA  . PRO B 9   ? 0.7711 0.8606 0.7857 -0.0821 -0.0026 -0.0810 109 PRO B CA  
634  C  C   . PRO B 9   ? 0.7334 0.8050 0.7399 -0.0859 0.0022  -0.0826 109 PRO B C   
635  O  O   . PRO B 9   ? 0.7854 0.8546 0.7866 -0.0887 0.0041  -0.0847 109 PRO B O   
636  C  CB  . PRO B 9   ? 0.7490 0.8379 0.7677 -0.0766 -0.0057 -0.0785 109 PRO B CB  
637  C  CG  . PRO B 9   ? 0.7625 0.8702 0.7852 -0.0749 -0.0095 -0.0781 109 PRO B CG  
638  C  CD  . PRO B 9   ? 0.8123 0.9282 0.8299 -0.0805 -0.0079 -0.0808 109 PRO B CD  
639  N  N   . PRO B 10  ? 0.6582 0.7178 0.6638 -0.0859 0.0044  -0.0816 110 PRO B N   
640  C  CA  . PRO B 10  ? 0.6261 0.6683 0.6247 -0.0886 0.0092  -0.0824 110 PRO B CA  
641  C  C   . PRO B 10  ? 0.6354 0.6662 0.6329 -0.0853 0.0094  -0.0809 110 PRO B C   
642  O  O   . PRO B 10  ? 0.6127 0.6489 0.6151 -0.0809 0.0056  -0.0792 110 PRO B O   
643  C  CB  . PRO B 10  ? 0.5975 0.6337 0.5969 -0.0887 0.0104  -0.0809 110 PRO B CB  
644  C  CG  . PRO B 10  ? 0.6082 0.6543 0.6157 -0.0841 0.0059  -0.0784 110 PRO B CG  
645  C  CD  . PRO B 10  ? 0.6358 0.6985 0.6470 -0.0834 0.0028  -0.0796 110 PRO B CD  
646  N  N   . GLU B 11  ? 0.6721 0.6874 0.6634 -0.0875 0.0142  -0.0818 111 GLU B N   
647  C  CA  . GLU B 11  ? 0.6921 0.6951 0.6820 -0.0844 0.0154  -0.0805 111 GLU B CA  
648  C  C   . GLU B 11  ? 0.6397 0.6349 0.6321 -0.0816 0.0152  -0.0771 111 GLU B C   
649  O  O   . GLU B 11  ? 0.6722 0.6651 0.6639 -0.0836 0.0166  -0.0765 111 GLU B O   
650  C  CB  . GLU B 11  ? 0.8019 0.7912 0.7840 -0.0879 0.0216  -0.0829 111 GLU B CB  
651  C  CG  . GLU B 11  ? 0.9823 0.9769 0.9618 -0.0897 0.0220  -0.0859 111 GLU B CG  
652  C  CD  . GLU B 11  ? 1.1331 1.1123 1.1049 -0.0926 0.0292  -0.0882 111 GLU B CD  
653  O  OE1 . GLU B 11  ? 1.1546 1.1258 1.1216 -0.0968 0.0344  -0.0897 111 GLU B OE1 
654  O  OE2 . GLU B 11  ? 1.1897 1.1643 1.1601 -0.0907 0.0301  -0.0887 111 GLU B OE2 
655  N  N   . PHE B 12  ? 0.5387 0.5307 0.5339 -0.0769 0.0136  -0.0746 112 PHE B N   
656  C  CA  . PHE B 12  ? 0.5284 0.5156 0.5264 -0.0722 0.0131  -0.0691 112 PHE B CA  
657  C  C   . PHE B 12  ? 0.5198 0.5015 0.5185 -0.0652 0.0132  -0.0643 112 PHE B C   
658  O  O   . PHE B 12  ? 0.5177 0.5018 0.5165 -0.0630 0.0122  -0.0648 112 PHE B O   
659  C  CB  . PHE B 12  ? 0.4348 0.4343 0.4395 -0.0711 0.0087  -0.0680 112 PHE B CB  
660  C  CG  . PHE B 12  ? 0.3990 0.4078 0.4090 -0.0659 0.0048  -0.0660 112 PHE B CG  
661  C  CD1 . PHE B 12  ? 0.3756 0.3849 0.3895 -0.0607 0.0032  -0.0614 112 PHE B CD1 
662  C  CD2 . PHE B 12  ? 0.3642 0.3815 0.3746 -0.0664 0.0030  -0.0685 112 PHE B CD2 
663  C  CE1 . PHE B 12  ? 0.4052 0.4215 0.4232 -0.0562 0.0004  -0.0597 112 PHE B CE1 
664  C  CE2 . PHE B 12  ? 0.3820 0.4069 0.3968 -0.0612 -0.0001 -0.0661 112 PHE B CE2 
665  C  CZ  . PHE B 12  ? 0.4102 0.4335 0.4286 -0.0561 -0.0011 -0.0617 112 PHE B CZ  
666  N  N   . GLU B 13  ? 0.4987 0.4740 0.4978 -0.0619 0.0143  -0.0594 113 GLU B N   
667  C  CA  . GLU B 13  ? 0.5218 0.4948 0.5226 -0.0552 0.0139  -0.0543 113 GLU B CA  
668  C  C   . GLU B 13  ? 0.4676 0.4462 0.4727 -0.0528 0.0113  -0.0499 113 GLU B C   
669  O  O   . GLU B 13  ? 0.5361 0.5164 0.5417 -0.0562 0.0111  -0.0504 113 GLU B O   
670  C  CB  . GLU B 13  ? 0.6445 0.6035 0.6404 -0.0533 0.0193  -0.0520 113 GLU B CB  
671  C  CG  . GLU B 13  ? 0.7957 0.7477 0.7871 -0.0550 0.0228  -0.0560 113 GLU B CG  
672  C  CD  . GLU B 13  ? 0.9864 0.9222 0.9720 -0.0551 0.0299  -0.0551 113 GLU B CD  
673  O  OE1 . GLU B 13  ? 1.0251 0.9550 1.0113 -0.0488 0.0318  -0.0491 113 GLU B OE1 
674  O  OE2 . GLU B 13  ? 1.0814 1.0106 1.0618 -0.0615 0.0339  -0.0601 113 GLU B OE2 
675  N  N   . ILE B 14  ? 0.3753 0.3573 0.3834 -0.0477 0.0096  -0.0461 114 ILE B N   
676  C  CA  . ILE B 14  ? 0.4190 0.4066 0.4305 -0.0462 0.0078  -0.0422 114 ILE B CA  
677  C  C   . ILE B 14  ? 0.4218 0.4073 0.4332 -0.0410 0.0089  -0.0366 114 ILE B C   
678  O  O   . ILE B 14  ? 0.4707 0.4531 0.4813 -0.0376 0.0098  -0.0361 114 ILE B O   
679  C  CB  . ILE B 14  ? 0.3697 0.3676 0.3859 -0.0460 0.0043  -0.0435 114 ILE B CB  
680  C  CG1 . ILE B 14  ? 0.3219 0.3209 0.3388 -0.0418 0.0035  -0.0428 114 ILE B CG1 
681  C  CG2 . ILE B 14  ? 0.3554 0.3576 0.3727 -0.0500 0.0032  -0.0483 114 ILE B CG2 
682  C  CD1 . ILE B 14  ? 0.3180 0.3251 0.3388 -0.0411 0.0011  -0.0436 114 ILE B CD1 
683  N  N   . VAL B 15  ? 0.4123 0.4009 0.4246 -0.0406 0.0086  -0.0324 115 VAL B N   
684  C  CA  . VAL B 15  ? 0.4486 0.4407 0.4624 -0.0357 0.0085  -0.0269 115 VAL B CA  
685  C  C   . VAL B 15  ? 0.4702 0.4735 0.4871 -0.0373 0.0061  -0.0250 115 VAL B C   
686  O  O   . VAL B 15  ? 0.4741 0.4797 0.4910 -0.0414 0.0057  -0.0255 115 VAL B O   
687  C  CB  . VAL B 15  ? 0.4152 0.3990 0.4260 -0.0317 0.0122  -0.0217 115 VAL B CB  
688  C  CG1 . VAL B 15  ? 0.4272 0.3998 0.4337 -0.0348 0.0156  -0.0236 115 VAL B CG1 
689  C  CG2 . VAL B 15  ? 0.3488 0.3403 0.3613 -0.0291 0.0116  -0.0149 115 VAL B CG2 
690  N  N   . GLY B 16  ? 0.4497 0.4601 0.4690 -0.0349 0.0047  -0.0236 116 GLY B N   
691  C  CA  . GLY B 16  ? 0.4331 0.4542 0.4550 -0.0377 0.0030  -0.0235 116 GLY B CA  
692  C  C   . GLY B 16  ? 0.4557 0.4846 0.4778 -0.0368 0.0030  -0.0177 116 GLY B C   
693  O  O   . GLY B 16  ? 0.4259 0.4547 0.4476 -0.0319 0.0039  -0.0131 116 GLY B O   
694  N  N   . PHE B 17  ? 0.4385 0.4752 0.4613 -0.0415 0.0022  -0.0179 117 PHE B N   
695  C  CA  . PHE B 17  ? 0.4407 0.4883 0.4638 -0.0418 0.0019  -0.0126 117 PHE B CA  
696  C  C   . PHE B 17  ? 0.4338 0.4923 0.4586 -0.0470 0.0011  -0.0155 117 PHE B C   
697  O  O   . PHE B 17  ? 0.4774 0.5331 0.5033 -0.0497 0.0013  -0.0212 117 PHE B O   
698  C  CB  . PHE B 17  ? 0.5050 0.5514 0.5259 -0.0433 0.0025  -0.0091 117 PHE B CB  
699  C  CG  . PHE B 17  ? 0.5455 0.5796 0.5639 -0.0385 0.0045  -0.0060 117 PHE B CG  
700  C  CD1 . PHE B 17  ? 0.5359 0.5706 0.5538 -0.0323 0.0058  0.0012  117 PHE B CD1 
701  C  CD2 . PHE B 17  ? 0.5275 0.5496 0.5440 -0.0403 0.0056  -0.0106 117 PHE B CD2 
702  C  CE1 . PHE B 17  ? 0.5707 0.5919 0.5859 -0.0278 0.0089  0.0038  117 PHE B CE1 
703  C  CE2 . PHE B 17  ? 0.5090 0.5186 0.5224 -0.0370 0.0085  -0.0086 117 PHE B CE2 
704  C  CZ  . PHE B 17  ? 0.5395 0.5475 0.5521 -0.0307 0.0105  -0.0015 117 PHE B CZ  
705  N  N   . THR B 18  ? 0.3511 0.4222 0.3759 -0.0484 0.0008  -0.0115 118 THR B N   
706  C  CA  . THR B 18  ? 0.4049 0.4871 0.4305 -0.0545 0.0009  -0.0145 118 THR B CA  
707  C  C   . THR B 18  ? 0.3810 0.4601 0.4069 -0.0607 0.0019  -0.0208 118 THR B C   
708  O  O   . THR B 18  ? 0.3769 0.4568 0.4037 -0.0639 0.0032  -0.0256 118 THR B O   
709  C  CB  . THR B 18  ? 0.4892 0.5873 0.5142 -0.0571 0.0004  -0.0094 118 THR B CB  
710  O  OG1 . THR B 18  ? 0.5645 0.6650 0.5895 -0.0501 -0.0003 -0.0018 118 THR B OG1 
711  C  CG2 . THR B 18  ? 0.5286 0.6390 0.5540 -0.0623 0.0011  -0.0122 118 THR B CG2 
712  N  N   . ASN B 19  ? 0.2907 0.3655 0.3156 -0.0624 0.0017  -0.0206 119 ASN B N   
713  C  CA  . ASN B 19  ? 0.3430 0.4165 0.3686 -0.0684 0.0029  -0.0263 119 ASN B CA  
714  C  C   . ASN B 19  ? 0.3780 0.4405 0.4038 -0.0675 0.0029  -0.0289 119 ASN B C   
715  O  O   . ASN B 19  ? 0.4996 0.5614 0.5263 -0.0720 0.0039  -0.0332 119 ASN B O   
716  C  CB  . ASN B 19  ? 0.4269 0.5115 0.4512 -0.0751 0.0033  -0.0251 119 ASN B CB  
717  C  CG  . ASN B 19  ? 0.5230 0.6206 0.5470 -0.0786 0.0039  -0.0247 119 ASN B CG  
718  O  OD1 . ASN B 19  ? 0.6114 0.7096 0.6363 -0.0824 0.0061  -0.0301 119 ASN B OD1 
719  N  ND2 . ASN B 19  ? 0.5176 0.6259 0.5403 -0.0772 0.0025  -0.0182 119 ASN B ND2 
720  N  N   . HIS B 20  ? 0.2565 0.3109 0.2814 -0.0621 0.0021  -0.0265 120 HIS B N   
721  C  CA  . HIS B 20  ? 0.3242 0.3693 0.3489 -0.0621 0.0023  -0.0297 120 HIS B CA  
722  C  C   . HIS B 20  ? 0.3402 0.3764 0.3641 -0.0563 0.0021  -0.0291 120 HIS B C   
723  O  O   . HIS B 20  ? 0.2887 0.3250 0.3121 -0.0519 0.0020  -0.0255 120 HIS B O   
724  C  CB  . HIS B 20  ? 0.3051 0.3489 0.3272 -0.0648 0.0027  -0.0275 120 HIS B CB  
725  C  CG  . HIS B 20  ? 0.4218 0.4629 0.4410 -0.0605 0.0029  -0.0208 120 HIS B CG  
726  N  ND1 . HIS B 20  ? 0.5184 0.5681 0.5373 -0.0586 0.0024  -0.0150 120 HIS B ND1 
727  C  CD2 . HIS B 20  ? 0.4867 0.5171 0.5032 -0.0573 0.0041  -0.0189 120 HIS B CD2 
728  C  CE1 . HIS B 20  ? 0.5417 0.5863 0.5583 -0.0536 0.0033  -0.0091 120 HIS B CE1 
729  N  NE2 . HIS B 20  ? 0.5177 0.5494 0.5325 -0.0529 0.0047  -0.0115 120 HIS B NE2 
730  N  N   . ILE B 21  ? 0.3468 0.3763 0.3707 -0.0570 0.0023  -0.0330 121 ILE B N   
731  C  CA  . ILE B 21  ? 0.4076 0.4290 0.4301 -0.0532 0.0026  -0.0335 121 ILE B CA  
732  C  C   . ILE B 21  ? 0.4272 0.4414 0.4467 -0.0553 0.0038  -0.0343 121 ILE B C   
733  O  O   . ILE B 21  ? 0.4605 0.4760 0.4806 -0.0598 0.0038  -0.0378 121 ILE B O   
734  C  CB  . ILE B 21  ? 0.4560 0.4775 0.4810 -0.0525 0.0018  -0.0381 121 ILE B CB  
735  C  CG1 . ILE B 21  ? 0.3931 0.4189 0.4200 -0.0499 0.0013  -0.0372 121 ILE B CG1 
736  C  CG2 . ILE B 21  ? 0.4506 0.4647 0.4734 -0.0506 0.0021  -0.0396 121 ILE B CG2 
737  C  CD1 . ILE B 21  ? 0.3089 0.3353 0.3383 -0.0492 0.0009  -0.0408 121 ILE B CD1 
738  N  N   . ASN B 22  ? 0.3912 0.3976 0.4072 -0.0522 0.0055  -0.0311 122 ASN B N   
739  C  CA  . ASN B 22  ? 0.4433 0.4401 0.4554 -0.0542 0.0079  -0.0323 122 ASN B CA  
740  C  C   . ASN B 22  ? 0.4650 0.4582 0.4768 -0.0552 0.0080  -0.0380 122 ASN B C   
741  O  O   . ASN B 22  ? 0.4385 0.4306 0.4509 -0.0517 0.0077  -0.0383 122 ASN B O   
742  C  CB  . ASN B 22  ? 0.6307 0.6191 0.6391 -0.0501 0.0108  -0.0267 122 ASN B CB  
743  C  CG  . ASN B 22  ? 0.8425 0.8319 0.8490 -0.0508 0.0117  -0.0213 122 ASN B CG  
744  O  OD1 . ASN B 22  ? 0.8572 0.8557 0.8658 -0.0491 0.0101  -0.0167 122 ASN B OD1 
745  N  ND2 . ASN B 22  ? 0.9415 0.9222 0.9438 -0.0539 0.0145  -0.0218 122 ASN B ND2 
746  N  N   . VAL B 23  ? 0.4705 0.4632 0.4815 -0.0603 0.0084  -0.0424 123 VAL B N   
747  C  CA  . VAL B 23  ? 0.5195 0.5109 0.5299 -0.0621 0.0086  -0.0478 123 VAL B CA  
748  C  C   . VAL B 23  ? 0.5732 0.5552 0.5780 -0.0664 0.0122  -0.0501 123 VAL B C   
749  O  O   . VAL B 23  ? 0.6176 0.5989 0.6210 -0.0707 0.0132  -0.0506 123 VAL B O   
750  C  CB  . VAL B 23  ? 0.4933 0.4953 0.5085 -0.0646 0.0059  -0.0519 123 VAL B CB  
751  C  CG1 . VAL B 23  ? 0.4986 0.5023 0.5136 -0.0657 0.0055  -0.0565 123 VAL B CG1 
752  C  CG2 . VAL B 23  ? 0.4120 0.4212 0.4320 -0.0610 0.0036  -0.0498 123 VAL B CG2 
753  N  N   . MSE B 24  ? 0.5806 0.5551 0.5818 -0.0657 0.0146  -0.0516 124 MSE B N   
754  C  CA  . MSE B 24  ? 0.6315 0.5960 0.6265 -0.0706 0.0191  -0.0550 124 MSE B CA  
755  C  C   . MSE B 24  ? 0.6514 0.6208 0.6460 -0.0751 0.0185  -0.0618 124 MSE B C   
756  O  O   . MSE B 24  ? 0.6631 0.6353 0.6588 -0.0726 0.0173  -0.0629 124 MSE B O   
757  C  CB  . MSE B 24  ? 0.6697 0.6200 0.6596 -0.0673 0.0240  -0.0518 124 MSE B CB  
758  C  CG  . MSE B 24  ? 0.7890 0.7347 0.7789 -0.0622 0.0251  -0.0440 124 MSE B CG  
759  SE SE  . MSE B 24  ? 1.6366 1.5631 1.6203 -0.0572 0.0328  -0.0400 124 MSE B SE  
760  C  CE  . MSE B 24  ? 0.7030 0.6154 0.6780 -0.0668 0.0396  -0.0466 124 MSE B CE  
761  N  N   . VAL B 25  ? 0.6316 0.6032 0.6245 -0.0820 0.0194  -0.0665 125 VAL B N   
762  C  CA  . VAL B 25  ? 0.6544 0.6342 0.6469 -0.0840 0.0186  -0.0705 125 VAL B CA  
763  C  C   . VAL B 25  ? 0.6939 0.6645 0.6788 -0.0888 0.0242  -0.0731 125 VAL B C   
764  O  O   . VAL B 25  ? 0.6962 0.6576 0.6771 -0.0913 0.0278  -0.0722 125 VAL B O   
765  C  CB  . VAL B 25  ? 0.6578 0.6530 0.6557 -0.0836 0.0147  -0.0705 125 VAL B CB  
766  C  CG1 . VAL B 25  ? 0.6200 0.6249 0.6177 -0.0854 0.0140  -0.0738 125 VAL B CG1 
767  C  CG2 . VAL B 25  ? 0.6502 0.6532 0.6553 -0.0790 0.0103  -0.0679 125 VAL B CG2 
768  N  N   . LYS B 26  ? 0.7499 0.7230 0.7325 -0.0903 0.0252  -0.0763 126 LYS B N   
769  C  CA  . LYS B 26  ? 0.8001 0.7665 0.7753 -0.0955 0.0309  -0.0795 126 LYS B CA  
770  C  C   . LYS B 26  ? 0.8534 0.8361 0.8302 -0.0986 0.0288  -0.0827 126 LYS B C   
771  O  O   . LYS B 26  ? 0.8577 0.8538 0.8397 -0.0962 0.0239  -0.0827 126 LYS B O   
772  C  CB  . LYS B 26  ? 0.7877 0.7413 0.7577 -0.0957 0.0357  -0.0809 126 LYS B CB  
773  N  N   . PHE B 27  ? 0.9333 0.9148 0.9054 -0.1040 0.0328  -0.0851 127 PHE B N   
774  C  CA  . PHE B 27  ? 0.9740 0.9716 0.9475 -0.1075 0.0313  -0.0880 127 PHE B CA  
775  C  C   . PHE B 27  ? 0.9738 0.9708 0.9407 -0.1138 0.0365  -0.0925 127 PHE B C   
776  O  O   . PHE B 27  ? 0.9745 0.9867 0.9426 -0.1168 0.0352  -0.0952 127 PHE B O   
777  C  CB  . PHE B 27  ? 1.0336 1.0345 1.0081 -0.1092 0.0313  -0.0875 127 PHE B CB  
778  C  CG  . PHE B 27  ? 1.0698 1.0767 1.0518 -0.1038 0.0259  -0.0837 127 PHE B CG  
779  C  CD1 . PHE B 27  ? 1.0711 1.0946 1.0601 -0.1011 0.0208  -0.0835 127 PHE B CD1 
780  C  CD2 . PHE B 27  ? 1.1021 1.0981 1.0838 -0.1018 0.0264  -0.0804 127 PHE B CD2 
781  C  CE1 . PHE B 27  ? 1.0621 1.0904 1.0579 -0.0964 0.0168  -0.0804 127 PHE B CE1 
782  C  CE2 . PHE B 27  ? 1.0718 1.0741 1.0602 -0.0976 0.0219  -0.0773 127 PHE B CE2 
783  C  CZ  . PHE B 27  ? 1.0410 1.0587 1.0362 -0.0949 0.0174  -0.0774 127 PHE B CZ  
784  N  N   . LEU B 39  ? 0.7796 0.9198 0.8089 -0.0997 0.0085  -0.0916 139 LEU B N   
785  C  CA  . LEU B 39  ? 0.7756 0.9069 0.8059 -0.0954 0.0063  -0.0886 139 LEU B CA  
786  C  C   . LEU B 39  ? 0.8153 0.9287 0.8441 -0.0934 0.0073  -0.0858 139 LEU B C   
787  O  O   . LEU B 39  ? 0.8373 0.9385 0.8595 -0.0968 0.0103  -0.0860 139 LEU B O   
788  C  CB  . LEU B 39  ? 0.6345 0.7621 0.6586 -0.0982 0.0070  -0.0894 139 LEU B CB  
789  N  N   . SER B 40  ? 0.7784 0.8911 0.8133 -0.0881 0.0049  -0.0833 140 SER B N   
790  C  CA  . SER B 40  ? 0.8077 0.9049 0.8410 -0.0861 0.0055  -0.0804 140 SER B CA  
791  C  C   . SER B 40  ? 0.7467 0.8369 0.7791 -0.0834 0.0039  -0.0784 140 SER B C   
792  O  O   . SER B 40  ? 0.7509 0.8500 0.7868 -0.0813 0.0016  -0.0788 140 SER B O   
793  C  CB  . SER B 40  ? 0.8646 0.9646 0.9045 -0.0829 0.0051  -0.0793 140 SER B CB  
794  O  OG  . SER B 40  ? 0.9437 1.0596 0.9898 -0.0828 0.0048  -0.0817 140 SER B OG  
795  N  N   . LEU B 41  ? 0.6761 0.7514 0.7039 -0.0834 0.0051  -0.0762 141 LEU B N   
796  C  CA  . LEU B 41  ? 0.6003 0.6685 0.6275 -0.0807 0.0038  -0.0743 141 LEU B CA  
797  C  C   . LEU B 41  ? 0.5558 0.6241 0.5889 -0.0762 0.0023  -0.0719 141 LEU B C   
798  O  O   . LEU B 41  ? 0.5918 0.6564 0.6255 -0.0759 0.0033  -0.0705 141 LEU B O   
799  C  CB  . LEU B 41  ? 0.5827 0.6359 0.6024 -0.0830 0.0062  -0.0733 141 LEU B CB  
800  C  CG  . LEU B 41  ? 0.6098 0.6549 0.6290 -0.0801 0.0052  -0.0711 141 LEU B CG  
801  C  CD1 . LEU B 41  ? 0.5833 0.6331 0.6030 -0.0791 0.0037  -0.0726 141 LEU B CD1 
802  C  CD2 . LEU B 41  ? 0.6457 0.6767 0.6585 -0.0824 0.0080  -0.0701 141 LEU B CD2 
803  N  N   . VAL B 42  ? 0.4667 0.5398 0.5038 -0.0730 0.0002  -0.0717 142 VAL B N   
804  C  CA  . VAL B 42  ? 0.4621 0.5341 0.5042 -0.0692 -0.0006 -0.0698 142 VAL B CA  
805  C  C   . VAL B 42  ? 0.5117 0.5739 0.5505 -0.0678 -0.0010 -0.0680 142 VAL B C   
806  O  O   . VAL B 42  ? 0.5081 0.5704 0.5446 -0.0679 -0.0020 -0.0688 142 VAL B O   
807  C  CB  . VAL B 42  ? 0.4686 0.5543 0.5192 -0.0663 -0.0024 -0.0710 142 VAL B CB  
808  C  CG1 . VAL B 42  ? 0.4565 0.5399 0.5124 -0.0630 -0.0020 -0.0697 142 VAL B CG1 
809  C  CG2 . VAL B 42  ? 0.4495 0.5479 0.5047 -0.0673 -0.0021 -0.0731 142 VAL B CG2 
810  N  N   . ILE B 43  ? 0.4765 0.5314 0.5150 -0.0668 -0.0002 -0.0656 143 ILE B N   
811  C  CA  . ILE B 43  ? 0.4349 0.4828 0.4718 -0.0652 -0.0005 -0.0639 143 ILE B CA  
812  C  C   . ILE B 43  ? 0.4308 0.4822 0.4736 -0.0622 -0.0008 -0.0632 143 ILE B C   
813  O  O   . ILE B 43  ? 0.4964 0.5473 0.5407 -0.0623 0.0006  -0.0623 143 ILE B O   
814  C  CB  . ILE B 43  ? 0.4013 0.4392 0.4330 -0.0670 0.0009  -0.0618 143 ILE B CB  
815  C  CG1 . ILE B 43  ? 0.4067 0.4393 0.4325 -0.0704 0.0022  -0.0630 143 ILE B CG1 
816  C  CG2 . ILE B 43  ? 0.4028 0.4356 0.4341 -0.0654 0.0006  -0.0600 143 ILE B CG2 
817  C  CD1 . ILE B 43  ? 0.4177 0.4405 0.4388 -0.0727 0.0041  -0.0612 143 ILE B CD1 
818  N  N   . GLU B 44  ? 0.3725 0.4268 0.4176 -0.0588 -0.0021 -0.0630 144 GLU B N   
819  C  CA  . GLU B 44  ? 0.3728 0.4292 0.4226 -0.0542 -0.0013 -0.0611 144 GLU B CA  
820  C  C   . GLU B 44  ? 0.4006 0.4496 0.4478 -0.0515 -0.0010 -0.0580 144 GLU B C   
821  O  O   . GLU B 44  ? 0.4966 0.5417 0.5399 -0.0503 -0.0021 -0.0568 144 GLU B O   
822  C  CB  . GLU B 44  ? 0.3948 0.4602 0.4489 -0.0501 -0.0023 -0.0607 144 GLU B CB  
823  C  CG  . GLU B 44  ? 0.4460 0.5127 0.5051 -0.0448 -0.0005 -0.0585 144 GLU B CG  
824  C  CD  . GLU B 44  ? 0.6136 0.6894 0.6763 -0.0396 -0.0017 -0.0568 144 GLU B CD  
825  O  OE1 . GLU B 44  ? 0.6131 0.6988 0.6807 -0.0395 -0.0016 -0.0579 144 GLU B OE1 
826  O  OE2 . GLU B 44  ? 0.7156 0.7896 0.7765 -0.0357 -0.0026 -0.0541 144 GLU B OE2 
827  N  N   . GLU B 45  ? 0.3125 0.3600 0.3618 -0.0510 0.0010  -0.0572 145 GLU B N   
828  C  CA  . GLU B 45  ? 0.2996 0.3416 0.3463 -0.0504 0.0019  -0.0550 145 GLU B CA  
829  C  C   . GLU B 45  ? 0.3102 0.3525 0.3599 -0.0467 0.0039  -0.0541 145 GLU B C   
830  O  O   . GLU B 45  ? 0.3935 0.4390 0.4476 -0.0461 0.0058  -0.0553 145 GLU B O   
831  C  CB  . GLU B 45  ? 0.3925 0.4335 0.4382 -0.0553 0.0033  -0.0555 145 GLU B CB  
