data_3SDI
# 
_entry.id   3SDI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SDI         
RCSB  RCSB066070   
WWPDB D_1000066070 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3MG4 . unspecified 
PDB 3MG6 . unspecified 
PDB 3MG7 . unspecified 
PDB 3MG8 . unspecified 
PDB 3OEU . unspecified 
PDB 3OEV . unspecified 
PDB 3SDK . unspecified 
# 
_pdbx_database_status.entry_id                        3SDI 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-09 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Sintchak, M.D.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
;Optimization of a series of dipeptides with a P3 threonine residue as non-covalent inhibitors of the chymotrypsin-like activity of the human 20S proteasome.
;
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            20 
_citation.page_first                6581 
_citation.page_last                 6586 
_citation.year                      2010 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20875739 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2010.09.032 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blackburn, C.'  1  
primary 'Barrett, C.'    2  
primary 'Blank, J.L.'    3  
primary 'Bruzzese, F.J.' 4  
primary 'Bump, N.'       5  
primary 'Dick, L.R.'     6  
primary 'Fleming, P.'    7  
primary 'Garcia, K.'     8  
primary 'Hales, P.'      9  
primary 'Hu, Z.'         10 
primary 'Jones, M.'      11 
primary 'Liu, J.X.'      12 
primary 'Sappal, D.S.'   13 
primary 'Sintchak, M.D.' 14 
primary 'Tsu, C.'        15 
primary 'Gigstad, K.M.'  16 
# 
_cell.length_a           136.600 
_cell.length_b           299.450 
_cell.length_c           145.483 
_cell.angle_alpha        90.000 
_cell.angle_beta         113.170 
_cell.angle_gamma        90.000 
_cell.entry_id           3SDI 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         3SDI 
_symmetry.Int_Tables_number                4 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Proteasome component Y7' 27191.828 2  3.4.25.1 ? ? ? 
2  polymer     nat 'Proteasome component Y13' 25968.258 2  3.4.25.1 ? ? ? 
3  polymer     nat 'Proteasome component PRE6' 26903.330 2  3.4.25.1 ? ? ? 
4  polymer     nat 'Proteasome component PUP2' 28649.086 2  3.4.25.1 ? ? ? 
5  polymer     nat 'Proteasome component PRE5' 25410.709 2  3.4.25.1 ? ? ? 
6  polymer     nat 'Proteasome component C1' 26734.328 2  3.4.25.1 ? ? ? 
7  polymer     nat 'Proteasome component C7-alpha' 27316.037 2  3.4.25.1 ? ? ? 
8  polymer     nat 'Proteasome component PUP1' 23987.254 2  3.4.25.1 ? ? ? 
9  polymer     nat 'Proteasome component PUP3' 22496.645 2  3.4.25.1 ? ? ? 
10 polymer     nat 'Proteasome component C11' 22545.676 2  3.4.25.1 ? ? ? 
11 polymer     nat 'Proteasome component PRE2' 23325.248 2  3.4.25.1 ? ? ? 
12 polymer     nat 'Proteasome component C5' 24883.928 2  3.4.25.1 ? ? ? 
13 polymer     nat 'Proteasome component PRE4' 25945.496 2  3.4.25.1 ? ? ? 
14 polymer     nat 'Proteasome component PRE3' 21517.186 2  3.4.25.1 ? ? ? 
15 non-polymer syn 'MAGNESIUM ION' 24.305    20 ?        ? ? ? 
16 non-polymer syn 
;N~4~-(2,2-dimethylpropyl)-N~1~-{(2S)-1-[(4-methylbenzyl)amino]-1-oxo-4-phenylbutan-2-yl}-N~2~-[(5-methyl-1,2-oxazol-3-yl)carbonyl]-L-aspartamide
;
575.698   2  ?        ? ? ? 
17 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   2  ?        ? ? ? 
18 water       nat water 18.015    1  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Macropain subunit Y7, Multicatalytic endopeptidase complex subunit Y7, Proteinase YSCE subunit 7' 
2  'Macropain subunit Y13, Multicatalytic endopeptidase complex subunit Y13, Proteinase YSCE subunit 13' 
3  'Macropain subunit PRE6, Multicatalytic endopeptidase complex subunit PRE6, Proteinase YSCE subunit PRE6' 
4  'Macropain subunit PUP2, Multicatalytic endopeptidase complex subunit PUP2, Proteinase YSCE subunit PUP2' 
5  'Macropain subunit PRE5, Multicatalytic endopeptidase complex subunit PRE5, Proteinase YSCE subunit PRE5' 
6  'Macropain subunit C1, Multicatalytic endopeptidase complex subunit C1, Proteinase YSCE subunit 1' 
7  
;Macropain subunit C7-alpha, Multicatalytic endopeptidase complex C7, Proteasome component Y8, Proteinase YSCE subunit 7, SCL1 suppressor protein
;
8  'Macropain subunit PUP1, Multicatalytic endopeptidase complex subunit PUP1, Proteinase YSCE subunit PUP1' 
9  'Macropain subunit PUP3, Multicatalytic endopeptidase complex subunit PUP3' 
10 'Macropain subunit C11, Multicatalytic endopeptidase complex subunit C11, Proteinase YSCE subunit 11' 
11 'Macropain subunit PRE2, Multicatalytic endopeptidase complex subunit PRE2, Proteinase YSCE subunit PRE2' 
12 'Multicatalytic endopeptidase complex subunit C5' 
13 'Macropain subunit PRE4, Multicatalytic endopeptidase complex subunit PRE4, Proteinase YSCE subunit PRE4' 
14 'Macropain subunit PRE3, Multicatalytic endopeptidase complex subunit PRE3, Proteinase YSCE subunit PRE3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGP
DYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWK
ATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL
;
;MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGP
DYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWK
ATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL
;
A,O ? 
2  'polypeptide(L)' no no 
;TIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINT
ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTS
AAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT
;
;TIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINT
ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTS
AAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT
;
B,P ? 
3  'polypeptide(L)' no no 
;GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADS
RILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQ
TIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE
Q
;
;GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADS
RILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQ
TIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE
Q
;
C,Q ? 
4  'polypeptide(L)' no no 
;MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSG
LTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEP
SGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS
;
;MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSG
LTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEP
SGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS
;
D,R ? 
5  'polypeptide(L)' no no 
;FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDA
RVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSAGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAI
GARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
;
;FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDA
RVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSAGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAI
GARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
;
E,S ? 
6  'polypeptide(L)' no no 
;GYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGR
HLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATG
KGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKE
IN
;
;GYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGR
HLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATG
KGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKE
IN
;
F,T ? 
7  'polypeptide(L)' no no 
;AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPD
ARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKAT
ATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIA
EQD
;
;AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPD
ARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKAT
ATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIA
EQD
;
G,U ? 
8  'polypeptide(L)' no no 
;TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL
QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ
AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD
;
;TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL
QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ
AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD
;
H,V ? 
9  'polypeptide(L)' no no 
;SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA
IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE
DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD
;
;SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA
IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE
DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD
;
I,W ? 
10 'polypeptide(L)' no no 
;MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAV
SSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL
LKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ
;
;MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAV
SSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL
LKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ
;
J,X ? 
11 'polypeptide(L)' no no 
;TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS
KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS
ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
;
;TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS
KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS
ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
;
K,Y ? 
12 'polypeptide(L)' no no 
;QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN
DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY
EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD
;
;QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN
DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY
EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD
;
L,Z ? 
13 'polypeptide(L)' no no 
;TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPL
ADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVD
RESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI
;
;TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPL
ADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVD
RESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI
;
M,1 ? 
14 'polypeptide(L)' no no 
;TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS
VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS
QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL
;
;TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS
VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS
QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL
;
N,2 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   ASP n 
1  4   ARG n 
1  5   TYR n 
1  6   SER n 
1  7   PHE n 
1  8   SER n 
1  9   LEU n 
1  10  THR n 
1  11  THR n 
1  12  PHE n 
1  13  SER n 
1  14  PRO n 
1  15  SER n 
1  16  GLY n 
1  17  LYS n 
1  18  LEU n 
1  19  GLY n 
1  20  GLN n 
1  21  ILE n 
1  22  ASP n 
1  23  TYR n 
1  24  ALA n 
1  25  LEU n 
1  26  THR n 
1  27  ALA n 
1  28  VAL n 
1  29  LYS n 
1  30  GLN n 
1  31  GLY n 
1  32  VAL n 
1  33  THR n 
1  34  SER n 
1  35  LEU n 
1  36  GLY n 
1  37  ILE n 
1  38  LYS n 
1  39  ALA n 
1  40  THR n 
1  41  ASN n 
1  42  GLY n 
1  43  VAL n 
1  44  VAL n 
1  45  ILE n 
1  46  ALA n 
1  47  THR n 
1  48  GLU n 
1  49  LYS n 
1  50  LYS n 
1  51  SER n 
1  52  SER n 
1  53  SER n 
1  54  PRO n 
1  55  LEU n 
1  56  ALA n 
1  57  MET n 
1  58  SER n 
1  59  GLU n 
1  60  THR n 
1  61  LEU n 
1  62  SER n 
1  63  LYS n 
1  64  VAL n 
1  65  SER n 
1  66  LEU n 
1  67  LEU n 
1  68  THR n 
1  69  PRO n 
1  70  ASP n 
1  71  ILE n 
1  72  GLY n 
1  73  ALA n 
1  74  VAL n 
1  75  TYR n 
1  76  SER n 
1  77  GLY n 
1  78  MET n 
1  79  GLY n 
1  80  PRO n 
1  81  ASP n 
1  82  TYR n 
1  83  ARG n 
1  84  VAL n 
1  85  LEU n 
1  86  VAL n 
1  87  ASP n 
1  88  LYS n 
1  89  SER n 
1  90  ARG n 
1  91  LYS n 
1  92  VAL n 
1  93  ALA n 
1  94  HIS n 
1  95  THR n 
1  96  SER n 
1  97  TYR n 
1  98  LYS n 
1  99  ARG n 
1  100 ILE n 
1  101 TYR n 
1  102 GLY n 
1  103 GLU n 
1  104 TYR n 
1  105 PRO n 
1  106 PRO n 
1  107 THR n 
1  108 LYS n 
1  109 LEU n 
1  110 LEU n 
1  111 VAL n 
1  112 SER n 
1  113 GLU n 
1  114 VAL n 
1  115 ALA n 
1  116 LYS n 
1  117 ILE n 
1  118 MET n 
1  119 GLN n 
1  120 GLU n 
1  121 ALA n 
1  122 THR n 
1  123 GLN n 
1  124 SER n 
1  125 GLY n 
1  126 GLY n 
1  127 VAL n 
1  128 ARG n 
1  129 PRO n 
1  130 PHE n 
1  131 GLY n 
1  132 VAL n 
1  133 SER n 
1  134 LEU n 
1  135 LEU n 
1  136 ILE n 
1  137 ALA n 
1  138 GLY n 
1  139 HIS n 
1  140 ASP n 
1  141 GLU n 
1  142 PHE n 
1  143 ASN n 
1  144 GLY n 
1  145 PHE n 
1  146 SER n 
1  147 LEU n 
1  148 TYR n 
1  149 GLN n 
1  150 VAL n 
1  151 ASP n 
1  152 PRO n 
1  153 SER n 
1  154 GLY n 
1  155 SER n 
1  156 TYR n 
1  157 PHE n 
1  158 PRO n 
1  159 TRP n 
1  160 LYS n 
1  161 ALA n 
1  162 THR n 
1  163 ALA n 
1  164 ILE n 
1  165 GLY n 
1  166 LYS n 
1  167 GLY n 
1  168 SER n 
1  169 VAL n 
1  170 ALA n 
1  171 ALA n 
1  172 LYS n 
1  173 THR n 
1  174 PHE n 
1  175 LEU n 
1  176 GLU n 
1  177 LYS n 
1  178 ARG n 
1  179 TRP n 
1  180 ASN n 
1  181 ASP n 
1  182 GLU n 
1  183 LEU n 
1  184 GLU n 
1  185 LEU n 
1  186 GLU n 
1  187 ASP n 
1  188 ALA n 
1  189 ILE n 
1  190 HIS n 
1  191 ILE n 
1  192 ALA n 
1  193 LEU n 
1  194 LEU n 
1  195 THR n 
1  196 LEU n 
1  197 LYS n 
1  198 GLU n 
1  199 SER n 
1  200 VAL n 
1  201 GLU n 
1  202 GLY n 
1  203 GLU n 
1  204 PHE n 
1  205 ASN n 
1  206 GLY n 
1  207 ASP n 
1  208 THR n 
1  209 ILE n 
1  210 GLU n 
1  211 LEU n 
1  212 ALA n 
1  213 ILE n 
1  214 ILE n 
1  215 GLY n 
1  216 ASP n 
1  217 GLU n 
1  218 ASN n 
1  219 PRO n 
1  220 ASP n 
1  221 LEU n 
1  222 LEU n 
1  223 GLY n 
1  224 TYR n 
1  225 THR n 
1  226 GLY n 
1  227 ILE n 
1  228 PRO n 
1  229 THR n 
1  230 ASP n 
1  231 LYS n 
1  232 GLY n 
1  233 PRO n 
1  234 ARG n 
1  235 PHE n 
1  236 ARG n 
1  237 LYS n 
1  238 LEU n 
1  239 THR n 
1  240 SER n 
1  241 GLN n 
1  242 GLU n 
1  243 ILE n 
1  244 ASN n 
1  245 ASP n 
1  246 ARG n 
1  247 LEU n 
1  248 GLU n 
1  249 ALA n 
1  250 LEU n 
2  1   THR n 
2  2   ILE n 
2  3   PHE n 
2  4   SER n 
2  5   PRO n 
2  6   GLU n 
2  7   GLY n 
2  8   ARG n 
2  9   LEU n 
2  10  TYR n 
2  11  GLN n 
2  12  VAL n 
2  13  GLU n 
2  14  TYR n 
2  15  ALA n 
2  16  LEU n 
2  17  GLU n 
2  18  SER n 
2  19  ILE n 
2  20  SER n 
2  21  HIS n 
2  22  ALA n 
2  23  GLY n 
2  24  THR n 
2  25  ALA n 
2  26  ILE n 
2  27  GLY n 
2  28  ILE n 
2  29  MET n 
2  30  ALA n 
2  31  SER n 
2  32  ASP n 
2  33  GLY n 
2  34  ILE n 
2  35  VAL n 
2  36  LEU n 
2  37  ALA n 
2  38  ALA n 
2  39  GLU n 
2  40  ARG n 
2  41  LYS n 
2  42  VAL n 
2  43  THR n 
2  44  SER n 
2  45  THR n 
2  46  LEU n 
2  47  LEU n 
2  48  GLU n 
2  49  GLN n 
2  50  ASP n 
2  51  THR n 
2  52  SER n 
2  53  THR n 
2  54  GLU n 
2  55  LYS n 
2  56  LEU n 
2  57  TYR n 
2  58  LYS n 
2  59  LEU n 
2  60  ASN n 
2  61  ASP n 
2  62  LYS n 
2  63  ILE n 
2  64  ALA n 
2  65  VAL n 
2  66  ALA n 
2  67  VAL n 
2  68  ALA n 
2  69  GLY n 
2  70  LEU n 
2  71  THR n 
2  72  ALA n 
2  73  ASP n 
2  74  ALA n 
2  75  GLU n 
2  76  ILE n 
2  77  LEU n 
2  78  ILE n 
2  79  ASN n 
2  80  THR n 
2  81  ALA n 
2  82  ARG n 
2  83  ILE n 
2  84  HIS n 
2  85  ALA n 
2  86  GLN n 
2  87  ASN n 
2  88  TYR n 
2  89  LEU n 
2  90  LYS n 
2  91  THR n 
2  92  TYR n 
2  93  ASN n 
2  94  GLU n 
2  95  ASP n 
2  96  ILE n 
2  97  PRO n 
2  98  VAL n 
2  99  GLU n 
2  100 ILE n 
2  101 LEU n 
2  102 VAL n 
2  103 ARG n 
2  104 ARG n 
2  105 LEU n 
2  106 SER n 
2  107 ASP n 
2  108 ILE n 
2  109 LYS n 
2  110 GLN n 
2  111 GLY n 
2  112 TYR n 
2  113 THR n 
2  114 GLN n 
2  115 HIS n 
2  116 GLY n 
2  117 GLY n 
2  118 LEU n 
2  119 ARG n 
2  120 PRO n 
2  121 PHE n 
2  122 GLY n 
2  123 VAL n 
2  124 SER n 
2  125 PHE n 
2  126 ILE n 
2  127 TYR n 
2  128 ALA n 
2  129 GLY n 
2  130 TYR n 
2  131 ASP n 
2  132 ASP n 
2  133 ARG n 
2  134 TYR n 
2  135 GLY n 
2  136 TYR n 
2  137 GLN n 
2  138 LEU n 
2  139 TYR n 
2  140 THR n 
2  141 SER n 
2  142 ASN n 
2  143 PRO n 
2  144 SER n 
2  145 GLY n 
2  146 ASN n 
2  147 TYR n 
2  148 THR n 
2  149 GLY n 
2  150 TRP n 
2  151 LYS n 
2  152 ALA n 
2  153 ILE n 
2  154 SER n 
2  155 VAL n 
2  156 GLY n 
2  157 ALA n 
2  158 ASN n 
2  159 THR n 
2  160 SER n 
2  161 ALA n 
2  162 ALA n 
2  163 GLN n 
2  164 THR n 
2  165 LEU n 
2  166 LEU n 
2  167 GLN n 
2  168 MET n 
2  169 ASP n 
2  170 TYR n 
2  171 LYS n 
2  172 ASP n 
2  173 ASP n 
2  174 MET n 
2  175 LYS n 
2  176 VAL n 
2  177 ASP n 
2  178 ASP n 
2  179 ALA n 
2  180 ILE n 
2  181 GLU n 
2  182 LEU n 
2  183 ALA n 
2  184 LEU n 
2  185 LYS n 
2  186 THR n 
2  187 LEU n 
2  188 SER n 
2  189 LYS n 
2  190 THR n 
2  191 THR n 
2  192 ASP n 
2  193 SER n 
2  194 SER n 
2  195 ALA n 
2  196 LEU n 
2  197 THR n 
2  198 TYR n 
2  199 ASP n 
2  200 ARG n 
2  201 LEU n 
2  202 GLU n 
2  203 PHE n 
2  204 ALA n 
2  205 THR n 
2  206 ILE n 
2  207 ARG n 
2  208 LYS n 
2  209 GLY n 
2  210 ALA n 
2  211 ASN n 
2  212 ASP n 
2  213 GLY n 
2  214 GLU n 
2  215 VAL n 
2  216 TYR n 
2  217 GLN n 
2  218 LYS n 
2  219 ILE n 
2  220 PHE n 
2  221 LYS n 
2  222 PRO n 
2  223 GLN n 
2  224 GLU n 
2  225 ILE n 
2  226 LYS n 
2  227 ASP n 
2  228 ILE n 
2  229 LEU n 
2  230 VAL n 
2  231 LYS n 
2  232 THR n 
2  233 GLY n 
2  234 ILE n 
2  235 THR n 
3  1   GLY n 
3  2   TYR n 
3  3   ASP n 
3  4   ARG n 
3  5   ALA n 
3  6   LEU n 
3  7   SER n 
3  8   ILE n 
3  9   PHE n 
3  10  SER n 
3  11  PRO n 
3  12  ASP n 
3  13  GLY n 
3  14  HIS n 
3  15  ILE n 
3  16  PHE n 
3  17  GLN n 
3  18  VAL n 
3  19  GLU n 
3  20  TYR n 
3  21  ALA n 
3  22  LEU n 
3  23  GLU n 
3  24  ALA n 
3  25  VAL n 
3  26  LYS n 
3  27  ARG n 
3  28  GLY n 
3  29  THR n 
3  30  CYS n 
3  31  ALA n 
3  32  VAL n 
3  33  GLY n 
3  34  VAL n 
3  35  LYS n 
3  36  GLY n 
3  37  LYS n 
3  38  ASN n 
3  39  CYS n 
3  40  VAL n 
3  41  VAL n 
3  42  LEU n 
3  43  GLY n 
3  44  CYS n 
3  45  GLU n 
3  46  ARG n 
3  47  ARG n 
3  48  SER n 
3  49  THR n 
3  50  LEU n 
3  51  LYS n 
3  52  LEU n 
3  53  GLN n 
3  54  ASP n 
3  55  THR n 
3  56  ARG n 
3  57  ILE n 
3  58  THR n 
3  59  PRO n 
3  60  SER n 
3  61  LYS n 
3  62  VAL n 
3  63  SER n 
3  64  LYS n 
3  65  ILE n 
3  66  ASP n 
3  67  SER n 
3  68  HIS n 
3  69  VAL n 
3  70  VAL n 
3  71  LEU n 
3  72  SER n 
3  73  PHE n 
3  74  SER n 
3  75  GLY n 
3  76  LEU n 
3  77  ASN n 
3  78  ALA n 
3  79  ASP n 
3  80  SER n 
3  81  ARG n 
3  82  ILE n 
3  83  LEU n 
3  84  ILE n 
3  85  GLU n 
3  86  LYS n 
3  87  ALA n 
3  88  ARG n 
3  89  VAL n 
3  90  GLU n 
3  91  ALA n 
3  92  GLN n 
3  93  SER n 
3  94  HIS n 
3  95  ARG n 
3  96  LEU n 
3  97  THR n 
3  98  LEU n 
3  99  GLU n 
3  100 ASP n 
3  101 PRO n 
3  102 VAL n 
3  103 THR n 
3  104 VAL n 
3  105 GLU n 
3  106 TYR n 
3  107 LEU n 
3  108 THR n 
3  109 ARG n 
3  110 TYR n 
3  111 VAL n 
3  112 ALA n 
3  113 GLY n 
3  114 VAL n 
3  115 GLN n 
3  116 GLN n 
3  117 ARG n 
3  118 TYR n 
3  119 THR n 
3  120 GLN n 
3  121 SER n 
3  122 GLY n 
3  123 GLY n 
3  124 VAL n 
3  125 ARG n 
3  126 PRO n 
3  127 PHE n 
3  128 GLY n 
3  129 VAL n 
3  130 SER n 
3  131 THR n 
3  132 LEU n 
3  133 ILE n 
3  134 ALA n 
3  135 GLY n 
3  136 PHE n 
3  137 ASP n 
3  138 PRO n 
3  139 ARG n 
3  140 ASP n 
3  141 ASP n 
3  142 GLU n 
3  143 PRO n 
3  144 LYS n 
3  145 LEU n 
3  146 TYR n 
3  147 GLN n 
3  148 THR n 
3  149 GLU n 
3  150 PRO n 
3  151 SER n 
3  152 GLY n 
3  153 ILE n 