832  C  CG  . GLU B 45  ? 0.5319 0.5714 0.5770 -0.0557 0.0052  -0.0542 145 GLU B CG  
833  C  CD  . GLU B 45  ? 0.5701 0.6119 0.6160 -0.0608 0.0076  -0.0557 145 GLU B CD  
834  O  OE1 . GLU B 45  ? 0.5073 0.5495 0.5516 -0.0621 0.0072  -0.0553 145 GLU B OE1 
835  O  OE2 . GLU B 45  ? 0.6114 0.6532 0.6572 -0.0616 0.0101  -0.0555 145 GLU B OE2 
836  N  N   . GLN B 46  ? 0.2949 0.3335 0.3424 -0.0441 0.0040  -0.0519 146 GLN B N   
837  C  CA  . GLN B 46  ? 0.3689 0.4062 0.4184 -0.0410 0.0067  -0.0511 146 GLN B CA  
838  C  C   . GLN B 46  ? 0.3645 0.3976 0.4108 -0.0406 0.0077  -0.0494 146 GLN B C   
839  O  O   . GLN B 46  ? 0.3894 0.4211 0.4322 -0.0404 0.0054  -0.0481 146 GLN B O   
840  C  CB  . GLN B 46  ? 0.4025 0.4425 0.4544 -0.0358 0.0059  -0.0498 146 GLN B CB  
841  C  CG  . GLN B 46  ? 0.4721 0.5119 0.5205 -0.0335 0.0026  -0.0482 146 GLN B CG  
842  C  CD  . GLN B 46  ? 0.5459 0.5911 0.5965 -0.0292 0.0013  -0.0469 146 GLN B CD  
843  O  OE1 . GLN B 46  ? 0.5516 0.5956 0.6021 -0.0248 0.0021  -0.0444 146 GLN B OE1 
844  N  NE2 . GLN B 46  ? 0.5515 0.6038 0.6039 -0.0305 -0.0007 -0.0485 146 GLN B NE2 
845  N  N   . SER B 47  ? 0.3918 0.4226 0.4392 -0.0404 0.0116  -0.0497 147 SER B N   
846  C  CA  . SER B 47  ? 0.4035 0.4310 0.4477 -0.0410 0.0135  -0.0489 147 SER B CA  
847  C  C   . SER B 47  ? 0.3889 0.4124 0.4345 -0.0396 0.0187  -0.0494 147 SER B C   
848  O  O   . SER B 47  ? 0.3737 0.3969 0.4220 -0.0415 0.0222  -0.0514 147 SER B O   
849  C  CB  . SER B 47  ? 0.4148 0.4444 0.4570 -0.0468 0.0139  -0.0499 147 SER B CB  
850  O  OG  . SER B 47  ? 0.4771 0.5057 0.5163 -0.0477 0.0154  -0.0492 147 SER B OG  
851  N  N   . GLU B 48  ? 0.4450 0.4647 0.4888 -0.0361 0.0196  -0.0475 148 GLU B N   
852  C  CA  . GLU B 48  ? 0.4922 0.5060 0.5360 -0.0353 0.0257  -0.0478 148 GLU B CA  
853  C  C   . GLU B 48  ? 0.4556 0.4679 0.5041 -0.0320 0.0292  -0.0477 148 GLU B C   
854  O  O   . GLU B 48  ? 0.4599 0.4668 0.5089 -0.0334 0.0357  -0.0493 148 GLU B O   
855  C  CB  . GLU B 48  ? 0.5791 0.5917 0.6202 -0.0423 0.0297  -0.0507 148 GLU B CB  
856  C  CG  . GLU B 48  ? 0.7671 0.7757 0.8039 -0.0431 0.0322  -0.0502 148 GLU B CG  
857  C  CD  . GLU B 48  ? 0.9232 0.9371 0.9567 -0.0494 0.0312  -0.0517 148 GLU B CD  
858  O  OE1 . GLU B 48  ? 0.9869 1.0073 1.0212 -0.0514 0.0271  -0.0515 148 GLU B OE1 
859  O  OE2 . GLU B 48  ? 0.9509 0.9628 0.9809 -0.0524 0.0348  -0.0527 148 GLU B OE2 
860  N  N   . GLY B 49  ? 0.4024 0.4198 0.4541 -0.0278 0.0253  -0.0461 149 GLY B N   
861  C  CA  . GLY B 49  ? 0.3471 0.3654 0.4041 -0.0237 0.0282  -0.0453 149 GLY B CA  
862  C  C   . GLY B 49  ? 0.4209 0.4440 0.4817 -0.0272 0.0282  -0.0484 149 GLY B C   
863  O  O   . GLY B 49  ? 0.4343 0.4609 0.5003 -0.0236 0.0296  -0.0478 149 GLY B O   
864  N  N   . ILE B 50  ? 0.3767 0.4009 0.4350 -0.0341 0.0269  -0.0514 150 ILE B N   
865  C  CA  . ILE B 50  ? 0.4048 0.4332 0.4659 -0.0384 0.0271  -0.0544 150 ILE B CA  
866  C  C   . ILE B 50  ? 0.3910 0.4261 0.4521 -0.0387 0.0207  -0.0541 150 ILE B C   
867  O  O   . ILE B 50  ? 0.4455 0.4806 0.5027 -0.0393 0.0167  -0.0529 150 ILE B O   
868  C  CB  . ILE B 50  ? 0.3724 0.3988 0.4305 -0.0462 0.0300  -0.0577 150 ILE B CB  
869  C  CG1 . ILE B 50  ? 0.4567 0.4759 0.5142 -0.0470 0.0375  -0.0589 150 ILE B CG1 
870  C  CG2 . ILE B 50  ? 0.2252 0.2562 0.2856 -0.0511 0.0301  -0.0607 150 ILE B CG2 
871  C  CD1 . ILE B 50  ? 0.4244 0.4432 0.4780 -0.0557 0.0404  -0.0623 150 ILE B CD1 
872  N  N   . VAL B 51  ? 0.3225 0.3633 0.3879 -0.0387 0.0202  -0.0554 151 VAL B N   
873  C  CA  . VAL B 51  ? 0.2769 0.3242 0.3423 -0.0393 0.0149  -0.0556 151 VAL B CA  
874  C  C   . VAL B 51  ? 0.3533 0.4047 0.4206 -0.0445 0.0152  -0.0589 151 VAL B C   
875  O  O   . VAL B 51  ? 0.3447 0.3970 0.4161 -0.0450 0.0192  -0.0607 151 VAL B O   
876  C  CB  . VAL B 51  ? 0.3223 0.3755 0.3912 -0.0328 0.0133  -0.0532 151 VAL B CB  
877  C  CG1 . VAL B 51  ? 0.1114 0.1725 0.1800 -0.0348 0.0085  -0.0544 151 VAL B CG1 
878  C  CG2 . VAL B 51  ? 0.1158 0.1650 0.1823 -0.0277 0.0130  -0.0496 151 VAL B CG2 
879  N  N   . LYS B 52  ? 0.2897 0.3429 0.3538 -0.0484 0.0114  -0.0598 152 LYS B N   
880  C  CA  . LYS B 52  ? 0.2949 0.3515 0.3599 -0.0538 0.0115  -0.0628 152 LYS B CA  
881  C  C   . LYS B 52  ? 0.3436 0.4036 0.4063 -0.0557 0.0076  -0.0635 152 LYS B C   
882  O  O   . LYS B 52  ? 0.3415 0.3977 0.3993 -0.0566 0.0052  -0.0621 152 LYS B O   
883  C  CB  . LYS B 52  ? 0.3904 0.4429 0.4519 -0.0596 0.0132  -0.0637 152 LYS B CB  
884  C  CG  . LYS B 52  ? 0.4117 0.4653 0.4708 -0.0625 0.0139  -0.0641 152 LYS B CG  
885  C  CD  . LYS B 52  ? 0.4244 0.4735 0.4761 -0.0646 0.0140  -0.0611 152 LYS B CD  
886  C  CE  . LYS B 52  ? 0.3870 0.4367 0.4371 -0.0671 0.0168  -0.0618 152 LYS B CE  
887  N  NZ  . LYS B 52  ? 0.3991 0.4520 0.4507 -0.0677 0.0165  -0.0634 152 LYS B NZ  
888  N  N   . LYS B 53  ? 0.4138 0.4811 0.4803 -0.0568 0.0075  -0.0657 153 LYS B N   
889  C  CA  . LYS B 53  ? 0.4928 0.5642 0.5571 -0.0600 0.0047  -0.0674 153 LYS B CA  
890  C  C   . LYS B 53  ? 0.4860 0.5508 0.5430 -0.0629 0.0055  -0.0659 153 LYS B C   
891  O  O   . LYS B 53  ? 0.5186 0.5842 0.5768 -0.0641 0.0078  -0.0665 153 LYS B O   
892  C  CB  . LYS B 53  ? 0.5243 0.6072 0.5944 -0.0580 0.0042  -0.0688 153 LYS B CB  
893  C  CG  . LYS B 53  ? 0.5280 0.6154 0.6018 -0.0503 0.0038  -0.0656 153 LYS B CG  
894  C  CD  . LYS B 53  ? 0.5032 0.6040 0.5842 -0.0472 0.0041  -0.0660 153 LYS B CD  
895  C  CE  . LYS B 53  ? 0.5505 0.6614 0.6304 -0.0519 0.0012  -0.0690 153 LYS B CE  
896  N  NZ  . LYS B 53  ? 0.5729 0.6999 0.6603 -0.0490 0.0012  -0.0692 153 LYS B NZ  
897  N  N   . HIS B 54  ? 0.4471 0.5057 0.4972 -0.0640 0.0040  -0.0639 154 HIS B N   
898  C  CA  . HIS B 54  ? 0.4251 0.4788 0.4695 -0.0668 0.0047  -0.0626 154 HIS B CA  
899  C  C   . HIS B 54  ? 0.5018 0.5585 0.5444 -0.0688 0.0042  -0.0643 154 HIS B C   
900  O  O   . HIS B 54  ? 0.4424 0.5001 0.4840 -0.0686 0.0028  -0.0652 154 HIS B O   
901  C  CB  . HIS B 54  ? 0.4545 0.5001 0.4935 -0.0674 0.0042  -0.0597 154 HIS B CB  
902  C  CG  . HIS B 54  ? 0.4995 0.5435 0.5394 -0.0663 0.0049  -0.0579 154 HIS B CG  
903  N  ND1 . HIS B 54  ? 0.5305 0.5717 0.5671 -0.0682 0.0057  -0.0556 154 HIS B ND1 
904  C  CD2 . HIS B 54  ? 0.5250 0.5707 0.5688 -0.0641 0.0052  -0.0583 154 HIS B CD2 
905  C  CE1 . HIS B 54  ? 0.5378 0.5796 0.5757 -0.0673 0.0064  -0.0547 154 HIS B CE1 
906  N  NE2 . HIS B 54  ? 0.5477 0.5914 0.5898 -0.0648 0.0064  -0.0564 154 HIS B NE2 
907  N  N   . LYS B 55  ? 0.5749 0.6333 0.6168 -0.0709 0.0056  -0.0651 155 LYS B N   
908  C  CA  . LYS B 55  ? 0.5849 0.6464 0.6247 -0.0734 0.0056  -0.0671 155 LYS B CA  
909  C  C   . LYS B 55  ? 0.5903 0.6449 0.6237 -0.0768 0.0071  -0.0660 155 LYS B C   
910  O  O   . LYS B 55  ? 0.5835 0.6411 0.6172 -0.0785 0.0084  -0.0671 155 LYS B O   
911  C  CB  . LYS B 55  ? 0.5361 0.6094 0.5822 -0.0732 0.0061  -0.0701 155 LYS B CB  
912  C  CG  . LYS B 55  ? 0.6213 0.7034 0.6756 -0.0699 0.0051  -0.0715 155 LYS B CG  
913  C  CD  . LYS B 55  ? 0.7162 0.8123 0.7752 -0.0701 0.0040  -0.0743 155 LYS B CD  
914  C  CE  . LYS B 55  ? 0.7648 0.8739 0.8353 -0.0673 0.0044  -0.0762 155 LYS B CE  
915  N  NZ  . LYS B 55  ? 0.8401 0.9544 0.9142 -0.0686 0.0068  -0.0782 155 LYS B NZ  
916  N  N   . PRO B 56  ? 0.6774 0.7232 0.7055 -0.0778 0.0070  -0.0642 156 PRO B N   
917  C  CA  . PRO B 56  ? 0.7197 0.7591 0.7422 -0.0814 0.0087  -0.0632 156 PRO B CA  
918  C  C   . PRO B 56  ? 0.8126 0.8548 0.8330 -0.0846 0.0101  -0.0661 156 PRO B C   
919  O  O   . PRO B 56  ? 0.8390 0.8869 0.8609 -0.0845 0.0096  -0.0685 156 PRO B O   
920  C  CB  . PRO B 56  ? 0.7482 0.7784 0.7661 -0.0821 0.0088  -0.0617 156 PRO B CB  
921  C  CG  . PRO B 56  ? 0.7204 0.7524 0.7419 -0.0785 0.0069  -0.0614 156 PRO B CG  
922  C  CD  . PRO B 56  ? 0.6832 0.7252 0.7101 -0.0766 0.0058  -0.0637 156 PRO B CD  
923  N  N   . GLU B 57  ? 0.8431 0.8825 0.8599 -0.0877 0.0119  -0.0658 157 GLU B N   
924  C  CA  . GLU B 57  ? 0.8850 0.9246 0.8979 -0.0918 0.0140  -0.0683 157 GLU B CA  
925  C  C   . GLU B 57  ? 0.9103 0.9389 0.9161 -0.0948 0.0159  -0.0678 157 GLU B C   
926  O  O   . GLU B 57  ? 0.8706 0.8912 0.8743 -0.0944 0.0158  -0.0651 157 GLU B O   
927  C  CB  . GLU B 57  ? 0.9009 0.9426 0.9131 -0.0939 0.0155  -0.0686 157 GLU B CB  
928  N  N   . ILE B 58  ? 0.9443 0.9724 0.9462 -0.0984 0.0181  -0.0708 158 ILE B N   
929  C  CA  . ILE B 58  ? 0.9445 0.9615 0.9395 -0.1015 0.0209  -0.0712 158 ILE B CA  
930  C  C   . ILE B 58  ? 0.9177 0.9312 0.9062 -0.1074 0.0251  -0.0738 158 ILE B C   
931  O  O   . ILE B 58  ? 0.8794 0.8809 0.8612 -0.1108 0.0285  -0.0729 158 ILE B O   
932  C  CB  . ILE B 58  ? 0.9282 0.9468 0.9242 -0.1000 0.0200  -0.0727 158 ILE B CB  
933  C  CG1 . ILE B 58  ? 0.9523 0.9855 0.9535 -0.0991 0.0181  -0.0754 158 ILE B CG1 
934  C  CG2 . ILE B 58  ? 0.8807 0.8967 0.8801 -0.0954 0.0173  -0.0699 158 ILE B CG2 
935  C  CD1 . ILE B 58  ? 0.9407 0.9788 0.9387 -0.1042 0.0209  -0.0791 158 ILE B CD1 
936  N  N   . ASN B 65  ? 1.0342 0.9613 0.9937 -0.1042 0.0458  -0.0747 165 ASN B N   
937  C  CA  . ASN B 65  ? 1.0945 1.0180 1.0581 -0.0991 0.0432  -0.0707 165 ASN B CA  
938  C  C   . ASN B 65  ? 1.0956 1.0264 1.0643 -0.0979 0.0387  -0.0671 165 ASN B C   
939  O  O   . ASN B 65  ? 1.1400 1.0597 1.1060 -0.0986 0.0415  -0.0634 165 ASN B O   
940  C  CB  . ASN B 65  ? 1.1957 1.0967 1.1532 -0.0976 0.0504  -0.0680 165 ASN B CB  
941  C  CG  . ASN B 65  ? 1.2567 1.1542 1.2144 -0.0943 0.0514  -0.0693 165 ASN B CG  
942  O  OD1 . ASN B 65  ? 1.2591 1.1703 1.2201 -0.0945 0.0473  -0.0728 165 ASN B OD1 
943  N  ND2 . ASN B 65  ? 1.2674 1.1505 1.2227 -0.0879 0.0561  -0.0637 165 ASN B ND2 
944  N  N   . PHE B 66  ? 1.0130 0.9621 0.9890 -0.0962 0.0321  -0.0680 166 PHE B N   
945  C  CA  . PHE B 66  ? 0.9033 0.8617 0.8848 -0.0948 0.0278  -0.0652 166 PHE B CA  
946  C  C   . PHE B 66  ? 0.8203 0.7797 0.8066 -0.0910 0.0250  -0.0621 166 PHE B C   
947  O  O   . PHE B 66  ? 0.8200 0.7812 0.8084 -0.0870 0.0235  -0.0621 166 PHE B O   
948  C  CB  . PHE B 66  ? 0.8709 0.8468 0.8580 -0.0940 0.0234  -0.0673 166 PHE B CB  
949  C  CG  . PHE B 66  ? 0.8364 0.8219 0.8294 -0.0919 0.0195  -0.0648 166 PHE B CG  
950  C  CD1 . PHE B 66  ? 0.8784 0.8625 0.8696 -0.0945 0.0207  -0.0635 166 PHE B CD1 
951  C  CD2 . PHE B 66  ? 0.8099 0.8057 0.8098 -0.0874 0.0151  -0.0640 166 PHE B CD2 
952  C  CE1 . PHE B 66  ? 0.8355 0.8285 0.8317 -0.0928 0.0177  -0.0615 166 PHE B CE1 
953  C  CE2 . PHE B 66  ? 0.8435 0.8470 0.8483 -0.0856 0.0126  -0.0620 166 PHE B CE2 
954  C  CZ  . PHE B 66  ? 0.8403 0.8426 0.8432 -0.0883 0.0139  -0.0608 166 PHE B CZ  
955  N  N   . THR B 67  ? 0.7233 0.6842 0.7112 -0.0895 0.0238  -0.0573 167 THR B N   
956  C  CA  . THR B 67  ? 0.6856 0.6514 0.6780 -0.0824 0.0206  -0.0514 167 THR B CA  
957  C  C   . THR B 67  ? 0.6879 0.6666 0.6859 -0.0837 0.0167  -0.0515 167 THR B C   
958  O  O   . THR B 67  ? 0.7778 0.7580 0.7748 -0.0886 0.0173  -0.0525 167 THR B O   
959  C  CB  . THR B 67  ? 0.7609 0.7167 0.7495 -0.0780 0.0236  -0.0438 167 THR B CB  
960  O  OG1 . THR B 67  ? 0.7995 0.7424 0.7835 -0.0758 0.0280  -0.0435 167 THR B OG1 
961  C  CG2 . THR B 67  ? 0.7940 0.7582 0.7875 -0.0718 0.0200  -0.0380 167 THR B CG2 
962  N  N   . TYR B 68  ? 0.6387 0.6263 0.6424 -0.0795 0.0131  -0.0507 168 TYR B N   
963  C  CA  . TYR B 68  ? 0.5243 0.5231 0.5332 -0.0806 0.0104  -0.0512 168 TYR B CA  
964  C  C   . TYR B 68  ? 0.5579 0.5608 0.5698 -0.0753 0.0085  -0.0465 168 TYR B C   
965  O  O   . TYR B 68  ? 0.6078 0.6077 0.6195 -0.0703 0.0083  -0.0445 168 TYR B O   
966  C  CB  . TYR B 68  ? 0.5117 0.5188 0.5247 -0.0797 0.0084  -0.0552 168 TYR B CB  
967  C  CG  . TYR B 68  ? 0.5867 0.6033 0.6045 -0.0777 0.0066  -0.0543 168 TYR B CG  
968  C  CD1 . TYR B 68  ? 0.5732 0.5926 0.5906 -0.0795 0.0073  -0.0542 168 TYR B CD1 
969  C  CD2 . TYR B 68  ? 0.5765 0.5984 0.5990 -0.0742 0.0049  -0.0538 168 TYR B CD2 
970  C  CE1 . TYR B 68  ? 0.5477 0.5741 0.5690 -0.0779 0.0066  -0.0538 168 TYR B CE1 
971  C  CE2 . TYR B 68  ? 0.5958 0.6242 0.6219 -0.0727 0.0045  -0.0534 168 TYR B CE2 
972  C  CZ  . TYR B 68  ? 0.6079 0.6383 0.6333 -0.0746 0.0055  -0.0535 168 TYR B CZ  
973  O  OH  . TYR B 68  ? 0.5970 0.6327 0.6257 -0.0735 0.0060  -0.0536 168 TYR B OH  
974  N  N   . ILE B 69  ? 0.5578 0.5681 0.5722 -0.0769 0.0074  -0.0452 169 ILE B N   
975  C  CA  . ILE B 69  ? 0.4859 0.5014 0.5025 -0.0732 0.0060  -0.0414 169 ILE B CA  
976  C  C   . ILE B 69  ? 0.4616 0.4860 0.4836 -0.0742 0.0047  -0.0450 169 ILE B C   
977  O  O   . ILE B 69  ? 0.4828 0.5108 0.5061 -0.0767 0.0050  -0.0471 169 ILE B O   
978  C  CB  . ILE B 69  ? 0.4790 0.4964 0.4932 -0.0741 0.0066  -0.0359 169 ILE B CB  
979  C  CG1 . ILE B 69  ? 0.5775 0.5853 0.5869 -0.0705 0.0085  -0.0306 169 ILE B CG1 
980  C  CG2 . ILE B 69  ? 0.4100 0.4367 0.4270 -0.0726 0.0051  -0.0334 169 ILE B CG2 
981  C  CD1 . ILE B 69  ? 0.6297 0.6400 0.6365 -0.0699 0.0090  -0.0234 169 ILE B CD1 
982  N  N   . ILE B 70  ? 0.3956 0.4219 0.4200 -0.0700 0.0037  -0.0444 170 ILE B N   
983  C  CA  . ILE B 70  ? 0.3330 0.3659 0.3619 -0.0704 0.0035  -0.0470 170 ILE B CA  
984  C  C   . ILE B 70  ? 0.3836 0.4216 0.4121 -0.0713 0.0038  -0.0438 170 ILE B C   
985  O  O   . ILE B 70  ? 0.3420 0.3800 0.3693 -0.0677 0.0032  -0.0401 170 ILE B O   
986  C  CB  . ILE B 70  ? 0.3614 0.3934 0.3925 -0.0658 0.0027  -0.0481 170 ILE B CB  
987  C  CG1 . ILE B 70  ? 0.4160 0.4454 0.4472 -0.0656 0.0023  -0.0512 170 ILE B CG1 
988  C  CG2 . ILE B 70  ? 0.2666 0.3037 0.3017 -0.0657 0.0035  -0.0499 170 ILE B CG2 
989  C  CD1 . ILE B 70  ? 0.3691 0.3981 0.4017 -0.0610 0.0013  -0.0518 170 ILE B CD1 
990  N  N   . ASP B 71  ? 0.3668 0.4091 0.3952 -0.0743 0.0048  -0.0441 171 ASP B N   
991  C  CA  . ASP B 71  ? 0.4522 0.5011 0.4795 -0.0767 0.0051  -0.0414 171 ASP B CA  
992  C  C   . ASP B 71  ? 0.4454 0.4970 0.4739 -0.0753 0.0067  -0.0429 171 ASP B C   
993  O  O   . ASP B 71  ? 0.3576 0.4060 0.3887 -0.0724 0.0075  -0.0456 171 ASP B O   
994  C  CB  . ASP B 71  ? 0.4766 0.5278 0.5008 -0.0805 0.0056  -0.0396 171 ASP B CB  
995  C  CG  . ASP B 71  ? 0.4956 0.5446 0.5197 -0.0798 0.0070  -0.0424 171 ASP B CG  
996  O  OD1 . ASP B 71  ? 0.4677 0.5159 0.4942 -0.0772 0.0082  -0.0450 171 ASP B OD1 
997  O  OD2 . ASP B 71  ? 0.4501 0.4982 0.4717 -0.0824 0.0073  -0.0419 171 ASP B OD2 
998  N  N   . LYS B 72  ? 0.3924 0.4503 0.4188 -0.0779 0.0076  -0.0412 172 LYS B N   
999  C  CA  . LYS B 72  ? 0.3361 0.3956 0.3622 -0.0778 0.0102  -0.0431 172 LYS B CA  
1000 C  C   . LYS B 72  ? 0.3615 0.4194 0.3900 -0.0753 0.0107  -0.0445 172 LYS B C   
1001 O  O   . LYS B 72  ? 0.3656 0.4209 0.3949 -0.0745 0.0136  -0.0473 172 LYS B O   
1002 C  CB  . LYS B 72  ? 0.2894 0.3454 0.3158 -0.0776 0.0125  -0.0461 172 LYS B CB  
1003 C  CG  . LYS B 72  ? 0.3503 0.4096 0.3731 -0.0812 0.0131  -0.0452 172 LYS B CG  
1004 C  CD  . LYS B 72  ? 0.3508 0.4071 0.3743 -0.0810 0.0151  -0.0481 172 LYS B CD  
1005 C  CE  . LYS B 72  ? 0.2987 0.3539 0.3236 -0.0805 0.0190  -0.0517 172 LYS B CE  
1006 N  NZ  . LYS B 72  ? 0.2583 0.3111 0.2857 -0.0797 0.0207  -0.0546 172 LYS B NZ  
1007 N  N   . LEU B 73  ? 0.3419 0.4016 0.3713 -0.0746 0.0085  -0.0425 173 LEU B N   
1008 C  CA  . LEU B 73  ? 0.3999 0.4583 0.4313 -0.0724 0.0088  -0.0437 173 LEU B CA  
1009 C  C   . LEU B 73  ? 0.4585 0.5244 0.4883 -0.0743 0.0095  -0.0420 173 LEU B C   
1010 O  O   . LEU B 73  ? 0.5256 0.5998 0.5535 -0.0770 0.0085  -0.0388 173 LEU B O   
1011 C  CB  . LEU B 73  ? 0.3265 0.3798 0.3589 -0.0677 0.0062  -0.0423 173 LEU B CB  
1012 C  CG  . LEU B 73  ? 0.3457 0.3930 0.3794 -0.0666 0.0056  -0.0445 173 LEU B CG  
1013 C  CD1 . LEU B 73  ? 0.3195 0.3607 0.3519 -0.0612 0.0036  -0.0425 173 LEU B CD1 
1014 C  CD2 . LEU B 73  ? 0.3415 0.3870 0.3783 -0.0662 0.0076  -0.0485 173 LEU B CD2 
1015 N  N   . ILE B 74  ? 0.3592 0.4231 0.3897 -0.0731 0.0112  -0.0440 174 ILE B N   
1016 C  CA  . ILE B 74  ? 0.3725 0.4431 0.4010 -0.0750 0.0125  -0.0432 174 ILE B CA  
1017 C  C   . ILE B 74  ? 0.3930 0.4660 0.4221 -0.0711 0.0100  -0.0399 174 ILE B C   
1018 O  O   . ILE B 74  ? 0.4358 0.5004 0.4656 -0.0654 0.0091  -0.0397 174 ILE B O   
1019 C  CB  . ILE B 74  ? 0.3884 0.4537 0.4159 -0.0753 0.0168  -0.0469 174 ILE B CB  
1020 C  CG1 . ILE B 74  ? 0.4220 0.4815 0.4492 -0.0758 0.0198  -0.0496 174 ILE B CG1 
1021 C  CG2 . ILE B 74  ? 0.3255 0.3976 0.3490 -0.0787 0.0191  -0.0468 174 ILE B CG2 
1022 C  CD1 . ILE B 74  ? 0.4479 0.5125 0.4714 -0.0791 0.0201  -0.0487 174 ILE B CD1 
1023 N  N   . PRO B 75  ? 0.4133 0.4970 0.4408 -0.0725 0.0091  -0.0363 175 PRO B N   
1024 C  CA  . PRO B 75  ? 0.3743 0.4602 0.4016 -0.0669 0.0071  -0.0320 175 PRO B CA  
1025 C  C   . PRO B 75  ? 0.3545 0.4361 0.3817 -0.0655 0.0089  -0.0348 175 PRO B C   
1026 O  O   . PRO B 75  ? 0.3589 0.4389 0.3857 -0.0702 0.0122  -0.0394 175 PRO B O   
1027 C  CB  . PRO B 75  ? 0.3238 0.4257 0.3499 -0.0706 0.0067  -0.0286 175 PRO B CB  
1028 C  CG  . PRO B 75  ? 0.2593 0.3663 0.2846 -0.0774 0.0075  -0.0299 175 PRO B CG  
1029 C  CD  . PRO B 75  ? 0.2854 0.3808 0.3111 -0.0794 0.0101  -0.0360 175 PRO B CD  
1030 N  N   . ASN B 76  ? 0.3916 0.4707 0.4189 -0.0593 0.0072  -0.0320 176 ASN B N   
1031 C  CA  . ASN B 76  ? 0.4126 0.4869 0.4394 -0.0574 0.0087  -0.0341 176 ASN B CA  
1032 C  C   . ASN B 76  ? 0.4032 0.4665 0.4305 -0.0574 0.0106  -0.0384 176 ASN B C   
1033 O  O   . ASN B 76  ? 0.4629 0.5231 0.4892 -0.0586 0.0134  -0.0411 176 ASN B O   
1034 C  CB  . ASN B 76  ? 0.5113 0.5959 0.5367 -0.0621 0.0109  -0.0351 176 ASN B CB  
1035 C  CG  . ASN B 76  ? 0.7481 0.8483 0.7735 -0.0638 0.0093  -0.0308 176 ASN B CG  
1036 O  OD1 . ASN B 76  ? 0.8589 0.9607 0.8854 -0.0583 0.0065  -0.0257 176 ASN B OD1 
1037 N  ND2 . ASN B 76  ? 0.7238 0.8357 0.7477 -0.0717 0.0115  -0.0329 176 ASN B ND2 
1038 N  N   . THR B 77  ? 0.3337 0.3911 0.3624 -0.0560 0.0093  -0.0388 177 THR B N   
1039 C  CA  . THR B 77  ? 0.3517 0.4004 0.3816 -0.0549 0.0108  -0.0420 177 THR B CA  
1040 C  C   . THR B 77  ? 0.3310 0.3732 0.3616 -0.0490 0.0079  -0.0406 177 THR B C   
1041 O  O   . THR B 77  ? 0.3336 0.3761 0.3641 -0.0474 0.0055  -0.0384 177 THR B O   
1042 C  CB  . THR B 77  ? 0.4062 0.4553 0.4376 -0.0594 0.0124  -0.0446 177 THR B CB  
1043 O  OG1 . THR B 77  ? 0.3789 0.4346 0.4090 -0.0661 0.0155  -0.0464 177 THR B OG1 
1044 C  CG2 . THR B 77  ? 0.1779 0.2192 0.2114 -0.0573 0.0142  -0.0473 177 THR B CG2 
1045 N  N   . ASN B 78  ? 0.3171 0.3535 0.3481 -0.0460 0.0086  -0.0419 178 ASN B N   
1046 C  CA  . ASN B 78  ? 0.3307 0.3625 0.3618 -0.0412 0.0061  -0.0410 178 ASN B CA  
1047 C  C   . ASN B 78  ? 0.3412 0.3712 0.3744 -0.0415 0.0056  -0.0427 178 ASN B C   
1048 O  O   . ASN B 78  ? 0.3987 0.4282 0.4340 -0.0424 0.0077  -0.0445 178 ASN B O   
1049 C  CB  . ASN B 78  ? 0.3811 0.4093 0.4112 -0.0379 0.0068  -0.0410 178 ASN B CB  
1050 C  CG  . ASN B 78  ? 0.4640 0.4896 0.4930 -0.0338 0.0042  -0.0398 178 ASN B CG  
1051 O  OD1 . ASN B 78  ? 0.5819 0.6068 0.6112 -0.0334 0.0024  -0.0398 178 ASN B OD1 
1052 N  ND2 . ASN B 78  ? 0.4285 0.4523 0.4558 -0.0313 0.0045  -0.0391 178 ASN B ND2 
1053 N  N   . TYR B 79  ? 0.2691 0.2984 0.3021 -0.0407 0.0032  -0.0421 179 TYR B N   
1054 C  CA  . TYR B 79  ? 0.2577 0.2867 0.2926 -0.0415 0.0026  -0.0440 179 TYR B CA  
1055 C  C   . TYR B 79  ? 0.3309 0.3577 0.3649 -0.0388 0.0006  -0.0442 179 TYR B C   
1056 O  O   . TYR B 79  ? 0.2579 0.2821 0.2891 -0.0372 -0.0003 -0.0429 179 TYR B O   
1057 C  CB  . TYR B 79  ? 0.2609 0.2917 0.2957 -0.0455 0.0025  -0.0442 179 TYR B CB  
1058 C  CG  . TYR B 79  ? 0.3954 0.4301 0.4311 -0.0496 0.0046  -0.0448 179 TYR B CG  
1059 C  CD1 . TYR B 79  ? 0.4169 0.4529 0.4552 -0.0523 0.0064  -0.0476 179 TYR B CD1 
1060 C  CD2 . TYR B 79  ? 0.4010 0.4390 0.4349 -0.0510 0.0050  -0.0427 179 TYR B CD2 
1061 C  CE1 . TYR B 79  ? 0.4076 0.4470 0.4462 -0.0571 0.0090  -0.0488 179 TYR B CE1 
1062 C  CE2 . TYR B 79  ? 0.4234 0.4665 0.4574 -0.0560 0.0071  -0.0437 179 TYR B CE2 
1063 C  CZ  . TYR B 79  ? 0.4588 0.5020 0.4949 -0.0593 0.0093  -0.0469 179 TYR B CZ  
1064 O  OH  . TYR B 79  ? 0.5306 0.5787 0.5664 -0.0651 0.0120  -0.0485 179 TYR B OH  
1065 N  N   . CYS B 80  ? 0.3195 0.3481 0.3558 -0.0384 0.0002  -0.0459 180 CYS B N   
1066 C  CA  . CYS B 80  ? 0.3576 0.3865 0.3929 -0.0374 -0.0016 -0.0468 180 CYS B CA  
1067 C  C   . CYS B 80  ? 0.3518 0.3836 0.3888 -0.0406 -0.0020 -0.0491 180 CYS B C   
1068 O  O   . CYS B 80  ? 0.3125 0.3474 0.3529 -0.0417 -0.0009 -0.0500 180 CYS B O   
1069 C  CB  . CYS B 80  ? 0.2994 0.3306 0.3359 -0.0337 -0.0021 -0.0463 180 CYS B CB  
1070 S  SG  . CYS B 80  ? 0.5201 0.5477 0.5538 -0.0304 -0.0018 -0.0440 180 CYS B SG  
1071 N  N   . VAL B 81  ? 0.2858 0.3161 0.3200 -0.0424 -0.0029 -0.0503 181 VAL B N   
1072 C  CA  . VAL B 81  ? 0.3164 0.3490 0.3510 -0.0463 -0.0029 -0.0529 181 VAL B CA  
1073 C  C   . VAL B 81  ? 0.4097 0.4466 0.4438 -0.0467 -0.0042 -0.0550 181 VAL B C   
1074 O  O   . VAL B 81  ? 0.4277 0.4626 0.4587 -0.0454 -0.0047 -0.0548 181 VAL B O   
1075 C  CB  . VAL B 81  ? 0.3440 0.3707 0.3750 -0.0495 -0.0019 -0.0527 181 VAL B CB  
1076 C  CG1 . VAL B 81  ? 0.1535 0.1822 0.1845 -0.0544 -0.0016 -0.0558 181 VAL B CG1 
1077 C  CG2 . VAL B 81  ? 0.2817 0.3068 0.3131 -0.0493 -0.0010 -0.0500 181 VAL B CG2 
1078 N  N   . SER B 82  ? 0.4525 0.4964 0.4895 -0.0488 -0.0046 -0.0572 182 SER B N   
1079 C  CA  . SER B 82  ? 0.4509 0.5019 0.4875 -0.0504 -0.0059 -0.0596 182 SER B CA  
1080 C  C   . SER B 82  ? 0.4451 0.4978 0.4811 -0.0562 -0.0051 -0.0631 182 SER B C   
1081 O  O   . SER B 82  ? 0.4913 0.5428 0.5293 -0.0577 -0.0041 -0.0632 182 SER B O   
1082 C  CB  . SER B 82  ? 0.4489 0.5103 0.4908 -0.0463 -0.0071 -0.0584 182 SER B CB  
1083 O  OG  . SER B 82  ? 0.4605 0.5313 0.5018 -0.0475 -0.0088 -0.0600 182 SER B OG  
1084 N  N   . VAL B 83  ? 0.4205 0.4757 0.4531 -0.0602 -0.0052 -0.0662 183 VAL B N   
1085 C  CA  . VAL B 83  ? 0.4695 0.5249 0.5000 -0.0661 -0.0039 -0.0694 183 VAL B CA  
1086 C  C   . VAL B 83  ? 0.5804 0.6479 0.6113 -0.0681 -0.0048 -0.0718 183 VAL B C   
1087 O  O   . VAL B 83  ? 0.7224 0.7925 0.7503 -0.0691 -0.0054 -0.0731 183 VAL B O   
1088 C  CB  . VAL B 83  ? 0.4942 0.5364 0.5172 -0.0688 -0.0012 -0.0696 183 VAL B CB  
1089 C  CG1 . VAL B 83  ? 0.5911 0.6321 0.6102 -0.0731 0.0011  -0.0710 183 VAL B CG1 
1090 C  CG2 . VAL B 83  ? 0.4792 0.5114 0.5020 -0.0673 -0.0002 -0.0671 183 VAL B CG2 
1091 N  N   . TYR B 84  ? 0.5313 0.6070 0.5655 -0.0690 -0.0049 -0.0723 184 TYR B N   
1092 C  CA  . TYR B 84  ? 0.5006 0.5901 0.5355 -0.0711 -0.0058 -0.0744 184 TYR B CA  
1093 C  C   . TYR B 84  ? 0.5184 0.6118 0.5534 -0.0739 -0.0042 -0.0757 184 TYR B C   
1094 O  O   . TYR B 84  ? 0.4828 0.5669 0.5165 -0.0746 -0.0022 -0.0748 184 TYR B O   
1095 C  CB  . TYR B 84  ? 0.5129 0.6184 0.5556 -0.0672 -0.0092 -0.0739 184 TYR B CB  
1096 C  CG  . TYR B 84  ? 0.5177 0.6251 0.5682 -0.0624 -0.0093 -0.0716 184 TYR B CG  
1097 C  CD1 . TYR B 84  ? 0.4950 0.5909 0.5456 -0.0574 -0.0086 -0.0679 184 TYR B CD1 
1098 C  CD2 . TYR B 84  ? 0.4810 0.6007 0.5380 -0.0621 -0.0094 -0.0724 184 TYR B CD2 
1099 C  CE1 . TYR B 84  ? 0.5066 0.6021 0.5629 -0.0530 -0.0074 -0.0655 184 TYR B CE1 
1100 C  CE2 . TYR B 84  ? 0.5147 0.6337 0.5780 -0.0569 -0.0082 -0.0697 184 TYR B CE2 
1101 C  CZ  . TYR B 84  ? 0.5292 0.6355 0.5918 -0.0527 -0.0070 -0.0665 184 TYR B CZ  
1102 O  OH  . TYR B 84  ? 0.5109 0.6156 0.5790 -0.0486 -0.0048 -0.0645 184 TYR B OH  
1103 N  N   . LEU B 85  ? 0.5117 0.6199 0.5481 -0.0757 -0.0051 -0.0775 185 LEU B N   
1104 C  CA  . LEU B 85  ? 0.5395 0.6528 0.5751 -0.0792 -0.0033 -0.0794 185 LEU B CA  
1105 C  C   . LEU B 85  ? 0.6288 0.7620 0.6728 -0.0772 -0.0054 -0.0797 185 LEU B C   
1106 O  O   . LEU B 85  ? 0.6741 0.8225 0.7207 -0.0762 -0.0077 -0.0798 185 LEU B O   
1107 C  CB  . LEU B 85  ? 0.4955 0.6075 0.5231 -0.0850 -0.0009 -0.0821 185 LEU B CB  
1108 C  CG  . LEU B 85  ? 0.4839 0.5761 0.5037 -0.0875 0.0024  -0.0820 185 LEU B CG  
1109 C  CD1 . LEU B 85  ? 0.4726 0.5637 0.4850 -0.0931 0.0053  -0.0851 185 LEU B CD1 
1110 C  CD2 . LEU B 85  ? 0.4929 0.5765 0.5116 -0.0886 0.0047  -0.0814 185 LEU B CD2 
1111 N  N   . GLU B 86  ? 0.6617 0.7956 0.7098 -0.0764 -0.0044 -0.0797 186 GLU B N   
1112 C  CA  . GLU B 86  ? 0.7379 0.8906 0.7954 -0.0738 -0.0058 -0.0799 186 GLU B CA  
1113 C  C   . GLU B 86  ? 0.7952 0.9517 0.8519 -0.0774 -0.0036 -0.0822 186 GLU B C   
1114 O  O   . GLU B 86  ? 0.8020 0.9444 0.8528 -0.0806 -0.0008 -0.0829 186 GLU B O   
1115 C  CB  . GLU B 86  ? 0.8029 0.9559 0.8696 -0.0684 -0.0065 -0.0780 186 GLU B CB  
1116 C  CG  . GLU B 86  ? 0.8615 0.9991 0.9264 -0.0694 -0.0036 -0.0780 186 GLU B CG  
1117 C  CD  . GLU B 86  ? 0.8672 1.0087 0.9423 -0.0652 -0.0029 -0.0774 186 GLU B CD  
1118 O  OE1 . GLU B 86  ? 0.8469 0.9932 0.9285 -0.0606 -0.0042 -0.0757 186 GLU B OE1 
1119 O  OE2 . GLU B 86  ? 0.8703 1.0097 0.9468 -0.0664 -0.0005 -0.0784 186 GLU B OE2 
1120 N  N   . HIS B 87  ? 0.8654 1.0421 0.9284 -0.0764 -0.0048 -0.0830 187 HIS B N   
1121 C  CA  . HIS B 87  ? 0.9155 1.0988 0.9800 -0.0787 -0.0029 -0.0852 187 HIS B CA  
1122 C  C   . HIS B 87  ? 1.1015 1.2918 1.1772 -0.0737 -0.0029 -0.0843 187 HIS B C   
1123 O  O   . HIS B 87  ? 1.0462 1.2347 1.1225 -0.0756 -0.0006 -0.0860 187 HIS B O   
1124 C  CB  . HIS B 87  ? 0.8745 1.0762 0.9380 -0.0814 -0.0036 -0.0870 187 HIS B CB  
1125 N  N   . SER B 88  ? 1.1201 1.3184 1.2051 -0.0674 -0.0049 -0.0815 188 SER B N   
1126 C  CA  . SER B 88  ? 1.1030 1.3080 1.2005 -0.0618 -0.0038 -0.0803 188 SER B CA  
1127 C  C   . SER B 88  ? 1.0968 1.2995 1.2001 -0.0562 -0.0047 -0.0773 188 SER B C   
1128 O  O   . SER B 88  ? 1.1004 1.2972 1.1975 -0.0570 -0.0068 -0.0763 188 SER B O   
1129 C  CB  . SER B 88  ? 1.0959 1.3252 1.2034 -0.0577 -0.0043 -0.0793 188 SER B CB  
1130 N  N   . ASP B 89  ? 1.0960 1.2964 1.2068 -0.0485 -0.0018 -0.0739 189 ASP B N   
1131 C  CA  . ASP B 89  ? 1.0719 1.2603 1.1821 -0.0405 -0.0010 -0.0683 189 ASP B CA  
1132 C  C   . ASP B 89  ? 1.0340 1.2353 1.1519 -0.0296 -0.0009 -0.0619 189 ASP B C   
1133 O  O   . ASP B 89  ? 1.0036 1.2232 1.1294 -0.0265 -0.0007 -0.0611 189 ASP B O   
1134 C  CB  . ASP B 89  ? 1.0434 1.2133 1.1531 -0.0404 0.0033  -0.0688 189 ASP B CB  
1135 N  N   . GLN B 91  ? 0.6204 0.8716 0.7465 -0.0204 -0.0085 -0.0540 191 GLN B N   
1136 C  CA  . GLN B 91  ? 0.6916 0.9496 0.8100 -0.0308 -0.0125 -0.0591 191 GLN B CA  
1137 C  C   . GLN B 91  ? 0.7796 1.0269 0.8895 -0.0311 -0.0148 -0.0572 191 GLN B C   
1138 O  O   . GLN B 91  ? 0.8983 1.1256 1.0055 -0.0275 -0.0129 -0.0549 191 GLN B O   
1139 C  CB  . GLN B 91  ? 0.6767 0.9241 0.7902 -0.0419 -0.0112 -0.0671 191 GLN B CB  
1140 N  N   . ALA B 92  ? 0.6733 0.9346 0.7790 -0.0358 -0.0185 -0.0586 192 ALA B N   
1141 C  CA  . ALA B 92  ? 0.6356 0.8881 0.7332 -0.0367 -0.0205 -0.0573 192 ALA B CA  
1142 C  C   . ALA B 92  ? 0.5947 0.8291 0.6819 -0.0472 -0.0199 -0.0640 192 ALA B C   
1143 O  O   . ALA B 92  ? 0.5773 0.8104 0.6595 -0.0555 -0.0188 -0.0694 192 ALA B O   
1144 C  CB  . ALA B 92  ? 0.6420 0.9182 0.7397 -0.0361 -0.0243 -0.0548 192 ALA B CB  
1145 N  N   . VAL B 93  ? 0.5397 0.7552 0.6214 -0.0453 -0.0194 -0.0622 193 VAL B N   
1146 C  CA  . VAL B 93  ? 0.4835 0.6807 0.5557 -0.0531 -0.0185 -0.0671 193 VAL B CA  
1147 C  C   . VAL B 93  ? 0.5304 0.7203 0.5967 -0.0511 -0.0197 -0.0645 193 VAL B C   
1148 O  O   . VAL B 93  ? 0.5741 0.7669 0.6437 -0.0426 -0.0206 -0.0584 193 VAL B O   
1149 C  CB  . VAL B 93  ? 0.5056 0.6822 0.5775 -0.0531 -0.0154 -0.0679 193 VAL B CB  
1150 C  CG1 . VAL B 93  ? 0.4510 0.6337 0.5283 -0.0555 -0.0138 -0.0707 193 VAL B CG1 
1151 C  CG2 . VAL B 93  ? 0.5165 0.6828 0.5914 -0.0437 -0.0143 -0.0620 193 VAL B CG2 
1152 N  N   . ILE B 94  ? 0.5303 0.7107 0.5879 -0.0589 -0.0192 -0.0692 194 ILE B N   
1153 C  CA  . ILE B 94  ? 0.4964 0.6669 0.5479 -0.0578 -0.0196 -0.0677 194 ILE B CA  
1154 C  C   . ILE B 94  ? 0.5233 0.6695 0.5706 -0.0583 -0.0170 -0.0684 194 ILE B C   
1155 O  O   . ILE B 94  ? 0.5549 0.6919 0.5981 -0.0651 -0.0149 -0.0730 194 ILE B O   
1156 C  CB  . ILE B 94  ? 0.5209 0.6991 0.5652 -0.0660 -0.0203 -0.0722 194 ILE B CB  
1157 C  CG1 . ILE B 94  ? 0.5399 0.7429 0.5874 -0.0644 -0.0230 -0.0698 194 ILE B CG1 
1158 C  CG2 . ILE B 94  ? 0.3916 0.5561 0.4289 -0.0659 -0.0198 -0.0718 194 ILE B CG2 
1159 C  CD1 . ILE B 94  ? 0.5313 0.7382 0.5704 -0.0719 -0.0209 -0.0733 194 ILE B CD1 
1160 N  N   . LYS B 95  ? 0.4728 0.6092 0.5209 -0.0512 -0.0168 -0.0636 195 LYS B N   
1161 C  CA  . LYS B 95  ? 0.4958 0.6126 0.5414 -0.0509 -0.0146 -0.0636 195 LYS B CA  
1162 C  C   . LYS B 95  ? 0.4521 0.5576 0.4901 -0.0535 -0.0139 -0.0648 195 LYS B C   
1163 O  O   . LYS B 95  ? 0.4082 0.5189 0.4436 -0.0528 -0.0153 -0.0640 195 LYS B O   
1164 C  CB  . LYS B 95  ? 0.5625 0.6741 0.6132 -0.0429 -0.0138 -0.0585 195 LYS B CB  
1165 C  CG  . LYS B 95  ? 0.5808 0.6998 0.6391 -0.0406 -0.0130 -0.0578 195 LYS B CG  
1166 C  CD  . LYS B 95  ? 0.6147 0.7214 0.6752 -0.0374 -0.0103 -0.0560 195 LYS B CD  
1167 C  CE  . LYS B 95  ? 0.6939 0.8045 0.7606 -0.0293 -0.0091 -0.0512 195 LYS B CE  
1168 N  NZ  . LYS B 95  ? 0.7132 0.8262 0.7864 -0.0282 -0.0065 -0.0517 195 LYS B NZ  
1169 N  N   . SER B 96  ? 0.4467 0.5373 0.4810 -0.0564 -0.0116 -0.0666 196 SER B N   
1170 C  CA  . SER B 96  ? 0.4726 0.5516 0.5002 -0.0580 -0.0102 -0.0675 196 SER B CA  
1171 C  C   . SER B 96  ? 0.5071 0.5812 0.5357 -0.0511 -0.0109 -0.0627 196 SER B C   
1172 O  O   . SER B 96  ? 0.5020 0.5772 0.5357 -0.0459 -0.0114 -0.0592 196 SER B O   
1173 C  CB  . SER B 96  ? 0.4134 0.4779 0.4373 -0.0616 -0.0073 -0.0693 196 SER B CB  
1174 O  OG  . SER B 96  ? 0.4288 0.4860 0.4557 -0.0571 -0.0069 -0.0657 196 SER B OG  
1175 N  N   . PRO B 97  ? 0.4302 0.4987 0.4536 -0.0513 -0.0104 -0.0630 197 PRO B N   
1176 C  CA  . PRO B 97  ? 0.3911 0.4523 0.4149 -0.0455 -0.0103 -0.0590 197 PRO B CA  
1177 C  C   . PRO B 97  ? 0.3745 0.4254 0.3999 -0.0441 -0.0087 -0.0575 197 PRO B C   
1178 O  O   . PRO B 97  ? 0.3439 0.3891 0.3675 -0.0480 -0.0070 -0.0597 197 PRO B O   
1179 C  CB  . PRO B 97  ? 0.2705 0.3251 0.2879 -0.0476 -0.0090 -0.0607 197 PRO B CB  
1180 C  CG  . PRO B 97  ? 0.2379 0.3026 0.2527 -0.0530 -0.0097 -0.0645 197 PRO B CG  
1181 C  CD  . PRO B 97  ? 0.2551 0.3260 0.2728 -0.0566 -0.0098 -0.0668 197 PRO B CD  
1182 N  N   . LEU B 98  ? 0.3398 0.3890 0.3681 -0.0391 -0.0089 -0.0539 198 LEU B N   
1183 C  CA  . LEU B 98  ? 0.3505 0.3920 0.3800 -0.0382 -0.0073 -0.0524 198 LEU B CA  
1184 C  C   . LEU B 98  ? 0.4387 0.4703 0.4637 -0.0389 -0.0059 -0.0524 198 LEU B C   
1185 O  O   . LEU B 98  ? 0.4656 0.4950 0.4876 -0.0377 -0.0058 -0.0521 198 LEU B O   
1186 C  CB  . LEU B 98  ? 0.2743 0.3163 0.3070 -0.0334 -0.0071 -0.0491 198 LEU B CB  
1187 C  CG  . LEU B 98  ? 0.3273 0.3777 0.3650 -0.0316 -0.0076 -0.0485 198 LEU B CG  
1188 C  CD1 . LEU B 98  ? 0.2751 0.3245 0.3148 -0.0265 -0.0065 -0.0451 198 LEU B CD1 
1189 C  CD2 . LEU B 98  ? 0.4260 0.4767 0.4667 -0.0344 -0.0065 -0.0502 198 LEU B CD2 
1190 N  N   . LYS B 99  ? 0.4276 0.4539 0.4524 -0.0407 -0.0045 -0.0523 199 LYS B N   
1191 C  CA  . LYS B 99  ? 0.4209 0.4389 0.4427 -0.0399 -0.0028 -0.0507 199 LYS B CA  
1192 C  C   . LYS B 99  ? 0.3843 0.4022 0.4087 -0.0377 -0.0026 -0.0477 199 LYS B C   
1193 O  O   . LYS B 99  ? 0.3860 0.4063 0.4129 -0.0393 -0.0026 -0.0477 199 LYS B O   
1194 C  CB  . LYS B 99  ? 0.4105 0.4224 0.4290 -0.0435 -0.0008 -0.0522 199 LYS B CB  
1195 C  CG  . LYS B 99  ? 0.4398 0.4463 0.4535 -0.0447 0.0009  -0.0543 199 LYS B CG  
1196 C  CD  . LYS B 99  ? 0.4755 0.4760 0.4854 -0.0495 0.0037  -0.0570 199 LYS B CD  
1197 C  CE  . LYS B 99  ? 0.4918 0.4936 0.4980 -0.0537 0.0046  -0.0617 199 LYS B CE  
1198 N  NZ  . LYS B 99  ? 0.5465 0.5364 0.5468 -0.0552 0.0092  -0.0631 199 LYS B NZ  
1199 N  N   . CYS B 100 ? 0.3624 0.3781 0.3858 -0.0347 -0.0022 -0.0455 200 CYS B N   
1200 C  CA  . CYS B 100 ? 0.3662 0.3837 0.3918 -0.0334 -0.0019 -0.0433 200 CYS B CA  
1201 C  C   . CYS B 100 ? 0.4162 0.4313 0.4406 -0.0326 -0.0008 -0.0407 200 CYS B C   
1202 O  O   . CYS B 100 ? 0.4479 0.4585 0.4696 -0.0311 0.0000  -0.0400 200 CYS B O   
1203 C  CB  . CYS B 100 ? 0.3290 0.3485 0.3553 -0.0307 -0.0022 -0.0428 200 CYS B CB  
1204 S  SG  . CYS B 100 ? 0.4959 0.5202 0.5244 -0.0301 -0.0034 -0.0442 200 CYS B SG  
1205 N  N   . THR B 101 ? 0.3195 0.3380 0.3457 -0.0336 -0.0004 -0.0393 201 THR B N   
1206 C  CA  . THR B 101 ? 0.3495 0.3689 0.3749 -0.0328 0.0003  -0.0362 201 THR B CA  
1207 C  C   . THR B 101 ? 0.3802 0.4058 0.4072 -0.0344 0.0008  -0.0353 201 THR B C   
1208 O  O   . THR B 101 ? 0.3797 0.4077 0.4084 -0.0373 0.0013  -0.0372 201 THR B O   
1209 C  CB  . THR B 101 ? 0.4409 0.4579 0.4652 -0.0338 0.0009  -0.0347 201 THR B CB  
1210 O  OG1 . THR B 101 ? 0.5517 0.5701 0.5754 -0.0315 0.0017  -0.0305 201 THR B OG1 
1211 C  CG2 . THR B 101 ? 0.3372 0.3575 0.3630 -0.0380 0.0006  -0.0357 201 THR B CG2 
1212 N  N   . LEU B 102 ? 0.3385 0.3672 0.3650 -0.0329 0.0013  -0.0327 202 LEU B N   
1213 C  CA  . LEU B 102 ? 0.3966 0.4326 0.4239 -0.0353 0.0021  -0.0321 202 LEU B CA  
1214 C  C   . LEU B 102 ? 0.4255 0.4672 0.4529 -0.0365 0.0020  -0.0288 202 LEU B C   
1215 O  O   . LEU B 102 ? 0.4616 0.5036 0.4884 -0.0330 0.0018  -0.0252 202 LEU B O   
1216 C  CB  . LEU B 102 ? 0.3478 0.3857 0.3744 -0.0333 0.0027  -0.0315 202 LEU B CB  
1217 C  CG  . LEU B 102 ? 0.3505 0.3971 0.3773 -0.0367 0.0041  -0.0312 202 LEU B CG  
1218 C  CD1 . LEU B 102 ? 0.3331 0.3790 0.3602 -0.0411 0.0059  -0.0348 202 LEU B CD1 
1219 C  CD2 . LEU B 102 ? 0.2461 0.2954 0.2719 -0.0347 0.0048  -0.0305 202 LEU B CD2 
1220 N  N   . LEU B 103 ? 0.3802 0.4264 0.4083 -0.0412 0.0023  -0.0296 203 LEU B N   
1221 C  CA  . LEU B 103 ? 0.3327 0.3857 0.3606 -0.0428 0.0020  -0.0261 203 LEU B CA  
1222 C  C   . LEU B 103 ? 0.3609 0.4243 0.3888 -0.0426 0.0022  -0.0230 203 LEU B C   
1223 O  O   . LEU B 103 ? 0.3715 0.4390 0.3995 -0.0450 0.0033  -0.0253 203 LEU B O   
1224 C  CB  . LEU B 103 ? 0.3318 0.3881 0.3601 -0.0488 0.0026  -0.0284 203 LEU B CB  
1225 C  CG  . LEU B 103 ? 0.3207 0.3691 0.3497 -0.0497 0.0026  -0.0320 203 LEU B CG  
1226 C  CD1 . LEU B 103 ? 0.2713 0.3243 0.3007 -0.0557 0.0034  -0.0336 203 LEU B CD1 
1227 C  CD2 . LEU B 103 ? 0.2432 0.2841 0.2711 -0.0460 0.0015  -0.0303 203 LEU B CD2 
1228 N  N   . PRO B 104 ? 0.3912 0.4591 0.4190 -0.0397 0.0016  -0.0175 204 PRO B N   
1229 C  CA  . PRO B 104 ? 0.4392 0.5201 0.4675 -0.0388 0.0014  -0.0132 204 PRO B CA  
1230 C  C   . PRO B 104 ? 0.5020 0.5962 0.5302 -0.0460 0.0017  -0.0139 204 PRO B C   