3  154 TYR n 
3  155 SER n 
3  156 SER n 
3  157 TRP n 
3  158 SER n 
3  159 ALA n 
3  160 GLN n 
3  161 THR n 
3  162 ILE n 
3  163 GLY n 
3  164 ARG n 
3  165 ASN n 
3  166 SER n 
3  167 LYS n 
3  168 THR n 
3  169 VAL n 
3  170 ARG n 
3  171 GLU n 
3  172 PHE n 
3  173 LEU n 
3  174 GLU n 
3  175 LYS n 
3  176 ASN n 
3  177 TYR n 
3  178 ASP n 
3  179 ARG n 
3  180 LYS n 
3  181 GLU n 
3  182 PRO n 
3  183 PRO n 
3  184 ALA n 
3  185 THR n 
3  186 VAL n 
3  187 GLU n 
3  188 GLU n 
3  189 CYS n 
3  190 VAL n 
3  191 LYS n 
3  192 LEU n 
3  193 THR n 
3  194 VAL n 
3  195 ARG n 
3  196 SER n 
3  197 LEU n 
3  198 LEU n 
3  199 GLU n 
3  200 VAL n 
3  201 VAL n 
3  202 GLN n 
3  203 THR n 
3  204 GLY n 
3  205 ALA n 
3  206 LYS n 
3  207 ASN n 
3  208 ILE n 
3  209 GLU n 
3  210 ILE n 
3  211 THR n 
3  212 VAL n 
3  213 VAL n 
3  214 LYS n 
3  215 PRO n 
3  216 ASP n 
3  217 SER n 
3  218 ASP n 
3  219 ILE n 
3  220 VAL n 
3  221 ALA n 
3  222 LEU n 
3  223 SER n 
3  224 SER n 
3  225 GLU n 
3  226 GLU n 
3  227 ILE n 
3  228 ASN n 
3  229 GLN n 
3  230 TYR n 
3  231 VAL n 
3  232 THR n 
3  233 GLN n 
3  234 ILE n 
3  235 GLU n 
3  236 GLN n 
3  237 GLU n 
3  238 LYS n 
3  239 GLN n 
3  240 GLU n 
3  241 GLN n 
4  1   MET n 
4  2   PHE n 
4  3   LEU n 
4  4   THR n 
4  5   ARG n 
4  6   SER n 
4  7   GLU n 
4  8   TYR n 
4  9   ASP n 
4  10  ARG n 
4  11  GLY n 
4  12  VAL n 
4  13  SER n 
4  14  THR n 
4  15  PHE n 
4  16  SER n 
4  17  PRO n 
4  18  GLU n 
4  19  GLY n 
4  20  ARG n 
4  21  LEU n 
4  22  PHE n 
4  23  GLN n 
4  24  VAL n 
4  25  GLU n 
4  26  TYR n 
4  27  SER n 
4  28  LEU n 
4  29  GLU n 
4  30  ALA n 
4  31  ILE n 
4  32  LYS n 
4  33  LEU n 
4  34  GLY n 
4  35  SER n 
4  36  THR n 
4  37  ALA n 
4  38  ILE n 
4  39  GLY n 
4  40  ILE n 
4  41  ALA n 
4  42  THR n 
4  43  LYS n 
4  44  GLU n 
4  45  GLY n 
4  46  VAL n 
4  47  VAL n 
4  48  LEU n 
4  49  GLY n 
4  50  VAL n 
4  51  GLU n 
4  52  LYS n 
4  53  ARG n 
4  54  ALA n 
4  55  THR n 
4  56  SER n 
4  57  PRO n 
4  58  LEU n 
4  59  LEU n 
4  60  GLU n 
4  61  SER n 
4  62  ASP n 
4  63  SER n 
4  64  ILE n 
4  65  GLU n 
4  66  LYS n 
4  67  ILE n 
4  68  VAL n 
4  69  GLU n 
4  70  ILE n 
4  71  ASP n 
4  72  ARG n 
4  73  HIS n 
4  74  ILE n 
4  75  GLY n 
4  76  CYS n 
4  77  ALA n 
4  78  MET n 
4  79  SER n 
4  80  GLY n 
4  81  LEU n 
4  82  THR n 
4  83  ALA n 
4  84  ASP n 
4  85  ALA n 
4  86  ARG n 
4  87  SER n 
4  88  MET n 
4  89  ILE n 
4  90  GLU n 
4  91  HIS n 
4  92  ALA n 
4  93  ARG n 
4  94  THR n 
4  95  ALA n 
4  96  ALA n 
4  97  VAL n 
4  98  THR n 
4  99  HIS n 
4  100 ASN n 
4  101 LEU n 
4  102 TYR n 
4  103 TYR n 
4  104 ASP n 
4  105 GLU n 
4  106 ASP n 
4  107 ILE n 
4  108 ASN n 
4  109 VAL n 
4  110 GLU n 
4  111 SER n 
4  112 LEU n 
4  113 THR n 
4  114 GLN n 
4  115 SER n 
4  116 VAL n 
4  117 CYS n 
4  118 ASP n 
4  119 LEU n 
4  120 ALA n 
4  121 LEU n 
4  122 ARG n 
4  123 PHE n 
4  124 GLY n 
4  125 GLU n 
4  126 GLY n 
4  127 ALA n 
4  128 SER n 
4  129 GLY n 
4  130 GLU n 
4  131 GLU n 
4  132 ARG n 
4  133 LEU n 
4  134 MET n 
4  135 SER n 
4  136 ARG n 
4  137 PRO n 
4  138 PHE n 
4  139 GLY n 
4  140 VAL n 
4  141 ALA n 
4  142 LEU n 
4  143 LEU n 
4  144 ILE n 
4  145 ALA n 
4  146 GLY n 
4  147 HIS n 
4  148 ASP n 
4  149 ALA n 
4  150 ASP n 
4  151 ASP n 
4  152 GLY n 
4  153 TYR n 
4  154 GLN n 
4  155 LEU n 
4  156 PHE n 
4  157 HIS n 
4  158 ALA n 
4  159 GLU n 
4  160 PRO n 
4  161 SER n 
4  162 GLY n 
4  163 THR n 
4  164 PHE n 
4  165 TYR n 
4  166 ARG n 
4  167 TYR n 
4  168 ASN n 
4  169 ALA n 
4  170 LYS n 
4  171 ALA n 
4  172 ILE n 
4  173 GLY n 
4  174 SER n 
4  175 GLY n 
4  176 SER n 
4  177 GLU n 
4  178 GLY n 
4  179 ALA n 
4  180 GLN n 
4  181 ALA n 
4  182 GLU n 
4  183 LEU n 
4  184 LEU n 
4  185 ASN n 
4  186 GLU n 
4  187 TRP n 
4  188 HIS n 
4  189 SER n 
4  190 SER n 
4  191 LEU n 
4  192 THR n 
4  193 LEU n 
4  194 LYS n 
4  195 GLU n 
4  196 ALA n 
4  197 GLU n 
4  198 LEU n 
4  199 LEU n 
4  200 VAL n 
4  201 LEU n 
4  202 LYS n 
4  203 ILE n 
4  204 LEU n 
4  205 LYS n 
4  206 GLN n 
4  207 VAL n 
4  208 MET n 
4  209 GLU n 
4  210 GLU n 
4  211 LYS n 
4  212 LEU n 
4  213 ASP n 
4  214 GLU n 
4  215 ASN n 
4  216 ASN n 
4  217 ALA n 
4  218 GLN n 
4  219 LEU n 
4  220 SER n 
4  221 CYS n 
4  222 ILE n 
4  223 THR n 
4  224 LYS n 
4  225 GLN n 
4  226 ASP n 
4  227 GLY n 
4  228 PHE n 
4  229 LYS n 
4  230 ILE n 
4  231 TYR n 
4  232 ASP n 
4  233 ASN n 
4  234 GLU n 
4  235 LYS n 
4  236 THR n 
4  237 ALA n 
4  238 GLU n 
4  239 LEU n 
4  240 ILE n 
4  241 LYS n 
4  242 GLU n 
4  243 LEU n 
4  244 LYS n 
4  245 GLU n 
4  246 LYS n 
4  247 GLU n 
4  248 ALA n 
4  249 ALA n 
4  250 GLU n 
4  251 SER n 
4  252 PRO n 
4  253 GLU n 
4  254 GLU n 
4  255 ALA n 
4  256 ASP n 
4  257 VAL n 
4  258 GLU n 
4  259 MET n 
4  260 SER n 
5  1   PHE n 
5  2   ARG n 
5  3   ASN n 
5  4   ASN n 
5  5   TYR n 
5  6   ASP n 
5  7   GLY n 
5  8   ASP n 
5  9   THR n 
5  10  VAL n 
5  11  THR n 
5  12  PHE n 
5  13  SER n 
5  14  PRO n 
5  15  THR n 
5  16  GLY n 
5  17  ARG n 
5  18  LEU n 
5  19  PHE n 
5  20  GLN n 
5  21  VAL n 
5  22  GLU n 
5  23  TYR n 
5  24  ALA n 
5  25  LEU n 
5  26  GLU n 
5  27  ALA n 
5  28  ILE n 
5  29  LYS n 
5  30  GLN n 
5  31  GLY n 
5  32  SER n 
5  33  VAL n 
5  34  THR n 
5  35  VAL n 
5  36  GLY n 
5  37  LEU n 
5  38  ARG n 
5  39  SER n 
5  40  ASN n 
5  41  THR n 
5  42  HIS n 
5  43  ALA n 
5  44  VAL n 
5  45  LEU n 
5  46  VAL n 
5  47  ALA n 
5  48  LEU n 
5  49  LYS n 
5  50  ARG n 
5  51  ASN n 
5  52  ALA n 
5  53  ASP n 
5  54  GLU n 
5  55  LEU n 
5  56  SER n 
5  57  SER n 
5  58  TYR n 
5  59  GLN n 
5  60  LYS n 
5  61  LYS n 
5  62  ILE n 
5  63  ILE n 
5  64  LYS n 
5  65  CYS n 
5  66  ASP n 
5  67  GLU n 
5  68  HIS n 
5  69  MET n 
5  70  GLY n 
5  71  LEU n 
5  72  SER n 
5  73  LEU n 
5  74  ALA n 
5  75  GLY n 
5  76  LEU n 
5  77  ALA n 
5  78  PRO n 
5  79  ASP n 
5  80  ALA n 
5  81  ARG n 
5  82  VAL n 
5  83  LEU n 
5  84  SER n 
5  85  ASN n 
5  86  TYR n 
5  87  LEU n 
5  88  ARG n 
5  89  GLN n 
5  90  GLN n 
5  91  CYS n 
5  92  ASN n 
5  93  TYR n 
5  94  SER n 
5  95  SER n 
5  96  LEU n 
5  97  VAL n 
5  98  PHE n 
5  99  ASN n 
5  100 ARG n 
5  101 LYS n 
5  102 LEU n 
5  103 ALA n 
5  104 VAL n 
5  105 GLU n 
5  106 ARG n 
5  107 ALA n 
5  108 GLY n 
5  109 HIS n 
5  110 LEU n 
5  111 LEU n 
5  112 CYS n 
5  113 ASP n 
5  114 LYS n 
5  115 ALA n 
5  116 GLN n 
5  117 LYS n 
5  118 ASN n 
5  119 THR n 
5  120 GLN n 
5  121 SER n 
5  122 ALA n 
5  123 GLY n 
5  124 GLY n 
5  125 ARG n 
5  126 PRO n 
5  127 TYR n 
5  128 GLY n 
5  129 VAL n 
5  130 GLY n 
5  131 LEU n 
5  132 LEU n 
5  133 ILE n 
5  134 ILE n 
5  135 GLY n 
5  136 TYR n 
5  137 ASP n 
5  138 LYS n 
5  139 SER n 
5  140 GLY n 
5  141 ALA n 
5  142 HIS n 
5  143 LEU n 
5  144 LEU n 
5  145 GLU n 
5  146 PHE n 
5  147 GLN n 
5  148 PRO n 
5  149 SER n 
5  150 GLY n 
5  151 ASN n 
5  152 VAL n 
5  153 THR n 
5  154 GLU n 
5  155 LEU n 
5  156 TYR n 
5  157 GLY n 
5  158 THR n 
5  159 ALA n 
5  160 ILE n 
5  161 GLY n 
5  162 ALA n 
5  163 ARG n 
5  164 SER n 
5  165 GLN n 
5  166 GLY n 
5  167 ALA n 
5  168 LYS n 
5  169 THR n 
5  170 TYR n 
5  171 LEU n 
5  172 GLU n 
5  173 ARG n 
5  174 THR n 
5  175 LEU n 
5  176 ASP n 
5  177 THR n 
5  178 PHE n 
5  179 ILE n 
5  180 LYS n 
5  181 ILE n 
5  182 ASP n 
5  183 GLY n 
5  184 ASN n 
5  185 PRO n 
5  186 ASP n 
5  187 GLU n 
5  188 LEU n 
5  189 ILE n 
5  190 LYS n 
5  191 ALA n 
5  192 GLY n 
5  193 VAL n 
5  194 GLU n 
5  195 ALA n 
5  196 ILE n 
5  197 SER n 
5  198 GLN n 
5  199 SER n 
5  200 LEU n 
5  201 ARG n 
5  202 ASP n 
5  203 GLU n 
5  204 SER n 
5  205 LEU n 
5  206 THR n 
5  207 VAL n 
5  208 ASP n 
5  209 ASN n 
5  210 LEU n 
5  211 SER n 
5  212 ILE n 
5  213 ALA n 
5  214 ILE n 
5  215 VAL n 
5  216 GLY n 
5  217 LYS n 
5  218 ASP n 
5  219 THR n 
5  220 PRO n 
5  221 PHE n 
5  222 THR n 
5  223 ILE n 
5  224 TYR n 
5  225 ASP n 
5  226 GLY n 
5  227 GLU n 
5  228 ALA n 
5  229 VAL n 
5  230 ALA n 
5  231 LYS n 
5  232 TYR n 
5  233 ILE n 
6  1   GLY n 
6  2   TYR n 
6  3   ASP n 
6  4   LEU n 
6  5   SER n 
6  6   ASN n 
6  7   SER n 
6  8   VAL n 
6  9   PHE n 
6  10  SER n 
6  11  PRO n 
6  12  ASP n 
6  13  GLY n 
6  14  ARG n 
6  15  ASN n 
6  16  PHE n 
6  17  GLN n 
6  18  VAL n 
6  19  GLU n 
6  20  TYR n 
6  21  ALA n 
6  22  VAL n 
6  23  LYS n 
6  24  ALA n 
6  25  VAL n 
6  26  GLU n 
6  27  ASN n 
6  28  GLY n 
6  29  THR n 
6  30  THR n 
6  31  SER n 
6  32  ILE n 
6  33  GLY n 
6  34  ILE n 
6  35  LYS n 
6  36  CYS n 
6  37  ASN n 
6  38  ASP n 
6  39  GLY n 
6  40  VAL n 
6  41  VAL n 
6  42  PHE n 
6  43  ALA n 
6  44  VAL n 
6  45  GLU n 
6  46  LYS n 
6  47  LEU n 
6  48  ILE n 
6  49  THR n 
6  50  SER n 
6  51  LYS n 
6  52  LEU n 
6  53  LEU n 
6  54  VAL n 
6  55  PRO n 
6  56  GLN n 
6  57  LYS n 
6  58  ASN n 
6  59  VAL n 
6  60  LYS n 
6  61  ILE n 
6  62  GLN n 
6  63  VAL n 
6  64  VAL n 
6  65  ASP n 
6  66  ARG n 
6  67  HIS n 
6  68  ILE n 
6  69  GLY n 
6  70  CYS n 
6  71  VAL n 
6  72  TYR n 
6  73  SER n 
6  74  GLY n 
6  75  LEU n 
6  76  ILE n 
6  77  PRO n 
6  78  ASP n 
6  79  GLY n 
6  80  ARG n 
6  81  HIS n 
6  82  LEU n 
6  83  VAL n 
6  84  ASN n 
6  85  ARG n 
6  86  GLY n 
6  87  ARG n 
6  88  GLU n 
6  89  GLU n 
6  90  ALA n 
6  91  ALA n 
6  92  SER n 
6  93  PHE n 
6  94  LYS n 
6  95  LYS n 
6  96  LEU n 
6  97  TYR n 
6  98  LYS n 
6  99  THR n 
6  100 PRO n 
6  101 ILE n 
6  102 PRO n 
6  103 ILE n 
6  104 PRO n 
6  105 ALA n 
6  106 PHE n 
6  107 ALA n 
6  108 ASP n 
6  109 ARG n 
6  110 LEU n 
6  111 GLY n 
6  112 GLN n 
6  113 TYR n 
6  114 VAL n 
6  115 GLN n 
6  116 ALA n 
6  117 HIS n 
6  118 THR n 
6  119 LEU n 
6  120 TYR n 
6  121 ASN n 
6  122 SER n 
6  123 VAL n 
6  124 ARG n 
6  125 PRO n 
6  126 PHE n 
6  127 GLY n 
6  128 VAL n 
6  129 SER n 
6  130 THR n 
6  131 ILE n 
6  132 PHE n 
6  133 GLY n 
6  134 GLY n 
6  135 VAL n 
6  136 ASP n 
6  137 LYS n 
6  138 ASN n 
6  139 GLY n 
6  140 ALA n 
6  141 HIS n 
6  142 LEU n 
6  143 TYR n 
6  144 MET n 
6  145 LEU n 
6  146 GLU n 
6  147 PRO n 
6  148 SER n 
6  149 GLY n 
6  150 SER n 
6  151 TYR n 
6  152 TRP n 
6  153 GLY n 
6  154 TYR n 
6  155 LYS n 
6  156 GLY n 
6  157 ALA n 
6  158 ALA n 
6  159 THR n 
6  160 GLY n 
6  161 LYS n 
6  162 GLY n 
6  163 ARG n 
6  164 GLN n 
6  165 SER n 
6  166 ALA n 
6  167 LYS n 
6  168 ALA n 
6  169 GLU n 
6  170 LEU n 
6  171 GLU n 
6  172 LYS n 
6  173 LEU n 
6  174 VAL n 
6  175 ASP n 
6  176 HIS n 
6  177 HIS n 
6  178 PRO n 
6  179 GLU n 
6  180 GLY n 
6  181 LEU n 
6  182 SER n 
6  183 ALA n 
6  184 ARG n 
6  185 GLU n 
6  186 ALA n 
6  187 VAL n 
6  188 LYS n 
6  189 GLN n 
6  190 ALA n 
6  191 ALA n 
6  192 LYS n 
6  193 ILE n 
6  194 ILE n 
6  195 TYR n 
6  196 LEU n 
6  197 ALA n 
6  198 HIS n 
6  199 GLU n 
6  200 ASP n 
6  201 ASN n 
6  202 LYS n 
6  203 GLU n 
6  204 LYS n 
6  205 ASP n 
6  206 PHE n 
6  207 GLU n 
6  208 LEU n 
6  209 GLU n 
6  210 ILE n 
6  211 SER n 
6  212 TRP n 
6  213 CYS n 
6  214 SER n 
6  215 LEU n 
6  216 SER n 
6  217 GLU n 
6  218 THR n 
6  219 ASN n 
6  220 GLY n 
6  221 LEU n 
6  222 HIS n 
6  223 LYS n 
6  224 PHE n 
6  225 VAL n 
6  226 LYS n 
6  227 GLY n 
6  228 ASP n 
6  229 LEU n 
6  230 LEU n 
6  231 GLN n 
6  232 GLU n 
6  233 ALA n 
6  234 ILE n 
6  235 ASP n 
6  236 PHE n 
6  237 ALA n 
6  238 GLN n 
6  239 LYS n 
6  240 GLU n 
6  241 ILE n 
6  242 ASN n 
7  1   ALA n 
7  2   GLY n 
7  3   TYR n 
7  4   ASP n 
7  5   ARG n 
7  6   HIS n 
7  7   ILE n 
7  8   THR n 
7  9   ILE n 
7  10  PHE n 
7  11  SER n 
7  12  PRO n 
7  13  GLU n 
7  14  GLY n 
7  15  ARG n 
7  16  LEU n 
7  17  TYR n 
7  18  GLN n 
7  19  VAL n 
7  20  GLU n 
7  21  TYR n 
7  22  ALA n 
7  23  PHE n 
7  24  LYS n 
7  25  ALA n 
7  26  THR n 
7  27  ASN n 
7  28  GLN n 
7  29  THR n 
7  30  ASN n 
7  31  ILE n 
7  32  ASN n 
7  33  SER n 
7  34  LEU n 
7  35  ALA n 
7  36  VAL n 
7  37  ARG n 
7  38  GLY n 
7  39  LYS n 
7  40  ASP n 
7  41  CYS n 
7  42  THR n 
7  43  VAL n 
7  44  VAL n 
7  45  ILE n 
7  46  SER n 
7  47  GLN n 
7  48  LYS n 
7  49  LYS n 
7  50  VAL n 
7  51  PRO n 
7  52  ASP n 
7  53  LYS n 
7  54  LEU n 
7  55  LEU n 
7  56  ASP n 
7  57  PRO n 
7  58  THR n 
7  59  THR n 
7  60  VAL n 
7  61  SER n 
7  62  TYR n 
7  63  ILE n 
7  64  PHE n 
7  65  CYS n 
7  66  ILE n 
7  67  SER n 
7  68  ARG n 
7  69  THR n 
7  70  ILE n 
7  71  GLY n 
7  72  MET n 
7  73  VAL n 
7  74  VAL n 
7  75  ASN n 
7  76  GLY n 
7  77  PRO n 
7  78  ILE n 
7  79  PRO n 
7  80  ASP n 
7  81  ALA n 
7  82  ARG n 
7  83  ASN n 
7  84  ALA n 
7  85  ALA n 
7  86  LEU n 
7  87  ARG n 
7  88  ALA n 
7  89  LYS n 
7  90  ALA n 
7  91  GLU n 
7  92  ALA n 
7  93  ALA n 
7  94  GLU n 
7  95  PHE n 
7  96  ARG n 
7  97  TYR n 
7  98  LYS n 
7  99  TYR n 
7  100 GLY n 
7  101 TYR n 
7  102 ASP n 
7  103 MET n 
7  104 PRO n 
7  105 CYS n 
7  106 ASP n 
7  107 VAL n 
7  108 LEU n 
7  109 ALA n 
7  110 LYS n 
7  111 ARG n 
7  112 MET n 
7  113 ALA n 
7  114 ASN n 
7  115 LEU n 
7  116 SER n 
7  117 GLN n 
7  118 ILE n 
7  119 TYR n 
7  120 THR n 
7  121 GLN n 
7  122 ARG n 
7  123 ALA n 
7  124 TYR n 
7  125 MET n 
7  126 ARG n 
7  127 PRO n 
7  128 LEU n 
7  129 GLY n 
7  130 VAL n 
7  131 ILE n 
7  132 LEU n 
7  133 THR n 
7  134 PHE n 
7  135 VAL n 
7  136 SER n 
7  137 VAL n 
7  138 ASP n 
7  139 GLU n 
7  140 GLU n 
7  141 LEU n 
7  142 GLY n 
7  143 PRO n 
7  144 SER n 
7  145 ILE n 
7  146 TYR n 
7  147 LYS n 
7  148 THR n 
7  149 ASP n 
7  150 PRO n 
7  151 ALA n 
7  152 GLY n 
7  153 TYR n 
7  154 TYR n 
7  155 VAL n 
7  156 GLY n 
7  157 TYR n 
7  158 LYS n 
7  159 ALA n 
7  160 THR n 
7  161 ALA n 
7  162 THR n 
7  163 GLY n 
7  164 PRO n 
7  165 LYS n 
7  166 GLN n 
7  167 GLN n 
7  168 GLU n 
7  169 ILE n 
7  170 THR n 
7  171 THR n 
7  172 ASN n 
7  173 LEU n 
7  174 GLU n 
7  175 ASN n 
7  176 HIS n 
7  177 PHE n 
7  178 LYS n 
7  179 LYS n 
7  180 SER n 
7  181 LYS n 
7  182 ILE n 
7  183 ASP n 
7  184 HIS n 
7  185 ILE n 
7  186 ASN n 
7  187 GLU n 
7  188 GLU n 
7  189 SER n 
7  190 TRP n 
7  191 GLU n 
7  192 LYS n 
7  193 VAL n 
7  194 VAL n 
7  195 GLU n 
7  196 PHE n 
7  197 ALA n 
7  198 ILE n 
7  199 THR n 
7  200 HIS n 
7  201 MET n 
7  202 ILE n 
7  203 ASP n 
7  204 ALA n 
7  205 LEU n 
7  206 GLY n 
7  207 THR n 
7  208 GLU n 
7  209 PHE n 
7  210 SER n 
7  211 LYS n 
7  212 ASN n 
7  213 ASP n 
7  214 LEU n 
7  215 GLU n 
7  216 VAL n 
7  217 GLY n 
7  218 VAL n 
7  219 ALA n 
7  220 THR n 
7  221 LYS n 
7  222 ASP n 
7  223 LYS n 
7  224 PHE n 
7  225 PHE n 
7  226 THR n 
7  227 LEU n 
7  228 SER n 
7  229 ALA n 
7  230 GLU n 
7  231 ASN n 
7  232 ILE n 
7  233 GLU n 
7  234 GLU n 
7  235 ARG n 
7  236 LEU n 
7  237 VAL n 
7  238 ALA n 
7  239 ILE n 
7  240 ALA n 
7  241 GLU n 
7  242 GLN n 
7  243 ASP n 
8  1   THR n 
8  2   THR n 
8  3   ILE n 
8  4   VAL n 
8  5   GLY n 
8  6   VAL n 
8  7   LYS n 
8  8   PHE n 
8  9   ASN n 
8  10  ASN n 
8  11  GLY n 
8  12  VAL n 
8  13  VAL n 
8  14  ILE n 
8  15  ALA n 
8  16  ALA n 
8  17  ASP n 
8  18  THR n 
8  19  ARG n 
8  20  SER n 
8  21  THR n 
8  22  GLN n 
8  23  GLY n 
8  24  PRO n 
8  25  ILE n 
8  26  VAL n 
8  27  ALA n 
8  28  ASP n 
8  29  LYS n 
8  30  ASN n 
8  31  CYS n 
8  32  ALA n 
8  33  LYS n 
8  34  LEU n 
8  35  HIS n 
8  36  ARG n 
8  37  ILE n 
8  38  SER n 
8  39  PRO n 
8  40  LYS n 
8  41  ILE n 
8  42  TRP n 
8  43  CYS n 
8  44  ALA n 
8  45  GLY n 
8  46  ALA n 
8  47  GLY n 
8  48  THR n 
8  49  ALA n 
8  50  ALA n 
8  51  ASP n 
8  52  THR n 
8  53  GLU n 
8  54  ALA n 
8  55  VAL n 
8  56  THR n 
8  57  GLN n 
8  58  LEU n 
8  59  ILE n 
8  60  GLY n 
8  61  SER n 
8  62  ASN n 
8  63  ILE n 
8  64  GLU n 
8  65  LEU n 
8  66  HIS n 
8  67  SER n 
8  68  LEU n 
8  69  TYR n 
8  70  THR n 
8  71  SER n 
8  72  ARG n 
8  73  GLU n 
8  74  PRO n 
8  75  ARG n 
8  76  VAL n 
8  77  VAL n 
8  78  SER n 
8  79  ALA n 
8  80  LEU n 
8  81  GLN n 
8  82  MET n 
8  83  LEU n 
8  84  LYS n 
8  85  GLN n 
8  86  HIS n 
8  87  LEU n 
8  88  PHE n 
8  89  LYS n 
8  90  TYR n 
8  91  GLN n 
8  92  GLY n 
8  93  HIS n 
8  94  ILE n 
8  95  GLY n 
8  96  ALA n 
8  97  TYR n 
8  98  LEU n 
8  99  ILE n 
8  100 VAL n 
8  101 ALA n 
8  102 GLY n 
8  103 VAL n 
8  104 ASP n 
8  105 PRO n 
8  106 THR n 
8  107 GLY n 
8  108 SER n 
8  109 HIS n 
8  110 LEU n 
8  111 PHE n 
8  112 SER n 
8  113 ILE n 
8  114 HIS n 
8  115 ALA n 
8  116 HIS n 
8  117 GLY n 
8  118 SER n 
8  119 THR n 
8  120 ASP n 
8  121 VAL n 
8  122 GLY n 
8  123 TYR n 
8  124 TYR n 
8  125 LEU n 
8  126 SER n 
8  127 LEU n 
8  128 GLY n 
8  129 SER n 
8  130 GLY n 
8  131 SER n 
8  132 LEU n 
8  133 ALA n 
8  134 ALA n 
8  135 MET n 
8  136 ALA n 
8  137 VAL n 
8  138 LEU n 
8  139 GLU n 
8  140 SER n 
8  141 HIS n 
8  142 TRP n 
8  143 LYS n 
8  144 GLN n 
8  145 ASP n 
8  146 LEU n 
8  147 THR n 
8  148 LYS n 
8  149 GLU n 
8  150 GLU n 
8  151 ALA n 
8  152 ILE n 
8  153 LYS n 
8  154 LEU n 
8  155 ALA n 
8  156 SER n 
8  157 ASP n 
8  158 ALA n 
8  159 ILE n 
8  160 GLN n 
8  161 ALA n 
8  162 GLY n 
8  163 ILE n 
8  164 TRP n 
8  165 ASN n 
8  166 ASP n 
8  167 LEU n 
8  168 GLY n 
8  169 SER n 
8  170 GLY n 
8  171 SER n 
8  172 ASN n 
8  173 VAL n 
8  174 ASP n 
8  175 VAL n 
8  176 CYS n 
8  177 VAL n 
8  178 MET n 
8  179 GLU n 
8  180 ILE n 
8  181 GLY n 
8  182 LYS n 
8  183 ASP n 
8  184 ALA n 
8  185 GLU n 
8  186 TYR n 
8  187 LEU n 
8  188 ARG n 
8  189 ASN n 
8  190 TYR n 
8  191 LEU n 
8  192 THR n 
8  193 PRO n 
8  194 ASN n 
8  195 VAL n 
8  196 ARG n 
8  197 GLU n 
8  198 GLU n 
8  199 LYS n 
8  200 GLN n 
8  201 LYS n 
8  202 SER n 
8  203 TYR n 
8  204 LYS n 
8  205 PHE n 
8  206 PRO n 
8  207 ARG n 
8  208 GLY n 
8  209 THR n 
8  210 THR n 
8  211 ALA n 
8  212 VAL n 
8  213 LEU n 
8  214 LYS n 
8  215 GLU n 
8  216 SER n 
8  217 ILE n 
8  218 VAL n 
8  219 ASN n 
8  220 ILE n 
8  221 CYS n 
8  222 ASP n 
9  1   SER n 
9  2   ASP n 
9  3   PRO n 
9  4   SER n 
9  5   SER n 
9  6   ILE n 
9  7   ASN n 
9  8   GLY n 
9  9   GLY n 
9  10  ILE n 
9  11  VAL n 
9  12  VAL n 
9  13  ALA n 
9  14  MET n 
9  15  THR n 
9  16  GLY n 
9  17  LYS n 
9  18  ASP n 
9  19  CYS n 
9  20  VAL n 
9  21  ALA n 
9  22  ILE n 
9  23  ALA n 
9  24  CYS n 
9  25  ASP n 
9  26  LEU n 
9  27  ARG n 
9  28  LEU n 
9  29  GLY n 
9  30  SER n 
9  31  GLN n 
9  32  SER n 
9  33  LEU n 
9  34  GLY n 
9  35  VAL n 
9  36  SER n 
9  37  ASN n 
9  38  LYS n 
9  39  PHE n 
9  40  GLU n 
9  41  LYS n 
9  42  ILE n 
9  43  PHE n 
9  44  HIS n 
9  45  TYR n 
9  46  GLY n 
9  47  HIS n 
9  48  VAL n 
9  49  PHE n 
9  50  LEU n 
9  51  GLY n 
9  52  ILE n 
9  53  THR n 
9  54  GLY n 
9  55  LEU n 
9  56  ALA n 
9  57  THR n 
9  58  ASP n 
9  59  VAL n 
9  60  THR n 
9  61  THR n 
9  62  LEU n 
9  63  ASN n 
9  64  GLU n 
9  65  MET n 
9  66  PHE n 
9  67  ARG n 
9  68  TYR n 
9  69  LYS n 
9  70  THR n 
9  71  ASN n 
9  72  LEU n 
9  73  TYR n 
9  74  LYS n 
9  75  LEU n 
9  76  LYS n 
9  77  GLU n 
9  78  GLU n 
9  79  ARG n 
9  80  ALA n 
9  81  ILE n 
9  82  GLU n 
9  83  PRO n 
9  84  GLU n 
9  85  THR n 
9  86  PHE n 
9  87  THR n 
9  88  GLN n 
9  89  LEU n 
9  90  VAL n 
9  91  SER n 
9  92  SER n 
9  93  SER n 
9  94  LEU n 
9  95  TYR n 
9  96  GLU n 
9  97  ARG n 
9  98  ARG n 
9  99  PHE n 
9  100 GLY n 
9  101 PRO n 
9  102 TYR n 
9  103 PHE n 
9  104 VAL n 
9  105 GLY n 
9  106 PRO n 
9  107 VAL n 
9  108 VAL n 
9  109 ALA n 
9  110 GLY n 
9  111 ILE n 
9  112 ASN n 
9  113 SER n 
9  114 LYS n 
9  115 SER n 
9  116 GLY n 
9  117 LYS n 
9  118 PRO n 
9  119 PHE n 
9  120 ILE n 
9  121 ALA n 
9  122 GLY n 
9  123 PHE n 
9  124 ASP n 
9  125 LEU n 
9  126 ILE n 
9  127 GLY n 
9  128 CYS n 
9  129 ILE n 
9  130 ASP n 
9  131 GLU n 
9  132 ALA n 
9  133 LYS n 
9  134 ASP n 
9  135 PHE n 
9  136 ILE n 
9  137 VAL n 
9  138 SER n 
9  139 GLY n 
9  140 THR n 
9  141 ALA n 
9  142 SER n 
9  143 ASP n 
9  144 GLN n 
9  145 LEU n 
9  146 PHE n 
9  147 GLY n 
9  148 MET n 
9  149 CYS n 
9  150 GLU n 
9  151 SER n 
9  152 LEU n 
9  153 TYR n 
9  154 GLU n 
9  155 PRO n 
9  156 ASN n 
9  157 LEU n 
9  158 GLU n 
9  159 PRO n 
9  160 GLU n 
9  161 ASP n 
9  162 LEU n 
9  163 PHE n 
9  164 GLU n 
9  165 THR n 
9  166 ILE n 
9  167 SER n 
9  168 GLN n 
9  169 ALA n 
9  170 LEU n 
9  171 LEU n 
9  172 ASN n 
9  173 ALA n 
9  174 ALA n 
9  175 ASP n 
9  176 ARG n 
9  177 ASP n 
9  178 ALA n 
9  179 LEU n 
9  180 SER n 
9  181 GLY n 
9  182 TRP n 
9  183 GLY n 
9  184 ALA n 
9  185 VAL n 
9  186 VAL n 
9  187 TYR n 
9  188 ILE n 
9  189 ILE n 
9  190 LYS n 
9  191 LYS n 
9  192 ASP n 
9  193 GLU n 
9  194 VAL n 
9  195 VAL n 
9  196 LYS n 
9  197 ARG n 
9  198 TYR n 
9  199 LEU n 
9  200 LYS n 
9  201 MET n 
9  202 ARG n 
9  203 GLN n 
9  204 ASP n 
10 1   MET n 
10 2   ASP n 
10 3   ILE n 
10 4   ILE n 
10 5   LEU n 
10 6   GLY n 
10 7   ILE n 
10 8   ARG n 
10 9   VAL n 
10 10  GLN n 
10 11  ASP n 
10 12  SER n 
10 13  VAL n 
10 14  ILE n 
10 15  LEU n 
10 16  ALA n 
10 17  SER n 
10 18  SER n 
10 19  LYS n 
10 20  ALA n 
10 21  VAL n 
10 22  THR n 
10 23  ARG n 
10 24  GLY n 
10 25  ILE n 
10 26  SER n 
10 27  VAL n 
10 28  LEU n 
10 29  LYS n 
10 30  ASP n 
10 31  SER n 
10 32  ASP n 
10 33  ASP n 
10 34  LYS n 
10 35  THR n 
10 36  ARG n 
10 37  GLN n 
10 38  LEU n 
10 39  SER n 
10 40  PRO n 
10 41  HIS n 
10 42  THR n 
10 43  LEU n 
10 44  MET n 
10 45  SER n 
10 46  PHE n 
10 47  ALA n 
10 48  GLY n 
10 49  GLU n 
10 50  ALA n 
10 51  GLY n 
10 52  ASP n 
10 53  THR n 
10 54  VAL n 
10 55  GLN n 
10 56  PHE n 
10 57  ALA n 
10 58  GLU n 
10 59  TYR n 
10 60  ILE n 
10 61  GLN n 
10 62  ALA n 
10 63  ASN n 
10 64  ILE n 
10 65  GLN n 
10 66  LEU n 
10 67  TYR n 
10 68  SER n 
10 69  ILE n 
10 70  ARG n 
10 71  GLU n 
10 72  ASP n 
10 73  TYR n 
10 74  GLU n 
10 75  LEU n 
10 76  SER n 
10 77  PRO n 
10 78  GLN n 
10 79  ALA n 
10 80  VAL n 
10 81  SER n 
10 82  SER n 
10 83  PHE n 
10 84  VAL n 
10 85  ARG n 
10 86  GLN n 
10 87  GLU n 
10 88  LEU n 
10 89  ALA n 
10 90  LYS n 
10 91  SER n 
10 92  ILE n 
10 93  ARG n 
10 94  SER n 
10 95  ARG n 
10 96  ARG n 
10 97  PRO n 
10 98  TYR n 
10 99  GLN n 
10 100 VAL n 
10 101 ASN n 
10 102 VAL n 
10 103 LEU n 
10 104 ILE n 
10 105 GLY n 
10 106 GLY n 
10 107 TYR n 
10 108 ASP n 
10 109 LYS n 
10 110 LYS n 
10 111 LYS n 
10 112 ASN n 
10 113 LYS n 
10 114 PRO n 
10 115 GLU n 
10 116 LEU n 
10 117 TYR n 
10 118 GLN n 
10 119 ILE n 
10 120 ASP n 
10 121 TYR n 
10 122 LEU n 
10 123 GLY n 
10 124 THR n 
10 125 LYS n 
10 126 VAL n 
10 127 GLU n 
10 128 LEU n 
10 129 PRO n 
10 130 TYR n 
10 131 GLY n 
10 132 ALA n 
10 133 HIS n 
10 134 GLY n 
10 135 TYR n 
10 136 SER n 
10 137 GLY n 
10 138 PHE n 
10 139 TYR n 
10 140 THR n 
10 141 PHE n 
10 142 SER n 
10 143 LEU n 
10 144 LEU n 
10 145 ASP n 
10 146 HIS n 
10 147 HIS n 
10 148 TYR n 
10 149 ARG n 
10 150 PRO n 
10 151 ASP n 
10 152 MET n 
10 153 THR n 
10 154 THR n 
10 155 GLU n 
10 156 GLU n 
10 157 GLY n 
10 158 LEU n 
10 159 ASP n 
10 160 LEU n 
10 161 LEU n 
10 162 LYS n 
10 163 LEU n 
10 164 CYS n 
10 165 VAL n 
10 166 GLN n 
10 167 GLU n 
10 168 LEU n 
10 169 GLU n 
10 170 LYS n 
10 171 ARG n 
10 172 MET n 
10 173 PRO n 
10 174 MET n 
10 175 ASP n 
10 176 PHE n 
10 177 LYS n 
10 178 GLY n 
10 179 VAL n 
10 180 ILE n 
10 181 VAL n 
10 182 LYS n 
10 183 ILE n 
10 184 VAL n 
10 185 ASP n 
10 186 LYS n 
10 187 ASP n 
10 188 GLY n 
10 189 ILE n 
10 190 ARG n 
10 191 GLN n 
10 192 VAL n 
10 193 ASP n 
10 194 ASP n 
10 195 PHE n 
10 196 GLN n 
10 197 ALA n 
10 198 GLN n 
11 1   THR n 
11 2   THR n 
11 3   THR n 
11 4   LEU n 
11 5   ALA n 
11 6   PHE n 
11 7   ARG n 
11 8   PHE n 
11 9   GLN n 
11 10  GLY n 
11 11  GLY n 
11 12  ILE n 
11 13  ILE n 
11 14  VAL n 
11 15  ALA n 
11 16  VAL n 
11 17  ASP n 
11 18  SER n 
11 19  ARG n 
11 20  ALA n 
11 21  THR n 
11 22  ALA n 
11 23  GLY n 
11 24  ASN n 
11 25  TRP n 
11 26  VAL n 
11 27  ALA n 
11 28  SER n 
11 29  GLN n 
11 30  THR n 
11 31  VAL n 
11 32  LYS n 
11 33  LYS n 
11 34  VAL n 
11 35  ILE n 
11 36  GLU n 
11 37  ILE n 
11 38  ASN n 
11 39  PRO n 
11 40  PHE n 
11 41  LEU n 
11 42  LEU n 
11 43  GLY n 
11 44  THR n 
11 45  MET n 
11 46  ALA n 
11 47  GLY n 
11 48  GLY n 
11 49  ALA n 
11 50  ALA n 
11 51  ASP n 
11 52  CYS n 
11 53  GLN n 
11 54  PHE n 
11 55  TRP n 
11 56  GLU n 
11 57  THR n 
11 58  TRP n 
11 59  LEU n 
11 60  GLY n 
11 61  SER n 
11 62  GLN n 
11 63  CYS n 
11 64  ARG n 
11 65  LEU n 
11 66  HIS n 
11 67  GLU n 
11 68  LEU n 
11 69  ARG n 
11 70  GLU n 
11 71  LYS n 
11 72  GLU n 
11 73  ARG n 
11 74  ILE n 
11 75  SER n 
11 76  VAL n 
11 77  ALA n 
11 78  ALA n 
11 79  ALA n 
11 80  SER n 
11 81  LYS n 
11 82  ILE n 
11 83  LEU n 
11 84  SER n 
11 85  ASN n 
11 86  LEU n 
11 87  VAL n 
11 88  TYR n 
11 89  GLN n 
11 90  TYR n 
11 91  LYS n 
11 92  GLY n 
11 93  ALA n 
11 94  GLY n 
11 95  LEU n 
11 96  SER n 
11 97  MET n 
11 98  GLY n 
11 99  THR n 
11 100 MET n 
11 101 ILE n 
11 102 CYS n 
11 103 GLY n 
11 104 TYR n 
11 105 THR n 
11 106 ARG n 
11 107 LYS n 
11 108 GLU n 
11 109 GLY n 
11 110 PRO n 
11 111 THR n 
11 112 ILE n 
11 113 TYR n 
11 114 TYR n 
11 115 VAL n 
11 116 ASP n 
11 117 SER n 
11 118 ASP n 
11 119 GLY n 
11 120 THR n 
11 121 ARG n 
11 122 LEU n 
11 123 LYS n 
11 124 GLY n 
11 125 ASP n 
11 126 ILE n 
11 127 PHE n 
11 128 CYS n 
11 129 VAL n 
11 130 GLY n 
11 131 SER n 
11 132 GLY n 
11 133 GLN n 
11 134 THR n 
11 135 PHE n 
11 136 ALA n 
11 137 TYR n 
11 138 GLY n 
11 139 VAL n 
11 140 LEU n 
11 141 ASP n 
11 142 SER n 
11 143 ASN n 
11 144 TYR n 
11 145 LYS n 
11 146 TRP n 
11 147 ASP n 
11 148 LEU n 
11 149 SER n 
11 150 VAL n 
11 151 GLU n 
11 152 ASP n 
11 153 ALA n 
11 154 LEU n 
11 155 TYR n 
11 156 LEU n 
11 157 GLY n 
11 158 LYS n 
11 159 ARG n 
11 160 SER n 
11 161 ILE n 
11 162 LEU n 
11 163 ALA n 
11 164 ALA n 
11 165 ALA n 
11 166 HIS n 
11 167 ARG n 
11 168 ASP n 
11 169 ALA n 
11 170 TYR n 
11 171 SER n 
11 172 GLY n 
11 173 GLY n 
11 174 SER n 
11 175 VAL n 
11 176 ASN n 
11 177 LEU n 
11 178 TYR n 
11 179 HIS n 
11 180 VAL n 
11 181 THR n 
11 182 GLU n 
11 183 ASP n 
11 184 GLY n 
11 185 TRP n 
11 186 ILE n 
11 187 TYR n 
11 188 HIS n 
11 189 GLY n 
11 190 ASN n 
11 191 HIS n 
11 192 ASP n 
11 193 VAL n 
11 194 GLY n 
11 195 GLU n 
11 196 LEU n 
11 197 PHE n 
11 198 TRP n 
11 199 LYS n 
11 200 VAL n 
11 201 LYS n 
11 202 GLU n 
11 203 GLU n 
11 204 GLU n 
11 205 GLY n 
11 206 SER n 
11 207 PHE n 
11 208 ASN n 
11 209 ASN n 
11 210 VAL n 
11 211 ILE n 
11 212 GLY n 
12 1   GLN n 
12 2   PHE n 
12 3   ASN n 
12 4   PRO n 
12 5   TYR n 
12 6   GLY n 
12 7   ASP n 
12 8   ASN n 
12 9   GLY n 
12 10  GLY n 
12 11  THR n 
12 12  ILE n 
12 13  LEU n 
12 14  GLY n 
12 15  ILE n 
12 16  ALA n 
12 17  GLY n 
12 18  GLU n 
12 19  ASP n 
12 20  PHE n 
12 21  ALA n 
12 22  VAL n 
12 23  LEU n 
12 24  ALA n 
12 25  GLY n 
12 26  ASP n 
12 27  THR n 
12 28  ARG n 
12 29  ASN n 
12 30  ILE n 
12 31  THR n 
12 32  ASP n 
12 33  TYR n 
12 34  SER n 
12 35  ILE n 
12 36  ASN n 
12 37  SER n 
12 38  ARG n 
12 39  TYR n 
12 40  GLU n 
12 41  PRO n 
12 42  LYS n 
12 43  VAL n 
12 44  PHE n 
12 45  ASP n 
12 46  CYS n 
12 47  GLY n 
12 48  ASP n 
12 49  ASN n 
12 50  ILE n 
12 51  VAL n 
12 52  MET n 
12 53  SER n 
12 54  ALA n 
12 55  ASN n 
12 56  GLY n 
12 57  PHE n 
12 58  ALA n 
12 59  ALA n 
12 60  ASP n 
12 61  GLY n 
12 62  ASP n 
12 63  ALA n 
12 64  LEU n 
12 65  VAL n 
12 66  LYS n 
12 67  ARG n 
12 68  PHE n 
12 69  LYS n 
12 70  ASN n 
12 71  SER n 
12 72  VAL n 
12 73  LYS n 
12 74  TRP n 
12 75  TYR n 
12 76  HIS n 
12 77  PHE n 
12 78  ASP n 
12 79  HIS n 
12 80  ASN n 
12 81  ASP n 
12 82  LYS n 
12 83  LYS n 
12 84  LEU n 
12 85  SER n 
12 86  ILE n 
12 87  ASN n 
12 88  SER n 
12 89  ALA n 
12 90  ALA n 
12 91  ARG n 
12 92  ASN n 
12 93  ILE n 
12 94  GLN n 
12 95  HIS n 
12 96  LEU n 
12 97  LEU n 
12 98  TYR n 
12 99  GLY n 
12 100 LYS n 
12 101 ARG n 
12 102 PHE n 
12 103 PHE n 
12 104 PRO n 
12 105 TYR n 
12 106 TYR n 
12 107 VAL n 
12 108 HIS n 
12 109 THR n 
12 110 ILE n 
12 111 ILE n 
12 112 ALA n 
12 113 GLY n 
12 114 LEU n 
12 115 ASP n 
12 116 GLU n 
12 117 ASP n 
12 118 GLY n 
12 119 LYS n 
12 120 GLY n 
12 121 ALA n 
12 122 VAL n 
12 123 TYR n 
12 124 SER n 
12 125 PHE n 
12 126 ASP n 
12 127 PRO n 
12 128 VAL n 
12 129 GLY n 
12 130 SER n 
12 131 TYR n 
12 132 GLU n 
12 133 ARG n 
12 134 GLU n 
12 135 GLN n 
12 136 CYS n 
12 137 ARG n 
12 138 ALA n 
12 139 GLY n 
12 140 GLY n 
12 141 ALA n 
12 142 ALA n 
12 143 ALA n 
12 144 SER n 
12 145 LEU n 
12 146 ILE n 
12 147 MET n 
12 148 PRO n 
12 149 PHE n 
12 150 LEU n 
12 151 ASP n 
12 152 ASN n 
12 153 GLN n 
12 154 VAL n 
12 155 ASN n 
12 156 PHE n 
12 157 LYS n 
12 158 ASN n 
12 159 GLN n 
12 160 TYR n 
12 161 GLU n 
12 162 PRO n 
12 163 GLY n 
12 164 THR n 
12 165 ASN n 
12 166 GLY n 
12 167 LYS n 
12 168 VAL n 
12 169 LYS n 
12 170 LYS n 
12 171 PRO n 
12 172 LEU n 
12 173 LYS n 
12 174 TYR n 
12 175 LEU n 
12 176 SER n 
12 177 VAL n 
12 178 GLU n 
12 179 GLU n 
12 180 VAL n 
12 181 ILE n 
12 182 LYS n 
12 183 LEU n 
12 184 VAL n 
12 185 ARG n 
12 186 ASP n 
12 187 SER n 
12 188 PHE n 
12 189 THR n 
12 190 SER n 
12 191 ALA n 
12 192 THR n 
12 193 GLU n 
12 194 ARG n 
12 195 HIS n 
12 196 ILE n 
12 197 GLN n 
12 198 VAL n 
12 199 GLY n 
12 200 ASP n 
12 201 GLY n 
12 202 LEU n 
12 203 GLU n 
12 204 ILE n 
12 205 LEU n 
12 206 ILE n 
12 207 VAL n 
12 208 THR n 
12 209 LYS n 
12 210 ASP n 
12 211 GLY n 
12 212 VAL n 
12 213 ARG n 
12 214 LYS n 
12 215 GLU n 
12 216 PHE n 
12 217 TYR n 
12 218 GLU n 
12 219 LEU n 
12 220 LYS n 
12 221 ARG n 
12 222 ASP n 
13 1   THR n 
13 2   GLN n 
13 3   GLN n 
13 4   PRO n 
13 5   ILE n 
13 6   VAL n 
13 7   THR n 
13 8   GLY n 
13 9   THR n 
13 10  SER n 
13 11  VAL n 
13 12  ILE n 
13 13  SER n 
13 14  MET n 
13 15  LYS n 
13 16  TYR n 
13 17  ASP n 
13 18  ASN n 
13 19  GLY n 
13 20  VAL n 
13 21  ILE n 
13 22  ILE n 
13 23  ALA n 
13 24  ALA n 
13 25  ASP n 
13 26  ASN n 
13 27  LEU n 
13 28  GLY n 
13 29  SER n 
13 30  TYR n 
13 31  GLY n 
13 32  SER n 
13 33  LEU n 
13 34  LEU n 
13 35  ARG n 
13 36  PHE n 
13 37  ASN n 
13 38  GLY n 
13 39  VAL n 
13 40  GLU n 
13 41  ARG n 
13 42  LEU n 
13 43  ILE n 
13 44  PRO n 
13 45  VAL n 
13 46  GLY n 
13 47  ASP n 
13 48  ASN n 
13 49  THR n 
13 50  VAL n 
13 51  VAL n 
13 52  GLY n 
13 53  ILE n 
13 54  SER n 
13 55  GLY n 
13 56  ASP n 
13 57  ILE n 
13 58  SER n 
13 59  ASP n 
13 60  MET n 
13 61  GLN n 
13 62  HIS n 
13 63  ILE n 
13 64  GLU n 
13 65  ARG n 
13 66  LEU n 
13 67  LEU n 
13 68  LYS n 
13 69  ASP n 
13 70  LEU n 
13 71  VAL n 
13 72  THR n 
13 73  GLU n 
13 74  ASN n 
13 75  ALA n 
13 76  TYR n 
13 77  ASP n 
13 78  ASN n 
13 79  PRO n 
13 80  LEU n 
13 81  ALA n 
13 82  ASP n 
13 83  ALA n 
13 84  GLU n 
13 85  GLU n 
13 86  ALA n 
13 87  LEU n 
13 88  GLU n 
13 89  PRO n 
13 90  SER n 
13 91  TYR n 
13 92  ILE n 
13 93  PHE n 
13 94  GLU n 
13 95  TYR n 
13 96  LEU n 
13 97  ALA n 
13 98  THR n 
13 99  VAL n 
13 100 MET n 
13 101 TYR n 
13 102 GLN n 
13 103 ARG n 
13 104 ARG n 
13 105 SER n 
13 106 LYS n 
13 107 MET n 
13 108 ASN n 
13 109 PRO n 
13 110 LEU n 
13 111 TRP n 
13 112 ASN n 
13 113 ALA n 
13 114 ILE n 
13 115 ILE n 
13 116 VAL n 
13 117 ALA n 
13 118 GLY n 
13 119 VAL n 
13 120 GLN n 
13 121 SER n 
13 122 ASN n 
13 123 GLY n 
13 124 ASP n 
13 125 GLN n 
13 126 PHE n 
13 127 LEU n 
13 128 ARG n 
13 129 TYR n 
13 130 VAL n 
13 131 ASN n 
13 132 LEU n 
13 133 LEU n 
13 134 GLY n 
13 135 VAL n 
13 136 THR n 
13 137 TYR n 
13 138 SER n 
13 139 SER n 
13 140 PRO n 
13 141 THR n 
13 142 LEU n 
13 143 ALA n 
13 144 THR n 
13 145 GLY n 
13 146 PHE n 
13 147 GLY n 
13 148 ALA n 
13 149 HIS n 
13 150 MET n 
13 151 ALA n 
13 152 ASN n 
13 153 PRO n 
13 154 LEU n 
13 155 LEU n 
13 156 ARG n 
13 157 LYS n 
13 158 VAL n 
13 159 VAL n 
13 160 ASP n 
13 161 ARG n 
13 162 GLU n 
13 163 SER n 
13 164 ASP n 
13 165 ILE n 
13 166 PRO n 
13 167 LYS n 
13 168 THR n 
13 169 THR n 
13 170 VAL n 
13 171 GLN n 
13 172 VAL n 
13 173 ALA n 
13 174 GLU n 
13 175 GLU n 
13 176 ALA n 
13 177 ILE n 
13 178 VAL n 
13 179 ASN n 
13 180 ALA n 
13 181 MET n 
13 182 ARG n 
13 183 VAL n 
13 184 LEU n 
13 185 TYR n 
13 186 TYR n 
13 187 ARG n 
13 188 ASP n 
13 189 ALA n 
13 190 ARG n 
13 191 SER n 
13 192 SER n 
13 193 ARG n 
13 194 ASN n 
13 195 PHE n 
13 196 SER n 
13 197 LEU n 
13 198 ALA n 
13 199 ILE n 
13 200 ILE n 
13 201 ASP n 
13 202 LYS n 
13 203 ASN n 
13 204 THR n 
13 205 GLY n 
13 206 LEU n 
13 207 THR n 
13 208 PHE n 
13 209 LYS n 
13 210 LYS n 
13 211 ASN n 
13 212 LEU n 
13 213 GLN n 
13 214 VAL n 
13 215 GLU n 
13 216 ASN n 
13 217 MET n 
13 218 LYS n 
13 219 TRP n 
13 220 ASP n 
13 221 PHE n 
13 222 ALA n 
13 223 LYS n 
13 224 ASP n 
13 225 ILE n 
13 226 LYS n 
13 227 GLY n 
13 228 TYR n 
13 229 GLY n 
13 230 THR n 
13 231 GLN n 
13 232 LYS n 
13 233 ILE n 
14 1   THR n 
14 2   SER n 
14 3   ILE n 
14 4   MET n 
14 5   ALA n 
14 6   VAL n 
14 7   THR n 
14 8   PHE n 
14 9   LYS n 
14 10  ASP n 
14 11  GLY n 
14 12  VAL n 
14 13  ILE n 
14 14  LEU n 
14 15  GLY n 
14 16  ALA n 
14 17  ASP n 
14 18  SER n 
14 19  ARG n 
14 20  THR n 
14 21  THR n 
14 22  THR n 
14 23  GLY n 
14 24  ALA n 
14 25  TYR n 
14 26  ILE n 
14 27  ALA n 
14 28  ASN n 
14 29  ARG n 
14 30  VAL n 
14 31  THR n 
14 32  ASP n 
14 33  LYS n 
14 34  LEU n 
14 35  THR n 
14 36  ARG n 
14 37  VAL n 
14 38  HIS n 
14 39  ASP n 
14 40  LYS n 
14 41  ILE n 
14 42  TRP n 
14 43  CYS n 
14 44  CYS n 
14 45  ARG n 
14 46  SER n 
14 47  GLY n 
14 48  SER n 
14 49  ALA n 
14 50  ALA n 
14 51  ASP n 
14 52  THR n 
14 53  GLN n 
14 54  ALA n 
14 55  ILE n 
14 56  ALA n 
14 57  ASP n 
14 58  ILE n 
14 59  VAL n 
14 60  GLN n 
14 61  TYR n 
14 62  HIS n 
14 63  LEU n 
14 64  GLU n 
14 65  LEU n 
14 66  TYR n 
14 67  THR n 
14 68  SER n 
14 69  GLN n 
14 70  TYR n 
14 71  GLY n 
14 72  THR n 
14 73  PRO n 
14 74  SER n 
14 75  THR n 
14 76  GLU n 
14 77  THR n 
14 78  ALA n 
14 79  ALA n 
14 80  SER n 
14 81  VAL n 
14 82  PHE n 
14 83  LYS n 
14 84  GLU n 
14 85  LEU n 
14 86  CYS n 
14 87  TYR n 
14 88  GLU n 
14 89  ASN n 
14 90  LYS n 
14 91  ASP n 
14 92  ASN n 
14 93  LEU n 
14 94  THR n 
14 95  ALA n 
14 96  GLY n 
14 97  ILE n 
14 98  ILE n 
14 99  VAL n 
14 100 ALA n 
14 101 GLY n 
14 102 TYR n 
14 103 ASP n 
14 104 ASP n 
14 105 LYS n 
14 106 ASN n 
14 107 LYS n 
14 108 GLY n 
14 109 GLU n 
14 110 VAL n 
14 111 TYR n 
14 112 THR n 
14 113 ILE n 
14 114 PRO n 
14 115 LEU n 
14 116 GLY n 
14 117 GLY n 
14 118 SER n 
14 119 VAL n 
14 120 HIS n 
14 121 LYS n 
14 122 LEU n 
14 123 PRO n 
14 124 TYR n 
14 125 ALA n 
14 126 ILE n 
14 127 ALA n 
14 128 GLY n 
14 129 SER n 
14 130 GLY n 
14 131 SER n 
14 132 THR n 
14 133 PHE n 
14 134 ILE n 
14 135 TYR n 
14 136 GLY n 
14 137 TYR n 
14 138 CYS n 
14 139 ASP n 
14 140 LYS n 
14 141 ASN n 
14 142 PHE n 
14 143 ARG n 
14 144 GLU n 
14 145 ASN n 
14 146 MET n 
14 147 SER n 
14 148 LYS n 
14 149 GLU n 
14 150 GLU n 
14 151 THR n 
14 152 VAL n 
14 153 ASP n 
14 154 PHE n 
14 155 ILE n 
14 156 LYS n 
14 157 HIS n 
14 158 SER n 
14 159 LEU n 
14 160 SER n 
14 161 GLN n 
14 162 ALA n 
14 163 ILE n 
14 164 LYS n 
14 165 TRP n 
14 166 ASP n 
14 167 GLY n 
14 168 SER n 
14 169 SER n 
14 170 GLY n 
14 171 GLY n 
14 172 VAL n 
14 173 ILE n 
14 174 ARG n 
14 175 MET n 
14 176 VAL n 
14 177 VAL n 
14 178 LEU n 
14 179 THR n 
14 180 ALA n 
14 181 ALA n 
14 182 GLY n 
14 183 VAL n 
14 184 GLU n 
14 185 ARG n 
14 186 LEU n 
14 187 ILE n 
14 188 PHE n 
14 189 TYR n 
14 190 PRO n 
14 191 ASP n 
14 192 GLU n 
14 193 TYR n 
14 194 GLU n 
14 195 GLN n 
14 196 LEU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? 
;Baker's yeast
;
'Saccharomyces cerevisiae' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP PSA2_YEAST P23639 1  
;MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGP
DYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWK
ATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL
;
1  ? 
2  UNP PSA4_YEAST P23638 2  
;TIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINT
ARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTS
AAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT
;
11 ? 
3  UNP PSA7_YEAST P40303 3  
;GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADS
RILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQ
TIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQE
Q
;
3  ? 
4  UNP PSA5_YEAST P32379 4  
;MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSG
LTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEP
SGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS
;
1  ? 
5  UNP PSA1_YEAST P40302 5  
;FRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDA
RVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAI
GARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
;
2  ? 
6  UNP PSA3_YEAST P21242 6  
;GYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGR
HLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATG
KGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKE
IN
;
7  ? 
7  UNP PSA6_YEAST P21243 7  
;AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPD
ARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKAT
ATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIA
EQD
;
10 ? 
8  UNP PSB7_YEAST P25043 8  
;TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL
QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ
AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICD
;
30 ? 
9  UNP PSB3_YEAST P25451 9  
;SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERA
IEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPE
DLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD
;
2  ? 
10 UNP PSB2_YEAST P22141 10 
;MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAV
SSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDL
LKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ
;
1  ? 
11 UNP PSB5_YEAST P30656 11 
;TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS
KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS
ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
;
76 ? 
12 UNP PSB1_YEAST P23724 12 
;QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHN
DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY
EPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD
;
20 ? 
13 UNP PSB4_YEAST P30657 13 
;TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPL
ADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVD
RESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQKI
;
34 ? 