1231 O  O   . PRO B 104 ? 0.4839 0.5764 0.5115 -0.0509 0.0019  -0.0166 204 PRO B O   
1232 C  CB  . PRO B 104 ? 0.4469 0.5275 0.4752 -0.0337 0.0011  -0.0065 204 PRO B CB  
1233 C  CG  . PRO B 104 ? 0.4622 0.5276 0.4893 -0.0323 0.0015  -0.0084 204 PRO B CG  
1234 C  CD  . PRO B 104 ? 0.4278 0.4892 0.4548 -0.0378 0.0013  -0.0150 204 PRO B CD  
1235 N  N   . PRO B 105 ? 0.6038 0.7119 0.6323 -0.0472 0.0018  -0.0119 205 PRO B N   
1236 C  CA  . PRO B 105 ? 0.6070 0.7306 0.6348 -0.0548 0.0022  -0.0123 205 PRO B CA  
1237 C  C   . PRO B 105 ? 0.6662 0.7972 0.6939 -0.0550 0.0008  -0.0068 205 PRO B C   
1238 O  O   . PRO B 105 ? 0.6940 0.8337 0.7205 -0.0622 0.0011  -0.0080 205 PRO B O   
1239 C  CB  . PRO B 105 ? 0.6036 0.7412 0.6320 -0.0545 0.0024  -0.0104 205 PRO B CB  
1240 C  CG  . PRO B 105 ? 0.5839 0.7104 0.6130 -0.0481 0.0027  -0.0112 205 PRO B CG  
1241 C  CD  . PRO B 105 ? 0.6013 0.7122 0.6308 -0.0420 0.0018  -0.0097 205 PRO B CD  
1242 O  OXT . PRO B 105 ? 0.7144 0.8421 0.7428 -0.0480 -0.0003 -0.0008 205 PRO B OXT 
1243 N  N   . SER C 6   ? 0.7909 0.8510 0.7545 -0.0479 0.0429  -0.0567 106 SER C N   
1244 C  CA  . SER C 6   ? 0.8110 0.8776 0.7746 -0.0476 0.0441  -0.0586 106 SER C CA  
1245 C  C   . SER C 6   ? 0.8842 0.9662 0.8566 -0.0436 0.0430  -0.0585 106 SER C C   
1246 O  O   . SER C 6   ? 0.9704 1.0601 0.9440 -0.0431 0.0446  -0.0602 106 SER C O   
1247 C  CB  . SER C 6   ? 0.7716 0.8274 0.7313 -0.0445 0.0429  -0.0580 106 SER C CB  
1248 N  N   . PHE C 7   ? 0.8270 0.9138 0.8057 -0.0405 0.0407  -0.0563 107 PHE C N   
1249 C  CA  . PHE C 7   ? 0.8111 0.9112 0.7984 -0.0352 0.0396  -0.0547 107 PHE C CA  
1250 C  C   . PHE C 7   ? 0.7779 0.8916 0.7702 -0.0365 0.0390  -0.0532 107 PHE C C   
1251 O  O   . PHE C 7   ? 0.7839 0.8960 0.7728 -0.0422 0.0395  -0.0541 107 PHE C O   
1252 C  CB  . PHE C 7   ? 0.8503 0.9420 0.8410 -0.0278 0.0372  -0.0525 107 PHE C CB  
1253 C  CG  . PHE C 7   ? 0.9168 1.0140 0.9120 -0.0226 0.0386  -0.0527 107 PHE C CG  
1254 C  CD1 . PHE C 7   ? 0.9667 1.0531 0.9590 -0.0205 0.0391  -0.0541 107 PHE C CD1 
1255 C  CD2 . PHE C 7   ? 0.9212 1.0353 0.9234 -0.0199 0.0398  -0.0514 107 PHE C CD2 
1256 C  CE1 . PHE C 7   ? 1.0453 1.1357 1.0416 -0.0159 0.0414  -0.0547 107 PHE C CE1 
1257 C  CE2 . PHE C 7   ? 0.9737 1.0923 0.9804 -0.0144 0.0418  -0.0512 107 PHE C CE2 
1258 C  CZ  . PHE C 7   ? 1.0521 1.1580 1.0558 -0.0124 0.0430  -0.0532 107 PHE C CZ  
1259 N  N   . GLU C 8   ? 0.7460 0.8732 0.7463 -0.0311 0.0382  -0.0508 108 GLU C N   
1260 C  CA  . GLU C 8   ? 0.7607 0.9043 0.7665 -0.0317 0.0373  -0.0486 108 GLU C CA  
1261 C  C   . GLU C 8   ? 0.6464 0.7831 0.6534 -0.0303 0.0345  -0.0460 108 GLU C C   
1262 O  O   . GLU C 8   ? 0.6585 0.7809 0.6654 -0.0256 0.0328  -0.0447 108 GLU C O   
1263 C  CB  . GLU C 8   ? 0.8455 1.0054 0.8599 -0.0247 0.0374  -0.0455 108 GLU C CB  
1264 C  CG  . GLU C 8   ? 0.9524 1.1181 0.9669 -0.0242 0.0403  -0.0479 108 GLU C CG  
1265 C  CD  . GLU C 8   ? 1.0387 1.2219 1.0518 -0.0318 0.0425  -0.0506 108 GLU C CD  
1266 O  OE1 . GLU C 8   ? 1.0855 1.2841 1.1029 -0.0297 0.0443  -0.0506 108 GLU C OE1 
1267 O  OE2 . GLU C 8   ? 1.0444 1.2260 1.0519 -0.0402 0.0429  -0.0531 108 GLU C OE2 
1268 N  N   . PRO C 9   ? 0.5183 0.6661 0.5264 -0.0349 0.0342  -0.0456 109 PRO C N   
1269 C  CA  . PRO C 9   ? 0.4754 0.6191 0.4850 -0.0343 0.0318  -0.0433 109 PRO C CA  
1270 C  C   . PRO C 9   ? 0.4127 0.5569 0.4291 -0.0249 0.0293  -0.0384 109 PRO C C   
1271 O  O   . PRO C 9   ? 0.4449 0.6025 0.4670 -0.0200 0.0296  -0.0358 109 PRO C O   
1272 C  CB  . PRO C 9   ? 0.4964 0.6586 0.5070 -0.0409 0.0326  -0.0438 109 PRO C CB  
1273 C  CG  . PRO C 9   ? 0.5138 0.6841 0.5205 -0.0476 0.0361  -0.0480 109 PRO C CG  
1274 C  CD  . PRO C 9   ? 0.4961 0.6626 0.5039 -0.0416 0.0365  -0.0477 109 PRO C CD  
1275 N  N   . PRO C 10  ? 0.3950 0.5250 0.4109 -0.0223 0.0272  -0.0371 110 PRO C N   
1276 C  CA  . PRO C 10  ? 0.4075 0.5384 0.4295 -0.0144 0.0255  -0.0325 110 PRO C CA  
1277 C  C   . PRO C 10  ? 0.4642 0.6146 0.4913 -0.0144 0.0247  -0.0289 110 PRO C C   
1278 O  O   . PRO C 10  ? 0.4606 0.6214 0.4859 -0.0218 0.0250  -0.0308 110 PRO C O   
1279 C  CB  . PRO C 10  ? 0.3833 0.4976 0.4028 -0.0143 0.0235  -0.0326 110 PRO C CB  
1280 C  CG  . PRO C 10  ? 0.3922 0.4956 0.4046 -0.0206 0.0243  -0.0369 110 PRO C CG  
1281 C  CD  . PRO C 10  ? 0.3966 0.5114 0.4069 -0.0267 0.0267  -0.0394 110 PRO C CD  
1282 N  N   . GLU C 11  ? 0.5130 0.6687 0.5462 -0.0066 0.0239  -0.0237 111 GLU C N   
1283 C  CA  . GLU C 11  ? 0.5398 0.7123 0.5775 -0.0063 0.0225  -0.0192 111 GLU C CA  
1284 C  C   . GLU C 11  ? 0.5242 0.6872 0.5590 -0.0104 0.0204  -0.0199 111 GLU C C   
1285 O  O   . GLU C 11  ? 0.5040 0.6476 0.5356 -0.0097 0.0199  -0.0218 111 GLU C O   
1286 C  CB  . GLU C 11  ? 0.6464 0.8234 0.6909 0.0041  0.0227  -0.0126 111 GLU C CB  
1287 C  CG  . GLU C 11  ? 0.7930 0.9914 0.8432 0.0081  0.0242  -0.0093 111 GLU C CG  
1288 C  CD  . GLU C 11  ? 0.9240 1.1215 0.9805 0.0199  0.0257  -0.0028 111 GLU C CD  
1289 O  OE1 . GLU C 11  ? 0.9514 1.1379 1.0082 0.0248  0.0285  -0.0042 111 GLU C OE1 
1290 O  OE2 . GLU C 11  ? 0.9383 1.1451 0.9991 0.0242  0.0245  0.0037  111 GLU C OE2 
1291 N  N   . PHE C 12  ? 0.5317 0.7094 0.5676 -0.0149 0.0193  -0.0184 112 PHE C N   
1292 C  CA  . PHE C 12  ? 0.4903 0.6602 0.5242 -0.0183 0.0176  -0.0187 112 PHE C CA  
1293 C  C   . PHE C 12  ? 0.4802 0.6696 0.5170 -0.0209 0.0163  -0.0152 112 PHE C C   
1294 O  O   . PHE C 12  ? 0.4971 0.7076 0.5355 -0.0242 0.0170  -0.0147 112 PHE C O   
1295 C  CB  . PHE C 12  ? 0.4452 0.6037 0.4725 -0.0267 0.0188  -0.0251 112 PHE C CB  
1296 C  CG  . PHE C 12  ? 0.4271 0.6002 0.4520 -0.0362 0.0205  -0.0282 112 PHE C CG  
1297 C  CD1 . PHE C 12  ? 0.4440 0.6204 0.4673 -0.0428 0.0204  -0.0293 112 PHE C CD1 
1298 C  CD2 . PHE C 12  ? 0.4181 0.6022 0.4422 -0.0391 0.0227  -0.0303 112 PHE C CD2 
1299 C  CE1 . PHE C 12  ? 0.4546 0.6444 0.4750 -0.0527 0.0228  -0.0329 112 PHE C CE1 
1300 C  CE2 . PHE C 12  ? 0.4246 0.6226 0.4458 -0.0490 0.0249  -0.0339 112 PHE C CE2 
1301 C  CZ  . PHE C 12  ? 0.4216 0.6222 0.4408 -0.0561 0.0252  -0.0353 112 PHE C CZ  
1302 N  N   . GLU C 13  ? 0.3878 0.5711 0.4251 -0.0199 0.0145  -0.0129 113 GLU C N   
1303 C  CA  . GLU C 13  ? 0.3922 0.5920 0.4312 -0.0234 0.0131  -0.0099 113 GLU C CA  
1304 C  C   . GLU C 13  ? 0.4502 0.6378 0.4849 -0.0302 0.0128  -0.0140 113 GLU C C   
1305 O  O   . GLU C 13  ? 0.4737 0.6403 0.5058 -0.0288 0.0129  -0.0166 113 GLU C O   
1306 C  CB  . GLU C 13  ? 0.3312 0.5372 0.3758 -0.0140 0.0115  -0.0016 113 GLU C CB  
1307 N  N   . ILE C 14  ? 0.4155 0.6170 0.4492 -0.0379 0.0127  -0.0147 114 ILE C N   
1308 C  CA  . ILE C 14  ? 0.4628 0.6538 0.4930 -0.0441 0.0129  -0.0181 114 ILE C CA  
1309 C  C   . ILE C 14  ? 0.5124 0.7155 0.5449 -0.0449 0.0108  -0.0137 114 ILE C C   
1310 O  O   . ILE C 14  ? 0.5273 0.7532 0.5625 -0.0455 0.0100  -0.0096 114 ILE C O   
1311 C  CB  . ILE C 14  ? 0.3270 0.5184 0.3518 -0.0555 0.0163  -0.0255 114 ILE C CB  
1312 C  CG1 . ILE C 14  ? 0.3540 0.5717 0.3790 -0.0632 0.0172  -0.0256 114 ILE C CG1 
1313 C  CG2 . ILE C 14  ? 0.1943 0.3733 0.2161 -0.0551 0.0186  -0.0295 114 ILE C CG2 
1314 C  CD1 . ILE C 14  ? 0.3273 0.5433 0.3451 -0.0750 0.0214  -0.0333 114 ILE C CD1 
1315 N  N   . VAL C 15  ? 0.4587 0.6477 0.4900 -0.0450 0.0101  -0.0144 115 VAL C N   
1316 C  CA  . VAL C 15  ? 0.4588 0.6584 0.4910 -0.0480 0.0086  -0.0114 115 VAL C CA  
1317 C  C   . VAL C 15  ? 0.4198 0.6106 0.4480 -0.0570 0.0103  -0.0176 115 VAL C C   
1318 O  O   . VAL C 15  ? 0.4213 0.5915 0.4476 -0.0560 0.0110  -0.0210 115 VAL C O   
1319 C  CB  . VAL C 15  ? 0.5042 0.7001 0.5401 -0.0383 0.0060  -0.0040 115 VAL C CB  
1320 C  CG1 . VAL C 15  ? 0.5543 0.7270 0.5901 -0.0310 0.0061  -0.0049 115 VAL C CG1 
1321 C  CG2 . VAL C 15  ? 0.4425 0.6405 0.4777 -0.0420 0.0048  -0.0027 115 VAL C CG2 
1322 N  N   . GLY C 16  ? 0.4142 0.6216 0.4408 -0.0660 0.0112  -0.0190 116 GLY C N   
1323 C  CA  . GLY C 16  ? 0.4560 0.6564 0.4786 -0.0756 0.0141  -0.0255 116 GLY C CA  
1324 C  C   . GLY C 16  ? 0.5201 0.7189 0.5431 -0.0761 0.0124  -0.0234 116 GLY C C   
1325 O  O   . GLY C 16  ? 0.4673 0.6807 0.4921 -0.0741 0.0096  -0.0175 116 GLY C O   
1326 N  N   . PHE C 17  ? 0.6514 0.8324 0.6727 -0.0784 0.0141  -0.0280 117 PHE C N   
1327 C  CA  . PHE C 17  ? 0.7121 0.8900 0.7325 -0.0802 0.0132  -0.0274 117 PHE C CA  
1328 C  C   . PHE C 17  ? 0.7516 0.9190 0.7633 -0.0869 0.0170  -0.0338 117 PHE C C   
1329 O  O   . PHE C 17  ? 0.8142 0.9778 0.8207 -0.0904 0.0203  -0.0384 117 PHE C O   
1330 C  CB  . PHE C 17  ? 0.6727 0.8329 0.6959 -0.0728 0.0112  -0.0258 117 PHE C CB  
1331 C  CG  . PHE C 17  ? 0.6614 0.8215 0.6878 -0.0623 0.0078  -0.0189 117 PHE C CG  
1332 C  CD1 . PHE C 17  ? 0.6123 0.7819 0.6408 -0.0589 0.0051  -0.0122 117 PHE C CD1 
1333 C  CD2 . PHE C 17  ? 0.6330 0.7835 0.6600 -0.0559 0.0078  -0.0189 117 PHE C CD2 
1334 C  CE1 . PHE C 17  ? 0.5706 0.7385 0.6018 -0.0489 0.0031  -0.0057 117 PHE C CE1 
1335 C  CE2 . PHE C 17  ? 0.5617 0.7112 0.5914 -0.0466 0.0056  -0.0131 117 PHE C CE2 
1336 C  CZ  . PHE C 17  ? 0.5727 0.7303 0.6047 -0.0428 0.0036  -0.0065 117 PHE C CZ  
1337 N  N   . THR C 18  ? 0.7563 0.9186 0.7664 -0.0885 0.0169  -0.0343 118 THR C N   
1338 C  CA  . THR C 18  ? 0.8008 0.9542 0.8031 -0.0942 0.0210  -0.0402 118 THR C CA  
1339 C  C   . THR C 18  ? 0.7217 0.8585 0.7221 -0.0953 0.0257  -0.0462 118 THR C C   
1340 O  O   . THR C 18  ? 0.6675 0.8017 0.6607 -0.1003 0.0299  -0.0511 118 THR C O   
1341 C  CB  . THR C 18  ? 0.8430 0.9914 0.8452 -0.0947 0.0205  -0.0399 118 THR C CB  
1342 O  OG1 . THR C 18  ? 0.8781 1.0407 0.8833 -0.0928 0.0160  -0.0333 118 THR C OG1 
1343 C  CG2 . THR C 18  ? 0.8369 0.9822 0.8304 -0.1009 0.0245  -0.0451 118 THR C CG2 
1344 N  N   . ASN C 19  ? 0.6487 0.7745 0.6550 -0.0910 0.0253  -0.0460 119 ASN C N   
1345 C  CA  . ASN C 19  ? 0.6361 0.7463 0.6409 -0.0916 0.0300  -0.0508 119 ASN C CA  
1346 C  C   . ASN C 19  ? 0.6670 0.7739 0.6766 -0.0880 0.0292  -0.0500 119 ASN C C   
1347 O  O   . ASN C 19  ? 0.6453 0.7395 0.6542 -0.0882 0.0329  -0.0533 119 ASN C O   
1348 C  CB  . ASN C 19  ? 0.6567 0.7532 0.6624 -0.0910 0.0319  -0.0530 119 ASN C CB  
1349 C  CG  . ASN C 19  ? 0.7181 0.8168 0.7185 -0.0950 0.0337  -0.0547 119 ASN C CG  
1350 O  OD1 . ASN C 19  ? 0.7860 0.8845 0.7793 -0.0999 0.0379  -0.0587 119 ASN C OD1 
1351 N  ND2 . ASN C 19  ? 0.6460 0.7465 0.6491 -0.0933 0.0305  -0.0521 119 ASN C ND2 
1352 N  N   . HIS C 20  ? 0.6670 0.7857 0.6815 -0.0846 0.0247  -0.0455 120 HIS C N   
1353 C  CA  . HIS C 20  ? 0.6296 0.7403 0.6447 -0.0768 0.0231  -0.0436 120 HIS C CA  
1354 C  C   . HIS C 20  ? 0.5811 0.7066 0.5975 -0.0742 0.0205  -0.0396 120 HIS C C   
1355 O  O   . HIS C 20  ? 0.5724 0.7150 0.5899 -0.0768 0.0189  -0.0369 120 HIS C O   
1356 C  CB  . HIS C 20  ? 0.6330 0.7305 0.6507 -0.0683 0.0197  -0.0409 120 HIS C CB  
1357 C  CG  . HIS C 20  ? 0.6726 0.7773 0.6935 -0.0630 0.0149  -0.0354 120 HIS C CG  
1358 N  ND1 . HIS C 20  ? 0.6570 0.7670 0.6791 -0.0651 0.0136  -0.0338 120 HIS C ND1 
1359 C  CD2 . HIS C 20  ? 0.6935 0.7999 0.7163 -0.0558 0.0119  -0.0309 120 HIS C CD2 
1360 C  CE1 . HIS C 20  ? 0.6685 0.7825 0.6929 -0.0591 0.0100  -0.0283 120 HIS C CE1 
1361 N  NE2 . HIS C 20  ? 0.7003 0.8119 0.7253 -0.0532 0.0092  -0.0265 120 HIS C NE2 
1362 N  N   . ILE C 21  ? 0.4771 0.5963 0.4932 -0.0690 0.0202  -0.0391 121 ILE C N   
1363 C  CA  . ILE C 21  ? 0.4643 0.5954 0.4822 -0.0651 0.0181  -0.0354 121 ILE C CA  
1364 C  C   . ILE C 21  ? 0.4656 0.5854 0.4854 -0.0552 0.0154  -0.0324 121 ILE C C   
1365 O  O   . ILE C 21  ? 0.3831 0.4877 0.4010 -0.0534 0.0165  -0.0349 121 ILE C O   
1366 C  CB  . ILE C 21  ? 0.4472 0.5847 0.4619 -0.0706 0.0216  -0.0389 121 ILE C CB  
1367 C  CG1 . ILE C 21  ? 0.4006 0.5527 0.4130 -0.0816 0.0247  -0.0422 121 ILE C CG1 
1368 C  CG2 . ILE C 21  ? 0.4788 0.6269 0.4959 -0.0651 0.0194  -0.0350 121 ILE C CG2 
1369 C  CD1 . ILE C 21  ? 0.3405 0.4973 0.3480 -0.0873 0.0285  -0.0460 121 ILE C CD1 
1370 N  N   . ASN C 22  ? 0.4817 0.6089 0.5050 -0.0490 0.0123  -0.0270 122 ASN C N   
1371 C  CA  . ASN C 22  ? 0.4888 0.6070 0.5136 -0.0404 0.0108  -0.0245 122 ASN C CA  
1372 C  C   . ASN C 22  ? 0.4919 0.6174 0.5167 -0.0390 0.0118  -0.0243 122 ASN C C   
1373 O  O   . ASN C 22  ? 0.5727 0.7159 0.5994 -0.0401 0.0118  -0.0219 122 ASN C O   
1374 C  CB  . ASN C 22  ? 0.5300 0.6496 0.5582 -0.0339 0.0082  -0.0189 122 ASN C CB  
1375 C  CG  . ASN C 22  ? 0.6138 0.7224 0.6416 -0.0342 0.0073  -0.0195 122 ASN C CG  
1376 O  OD1 . ASN C 22  ? 0.7161 0.8126 0.7418 -0.0364 0.0081  -0.0237 122 ASN C OD1 
1377 N  ND2 . ASN C 22  ? 0.5903 0.7036 0.6202 -0.0319 0.0057  -0.0149 122 ASN C ND2 
1378 N  N   . VAL C 23  ? 0.3897 0.5027 0.4125 -0.0367 0.0127  -0.0268 123 VAL C N   
1379 C  CA  . VAL C 23  ? 0.4265 0.5447 0.4492 -0.0350 0.0138  -0.0268 123 VAL C CA  
1380 C  C   . VAL C 23  ? 0.4328 0.5432 0.4576 -0.0262 0.0125  -0.0240 123 VAL C C   
1381 O  O   . VAL C 23  ? 0.4395 0.5347 0.4628 -0.0239 0.0120  -0.0254 123 VAL C O   
1382 C  CB  . VAL C 23  ? 0.4177 0.5282 0.4357 -0.0399 0.0166  -0.0320 123 VAL C CB  
1383 C  CG1 . VAL C 23  ? 0.3681 0.4853 0.3855 -0.0392 0.0180  -0.0324 123 VAL C CG1 
1384 C  CG2 . VAL C 23  ? 0.3561 0.4706 0.3714 -0.0490 0.0191  -0.0354 123 VAL C CG2 
1385 N  N   . MSE C 24  ? 0.4354 0.5572 0.4638 -0.0216 0.0122  -0.0200 124 MSE C N   
1386 C  CA  . MSE C 24  ? 0.4724 0.5866 0.5026 -0.0135 0.0122  -0.0176 124 MSE C CA  
1387 C  C   . MSE C 24  ? 0.5110 0.6292 0.5409 -0.0124 0.0140  -0.0190 124 MSE C C   
1388 O  O   . MSE C 24  ? 0.5606 0.6956 0.5929 -0.0129 0.0146  -0.0173 124 MSE C O   
1389 C  CB  . MSE C 24  ? 0.5349 0.6569 0.5698 -0.0073 0.0115  -0.0112 124 MSE C CB  
1390 C  CG  . MSE C 24  ? 0.6649 0.7779 0.6998 -0.0064 0.0102  -0.0095 124 MSE C CG  
1391 SE SE  . MSE C 24  ? 1.1676 1.2920 1.2020 -0.0145 0.0085  -0.0095 124 MSE C SE  
1392 C  CE  . MSE C 24  ? 0.7795 0.9326 0.8176 -0.0149 0.0086  -0.0049 124 MSE C CE  
1393 N  N   . VAL C 25  ? 0.4664 0.5707 0.4934 -0.0112 0.0147  -0.0221 125 VAL C N   
1394 C  CA  . VAL C 25  ? 0.4721 0.5792 0.4986 -0.0099 0.0166  -0.0234 125 VAL C CA  
1395 C  C   . VAL C 25  ? 0.5041 0.6042 0.5327 -0.0022 0.0175  -0.0215 125 VAL C C   
1396 O  O   . VAL C 25  ? 0.4850 0.5715 0.5126 0.0002  0.0171  -0.0216 125 VAL C O   
1397 C  CB  . VAL C 25  ? 0.4559 0.5547 0.4769 -0.0152 0.0175  -0.0284 125 VAL C CB  
1398 C  CG1 . VAL C 25  ? 0.4644 0.5683 0.4830 -0.0230 0.0179  -0.0306 125 VAL C CG1 
1399 C  CG2 . VAL C 25  ? 0.4945 0.5755 0.5126 -0.0136 0.0167  -0.0300 125 VAL C CG2 
1400 N  N   . LYS C 26  ? 0.5689 0.6789 0.6004 0.0013  0.0193  -0.0199 126 LYS C N   
1401 C  CA  . LYS C 26  ? 0.6194 0.7224 0.6526 0.0082  0.0216  -0.0189 126 LYS C CA  
1402 C  C   . LYS C 26  ? 0.5783 0.6782 0.6084 0.0064  0.0233  -0.0232 126 LYS C C   
1403 O  O   . LYS C 26  ? 0.5240 0.6361 0.5544 0.0039  0.0240  -0.0241 126 LYS C O   
1404 C  CB  . LYS C 26  ? 0.7037 0.8195 0.7434 0.0153  0.0230  -0.0129 126 LYS C CB  
1405 C  CG  . LYS C 26  ? 0.8492 0.9555 0.8908 0.0231  0.0266  -0.0116 126 LYS C CG  
1406 C  CD  . LYS C 26  ? 0.9759 1.0964 1.0245 0.0310  0.0288  -0.0051 126 LYS C CD  
1407 C  CE  . LYS C 26  ? 1.0562 1.1636 1.1068 0.0395  0.0331  -0.0025 126 LYS C CE  
1408 N  NZ  . LYS C 26  ? 1.0727 1.1811 1.1268 0.0452  0.0334  0.0045  126 LYS C NZ  
1409 N  N   . PHE C 27  ? 0.5920 0.6759 0.6185 0.0070  0.0240  -0.0260 127 PHE C N   
1410 C  CA  . PHE C 27  ? 0.6835 0.7635 0.7071 0.0065  0.0261  -0.0296 127 PHE C CA  
1411 C  C   . PHE C 27  ? 0.8228 0.8999 0.8497 0.0135  0.0295  -0.0281 127 PHE C C   
1412 O  O   . PHE C 27  ? 0.8567 0.9272 0.8857 0.0179  0.0303  -0.0256 127 PHE C O   
1413 C  CB  . PHE C 27  ? 0.6628 0.7282 0.6801 0.0025  0.0250  -0.0335 127 PHE C CB  
1414 C  CG  . PHE C 27  ? 0.6140 0.6800 0.6275 -0.0039 0.0228  -0.0351 127 PHE C CG  
1415 C  CD1 . PHE C 27  ? 0.5448 0.6141 0.5548 -0.0080 0.0239  -0.0377 127 PHE C CD1 
1416 C  CD2 . PHE C 27  ? 0.6143 0.6768 0.6276 -0.0058 0.0205  -0.0343 127 PHE C CD2 
1417 C  CE1 . PHE C 27  ? 0.5217 0.5893 0.5277 -0.0137 0.0231  -0.0391 127 PHE C CE1 
1418 C  CE2 . PHE C 27  ? 0.5383 0.6000 0.5481 -0.0113 0.0196  -0.0358 127 PHE C CE2 
1419 C  CZ  . PHE C 27  ? 0.5204 0.5841 0.5265 -0.0151 0.0211  -0.0381 127 PHE C CZ  
1420 N  N   . PRO C 28  ? 0.8971 0.9783 0.9243 0.0145  0.0322  -0.0298 128 PRO C N   
1421 C  CA  . PRO C 28  ? 0.9111 0.9885 0.9412 0.0211  0.0366  -0.0291 128 PRO C CA  
1422 C  C   . PRO C 28  ? 0.9412 1.0000 0.9674 0.0214  0.0381  -0.0317 128 PRO C C   
1423 O  O   . PRO C 28  ? 0.9611 1.0117 0.9822 0.0163  0.0352  -0.0343 128 PRO C O   
1424 C  CB  . PRO C 28  ? 0.8743 0.9575 0.9031 0.0192  0.0386  -0.0324 128 PRO C CB  
1425 C  CG  . PRO C 28  ? 0.8570 0.9539 0.8853 0.0139  0.0357  -0.0324 128 PRO C CG  
1426 C  CD  . PRO C 28  ? 0.8628 0.9533 0.8877 0.0094  0.0319  -0.0324 128 PRO C CD  
1427 N  N   . PHE C 37  ? 0.9870 1.0092 0.9348 -0.0342 0.0335  -0.0530 137 PHE C N   
1428 C  CA  . PHE C 37  ? 1.0005 1.0160 0.9455 -0.0333 0.0310  -0.0495 137 PHE C CA  
1429 C  C   . PHE C 37  ? 1.0478 1.0636 0.9993 -0.0304 0.0288  -0.0481 137 PHE C C   