14 UNP PSB6_YEAST P38624 14 
;TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS
VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS
QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL
;
20 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3SDI A 1 ? 250 ? P23639 1  ? 250 ? 4  236 
2  2  3SDI B 1 ? 235 ? P23638 11 ? 245 ? 13 239 
3  3  3SDI C 1 ? 241 ? P40303 3  ? 243 ? 7  243 
4  4  3SDI D 1 ? 260 ? P32379 1  ? 260 ? 1  254 
5  5  3SDI E 1 ? 233 ? P40302 2  ? 234 ? 4  233 
6  6  3SDI F 1 ? 242 ? P21242 7  ? 248 ? 7  241 
7  7  3SDI G 1 ? 243 ? P21243 10 ? 252 ? 6  240 
8  8  3SDI H 1 ? 222 ? P25043 30 ? 251 ? 1  223 
9  9  3SDI I 1 ? 204 ? P25451 2  ? 205 ? -8 194 
10 10 3SDI J 1 ? 198 ? P22141 1  ? 198 ? -1 193 
11 11 3SDI K 1 ? 212 ? P30656 76 ? 287 ? 1  211 
12 12 3SDI L 1 ? 222 ? P23724 20 ? 241 ? -9 194 
13 13 3SDI M 1 ? 220 ? P30657 34 ? 266 ? -8 211 
14 14 3SDI N 1 ? 196 J P38624 20 ? 215 ? 1  187 
15 1  3SDI O 1 ? 250 ? P23639 1  ? 250 ? 4  236 
16 2  3SDI P 1 ? 235 ? P23638 11 ? 245 ? 13 239 
17 3  3SDI Q 1 ? 241 ? P40303 3  ? 243 ? 7  243 
18 4  3SDI R 1 ? 260 ? P32379 1  ? 260 ? 1  254 
19 5  3SDI S 1 ? 233 ? P40302 2  ? 234 ? 4  233 
20 6  3SDI T 1 ? 242 ? P21242 7  ? 248 ? 7  241 
21 7  3SDI U 1 ? 243 ? P21243 10 ? 252 ? 6  240 
22 8  3SDI V 1 ? 222 ? P25043 30 ? 251 ? 1  223 
23 9  3SDI W 1 ? 204 ? P25451 2  ? 205 ? -8 194 
24 10 3SDI X 1 ? 198 ? P22141 1  ? 198 ? -1 193 
25 11 3SDI Y 1 ? 212 ? P30656 76 ? 287 ? 1  211 
26 12 3SDI Z 1 ? 222 ? P23724 20 ? 241 ? -9 194 
27 13 3SDI 1 1 ? 220 ? P30657 34 ? 266 ? -8 211 
28 14 3SDI 2 1 ? 196 J P38624 20 ? 215 ? 1  187 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
5  3SDI ALA E 122 ? UNP P40302 TYR 123 CONFLICT 127 1 
19 3SDI ALA S 122 ? UNP P40302 TYR 123 CONFLICT 127 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3SD peptide-like        . 
;N~4~-(2,2-dimethylpropyl)-N~1~-{(2S)-1-[(4-methylbenzyl)amino]-1-oxo-4-phenylbutan-2-yl}-N~2~-[(5-methyl-1,2-oxazol-3-yl)carbonyl]-L-aspartamide
;
? 'C32 H41 N5 O5'  575.698 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S'  195.237 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3SDI 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.88 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   68.27 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'100 mM MES, pH 7.0, 40 mM MgOAc, 15% 2-methyl-2,4-pentanediol (MPD), 10 mM EDTA, vapor diffusion, hanging drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
# 
_reflns.entry_id                     3SDI 
_reflns.d_resolution_high            2.650 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   297624 
_reflns.pdbx_Rmerge_I_obs            0.099 
_reflns.pdbx_netI_over_sigmaI        9.500 
_reflns.pdbx_chi_squared             1.029 
_reflns.pdbx_redundancy              3.700 
_reflns.percent_possible_obs         95.800 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.650 2.740  ? ? ? 0.378 ? ? 1.033 2.800 ? 24439 78.800  1  1 
2.740 2.850  ? ? ? 0.359 ? ? 1.038 3.200 ? 27156 87.500  2  1 
2.850 2.980  ? ? ? 0.318 ? ? 1.071 3.500 ? 29047 93.800  3  1 
2.980 3.140  ? ? ? 0.274 ? ? 1.070 3.700 ? 30528 98.500  4  1 
3.140 3.340  ? ? ? 0.204 ? ? 1.048 3.900 ? 30991 99.900  5  1 
3.340 3.600  ? ? ? 0.134 ? ? 0.994 3.900 ? 31068 100.000 6  1 
3.600 3.960  ? ? ? 0.101 ? ? 1.027 3.900 ? 31006 100.000 7  1 
3.960 4.530  ? ? ? 0.074 ? ? 0.991 3.900 ? 31103 100.000 8  1 
4.530 5.700  ? ? ? 0.062 ? ? 0.998 3.900 ? 31114 100.000 9  1 
5.700 30.000 ? ? ? 0.050 ? ? 1.039 3.800 ? 31172 99.500  10 1 
# 
_refine.entry_id                                 3SDI 
_refine.ls_d_res_high                            2.6500 
_refine.ls_d_res_low                             30.0 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.4000 
_refine.ls_number_reflns_obs                     296915 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'U VALUES: REFINED INDIVIDUALLY' 
_refine.ls_R_factor_obs                          0.2193 
_refine.ls_R_factor_R_work                       0.2186 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2532 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 2.0000 
_refine.ls_number_reflns_R_free                  5996 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               47.8467 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            2.4200 
_refine.aniso_B[2][2]                            -4.4300 
_refine.aniso_B[3][3]                            1.6300 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.4900 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9310 
_refine.correlation_coeff_Fo_to_Fc_free          0.9080 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.2810 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 1G0U' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                126.950 
_refine.B_iso_min                                18.660 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        48883 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         128 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               49012 
_refine_hist.d_res_high                       2.6500 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       49882 0.010  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    67464 1.258  1.965  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 6248  5.921  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 2214  38.134 24.499 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 8652  17.922 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 270   18.044 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         7618  0.085  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   37416 0.005  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            31148 0.560  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           50078 1.092  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            18734 1.440  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           17386 2.580  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.65 
_refine_ls_shell.d_res_low                        2.7150 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               75.7700 
_refine_ls_shell.number_reflns_R_work             17002 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3130 
_refine_ls_shell.R_factor_R_free                  0.3420 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             369 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                17371 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SDI 
_struct.title                     'Structure of yeast 20S open-gate proteasome with Compound 20' 
_struct.pdbx_descriptor           
;Proteasome component Y7 (E.C.3.4.25.1), Proteasome component Y13 (E.C.3.4.25.1), Proteasome component PRE6 (E.C.3.4.25.1), Proteasome component PUP2 (E.C.3.4.25.1), Proteasome component PRE5 (E.C.3.4.25.1), Proteasome component C1 (E.C.3.4.25.1), Proteasome component C7-alpha (E.C.3.4.25.1), Proteasome component PUP1 (E.C.3.4.25.1), Proteasome component PUP3 (E.C.3.4.25.1), Proteasome component C11 (E.C.3.4.25.1), Proteasome component PRE2 (E.C.3.4.25.1), Proteasome component C5 (E.C.3.4.25.1), Proteasome component PRE4 (E.C.3.4.25.1), Proteasome component PRE3 (E.C.3.4.25.1)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SDI 
_struct_keywords.text            '20S proteasome, Hydrolase-Hydrolase Inhibitor complex' 
_struct_keywords.pdbx_keywords   'Hydrolase/Hydrolase Inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 1  ? 
P  N N 2  ? 
Q  N N 3  ? 
R  N N 4  ? 
S  N N 5  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 8  ? 
W  N N 9  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 12 ? 
AA N N 13 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 15 ? 
EA N N 15 ? 
FA N N 15 ? 
GA N N 15 ? 
HA N N 15 ? 
IA N N 15 ? 
JA N N 16 ? 
KA N N 17 ? 
LA N N 15 ? 
MA N N 15 ? 
NA N N 15 ? 
OA N N 15 ? 
PA N N 15 ? 
QA N N 15 ? 
RA N N 15 ? 
SA N N 15 ? 
TA N N 15 ? 
UA N N 15 ? 
VA N N 16 ? 
WA N N 17 ? 
XA N N 15 ? 
YA N N 15 ? 
ZA N N 15 ? 
AB N N 18 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   LEU A  18  ? GLN A  30  ? LEU A 21  GLN A 33  1 ? 13 
HELX_P HELX_P2   2   MET A  57  ? LEU A  61  ? MET A 60  LEU A 64  5 ? 5  
HELX_P HELX_P3   3   MET A  78  ? SER A  96  ? MET A 81  SER A 99  1 ? 19 
HELX_P HELX_P4   4   TYR A  97  ? GLY A  102 ? TYR A 100 GLY A 104 1 ? 6  
HELX_P HELX_P5   5   PRO A  106 ? ALA A  121 ? PRO A 108 ALA A 123 1 ? 16 
HELX_P HELX_P6   6   GLY A  167 ? TRP A  179 ? GLY A 168 TRP A 180 1 ? 13 
HELX_P HELX_P7   7   GLU A  184 ? SER A  199 ? GLU A 185 SER A 200 1 ? 16 
HELX_P HELX_P8   8   ASN A  218 B LEU A  222 G ASN A 217 LEU A 217 5 ? 5  
HELX_P HELX_P9   9   THR A  239 ? GLU A  248 ? THR A 225 GLU A 234 1 ? 10 
HELX_P HELX_P10  10  LEU B  9   ? SER B  20  ? LEU B 21  SER B 32  1 ? 12 
HELX_P HELX_P11  11  LEU B  70  ? ASN B  93  ? LEU B 81  ASN B 104 1 ? 24 
HELX_P HELX_P12  12  PRO B  97  ? HIS B  115 ? PRO B 108 HIS B 126 1 ? 19 
HELX_P HELX_P13  13  ASN B  158 ? TYR B  170 ? ASN B 168 TYR B 180 1 ? 13 
HELX_P HELX_P14  14  LYS B  175 ? THR B  191 ? LYS B 185 THR B 202 1 ? 17 
HELX_P HELX_P15  15  THR B  197 ? ASP B  199 ? THR B 206 ASP B 208 5 ? 3  
HELX_P HELX_P16  16  LYS B  221 ? THR B  232 ? LYS B 225 THR B 236 1 ? 12 
HELX_P HELX_P17  17  ILE C  15  ? GLY C  28  ? ILE C 21  GLY C 34  1 ? 14 
HELX_P HELX_P18  18  LEU C  76  ? GLU C  99  ? LEU C 81  GLU C 104 1 ? 24 
HELX_P HELX_P19  19  THR C  103 ? TYR C  118 ? THR C 108 TYR C 123 1 ? 16 
HELX_P HELX_P20  20  ASN C  165 ? TYR C  177 ? ASN C 168 TYR C 180 1 ? 13 
HELX_P HELX_P21  21  THR C  185 ? GLU C  199 ? THR C 185 GLU C 199 1 ? 15 
HELX_P HELX_P22  22  SER C  223 ? GLN C  239 ? SER C 225 GLN C 241 1 ? 17 
HELX_P HELX_P23  23  LEU D  21  ? LEU D  33  ? LEU D 21  LEU D 33  1 ? 13 
HELX_P HELX_P24  24  GLU D  60  ? ILE D  64  ? GLU D 60  ILE D 64  5 ? 5  
HELX_P HELX_P25  25  THR D  82  ? ASP D  84  ? THR D 82  ASP D 84  5 ? 3  
HELX_P HELX_P26  26  ALA D  85  ? ASP D  104 ? ALA D 85  ASP D 104 1 ? 20 
HELX_P HELX_P27  27  ASN D  108 ? ARG D  122 ? ASN D 108 ARG D 122 1 ? 15 
HELX_P HELX_P28  28  GLY D  175 ? TRP D  187 ? GLY D 168 TRP D 180 1 ? 13 
HELX_P HELX_P29  29  THR D  192 ? MET D  208 ? THR D 185 MET D 201 1 ? 17 
HELX_P HELX_P30  30  ASP D  232 ? ALA D  248 ? ASP D 225 ALA D 242 1 ? 17 
HELX_P HELX_P31  31  LEU E  18  ? GLN E  30  ? LEU E 21  GLN E 33  1 ? 13 
HELX_P HELX_P32  32  LEU E  76  ? ASN E  99  ? LEU E 81  ASN E 104 1 ? 24 
HELX_P HELX_P33  33  ALA E  103 ? ASN E  118 ? ALA E 108 ASN E 123 1 ? 16 
HELX_P HELX_P34  34  SER E  164 ? ILE E  179 D SER E 169 ILE E 180 1 ? 16 
HELX_P HELX_P35  35  ASN E  184 ? GLN E  198 ? ASN E 185 GLN E 199 1 ? 15 
HELX_P HELX_P36  36  GLU E  227 ? ILE E  233 ? GLU E 227 ILE E 233 5 ? 7  
HELX_P HELX_P37  37  ASN F  15  ? ASN F  27  ? ASN F 21  ASN F 33  1 ? 13 
HELX_P HELX_P38  38  LEU F  75  ? LYS F  98  ? LEU F 81  LYS F 104 1 ? 24 
HELX_P HELX_P39  39  PRO F  102 ? HIS F  117 ? PRO F 108 HIS F 123 1 ? 16 
HELX_P HELX_P40  40  GLY F  162 ? HIS F  177 C GLY F 168 HIS F 180 1 ? 16 
HELX_P HELX_P41  41  SER F  182 ? GLU F  199 ? SER F 185 GLU F 203 1 ? 18 
HELX_P HELX_P42  42  ASP F  200 ? LYS F  202 ? ASP F 204 LYS F 206 5 ? 3  
HELX_P HELX_P43  43  LYS F  226 ? GLU F  240 ? LYS F 225 GLU F 239 1 ? 15 
HELX_P HELX_P44  44  LEU G  16  ? THR G  26  ? LEU G 21  THR G 31  1 ? 11 
HELX_P HELX_P45  45  ASP G  56  ? VAL G  60  ? ASP G 60  VAL G 64  5 ? 5  
HELX_P HELX_P46  46  PRO G  77  ? GLY G  100 ? PRO G 81  GLY G 104 1 ? 24 
HELX_P HELX_P47  47  PRO G  104 ? ARG G  122 ? PRO G 108 ARG G 126 1 ? 19 
HELX_P HELX_P48  48  LYS G  165 ? LYS G  181 E LYS G 168 LYS G 179 1 ? 17 
HELX_P HELX_P49  49  SER G  189 M GLY G  206 ? SER G 184 GLY G 202 1 ? 18 
HELX_P HELX_P50  50  SER G  228 ? ALA G  240 ? SER G 225 ALA G 237 1 ? 13 
HELX_P HELX_P51  51  THR H  48  ? SER H  71  ? THR H 48  SER H 71  1 ? 24 
HELX_P HELX_P52  52  ARG H  75  ? TYR H  90  ? ARG H 75  TYR H 90  1 ? 16 
HELX_P HELX_P53  53  GLY H  130 ? TRP H  142 ? GLY H 130 TRP H 142 1 ? 13 
HELX_P HELX_P54  54  THR H  147 ? ASP H  166 ? THR H 147 ASP H 166 1 ? 20 
HELX_P HELX_P55  55  ASP I  2   ? ILE I  6   ? ASP I -7  ILE I -3  5 ? 5  
HELX_P HELX_P56  56  LEU I  55  ? GLU I  78  ? LEU I 48  GLU I 71  1 ? 24 
HELX_P HELX_P57  57  GLU I  82  ? GLU I  96  ? GLU I 75  GLU I 89  1 ? 15 
HELX_P HELX_P58  58  ALA I  141 ? TYR I  153 ? ALA I 130 TYR I 142 1 ? 13 
HELX_P HELX_P59  59  GLU I  158 ? ARG I  176 ? GLU I 147 ARG I 165 1 ? 19 
HELX_P HELX_P60  60  GLY J  51  ? ASP J  72  ? GLY J 50  ASP J 71  1 ? 22 
HELX_P HELX_P61  61  SER J  76  ? ARG J  93  B SER J 75  ARG J 90  1 ? 18 
HELX_P HELX_P62  62  TYR J  135 ? TYR J  148 ? TYR J 129 TYR J 142 1 ? 14 
HELX_P HELX_P63  63  THR J  153 ? MET J  172 ? THR J 147 MET J 166 1 ? 20 
HELX_P HELX_P64  64  GLY K  48  ? LYS K  71  ? GLY K 48  LYS K 71  1 ? 24 
HELX_P HELX_P65  65  SER K  75  ? TYR K  90  ? SER K 75  TYR K 90  1 ? 16 
HELX_P HELX_P66  66  GLY K  132 ? TYR K  144 ? GLY K 130 TYR K 142 1 ? 13 
HELX_P HELX_P67  67  SER K  149 ? ASP K  168 ? SER K 147 ASP K 166 1 ? 20 
HELX_P HELX_P68  68  VAL K  193 ? GLY K  205 ? VAL K 192 GLY K 204 1 ? 13 
HELX_P HELX_P69  69  PHE L  57  ? HIS L  79  ? PHE L 48  HIS L 70  1 ? 23 
HELX_P HELX_P70  70  SER L  85  ? LYS L  100 ? SER L 75  LYS L 90  1 ? 16 
HELX_P HELX_P71  71  ALA L  142 ? VAL L  154 ? ALA L 130 VAL L 142 1 ? 13 
HELX_P HELX_P72  72  SER L  176 ? HIS L  195 ? SER L 147 HIS L 166 1 ? 20 
HELX_P HELX_P73  73  ILE M  57  ? TYR M  76  ? ILE M 48  TYR M 67  1 ? 20 
HELX_P HELX_P74  74  GLU M  88  ? LYS M  106 ? GLU M 79  LYS M 97  1 ? 19 
HELX_P HELX_P75  75  GLY M  145 ? LYS M  157 ? GLY M 136 LYS M 148 1 ? 13 
HELX_P HELX_P76  76  ARG M  161 ? ILE M  165 ? ARG M 152 ILE M 156 5 ? 5  
HELX_P HELX_P77  77  THR M  169 ? ASP M  188 ? THR M 160 ASP M 179 1 ? 20 
HELX_P HELX_P78  78  TRP M  219 ? ILE M  225 ? TRP M 210 ILE M 216 5 ? 7  
HELX_P HELX_P79  79  SER N  48  ? GLY N  71  ? SER N 48  GLY N 72  1 ? 24 
HELX_P HELX_P80  80  SER N  74  ? ASN N  89  ? SER N 75  ASN N 90  1 ? 16 
HELX_P HELX_P81  81  GLY N  128 ? PHE N  133 ? GLY N 128 PHE N 133 5 ? 6  
HELX_P HELX_P82  82  ILE N  134 ? PHE N  142 ? ILE N 134 PHE N 142 1 ? 9  
HELX_P HELX_P83  83  SER N  147 ? ASP N  166 ? SER N 147 ASP N 166 1 ? 20 
HELX_P HELX_P84  84  TYR N  189 C GLU N  194 H TYR N 187 GLU N 187 1 ? 6  
HELX_P HELX_P85  85  LEU O  18  ? GLY O  31  ? LEU O 21  GLY O 34  1 ? 14 
HELX_P HELX_P86  86  MET O  78  ? SER O  96  ? MET O 81  SER O 99  1 ? 19 
HELX_P HELX_P87  87  TYR O  97  ? GLY O  102 ? TYR O 100 GLY O 104 1 ? 6  
HELX_P HELX_P88  88  PRO O  106 ? THR O  122 ? PRO O 108 THR O 124 1 ? 17 
HELX_P HELX_P89  89  GLY O  167 ? TRP O  179 ? GLY O 168 TRP O 180 1 ? 13 
HELX_P HELX_P90  90  GLU O  184 ? VAL O  200 ? GLU O 185 VAL O 202 1 ? 17 
HELX_P HELX_P91  91  ASN O  218 B LEU O  222 G ASN O 217 LEU O 217 5 ? 5  
HELX_P HELX_P92  92  THR O  239 ? ALA O  249 ? THR O 225 ALA O 235 1 ? 11 
HELX_P HELX_P93  93  LEU P  9   ? SER P  20  ? LEU P 21  SER P 32  1 ? 12 
HELX_P HELX_P94  94  LEU P  70  ? ASN P  93  ? LEU P 81  ASN P 104 1 ? 24 
HELX_P HELX_P95  95  PRO P  97  ? HIS P  115 ? PRO P 108 HIS P 126 1 ? 19 
HELX_P HELX_P96  96  ASN P  158 ? TYR P  170 ? ASN P 168 TYR P 180 1 ? 13 
HELX_P HELX_P97  97  LYS P  175 ? THR P  191 ? LYS P 185 THR P 202 1 ? 17 
HELX_P HELX_P98  98  THR P  197 ? ASP P  199 ? THR P 206 ASP P 208 5 ? 3  
HELX_P HELX_P99  99  LYS P  221 ? THR P  232 ? LYS P 225 THR P 236 1 ? 12 
HELX_P HELX_P100 100 ILE Q  15  ? ARG Q  27  ? ILE Q 21  ARG Q 33  1 ? 13 
HELX_P HELX_P101 101 LEU Q  76  ? GLU Q  99  ? LEU Q 81  GLU Q 104 1 ? 24 
HELX_P HELX_P102 102 THR Q  103 ? THR Q  119 ? THR Q 108 THR Q 124 1 ? 17 
HELX_P HELX_P103 103 ASN Q  165 ? TYR Q  177 ? ASN Q 168 TYR Q 180 1 ? 13 
HELX_P HELX_P104 104 THR Q  185 ? GLN Q  202 ? THR Q 185 GLN Q 202 1 ? 18 
HELX_P HELX_P105 105 SER Q  223 ? GLU Q  240 ? SER Q 225 GLU Q 242 1 ? 18 
HELX_P HELX_P106 106 LEU R  21  ? LEU R  33  ? LEU R 21  LEU R 33  1 ? 13 
HELX_P HELX_P107 107 GLU R  60  ? ILE R  64  ? GLU R 60  ILE R 64  5 ? 5  
HELX_P HELX_P108 108 THR R  82  ? ASP R  84  ? THR R 82  ASP R 84  5 ? 3  
HELX_P HELX_P109 109 ALA R  85  ? ASP R  104 ? ALA R 85  ASP R 104 1 ? 20 
HELX_P HELX_P110 110 ASN R  108 ? ARG R  122 ? ASN R 108 ARG R 122 1 ? 15 
HELX_P HELX_P111 111 GLY R  175 ? TRP R  187 ? GLY R 168 TRP R 180 1 ? 13 
HELX_P HELX_P112 112 THR R  192 ? MET R  208 ? THR R 185 MET R 201 1 ? 17 
HELX_P HELX_P113 113 ASP R  232 ? ALA R  248 ? ASP R 225 ALA R 242 1 ? 17 
HELX_P HELX_P114 114 LEU S  18  ? ALA S  27  ? LEU S 21  ALA S 30  1 ? 10 
HELX_P HELX_P115 115 LEU S  76  ? ASN S  99  ? LEU S 81  ASN S 104 1 ? 24 
HELX_P HELX_P116 116 ALA S  103 ? ASN S  118 ? ALA S 108 ASN S 123 1 ? 16 
HELX_P HELX_P117 117 SER S  164 ? ILE S  179 D SER S 169 ILE S 180 1 ? 16 
HELX_P HELX_P118 118 PRO S  185 ? GLN S  198 ? PRO S 186 GLN S 199 1 ? 14 
HELX_P HELX_P119 119 GLU S  227 ? ILE S  233 ? GLU S 227 ILE S 233 5 ? 7  
HELX_P HELX_P120 120 ASN T  15  ? ASN T  27  ? ASN T 21  ASN T 33  1 ? 13 
HELX_P HELX_P121 121 LEU T  75  ? LYS T  98  ? LEU T 81  LYS T 104 1 ? 24 
HELX_P HELX_P122 122 PRO T  102 ? HIS T  117 ? PRO T 108 HIS T 123 1 ? 16 
HELX_P HELX_P123 123 GLY T  162 ? HIS T  177 C GLY T 168 HIS T 180 1 ? 16 
HELX_P HELX_P124 124 SER T  182 ? HIS T  198 ? SER T 185 HIS T 202 1 ? 17 
HELX_P HELX_P125 125 GLU T  199 ? LYS T  202 ? GLU T 203 LYS T 206 5 ? 4  
HELX_P HELX_P126 126 LYS T  226 ? GLU T  240 ? LYS T 225 GLU T 239 1 ? 15 
HELX_P HELX_P127 127 LEU U  16  ? THR U  26  ? LEU U 21  THR U 31  1 ? 11 
HELX_P HELX_P128 128 ASP U  56  ? VAL U  60  ? ASP U 60  VAL U 64  5 ? 5  
HELX_P HELX_P129 129 PRO U  77  ? GLY U  100 ? PRO U 81  GLY U 104 1 ? 24 
HELX_P HELX_P130 130 PRO U  104 ? ARG U  122 ? PRO U 108 ARG U 126 1 ? 19 
HELX_P HELX_P131 131 LYS U  165 ? LYS U  181 E LYS U 168 LYS U 179 1 ? 17 
HELX_P HELX_P132 132 SER U  189 M GLY U  206 ? SER U 184 GLY U 202 1 ? 18 
HELX_P HELX_P133 133 SER U  228 ? ALA U  240 ? SER U 225 ALA U 237 1 ? 13 
HELX_P HELX_P134 134 THR V  48  ? SER V  71  ? THR V 48  SER V 71  1 ? 24 
HELX_P HELX_P135 135 ARG V  75  ? TYR V  90  ? ARG V 75  TYR V 90  1 ? 16 
HELX_P HELX_P136 136 GLY V  130 ? TRP V  142 ? GLY V 130 TRP V 142 1 ? 13 
HELX_P HELX_P137 137 THR V  147 ? ASP V  166 ? THR V 147 ASP V 166 1 ? 20 
HELX_P HELX_P138 138 ASP W  2   ? ILE W  6   ? ASP W -7  ILE W -3  5 ? 5  
HELX_P HELX_P139 139 LEU W  55  ? GLU W  78  ? LEU W 48  GLU W 71  1 ? 24 
HELX_P HELX_P140 140 GLU W  82  ? GLU W  96  ? GLU W 75  GLU W 89  1 ? 15 
HELX_P HELX_P141 141 ALA W  141 ? TYR W  153 ? ALA W 130 TYR W 142 1 ? 13 
HELX_P HELX_P142 142 GLU W  158 ? ASP W  175 ? GLU W 147 ASP W 164 1 ? 18 
HELX_P HELX_P143 143 GLY X  51  ? ASP X  72  ? GLY X 50  ASP X 71  1 ? 22 
HELX_P HELX_P144 144 SER X  76  ? ILE X  92  A SER X 75  ILE X 90  1 ? 17 
HELX_P HELX_P145 145 TYR X  135 ? TYR X  148 ? TYR X 129 TYR X 142 1 ? 14 
HELX_P HELX_P146 146 THR X  153 ? MET X  172 ? THR X 147 MET X 166 1 ? 20 
HELX_P HELX_P147 147 GLY Y  48  ? LYS Y  71  ? GLY Y 48  LYS Y 71  1 ? 24 
HELX_P HELX_P148 148 SER Y  75  ? TYR Y  90  ? SER Y 75  TYR Y 90  1 ? 16 
HELX_P HELX_P149 149 GLY Y  132 ? SER Y  142 ? GLY Y 130 SER Y 140 1 ? 11 
HELX_P HELX_P150 150 SER Y  149 ? ASP Y  168 ? SER Y 147 ASP Y 166 1 ? 20 
HELX_P HELX_P151 151 VAL Y  193 ? GLY Y  205 ? VAL Y 192 GLY Y 204 1 ? 13 
HELX_P HELX_P152 152 PHE Z  57  ? HIS Z  79  ? PHE Z 48  HIS Z 70  1 ? 23 
HELX_P HELX_P153 153 SER Z  85  ? GLY Z  99  ? SER Z 75  GLY Z 89  1 ? 15 
HELX_P HELX_P154 154 ALA Z  142 ? VAL Z  154 ? ALA Z 130 VAL Z 142 1 ? 13 
HELX_P HELX_P155 155 SER Z  176 ? HIS Z  195 ? SER Z 147 HIS Z 166 1 ? 20 
HELX_P HELX_P156 156 ILE AA 57  ? TYR AA 76  ? ILE 1 48  TYR 1 67  1 ? 20 
HELX_P HELX_P157 157 GLU AA 88  ? LYS AA 106 ? GLU 1 79  LYS 1 97  1 ? 19 
HELX_P HELX_P158 158 GLY AA 145 ? LYS AA 157 ? GLY 1 136 LYS 1 148 1 ? 13 
HELX_P HELX_P159 159 ARG AA 161 ? ILE AA 165 ? ARG 1 152 ILE 1 156 5 ? 5  
HELX_P HELX_P160 160 THR AA 169 ? ASP AA 188 ? THR 1 160 ASP 1 179 1 ? 20 
HELX_P HELX_P161 161 TRP AA 219 ? ILE AA 225 ? TRP 1 210 ILE 1 216 5 ? 7  
HELX_P HELX_P162 162 SER BA 48  ? GLY BA 71  ? SER 2 48  GLY 2 72  1 ? 24 
HELX_P HELX_P163 163 SER BA 74  ? ASN BA 89  ? SER 2 75  ASN 2 90  1 ? 16 
HELX_P HELX_P164 164 LYS BA 90  ? LEU BA 93  ? LYS 2 91  LEU 2 95  5 ? 4  
HELX_P HELX_P165 165 GLY BA 128 ? PHE BA 133 ? GLY 2 128 PHE 2 133 5 ? 6  
HELX_P HELX_P166 166 ILE BA 134 ? PHE BA 142 ? ILE 2 134 PHE 2 142 1 ? 9  
HELX_P HELX_P167 167 SER BA 147 ? ASP BA 166 ? SER 2 147 ASP 2 166 1 ? 20 
HELX_P HELX_P168 168 TYR BA 189 C GLU BA 194 H TYR 2 187 GLU 2 187 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? G  MET 125 O   ? ? ? 1_555 EA MG . MG ? ? G MET 129 G MG 9001 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc2  metalc ? ? G  TYR 119 O   ? ? ? 1_555 EA MG . MG ? ? G TYR 123 G MG 9001 1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc3  metalc ? ? G  ARG 122 O   ? ? ? 1_555 EA MG . MG ? ? G ARG 126 G MG 9001 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc4  metalc ? ? G  THR 8   OG1 ? ? ? 1_555 EA MG . MG ? ? G THR 13  G MG 9001 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc5  metalc ? ? H  ILE 163 O   ? ? ? 1_555 FA MG . MG ? ? H ILE 163 H MG 301  1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc6  metalc ? ? R  GLU 105 OE2 ? ? ? 1_555 XA MG . MG ? ? R GLU 105 Z MG 201  1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc7  metalc ? ? T  SER 7   OG  ? ? ? 1_555 PA MG . MG ? ? T SER 13  T MG 302  1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc8  metalc ? ? H  SER 169 O   ? ? ? 1_555 FA MG . MG ? ? H SER 169 H MG 301  1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc9  metalc ? ? U  MET 125 O   ? ? ? 1_555 QA MG . MG ? ? U MET 129 U MG 301  1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc10 metalc ? ? V  ILE 163 O   ? ? ? 1_555 RA MG . MG ? ? V ILE 163 V MG 301  1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc11 metalc ? ? V  SER 169 O   ? ? ? 1_555 RA MG . MG ? ? V SER 169 V MG 301  1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc12 metalc ? ? U  ARG 122 O   ? ? ? 1_555 QA MG . MG ? ? U ARG 126 U MG 301  1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc13 metalc ? ? Y  ASP 168 O   ? ? ? 1_555 UA MG . MG ? ? Y ASP 166 Y MG 301  1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc14 metalc ? ? V  ASP 166 O   ? ? ? 1_555 RA MG . MG ? ? V ASP 166 V MG 301  1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc15 metalc ? ? K  ASP 168 O   ? ? ? 1_555 IA MG . MG ? ? K ASP 166 K MG 301  1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc16 metalc ? ? Z  THR 192 O   ? ? ? 1_555 YA MG . MG ? ? Z THR 163 Z MG 202  1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc17 metalc ? ? W  ALA 174 O   ? ? ? 1_555 TA MG . MG ? ? W ALA 163 W MG 202  1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc18 metalc ? ? U  TYR 119 O   ? ? ? 1_555 QA MG . MG ? ? U TYR 123 U MG 301  1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc19 metalc ? ? D  GLU 105 OE2 ? ? ? 1_555 LA MG . MG ? ? D GLU 105 L MG 201  1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc20 metalc ? ? K  ALA 165 O   ? ? ? 1_555 IA MG . MG ? ? K ALA 163 K MG 301  1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc21 metalc ? ? Y  ALA 165 O   ? ? ? 1_555 UA MG . MG ? ? Y ALA 163 Y MG 301  1_555 ? ? ? ? ? ? ? 2.369 ? 
metalc22 metalc ? ? W  ASP 177 O   ? ? ? 1_555 TA MG . MG ? ? W ASP 166 W MG 202  1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc23 metalc ? ? H  ASP 166 O   ? ? ? 1_555 FA MG . MG ? ? H ASP 166 H MG 301  1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc24 metalc ? ? I  ASP 204 O   ? ? ? 1_555 UA MG . MG ? ? I ASP 194 Y MG 301  1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc25 metalc ? ? Y  SER 171 O   ? ? ? 1_555 UA MG . MG ? ? Y SER 169 Y MG 301  1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc26 metalc ? ? Z  ASP 222 OXT ? ? ? 1_555 FA MG . MG ? ? Z ASP 194 H MG 301  1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc27 metalc ? ? BA ILE 163 O   ? ? ? 1_555 ZA MG . MG ? ? 2 ILE 163 2 MG 201  1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc28 metalc ? ? W  SER 142 OG  ? ? ? 1_555 SA MG . MG ? ? W SER 131 W MG 201  1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc29 metalc ? ? BA SER 169 O   ? ? ? 1_555 ZA MG . MG ? ? 2 SER 169 2 MG 201  1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc30 metalc ? ? F  SER 7   OG  ? ? ? 1_555 DA MG . MG ? ? F SER 13  F MG 302  1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc31 metalc ? ? I  ASP 177 O   ? ? ? 1_555 HA MG . MG ? ? I ASP 166 I MG 202  1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc32 metalc ? ? Z  VAL 198 O   ? ? ? 1_555 YA MG . MG ? ? Z VAL 169 Z MG 202  1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc33 metalc ? ? L  VAL 198 O   ? ? ? 1_555 MA MG . MG ? ? L VAL 169 L MG 202  1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc34 metalc ? ? L  THR 192 O   ? ? ? 1_555 MA MG . MG ? ? L THR 163 L MG 202  1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc35 metalc ? ? Z  SER 85  OG  ? ? ? 1_555 XA MG . MG ? ? Z SER 75  Z MG 201  1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc36 metalc ? ? W  ASP 204 O   ? ? ? 1_555 IA MG . MG ? ? W ASP 194 K MG 301  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc37 metalc ? ? N  SER 169 O   ? ? ? 1_555 NA MG . MG ? ? N SER 169 N MG 201  1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc38 metalc ? ? F  ASN 121 OD1 ? ? ? 1_555 DA MG . MG ? ? F ASN 127 F MG 302  1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc39 metalc ? ? I  SER 142 OG  ? ? ? 1_555 GA MG . MG ? ? I SER 131 I MG 201  1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc40 metalc ? ? I  ALA 174 O   ? ? ? 1_555 HA MG . MG ? ? I ALA 163 I MG 202  1_555 ? ? ? ? ? ? ? 2.568 ? 
metalc41 metalc ? ? L  ASP 222 OXT ? ? ? 1_555 RA MG . MG ? ? L ASP 194 V MG 301  1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc42 metalc ? ? U  THR 8   OG1 ? ? ? 1_555 QA MG . MG ? ? U THR 13  U MG 301  1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc43 metalc ? ? N  ILE 163 O   ? ? ? 1_555 NA MG . MG ? ? N ILE 163 N MG 201  1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc44 metalc ? ? W  SER 180 O   ? ? ? 1_555 TA MG . MG ? ? W SER 169 W MG 202  1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc45 metalc ? ? T  ASN 121 OD1 ? ? ? 1_555 PA MG . MG ? ? T ASN 127 T MG 302  1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc46 metalc ? ? L  SER 85  OG  ? ? ? 1_555 LA MG . MG ? ? L SER 75  L MG 201  1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc47 metalc ? ? BA ASP 166 O   ? ? ? 1_555 ZA MG . MG ? ? 2 ASP 166 2 MG 201  1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc48 metalc ? ? L  HIS 195 O   ? ? ? 1_555 MA MG . MG ? ? L HIS 166 L MG 202  1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc49 metalc ? ? K  SER 171 O   ? ? ? 1_555 IA MG . MG ? ? K SER 169 K MG 301  1_555 ? ? ? ? ? ? ? 2.729 ? 
metalc50 metalc ? ? Z  HIS 195 O   ? ? ? 1_555 YA MG . MG ? ? Z HIS 166 Z MG 202  1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc51 metalc ? ? I  SER 180 O   ? ? ? 1_555 HA MG . MG ? ? I SER 169 I MG 202  1_555 ? ? ? ? ? ? ? 2.753 ? 
metalc52 metalc ? ? U  ALA 123 O   ? ? ? 1_555 PA MG . MG ? ? U ALA 127 T MG 302  1_555 ? ? ? ? ? ? ? 2.766 ? 
metalc53 metalc ? ? N  ASP 166 O   ? ? ? 1_555 NA MG . MG ? ? N ASP 166 N MG 201  1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc54 metalc ? ? L  SER 88  OG  ? ? ? 1_555 LA MG . MG ? ? L SER 78  L MG 201  1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc55 metalc ? ? Z  SER 88  OG  ? ? ? 1_555 XA MG . MG ? ? Z SER 78  Z MG 201  1_555 ? ? ? ? ? ? ? 2.972 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 5 ? 
B  ? 5 ? 
C  ? 6 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 5 ? 
G  ? 5 ? 
H  ? 5 ? 
I  ? 5 ? 
J  ? 5 ? 
K  ? 5 ? 
L  ? 5 ? 
M  ? 5 ? 
N  ? 5 ? 
O  ? 5 ? 
P  ? 2 ? 
Q  ? 5 ? 
R  ? 6 ? 
S  ? 2 ? 
T  ? 5 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 5 ? 
X  ? 5 ? 
Y  ? 2 ? 
Z  ? 5 ? 
AA ? 5 ? 
AB ? 2 ? 
AC ? 5 ? 
AD ? 5 ? 
AE ? 7 ? 
AF ? 5 ? 
AG ? 5 ? 
AH ? 2 ? 
AI ? 5 ? 
AJ ? 5 ? 
AK ? 5 ? 
AL ? 6 ? 
AM ? 5 ? 
AN ? 5 ? 
AO ? 5 ? 
AP ? 5 ? 
AQ ? 5 ? 
AR ? 5 ? 
AS ? 5 ? 
AT ? 5 ? 
AU ? 5 ? 
AV ? 5 ? 
AW ? 5 ? 
AX ? 5 ? 
AY ? 2 ? 
AZ ? 5 ? 
BA ? 6 ? 
BB ? 2 ? 
BC ? 5 ? 
BD ? 5 ? 
BE ? 2 ? 
BF ? 5 ? 
BG ? 5 ? 
BH ? 2 ? 
BI ? 5 ? 
BJ ? 5 ? 
BK ? 2 ? 
BL ? 5 ? 
BM ? 5 ? 
BN ? 7 ? 
BO ? 5 ? 
BP ? 5 ? 
BQ ? 2 ? 
BR ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
C  1 2 ? parallel      
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? anti-parallel 
C  5 6 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
G  4 5 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
H  4 5 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
J  4 5 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
L  4 5 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
P  1 2 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
R  5 6 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
Z  4 5 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AE 5 6 ? anti-parallel 
AE 6 7 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AG 4 5 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AI 4 5 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AJ 4 5 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AL 1 2 ? parallel      
AL 2 3 ? anti-parallel 
AL 3 4 ? anti-parallel 
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AN 4 5 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AO 4 5 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AR 4 5 ? anti-parallel 
AS 1 2 ? anti-parallel 
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AT 4 5 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AU 4 5 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AV 4 5 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AW 4 5 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
AZ 4 5 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BC 3 4 ? anti-parallel 
BC 4 5 ? anti-parallel 
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? anti-parallel 
BD 4 5 ? anti-parallel 
BE 1 2 ? anti-parallel 
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BF 3 4 ? anti-parallel 
BF 4 5 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BG 3 4 ? anti-parallel 
BG 4 5 ? anti-parallel 
BH 1 2 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BI 3 4 ? anti-parallel 
BI 4 5 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BJ 3 4 ? anti-parallel 
BJ 4 5 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? anti-parallel 
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BM 1 2 ? anti-parallel 
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? anti-parallel 
BN 4 5 ? anti-parallel 
BN 5 6 ? anti-parallel 
BN 6 7 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BO 4 5 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BP 3 4 ? anti-parallel 
BP 4 5 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BR 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ALA A  161 ? ILE A  164 ? ALA A 162 ILE A 165 
A  2 SER A  34  ? ALA A  39  ? SER A 37  ALA A 42  
A  3 GLY A  42  ? GLU A  48  ? GLY A 45  GLU A 51  
A  4 ILE A  209 ? ILE A  214 ? ILE A 210 ILE A 215 
A  5 PHE A  235 ? LYS A  237 ? PHE A 221 LYS A 223 
B  1 SER A  65  ? THR A  68  ? SER A 68  THR A 71  
B  2 ILE A  71  ? GLY A  77  ? ILE A 74  GLY A 80  
B  3 VAL A  132 ? ASP A  140 ? VAL A 134 ASP A 142 
B  4 GLY A  144 ? VAL A  150 ? GLY A 146 VAL A 151 
B  5 TYR A  156 ? PRO A  158 ? TYR A 157 PRO A 159 
C  1 TYR A  224 I THR A  225 J TYR A 217 THR A 217 
C  2 ALA H  184 ? LEU H  191 ? ALA H 184 LEU H 192 
C  3 VAL H  173 ? GLU H  179 ? VAL H 173 GLU H 179 
C  4 GLY H  11  ? ASP H  17  ? GLY H 11  ASP H 17  
C  5 ILE H  3   ? PHE H  8   ? ILE H 3   PHE H 8   
C  6 TYR H  124 ? LEU H  127 ? TYR H 124 LEU H 127 
D  1 ALA B  152 ? VAL B  155 ? ALA B 162 VAL B 165 
D  2 ALA B  25  ? MET B  29  ? ALA B 37  MET B 41  
D  3 GLY B  33  ? GLU B  39  ? GLY B 45  GLU B 51  
D  4 LEU B  201 ? ARG B  207 ? LEU B 210 ARG B 216 
D  5 TYR B  216 ? ILE B  219 ? TYR B 220 ILE B 223 
E  1 LEU B  56  ? ASN B  60  ? LEU B 67  ASN B 71  
E  2 ILE B  63  ? GLY B  69  ? ILE B 74  GLY B 80  
E  3 VAL B  123 ? ASP B  131 ? VAL B 134 ASP B 142 
E  4 GLY B  135 ? SER B  141 ? GLY B 145 SER B 151 
E  5 TYR B  147 ? GLY B  149 ? TYR B 157 GLY B 159 
F  1 ALA C  159 ? ILE C  162 ? ALA C 162 ILE C 165 
F  2 ALA C  31  ? LYS C  35  ? ALA C 37  LYS C 41  
F  3 VAL C  40  ? GLU C  45  ? VAL C 46  GLU C 51  
F  4 ILE C  208 ? LYS C  214 ? ILE C 210 LYS C 216 
F  5 ASP C  218 ? ALA C  221 ? ASP C 220 ALA C 223 
G  1 SER C  63  ? ASP C  66  ? SER C 68  ASP C 71  
G  2 VAL C  69  ? GLY C  75  ? VAL C 74  GLY C 80  
G  3 VAL C  129 ? GLY C  135 ? VAL C 134 GLY C 140 
G  4 LYS C  144 ? THR C  148 ? LYS C 147 THR C 151 
G  5 TYR C  154 ? SER C  156 ? TYR C 157 SER C 159 
H  1 ALA D  169 ? ILE D  172 ? ALA D 162 ILE D 165 
H  2 ALA D  37  ? ALA D  41  ? ALA D 37  ALA D 41  
H  3 VAL D  46  ? GLU D  51  ? VAL D 46  GLU D 51  
H  4 ALA D  217 ? THR D  223 ? ALA D 210 THR D 216 
H  5 GLY D  227 ? ILE D  230 ? GLY D 220 ILE D 223 
I  1 ILE D  67  ? ASP D  71  ? ILE D 67  ASP D 71  
I  2 ILE D  74  ? GLY D  80  ? ILE D 74  GLY D 80  
I  3 VAL D  140 ? ASP D  148 ? VAL D 134 ASP D 142 
I  4 GLY D  152 ? ALA D  158 ? GLY D 145 ALA D 151 
I  5 PHE D  164 ? ARG D  166 ? PHE D 157 ARG D 159 
J  1 GLY E  157 ? ILE E  160 ? GLY E 162 ILE E 165 
J  2 THR E  34  ? ARG E  38  ? THR E 37  ARG E 41  
J  3 HIS E  42  ? LEU E  48  ? HIS E 45  LEU E 51  
J  4 LEU E  210 ? GLY E  216 ? LEU E 210 GLY E 216 
J  5 THR E  219 ? ASP E  225 ? THR E 219 ASP E 225 
K  1 ILE E  62  ? ASP E  66  ? ILE E 67  ASP E 71  
K  2 MET E  69  ? GLY E  75  ? MET E 74  GLY E 80  
K  3 VAL E  129 ? ASP E  137 ? VAL E 134 ASP E 142 
K  4 GLY E  140 ? PHE E  146 ? GLY E 145 PHE E 151 
K  5 VAL E  152 ? GLU E  154 ? VAL E 157 GLU E 159 
L  1 GLY F  156 ? THR F  159 ? GLY F 162 THR F 165 
L  2 SER F  31  ? CYS F  36  ? SER F 37  CYS F 42  
L  3 GLY F  39  ? ILE F  48  ? GLY F 45  ILE F 54  
L  4 ASP F  205 ? SER F  214 ? ASP F 207 SER F 216 
L  5 LYS F  223 ? PHE F  224 ? LYS F 222 PHE F 223 
M  1 GLN F  62  ? VAL F  64  ? GLN F 68  VAL F 70  
M  2 ILE F  68  ? GLY F  74  ? ILE F 74  GLY F 80  
M  3 VAL F  128 ? ASP F  136 ? VAL F 134 ASP F 142 
M  4 GLY F  139 ? LEU F  145 ? GLY F 145 LEU F 151 
M  5 TYR F  151 ? GLY F  153 ? TYR F 157 GLY F 159 
N  1 ALA G  159 ? THR G  162 ? ALA G 162 THR G 165 
N  2 SER G  33  ? ARG G  37  ? SER G 37  ARG G 41  
N  3 CYS G  41  ? GLN G  47  ? CYS G 45  GLN G 51  
N  4 LEU G  214 ? THR G  220 ? LEU G 210 THR G 216 
N  5 LYS G  223 ? THR G  226 ? LYS G 220 THR G 223 
O  1 ILE G  63  ? CYS G  65  ? ILE G 67  CYS G 69  
O  2 GLY G  71  ? ASN G  75  ? GLY G 75  ASN G 79  
O  3 ILE G  131 ? ASP G  138 ? ILE G 135 ASP G 142 
O  4 GLY G  142 ? THR G  148 ? GLY G 145 THR G 151 
O  5 TYR G  154 ? GLY G  156 ? TYR G 157 GLY G 159 
P  1 SER H  20  ? GLN H  22  ? SER H 20  GLN H 22  
P  2 ILE H  25  ? ASP H  28  ? ILE H 25  ASP H 28  
Q  1 LEU H  34  ? SER H  38  ? LEU H 34  SER H 38  
Q  2 ILE H  41  ? GLY H  47  ? ILE H 41  GLY H 47  
Q  3 ALA H  96  ? ASP H  104 ? ALA H 97  ASP H 105 
Q  4 GLY H  107 ? ILE H  113 ? GLY H 107 ILE H 113 
Q  5 THR H  119 ? VAL H  121 ? THR H 119 VAL H 121 
R  1 VAL H  212 ? ILE H  217 ? VAL H 213 ILE H 218 
R  2 VAL I  194 ? LEU I  199 ? VAL I 184 LEU I 189 
R  3 ALA I  184 ? LYS I  190 ? ALA I 173 LYS I 179 
R  4 CYS I  19  ? ASP I  25  ? CYS I 11  ASP I 17  
R  5 ILE I  10  ? GLY I  16  ? ILE I 2   GLY I 8   
R  6 PHE I  135 ? GLY I  139 ? PHE I 124 GLY I 128 
S  1 LEU I  28  ? SER I  30  ? LEU I 20  SER I 22  
S  2 LEU I  33  ? SER I  36  ? LEU I 25  SER I 28  
T  1 ILE I  42  ? TYR I  45  ? ILE I 34  TYR I 38  
T  2 VAL I  48  ? GLY I  54  ? VAL I 41  GLY I 47  
T  3 VAL I  104 ? ILE I  111 ? VAL I 97  ILE I 104 
T  4 PRO I  118 ? PHE I  123 ? PRO I 108 PHE I 113 
T  5 ILE I  129 ? ASP I  130 ? ILE I 119 ASP I 120 
U  1 TYR J  130 ? HIS J  133 ? TYR J 124 HIS J 127 
U  2 ILE J  4   ? ARG J  8   ? ILE J 3   ARG J 7   
U  3 SER J  12  ? SER J  18  ? SER J 11  SER J 17  
U  4 VAL J  179 ? ASP J  185 ? VAL J 173 ASP J 179 
U  5 GLY J  188 ? VAL J  192 ? GLY J 183 VAL J 187 
V  1 VAL J  21  ? ARG J  23  ? VAL J 20  ARG J 22  
V  2 SER J  26  ? LYS J  29  ? SER J 25  LYS J 28  
W  1 THR J  35  ? SER J  39  ? THR J 34  SER J 38  
W  2 THR J  42  ? GLY J  48  ? THR J 41  GLY J 47  
W  3 VAL J  100 ? ASP J  108 ? VAL J 97  ASP J 105 
W  4 LYS J  113 ? ILE J  119 ? LYS J 107 ILE J 113 
W  5 LYS J  125 ? GLU J  127 ? LYS J 119 GLU J 121 
X  1 ILE K  126 ? VAL K  129 ? ILE K 124 VAL K 127 
X  2 THR K  3   ? PHE K  8   ? THR K 3   PHE K 8   
X  3 GLY K  11  ? VAL K  16  ? GLY K 11  VAL K 16  
X  4 SER K  174 ? THR K  181 ? SER K 172 THR K 179 
X  5 GLY K  184 ? ASP K  192 ? GLY K 183 ASP K 191 
Y  1 ALA K  20  ? ALA K  22  ? ALA K 20  ALA K 22  
Y  2 TRP K  25  ? SER K  28  ? TRP K 25  SER K 28  
Z  1 VAL K  34  ? ASN K  38  ? VAL K 34  ASN K 38  
Z  2 LEU K  41  ? GLY K  47  ? LEU K 41  GLY K 47  
Z  3 MET K  97  ? THR K  105 ? MET K 97  THR K 105 
Z  4 GLY K  109 ? ASP K  116 ? GLY K 107 ASP K 114 
Z  5 ARG K  121 ? LYS K  123 ? ARG K 119 LYS K 121 
AA 1 CYS L  136 ? GLY L  140 ? CYS L 124 GLY L 128 
AA 2 THR L  11  ? ALA L  16  ? THR L 2   ALA L 7   
AA 3 ALA L  21  ? ASP L  26  ? ALA L 12  ASP L 17  
AA 4 GLY L  201 ? THR L  208 ? GLY L 172 THR L 179 
AA 5 GLY L  211 ? GLU L  218 ? GLY L 183 GLU L 190 
AB 1 ASN L  29  ? THR L  31  ? ASN L 20  THR L 22  
AB 2 SER L  34  ? SER L  37  ? SER L 25  SER L 28  
AC 1 VAL L  43  ? ASP L  45  ? VAL L 34  ASP L 36  
AC 2 ILE L  50  ? GLY L  56  ? ILE L 41  GLY L 47  
AC 3 VAL L  107 ? LEU L  114 ? VAL L 97  LEU L 104 
AC 4 GLY L  120 ? PHE L  125 ? GLY L 108 PHE L 113 
AC 5 TYR L  131 ? GLU L  134 ? TYR L 119 GLU L 122 
AD 1 LEU M  33  ? PHE M  36  ? LEU M 24  PHE M 27  
AD 2 GLY M  28  ? TYR M  30  ? GLY M 19  TYR M 21  
AD 3 VAL M  6   ? GLY M  8   ? VAL M -3  GLY M -1  
AD 4 THR M  49  ? ASP M  56  ? THR M 40  ASP M 47  
AD 5 LEU M  42  ? VAL M  45  ? LEU M 33  VAL M 36  
AE 1 LEU M  33  ? PHE M  36  ? LEU M 24  PHE M 27  
AE 2 GLY M  28  ? TYR M  30  ? GLY M 19  TYR M 21  
AE 3 VAL M  6   ? GLY M  8   ? VAL M -3  GLY M -1  
AE 4 THR M  49  ? ASP M  56  ? THR M 40  ASP M 47  
AE 5 ASN M  112 ? VAL M  119 ? ASN M 103 VAL M 110 
AE 6 GLN M  125 ? ASN M  131 ? GLN M 116 ASN M 122 
AE 7 THR M  136 ? TYR M  137 ? THR M 127 TYR M 128 
AF 1 THR M  141 ? ALA M  143 ? THR M 132 ALA M 134 
AF 2 VAL M  11  ? TYR M  16  ? VAL M 2   TYR M 7   
AF 3 GLY M  19  ? ASP M  25  ? GLY M 10  ASP M 16  
AF 4 ASN M  194 ? ASP M  201 ? ASN M 185 ASP M 192 
AF 5 GLY M  205 ? GLN M  213 ? GLY M 196 GLN M 204 
AG 1 TYR N  124 ? ALA N  127 ? TYR N 124 ALA N 127 
AG 2 ILE N  3   ? THR N  7   ? ILE N 3   THR N 7   
AG 3 GLY N  11  ? ALA N  16  ? GLY N 11  ALA N 16  
AG 4 ILE N  173 ? THR N  179 ? ILE N 173 THR N 179 
AG 5 GLY N  182 ? PHE N  188 B GLY N 183 PHE N 187 
AH 1 THR N  20  ? THR N  22  ? THR N 20  THR N 22  
AH 2 TYR N  25  ? ASN N  28  ? TYR N 25  ASN N 28  
AI 1 LEU N  34  ? HIS N  38  ? LEU N 34  HIS N 38  
AI 2 ILE N  41  ? GLY N  47  ? ILE N 41  GLY N 47  
AI 3 ALA N  95  ? ASP N  103 ? ALA N 97  ASP N 105 
AI 4 LYS N  107 ? ILE N  113 ? LYS N 107 ILE N 113 
AI 5 HIS N  120 ? LYS N  121 ? HIS N 120 LYS N 121 
AJ 1 ALA O  161 ? ILE O  164 ? ALA O 162 ILE O 165 
AJ 2 SER O  34  ? LYS O  38  ? SER O 37  LYS O 41  
AJ 3 VAL O  43  ? GLU O  48  ? VAL O 46  GLU O 51  
AJ 4 ILE O  209 ? ILE O  214 ? ILE O 210 ILE O 215 
AJ 5 PHE O  235 ? LYS O  237 ? PHE O 221 LYS O 223 
AK 1 SER O  65  ? THR O  68  ? SER O 68  THR O 71  
AK 2 ILE O  71  ? GLY O  77  ? ILE O 74  GLY O 80  
AK 3 VAL O  132 ? ASP O  140 ? VAL O 134 ASP O 142 
AK 4 GLY O  144 ? VAL O  150 ? GLY O 146 VAL O 151 
AK 5 TYR O  156 ? PRO O  158 ? TYR O 157 PRO O 159 
AL 1 TYR O  224 I THR O  225 J TYR O 217 THR O 217 
AL 2 ALA V  184 ? LEU V  191 ? ALA V 184 LEU V 192 
AL 3 VAL V  173 ? GLU V  179 ? VAL V 173 GLU V 179 
AL 4 GLY V  11  ? ASP V  17  ? GLY V 11  ASP V 17  
AL 5 ILE V  3   ? PHE V  8   ? ILE V 3   PHE V 8   
AL 6 TYR V  124 ? LEU V  127 ? TYR V 124 LEU V 127 
AM 1 ALA P  152 ? VAL P  155 ? ALA P 162 VAL P 165 
AM 2 ALA P  25  ? MET P  29  ? ALA P 37  MET P 41  
AM 3 ILE P  34  ? GLU P  39  ? ILE P 46  GLU P 51  
AM 4 LEU P  201 ? ARG P  207 ? LEU P 210 ARG P 216 
AM 5 TYR P  216 ? ILE P  219 ? TYR P 220 ILE P 223 
AN 1 LEU P  56  ? LYS P  58  ? LEU P 67  LYS P 69  
AN 2 ILE P  63  ? GLY P  69  ? ILE P 74  GLY P 80  
AN 3 VAL P  123 ? ASP P  131 ? VAL P 134 ASP P 142 
AN 4 GLY P  135 ? SER P  141 ? GLY P 145 SER P 151 
AN 5 TYR P  147 ? GLY P  149 ? TYR P 157 GLY P 159 
AO 1 ALA Q  159 ? ILE Q  162 ? ALA Q 162 ILE Q 165 
AO 2 ALA Q  31  ? LYS Q  35  ? ALA Q 37  LYS Q 41  
AO 3 VAL Q  40  ? GLU Q  45  ? VAL Q 46  GLU Q 51  
AO 4 ILE Q  208 ? LYS Q  214 ? ILE Q 210 LYS Q 216 
AO 5 ASP Q  218 ? ALA Q  221 ? ASP Q 220 ALA Q 223 
AP 1 VAL Q  62  ? ASP Q  66  ? VAL Q 67  ASP Q 71  
AP 2 VAL Q  69  ? GLY Q  75  ? VAL Q 74  GLY Q 80  
AP 3 VAL Q  129 ? GLY Q  135 ? VAL Q 134 GLY Q 140 
AP 4 LYS Q  144 ? THR Q  148 ? LYS Q 147 THR Q 151 
AP 5 TYR Q  154 ? SER Q  156 ? TYR Q 157 SER Q 159 
AQ 1 ALA R  169 ? ILE R  172 ? ALA R 162 ILE R 165 
AQ 2 ALA R  37  ? ALA R  41  ? ALA R 37  ALA R 41  
AQ 3 VAL R  46  ? GLU R  51  ? VAL R 46  GLU R 51  
AQ 4 ALA R  217 ? THR R  223 ? ALA R 210 THR R 216 
AQ 5 GLY R  227 ? ILE R  230 ? GLY R 220 ILE R 223 
AR 1 ILE R  67  ? ASP R  71  ? ILE R 67  ASP R 71  
AR 2 ILE R  74  ? GLY R  80  ? ILE R 74  GLY R 80  
AR 3 VAL R  140 ? ASP R  148 ? VAL R 134 ASP R 142 
AR 4 GLY R  152 ? ALA R  158 ? GLY R 145 ALA R 151 
AR 5 PHE R  164 ? ARG R  166 ? PHE R 157 ARG R 159 
AS 1 GLY S  157 ? ILE S  160 ? GLY S 162 ILE S 165 
AS 2 THR S  34  ? ARG S  38  ? THR S 37  ARG S 41  
AS 3 HIS S  42  ? ALA S  47  ? HIS S 45  ALA S 50  
AS 4 SER S  211 ? GLY S  216 ? SER S 211 GLY S 216 
AS 5 THR S  219 ? ASP S  225 ? THR S 219 ASP S 225 
AT 1 ILE S  62  ? ASP S  66  ? ILE S 67  ASP S 71  
AT 2 MET S  69  ? GLY S  75  ? MET S 74  GLY S 80  
AT 3 VAL S  129 ? ASP S  137 ? VAL S 134 ASP S 142 
AT 4 GLY S  140 ? GLN S  147 ? GLY S 145 GLN S 152 
AT 5 ASN S  151 ? LEU S  155 ? ASN S 156 LEU S 160 
AU 1 GLY T  156 ? THR T  159 ? GLY T 162 THR T 165 
AU 2 SER T  31  ? CYS T  36  ? SER T 37  CYS T 42  
AU 3 GLY T  39  ? LEU T  47  ? GLY T 45  LEU T 53  
AU 4 PHE T  206 ? SER T  214 ? PHE T 208 SER T 216 
AU 5 LYS T  223 ? PHE T  224 ? LYS T 222 PHE T 223 
AV 1 GLN T  62  ? VAL T  64  ? GLN T 68  VAL T 70  
AV 2 ILE T  68  ? GLY T  74  ? ILE T 74  GLY T 80  
AV 3 VAL T  128 ? ASP T  136 ? VAL T 134 ASP T 142 
AV 4 GLY T  139 ? LEU T  145 ? GLY T 145 LEU T 151 
AV 5 TYR T  151 ? GLY T  153 ? TYR T 157 GLY T 159 
AW 1 ALA U  159 ? THR U  162 ? ALA U 162 THR U 165 
AW 2 SER U  33  ? ARG U  37  ? SER U 37  ARG U 41  
AW 3 CYS U  41  ? GLN U  47  ? CYS U 45  GLN U 51  
AW 4 LEU U  214 ? THR U  220 ? LEU U 210 THR U 216 
AW 5 LYS U  223 ? THR U  226 ? LYS U 220 THR U 223 
AX 1 ILE U  63  ? CYS U  65  ? ILE U 67  CYS U 69  
AX 2 GLY U  71  ? ASN U  75  ? GLY U 75  ASN U 79  
AX 3 ILE U  131 ? ASP U  138 ? ILE U 135 ASP U 142 
AX 4 GLY U  142 ? THR U  148 ? GLY U 145 THR U 151 
AX 5 TYR U  154 ? GLY U  156 ? TYR U 157 GLY U 159 
AY 1 SER V  20  ? GLN V  22  ? SER V 20  GLN V 22  
AY 2 ILE V  25  ? ASP V  28  ? ILE V 25  ASP V 28  
AZ 1 LEU V  34  ? SER V  38  ? LEU V 34  SER V 38  
AZ 2 ILE V  41  ? GLY V  47  ? ILE V 41  GLY V 47  
AZ 3 ALA V  96  ? ASP V  104 ? ALA V 97  ASP V 105 
AZ 4 GLY V  107 ? ILE V  113 ? GLY V 107 ILE V 113 
AZ 5 THR V  119 ? VAL V  121 ? THR V 119 VAL V 121 
BA 1 VAL V  212 ? ILE V  217 ? VAL V 213 ILE V 218 
BA 2 VAL W  194 ? LEU W  199 ? VAL W 184 LEU W 189 
BA 3 ALA W  184 ? LYS W  190 ? ALA W 173 LYS W 179 
BA 4 CYS W  19  ? ASP W  25  ? CYS W 11  ASP W 17  
BA 5 ILE W  10  ? GLY W  16  ? ILE W 2   GLY W 8   
BA 6 PHE W  135 ? GLY W  139 ? PHE W 124 GLY W 128 
BB 1 LEU W  28  ? SER W  30  ? LEU W 20  SER W 22  
BB 2 LEU W  33  ? SER W  36  ? LEU W 25  SER W 28  
BC 1 ILE W  42  ? TYR W  45  ? ILE W 34  TYR W 38  