1430 O  O   . PHE C 37  ? 1.0852 1.1060 1.0430 -0.0286 0.0287  -0.0497 137 PHE C O   
1431 C  CB  . PHE C 37  ? 0.9652 0.9752 0.9036 -0.0361 0.0331  -0.0472 137 PHE C CB  
1432 N  N   . ASP C 38  ? 1.0338 1.0444 0.9838 -0.0297 0.0272  -0.0449 138 ASP C N   
1433 C  CA  . ASP C 38  ? 0.9841 0.9948 0.9399 -0.0272 0.0251  -0.0436 138 ASP C CA  
1434 C  C   . ASP C 38  ? 0.8996 0.9120 0.8584 -0.0287 0.0271  -0.0438 138 ASP C C   
1435 O  O   . ASP C 38  ? 0.9035 0.9118 0.8583 -0.0311 0.0296  -0.0428 138 ASP C O   
1436 C  CB  . ASP C 38  ? 0.9943 1.0000 0.9480 -0.0256 0.0228  -0.0401 138 ASP C CB  
1437 N  N   . LEU C 39  ? 0.8286 0.8468 0.7939 -0.0274 0.0263  -0.0450 139 LEU C N   
1438 C  CA  . LEU C 39  ? 0.7182 0.7411 0.6865 -0.0294 0.0280  -0.0455 139 LEU C CA  
1439 C  C   . LEU C 39  ? 0.7344 0.7563 0.7068 -0.0283 0.0263  -0.0439 139 LEU C C   
1440 O  O   . LEU C 39  ? 0.7813 0.8032 0.7575 -0.0250 0.0235  -0.0431 139 LEU C O   
1441 C  CB  . LEU C 39  ? 0.6202 0.6533 0.5928 -0.0291 0.0289  -0.0474 139 LEU C CB  
1442 C  CG  . LEU C 39  ? 0.6274 0.6635 0.5962 -0.0317 0.0317  -0.0496 139 LEU C CG  
1443 C  CD1 . LEU C 39  ? 0.5801 0.6274 0.5544 -0.0300 0.0325  -0.0510 139 LEU C CD1 
1444 C  CD2 . LEU C 39  ? 0.6685 0.7031 0.6322 -0.0372 0.0350  -0.0503 139 LEU C CD2 
1445 N  N   . SER C 40  ? 0.6829 0.7038 0.6541 -0.0316 0.0286  -0.0439 140 SER C N   
1446 C  CA  . SER C 40  ? 0.5950 0.6152 0.5697 -0.0313 0.0277  -0.0428 140 SER C CA  
1447 C  C   . SER C 40  ? 0.5847 0.6152 0.5640 -0.0334 0.0283  -0.0441 140 SER C C   
1448 O  O   . SER C 40  ? 0.5928 0.6298 0.5708 -0.0371 0.0310  -0.0460 140 SER C O   
1449 C  CB  . SER C 40  ? 0.6250 0.6362 0.5953 -0.0335 0.0305  -0.0419 140 SER C CB  
1450 O  OG  . SER C 40  ? 0.6770 0.6805 0.6450 -0.0300 0.0288  -0.0392 140 SER C OG  
1451 N  N   . LEU C 41  ? 0.5340 0.5670 0.5183 -0.0315 0.0259  -0.0430 141 LEU C N   
1452 C  CA  . LEU C 41  ? 0.4547 0.4982 0.4432 -0.0336 0.0263  -0.0435 141 LEU C CA  
1453 C  C   . LEU C 41  ? 0.5037 0.5449 0.4899 -0.0389 0.0292  -0.0446 141 LEU C C   
1454 O  O   . LEU C 41  ? 0.5909 0.6231 0.5762 -0.0383 0.0291  -0.0438 141 LEU C O   
1455 C  CB  . LEU C 41  ? 0.4269 0.4739 0.4213 -0.0293 0.0228  -0.0415 141 LEU C CB  
1456 C  CG  . LEU C 41  ? 0.3936 0.4511 0.3920 -0.0315 0.0228  -0.0410 141 LEU C CG  
1457 C  CD1 . LEU C 41  ? 0.3482 0.4193 0.3474 -0.0342 0.0247  -0.0419 141 LEU C CD1 
1458 C  CD2 . LEU C 41  ? 0.3798 0.4392 0.3835 -0.0267 0.0196  -0.0385 141 LEU C CD2 
1459 N  N   . VAL C 42  ? 0.4023 0.4523 0.3876 -0.0444 0.0322  -0.0467 142 VAL C N   
1460 C  CA  . VAL C 42  ? 0.3960 0.4446 0.3789 -0.0506 0.0358  -0.0486 142 VAL C CA  
1461 C  C   . VAL C 42  ? 0.4471 0.5106 0.4346 -0.0535 0.0351  -0.0490 142 VAL C C   
1462 O  O   . VAL C 42  ? 0.4241 0.5017 0.4142 -0.0537 0.0342  -0.0489 142 VAL C O   
1463 C  CB  . VAL C 42  ? 0.4025 0.4478 0.3788 -0.0567 0.0414  -0.0515 142 VAL C CB  
1464 C  CG1 . VAL C 42  ? 0.4531 0.4946 0.4261 -0.0638 0.0465  -0.0541 142 VAL C CG1 
1465 C  CG2 . VAL C 42  ? 0.3393 0.3711 0.3110 -0.0533 0.0419  -0.0502 142 VAL C CG2 
1466 N  N   . ILE C 43  ? 0.4319 0.4929 0.4204 -0.0555 0.0354  -0.0492 143 ILE C N   
1467 C  CA  . ILE C 43  ? 0.4339 0.5089 0.4259 -0.0591 0.0349  -0.0495 143 ILE C CA  
1468 C  C   . ILE C 43  ? 0.4643 0.5382 0.4518 -0.0682 0.0405  -0.0535 143 ILE C C   
1469 O  O   . ILE C 43  ? 0.4817 0.5436 0.4675 -0.0693 0.0427  -0.0543 143 ILE C O   
1470 C  CB  . ILE C 43  ? 0.4200 0.4940 0.4170 -0.0543 0.0307  -0.0466 143 ILE C CB  
1471 C  CG1 . ILE C 43  ? 0.4356 0.5112 0.4367 -0.0461 0.0261  -0.0431 143 ILE C CG1 
1472 C  CG2 . ILE C 43  ? 0.3774 0.4651 0.3769 -0.0591 0.0307  -0.0469 143 ILE C CG2 
1473 C  CD1 . ILE C 43  ? 0.3943 0.4620 0.3983 -0.0410 0.0228  -0.0408 143 ILE C CD1 
1474 N  N   . GLU C 44  ? 0.4324 0.5190 0.4180 -0.0751 0.0434  -0.0562 144 GLU C N   
1475 C  CA  . GLU C 44  ? 0.4106 0.4971 0.3908 -0.0856 0.0500  -0.0611 144 GLU C CA  
1476 C  C   . GLU C 44  ? 0.4749 0.5744 0.4579 -0.0907 0.0497  -0.0619 144 GLU C C   
1477 O  O   . GLU C 44  ? 0.4321 0.5511 0.4195 -0.0905 0.0461  -0.0601 144 GLU C O   
1478 C  CB  . GLU C 44  ? 0.3660 0.4615 0.3422 -0.0916 0.0536  -0.0642 144 GLU C CB  
1479 C  CG  . GLU C 44  ? 0.4751 0.5690 0.4449 -0.1026 0.0596  -0.0696 144 GLU C CG  
1480 C  CD  . GLU C 44  ? 0.5963 0.6883 0.5610 -0.1061 0.0617  -0.0722 144 GLU C CD  
1481 O  OE1 . GLU C 44  ? 0.6450 0.7285 0.6078 -0.1021 0.0635  -0.0709 144 GLU C OE1 
1482 O  OE2 . GLU C 44  ? 0.5048 0.6037 0.4668 -0.1131 0.0616  -0.0757 144 GLU C OE2 
1483 N  N   . GLU C 45  ? 0.5259 0.6149 0.5062 -0.0952 0.0537  -0.0644 145 GLU C N   
1484 C  CA  . GLU C 45  ? 0.5228 0.6214 0.5042 -0.1005 0.0535  -0.0658 145 GLU C CA  
1485 C  C   . GLU C 45  ? 0.5538 0.6472 0.5265 -0.1084 0.0572  -0.0714 145 GLU C C   
1486 O  O   . GLU C 45  ? 0.5444 0.6203 0.5118 -0.1109 0.0630  -0.0744 145 GLU C O   
1487 C  CB  . GLU C 45  ? 0.5966 0.6830 0.5808 -0.0968 0.0529  -0.0643 145 GLU C CB  
1488 C  CG  . GLU C 45  ? 0.6610 0.7529 0.6448 -0.1013 0.0526  -0.0659 145 GLU C CG  
1489 C  CD  . GLU C 45  ? 0.7150 0.7895 0.6977 -0.1017 0.0566  -0.0676 145 GLU C CD  
1490 O  OE1 . GLU C 45  ? 0.6628 0.7266 0.6494 -0.0946 0.0547  -0.0645 145 GLU C OE1 
1491 O  OE2 . GLU C 45  ? 0.8003 0.8692 0.7765 -0.1067 0.0603  -0.0718 145 GLU C OE2 
1492 N  N   . GLN C 46  ? 0.5979 0.7064 0.5687 -0.1123 0.0541  -0.0727 146 GLN C N   
1493 C  CA  . GLN C 46  ? 0.6310 0.7352 0.5932 -0.1206 0.0576  -0.0789 146 GLN C CA  
1494 C  C   . GLN C 46  ? 0.6110 0.7260 0.5711 -0.1241 0.0553  -0.0801 146 GLN C C   
1495 O  O   . GLN C 46  ? 0.5443 0.6784 0.5081 -0.1220 0.0497  -0.0764 146 GLN C O   
1496 C  CB  . GLN C 46  ? 0.6328 0.7425 0.5912 -0.1252 0.0582  -0.0818 146 GLN C CB  
1497 C  CG  . GLN C 46  ? 0.6341 0.7662 0.5975 -0.1221 0.0524  -0.0779 146 GLN C CG  
1498 C  CD  . GLN C 46  ? 0.6186 0.7514 0.5805 -0.1236 0.0536  -0.0794 146 GLN C CD  
1499 O  OE1 . GLN C 46  ? 0.6304 0.7674 0.5870 -0.1309 0.0547  -0.0841 146 GLN C OE1 
1500 N  NE2 . GLN C 46  ? 0.5157 0.6448 0.4822 -0.1169 0.0535  -0.0756 146 GLN C NE2 
1501 N  N   . SER C 47  ? 0.6585 0.7607 0.6125 -0.1290 0.0600  -0.0852 147 SER C N   
1502 C  CA  . SER C 47  ? 0.6956 0.8062 0.6450 -0.1340 0.0592  -0.0880 147 SER C CA  
1503 C  C   . SER C 47  ? 0.7220 0.8168 0.6656 -0.1395 0.0662  -0.0931 147 SER C C   
1504 O  O   . SER C 47  ? 0.6576 0.7326 0.6001 -0.1386 0.0719  -0.0947 147 SER C O   
1505 C  CB  . SER C 47  ? 0.7404 0.8536 0.6950 -0.1290 0.0563  -0.0835 147 SER C CB  
1506 O  OG  . SER C 47  ? 0.7938 0.8873 0.7493 -0.1266 0.0608  -0.0843 147 SER C OG  
1507 N  N   . GLU C 48  ? 0.7939 0.8978 0.7341 -0.1450 0.0660  -0.0952 148 GLU C N   
1508 C  CA  . GLU C 48  ? 0.7783 0.8692 0.7130 -0.1506 0.0727  -0.1002 148 GLU C CA  
1509 C  C   . GLU C 48  ? 0.7783 0.8552 0.7100 -0.1530 0.0783  -0.1031 148 GLU C C   
1510 O  O   . GLU C 48  ? 0.8154 0.8738 0.7436 -0.1548 0.0854  -0.1062 148 GLU C O   
1511 C  CB  . GLU C 48  ? 0.6897 0.7659 0.6245 -0.1485 0.0765  -0.1009 148 GLU C CB  
1512 N  N   . GLY C 49  ? 0.7287 0.8143 0.6615 -0.1530 0.0753  -0.1020 149 GLY C N   
1513 C  CA  . GLY C 49  ? 0.7675 0.8403 0.6974 -0.1552 0.0803  -0.1043 149 GLY C CA  
1514 C  C   . GLY C 49  ? 0.7703 0.8217 0.7009 -0.1502 0.0849  -0.1030 149 GLY C C   
1515 O  O   . GLY C 49  ? 0.8216 0.8559 0.7480 -0.1523 0.0917  -0.1053 149 GLY C O   
1516 N  N   . ILE C 50  ? 0.7022 0.7546 0.6379 -0.1438 0.0815  -0.0992 150 ILE C N   
1517 C  CA  . ILE C 50  ? 0.6821 0.7164 0.6191 -0.1386 0.0853  -0.0973 150 ILE C CA  
1518 C  C   . ILE C 50  ? 0.6831 0.7267 0.6255 -0.1334 0.0796  -0.0934 150 ILE C C   
1519 O  O   . ILE C 50  ? 0.6721 0.7328 0.6200 -0.1302 0.0731  -0.0898 150 ILE C O   
1520 C  CB  . ILE C 50  ? 0.8924 0.9148 0.8306 -0.1354 0.0885  -0.0969 150 ILE C CB  
1521 C  CG1 . ILE C 50  ? 0.8835 0.8878 0.8165 -0.1385 0.0972  -0.1002 150 ILE C CG1 
1522 C  CG2 . ILE C 50  ? 0.8820 0.8950 0.8244 -0.1285 0.0888  -0.0933 150 ILE C CG2 
1523 C  CD1 . ILE C 50  ? 0.8631 0.8754 0.7922 -0.1454 0.0976  -0.1042 150 ILE C CD1 
1524 N  N   . VAL C 51  ? 0.6440 0.6767 0.5868 -0.1305 0.0824  -0.0912 151 VAL C N   
1525 C  CA  . VAL C 51  ? 0.5551 0.5955 0.5043 -0.1235 0.0780  -0.0852 151 VAL C CA  
1526 C  C   . VAL C 51  ? 0.6018 0.6273 0.5540 -0.1165 0.0809  -0.0809 151 VAL C C   
1527 O  O   . VAL C 51  ? 0.6997 0.7063 0.6474 -0.1162 0.0875  -0.0813 151 VAL C O   
1528 C  CB  . VAL C 51  ? 0.5273 0.5686 0.4739 -0.1254 0.0787  -0.0858 151 VAL C CB  
1529 C  CG1 . VAL C 51  ? 0.4723 0.5194 0.4243 -0.1176 0.0753  -0.0801 151 VAL C CG1 
1530 C  CG2 . VAL C 51  ? 0.4360 0.4941 0.3804 -0.1325 0.0756  -0.0899 151 VAL C CG2 
1531 N  N   . LYS C 52  ? 0.6053 0.6392 0.5648 -0.1108 0.0762  -0.0767 152 LYS C N   
1532 C  CA  . LYS C 52  ? 0.6294 0.6516 0.5922 -0.1033 0.0773  -0.0724 152 LYS C CA  
1533 C  C   . LYS C 52  ? 0.6051 0.6339 0.5716 -0.0948 0.0693  -0.0678 152 LYS C C   
1534 O  O   . LYS C 52  ? 0.6167 0.6635 0.5866 -0.0955 0.0645  -0.0674 152 LYS C O   
1535 C  CB  . LYS C 52  ? 0.6867 0.7095 0.6552 -0.1002 0.0740  -0.0708 152 LYS C CB  
1536 C  CG  . LYS C 52  ? 0.8325 0.8395 0.7983 -0.1033 0.0818  -0.0734 152 LYS C CG  
1537 C  CD  . LYS C 52  ? 0.9502 0.9620 0.9218 -0.1021 0.0784  -0.0728 152 LYS C CD  
1538 C  CE  . LYS C 52  ? 1.0068 1.0042 0.9750 -0.1045 0.0853  -0.0760 152 LYS C CE  
1539 N  NZ  . LYS C 52  ? 1.0333 1.0188 1.0067 -0.0970 0.0854  -0.0722 152 LYS C NZ  
1540 N  N   . LYS C 53  ? 0.6410 0.6561 0.6069 -0.0867 0.0679  -0.0642 153 LYS C N   
1541 C  CA  . LYS C 53  ? 0.6498 0.6699 0.6187 -0.0790 0.0609  -0.0603 153 LYS C CA  
1542 C  C   . LYS C 53  ? 0.6686 0.6839 0.6428 -0.0694 0.0547  -0.0557 153 LYS C C   
1543 O  O   . LYS C 53  ? 0.7005 0.7024 0.6740 -0.0663 0.0567  -0.0543 153 LYS C O   
1544 C  CB  . LYS C 53  ? 0.6933 0.7043 0.6561 -0.0787 0.0642  -0.0602 153 LYS C CB  
1545 C  CG  . LYS C 53  ? 0.7783 0.8029 0.7399 -0.0824 0.0635  -0.0621 153 LYS C CG  
1546 C  CD  . LYS C 53  ? 0.8261 0.8421 0.7794 -0.0875 0.0704  -0.0646 153 LYS C CD  
1547 C  CE  . LYS C 53  ? 0.8694 0.9014 0.8208 -0.0970 0.0732  -0.0694 153 LYS C CE  
1548 N  NZ  . LYS C 53  ? 0.9169 0.9405 0.8599 -0.1040 0.0803  -0.0728 153 LYS C NZ  
1549 N  N   . HIS C 54  ? 0.6215 0.6479 0.6011 -0.0648 0.0477  -0.0534 154 HIS C N   
1550 C  CA  . HIS C 54  ? 0.5757 0.5978 0.5597 -0.0566 0.0422  -0.0497 154 HIS C CA  
1551 C  C   . HIS C 54  ? 0.5803 0.6012 0.5641 -0.0505 0.0385  -0.0472 154 HIS C C   
1552 O  O   . HIS C 54  ? 0.6309 0.6617 0.6159 -0.0503 0.0363  -0.0473 154 HIS C O   
1553 C  CB  . HIS C 54  ? 0.5866 0.6195 0.5765 -0.0559 0.0378  -0.0489 154 HIS C CB  
1554 C  CG  . HIS C 54  ? 0.7035 0.7381 0.6936 -0.0620 0.0412  -0.0514 154 HIS C CG  
1555 N  ND1 . HIS C 54  ? 0.7690 0.7929 0.7593 -0.0612 0.0432  -0.0515 154 HIS C ND1 
1556 C  CD2 . HIS C 54  ? 0.7440 0.7907 0.7341 -0.0693 0.0431  -0.0540 154 HIS C CD2 
1557 C  CE1 . HIS C 54  ? 0.7844 0.8125 0.7747 -0.0680 0.0465  -0.0544 154 HIS C CE1 
1558 N  NE2 . HIS C 54  ? 0.7545 0.7967 0.7443 -0.0733 0.0464  -0.0560 154 HIS C NE2 
1559 N  N   . LYS C 55  ? 0.5412 0.5507 0.5234 -0.0457 0.0380  -0.0449 155 LYS C N   
1560 C  CA  . LYS C 55  ? 0.5249 0.5333 0.5061 -0.0409 0.0349  -0.0430 155 LYS C CA  
1561 C  C   . LYS C 55  ? 0.4743 0.4802 0.4588 -0.0345 0.0300  -0.0401 155 LYS C C   
1562 O  O   . LYS C 55  ? 0.5819 0.5798 0.5644 -0.0314 0.0301  -0.0380 155 LYS C O   
1563 C  CB  . LYS C 55  ? 0.5756 0.5748 0.5501 -0.0419 0.0392  -0.0427 155 LYS C CB  
1564 C  CG  . LYS C 55  ? 0.6842 0.6843 0.6543 -0.0493 0.0452  -0.0461 155 LYS C CG  
1565 C  CD  . LYS C 55  ? 0.7574 0.7478 0.7203 -0.0500 0.0494  -0.0457 155 LYS C CD  
1566 C  CE  . LYS C 55  ? 0.8290 0.8196 0.7867 -0.0586 0.0563  -0.0498 155 LYS C CE  
1567 N  NZ  . LYS C 55  ? 0.8669 0.8445 0.8166 -0.0600 0.0622  -0.0492 155 LYS C NZ  
1568 N  N   . PRO C 56  ? 0.3879 0.4014 0.3774 -0.0327 0.0258  -0.0399 156 PRO C N   
1569 C  CA  . PRO C 56  ? 0.4764 0.4877 0.4684 -0.0277 0.0215  -0.0380 156 PRO C CA  
1570 C  C   . PRO C 56  ? 0.5042 0.5146 0.4939 -0.0247 0.0197  -0.0373 156 PRO C C   
1571 O  O   . PRO C 56  ? 0.5420 0.5571 0.5312 -0.0254 0.0199  -0.0383 156 PRO C O   
1572 C  CB  . PRO C 56  ? 0.4634 0.4824 0.4605 -0.0274 0.0189  -0.0382 156 PRO C CB  
1573 C  CG  . PRO C 56  ? 0.4491 0.4764 0.4462 -0.0303 0.0204  -0.0395 156 PRO C CG  
1574 C  CD  . PRO C 56  ? 0.3897 0.4142 0.3823 -0.0350 0.0251  -0.0411 156 PRO C CD  
1575 N  N   . GLU C 57  ? 0.4660 0.4715 0.4544 -0.0217 0.0180  -0.0356 157 GLU C N   
1576 C  CA  . GLU C 57  ? 0.4698 0.4756 0.4562 -0.0195 0.0159  -0.0352 157 GLU C CA  
1577 C  C   . GLU C 57  ? 0.5074 0.5174 0.4974 -0.0180 0.0130  -0.0362 157 GLU C C   
1578 O  O   . GLU C 57  ? 0.5178 0.5282 0.5111 -0.0171 0.0111  -0.0360 157 GLU C O   
1579 C  CB  . GLU C 57  ? 0.4600 0.4613 0.4436 -0.0172 0.0150  -0.0327 157 GLU C CB  
1580 C  CG  . GLU C 57  ? 0.5434 0.5458 0.5238 -0.0160 0.0132  -0.0325 157 GLU C CG  
1581 C  CD  . GLU C 57  ? 0.6484 0.6487 0.6258 -0.0138 0.0124  -0.0292 157 GLU C CD  
1582 O  OE1 . GLU C 57  ? 0.6980 0.7002 0.6720 -0.0134 0.0110  -0.0288 157 GLU C OE1 
1583 O  OE2 . GLU C 57  ? 0.6735 0.6708 0.6520 -0.0124 0.0135  -0.0268 157 GLU C OE2 
1584 N  N   . ILE C 58  ? 0.5752 0.5876 0.5643 -0.0178 0.0131  -0.0375 158 ILE C N   
1585 C  CA  . ILE C 58  ? 0.5422 0.5563 0.5337 -0.0160 0.0115  -0.0384 158 ILE C CA  
1586 C  C   . ILE C 58  ? 0.6135 0.6254 0.6012 -0.0155 0.0108  -0.0393 158 ILE C C   
1587 O  O   . ILE C 58  ? 0.6640 0.6757 0.6480 -0.0163 0.0121  -0.0396 158 ILE C O   
1588 C  CB  . ILE C 58  ? 0.4211 0.4403 0.4151 -0.0156 0.0131  -0.0392 158 ILE C CB  
1589 C  CG1 . ILE C 58  ? 0.3753 0.3993 0.3725 -0.0171 0.0138  -0.0384 158 ILE C CG1 
1590 C  CG2 . ILE C 58  ? 0.3510 0.3698 0.3473 -0.0132 0.0126  -0.0397 158 ILE C CG2 
1591 C  CD1 . ILE C 58  ? 0.4492 0.4799 0.4507 -0.0153 0.0141  -0.0378 158 ILE C CD1 
1592 N  N   . LYS C 59  ? 0.6654 0.6762 0.6538 -0.0148 0.0090  -0.0399 159 LYS C N   
1593 C  CA  . LYS C 59  ? 0.6956 0.7056 0.6801 -0.0154 0.0083  -0.0410 159 LYS C CA  
1594 C  C   . LYS C 59  ? 0.7469 0.7570 0.7293 -0.0157 0.0105  -0.0432 159 LYS C C   
1595 O  O   . LYS C 59  ? 0.7665 0.7765 0.7517 -0.0146 0.0122  -0.0444 159 LYS C O   
1596 C  CB  . LYS C 59  ? 0.7291 0.7387 0.7148 -0.0157 0.0067  -0.0422 159 LYS C CB  
1597 C  CG  . LYS C 59  ? 0.8527 0.8637 0.8341 -0.0175 0.0055  -0.0434 159 LYS C CG  
1598 C  CD  . LYS C 59  ? 0.9358 0.9450 0.9152 -0.0190 0.0077  -0.0472 159 LYS C CD  
1599 C  CE  . LYS C 59  ? 1.0090 1.0208 0.9825 -0.0217 0.0072  -0.0485 159 LYS C CE  
1600 N  NZ  . LYS C 59  ? 0.9965 1.0066 0.9674 -0.0224 0.0103  -0.0508 159 LYS C NZ  
1601 N  N   . GLY C 60  ? 0.6731 0.6834 0.6507 -0.0169 0.0108  -0.0432 160 GLY C N   
1602 C  CA  . GLY C 60  ? 0.6390 0.6495 0.6140 -0.0177 0.0131  -0.0455 160 GLY C CA  
1603 C  C   . GLY C 60  ? 0.6538 0.6660 0.6320 -0.0166 0.0156  -0.0459 160 GLY C C   
1604 O  O   . GLY C 60  ? 0.6798 0.6936 0.6597 -0.0165 0.0157  -0.0441 160 GLY C O   
1605 N  N   . ASN C 61  ? 0.6857 0.6980 0.6647 -0.0158 0.0179  -0.0482 161 ASN C N   
1606 C  CA  . ASN C 61  ? 0.7452 0.7614 0.7280 -0.0140 0.0204  -0.0482 161 ASN C CA  
1607 C  C   . ASN C 61  ? 0.7068 0.7246 0.6956 -0.0114 0.0199  -0.0463 161 ASN C C   
1608 O  O   . ASN C 61  ? 0.7061 0.7206 0.6960 -0.0110 0.0183  -0.0459 161 ASN C O   
1609 C  CB  . ASN C 61  ? 0.8460 0.8617 0.8281 -0.0133 0.0236  -0.0509 161 ASN C CB  
1610 C  CG  . ASN C 61  ? 0.9727 0.9872 0.9483 -0.0165 0.0241  -0.0530 161 ASN C CG  
1611 O  OD1 . ASN C 61  ? 1.0185 1.0347 0.9909 -0.0184 0.0233  -0.0519 161 ASN C OD1 
1612 N  ND2 . ASN C 61  ? 0.9815 0.9929 0.9547 -0.0174 0.0260  -0.0561 161 ASN C ND2 
1613 N  N   . MSE C 62  ? 0.6399 0.6640 0.6325 -0.0098 0.0214  -0.0452 162 MSE C N   
1614 C  CA  . MSE C 62  ? 0.5929 0.6207 0.5911 -0.0075 0.0209  -0.0428 162 MSE C CA  
1615 C  C   . MSE C 62  ? 0.6230 0.6550 0.6257 -0.0033 0.0236  -0.0419 162 MSE C C   
1616 O  O   . MSE C 62  ? 0.6543 0.6918 0.6576 -0.0027 0.0257  -0.0424 162 MSE C O   
1617 C  CB  . MSE C 62  ? 0.5443 0.5783 0.5432 -0.0099 0.0198  -0.0413 162 MSE C CB  
1618 C  CG  . MSE C 62  ? 0.5961 0.6252 0.5911 -0.0131 0.0180  -0.0415 162 MSE C CG  
1619 SE SE  . MSE C 62  ? 1.3255 1.3559 1.3150 -0.0172 0.0199  -0.0427 162 MSE C SE  
1620 C  CE  . MSE C 62  ? 0.4974 0.5385 0.4909 -0.0194 0.0211  -0.0419 162 MSE C CE  
1621 N  N   . SER C 63  ? 0.5656 0.5950 0.5717 -0.0001 0.0239  -0.0401 163 SER C N   
1622 C  CA  . SER C 63  ? 0.5650 0.5983 0.5762 0.0051  0.0269  -0.0379 163 SER C CA  
1623 C  C   . SER C 63  ? 0.5505 0.5832 0.5653 0.0078  0.0261  -0.0345 163 SER C C   
1624 O  O   . SER C 63  ? 0.4871 0.5132 0.5000 0.0057  0.0241  -0.0351 163 SER C O   
1625 C  CB  . SER C 63  ? 0.5328 0.5587 0.5426 0.0073  0.0309  -0.0404 163 SER C CB  
1626 O  OG  . SER C 63  ? 0.5845 0.5993 0.5906 0.0053  0.0308  -0.0427 163 SER C OG  
1627 N  N   . GLY C 64  ? 0.5255 0.5661 0.5457 0.0126  0.0278  -0.0306 164 GLY C N   
1628 C  CA  . GLY C 64  ? 0.4937 0.5350 0.5173 0.0155  0.0273  -0.0265 164 GLY C CA  