BC 2 VAL W  48  ? GLY W  54  ? VAL W 41  GLY W 47  
BC 3 VAL W  104 ? ILE W  111 ? VAL W 97  ILE W 104 
BC 4 PRO W  118 ? PHE W  123 ? PRO W 108 PHE W 113 
BC 5 ILE W  129 ? ASP W  130 ? ILE W 119 ASP W 120 
BD 1 TYR X  130 ? HIS X  133 ? TYR X 124 HIS X 127 
BD 2 ILE X  4   ? ARG X  8   ? ILE X 3   ARG X 7   
BD 3 SER X  12  ? SER X  18  ? SER X 11  SER X 17  
BD 4 VAL X  179 ? ASP X  185 ? VAL X 173 ASP X 179 
BD 5 GLY X  188 ? VAL X  192 ? GLY X 183 VAL X 187 
BE 1 VAL X  21  ? ARG X  23  ? VAL X 20  ARG X 22  
BE 2 SER X  26  ? LYS X  29  ? SER X 25  LYS X 28  
BF 1 THR X  35  ? SER X  39  ? THR X 34  SER X 38  
BF 2 THR X  42  ? GLY X  48  ? THR X 41  GLY X 47  
BF 3 VAL X  100 ? ASP X  108 ? VAL X 97  ASP X 105 
BF 4 LYS X  113 ? ILE X  119 ? LYS X 107 ILE X 113 
BF 5 LYS X  125 ? GLU X  127 ? LYS X 119 GLU X 121 
BG 1 ILE Y  126 ? VAL Y  129 ? ILE Y 124 VAL Y 127 
BG 2 THR Y  3   ? PHE Y  8   ? THR Y 3   PHE Y 8   
BG 3 GLY Y  11  ? VAL Y  16  ? GLY Y 11  VAL Y 16  
BG 4 SER Y  174 ? THR Y  181 ? SER Y 172 THR Y 179 
BG 5 GLY Y  184 ? ASP Y  192 ? GLY Y 183 ASP Y 191 
BH 1 ALA Y  20  ? ALA Y  22  ? ALA Y 20  ALA Y 22  
BH 2 TRP Y  25  ? SER Y  28  ? TRP Y 25  SER Y 28  
BI 1 VAL Y  34  ? ASN Y  38  ? VAL Y 34  ASN Y 38  
BI 2 LEU Y  41  ? THR Y  44  ? LEU Y 41  THR Y 44  
BI 3 GLY Y  98  ? THR Y  105 ? GLY Y 98  THR Y 105 
BI 4 GLY Y  109 ? ASP Y  116 ? GLY Y 107 ASP Y 114 
BI 5 ARG Y  121 ? LYS Y  123 ? ARG Y 119 LYS Y 121 
BJ 1 CYS Z  136 ? GLY Z  140 ? CYS Z 124 GLY Z 128 
BJ 2 THR Z  11  ? ALA Z  16  ? THR Z 2   ALA Z 7   
BJ 3 ALA Z  21  ? ASP Z  26  ? ALA Z 12  ASP Z 17  
BJ 4 GLY Z  201 ? THR Z  208 ? GLY Z 172 THR Z 179 
BJ 5 GLY Z  211 ? GLU Z  218 ? GLY Z 183 GLU Z 190 
BK 1 ASN Z  29  ? THR Z  31  ? ASN Z 20  THR Z 22  
BK 2 SER Z  34  ? SER Z  37  ? SER Z 25  SER Z 28  
BL 1 PHE Z  44  ? ASP Z  45  ? PHE Z 35  ASP Z 36  
BL 2 VAL Z  51  ? GLY Z  56  ? VAL Z 42  GLY Z 47  
BL 3 VAL Z  107 ? LEU Z  114 ? VAL Z 97  LEU Z 104 
BL 4 GLY Z  120 ? PHE Z  125 ? GLY Z 108 PHE Z 113 
BL 5 TYR Z  131 ? GLU Z  134 ? TYR Z 119 GLU Z 122 
BM 1 LEU AA 33  ? PHE AA 36  ? LEU 1 24  PHE 1 27  
BM 2 GLY AA 28  ? TYR AA 30  ? GLY 1 19  TYR 1 21  
BM 3 VAL AA 6   ? GLY AA 8   ? VAL 1 -3  GLY 1 -1  
BM 4 THR AA 49  ? ASP AA 56  ? THR 1 40  ASP 1 47  
BM 5 LEU AA 42  ? PRO AA 44  ? LEU 1 33  PRO 1 35  
BN 1 LEU AA 33  ? PHE AA 36  ? LEU 1 24  PHE 1 27  
BN 2 GLY AA 28  ? TYR AA 30  ? GLY 1 19  TYR 1 21  
BN 3 VAL AA 6   ? GLY AA 8   ? VAL 1 -3  GLY 1 -1  
BN 4 THR AA 49  ? ASP AA 56  ? THR 1 40  ASP 1 47  
BN 5 ASN AA 112 ? VAL AA 119 ? ASN 1 103 VAL 1 110 
BN 6 GLN AA 125 ? ASN AA 131 ? GLN 1 116 ASN 1 122 
BN 7 THR AA 136 ? TYR AA 137 ? THR 1 127 TYR 1 128 
BO 1 THR AA 141 ? ALA AA 143 ? THR 1 132 ALA 1 134 
BO 2 VAL AA 11  ? TYR AA 16  ? VAL 1 2   TYR 1 7   
BO 3 GLY AA 19  ? ASP AA 25  ? GLY 1 10  ASP 1 16  
BO 4 ASN AA 194 ? ASP AA 201 ? ASN 1 185 ASP 1 192 
BO 5 GLY AA 205 ? GLN AA 213 ? GLY 1 196 GLN 1 204 
BP 1 TYR BA 124 ? ALA BA 127 ? TYR 2 124 ALA 2 127 
BP 2 ILE BA 3   ? PHE BA 8   ? ILE 2 3   PHE 2 8   
BP 3 GLY BA 11  ? ASP BA 17  ? GLY 2 11  ASP 2 17  
BP 4 ILE BA 173 ? THR BA 179 ? ILE 2 173 THR 2 179 
BP 5 GLY BA 182 ? PHE BA 188 B GLY 2 183 PHE 2 187 
BQ 1 THR BA 20  ? THR BA 22  ? THR 2 20  THR 2 22  
BQ 2 TYR BA 25  ? ASN BA 28  ? TYR 2 25  ASN 2 28  
BR 1 LEU BA 34  ? HIS BA 38  ? LEU 2 34  HIS 2 38  
BR 2 ILE BA 41  ? GLY BA 47  ? ILE 2 41  GLY 2 47  
BR 3 ALA BA 95  ? ASP BA 103 ? ALA 2 97  ASP 2 105 
BR 4 LYS BA 107 ? ILE BA 113 ? LYS 2 107 ILE 2 113 
BR 5 HIS BA 120 ? LYS BA 121 ? HIS 2 120 LYS 2 121 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE A  164 ? O ILE A 165 N SER A  34  ? N SER A 37  
A  2 3 N ILE A  37  ? N ILE A 40  O VAL A  44  ? O VAL A 47  
A  3 4 N THR A  47  ? N THR A 50  O GLU A  210 ? O GLU A 211 
A  4 5 N ILE A  213 ? N ILE A 214 O ARG A  236 ? O ARG A 222 
B  1 2 N LEU A  67  ? N LEU A 70  O ILE A  71  ? O ILE A 74  
B  2 3 N GLY A  72  ? N GLY A 75  O ALA A  137 ? O ALA A 139 
B  3 4 N ILE A  136 ? N ILE A 138 O TYR A  148 ? O TYR A 149 
B  4 5 N GLN A  149 ? N GLN A 150 O PHE A  157 ? O PHE A 158 
C  1 2 N THR A  225 J N THR A 217 O TYR H  186 ? O TYR H 186 
C  2 3 O LEU H  187 ? O LEU H 187 N VAL H  175 ? N VAL H 175 
C  3 4 O CYS H  176 ? O CYS H 176 N ILE H  14  ? N ILE H 14  
C  4 5 O ALA H  15  ? O ALA H 15  N VAL H  4   ? N VAL H 4   
C  5 6 N GLY H  5   ? N GLY H 5   O LEU H  125 ? O LEU H 125 
D  1 2 O ILE B  153 ? O ILE B 163 N GLY B  27  ? N GLY B 39  
D  2 3 N ILE B  28  ? N ILE B 40  O VAL B  35  ? O VAL B 47  
D  3 4 N LEU B  36  ? N LEU B 48  O ALA B  204 ? O ALA B 213 
D  4 5 N ARG B  207 ? N ARG B 216 O TYR B  216 ? O TYR B 220 
E  1 2 N TYR B  57  ? N TYR B 68  O VAL B  65  ? O VAL B 76  
E  2 3 N ALA B  64  ? N ALA B 75  O ALA B  128 ? O ALA B 139 
E  3 4 N PHE B  125 ? N PHE B 136 O SER B  141 ? O SER B 151 
E  4 5 N THR B  140 ? N THR B 150 O THR B  148 ? O THR B 158 
F  1 2 O GLN C  160 ? O GLN C 163 N GLY C  33  ? N GLY C 39  
F  2 3 N VAL C  32  ? N VAL C 38  O GLY C  43  ? O GLY C 49  
F  3 4 N LEU C  42  ? N LEU C 48  O THR C  211 ? O THR C 213 
F  4 5 N LYS C  214 ? N LYS C 216 O ASP C  218 ? O ASP C 220 
G  1 2 N SER C  63  ? N SER C 68  O LEU C  71  ? O LEU C 76  
G  2 3 N SER C  72  ? N SER C 77  O LEU C  132 ? O LEU C 137 
G  3 4 N ILE C  133 ? N ILE C 138 O TYR C  146 ? O TYR C 149 
G  4 5 N GLN C  147 ? N GLN C 150 O SER C  155 ? O SER C 158 
H  1 2 O LYS D  170 ? O LYS D 163 N GLY D  39  ? N GLY D 39  
H  2 3 N ILE D  38  ? N ILE D 38  O GLY D  49  ? O GLY D 49  
H  3 4 N LEU D  48  ? N LEU D 48  O SER D  220 ? O SER D 213 
H  4 5 N THR D  223 ? N THR D 216 O GLY D  227 ? O GLY D 220 
I  1 2 N VAL D  68  ? N VAL D 68  O CYS D  76  ? O CYS D 76  
I  2 3 N ALA D  77  ? N ALA D 77  O LEU D  143 ? O LEU D 137 
I  3 4 N LEU D  142 ? N LEU D 136 O ALA D  158 ? O ALA D 151 
I  4 5 N HIS D  157 ? N HIS D 150 O TYR D  165 ? O TYR D 158 
J  1 2 O THR E  158 ? O THR E 163 N GLY E  36  ? N GLY E 39  
J  2 3 N VAL E  35  ? N VAL E 38  O VAL E  46  ? O VAL E 49  
J  3 4 N ALA E  47  ? N ALA E 50  O SER E  211 ? O SER E 211 
J  4 5 N ILE E  212 ? N ILE E 212 O TYR E  224 ? O TYR E 224 
K  1 2 N ILE E  63  ? N ILE E 68  O LEU E  71  ? O LEU E 76  
K  2 3 N GLY E  70  ? N GLY E 75  O ILE E  134 ? O ILE E 139 
K  3 4 N LEU E  131 ? N LEU E 136 O PHE E  146 ? O PHE E 151 
K  4 5 N GLU E  145 ? N GLU E 150 O THR E  153 ? O THR E 158 
L  1 2 O ALA F  157 ? O ALA F 163 N GLY F  33  ? N GLY F 39  
L  2 3 N ILE F  32  ? N ILE F 38  O ALA F  43  ? O ALA F 49  
L  3 4 N PHE F  42  ? N PHE F 48  O SER F  211 ? O SER F 213 
L  4 5 N TRP F  212 ? N TRP F 214 O LYS F  223 ? O LYS F 222 
M  1 2 N GLN F  62  ? N GLN F 68  O CYS F  70  ? O CYS F 76  
M  2 3 N VAL F  71  ? N VAL F 77  O ILE F  131 ? O ILE F 137 
M  3 4 N PHE F  132 ? N PHE F 138 O TYR F  143 ? O TYR F 149 
M  4 5 N MET F  144 ? N MET F 150 O TRP F  152 ? O TRP F 158 
N  1 2 O THR G  160 ? O THR G 163 N ALA G  35  ? N ALA G 39  
N  2 3 N VAL G  36  ? N VAL G 40  O VAL G  43  ? O VAL G 47  
N  3 4 N THR G  42  ? N THR G 46  O ALA G  219 ? O ALA G 215 
N  4 5 N THR G  220 ? N THR G 216 O LYS G  223 ? O LYS G 220 
O  1 2 N PHE G  64  ? N PHE G 68  O MET G  72  ? O MET G 76  
O  2 3 N VAL G  73  ? N VAL G 77  O THR G  133 ? O THR G 137 
O  3 4 N PHE G  134 ? N PHE G 138 O TYR G  146 ? O TYR G 149 
O  4 5 N LYS G  147 ? N LYS G 150 O VAL G  155 ? O VAL G 158 
P  1 2 N SER H  20  ? N SER H 20  O ASP H  28  ? O ASP H 28  
Q  1 2 N ILE H  37  ? N ILE H 37  O ILE H  41  ? O ILE H 41  
Q  2 3 N ALA H  46  ? N ALA H 46  O TYR H  97  ? O TYR H 98  
Q  3 4 N VAL H  100 ? N VAL H 101 O PHE H  111 ? O PHE H 111 
Q  4 5 N SER H  112 ? N SER H 112 O ASP H  120 ? O ASP H 120 
R  1 2 N LEU H  213 ? N LEU H 214 O TYR I  198 ? O TYR I 188 
R  2 3 O VAL I  195 ? O VAL I 185 N ILE I  188 ? N ILE I 177 
R  3 4 O ILE I  189 ? O ILE I 178 N VAL I  20  ? N VAL I 12  
R  4 5 O ALA I  21  ? O ALA I 13  N MET I  14  ? N MET I 6   
R  5 6 N ALA I  13  ? N ALA I 5   O ILE I  136 ? O ILE I 125 
S  1 2 N SER I  30  ? N SER I 22  O LEU I  33  ? O LEU I 25  
T  1 2 N PHE I  43  ? N PHE I 35  O LEU I  50  ? O LEU I 43  
T  2 3 N GLY I  51  ? N GLY I 44  O VAL I  107 ? O VAL I 100 
T  3 4 N GLY I  110 ? N GLY I 103 O PHE I  119 ? O PHE I 109 
T  4 5 N GLY I  122 ? N GLY I 112 O ASP I  130 ? O ASP I 120 
U  1 2 O GLY J  131 ? O GLY J 125 N GLY J  6   ? N GLY J 5   
U  2 3 N ILE J  7   ? N ILE J 6   O ILE J  14  ? O ILE J 13  
U  3 4 N LEU J  15  ? N LEU J 14  O LYS J  182 ? O LYS J 176 
U  4 5 N ILE J  183 ? N ILE J 177 O ARG J  190 ? O ARG J 185 
V  1 2 N VAL J  21  ? N VAL J 20  O LEU J  28  ? O LEU J 27  
W  1 2 N LEU J  38  ? N LEU J 37  O THR J  42  ? O THR J 41  
W  2 3 N LEU J  43  ? N LEU J 42  O GLY J  105 ? O GLY J 102 
W  3 4 N VAL J  102 ? N VAL J 99  O ILE J  119 ? O ILE J 113 
W  4 5 N GLN J  118 ? N GLN J 112 O VAL J  126 ? O VAL J 120 
X  1 2 O VAL K  129 ? O VAL K 127 N THR K  3   ? N THR K 3   
X  2 3 N LEU K  4   ? N LEU K 4   O ALA K  15  ? O ALA K 15  
X  3 4 N ILE K  12  ? N ILE K 12  O VAL K  180 ? O VAL K 178 
X  4 5 N THR K  181 ? N THR K 179 O GLY K  184 ? O GLY K 183 
Y  1 2 N ALA K  20  ? N ALA K 20  O SER K  28  ? O SER K 28  
Z  1 2 N ILE K  35  ? N ILE K 35  O GLY K  43  ? O GLY K 43  
Z  2 3 N LEU K  42  ? N LEU K 42  O CYS K  102 ? O CYS K 102 
Z  3 4 N THR K  99  ? N THR K 99  O VAL K  115 ? O VAL K 113 
Z  4 5 N TYR K  114 ? N TYR K 112 O LEU K  122 ? O LEU K 120 
AA 1 2 O ARG L  137 ? O ARG L 125 N GLY L  14  ? N GLY L 5   
AA 2 3 N LEU L  13  ? N LEU L 4   O ALA L  24  ? O ALA L 15  
AA 3 4 N ALA L  21  ? N ALA L 12  O VAL L  207 ? O VAL L 178 
AA 4 5 N ILE L  204 ? N ILE L 175 O GLU L  215 ? O GLU L 187 
AB 1 2 N ASN L  29  ? N ASN L 20  O SER L  37  ? O SER L 28  
AC 1 2 N PHE L  44  ? N PHE L 35  O MET L  52  ? O MET L 43  
AC 2 3 N SER L  53  ? N SER L 44  O ILE L  110 ? O ILE L 100 
AC 3 4 N GLY L  113 ? N GLY L 103 O ALA L  121 ? O ALA L 109 
AC 4 5 N VAL L  122 ? N VAL L 110 O GLU L  134 ? O GLU L 122 
AD 1 2 O LEU M  33  ? O LEU M 24  N TYR M  30  ? N TYR M 21  
AD 2 3 O SER M  29  ? O SER M 20  N THR M  7   ? N THR M -2  
AD 3 4 N GLY M  8   ? N GLY M -1  O GLY M  55  ? O GLY M 46  
AD 4 5 O VAL M  51  ? O VAL M 42  N ILE M  43  ? N ILE M 34  
AE 1 2 O LEU M  33  ? O LEU M 24  N TYR M  30  ? N TYR M 21  
AE 2 3 O SER M  29  ? O SER M 20  N THR M  7   ? N THR M -2  
AE 3 4 N GLY M  8   ? N GLY M -1  O GLY M  55  ? O GLY M 46  
AE 4 5 N GLY M  52  ? N GLY M 43  O ILE M  115 ? O ILE M 106 
AE 5 6 N ILE M  114 ? N ILE M 105 O VAL M  130 ? O VAL M 121 
AE 6 7 N TYR M  129 ? N TYR M 120 O TYR M  137 ? O TYR M 128 
AF 1 2 O LEU M  142 ? O LEU M 133 N SER M  13  ? N SER M 4   
AF 2 3 N ILE M  12  ? N ILE M 3   O ALA M  23  ? O ALA M 14  
AF 3 4 N ALA M  24  ? N ALA M 15  O SER M  196 ? O SER M 187 
AF 4 5 N ASP M  201 ? N ASP M 192 O GLY M  205 ? O GLY M 196 
AG 1 2 O ALA N  127 ? O ALA N 127 N ILE N  3   ? N ILE N 3   
AG 2 3 N MET N  4   ? N MET N 4   O GLY N  15  ? O GLY N 15  
AG 3 4 N VAL N  12  ? N VAL N 12  O LEU N  178 ? O LEU N 178 
AG 4 5 N VAL N  177 ? N VAL N 177 O GLU N  184 ? O GLU N 185 
AH 1 2 N THR N  20  ? N THR N 20  O ASN N  28  ? O ASN N 28  
AI 1 2 N THR N  35  ? N THR N 35  O CYS N  43  ? O CYS N 43  
AI 2 3 N TRP N  42  ? N TRP N 42  O ALA N  100 ? O ALA N 102 
AI 3 4 N ILE N  97  ? N ILE N 99  O ILE N  113 ? O ILE N 113 
AI 4 5 N THR N  112 ? N THR N 112 O HIS N  120 ? O HIS N 120 
AJ 1 2 O ILE O  164 ? O ILE O 165 N SER O  34  ? N SER O 37  
AJ 2 3 N LEU O  35  ? N LEU O 38  O ALA O  46  ? O ALA O 49  
AJ 3 4 N VAL O  43  ? N VAL O 46  O ILE O  214 ? O ILE O 215 
AJ 4 5 N ILE O  213 ? N ILE O 214 O ARG O  236 ? O ARG O 222 
AK 1 2 N LEU O  67  ? N LEU O 70  O ILE O  71  ? O ILE O 74  
AK 2 3 N VAL O  74  ? N VAL O 77  O LEU O  135 ? O LEU O 137 
AK 3 4 N ILE O  136 ? N ILE O 138 O TYR O  148 ? O TYR O 149 
AK 4 5 N GLN O  149 ? N GLN O 150 O PHE O  157 ? O PHE O 158 
AL 1 2 N THR O  225 J N THR O 217 O TYR V  186 ? O TYR V 186 
AL 2 3 O LEU V  187 ? O LEU V 187 N VAL V  175 ? N VAL V 175 
AL 3 4 O ASP V  174 ? O ASP V 174 N ALA V  16  ? N ALA V 16  
AL 4 5 O VAL V  13  ? O VAL V 13  N VAL V  6   ? N VAL V 6   
AL 5 6 N GLY V  5   ? N GLY V 5   O LEU V  125 ? O LEU V 125 
AM 1 2 O ILE P  153 ? O ILE P 163 N GLY P  27  ? N GLY P 39  
AM 2 3 N ILE P  26  ? N ILE P 38  O ALA P  37  ? O ALA P 49  
AM 3 4 N LEU P  36  ? N LEU P 48  O ALA P  204 ? O ALA P 213 
AM 4 5 N ARG P  207 ? N ARG P 216 O TYR P  216 ? O TYR P 220 
AN 1 2 N TYR P  57  ? N TYR P 68  O VAL P  65  ? O VAL P 76  
AN 2 3 N ALA P  68  ? N ALA P 79  O SER P  124 ? O SER P 135 
AN 3 4 N TYR P  127 ? N TYR P 138 O TYR P  139 ? O TYR P 149 
AN 4 5 N THR P  140 ? N THR P 150 O THR P  148 ? O THR P 158 
AO 1 2 O ILE Q  162 ? O ILE Q 165 N ALA Q  31  ? N ALA Q 37  
AO 2 3 N VAL Q  32  ? N VAL Q 38  O GLY Q  43  ? O GLY Q 49  
AO 3 4 N LEU Q  42  ? N LEU Q 48  O THR Q  211 ? O THR Q 213 
AO 4 5 N LYS Q  214 ? N LYS Q 216 O ASP Q  218 ? O ASP Q 220 
AP 1 2 N SER Q  63  ? N SER Q 68  O LEU Q  71  ? O LEU Q 76  
AP 2 3 N VAL Q  70  ? N VAL Q 75  O ALA Q  134 ? O ALA Q 139 
AP 3 4 N ILE Q  133 ? N ILE Q 138 O TYR Q  146 ? O TYR Q 149 
AP 4 5 N GLN Q  147 ? N GLN Q 150 O SER Q  155 ? O SER Q 158 
AQ 1 2 O LYS R  170 ? O LYS R 163 N GLY R  39  ? N GLY R 39  
AQ 2 3 N ILE R  38  ? N ILE R 38  O GLY R  49  ? O GLY R 49  
AQ 3 4 N LEU R  48  ? N LEU R 48  O SER R  220 ? O SER R 213 
AQ 4 5 N THR R  223 ? N THR R 216 O GLY R  227 ? O GLY R 220 
AR 1 2 N ILE R  70  ? N ILE R 70  O ILE R  74  ? O ILE R 74  
AR 2 3 N ALA R  77  ? N ALA R 77  O LEU R  143 ? O LEU R 137 
AR 3 4 N LEU R  142 ? N LEU R 136 O ALA R  158 ? O ALA R 151 
AR 4 5 N HIS R  157 ? N HIS R 150 O TYR R  165 ? O TYR R 158 
AS 1 2 O THR S  158 ? O THR S 163 N GLY S  36  ? N GLY S 39  
AS 2 3 N VAL S  35  ? N VAL S 38  O VAL S  46  ? O VAL S 49  
AS 3 4 N ALA S  47  ? N ALA S 50  O SER S  211 ? O SER S 211 
AS 4 5 N ILE S  212 ? N ILE S 212 O TYR S  224 ? O TYR S 224 
AT 1 2 N ILE S  63  ? N ILE S 68  O LEU S  71  ? O LEU S 76  
AT 2 3 N SER S  72  ? N SER S 77  O LEU S  132 ? O LEU S 137 
AT 3 4 N LEU S  131 ? N LEU S 136 O PHE S  146 ? O PHE S 151 
AT 4 5 N GLU S  145 ? N GLU S 150 O THR S  153 ? O THR S 158 
AU 1 2 O ALA T  157 ? O ALA T 163 N GLY T  33  ? N GLY T 39  
AU 2 3 N CYS T  36  ? N CYS T 42  O GLY T  39  ? O GLY T 45  
AU 3 4 N PHE T  42  ? N PHE T 48  O SER T  211 ? O SER T 213 
AU 4 5 N TRP T  212 ? N TRP T 214 O LYS T  223 ? O LYS T 222 
AV 1 2 N GLN T  62  ? N GLN T 68  O CYS T  70  ? O CYS T 76  
AV 2 3 N VAL T  71  ? N VAL T 77  O ILE T  131 ? O ILE T 137 
AV 3 4 N THR T  130 ? N THR T 136 O LEU T  145 ? O LEU T 151 
AV 4 5 N MET T  144 ? N MET T 150 O TRP T  152 ? O TRP T 158 
AW 1 2 O THR U  160 ? O THR U 163 N ALA U  35  ? N ALA U 39  
AW 2 3 N LEU U  34  ? N LEU U 38  O ILE U  45  ? O ILE U 49  
AW 3 4 N VAL U  44  ? N VAL U 48  O GLY U  217 ? O GLY U 213 
AW 4 5 N THR U  220 ? N THR U 216 O LYS U  223 ? O LYS U 220 
AX 1 2 N PHE U  64  ? N PHE U 68  O MET U  72  ? O MET U 76  
AX 2 3 N GLY U  71  ? N GLY U 75  O VAL U  135 ? O VAL U 139 
AX 3 4 N PHE U  134 ? N PHE U 138 O TYR U  146 ? O TYR U 149 
AX 4 5 N LYS U  147 ? N LYS U 150 O VAL U  155 ? O VAL U 158 
AY 1 2 N SER V  20  ? N SER V 20  O ASP V  28  ? O ASP V 28  
AZ 1 2 N ILE V  37  ? N ILE V 37  O ILE V  41  ? O ILE V 41  
AZ 2 3 N TRP V  42  ? N TRP V 42  O ALA V  101 ? O ALA V 102 
AZ 3 4 N VAL V  100 ? N VAL V 101 O PHE V  111 ? O PHE V 111 
AZ 4 5 N SER V  112 ? N SER V 112 O ASP V  120 ? O ASP V 120 
BA 1 2 N LEU V  213 ? N LEU V 214 O TYR W  198 ? O TYR W 188 
BA 2 3 O ARG W  197 ? O ARG W 187 N VAL W  186 ? N VAL W 175 
BA 3 4 O ILE W  189 ? O ILE W 178 N VAL W  20  ? N VAL W 12  
BA 4 5 O ALA W  23  ? O ALA W 15  N VAL W  12  ? N VAL W 4   
BA 5 6 N VAL W  11  ? N VAL W 3   O SER W  138 ? O SER W 127 
BB 1 2 N SER W  30  ? N SER W 22  O LEU W  33  ? O LEU W 25  
BC 1 2 N PHE W  43  ? N PHE W 35  O LEU W  50  ? O LEU W 43  
BC 2 3 N PHE W  49  ? N PHE W 42  O ALA W  109 ? O ALA W 102 
BC 3 4 N VAL W  108 ? N VAL W 101 O ALA W  121 ? O ALA W 111 
BC 4 5 N GLY W  122 ? N GLY W 112 O ASP W  130 ? O ASP W 120 
BD 1 2 O GLY X  131 ? O GLY X 125 N GLY X  6   ? N GLY X 5   
BD 2 3 N LEU X  5   ? N LEU X 4   O ALA X  16  ? O ALA X 15  
BD 3 4 N SER X  17  ? N SER X 16  O ILE X  180 ? O ILE X 174 
BD 4 5 N ILE X  183 ? N ILE X 177 O ARG X  190 ? O ARG X 185 
BE 1 2 N VAL X  21  ? N VAL X 20  O LYS X  29  ? O LYS X 28  
BF 1 2 N LEU X  38  ? N LEU X 37  O THR X  42  ? O THR X 41  
BF 2 3 N LEU X  43  ? N LEU X 42  O GLY X  105 ? O GLY X 102 
BF 3 4 N VAL X  102 ? N VAL X 99  O ILE X  119 ? O ILE X 113 
BF 4 5 N GLN X  118 ? N GLN X 112 O VAL X  126 ? O VAL X 120 
BG 1 2 O VAL Y  129 ? O VAL Y 127 N THR Y  3   ? N THR Y 3   
BG 2 3 N LEU Y  4   ? N LEU Y 4   O ALA Y  15  ? O ALA Y 15  
BG 3 4 N ILE Y  12  ? N ILE Y 12  O VAL Y  180 ? O VAL Y 178 
BG 4 5 N LEU Y  177 ? N LEU Y 175 O HIS Y  188 ? O HIS Y 187 
BH 1 2 N ALA Y  22  ? N ALA Y 22  O TRP Y  25  ? O TRP Y 25  
BI 1 2 N ILE Y  35  ? N ILE Y 35  O GLY Y  43  ? O GLY Y 43  
BI 2 3 N LEU Y  42  ? N LEU Y 42  O CYS Y  102 ? O CYS Y 102 
BI 3 4 N THR Y  99  ? N THR Y 99  O VAL Y  115 ? O VAL Y 113 
BI 4 5 N TYR Y  114 ? N TYR Y 112 O LEU Y  122 ? O LEU Y 120 
BJ 1 2 O ARG Z  137 ? O ARG Z 125 N GLY Z  14  ? N GLY Z 5   
BJ 2 3 N LEU Z  13  ? N LEU Z 4   O ALA Z  24  ? O ALA Z 15  
BJ 3 4 N GLY Z  25  ? N GLY Z 16  O GLU Z  203 ? O GLU Z 174 
BJ 4 5 N LEU Z  202 ? N LEU Z 173 O TYR Z  217 ? O TYR Z 189 
BK 1 2 N ASN Z  29  ? N ASN Z 20  O ASN Z  36  ? O ASN Z 27  
BL 1 2 N PHE Z  44  ? N PHE Z 35  O MET Z  52  ? O MET Z 43  
BL 2 3 N ASN Z  55  ? N ASN Z 46  O HIS Z  108 ? O HIS Z 98  
BL 3 4 N THR Z  109 ? N THR Z 99  O PHE Z  125 ? O PHE Z 113 
BL 4 5 N VAL Z  122 ? N VAL Z 110 O GLU Z  134 ? O GLU Z 122 
BM 1 2 O LEU AA 33  ? O LEU 1 24  N TYR AA 30  ? N TYR 1 21  
BM 2 3 O SER AA 29  ? O SER 1 20  N THR AA 7   ? N THR 1 -2  
BM 3 4 N GLY AA 8   ? N GLY 1 -1  O GLY AA 55  ? O GLY 1 46  
BM 4 5 O VAL AA 51  ? O VAL 1 42  N ILE AA 43  ? N ILE 1 34  
BN 1 2 O LEU AA 33  ? O LEU 1 24  N TYR AA 30  ? N TYR 1 21  
BN 2 3 O SER AA 29  ? O SER 1 20  N THR AA 7   ? N THR 1 -2  
BN 3 4 N GLY AA 8   ? N GLY 1 -1  O GLY AA 55  ? O GLY 1 46  
BN 4 5 N VAL AA 50  ? N VAL 1 41  O ALA AA 117 ? O ALA 1 108 
BN 5 6 N GLY AA 118 ? N GLY 1 109 O PHE AA 126 ? O PHE 1 117 
BN 6 7 N TYR AA 129 ? N TYR 1 120 O TYR AA 137 ? O TYR 1 128 
BO 1 2 O LEU AA 142 ? O LEU 1 133 N SER AA 13  ? N SER 1 4   
BO 2 3 N ILE AA 12  ? N ILE 1 3   O ALA AA 23  ? O ALA 1 14  
BO 3 4 N ILE AA 22  ? N ILE 1 13  O ALA AA 198 ? O ALA 1 189 
BO 4 5 N ASP AA 201 ? N ASP 1 192 O GLY AA 205 ? O GLY 1 196 
BP 1 2 O ALA BA 127 ? O ALA 2 127 N ILE BA 3   ? N ILE 2 3   
BP 2 3 N MET BA 4   ? N MET 2 4   O GLY BA 15  ? O GLY 2 15  
BP 3 4 N ALA BA 16  ? N ALA 2 16  O ARG BA 174 ? O ARG 2 174 
BP 4 5 N VAL BA 177 ? N VAL 2 177 O GLU BA 184 ? O GLU 2 185 
BQ 1 2 N THR BA 20  ? N THR 2 20  O ASN BA 28  ? O ASN 2 28  
BR 1 2 N THR BA 35  ? N THR 2 35  O CYS BA 43  ? O CYS 2 43  
BR 2 3 N TRP BA 42  ? N TRP 2 42  O ALA BA 100 ? O ALA 2 102 
BR 3 4 N ILE BA 97  ? N ILE 2 99  O ILE BA 113 ? O ILE 2 113 
BR 4 5 N THR BA 112 ? N THR 2 112 O HIS BA 120 ? O HIS 2 120 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG F 301'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG F 302'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG G 9001' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG H 301'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG I 201'  
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG I 202'  
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG K 301'  
AC8 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 3SD K 302' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MES K 303' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG L 201'  
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG L 202'  
BC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG N 201'  
BC4 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG T 301'  
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG T 302'  
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG U 301'  
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG V 301'  
BC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG W 201'  
BC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG W 202'  
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG Y 301'  
CC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE 3SD Y 302' 
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MES Y 303' 
CC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG Z 201'  
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG Z 202'  
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG 2 201'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 1  LYS F  167 ? LYS F 173 . ? 1_555 ? 
2   AC2 4  SER F  7   ? SER F 13  . ? 1_555 ? 
3   AC2 4  ASN F  121 ? ASN F 127 . ? 1_555 ? 
4   AC2 4  ALA G  123 ? ALA G 127 . ? 1_555 ? 
5   AC2 4  TYR G  124 ? TYR G 128 . ? 1_555 ? 
6   AC3 4  THR G  8   ? THR G 13  . ? 1_555 ? 
7   AC3 4  TYR G  119 ? TYR G 123 . ? 1_555 ? 
8   AC3 4  ARG G  122 ? ARG G 126 . ? 1_555 ? 
9   AC3 4  MET G  125 ? MET G 129 . ? 1_555 ? 
10  AC4 4  ILE H  163 ? ILE H 163 . ? 1_555 ? 
11  AC4 4  ASP H  166 ? ASP H 166 . ? 1_555 ? 
12  AC4 4  SER H  169 ? SER H 169 . ? 1_555 ? 
13  AC4 4  ASP Z  222 ? ASP Z 194 . ? 1_555 ? 
14  AC5 2  GLY I  139 ? GLY I 128 . ? 1_555 ? 
15  AC5 2  SER I  142 ? SER I 131 . ? 1_555 ? 
16  AC6 3  ALA I  174 ? ALA I 163 . ? 1_555 ? 
17  AC6 3  ASP I  177 ? ASP I 166 . ? 1_555 ? 
18  AC6 3  SER I  180 ? SER I 169 . ? 1_555 ? 
19  AC7 4  ALA K  165 ? ALA K 163 . ? 1_555 ? 
20  AC7 4  ASP K  168 ? ASP K 166 . ? 1_555 ? 
21  AC7 4  SER K  171 ? SER K 169 . ? 1_555 ? 
22  AC7 4  ASP W  204 ? ASP W 194 . ? 1_555 ? 
23  AC8 17 THR K  1   ? THR K 1   . ? 1_555 ? 
24  AC8 17 ALA K  20  ? ALA K 20  . ? 1_555 ? 
25  AC8 17 THR K  21  ? THR K 21  . ? 1_555 ? 
26  AC8 17 ALA K  27  ? ALA K 27  . ? 1_555 ? 
27  AC8 17 SER K  28  ? SER K 28  . ? 1_555 ? 
28  AC8 17 VAL K  31  ? VAL K 31  . ? 1_555 ? 
29  AC8 17 LYS K  33  ? LYS K 33  . ? 1_555 ? 
30  AC8 17 GLY K  47  ? GLY K 47  . ? 1_555 ? 
31  AC8 17 GLY K  48  ? GLY K 48  . ? 1_555 ? 
32  AC8 17 ALA K  49  ? ALA K 49  . ? 1_555 ? 
33  AC8 17 MES KA .   ? MES K 303 . ? 1_555 ? 
34  AC8 17 SER L  124 ? SER L 112 . ? 1_555 ? 
35  AC8 17 ASP L  126 ? ASP L 114 . ? 1_555 ? 
36  AC8 17 PRO L  127 ? PRO L 115 . ? 1_555 ? 
37  AC8 17 SER L  130 ? SER L 118 . ? 1_555 ? 
38  AC8 17 ARG L  137 ? ARG L 125 . ? 1_555 ? 
39  AC8 17 HOH AB .   ? HOH L 301 . ? 1_555 ? 
40  AC9 5  THR K  1   ? THR K 1   . ? 1_555 ? 
41  AC9 5  GLY K  47  ? GLY K 47  . ? 1_555 ? 
42  AC9 5  SER K  131 ? SER K 129 . ? 1_555 ? 
43  AC9 5  TYR K  170 ? TYR K 168 . ? 1_555 ? 
44  AC9 5  3SD JA .   ? 3SD K 302 . ? 1_555 ? 
45  BC1 3  GLU D  105 ? GLU D 105 . ? 1_555 ? 
46  BC1 3  SER L  85  ? SER L 75  . ? 1_555 ? 
47  BC1 3  SER L  88  ? SER L 78  . ? 1_555 ? 
48  BC2 3  THR L  192 ? THR L 163 . ? 1_555 ? 
49  BC2 3  HIS L  195 ? HIS L 166 . ? 1_555 ? 
50  BC2 3  VAL L  198 ? VAL L 169 . ? 1_555 ? 
51  BC3 5  LEU AA 34  ? LEU 1 25  . ? 1_555 ? 
52  BC3 5  ARG N  19  ? ARG N 19  . ? 1_555 ? 
53  BC3 5  ILE N  163 ? ILE N 163 . ? 1_555 ? 
54  BC3 5  ASP N  166 ? ASP N 166 . ? 1_555 ? 
55  BC3 5  SER N  169 ? SER N 169 . ? 1_555 ? 
56  BC4 2  ARG T  163 ? ARG T 169 . ? 1_555 ? 
57  BC4 2  LYS T  167 ? LYS T 173 . ? 1_555 ? 
58  BC5 4  SER T  7   ? SER T 13  . ? 1_555 ? 
59  BC5 4  ASN T  121 ? ASN T 127 . ? 1_555 ? 
60  BC5 4  ALA U  123 ? ALA U 127 . ? 1_555 ? 
61  BC5 4  TYR U  124 ? TYR U 128 . ? 1_555 ? 
62  BC6 4  THR U  8   ? THR U 13  . ? 1_555 ? 
63  BC6 4  TYR U  119 ? TYR U 123 . ? 1_555 ? 
64  BC6 4  ARG U  122 ? ARG U 126 . ? 1_555 ? 
65  BC6 4  MET U  125 ? MET U 129 . ? 1_555 ? 
66  BC7 5  ASP L  222 ? ASP L 194 . ? 1_555 ? 
67  BC7 5  GLY V  162 ? GLY V 162 . ? 1_555 ? 
68  BC7 5  ILE V  163 ? ILE V 163 . ? 1_555 ? 
69  BC7 5  ASP V  166 ? ASP V 166 . ? 1_555 ? 
70  BC7 5  SER V  169 ? SER V 169 . ? 1_555 ? 
71  BC8 2  GLY W  139 ? GLY W 128 . ? 1_555 ? 
72  BC8 2  SER W  142 ? SER W 131 . ? 1_555 ? 
73  BC9 3  ALA W  174 ? ALA W 163 . ? 1_555 ? 
74  BC9 3  ASP W  177 ? ASP W 166 . ? 1_555 ? 
75  BC9 3  SER W  180 ? SER W 169 . ? 1_555 ? 
76  CC1 5  ASP I  204 ? ASP I 194 . ? 1_555 ? 
77  CC1 5  ARG Y  19  ? ARG Y 19  . ? 1_555 ? 
78  CC1 5  ALA Y  165 ? ALA Y 163 . ? 1_555 ? 
79  CC1 5  ASP Y  168 ? ASP Y 166 . ? 1_555 ? 
80  CC1 5  SER Y  171 ? SER Y 169 . ? 1_555 ? 
81  CC2 15 THR Y  1   ? THR Y 1   . ? 1_555 ? 
82  CC2 15 ALA Y  20  ? ALA Y 20  . ? 1_555 ? 
83  CC2 15 THR Y  21  ? THR Y 21  . ? 1_555 ? 
84  CC2 15 ALA Y  27  ? ALA Y 27  . ? 1_555 ? 
85  CC2 15 SER Y  28  ? SER Y 28  . ? 1_555 ? 
86  CC2 15 VAL Y  31  ? VAL Y 31  . ? 1_555 ? 
87  CC2 15 LYS Y  32  ? LYS Y 32  . ? 1_555 ? 
88  CC2 15 GLY Y  47  ? GLY Y 47  . ? 1_555 ? 
89  CC2 15 ALA Y  49  ? ALA Y 49  . ? 1_555 ? 
90  CC2 15 SER Y  96  ? SER Y 96  . ? 1_555 ? 
91  CC2 15 SER Z  124 ? SER Z 112 . ? 1_555 ? 
92  CC2 15 ASP Z  126 ? ASP Z 114 . ? 1_555 ? 
93  CC2 15 VAL Z  128 ? VAL Z 116 . ? 1_555 ? 
94  CC2 15 SER Z  130 ? SER Z 118 . ? 1_555 ? 
95  CC2 15 ARG Z  137 ? ARG Z 125 . ? 1_555 ? 
96  CC3 4  THR Y  1   ? THR Y 1   . ? 1_555 ? 
97  CC3 4  GLY Y  47  ? GLY Y 47  . ? 1_555 ? 
98  CC3 4  GLY Y  130 ? GLY Y 128 . ? 1_555 ? 
99  CC3 4  SER Y  131 ? SER Y 129 . ? 1_555 ? 
100 CC4 3  GLU R  105 ? GLU R 105 . ? 1_555 ? 
101 CC4 3  SER Z  85  ? SER Z 75  . ? 1_555 ? 
102 CC4 3  SER Z  88  ? SER Z 78  . ? 1_555 ? 
103 CC5 3  THR Z  192 ? THR Z 163 . ? 1_555 ? 
104 CC5 3  HIS Z  195 ? HIS Z 166 . ? 1_555 ? 
105 CC5 3  VAL Z  198 ? VAL Z 169 . ? 1_555 ? 
106 CC6 4  ARG BA 19  ? ARG 2 19  . ? 1_555 ? 
107 CC6 4  ILE BA 163 ? ILE 2 163 . ? 1_555 ? 
108 CC6 4  ASP BA 166 ? ASP 2 166 . ? 1_555 ? 
109 CC6 4  SER BA 169 ? SER 2 169 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3SDI 
_atom_sites.fract_transf_matrix[1][1]   0.007321 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003132 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003339 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007476 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . TYR A  1  5   ? 34.533  -88.829  40.317  1.00 64.33  ? 8    TYR A N   1 
ATOM   2     C  CA  . TYR A  1  5   ? 35.971  -88.411  40.122  1.00 64.09  ? 8    TYR A CA  1 
ATOM   3     C  C   . TYR A  1  5   ? 36.812  -89.319  39.196  1.00 63.30  ? 8    TYR A C   1 
ATOM   4     O  O   . TYR A  1  5   ? 38.016  -89.506  39.416  1.00 63.29  ? 8    TYR A O   1 
ATOM   5     C  CB  . TYR A  1  5   ? 36.678  -88.249  41.480  1.00 64.48  ? 8    TYR A CB  1 
ATOM   6     C  CG  . TYR A  1  5   ? 36.361  -86.949  42.178  1.00 65.22  ? 8    TYR A CG  1 
ATOM   7     C  CD1 . TYR A  1  5   ? 36.764  -85.724  41.631  1.00 66.18  ? 8    TYR A CD1 1 
ATOM   8     C  CD2 . TYR A  1  5   ? 35.669  -86.938  43.386  1.00 65.99  ? 8    TYR A CD2 1 
ATOM   9     C  CE1 . TYR A  1  5   ? 36.475  -84.518  42.265  1.00 66.53  ? 8    TYR A CE1 1 
ATOM   10    C  CE2 . TYR A  1  5   ? 35.380  -85.738  44.032  1.00 66.32  ? 8    TYR A CE2 1 
ATOM   11    C  CZ  . TYR A  1  5   ? 35.785  -84.534  43.466  1.00 67.03  ? 8    TYR A CZ  1 
ATOM   12    O  OH  . TYR A  1  5   ? 35.495  -83.347  44.098  1.00 67.94  ? 8    TYR A OH  1 
ATOM   13    N  N   . SER A  1  6   ? 36.188  -89.862  38.153  1.00 62.07  ? 9    SER A N   1 
ATOM   14    C  CA  . SER A  1  6   ? 36.901  -90.748  37.229  1.00 60.84  ? 9    SER A CA  1 
ATOM   15    C  C   . SER A  1  6   ? 37.638  -89.987  36.112  1.00 59.66  ? 9    SER A C   1 
ATOM   16    O  O   . SER A  1  6   ? 38.052  -90.590  35.109  1.00 59.73  ? 9    SER A O   1 
ATOM   17    C  CB  . SER A  1  6   ? 35.955  -91.808  36.648  1.00 60.89  ? 9    SER A CB  1 
ATOM   18    O  OG  . SER A  1  6   ? 34.767  -91.209  36.168  1.00 61.28  ? 9    SER A OG  1 
ATOM   19    N  N   . PHE A  1  7   ? 37.809  -88.676  36.293  1.00 57.81  ? 10   PHE A N   1 
ATOM   20    C  CA  . PHE A  1  7   ? 38.537  -87.851  35.326  1.00 56.21  ? 10   PHE A CA  1 
ATOM   21    C  C   . PHE A  1  7   ? 39.918  -87.390  35.838  1.00 54.81  ? 10   PHE A C   1 
ATOM   22    O  O   . PHE A  1  7   ? 40.158  -87.357  37.044  1.00 54.47  ? 10   PHE A O   1 
ATOM   23    C  CB  . PHE A  1  7   ? 37.673  -86.668  34.855  1.00 56.36  ? 10   PHE A CB  1 
ATOM   24    C  CG  . PHE A  1  7   ? 37.045  -85.879  35.972  1.00 56.83  ? 10   PHE A CG  1 
ATOM   25    C  CD1 . PHE A  1  7   ? 37.724  -84.812  36.556  1.00 56.91  ? 10   PHE A CD1 1 
ATOM   26    C  CD2 . PHE A  1  7   ? 35.768  -86.197  36.434  1.00 57.75  ? 10   PHE A CD2 1 
ATOM   27    C  CE1 . PHE A  1  7   ? 37.149  -84.079  37.591  1.00 57.61  ? 10   PHE A CE1 1 
ATOM   28    C  CE2 . PHE A  1  7   ? 35.178  -85.469  37.477  1.00 58.54  ? 10   PHE A CE2 1 
ATOM   29    C  CZ  . PHE A  1  7   ? 35.871  -84.405  38.054  1.00 58.21  ? 10   PHE A CZ  1 
ATOM   30    N  N   . SER A  1  8   ? 40.818  -87.057  34.911  1.00 53.19  ? 11   SER A N   1 
ATOM   31    C  CA  . SER A  1  8   ? 42.133  -86.499  35.244  1.00 51.92  ? 11   SER A CA  1 
ATOM   32    C  C   . SER A  1  8   ? 42.015  -85.248  36.106  1.00 51.20  ? 11   SER A C   1 
ATOM   33    O  O   . SER A  1  8   ? 41.208  -84.360  35.818  1.00 51.23  ? 11   SER A O   1 
ATOM   34    C  CB  . SER A  1  8   ? 42.906  -86.126  33.977  1.00 52.02  ? 11   SER A CB  1 
ATOM   35    O  OG  . SER A  1  8   ? 43.575  -87.229  33.411  1.00 51.39  ? 11   SER A OG  1 
ATOM   36    N  N   . LEU A  1  9   ? 42.828  -85.183  37.156  1.00 50.08  ? 12   LEU A N   1 
ATOM   37    C  CA  . LEU A  1  9   ? 42.897  -84.009  38.010  1.00 48.95  ? 12   LEU A CA  1 
ATOM   38    C  C   . LEU A  1  9   ? 44.113  -83.142  37.658  1.00 48.53  ? 12   LEU A C   1 
ATOM   39    O  O   . LEU A  1  9   ? 44.219  -82.003  38.114  1.00 48.40  ? 12   LEU A O   1 
ATOM   40    C  CB  . LEU A  1  9   ? 42.933  -84.418  39.478  1.00 48.85  ? 12   LEU A CB  1 
ATOM   41    C  CG  . LEU A  1  9   ? 41.847  -85.342  40.022  1.00 48.37  ? 12   LEU A CG  1 
ATOM   42    C  CD1 . LEU A  1  9   ? 42.103  -85.589  41.497  1.00 47.45  ? 12   LEU A CD1 1 
ATOM   43    C  CD2 . LEU A  1  9   ? 40.447  -84.775  39.814  1.00 48.31  ? 12   LEU A CD2 1 
ATOM   44    N  N   . THR A  1  10  ? 45.028  -83.699  36.864  1.00 47.92  ? 13   THR A N   1 
ATOM   45    C  CA  . THR A  1  10  ? 46.086  -82.934  36.213  1.00 47.72  ? 13   THR A CA  1 
ATOM   46    C  C   . THR A  1  10  ? 45.686  -82.700  34.756  1.00 47.78  ? 13   THR A C   1 
ATOM   47    O  O   . THR A  1  10  ? 45.757  -83.617  33.930  1.00 48.01  ? 13   THR A O   1 
ATOM   48    C  CB  . THR A  1  10  ? 47.465  -83.660  36.260  1.00 47.59  ? 13   THR A CB  1 
ATOM   49    O  OG1 . THR A  1  10  ? 47.817  -83.975  37.611  1.00 47.88  ? 13   THR A OG1 1 
ATOM   50    C  CG2 . THR A  1  10  ? 48.560  -82.791  35.681  1.00 47.40  ? 13   THR A CG2 1 
ATOM   51    N  N   . THR A  1  11  ? 45.254  -81.480  34.448  1.00 47.73  ? 14   THR A N   1 
ATOM   52    C  CA  . THR A  1  11  ? 44.899  -81.102  33.075  1.00 47.93  ? 14   THR A CA  1 
ATOM   53    C  C   . THR A  1  11  ? 45.806  -79.990  32.568  1.00 47.93  ? 14   THR A C   1 
ATOM   54    O  O   . THR A  1  11  ? 46.544  -79.377  33.346  1.00 48.18  ? 14   THR A O   1 
ATOM   55    C  CB  . THR A  1  11  ? 43.429  -80.639  32.958  1.00 48.11  ? 14   THR A CB  1 
ATOM   56    O  OG1 . THR A  1  11  ? 43.227  -79.452  33.741  1.00 47.97  ? 14   THR A OG1 1 
ATOM   57    C  CG2 . THR A  1  11  ? 42.469  -81.743  33.425  1.00 48.59  ? 14   THR A CG2 1 
ATOM   58    N  N   . PHE A  1  12  ? 45.759  -79.738  31.263  1.00 47.77  ? 15   PHE A N   1 
ATOM   59    C  CA  . PHE A  1  12  ? 46.505  -78.633  30.680  1.00 47.66  ? 15   PHE A CA  1 
ATOM   60    C  C   . PHE A  1  12  ? 45.745  -77.321  30.878  1.00 48.24  ? 15   PHE A C   1 
ATOM   61    O  O   . PHE A  1  12  ? 44.519  -77.266  30.709  1.00 48.13  ? 15   PHE A O   1 
ATOM   62    C  CB  . PHE A  1  12  ? 46.721  -78.850  29.188  1.00 47.32  ? 15   PHE A CB  1 
ATOM   63    C  CG  . PHE A  1  12  ? 47.622  -79.989  28.859  1.00 45.83  ? 15   PHE A CG  1 
ATOM   64    C  CD1 . PHE A  1  12  ? 48.989  -79.801  28.777  1.00 45.05  ? 15   PHE A CD1 1 
ATOM   65    C  CD2 . PHE A  1  12  ? 47.100  -81.246  28.596  1.00 44.39  ? 15   PHE A CD2 1 
ATOM   66    C  CE1 . PHE A  1  12  ? 49.830  -80.856  28.456  1.00 45.30  ? 15   PHE A CE1 1 
ATOM   67    C  CE2 . PHE A  1  12  ? 47.929  -82.310  28.272  1.00 43.92  ? 15   PHE A CE2 1 
ATOM   68    C  CZ  . PHE A  1  12  ? 49.295  -82.119  28.198  1.00 44.43  ? 15   PHE A CZ  1 
ATOM   69    N  N   . SER A  1  13  ? 46.481  -76.271  31.237  1.00 48.61  ? 16   SER A N   1 
ATOM   70    C  CA  . SER A  1  13  ? 45.935  -74.919  31.274  1.00 49.12  ? 16   SER A CA  1 
ATOM   71    C  C   . SER A  1  13  ? 46.218  -74.217  29.926  1.00 49.28  ? 16   SER A C   1 
ATOM   72    O  O   . SER A  1  13  ? 47.050  -74.694  29.150  1.00 49.16  ? 16   SER A O   1 
ATOM   73    C  CB  . SER A  1  13  ? 46.528  -74.140  32.454  1.00 49.07  ? 16   SER A CB  1 
ATOM   74    O  OG  . SER A  1  13  ? 47.913  -73.914  32.259  1.00 49.82  ? 16   SER A OG  1 
ATOM   75    N  N   . PRO A  1  14  ? 45.524  -73.094  29.638  1.00 49.66  ? 17   PRO A N   1 
ATOM   76    C  CA  . PRO A  1  14  ? 45.738  -72.397  28.365  1.00 50.05  ? 17   PRO A CA  1 
ATOM   77    C  C   . PRO A  1  14  ? 47.202  -72.131  27.984  1.00 50.55  ? 17   PRO A C   1 
ATOM   78    O  O   . PRO A  1  14  ? 47.531  -72.179  26.796  1.00 50.68  ? 17   PRO A O   1 
ATOM   79    C  CB  . PRO A  1  14  ? 44.959  -71.098  28.554  1.00 50.01  ? 17   PRO A CB  1 
ATOM   80    C  CG  . PRO A  1  14  ? 43.796  -71.521  29.404  1.00 49.82  ? 17   PRO A CG  1 
ATOM   81    C  CD  . PRO A  1  14  ? 44.388  -72.508  30.385  1.00 49.66  ? 17   PRO A CD  1 
ATOM   82    N  N   . SER A  1  15  ? 48.070  -71.882  28.966  1.00 51.00  ? 18   SER A N   1 
ATOM   83    C  CA  . SER A  1  15  ? 49.490  -71.603  28.698  1.00 51.51  ? 18   SER A CA  1 
ATOM   84    C  C   . SER A  1  15  ? 50.320  -72.859  28.385  1.00 51.68  ? 18   SER A C   1 
ATOM   85    O  O   . SER A  1  15  ? 51.526  -72.765  28.107  1.00 51.99  ? 18   SER A O   1 
ATOM   86    C  CB  . SER A  1  15  ? 50.114  -70.864  29.881  1.00 51.57  ? 18   SER A CB  1 
ATOM   87    O  OG  . SER A  1  15  ? 50.315  -71.759  30.967  1.00 53.08  ? 18   SER A OG  1 
ATOM   88    N  N   . GLY A  1  16  ? 49.677  -74.027  28.444  1.00 51.61  ? 19   GLY A N   1 
ATOM   89    C  CA  . GLY A  1  16  ? 50.346  -75.314  28.228  1.00 51.35  ? 19   GLY A CA  1 
ATOM   90    C  C   . GLY A  1  16  ? 50.964  -75.925  29.482  1.00 51.09  ? 19   GLY A C   1 
ATOM   91    O  O   . GLY A  1  16  ? 51.707  -76.894  29.402  1.00 50.68  ? 19   GLY A O   1 
ATOM   92    N  N   . LYS A  1  17  ? 50.655  -75.350  30.639  1.00 51.07  ? 20   LYS A N   1 
ATOM   93    C  CA  . LYS A  1  17  ? 51.203  -75.812  31.905  1.00 51.09  ? 20   LYS A CA  1 
ATOM   94    C  C   . LYS A  1  17  ? 50.355  -76.927  32.487  1.00 50.30  ? 20   LYS A C   1 
ATOM   95    O  O   . LYS A  1  17  ? 49.122  -76.916  32.345  1.00 50.47  ? 20   LYS A O   1 
ATOM   96    C  CB  . LYS A  1  17  ? 51.293  -74.655  32.912  1.00 51.61  ? 20   LYS A CB  1 
ATOM   97    C  CG  . LYS A  1  17  ? 52.526  -73.738  32.741  1.00 54.71  ? 20   LYS A CG  1 
ATOM   98    C  CD  . LYS A  1  17  ? 53.818  -74.565  32.528  1.00 58.73  ? 20   LYS A CD  1 
ATOM   99    C  CE  . LYS A  1  17  ? 55.013  -74.039  33.345  1.00 59.68  ? 20   LYS A CE  1 