1629 C  C   . GLY C 64  ? 0.5160 0.5664 0.5405 0.0118  0.0233  -0.0249 164 GLY C C   
1630 O  O   . GLY C 64  ? 0.5549 0.6116 0.5777 0.0075  0.0218  -0.0268 164 GLY C O   
1631 N  N   . ASN C 65  ? 0.4914 0.5414 0.5179 0.0131  0.0223  -0.0218 165 ASN C N   
1632 C  CA  . ASN C 65  ? 0.4689 0.5282 0.4965 0.0097  0.0192  -0.0201 165 ASN C CA  
1633 C  C   . ASN C 65  ? 0.5056 0.5575 0.5294 0.0041  0.0166  -0.0234 165 ASN C C   
1634 O  O   . ASN C 65  ? 0.5347 0.5748 0.5560 0.0038  0.0166  -0.0255 165 ASN C O   
1635 C  CB  . ASN C 65  ? 0.4713 0.5353 0.5031 0.0139  0.0195  -0.0145 165 ASN C CB  
1636 C  CG  . ASN C 65  ? 0.5805 0.6542 0.6169 0.0205  0.0222  -0.0100 165 ASN C CG  
1637 O  OD1 . ASN C 65  ? 0.6184 0.6995 0.6556 0.0206  0.0232  -0.0111 165 ASN C OD1 
1638 N  ND2 . ASN C 65  ? 0.6847 0.7588 0.7245 0.0262  0.0236  -0.0044 165 ASN C ND2 
1639 N  N   . PHE C 66  ? 0.5227 0.5822 0.5462 -0.0005 0.0148  -0.0239 166 PHE C N   
1640 C  CA  . PHE C 66  ? 0.5486 0.6023 0.5695 -0.0051 0.0128  -0.0262 166 PHE C CA  
1641 C  C   . PHE C 66  ? 0.5832 0.6465 0.6058 -0.0085 0.0117  -0.0247 166 PHE C C   
1642 O  O   . PHE C 66  ? 0.6308 0.7069 0.6553 -0.0091 0.0123  -0.0231 166 PHE C O   
1643 C  CB  . PHE C 66  ? 0.5176 0.5668 0.5342 -0.0086 0.0129  -0.0299 166 PHE C CB  
1644 C  CG  . PHE C 66  ? 0.6407 0.6817 0.6549 -0.0065 0.0138  -0.0317 166 PHE C CG  
1645 C  CD1 . PHE C 66  ? 0.7277 0.7587 0.7396 -0.0068 0.0128  -0.0334 166 PHE C CD1 
1646 C  CD2 . PHE C 66  ? 0.7124 0.7568 0.7265 -0.0047 0.0158  -0.0321 166 PHE C CD2 
1647 C  CE1 . PHE C 66  ? 0.7576 0.7823 0.7666 -0.0059 0.0138  -0.0355 166 PHE C CE1 
1648 C  CE2 . PHE C 66  ? 0.7216 0.7585 0.7331 -0.0035 0.0170  -0.0343 166 PHE C CE2 
1649 C  CZ  . PHE C 66  ? 0.7255 0.7526 0.7341 -0.0043 0.0160  -0.0361 166 PHE C CZ  
1650 N  N   . THR C 67  ? 0.5467 0.6049 0.5683 -0.0112 0.0103  -0.0256 167 THR C N   
1651 C  CA  . THR C 67  ? 0.4603 0.5263 0.4827 -0.0158 0.0098  -0.0255 167 THR C CA  
1652 C  C   . THR C 67  ? 0.4210 0.4803 0.4401 -0.0204 0.0101  -0.0292 167 THR C C   
1653 O  O   . THR C 67  ? 0.4900 0.5388 0.5073 -0.0193 0.0095  -0.0307 167 THR C O   
1654 C  CB  . THR C 67  ? 0.4845 0.5514 0.5092 -0.0148 0.0086  -0.0227 167 THR C CB  
1655 O  OG1 . THR C 67  ? 0.5086 0.5800 0.5361 -0.0094 0.0090  -0.0184 167 THR C OG1 
1656 C  CG2 . THR C 67  ? 0.4811 0.5579 0.5063 -0.0204 0.0083  -0.0228 167 THR C CG2 
1657 N  N   . TYR C 68  ? 0.3872 0.4534 0.4055 -0.0255 0.0114  -0.0305 168 TYR C N   
1658 C  CA  . TYR C 68  ? 0.4414 0.5010 0.4568 -0.0298 0.0128  -0.0336 168 TYR C CA  
1659 C  C   . TYR C 68  ? 0.5028 0.5695 0.5190 -0.0351 0.0136  -0.0341 168 TYR C C   
1660 O  O   . TYR C 68  ? 0.4816 0.5612 0.4989 -0.0377 0.0142  -0.0332 168 TYR C O   
1661 C  CB  . TYR C 68  ? 0.4520 0.5103 0.4638 -0.0320 0.0153  -0.0358 168 TYR C CB  
1662 C  CG  . TYR C 68  ? 0.5348 0.5849 0.5434 -0.0359 0.0178  -0.0384 168 TYR C CG  
1663 C  CD1 . TYR C 68  ? 0.5946 0.6332 0.6014 -0.0331 0.0175  -0.0385 168 TYR C CD1 
1664 C  CD2 . TYR C 68  ? 0.5239 0.5782 0.5312 -0.0423 0.0210  -0.0405 168 TYR C CD2 
1665 C  CE1 . TYR C 68  ? 0.6424 0.6734 0.6467 -0.0354 0.0203  -0.0399 168 TYR C CE1 
1666 C  CE2 . TYR C 68  ? 0.5808 0.6258 0.5851 -0.0454 0.0244  -0.0427 168 TYR C CE2 
1667 C  CZ  . TYR C 68  ? 0.6643 0.6974 0.6674 -0.0413 0.0241  -0.0420 168 TYR C CZ  
1668 O  OH  . TYR C 68  ? 0.7449 0.7687 0.7454 -0.0432 0.0280  -0.0433 168 TYR C OH  
1669 N  N   . ILE C 69  ? 0.5301 0.5897 0.5461 -0.0367 0.0138  -0.0354 169 ILE C N   
1670 C  CA  . ILE C 69  ? 0.4796 0.5448 0.4962 -0.0422 0.0150  -0.0364 169 ILE C CA  
1671 C  C   . ILE C 69  ? 0.4337 0.4956 0.4469 -0.0482 0.0194  -0.0402 169 ILE C C   
1672 O  O   . ILE C 69  ? 0.4136 0.4638 0.4250 -0.0471 0.0210  -0.0416 169 ILE C O   
1673 C  CB  . ILE C 69  ? 0.4403 0.5004 0.4588 -0.0409 0.0131  -0.0358 169 ILE C CB  
1674 C  CG1 . ILE C 69  ? 0.4177 0.4818 0.4390 -0.0364 0.0099  -0.0320 169 ILE C CG1 
1675 C  CG2 . ILE C 69  ? 0.4481 0.5120 0.4665 -0.0474 0.0153  -0.0378 169 ILE C CG2 
1676 C  CD1 . ILE C 69  ? 0.3678 0.4247 0.3904 -0.0344 0.0081  -0.0315 169 ILE C CD1 
1677 N  N   . ILE C 70  ? 0.3976 0.4703 0.4098 -0.0545 0.0217  -0.0417 170 ILE C N   
1678 C  CA  . ILE C 70  ? 0.5012 0.5712 0.5098 -0.0619 0.0271  -0.0460 170 ILE C CA  
1679 C  C   . ILE C 70  ? 0.5180 0.5904 0.5277 -0.0665 0.0280  -0.0473 170 ILE C C   
1680 O  O   . ILE C 70  ? 0.4700 0.5563 0.4810 -0.0701 0.0268  -0.0465 170 ILE C O   
1681 C  CB  . ILE C 70  ? 0.4281 0.5100 0.4341 -0.0680 0.0299  -0.0479 170 ILE C CB  
1682 C  CG1 . ILE C 70  ? 0.3936 0.4742 0.3985 -0.0638 0.0291  -0.0468 170 ILE C CG1 
1683 C  CG2 . ILE C 70  ? 0.3107 0.3887 0.3121 -0.0770 0.0366  -0.0531 170 ILE C CG2 
1684 C  CD1 . ILE C 70  ? 0.3786 0.4730 0.3814 -0.0696 0.0315  -0.0485 170 ILE C CD1 
1685 N  N   . ASP C 71  ? 0.6078 0.6677 0.6172 -0.0662 0.0301  -0.0490 171 ASP C N   
1686 C  CA  . ASP C 71  ? 0.7176 0.7793 0.7286 -0.0700 0.0308  -0.0502 171 ASP C CA  
1687 C  C   . ASP C 71  ? 0.6114 0.6679 0.6192 -0.0775 0.0379  -0.0552 171 ASP C C   
1688 O  O   . ASP C 71  ? 0.6018 0.6544 0.6057 -0.0807 0.0426  -0.0577 171 ASP C O   
1689 C  CB  . ASP C 71  ? 0.8323 0.8854 0.8465 -0.0636 0.0275  -0.0482 171 ASP C CB  
1690 C  CG  . ASP C 71  ? 0.9272 0.9658 0.9406 -0.0596 0.0296  -0.0488 171 ASP C CG  
1691 O  OD1 . ASP C 71  ? 0.9058 0.9404 0.9162 -0.0592 0.0320  -0.0493 171 ASP C OD1 
1692 O  OD2 . ASP C 71  ? 1.0015 1.0338 1.0172 -0.0568 0.0290  -0.0485 171 ASP C OD2 
1693 N  N   . LYS C 72  ? 0.5655 0.6210 0.5746 -0.0805 0.0392  -0.0568 172 LYS C N   
1694 C  CA  . LYS C 72  ? 0.5936 0.6417 0.5999 -0.0872 0.0469  -0.0617 172 LYS C CA  
1695 C  C   . LYS C 72  ? 0.5931 0.6482 0.5926 -0.0932 0.0503  -0.0642 172 LYS C C   
1696 O  O   . LYS C 72  ? 0.5880 0.6348 0.5829 -0.0956 0.0561  -0.0671 172 LYS C O   
1697 C  CB  . LYS C 72  ? 0.5640 0.5945 0.5695 -0.0818 0.0504  -0.0617 172 LYS C CB  
1698 N  N   . LEU C 73  ? 0.4827 0.5525 0.4807 -0.0949 0.0464  -0.0628 173 LEU C N   
1699 C  CA  . LEU C 73  ? 0.4808 0.5599 0.4720 -0.0997 0.0476  -0.0646 173 LEU C CA  
1700 C  C   . LEU C 73  ? 0.6036 0.6876 0.5888 -0.1043 0.0488  -0.0670 173 LEU C C   
1701 O  O   . LEU C 73  ? 0.7043 0.7853 0.6912 -0.1033 0.0484  -0.0666 173 LEU C O   
1702 C  CB  . LEU C 73  ? 0.4164 0.5109 0.4108 -0.0977 0.0421  -0.0605 173 LEU C CB  
1703 C  CG  . LEU C 73  ? 0.4620 0.5539 0.4609 -0.0942 0.0415  -0.0590 173 LEU C CG  
1704 C  CD1 . LEU C 73  ? 0.4196 0.5288 0.4216 -0.0923 0.0367  -0.0552 173 LEU C CD1 
1705 C  CD2 . LEU C 73  ? 0.3526 0.4320 0.3462 -0.0971 0.0479  -0.0632 173 LEU C CD2 
1706 N  N   . ILE C 74  ? 0.5800 0.6719 0.5580 -0.1097 0.0501  -0.0698 174 ILE C N   
1707 C  CA  . ILE C 74  ? 0.6500 0.7461 0.6210 -0.1152 0.0519  -0.0733 174 ILE C CA  
1708 C  C   . ILE C 74  ? 0.6735 0.7896 0.6440 -0.1162 0.0459  -0.0696 174 ILE C C   
1709 O  O   . ILE C 74  ? 0.6908 0.8190 0.6604 -0.1172 0.0434  -0.0682 174 ILE C O   
1710 C  CB  . ILE C 74  ? 0.6508 0.7413 0.6122 -0.1222 0.0582  -0.0805 174 ILE C CB  
1711 C  CG1 . ILE C 74  ? 0.5919 0.6624 0.5535 -0.1210 0.0649  -0.0837 174 ILE C CG1 
1712 C  CG2 . ILE C 74  ? 0.6590 0.7529 0.6129 -0.1283 0.0603  -0.0850 174 ILE C CG2 
1713 C  CD1 . ILE C 74  ? 0.6469 0.7052 0.6137 -0.1167 0.0669  -0.0825 174 ILE C CD1 
1714 N  N   . PRO C 75  ? 0.6367 0.7569 0.6082 -0.1159 0.0437  -0.0676 175 PRO C N   
1715 C  CA  . PRO C 75  ? 0.6196 0.7589 0.5903 -0.1169 0.0386  -0.0635 175 PRO C CA  
1716 C  C   . PRO C 75  ? 0.6277 0.7783 0.5896 -0.1238 0.0397  -0.0671 175 PRO C C   
1717 O  O   . PRO C 75  ? 0.6494 0.7912 0.6042 -0.1292 0.0451  -0.0742 175 PRO C O   
1718 C  CB  . PRO C 75  ? 0.6186 0.7560 0.5887 -0.1175 0.0385  -0.0632 175 PRO C CB  
1719 C  CG  . PRO C 75  ? 0.6180 0.7377 0.5940 -0.1128 0.0405  -0.0637 175 PRO C CG  
1720 C  CD  . PRO C 75  ? 0.6597 0.7676 0.6340 -0.1137 0.0456  -0.0682 175 PRO C CD  
1721 N  N   . ASN C 76  ? 0.6689 0.8391 0.6313 -0.1237 0.0347  -0.0623 176 ASN C N   
1722 C  CA  . ASN C 76  ? 0.7619 0.9464 0.7159 -0.1305 0.0347  -0.0653 176 ASN C CA  
1723 C  C   . ASN C 76  ? 0.7984 0.9765 0.7483 -0.1340 0.0385  -0.0711 176 ASN C C   
1724 O  O   . ASN C 76  ? 0.8124 0.9901 0.7569 -0.1403 0.0416  -0.0760 176 ASN C O   
1725 C  CB  . ASN C 76  ? 0.7469 0.9333 0.6927 -0.1374 0.0369  -0.0696 176 ASN C CB  
1726 C  CG  . ASN C 76  ? 0.8126 1.0176 0.7555 -0.1420 0.0347  -0.0684 176 ASN C CG  
1727 O  OD1 . ASN C 76  ? 0.8534 1.0556 0.7919 -0.1482 0.0383  -0.0736 176 ASN C OD1 
1728 N  ND2 . ASN C 76  ? 0.8098 1.0345 0.7555 -0.1390 0.0291  -0.0613 176 ASN C ND2 
1729 N  N   . THR C 77  ? 0.7600 0.9313 0.7166 -0.1285 0.0382  -0.0688 177 THR C N   
1730 C  CA  . THR C 77  ? 0.6927 0.8569 0.6460 -0.1314 0.0418  -0.0739 177 THR C CA  
1731 C  C   . THR C 77  ? 0.6488 0.8231 0.6078 -0.1268 0.0381  -0.0691 177 THR C C   
1732 O  O   . THR C 77  ? 0.6773 0.8538 0.6453 -0.1194 0.0346  -0.0626 177 THR C O   
1733 C  CB  . THR C 77  ? 0.6240 0.7640 0.5777 -0.1303 0.0477  -0.0780 177 THR C CB  
1734 O  OG1 . THR C 77  ? 0.6501 0.7814 0.5983 -0.1344 0.0517  -0.0827 177 THR C OG1 
1735 C  CG2 . THR C 77  ? 0.5208 0.6531 0.4702 -0.1339 0.0518  -0.0831 177 THR C CG2 
1736 N  N   . ASN C 78  ? 0.6119 0.7928 0.5657 -0.1317 0.0390  -0.0727 178 ASN C N   
1737 C  CA  . ASN C 78  ? 0.6049 0.7952 0.5636 -0.1279 0.0362  -0.0691 178 ASN C CA  
1738 C  C   . ASN C 78  ? 0.5815 0.7546 0.5445 -0.1239 0.0390  -0.0697 178 ASN C C   
1739 O  O   . ASN C 78  ? 0.6354 0.7917 0.5935 -0.1279 0.0444  -0.0758 178 ASN C O   
1740 C  CB  . ASN C 78  ? 0.6190 0.8222 0.5714 -0.1345 0.0361  -0.0727 178 ASN C CB  
1741 C  CG  . ASN C 78  ? 0.6877 0.9143 0.6401 -0.1352 0.0316  -0.0681 178 ASN C CG  
1742 O  OD1 . ASN C 78  ? 0.7196 0.9603 0.6771 -0.1291 0.0269  -0.0609 178 ASN C OD1 
1743 N  ND2 . ASN C 78  ? 0.6319 0.8626 0.5796 -0.1421 0.0334  -0.0715 178 ASN C ND2 
1744 N  N   . TYR C 79  ? 0.4413 0.6188 0.4134 -0.1161 0.0357  -0.0633 179 TYR C N   
1745 C  CA  . TYR C 79  ? 0.4911 0.6564 0.4668 -0.1126 0.0379  -0.0636 179 TYR C CA  
1746 C  C   . TYR C 79  ? 0.4823 0.6616 0.4617 -0.1095 0.0351  -0.0604 179 TYR C C   
1747 O  O   . TYR C 79  ? 0.4963 0.6949 0.4792 -0.1067 0.0307  -0.0554 179 TYR C O   
1748 C  CB  . TYR C 79  ? 0.4803 0.6340 0.4633 -0.1062 0.0375  -0.0602 179 TYR C CB  
1749 C  CG  . TYR C 79  ? 0.5422 0.6792 0.5219 -0.1087 0.0413  -0.0638 179 TYR C CG  
1750 C  CD1 . TYR C 79  ? 0.5667 0.6840 0.5450 -0.1090 0.0464  -0.0671 179 TYR C CD1 
1751 C  CD2 . TYR C 79  ? 0.5222 0.6633 0.5001 -0.1105 0.0400  -0.0635 179 TYR C CD2 
1752 C  CE1 . TYR C 79  ? 0.5750 0.6775 0.5509 -0.1104 0.0503  -0.0700 179 TYR C CE1 
1753 C  CE2 . TYR C 79  ? 0.4917 0.6178 0.4669 -0.1123 0.0439  -0.0669 179 TYR C CE2 
1754 C  CZ  . TYR C 79  ? 0.5822 0.6893 0.5568 -0.1120 0.0491  -0.0701 179 TYR C CZ  
1755 O  OH  . TYR C 79  ? 0.6318 0.7245 0.6045 -0.1130 0.0533  -0.0730 179 TYR C OH  
1756 N  N   . CYS C 80  ? 0.4292 0.5988 0.4077 -0.1099 0.0381  -0.0631 180 CYS C N   
1757 C  CA  . CYS C 80  ? 0.4728 0.6531 0.4554 -0.1062 0.0363  -0.0604 180 CYS C CA  
1758 C  C   . CYS C 80  ? 0.4659 0.6325 0.4529 -0.1011 0.0383  -0.0593 180 CYS C C   
1759 O  O   . CYS C 80  ? 0.4768 0.6242 0.4606 -0.1030 0.0426  -0.0627 180 CYS C O   
1760 C  CB  . CYS C 80  ? 0.4777 0.6632 0.4534 -0.1131 0.0378  -0.0653 180 CYS C CB  
1761 S  SG  . CYS C 80  ? 0.6666 0.8751 0.6377 -0.1186 0.0343  -0.0657 180 CYS C SG  
1762 N  N   . VAL C 81  ? 0.4344 0.6113 0.4287 -0.0941 0.0355  -0.0544 181 VAL C N   
1763 C  CA  . VAL C 81  ? 0.4429 0.6093 0.4414 -0.0888 0.0372  -0.0533 181 VAL C CA  
1764 C  C   . VAL C 81  ? 0.4588 0.6329 0.4585 -0.0861 0.0373  -0.0527 181 VAL C C   
1765 O  O   . VAL C 81  ? 0.4495 0.6416 0.4511 -0.0850 0.0344  -0.0504 181 VAL C O   
1766 C  CB  . VAL C 81  ? 0.4463 0.6088 0.4511 -0.0791 0.0321  -0.0476 181 VAL C CB  
1767 C  CG1 . VAL C 81  ? 0.4122 0.5577 0.4178 -0.0695 0.0301  -0.0456 181 VAL C CG1 
1768 C  CG2 . VAL C 81  ? 0.4215 0.5750 0.4253 -0.0821 0.0327  -0.0489 181 VAL C CG2 
1769 N  N   . SER C 82  ? 0.4906 0.6463 0.4873 -0.0827 0.0387  -0.0539 182 SER C N   
1770 C  CA  . SER C 82  ? 0.4093 0.5680 0.4061 -0.0794 0.0386  -0.0535 182 SER C CA  
1771 C  C   . SER C 82  ? 0.3985 0.5363 0.3951 -0.0708 0.0367  -0.0516 182 SER C C   
1772 O  O   . SER C 82  ? 0.4029 0.5228 0.3964 -0.0708 0.0378  -0.0526 182 SER C O   
1773 C  CB  . SER C 82  ? 0.3680 0.5276 0.3578 -0.0892 0.0443  -0.0592 182 SER C CB  
1774 O  OG  . SER C 82  ? 0.4906 0.6486 0.4796 -0.0860 0.0448  -0.0593 182 SER C OG  
1775 N  N   . VAL C 83  ? 0.3762 0.5168 0.3759 -0.0635 0.0343  -0.0489 183 VAL C N   
1776 C  CA  . VAL C 83  ? 0.3988 0.5212 0.3978 -0.0564 0.0328  -0.0477 183 VAL C CA  
1777 C  C   . VAL C 83  ? 0.4655 0.5853 0.4611 -0.0564 0.0348  -0.0495 183 VAL C C   
1778 O  O   . VAL C 83  ? 0.4903 0.6253 0.4869 -0.0588 0.0361  -0.0505 183 VAL C O   
1779 C  CB  . VAL C 83  ? 0.3666 0.4889 0.3718 -0.0469 0.0282  -0.0429 183 VAL C CB  
1780 C  CG1 . VAL C 83  ? 0.4247 0.5465 0.4323 -0.0469 0.0263  -0.0411 183 VAL C CG1 
1781 C  CG2 . VAL C 83  ? 0.3691 0.5097 0.3797 -0.0432 0.0271  -0.0402 183 VAL C CG2 
1782 N  N   . TYR C 84  ? 0.4630 0.5647 0.4549 -0.0538 0.0351  -0.0499 184 TYR C N   
1783 C  CA  . TYR C 84  ? 0.4095 0.5078 0.3981 -0.0531 0.0366  -0.0512 184 TYR C CA  
1784 C  C   . TYR C 84  ? 0.4416 0.5216 0.4271 -0.0486 0.0356  -0.0503 184 TYR C C   
1785 O  O   . TYR C 84  ? 0.3997 0.4682 0.3843 -0.0472 0.0346  -0.0492 184 TYR C O   
1786 C  CB  . TYR C 84  ? 0.3894 0.4911 0.3721 -0.0621 0.0417  -0.0554 184 TYR C CB  
1787 C  CG  . TYR C 84  ? 0.4717 0.5597 0.4479 -0.0680 0.0456  -0.0577 184 TYR C CG  
1788 C  CD1 . TYR C 84  ? 0.5070 0.5772 0.4768 -0.0677 0.0480  -0.0581 184 TYR C CD1 
1789 C  CD2 . TYR C 84  ? 0.5202 0.6132 0.4965 -0.0739 0.0475  -0.0592 184 TYR C CD2 
1790 C  CE1 . TYR C 84  ? 0.5396 0.5965 0.5037 -0.0723 0.0525  -0.0595 184 TYR C CE1 
1791 C  CE2 . TYR C 84  ? 0.5617 0.6411 0.5322 -0.0792 0.0521  -0.0615 184 TYR C CE2 
1792 C  CZ  . TYR C 84  ? 0.5948 0.6558 0.5594 -0.0781 0.0548  -0.0615 184 TYR C CZ  
1793 O  OH  . TYR C 84  ? 0.6548 0.7017 0.6139 -0.0826 0.0603  -0.0632 184 TYR C OH  
1794 N  N   . LEU C 85  ? 0.5034 0.5825 0.4874 -0.0465 0.0359  -0.0508 185 LEU C N   
1795 C  CA  . LEU C 85  ? 0.4717 0.5363 0.4521 -0.0430 0.0351  -0.0501 185 LEU C CA  
1796 C  C   . LEU C 85  ? 0.4990 0.5558 0.4714 -0.0483 0.0391  -0.0523 185 LEU C C   
1797 O  O   . LEU C 85  ? 0.5572 0.6216 0.5274 -0.0535 0.0424  -0.0549 185 LEU C O   
1798 C  CB  . LEU C 85  ? 0.4650 0.5333 0.4487 -0.0374 0.0332  -0.0493 185 LEU C CB  
1799 C  CG  . LEU C 85  ? 0.4568 0.5330 0.4483 -0.0321 0.0304  -0.0469 185 LEU C CG  
1800 C  CD1 . LEU C 85  ? 0.4349 0.5141 0.4297 -0.0266 0.0301  -0.0463 185 LEU C CD1 
1801 C  CD2 . LEU C 85  ? 0.4427 0.5098 0.4354 -0.0297 0.0277  -0.0449 185 LEU C CD2 
1802 N  N   . GLU C 86  ? 0.4934 0.5354 0.4613 -0.0471 0.0392  -0.0510 186 GLU C N   
1803 C  CA  . GLU C 86  ? 0.4810 0.5136 0.4408 -0.0508 0.0432  -0.0519 186 GLU C CA  
1804 C  C   . GLU C 86  ? 0.5115 0.5332 0.4687 -0.0458 0.0409  -0.0492 186 GLU C C   
1805 O  O   . GLU C 86  ? 0.5672 0.5866 0.5281 -0.0411 0.0371  -0.0470 186 GLU C O   
1806 C  CB  . GLU C 86  ? 0.4286 0.4540 0.3843 -0.0560 0.0476  -0.0527 186 GLU C CB  
1807 C  CG  . GLU C 86  ? 0.5056 0.5195 0.4616 -0.0523 0.0464  -0.0497 186 GLU C CG  
1808 C  CD  . GLU C 86  ? 0.6260 0.6325 0.5787 -0.0573 0.0517  -0.0508 186 GLU C CD  
1809 O  OE1 . GLU C 86  ? 0.6294 0.6256 0.5820 -0.0542 0.0517  -0.0482 186 GLU C OE1 
1810 O  OE2 . GLU C 86  ? 0.6642 0.6755 0.6145 -0.0646 0.0563  -0.0544 186 GLU C OE2 
1811 N  N   . HIS C 87  ? 0.4778 0.4938 0.4284 -0.0475 0.0433  -0.0494 187 HIS C N   
1812 C  CA  . HIS C 87  ? 0.5283 0.5340 0.4749 -0.0439 0.0419  -0.0463 187 HIS C CA  
1813 C  C   . HIS C 87  ? 0.5677 0.5619 0.5093 -0.0456 0.0456  -0.0443 187 HIS C C   
1814 O  O   . HIS C 87  ? 0.6442 0.6310 0.5854 -0.0416 0.0440  -0.0406 187 HIS C O   
1815 C  CB  . HIS C 87  ? 0.6100 0.6157 0.5515 -0.0448 0.0427  -0.0470 187 HIS C CB  
1816 C  CG  . HIS C 87  ? 0.6823 0.6781 0.6177 -0.0427 0.0423  -0.0435 187 HIS C CG  
1817 N  ND1 . HIS C 87  ? 0.7167 0.7034 0.6441 -0.0454 0.0467  -0.0420 187 HIS C ND1 
1818 C  CD2 . HIS C 87  ? 0.7095 0.7039 0.6456 -0.0381 0.0381  -0.0409 187 HIS C CD2 
1819 C  CE1 . HIS C 87  ? 0.7592 0.7400 0.6829 -0.0419 0.0450  -0.0379 187 HIS C CE1 
1820 N  NE2 . HIS C 87  ? 0.7607 0.7469 0.6896 -0.0379 0.0396  -0.0374 187 HIS C NE2 
1821 N  N   . SER C 88  ? 0.5860 0.5791 0.5240 -0.0517 0.0511  -0.0468 188 SER C N   
1822 C  CA  . SER C 88  ? 0.6540 0.6341 0.5859 -0.0541 0.0567  -0.0455 188 SER C CA  
1823 C  C   . SER C 88  ? 0.7628 0.7448 0.6949 -0.0607 0.0615  -0.0492 188 SER C C   
1824 O  O   . SER C 88  ? 0.8190 0.8132 0.7532 -0.0652 0.0618  -0.0532 188 SER C O   
1825 C  CB  . SER C 88  ? 0.6604 0.6328 0.5833 -0.0565 0.0608  -0.0449 188 SER C CB  
1826 O  OG  . SER C 88  ? 0.6958 0.6570 0.6121 -0.0613 0.0685  -0.0454 188 SER C OG  
1827 N  N   . ASP C 89  ? 0.7903 0.7608 0.7200 -0.0613 0.0658  -0.0479 189 ASP C N   
1828 C  CA  . ASP C 89  ? 0.7822 0.7525 0.7109 -0.0685 0.0715  -0.0519 189 ASP C CA  
1829 C  C   . ASP C 89  ? 0.7447 0.7163 0.6665 -0.0774 0.0779  -0.0564 189 ASP C C   
1830 O  O   . ASP C 89  ? 0.7610 0.7418 0.6836 -0.0847 0.0806  -0.0612 189 ASP C O   
1831 C  CB  . ASP C 89  ? 0.8396 0.7939 0.7656 -0.0672 0.0763  -0.0494 189 ASP C CB  
1832 C  CG  . ASP C 89  ? 0.9167 0.8697 0.8413 -0.0754 0.0832  -0.0541 189 ASP C CG  
1833 O  OD1 . ASP C 89  ? 0.9492 0.8867 0.8671 -0.0784 0.0915  -0.0542 189 ASP C OD1 
1834 O  OD2 . ASP C 89  ? 0.9416 0.9091 0.8714 -0.0790 0.0806  -0.0576 189 ASP C OD2 
1835 N  N   . GLU C 90  ? 0.6434 0.6066 0.5582 -0.0773 0.0805  -0.0550 190 GLU C N   
1836 C  CA  . GLU C 90  ? 0.6100 0.5723 0.5171 -0.0862 0.0875  -0.0593 190 GLU C CA  
1837 C  C   . GLU C 90  ? 0.5637 0.5412 0.4721 -0.0882 0.0843  -0.0620 190 GLU C C   
1838 O  O   . GLU C 90  ? 0.5039 0.4816 0.4057 -0.0954 0.0897  -0.0656 190 GLU C O   
1839 C  CB  . GLU C 90  ? 0.7416 0.6837 0.6387 -0.0865 0.0945  -0.0565 190 GLU C CB  
1840 C  CG  . GLU C 90  ? 0.9184 0.8441 0.8140 -0.0840 0.0991  -0.0535 190 GLU C CG  
1841 C  CD  . GLU C 90  ? 1.0384 0.9430 0.9233 -0.0848 0.1080  -0.0506 190 GLU C CD  
1842 O  OE1 . GLU C 90  ? 1.0828 0.9740 0.9675 -0.0783 0.1096  -0.0450 190 GLU C OE1 
1843 O  OE2 . GLU C 90  ? 1.0465 0.9479 0.9233 -0.0918 0.1138  -0.0536 190 GLU C OE2 
1844 N  N   . GLN C 91  ? 0.6072 0.5973 0.5239 -0.0820 0.0762  -0.0606 191 GLN C N   
1845 C  CA  . GLN C 91  ? 0.6391 0.6438 0.5577 -0.0833 0.0738  -0.0632 191 GLN C CA  
1846 C  C   . GLN C 91  ? 0.5968 0.6199 0.5204 -0.0889 0.0741  -0.0676 191 GLN C C   
1847 O  O   . GLN C 91  ? 0.5382 0.5648 0.4657 -0.0902 0.0740  -0.0682 191 GLN C O   
1848 C  CB  . GLN C 91  ? 0.6788 0.6885 0.6036 -0.0745 0.0661  -0.0600 191 GLN C CB  
1849 C  CG  . GLN C 91  ? 0.6905 0.7131 0.6257 -0.0704 0.0605  -0.0597 191 GLN C CG  
1850 C  CD  . GLN C 91  ? 0.7633 0.7919 0.7038 -0.0633 0.0546  -0.0580 191 GLN C CD  
1851 O  OE1 . GLN C 91  ? 0.8569 0.8783 0.7987 -0.0574 0.0509  -0.0546 191 GLN C OE1 
1852 N  NE2 . GLN C 91  ? 0.6771 0.7196 0.6209 -0.0641 0.0541  -0.0604 191 GLN C NE2 
1853 N  N   . ALA C 92  ? 0.5767 0.6124 0.5005 -0.0920 0.0744  -0.0705 192 ALA C N   
1854 C  CA  . ALA C 92  ? 0.4475 0.5040 0.3800 -0.0941 0.0713  -0.0724 192 ALA C CA  
1855 C  C   . ALA C 92  ? 0.4678 0.5337 0.4083 -0.0866 0.0660  -0.0702 192 ALA C C   
1856 O  O   . ALA C 92  ? 0.4583 0.5182 0.4013 -0.0786 0.0616  -0.0668 192 ALA C O   
1857 C  CB  . ALA C 92  ? 0.3422 0.4090 0.2760 -0.0955 0.0705  -0.0739 192 ALA C CB  
1858 N  N   . VAL C 93  ? 0.4797 0.5597 0.4258 -0.0888 0.0651  -0.0711 193 VAL C N   
1859 C  CA  . VAL C 93  ? 0.3784 0.4641 0.3334 -0.0812 0.0590  -0.0675 193 VAL C CA  
1860 C  C   . VAL C 93  ? 0.4121 0.5221 0.3742 -0.0828 0.0575  -0.0684 193 VAL C C   
1861 O  O   . VAL C 93  ? 0.3522 0.4714 0.3135 -0.0906 0.0594  -0.0711 193 VAL C O   
1862 C  CB  . VAL C 93  ? 0.4092 0.4811 0.3628 -0.0809 0.0593  -0.0660 193 VAL C CB  
1863 C  CG1 . VAL C 93  ? 0.3687 0.4535 0.3283 -0.0827 0.0577  -0.0661 193 VAL C CG1 
1864 C  CG2 . VAL C 93  ? 0.3737 0.4313 0.3284 -0.0721 0.0552  -0.0618 193 VAL C CG2 
1865 N  N   . ILE C 94  ? 0.3101 0.4283 0.2806 -0.0743 0.0522  -0.0648 194 ILE C N   
1866 C  CA  . ILE C 94  ? 0.3359 0.4777 0.3138 -0.0741 0.0506  -0.0641 194 ILE C CA  
1867 C  C   . ILE C 94  ? 0.3969 0.5433 0.3799 -0.0723 0.0476  -0.0614 194 ILE C C   
1868 O  O   . ILE C 94  ? 0.3931 0.5335 0.3807 -0.0641 0.0435  -0.0575 194 ILE C O   
1869 C  CB  . ILE C 94  ? 0.3448 0.4947 0.3289 -0.0658 0.0478  -0.0617 194 ILE C CB  
1870 C  CG1 . ILE C 94  ? 0.3422 0.4848 0.3205 -0.0675 0.0507  -0.0645 194 ILE C CG1 
1871 C  CG2 . ILE C 94  ? 0.3293 0.5058 0.3208 -0.0656 0.0471  -0.0606 194 ILE C CG2 
1872 C  CD1 . ILE C 94  ? 0.3019 0.4499 0.2855 -0.0598 0.0489  -0.0629 194 ILE C CD1 
1873 N  N   . LYS C 95  ? 0.3481 0.5050 0.3295 -0.0808 0.0501  -0.0639 195 LYS C N   
1874 C  CA  . LYS C 95  ? 0.4358 0.5953 0.4206 -0.0805 0.0479  -0.0619 195 LYS C CA  
1875 C  C   . LYS C 95  ? 0.4481 0.6319 0.4416 -0.0770 0.0443  -0.0584 195 LYS C C   
1876 O  O   . LYS C 95  ? 0.4613 0.6612 0.4559 -0.0801 0.0433  -0.0590 195 LYS C O   
1877 C  CB  . LYS C 95  ? 0.4720 0.6250 0.4508 -0.0904 0.0508  -0.0657 195 LYS C CB  
1878 C  CG  . LYS C 95  ? 0.4458 0.5741 0.4174 -0.0922 0.0551  -0.0676 195 LYS C CG  
1879 C  CD  . LYS C 95  ? 0.4200 0.5400 0.3862 -0.1014 0.0578  -0.0713 195 LYS C CD  
1880 C  CE  . LYS C 95  ? 0.4388 0.5342 0.3984 -0.1021 0.0628  -0.0721 195 LYS C CE  
1881 N  NZ  . LYS C 95  ? 0.4235 0.5101 0.3795 -0.1094 0.0658  -0.0752 195 LYS C NZ  
1882 N  N   . SER C 96  ? 0.3720 0.5532 0.3713 -0.0689 0.0399  -0.0535 196 SER C N   
1883 C  CA  . SER C 96  ? 0.3455 0.5483 0.3524 -0.0656 0.0368  -0.0493 196 SER C CA  
1884 C  C   . SER C 96  ? 0.3844 0.6004 0.3887 -0.0753 0.0375  -0.0516 196 SER C C   
1885 O  O   . SER C 96  ? 0.4039 0.6067 0.4011 -0.0829 0.0395  -0.0558 196 SER C O   
1886 C  CB  . SER C 96  ? 0.3540 0.5477 0.3653 -0.0574 0.0328  -0.0443 196 SER C CB  
1887 O  OG  . SER C 96  ? 0.4175 0.6069 0.4263 -0.0630 0.0330  -0.0456 196 SER C OG  
1888 N  N   . PRO C 97  ? 0.4477 0.6849 0.4563 -0.0733 0.0341  -0.0482 197 PRO C N   
1889 C  CA  . PRO C 97  ? 0.4354 0.6828 0.4405 -0.0799 0.0318  -0.0489 197 PRO C CA  
1890 C  C   . PRO C 97  ? 0.4544 0.6932 0.4592 -0.0808 0.0313  -0.0480 197 PRO C C   
1891 O  O   . PRO C 97  ? 0.4425 0.6736 0.4524 -0.0745 0.0315  -0.0451 197 PRO C O   
1892 C  CB  . PRO C 97  ? 0.4153 0.6873 0.4271 -0.0735 0.0281  -0.0427 197 PRO C CB  
1893 C  CG  . PRO C 97  ? 0.4937 0.7679 0.5106 -0.0663 0.0294  -0.0412 197 PRO C CG  
1894 C  CD  . PRO C 97  ? 0.4412 0.6937 0.4576 -0.0644 0.0327  -0.0434 197 PRO C CD  
1895 N  N   . LEU C 98  ? 0.4446 0.6849 0.4433 -0.0888 0.0308  -0.0510 198 LEU C N   
1896 C  CA  . LEU C 98  ? 0.4728 0.7043 0.4702 -0.0905 0.0306  -0.0510 198 LEU C CA  
1897 C  C   . LEU C 98  ? 0.4768 0.7233 0.4809 -0.0842 0.0265  -0.0439 198 LEU C C   
1898 O  O   . LEU C 98  ? 0.4768 0.7435 0.4834 -0.0815 0.0236  -0.0399 198 LEU C O   
1899 C  CB  . LEU C 98  ? 0.5151 0.7427 0.5030 -0.1013 0.0320  -0.0571 198 LEU C CB  
1900 C  CG  . LEU C 98  ? 0.4564 0.6679 0.4367 -0.1091 0.0366  -0.0646 198 LEU C CG  
1901 C  CD1 . LEU C 98  ? 0.4926 0.7020 0.4646 -0.1189 0.0378  -0.0702 198 LEU C CD1 
1902 C  CD2 . LEU C 98  ? 0.4000 0.5888 0.3809 -0.1064 0.0403  -0.0651 198 LEU C CD2 
1903 N  N   . LYS C 99  ? 0.4512 0.6880 0.4580 -0.0818 0.0263  -0.0421 199 LYS C N   
1904 C  CA  . LYS C 99  ? 0.4520 0.7003 0.4630 -0.0781 0.0227  -0.0363 199 LYS C CA  
1905 C  C   . LYS C 99  ? 0.4465 0.6846 0.4513 -0.0850 0.0235  -0.0399 199 LYS C C   
1906 O  O   . LYS C 99  ? 0.4329 0.6514 0.4348 -0.0881 0.0267  -0.0444 199 LYS C O   
1907 C  CB  . LYS C 99  ? 0.4559 0.7046 0.4774 -0.0675 0.0213  -0.0300 199 LYS C CB  
1908 C  CG  . LYS C 99  ? 0.4211 0.6838 0.4493 -0.0591 0.0203  -0.0251 199 LYS C CG  
1909 C  CD  . LYS C 99  ? 0.4480 0.7081 0.4839 -0.0469 0.0176  -0.0177 199 LYS C CD  
1910 C  CE  . LYS C 99  ? 0.4581 0.7264 0.4994 -0.0373 0.0173  -0.0132 199 LYS C CE  
1911 N  NZ  . LYS C 99  ? 0.4294 0.6822 0.4675 -0.0371 0.0196  -0.0182 199 LYS C NZ  
1912 N  N   . CYS C 100 ? 0.4813 0.7327 0.4835 -0.0875 0.0211  -0.0380 200 CYS C N   
1913 C  CA  . CYS C 100 ? 0.4578 0.7011 0.4525 -0.0952 0.0224  -0.0425 200 CYS C CA  
1914 C  C   . CYS C 100 ? 0.4302 0.6807 0.4279 -0.0923 0.0193  -0.0371 200 CYS C C   
1915 O  O   . CYS C 100 ? 0.3863 0.6544 0.3896 -0.0863 0.0158  -0.0298 200 CYS C O   
1916 C  CB  . CYS C 100 ? 0.4840 0.7351 0.4690 -0.1044 0.0233  -0.0481 200 CYS C CB  
1917 S  SG  . CYS C 100 ? 0.6278 0.8677 0.6077 -0.1099 0.0274  -0.0558 200 CYS C SG  
1918 N  N   . THR C 101 ? 0.4511 0.6879 0.4452 -0.0963 0.0210  -0.0404 201 THR C N   
1919 C  CA  . THR C 101 ? 0.4499 0.6915 0.4459 -0.0946 0.0184  -0.0360 201 THR C CA  
1920 C  C   . THR C 101 ? 0.4288 0.6593 0.4165 -0.1023 0.0210  -0.0420 201 THR C C   
1921 O  O   . THR C 101 ? 0.3904 0.6026 0.3740 -0.1062 0.0251  -0.0485 201 THR C O   
1922 C  CB  . THR C 101 ? 0.6004 0.8358 0.6067 -0.0859 0.0168  -0.0306 201 THR C CB  
1923 O  OG1 . THR C 101 ? 0.5987 0.8444 0.6082 -0.0828 0.0135  -0.0243 201 THR C OG1 
1924 C  CG2 . THR C 101 ? 0.5665 0.7783 0.5723 -0.0874 0.0200  -0.0357 201 THR C CG2 
1925 N  N   . LEU C 102 ? 0.5078 0.7498 0.4929 -0.1042 0.0188  -0.0394 202 LEU C N   
1926 C  CA  . LEU C 102 ? 0.4621 0.6954 0.4395 -0.1111 0.0212  -0.0447 202 LEU C CA  
1927 C  C   . LEU C 102 ? 0.4700 0.6943 0.4527 -0.1069 0.0203  -0.0414 202 LEU C C   
1928 O  O   . LEU C 102 ? 0.5576 0.7941 0.5451 -0.1025 0.0164  -0.0343 202 LEU C O   
1929 C  CB  . LEU C 102 ? 0.4333 0.6858 0.4034 -0.1168 0.0195  -0.0446 202 LEU C CB  
1930 C  CG  . LEU C 102 ? 0.5039 0.7512 0.4659 -0.1237 0.0216  -0.0493 202 LEU C CG  
1931 C  CD1 . LEU C 102 ? 0.5157 0.7421 0.4711 -0.1298 0.0275  -0.0592 202 LEU C CD1 
1932 C  CD2 . LEU C 102 ? 0.3840 0.6535 0.3393 -0.1290 0.0193  -0.0482 202 LEU C CD2 
1933 N  N   . LEU C 103 ? 0.4477 0.6511 0.4296 -0.1080 0.0238  -0.0462 203 LEU C N   
1934 C  CA  . LEU C 103 ? 0.5103 0.7047 0.4970 -0.1045 0.0229  -0.0437 203 LEU C CA  
1935 C  C   . LEU C 103 ? 0.6181 0.8216 0.6005 -0.1078 0.0215  -0.0424 203 LEU C C   
1936 O  O   . LEU C 103 ? 0.6919 0.8976 0.6653 -0.1149 0.0238  -0.0474 203 LEU C O   
1937 C  CB  . LEU C 103 ? 0.4851 0.6566 0.4708 -0.1054 0.0274  -0.0494 203 LEU C CB  
1938 C  CG  . LEU C 103 ? 0.5143 0.6750 0.5044 -0.1018 0.0289  -0.0503 203 LEU C CG  
1939 C  CD1 . LEU C 103 ? 0.5045 0.6458 0.4973 -0.0999 0.0314  -0.0523 203 LEU C CD1 
1940 C  CD2 . LEU C 103 ? 0.5330 0.7054 0.5316 -0.0953 0.0245  -0.0437 203 LEU C CD2 
1941 N  N   . PRO C 104 ? 0.6485 0.8574 0.6371 -0.1031 0.0178  -0.0359 204 PRO C N   
1942 C  CA  . PRO C 104 ? 0.6781 0.8948 0.6635 -0.1057 0.0163  -0.0337 204 PRO C CA  
1943 C  C   . PRO C 104 ? 0.7035 0.9044 0.6832 -0.1106 0.0202  -0.0405 204 PRO C C   
1944 O  O   . PRO C 104 ? 0.7209 0.9034 0.7028 -0.1090 0.0231  -0.0441 204 PRO C O   
1945 C  CB  . PRO C 104 ? 0.6655 0.8850 0.6604 -0.0984 0.0124  -0.0259 204 PRO C CB  
1946 C  CG  . PRO C 104 ? 0.6823 0.9042 0.6849 -0.0921 0.0110  -0.0226 204 PRO C CG  
1947 C  CD  . PRO C 104 ? 0.6917 0.9002 0.6908 -0.0950 0.0150  -0.0301 204 PRO C CD  
1948 N  N   . PRO C 105 ? 0.6748 0.8834 0.6472 -0.1162 0.0205  -0.0418 205 PRO C N   
1949 C  CA  . PRO C 105 ? 0.6668 0.8618 0.6340 -0.1204 0.0244  -0.0478 205 PRO C CA  
1950 C  C   . PRO C 105 ? 0.6846 0.8730 0.6580 -0.1160 0.0225  -0.0439 205 PRO C C   
1951 O  O   . PRO C 105 ? 0.7448 0.9187 0.7168 -0.1172 0.0258  -0.0483 205 PRO C O   
1952 C  CB  . PRO C 105 ? 0.6704 0.8799 0.6279 -0.1278 0.0245  -0.0497 205 PRO C CB  
1953 C  CG  . PRO C 105 ? 0.6559 0.8875 0.6164 -0.1251 0.0189  -0.0410 205 PRO C CG  
1954 C  CD  . PRO C 105 ? 0.6581 0.8898 0.6267 -0.1187 0.0173  -0.0374 205 PRO C CD  
1955 O  OXT . PRO C 105 ? 0.6130 0.8105 0.5929 -0.1112 0.0180  -0.0365 205 PRO C OXT 
1956 CL CL  . CL  D .   ? 1.0147 1.0178 0.9918 -0.0177 0.0191  -0.0542 1   CL  A CL  
1957 CL CL  . CL  E .   ? 0.8018 0.7986 0.7926 -0.0349 0.0325  -0.0396 1   CL  C CL  
1958 O  O   . HOH F .   ? 0.4167 0.4380 0.4451 -0.0262 0.0005  -0.0403 5   HOH A O   
1959 O  O   . HOH F .   ? 0.3796 0.4002 0.4047 -0.0287 0.0005  -0.0375 6   HOH A O   
1960 O  O   . HOH F .   ? 0.2631 0.2781 0.2849 -0.0249 0.0010  -0.0351 7   HOH A O   
1961 O  O   . HOH F .   ? 0.4609 0.4899 0.4998 -0.0066 0.0061  -0.0301 14  HOH A O   
1962 O  O   . HOH F .   ? 0.6381 0.6011 0.6326 -0.0479 0.0184  -0.0572 18  HOH A O   
1963 O  O   . HOH F .   ? 0.5036 0.5517 0.5295 -0.0004 0.0114  -0.0188 20  HOH A O   
1964 O  O   . HOH F .   ? 0.3986 0.3946 0.4139 -0.0300 0.0043  -0.0394 26  HOH A O   
1965 O  O   . HOH F .   ? 0.7390 0.7322 0.7454 -0.0392 0.0052  -0.0532 28  HOH A O   
1966 O  O   . HOH F .   ? 0.5916 0.6841 0.5613 -0.0436 -0.0151 -0.0499 30  HOH A O   
1967 O  O   . HOH F .   ? 0.5313 0.5716 0.5587 0.0022  0.0115  -0.0135 32  HOH A O   
1968 O  O   . HOH F .   ? 0.5420 0.5544 0.5146 -0.0133 0.0044  -0.0301 34  HOH A O   
1969 O  O   . HOH F .   ? 0.5794 0.5641 0.5599 -0.0317 0.0176  -0.0633 35  HOH A O   
1970 O  O   . HOH F .   ? 0.5273 0.5547 0.4977 -0.0157 -0.0020 -0.0313 206 HOH A O   
1971 O  O   . HOH G .   ? 0.4615 0.4652 0.4804 -0.0278 0.0054  -0.0270 2   HOH B O   
1972 O  O   . HOH G .   ? 0.4485 0.5235 0.5278 -0.0499 0.0141  -0.0663 3   HOH B O   
1973 O  O   . HOH G .   ? 0.5394 0.5693 0.5698 -0.0480 0.0166  -0.0459 4   HOH B O   
1974 O  O   . HOH G .   ? 0.4856 0.6094 0.5185 -0.0761 -0.0086 -0.0785 11  HOH B O   
1975 O  O   . HOH G .   ? 0.3798 0.4003 0.4032 -0.0250 0.0023  -0.0287 12  HOH B O   
1976 O  O   . HOH G .   ? 0.4001 0.4455 0.4334 -0.0723 0.0107  -0.0515 15  HOH B O   
1977 O  O   . HOH G .   ? 0.5840 0.6221 0.6119 -0.0744 0.0060  -0.0483 16  HOH B O   
1978 O  O   . HOH G .   ? 0.3718 0.4224 0.4112 -0.0737 0.0164  -0.0596 21  HOH B O   
1979 O  O   . HOH G .   ? 0.5210 0.6747 0.5752 -0.0393 -0.0199 -0.0547 24  HOH B O   
1980 O  O   . HOH G .   ? 0.5657 0.5669 0.5659 -0.0498 0.0052  -0.0631 29  HOH B O   
1981 O  O   . HOH G .   ? 0.5624 0.7303 0.6116 -0.0712 -0.0137 -0.0768 31  HOH B O   
1982 O  O   . HOH G .   ? 0.4511 0.5301 0.4784 -0.0449 0.0050  -0.0254 33  HOH B O   
1983 O  O   . HOH H .   ? 0.3419 0.4533 0.3320 -0.0475 0.0376  -0.0521 8   HOH C O   
1984 O  O   . HOH H .   ? 0.5549 0.5651 0.5350 -0.0315 0.0274  -0.0400 9   HOH C O   
1985 O  O   . HOH H .   ? 0.4614 0.5545 0.4333 -0.0592 0.0461  -0.0594 10  HOH C O   
1986 O  O   . HOH H .   ? 0.5792 0.5707 0.5657 -0.0212 0.0239  -0.0322 13  HOH C O   
1987 O  O   . HOH H .   ? 0.4592 0.6957 0.5043 -0.0157 0.0210  -0.0134 17  HOH C O   
1988 O  O   . HOH H .   ? 0.3684 0.6176 0.4111 -0.0327 0.0109  -0.0037 19  HOH C O   
1989 O  O   . HOH H .   ? 0.4543 0.6563 0.4812 -0.0324 0.0276  -0.0325 22  HOH C O   
1990 O  O   . HOH H .   ? 0.5865 0.5540 0.4945 -0.0560 0.0610  -0.0420 23  HOH C O   
1991 O  O   . HOH H .   ? 0.6127 0.6497 0.6030 -0.0859 0.0553  -0.0625 25  HOH C O   
1992 O  O   . HOH H .   ? 0.5731 0.6778 0.5249 -0.1265 0.0656  -0.0839 27  HOH C O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   101 ?   ?   ?   A . n 
A 1 2   ASP 2   102 ?   ?   ?   A . n 
A 1 3   PRO 3   103 ?   ?   ?   A . n 
A 1 4   ASP 4   104 ?   ?   ?   A . n 
A 1 5   MSE 5   105 ?   ?   ?   A . n 
A 1 6   SER 6   106 106 SER SER A . n 
A 1 7   PHE 7   107 107 PHE PHE A . n 
A 1 8   GLU 8   108 108 GLU GLU A . n 
A 1 9   PRO 9   109 109 PRO PRO A . n 
A 1 10  PRO 10  110 110 PRO PRO A . n 
A 1 11  GLU 11  111 111 GLU GLU A . n 
A 1 12  PHE 12  112 112 PHE PHE A . n 
A 1 13  GLU 13  113 113 GLU GLU A . n 
A 1 14  ILE 14  114 114 ILE ILE A . n 
A 1 15  VAL 15  115 115 VAL VAL A . n 
A 1 16  GLY 16  116 116 GLY GLY A . n 
A 1 17  PHE 17  117 117 PHE PHE A . n 
A 1 18  THR 18  118 118 THR THR A . n 
A 1 19  ASN 19  119 119 ASN ASN A . n 
A 1 20  HIS 20  120 120 HIS HIS A . n 
A 1 21  ILE 21  121 121 ILE ILE A . n 
A 1 22  ASN 22  122 122 ASN ASN A . n 
A 1 23  VAL 23  123 123 VAL VAL A . n 
A 1 24  MSE 24  124 124 MSE MSE A . n 
A 1 25  VAL 25  125 125 VAL VAL A . n 
A 1 26  LYS 26  126 126 LYS LYS A . n 
A 1 27  PHE 27  127 127 PHE PHE A . n 
A 1 28  PRO 28  128 ?   ?   ?   A . n 
A 1 29  SER 29  129 ?   ?   ?   A . n 
A 1 30  ILE 30  130 ?   ?   ?   A . n 
A 1 31  VAL 31  131 ?   ?   ?   A . n 
A 1 32  GLU 32  132 ?   ?   ?   A . n 
A 1 33  GLU 33  133 ?   ?   ?   A . n 
A 1 34  GLU 34  134 ?   ?   ?   A . n 
A 1 35  LEU 35  135 ?   ?   ?   A . n 
A 1 36  GLN 36  136 ?   ?   ?   A . n 
A 1 37  PHE 37  137 ?   ?   ?   A . n 
A 1 38  ASP 38  138 ?   ?   ?   A . n 
A 1 39  LEU 39  139 ?   ?   ?   A . n 
A 1 40  SER 40  140 140 SER SER A . n 
A 1 41  LEU 41  141 141 LEU LEU A . n 
A 1 42  VAL 42  142 142 VAL VAL A . n 
A 1 43  ILE 43  143 143 ILE ILE A . n 
A 1 44  GLU 44  144 144 GLU GLU A . n 
A 1 45  GLU 45  145 145 GLU GLU A . n 
A 1 46  GLN 46  146 146 GLN GLN A . n 
A 1 47  SER 47  147 147 SER SER A . n 
A 1 48  GLU 48  148 148 GLU GLU A . n 
A 1 49  GLY 49  149 149 GLY GLY A . n 
A 1 50  ILE 50  150 150 ILE ILE A . n 
A 1 51  VAL 51  151 151 VAL VAL A . n 
A 1 52  LYS 52  152 152 LYS LYS A . n 
A 1 53  LYS 53  153 153 LYS LYS A . n 
A 1 54  HIS 54  154 154 HIS HIS A . n 
A 1 55  LYS 55  155 155 LYS LYS A . n 
A 1 56  PRO 56  156 156 PRO PRO A . n 
A 1 57  GLU 57  157 157 GLU GLU A . n 
A 1 58  ILE 58  158 158 ILE ILE A . n 
A 1 59  LYS 59  159 ?   ?   ?   A . n 
A 1 60  GLY 60  160 ?   ?   ?   A . n 
A 1 61  ASN 61  161 ?   ?   ?   A . n 
A 1 62  MSE 62  162 ?   ?   ?   A . n 
A 1 63  SER 63  163 ?   ?   ?   A . n 
A 1 64  GLY 64  164 ?   ?   ?   A . n 
A 1 65  ASN 65  165 165 ASN ASN A . n 
A 1 66  PHE 66  166 166 PHE PHE A . n 
A 1 67  THR 67  167 167 THR THR A . n 
A 1 68  TYR 68  168 168 TYR TYR A . n 
A 1 69  ILE 69  169 169 ILE ILE A . n 
A 1 70  ILE 70  170 170 ILE ILE A . n 
A 1 71  ASP 71  171 171 ASP ASP A . n 
A 1 72  LYS 72  172 172 LYS LYS A . n 
A 1 73  LEU 73  173 173 LEU LEU A . n 
A 1 74  ILE 74  174 174 ILE ILE A . n 
A 1 75  PRO 75  175 175 PRO PRO A . n 
A 1 76  ASN 76  176 176 ASN ASN A . n 
A 1 77  THR 77  177 177 THR THR A . n 
A 1 78  ASN 78  178 178 ASN ASN A . n 
A 1 79  TYR 79  179 179 TYR TYR A . n 
A 1 80  CYS 80  180 180 CYS CYS A . n 
A 1 81  VAL 81  181 181 VAL VAL A . n 
A 1 82  SER 82  182 182 SER SER A . n 
A 1 83  VAL 83  183 183 VAL VAL A . n 
A 1 84  TYR 84  184 184 TYR TYR A . n 
A 1 85  LEU 85  185 185 LEU LEU A . n 
A 1 86  GLU 86  186 186 GLU GLU A . n 
A 1 87  HIS 87  187 187 HIS ALA A . n 
A 1 88  SER 88  188 ?   ?   ?   A . n 
A 1 89  ASP 89  189 ?   ?   ?   A . n 
A 1 90  GLU 90  190 ?   ?   ?   A . n 
A 1 91  GLN 91  191 ?   ?   ?   A . n 
A 1 92  ALA 92  192 ?   ?   ?   A . n 
A 1 93  VAL 93  193 193 VAL VAL A . n 
A 1 94  ILE 94  194 194 ILE ILE A . n 
A 1 95  LYS 95  195 195 LYS LYS A . n 
A 1 96  SER 96  196 196 SER SER A . n 
A 1 97  PRO 97  197 197 PRO PRO A . n 
A 1 98  LEU 98  198 198 LEU LEU A . n 
A 1 99  LYS 99  199 199 LYS LYS A . n 
A 1 100 CYS 100 200 200 CYS CYS A . n 
A 1 101 THR 101 201 201 THR THR A . n 
A 1 102 LEU 102 202 202 LEU LEU A . n 
A 1 103 LEU 103 203 203 LEU LEU A . n 
A 1 104 PRO 104 204 204 PRO PRO A . n 
A 1 105 PRO 105 205 205 PRO PRO A . n 
B 1 1   ALA 1   101 ?   ?   ?   B . n 
B 1 2   ASP 2   102 ?   ?   ?   B . n 
B 1 3   PRO 3   103 ?   ?   ?   B . n 
B 1 4   ASP 4   104 ?   ?   ?   B . n 
B 1 5   MSE 5   105 ?   ?   ?   B . n 
B 1 6   SER 6   106 ?   ?   ?   B . n 
B 1 7   PHE 7   107 107 PHE PHE B . n 
B 1 8   GLU 8   108 108 GLU GLU B . n 
B 1 9   PRO 9   109 109 PRO PRO B . n 
B 1 10  PRO 10  110 110 PRO PRO B . n 
B 1 11  GLU 11  111 111 GLU GLU B . n 
B 1 12  PHE 12  112 112 PHE PHE B . n 
B 1 13  GLU 13  113 113 GLU GLU B . n 
B 1 14  ILE 14  114 114 ILE ILE B . n 
B 1 15  VAL 15  115 115 VAL VAL B . n 
B 1 16  GLY 16  116 116 GLY GLY B . n 
B 1 17  PHE 17  117 117 PHE PHE B . n 
B 1 18  THR 18  118 118 THR THR B . n 
B 1 19  ASN 19  119 119 ASN ASN B . n 
B 1 20  HIS 20  120 120 HIS HIS B . n 
B 1 21  ILE 21  121 121 ILE ILE B . n 
B 1 22  ASN 22  122 122 ASN ASN B . n 
B 1 23  VAL 23  123 123 VAL VAL B . n 
B 1 24  MSE 24  124 124 MSE MSE B . n 
B 1 25  VAL 25  125 125 VAL VAL B . n 
B 1 26  LYS 26  126 126 LYS LYS B . n 
B 1 27  PHE 27  127 127 PHE PHE B . n 
B 1 28  PRO 28  128 ?   ?   ?   B . n 
B 1 29  SER 29  129 ?   ?   ?   B . n 
B 1 30  ILE 30  130 ?   ?   ?   B . n 
B 1 31  VAL 31  131 ?   ?   ?   B . n 
B 1 32  GLU 32  132 ?   ?   ?   B . n 
B 1 33  GLU 33  133 ?   ?   ?   B . n 
B 1 34  GLU 34  134 ?   ?   ?   B . n 
B 1 35  LEU 35  135 ?   ?   ?   B . n 
B 1 36  GLN 36  136 ?   ?   ?   B . n 
B 1 37  PHE 37  137 ?   ?   ?   B . n 
B 1 38  ASP 38  138 ?   ?   ?   B . n 
B 1 39  LEU 39  139 139 LEU LEU B . n 
B 1 40  SER 40  140 140 SER SER B . n 
B 1 41  LEU 41  141 141 LEU LEU B . n 
B 1 42  VAL 42  142 142 VAL VAL B . n 
B 1 43  ILE 43  143 143 ILE ILE B . n 
B 1 44  GLU 44  144 144 GLU GLU B . n 
B 1 45  GLU 45  145 145 GLU GLU B . n 
B 1 46  GLN 46  146 146 GLN GLN B . n 
B 1 47  SER 47  147 147 SER SER B . n 
B 1 48  GLU 48  148 148 GLU GLU B . n 
B 1 49  GLY 49  149 149 GLY GLY B . n 
B 1 50  ILE 50  150 150 ILE ILE B . n 
B 1 51  VAL 51  151 151 VAL VAL B . n 
B 1 52  LYS 52  152 152 LYS LYS B . n 
B 1 53  LYS 53  153 153 LYS LYS B . n 
B 1 54  HIS 54  154 154 HIS HIS B . n 
B 1 55  LYS 55  155 155 LYS LYS B . n 
B 1 56  PRO 56  156 156 PRO PRO B . n 
B 1 57  GLU 57  157 157 GLU GLU B . n 
B 1 58  ILE 58  158 158 ILE ILE B . n 
B 1 59  LYS 59  159 ?   ?   ?   B . n 
B 1 60  GLY 60  160 ?   ?   ?   B . n 
B 1 61  ASN 61  161 ?   ?   ?   B . n 
B 1 62  MSE 62  162 ?   ?   ?   B . n 
B 1 63  SER 63  163 ?   ?   ?   B . n 
B 1 64  GLY 64  164 ?   ?   ?   B . n 
B 1 65  ASN 65  165 165 ASN ASN B . n 
B 1 66  PHE 66  166 166 PHE PHE B . n 
B 1 67  THR 67  167 167 THR THR B . n 
B 1 68  TYR 68  168 168 TYR TYR B . n 
B 1 69  ILE 69  169 169 ILE ILE B . n 
B 1 70  ILE 70  170 170 ILE ILE B . n 
B 1 71  ASP 71  171 171 ASP ASP B . n 
B 1 72  LYS 72  172 172 LYS LYS B . n 
B 1 73  LEU 73  173 173 LEU LEU B . n 
B 1 74  ILE 74  174 174 ILE ILE B . n 
B 1 75  PRO 75  175 175 PRO PRO B . n 
B 1 76  ASN 76  176 176 ASN ASN B . n 
B 1 77  THR 77  177 177 THR THR B . n 
B 1 78  ASN 78  178 178 ASN ASN B . n 
B 1 79  TYR 79  179 179 TYR TYR B . n 
B 1 80  CYS 80  180 180 CYS CYS B . n 
B 1 81  VAL 81  181 181 VAL VAL B . n 
B 1 82  SER 82  182 182 SER SER B . n 
B 1 83  VAL 83  183 183 VAL VAL B . n 
B 1 84  TYR 84  184 184 TYR TYR B . n 
B 1 85  LEU 85  185 185 LEU LEU B . n 
B 1 86  GLU 86  186 186 GLU GLU B . n 
B 1 87  HIS 87  187 187 HIS HIS B . n 
B 1 88  SER 88  188 188 SER SER B . n 
B 1 89  ASP 89  189 189 ASP ASP B . n 
B 1 90  GLU 90  190 ?   ?   ?   B . n 
B 1 91  GLN 91  191 191 GLN GLN B . n 
B 1 92  ALA 92  192 192 ALA ALA B . n 
B 1 93  VAL 93  193 193 VAL VAL B . n 
B 1 94  ILE 94  194 194 ILE ILE B . n 
B 1 95  LYS 95  195 195 LYS LYS B . n 
B 1 96  SER 96  196 196 SER SER B . n 
B 1 97  PRO 97  197 197 PRO PRO B . n 
B 1 98  LEU 98  198 198 LEU LEU B . n 
B 1 99  LYS 99  199 199 LYS LYS B . n 
B 1 100 CYS 100 200 200 CYS CYS B . n 
B 1 101 THR 101 201 201 THR THR B . n 
B 1 102 LEU 102 202 202 LEU LEU B . n 
B 1 103 LEU 103 203 203 LEU LEU B . n 
B 1 104 PRO 104 204 204 PRO PRO B . n 
B 1 105 PRO 105 205 205 PRO PRO B . n 
C 1 1   ALA 1   101 ?   ?   ?   C . n 
C 1 2   ASP 2   102 ?   ?   ?   C . n 
C 1 3   PRO 3   103 ?   ?   ?   C . n 
C 1 4   ASP 4   104 ?   ?   ?   C . n 
C 1 5   MSE 5   105 ?   ?   ?   C . n 
C 1 6   SER 6   106 106 SER SER C . n 
C 1 7   PHE 7   107 107 PHE PHE C . n 
C 1 8   GLU 8   108 108 GLU GLU C . n 
C 1 9   PRO 9   109 109 PRO PRO C . n 
C 1 10  PRO 10  110 110 PRO PRO C . n 
C 1 11  GLU 11  111 111 GLU GLU C . n 
C 1 12  PHE 12  112 112 PHE PHE C . n 
C 1 13  GLU 13  113 113 GLU GLU C . n 
C 1 14  ILE 14  114 114 ILE ILE C . n 
C 1 15  VAL 15  115 115 VAL VAL C . n 
C 1 16  GLY 16  116 116 GLY GLY C . n 
C 1 17  PHE 17  117 117 PHE PHE C . n 
C 1 18  THR 18  118 118 THR THR C . n 
C 1 19  ASN 19  119 119 ASN ASN C . n 
C 1 20  HIS 20  120 120 HIS HIS C . n 
C 1 21  ILE 21  121 121 ILE ILE C . n 
C 1 22  ASN 22  122 122 ASN ASN C . n 
C 1 23  VAL 23  123 123 VAL VAL C . n 
C 1 24  MSE 24  124 124 MSE MSE C . n 
C 1 25  VAL 25  125 125 VAL VAL C . n 
C 1 26  LYS 26  126 126 LYS LYS C . n 
C 1 27  PHE 27  127 127 PHE PHE C . n 
C 1 28  PRO 28  128 128 PRO PRO C . n 
C 1 29  SER 29  129 ?   ?   ?   C . n 
C 1 30  ILE 30  130 ?   ?   ?   C . n 
C 1 31  VAL 31  131 ?   ?   ?   C . n 
C 1 32  GLU 32  132 ?   ?   ?   C . n 
C 1 33  GLU 33  133 ?   ?   ?   C . n 
C 1 34  GLU 34  134 ?   ?   ?   C . n 
C 1 35  LEU 35  135 ?   ?   ?   C . n 
C 1 36  GLN 36  136 ?   ?   ?   C . n 
C 1 37  PHE 37  137 137 PHE PHE C . n 
C 1 38  ASP 38  138 138 ASP ASP C . n 
C 1 39  LEU 39  139 139 LEU LEU C . n 
C 1 40  SER 40  140 140 SER SER C . n 
C 1 41  LEU 41  141 141 LEU LEU C . n 
C 1 42  VAL 42  142 142 VAL VAL C . n 
C 1 43  ILE 43  143 143 ILE ILE C . n 
C 1 44  GLU 44  144 144 GLU GLU C . n 
C 1 45  GLU 45  145 145 GLU GLU C . n 
C 1 46  GLN 46  146 146 GLN GLN C . n 
C 1 47  SER 47  147 147 SER SER C . n 
C 1 48  GLU 48  148 148 GLU GLU C . n 
C 1 49  GLY 49  149 149 GLY GLY C . n 
C 1 50  ILE 50  150 150 ILE ILE C . n 
C 1 51  VAL 51  151 151 VAL VAL C . n 
C 1 52  LYS 52  152 152 LYS LYS C . n 
C 1 53  LYS 53  153 153 LYS LYS C . n 
C 1 54  HIS 54  154 154 HIS HIS C . n 
C 1 55  LYS 55  155 155 LYS LYS C . n 
C 1 56  PRO 56  156 156 PRO PRO C . n 
C 1 57  GLU 57  157 157 GLU GLU C . n 
C 1 58  ILE 58  158 158 ILE ILE C . n 
C 1 59  LYS 59  159 159 LYS LYS C . n 
C 1 60  GLY 60  160 160 GLY GLY C . n 
C 1 61  ASN 61  161 161 ASN ASN C . n 
C 1 62  MSE 62  162 162 MSE MSE C . n 
C 1 63  SER 63  163 163 SER SER C . n 
C 1 64  GLY 64  164 164 GLY GLY C . n 
C 1 65  ASN 65  165 165 ASN ASN C . n 
C 1 66  PHE 66  166 166 PHE PHE C . n 
C 1 67  THR 67  167 167 THR THR C . n 
C 1 68  TYR 68  168 168 TYR TYR C . n 
C 1 69  ILE 69  169 169 ILE ILE C . n 
C 1 70  ILE 70  170 170 ILE ILE C . n 
C 1 71  ASP 71  171 171 ASP ASP C . n 
C 1 72  LYS 72  172 172 LYS LYS C . n 
C 1 73  LEU 73  173 173 LEU LEU C . n 
C 1 74  ILE 74  174 174 ILE ILE C . n 
C 1 75  PRO 75  175 175 PRO PRO C . n 
C 1 76  ASN 76  176 176 ASN ASN C . n 
C 1 77  THR 77  177 177 THR THR C . n 
C 1 78  ASN 78  178 178 ASN ASN C . n 
C 1 79  TYR 79  179 179 TYR TYR C . n 
C 1 80  CYS 80  180 180 CYS CYS C . n 
C 1 81  VAL 81  181 181 VAL VAL C . n 
C 1 82  SER 82  182 182 SER SER C . n 
C 1 83  VAL 83  183 183 VAL VAL C . n 
C 1 84  TYR 84  184 184 TYR TYR C . n 
C 1 85  LEU 85  185 185 LEU LEU C . n 
C 1 86  GLU 86  186 186 GLU GLU C . n 
C 1 87  HIS 87  187 187 HIS HIS C . n 
C 1 88  SER 88  188 188 SER SER C . n 
C 1 89  ASP 89  189 189 ASP ASP C . n 
C 1 90  GLU 90  190 190 GLU GLU C . n 
C 1 91  GLN 91  191 191 GLN GLN C . n 
C 1 92  ALA 92  192 192 ALA ALA C . n 
C 1 93  VAL 93  193 193 VAL VAL C . n 
C 1 94  ILE 94  194 194 ILE ILE C . n 
C 1 95  LYS 95  195 195 LYS LYS C . n 
C 1 96  SER 96  196 196 SER SER C . n 
C 1 97  PRO 97  197 197 PRO PRO C . n 
C 1 98  LEU 98  198 198 LEU LEU C . n 
C 1 99  LYS 99  199 199 LYS LYS C . n 
C 1 100 CYS 100 200 200 CYS CYS C . n 
C 1 101 THR 101 201 201 THR THR C . n 
C 1 102 LEU 102 202 202 LEU LEU C . n 
C 1 103 LEU 103 203 203 LEU LEU C . n 
C 1 104 PRO 104 204 204 PRO PRO C . n 
C 1 105 PRO 105 205 205 PRO PRO C . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 24 A MSE 124 ? MET SELENOMETHIONINE 
2 B MSE 24 B MSE 124 ? MET SELENOMETHIONINE 
3 C MSE 24 C MSE 124 ? MET SELENOMETHIONINE 
4 C MSE 62 C MSE 162 ? MET SELENOMETHIONINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
3 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,F 
2 1 B,G   
3 1 C,E,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-08-31 
2 'Structure model' 1 1 2012-03-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         25.2747 
_pdbx_refine_tls.origin_y         -26.4021 
_pdbx_refine_tls.origin_z         0.5411 
_pdbx_refine_tls.T[1][1]          0.1170 
_pdbx_refine_tls.T[2][2]          0.1367 
_pdbx_refine_tls.T[3][3]          0.1371 
_pdbx_refine_tls.T[1][2]          -0.0234 
_pdbx_refine_tls.T[1][3]          0.0032 
_pdbx_refine_tls.T[2][3]          -0.0365 
_pdbx_refine_tls.L[1][1]          0.7434 
_pdbx_refine_tls.L[2][2]          0.2268 
_pdbx_refine_tls.L[3][3]          1.0209 
_pdbx_refine_tls.L[1][2]          0.3010 
_pdbx_refine_tls.L[1][3]          -0.6159 
_pdbx_refine_tls.L[2][3]          -0.0223 
_pdbx_refine_tls.S[1][1]          -0.0554 
_pdbx_refine_tls.S[1][2]          0.0162 
_pdbx_refine_tls.S[1][3]          0.0050 
_pdbx_refine_tls.S[2][1]          0.0430 
_pdbx_refine_tls.S[2][2]          0.0463 
_pdbx_refine_tls.S[2][3]          -0.0223 
_pdbx_refine_tls.S[3][1]          -0.0029 
_pdbx_refine_tls.S[3][2]          -0.0412 
_pdbx_refine_tls.S[3][3]          -0.0014 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice   'data collection' . ? 1 
autoSHARP phasing           . ? 2 
PHENIX    refinement        . ? 3 
XDS       'data reduction'  . ? 4 
XSCALE    'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 157 ? ? -68.02  99.95   
2 1 ASN A 176 ? ? 73.54   36.44   
3 1 ASP C 171 ? ? -114.35 -169.74 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 126 ? CG  ? A LYS 26 CG  
2  1 Y 1 A LYS 126 ? CD  ? A LYS 26 CD  
3  1 Y 1 A LYS 126 ? CE  ? A LYS 26 CE  
4  1 Y 1 A LYS 126 ? NZ  ? A LYS 26 NZ  
5  1 Y 1 A PHE 127 ? CG  ? A PHE 27 CG  
6  1 Y 1 A PHE 127 ? CD1 ? A PHE 27 CD1 
7  1 Y 1 A PHE 127 ? CD2 ? A PHE 27 CD2 
8  1 Y 1 A PHE 127 ? CE1 ? A PHE 27 CE1 
9  1 Y 1 A PHE 127 ? CE2 ? A PHE 27 CE2 
10 1 Y 1 A PHE 127 ? CZ  ? A PHE 27 CZ  
11 1 Y 1 A SER 140 ? OG  ? A SER 40 OG  
12 1 Y 1 A ILE 158 ? CG1 ? A ILE 58 CG1 
13 1 Y 1 A ILE 158 ? CG2 ? A ILE 58 CG2 
14 1 Y 1 A ILE 158 ? CD1 ? A ILE 58 CD1 
15 1 Y 1 A HIS 187 ? CG  ? A HIS 87 CG  
16 1 Y 1 A HIS 187 ? ND1 ? A HIS 87 ND1 
17 1 Y 1 A HIS 187 ? CD2 ? A HIS 87 CD2 
18 1 Y 1 A HIS 187 ? CE1 ? A HIS 87 CE1 
19 1 Y 1 A HIS 187 ? NE2 ? A HIS 87 NE2 
20 1 Y 1 B LYS 126 ? CG  ? B LYS 26 CG  
21 1 Y 1 B LYS 126 ? CD  ? B LYS 26 CD  
22 1 Y 1 B LYS 126 ? CE  ? B LYS 26 CE  
23 1 Y 1 B LYS 126 ? NZ  ? B LYS 26 NZ  
24 1 Y 1 B LEU 139 ? CG  ? B LEU 39 CG  
25 1 Y 1 B LEU 139 ? CD1 ? B LEU 39 CD1 
26 1 Y 1 B LEU 139 ? CD2 ? B LEU 39 CD2 
27 1 Y 1 B GLU 157 ? CG  ? B GLU 57 CG  
28 1 Y 1 B GLU 157 ? CD  ? B GLU 57 CD  
29 1 Y 1 B GLU 157 ? OE1 ? B GLU 57 OE1 
30 1 Y 1 B GLU 157 ? OE2 ? B GLU 57 OE2 
31 1 Y 1 B HIS 187 ? CG  ? B HIS 87 CG  
32 1 Y 1 B HIS 187 ? ND1 ? B HIS 87 ND1 
33 1 Y 1 B HIS 187 ? CD2 ? B HIS 87 CD2 
34 1 Y 1 B HIS 187 ? CE1 ? B HIS 87 CE1 
35 1 Y 1 B HIS 187 ? NE2 ? B HIS 87 NE2 
36 1 Y 1 B SER 188 ? OG  ? B SER 88 OG  
37 1 Y 1 B ASP 189 ? CG  ? B ASP 89 CG  
38 1 Y 1 B ASP 189 ? OD1 ? B ASP 89 OD1 
39 1 Y 1 B ASP 189 ? OD2 ? B ASP 89 OD2 
40 1 Y 1 B GLN 191 ? CG  ? B GLN 91 CG  
41 1 Y 1 B GLN 191 ? CD  ? B GLN 91 CD  
42 1 Y 1 B GLN 191 ? OE1 ? B GLN 91 OE1 
43 1 Y 1 B GLN 191 ? NE2 ? B GLN 91 NE2 
44 1 Y 1 C SER 106 ? OG  ? C SER 6  OG  
45 1 Y 1 C GLU 113 ? CG  ? C GLU 13 CG  
46 1 Y 1 C GLU 113 ? CD  ? C GLU 13 CD  
47 1 Y 1 C GLU 113 ? OE1 ? C GLU 13 OE1 
48 1 Y 1 C GLU 113 ? OE2 ? C GLU 13 OE2 
49 1 Y 1 C PHE 137 ? CG  ? C PHE 37 CG  
50 1 Y 1 C PHE 137 ? CD1 ? C PHE 37 CD1 
51 1 Y 1 C PHE 137 ? CD2 ? C PHE 37 CD2 
52 1 Y 1 C PHE 137 ? CE1 ? C PHE 37 CE1 
53 1 Y 1 C PHE 137 ? CE2 ? C PHE 37 CE2 
54 1 Y 1 C PHE 137 ? CZ  ? C PHE 37 CZ  
55 1 Y 1 C ASP 138 ? CG  ? C ASP 38 CG  
56 1 Y 1 C ASP 138 ? OD1 ? C ASP 38 OD1 
57 1 Y 1 C ASP 138 ? OD2 ? C ASP 38 OD2 
58 1 Y 1 C GLU 148 ? CG  ? C GLU 48 CG  
59 1 Y 1 C GLU 148 ? CD  ? C GLU 48 CD  
60 1 Y 1 C GLU 148 ? OE1 ? C GLU 48 OE1 
61 1 Y 1 C GLU 148 ? OE2 ? C GLU 48 OE2 
62 1 Y 1 C LYS 172 ? CG  ? C LYS 72 CG  
63 1 Y 1 C LYS 172 ? CD  ? C LYS 72 CD  
64 1 Y 1 C LYS 172 ? CE  ? C LYS 72 CE  
65 1 Y 1 C LYS 172 ? NZ  ? C LYS 72 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 101 ? A ALA 1  
2  1 Y 1 A ASP 102 ? A ASP 2  
3  1 Y 1 A PRO 103 ? A PRO 3  
4  1 Y 1 A ASP 104 ? A ASP 4  
5  1 Y 1 A MSE 105 ? A MSE 5  
6  1 Y 1 A PRO 128 ? A PRO 28 
7  1 Y 1 A SER 129 ? A SER 29 
8  1 Y 1 A ILE 130 ? A ILE 30 
9  1 Y 1 A VAL 131 ? A VAL 31 
10 1 Y 1 A GLU 132 ? A GLU 32 
11 1 Y 1 A GLU 133 ? A GLU 33 
12 1 Y 1 A GLU 134 ? A GLU 34 
13 1 Y 1 A LEU 135 ? A LEU 35 
14 1 Y 1 A GLN 136 ? A GLN 36 
15 1 Y 1 A PHE 137 ? A PHE 37 
16 1 Y 1 A ASP 138 ? A ASP 38 
17 1 Y 1 A LEU 139 ? A LEU 39 
18 1 Y 1 A LYS 159 ? A LYS 59 
19 1 Y 1 A GLY 160 ? A GLY 60 
20 1 Y 1 A ASN 161 ? A ASN 61 
21 1 Y 1 A MSE 162 ? A MSE 62 
22 1 Y 1 A SER 163 ? A SER 63 
23 1 Y 1 A GLY 164 ? A GLY 64 
24 1 Y 1 A SER 188 ? A SER 88 
25 1 Y 1 A ASP 189 ? A ASP 89 
26 1 Y 1 A GLU 190 ? A GLU 90 
27 1 Y 1 A GLN 191 ? A GLN 91 
28 1 Y 1 A ALA 192 ? A ALA 92 
29 1 Y 1 B ALA 101 ? B ALA 1  
30 1 Y 1 B ASP 102 ? B ASP 2  
31 1 Y 1 B PRO 103 ? B PRO 3  
32 1 Y 1 B ASP 104 ? B ASP 4  
33 1 Y 1 B MSE 105 ? B MSE 5  
34 1 Y 1 B SER 106 ? B SER 6  
35 1 Y 1 B PRO 128 ? B PRO 28 
36 1 Y 1 B SER 129 ? B SER 29 
37 1 Y 1 B ILE 130 ? B ILE 30 
38 1 Y 1 B VAL 131 ? B VAL 31 
39 1 Y 1 B GLU 132 ? B GLU 32 
40 1 Y 1 B GLU 133 ? B GLU 33 
41 1 Y 1 B GLU 134 ? B GLU 34 
42 1 Y 1 B LEU 135 ? B LEU 35 
43 1 Y 1 B GLN 136 ? B GLN 36 
44 1 Y 1 B PHE 137 ? B PHE 37 
45 1 Y 1 B ASP 138 ? B ASP 38 
46 1 Y 1 B LYS 159 ? B LYS 59 
47 1 Y 1 B GLY 160 ? B GLY 60 
48 1 Y 1 B ASN 161 ? B ASN 61 
49 1 Y 1 B MSE 162 ? B MSE 62 
50 1 Y 1 B SER 163 ? B SER 63 
51 1 Y 1 B GLY 164 ? B GLY 64 
52 1 Y 1 B GLU 190 ? B GLU 90 
53 1 Y 1 C ALA 101 ? C ALA 1  
54 1 Y 1 C ASP 102 ? C ASP 2  
55 1 Y 1 C PRO 103 ? C PRO 3  
56 1 Y 1 C ASP 104 ? C ASP 4  
57 1 Y 1 C MSE 105 ? C MSE 5  
58 1 Y 1 C SER 129 ? C SER 29 
59 1 Y 1 C ILE 130 ? C ILE 30 
60 1 Y 1 C VAL 131 ? C VAL 31 
61 1 Y 1 C GLU 132 ? C GLU 32 
62 1 Y 1 C GLU 133 ? C GLU 33 
63 1 Y 1 C GLU 134 ? C GLU 34 
64 1 Y 1 C LEU 135 ? C LEU 35 
65 1 Y 1 C GLN 136 ? C GLN 36 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 CL  1  1   1  CL  CL  A . 
E 2 CL  1  1   1  CL  CL  C . 
F 3 HOH 1  5   5  HOH HOH A . 
F 3 HOH 2  6   6  HOH HOH A . 
F 3 HOH 3  7   7  HOH HOH A . 
F 3 HOH 4  14  14 HOH HOH A . 
F 3 HOH 5  18  18 HOH HOH A . 
F 3 HOH 6  20  20 HOH HOH A . 
F 3 HOH 7  26  26 HOH HOH A . 
F 3 HOH 8  28  28 HOH HOH A . 
F 3 HOH 9  30  30 HOH HOH A . 
F 3 HOH 10 32  32 HOH HOH A . 
F 3 HOH 11 34  34 HOH HOH A . 
F 3 HOH 12 35  35 HOH HOH A . 
F 3 HOH 13 206 1  HOH HOH A . 
G 3 HOH 1  2   2  HOH HOH B . 
G 3 HOH 2  3   3  HOH HOH B . 
G 3 HOH 3  4   4  HOH HOH B . 
G 3 HOH 4  11  11 HOH HOH B . 
G 3 HOH 5  12  12 HOH HOH B . 
G 3 HOH 6  15  15 HOH HOH B . 
G 3 HOH 7  16  16 HOH HOH B . 
G 3 HOH 8  21  21 HOH HOH B . 
G 3 HOH 9  24  24 HOH HOH B . 
G 3 HOH 10 29  29 HOH HOH B . 
G 3 HOH 11 31  31 HOH HOH B . 
G 3 HOH 12 33  33 HOH HOH B . 
H 3 HOH 1  8   8  HOH HOH C . 
H 3 HOH 2  9   9  HOH HOH C . 
H 3 HOH 3  10  10 HOH HOH C . 
H 3 HOH 4  13  13 HOH HOH C . 
H 3 HOH 5  17  17 HOH HOH C . 
H 3 HOH 6  19  19 HOH HOH C . 
H 3 HOH 7  22  22 HOH HOH C . 
H 3 HOH 8  23  23 HOH HOH C . 
H 3 HOH 9  25  25 HOH HOH C . 
H 3 HOH 10 27  27 HOH HOH C . 
#