ATOM   100   N  NZ  . LYS A  1  17  ? 56.135  -75.027  33.225  1.00 60.72  ? 20   LYS A NZ  1 
ATOM   101   N  N   . LEU A  1  18  ? 51.015  -77.886  33.136  1.00 48.96  ? 21   LEU A N   1 
ATOM   102   C  CA  . LEU A  1  18  ? 50.312  -78.915  33.882  1.00 47.93  ? 21   LEU A CA  1 
ATOM   103   C  C   . LEU A  1  18  ? 50.342  -78.564  35.372  1.00 47.19  ? 21   LEU A C   1 
ATOM   104   O  O   . LEU A  1  18  ? 51.258  -78.967  36.102  1.00 47.41  ? 21   LEU A O   1 
ATOM   105   C  CB  . LEU A  1  18  ? 50.901  -80.305  33.597  1.00 48.15  ? 21   LEU A CB  1 
ATOM   106   C  CG  . LEU A  1  18  ? 50.551  -80.981  32.258  1.00 48.41  ? 21   LEU A CG  1 
ATOM   107   C  CD1 . LEU A  1  18  ? 51.535  -82.090  31.922  1.00 48.55  ? 21   LEU A CD1 1 
ATOM   108   C  CD2 . LEU A  1  18  ? 49.123  -81.521  32.230  1.00 48.51  ? 21   LEU A CD2 1 
ATOM   109   N  N   . GLY A  1  19  ? 49.329  -77.804  35.801  1.00 46.14  ? 22   GLY A N   1 
ATOM   110   C  CA  . GLY A  1  19  ? 49.251  -77.198  37.133  1.00 44.67  ? 22   GLY A CA  1 
ATOM   111   C  C   . GLY A  1  19  ? 49.724  -78.047  38.294  1.00 44.04  ? 22   GLY A C   1 
ATOM   112   O  O   . GLY A  1  19  ? 50.645  -77.658  39.026  1.00 44.22  ? 22   GLY A O   1 
ATOM   113   N  N   . GLN A  1  20  ? 49.115  -79.218  38.464  1.00 42.91  ? 23   GLN A N   1 
ATOM   114   C  CA  . GLN A  1  20  ? 49.403  -80.043  39.631  1.00 41.68  ? 23   GLN A CA  1 
ATOM   115   C  C   . GLN A  1  20  ? 50.835  -80.561  39.650  1.00 41.02  ? 23   GLN A C   1 
ATOM   116   O  O   . GLN A  1  20  ? 51.405  -80.744  40.718  1.00 40.93  ? 23   GLN A O   1 
ATOM   117   C  CB  . GLN A  1  20  ? 48.403  -81.181  39.763  1.00 41.49  ? 23   GLN A CB  1 
ATOM   118   C  CG  . GLN A  1  20  ? 47.017  -80.736  40.177  1.00 42.08  ? 23   GLN A CG  1 
ATOM   119   C  CD  . GLN A  1  20  ? 46.902  -80.432  41.671  1.00 44.65  ? 23   GLN A CD  1 
ATOM   120   O  OE1 . GLN A  1  20  ? 47.396  -81.186  42.523  1.00 44.35  ? 23   GLN A OE1 1 
ATOM   121   N  NE2 . GLN A  1  20  ? 46.234  -79.323  41.994  1.00 44.54  ? 23   GLN A NE2 1 
ATOM   122   N  N   . ILE A  1  21  ? 51.422  -80.782  38.479  1.00 40.42  ? 24   ILE A N   1 
ATOM   123   C  CA  . ILE A  1  21  ? 52.828  -81.201  38.410  1.00 40.10  ? 24   ILE A CA  1 
ATOM   124   C  C   . ILE A  1  21  ? 53.726  -80.059  38.885  1.00 40.37  ? 24   ILE A C   1 
ATOM   125   O  O   . ILE A  1  21  ? 54.657  -80.283  39.664  1.00 39.97  ? 24   ILE A O   1 
ATOM   126   C  CB  . ILE A  1  21  ? 53.221  -81.695  36.991  1.00 40.05  ? 24   ILE A CB  1 
ATOM   127   C  CG1 . ILE A  1  21  ? 52.574  -83.052  36.720  1.00 39.20  ? 24   ILE A CG1 1 
ATOM   128   C  CG2 . ILE A  1  21  ? 54.725  -81.807  36.841  1.00 39.48  ? 24   ILE A CG2 1 
ATOM   129   C  CD1 . ILE A  1  21  ? 52.536  -83.442  35.273  1.00 38.16  ? 24   ILE A CD1 1 
ATOM   130   N  N   . ASP A  1  22  ? 53.425  -78.834  38.439  1.00 40.82  ? 25   ASP A N   1 
ATOM   131   C  CA  . ASP A  1  22  ? 54.126  -77.637  38.935  1.00 41.16  ? 25   ASP A CA  1 
ATOM   132   C  C   . ASP A  1  22  ? 53.976  -77.522  40.439  1.00 40.58  ? 25   ASP A C   1 
ATOM   133   O  O   . ASP A  1  22  ? 54.967  -77.366  41.149  1.00 40.69  ? 25   ASP A O   1 
ATOM   134   C  CB  . ASP A  1  22  ? 53.613  -76.353  38.281  1.00 41.54  ? 25   ASP A CB  1 
ATOM   135   C  CG  . ASP A  1  22  ? 53.966  -76.253  36.803  1.00 43.99  ? 25   ASP A CG  1 
ATOM   136   O  OD1 . ASP A  1  22  ? 53.430  -75.322  36.141  1.00 46.67  ? 25   ASP A OD1 1 
ATOM   137   O  OD2 . ASP A  1  22  ? 54.766  -77.087  36.300  1.00 45.40  ? 25   ASP A OD2 1 
ATOM   138   N  N   . TYR A  1  23  ? 52.742  -77.630  40.928  1.00 40.08  ? 26   TYR A N   1 
ATOM   139   C  CA  . TYR A  1  23  ? 52.499  -77.463  42.355  1.00 39.71  ? 26   TYR A CA  1 
ATOM   140   C  C   . TYR A  1  23  ? 53.218  -78.532  43.182  1.00 39.43  ? 26   TYR A C   1 
ATOM   141   O  O   . TYR A  1  23  ? 53.801  -78.228  44.225  1.00 39.52  ? 26   TYR A O   1 
ATOM   142   C  CB  . TYR A  1  23  ? 51.004  -77.399  42.675  1.00 39.89  ? 26   TYR A CB  1 
ATOM   143   C  CG  . TYR A  1  23  ? 50.202  -76.360  41.893  1.00 40.41  ? 26   TYR A CG  1 
ATOM   144   C  CD1 . TYR A  1  23  ? 50.823  -75.311  41.202  1.00 39.87  ? 26   TYR A CD1 1 
ATOM   145   C  CD2 . TYR A  1  23  ? 48.814  -76.415  41.876  1.00 41.47  ? 26   TYR A CD2 1 
ATOM   146   C  CE1 . TYR A  1  23  ? 50.084  -74.384  40.494  1.00 39.80  ? 26   TYR A CE1 1 
ATOM   147   C  CE2 . TYR A  1  23  ? 48.059  -75.478  41.174  1.00 41.33  ? 26   TYR A CE2 1 
ATOM   148   C  CZ  . TYR A  1  23  ? 48.696  -74.471  40.486  1.00 40.96  ? 26   TYR A CZ  1 
ATOM   149   O  OH  . TYR A  1  23  ? 47.930  -73.563  39.797  1.00 40.73  ? 26   TYR A OH  1 
ATOM   150   N  N   . ALA A  1  24  ? 53.211  -79.772  42.699  1.00 38.76  ? 27   ALA A N   1 
ATOM   151   C  CA  . ALA A  1  24  ? 53.996  -80.829  43.321  1.00 38.39  ? 27   ALA A CA  1 
ATOM   152   C  C   . ALA A  1  24  ? 55.492  -80.501  43.341  1.00 38.19  ? 27   ALA A C   1 
ATOM   153   O  O   . ALA A  1  24  ? 56.159  -80.743  44.338  1.00 38.02  ? 27   ALA A O   1 
ATOM   154   C  CB  . ALA A  1  24  ? 53.752  -82.160  42.632  1.00 38.65  ? 27   ALA A CB  1 
ATOM   155   N  N   . LEU A  1  25  ? 56.022  -79.957  42.247  1.00 38.01  ? 28   LEU A N   1 
ATOM   156   C  CA  . LEU A  1  25  ? 57.436  -79.577  42.218  1.00 37.81  ? 28   LEU A CA  1 
ATOM   157   C  C   . LEU A  1  25  ? 57.730  -78.503  43.261  1.00 38.22  ? 28   LEU A C   1 
ATOM   158   O  O   . LEU A  1  25  ? 58.832  -78.466  43.806  1.00 38.49  ? 28   LEU A O   1 
ATOM   159   C  CB  . LEU A  1  25  ? 57.864  -79.097  40.834  1.00 37.40  ? 28   LEU A CB  1 
ATOM   160   C  CG  . LEU A  1  25  ? 58.209  -80.157  39.791  1.00 36.36  ? 28   LEU A CG  1 
ATOM   161   C  CD1 . LEU A  1  25  ? 57.982  -79.639  38.368  1.00 34.87  ? 28   LEU A CD1 1 
ATOM   162   C  CD2 . LEU A  1  25  ? 59.626  -80.646  39.963  1.00 35.22  ? 28   LEU A CD2 1 
ATOM   163   N  N   . THR A  1  26  ? 56.749  -77.639  43.538  1.00 38.41  ? 29   THR A N   1 
ATOM   164   C  CA  . THR A  1  26  ? 56.893  -76.638  44.594  1.00 38.76  ? 29   THR A CA  1 
ATOM   165   C  C   . THR A  1  26  ? 57.026  -77.327  45.949  1.00 39.03  ? 29   THR A C   1 
ATOM   166   O  O   . THR A  1  26  ? 57.878  -76.944  46.765  1.00 39.33  ? 29   THR A O   1 
ATOM   167   C  CB  . THR A  1  26  ? 55.719  -75.631  44.619  1.00 38.90  ? 29   THR A CB  1 
ATOM   168   O  OG1 . THR A  1  26  ? 55.745  -74.837  43.434  1.00 38.92  ? 29   THR A OG1 1 
ATOM   169   C  CG2 . THR A  1  26  ? 55.812  -74.708  45.827  1.00 38.50  ? 29   THR A CG2 1 
ATOM   170   N  N   . ALA A  1  27  ? 56.193  -78.346  46.181  1.00 38.93  ? 30   ALA A N   1 
ATOM   171   C  CA  . ALA A  1  27  ? 56.296  -79.183  47.382  1.00 38.86  ? 30   ALA A CA  1 
ATOM   172   C  C   . ALA A  1  27  ? 57.700  -79.782  47.553  1.00 38.78  ? 30   ALA A C   1 
ATOM   173   O  O   . ALA A  1  27  ? 58.204  -79.873  48.675  1.00 38.67  ? 30   ALA A O   1 
ATOM   174   C  CB  . ALA A  1  27  ? 55.233  -80.294  47.366  1.00 38.84  ? 30   ALA A CB  1 
ATOM   175   N  N   . VAL A  1  28  ? 58.326  -80.174  46.446  1.00 38.76  ? 31   VAL A N   1 
ATOM   176   C  CA  . VAL A  1  28  ? 59.675  -80.726  46.494  1.00 39.42  ? 31   VAL A CA  1 
ATOM   177   C  C   . VAL A  1  28  ? 60.695  -79.672  46.913  1.00 40.34  ? 31   VAL A C   1 
ATOM   178   O  O   . VAL A  1  28  ? 61.593  -79.969  47.707  1.00 40.45  ? 31   VAL A O   1 
ATOM   179   C  CB  . VAL A  1  28  ? 60.094  -81.378  45.161  1.00 39.17  ? 31   VAL A CB  1 
ATOM   180   C  CG1 . VAL A  1  28  ? 61.500  -81.939  45.246  1.00 37.68  ? 31   VAL A CG1 1 
ATOM   181   C  CG2 . VAL A  1  28  ? 59.118  -82.468  44.794  1.00 39.23  ? 31   VAL A CG2 1 
ATOM   182   N  N   . LYS A  1  29  ? 60.546  -78.451  46.388  1.00 41.37  ? 32   LYS A N   1 
ATOM   183   C  CA  . LYS A  1  29  ? 61.428  -77.326  46.735  1.00 42.27  ? 32   LYS A CA  1 
ATOM   184   C  C   . LYS A  1  29  ? 61.419  -77.048  48.231  1.00 41.97  ? 32   LYS A C   1 
ATOM   185   O  O   . LYS A  1  29  ? 62.457  -76.741  48.796  1.00 42.29  ? 32   LYS A O   1 
ATOM   186   C  CB  . LYS A  1  29  ? 61.035  -76.051  45.976  1.00 43.09  ? 32   LYS A CB  1 
ATOM   187   C  CG  . LYS A  1  29  ? 61.608  -75.897  44.557  1.00 45.85  ? 32   LYS A CG  1 
ATOM   188   C  CD  . LYS A  1  29  ? 62.836  -74.963  44.538  1.00 50.70  ? 32   LYS A CD  1 
ATOM   189   C  CE  . LYS A  1  29  ? 64.132  -75.697  44.994  1.00 52.51  ? 32   LYS A CE  1 
ATOM   190   N  NZ  . LYS A  1  29  ? 65.244  -74.764  45.395  1.00 52.68  ? 32   LYS A NZ  1 
ATOM   191   N  N   . GLN A  1  30  ? 60.257  -77.168  48.869  1.00 41.70  ? 33   GLN A N   1 
ATOM   192   C  CA  . GLN A  1  30  ? 60.145  -76.922  50.316  1.00 42.12  ? 33   GLN A CA  1 
ATOM   193   C  C   . GLN A  1  30  ? 60.817  -77.996  51.160  1.00 41.41  ? 33   GLN A C   1 
ATOM   194   O  O   . GLN A  1  30  ? 61.042  -77.797  52.359  1.00 41.71  ? 33   GLN A O   1 
ATOM   195   C  CB  . GLN A  1  30  ? 58.677  -76.819  50.764  1.00 42.64  ? 33   GLN A CB  1 
ATOM   196   C  CG  . GLN A  1  30  ? 57.767  -75.962  49.890  1.00 45.92  ? 33   GLN A CG  1 
ATOM   197   C  CD  . GLN A  1  30  ? 58.063  -74.468  50.002  1.00 50.09  ? 33   GLN A CD  1 
ATOM   198   O  OE1 . GLN A  1  30  ? 57.343  -73.743  50.698  1.00 52.13  ? 33   GLN A OE1 1 
ATOM   199   N  NE2 . GLN A  1  30  ? 59.123  -73.998  49.315  1.00 49.67  ? 33   GLN A NE2 1 
ATOM   200   N  N   . GLY A  1  31  ? 61.121  -79.136  50.544  1.00 40.42  ? 34   GLY A N   1 
ATOM   201   C  CA  . GLY A  1  31  ? 61.628  -80.284  51.281  1.00 39.32  ? 34   GLY A CA  1 
ATOM   202   C  C   . GLY A  1  31  ? 63.099  -80.209  51.623  1.00 38.56  ? 34   GLY A C   1 
ATOM   203   O  O   . GLY A  1  31  ? 63.869  -79.501  50.965  1.00 38.48  ? 34   GLY A O   1 
ATOM   204   N  N   . VAL A  1  32  ? 63.481  -80.949  52.659  1.00 37.85  ? 35   VAL A N   1 
ATOM   205   C  CA  . VAL A  1  32  ? 64.875  -81.075  53.072  1.00 37.77  ? 35   VAL A CA  1 
ATOM   206   C  C   . VAL A  1  32  ? 65.793  -81.504  51.923  1.00 37.64  ? 35   VAL A C   1 
ATOM   207   O  O   . VAL A  1  32  ? 65.446  -82.371  51.134  1.00 37.84  ? 35   VAL A O   1 
ATOM   208   C  CB  . VAL A  1  32  ? 64.995  -82.062  54.257  1.00 37.60  ? 35   VAL A CB  1 
ATOM   209   C  CG1 . VAL A  1  32  ? 66.420  -82.576  54.411  1.00 37.61  ? 35   VAL A CG1 1 
ATOM   210   C  CG2 . VAL A  1  32  ? 64.548  -81.387  55.519  1.00 37.55  ? 35   VAL A CG2 1 
ATOM   211   N  N   . THR A  1  33  ? 66.958  -80.883  51.837  1.00 37.97  ? 36   THR A N   1 
ATOM   212   C  CA  . THR A  1  33  ? 67.937  -81.182  50.796  1.00 38.61  ? 36   THR A CA  1 
ATOM   213   C  C   . THR A  1  33  ? 68.374  -82.641  50.811  1.00 38.90  ? 36   THR A C   1 
ATOM   214   O  O   . THR A  1  33  ? 68.656  -83.206  51.876  1.00 38.99  ? 36   THR A O   1 
ATOM   215   C  CB  . THR A  1  33  ? 69.219  -80.338  50.974  1.00 38.60  ? 36   THR A CB  1 
ATOM   216   O  OG1 . THR A  1  33  ? 68.870  -79.000  51.355  1.00 40.65  ? 36   THR A OG1 1 
ATOM   217   C  CG2 . THR A  1  33  ? 70.033  -80.305  49.680  1.00 38.61  ? 36   THR A CG2 1 
ATOM   218   N  N   . SER A  1  34  ? 68.436  -83.245  49.624  1.00 38.83  ? 37   SER A N   1 
ATOM   219   C  CA  . SER A  1  34  ? 69.160  -84.498  49.453  1.00 38.73  ? 37   SER A CA  1 
ATOM   220   C  C   . SER A  1  34  ? 69.990  -84.413  48.194  1.00 38.55  ? 37   SER A C   1 
ATOM   221   O  O   . SER A  1  34  ? 69.698  -83.612  47.300  1.00 38.43  ? 37   SER A O   1 
ATOM   222   C  CB  . SER A  1  34  ? 68.223  -85.710  49.428  1.00 38.67  ? 37   SER A CB  1 
ATOM   223   O  OG  . SER A  1  34  ? 67.214  -85.551  48.456  1.00 39.67  ? 37   SER A OG  1 
ATOM   224   N  N   . LEU A  1  35  ? 71.037  -85.224  48.136  1.00 38.49  ? 38   LEU A N   1 
ATOM   225   C  CA  . LEU A  1  35  ? 71.954  -85.183  47.014  1.00 38.61  ? 38   LEU A CA  1 
ATOM   226   C  C   . LEU A  1  35  ? 72.560  -86.552  46.693  1.00 38.82  ? 38   LEU A C   1 
ATOM   227   O  O   . LEU A  1  35  ? 72.476  -87.487  47.492  1.00 38.67  ? 38   LEU A O   1 
ATOM   228   C  CB  . LEU A  1  35  ? 73.045  -84.138  47.264  1.00 38.52  ? 38   LEU A CB  1 
ATOM   229   C  CG  . LEU A  1  35  ? 73.926  -84.303  48.501  1.00 38.75  ? 38   LEU A CG  1 
ATOM   230   C  CD1 . LEU A  1  35  ? 75.184  -85.059  48.126  1.00 39.34  ? 38   LEU A CD1 1 
ATOM   231   C  CD2 . LEU A  1  35  ? 74.282  -82.948  49.088  1.00 38.75  ? 38   LEU A CD2 1 
ATOM   232   N  N   . GLY A  1  36  ? 73.148  -86.651  45.505  1.00 38.90  ? 39   GLY A N   1 
ATOM   233   C  CA  . GLY A  1  36  ? 73.873  -87.831  45.083  1.00 39.31  ? 39   GLY A CA  1 
ATOM   234   C  C   . GLY A  1  36  ? 75.089  -87.436  44.267  1.00 39.69  ? 39   GLY A C   1 
ATOM   235   O  O   . GLY A  1  36  ? 75.036  -86.499  43.474  1.00 39.50  ? 39   GLY A O   1 
ATOM   236   N  N   . ILE A  1  37  ? 76.187  -88.154  44.474  1.00 40.12  ? 40   ILE A N   1 
ATOM   237   C  CA  . ILE A  1  37  ? 77.433  -87.899  43.767  1.00 40.94  ? 40   ILE A CA  1 
ATOM   238   C  C   . ILE A  1  37  ? 77.999  -89.218  43.286  1.00 41.26  ? 40   ILE A C   1 
ATOM   239   O  O   . ILE A  1  37  ? 78.130  -90.157  44.074  1.00 41.09  ? 40   ILE A O   1 
ATOM   240   C  CB  . ILE A  1  37  ? 78.508  -87.228  44.679  1.00 41.01  ? 40   ILE A CB  1 
ATOM   241   C  CG1 . ILE A  1  37  ? 77.897  -86.105  45.523  1.00 41.77  ? 40   ILE A CG1 1 
ATOM   242   C  CG2 . ILE A  1  37  ? 79.687  -86.711  43.843  1.00 40.08  ? 40   ILE A CG2 1 
ATOM   243   C  CD1 . ILE A  1  37  ? 78.876  -85.455  46.481  1.00 43.48  ? 40   ILE A CD1 1 
ATOM   244   N  N   . LYS A  1  38  ? 78.377  -89.257  42.011  1.00 41.88  ? 41   LYS A N   1 
ATOM   245   C  CA  . LYS A  1  38  ? 78.874  -90.470  41.360  1.00 42.79  ? 41   LYS A CA  1 
ATOM   246   C  C   . LYS A  1  38  ? 80.407  -90.492  41.180  1.00 42.93  ? 41   LYS A C   1 
ATOM   247   O  O   . LYS A  1  38  ? 80.972  -89.653  40.473  1.00 43.61  ? 41   LYS A O   1 
ATOM   248   C  CB  . LYS A  1  38  ? 78.168  -90.647  40.004  1.00 43.00  ? 41   LYS A CB  1 
ATOM   249   C  CG  . LYS A  1  38  ? 78.371  -91.997  39.342  1.00 44.79  ? 41   LYS A CG  1 
ATOM   250   C  CD  . LYS A  1  38  ? 77.542  -92.130  38.079  1.00 47.08  ? 41   LYS A CD  1 
ATOM   251   C  CE  . LYS A  1  38  ? 78.250  -91.560  36.876  1.00 49.00  ? 41   LYS A CE  1 
ATOM   252   N  NZ  . LYS A  1  38  ? 77.252  -91.249  35.818  1.00 51.05  ? 41   LYS A NZ  1 
ATOM   253   N  N   . ALA A  1  39  ? 81.066  -91.464  41.811  1.00 42.45  ? 42   ALA A N   1 
ATOM   254   C  CA  . ALA A  1  39  ? 82.508  -91.659  41.672  1.00 42.05  ? 42   ALA A CA  1 
ATOM   255   C  C   . ALA A  1  39  ? 82.834  -92.723  40.610  1.00 41.99  ? 42   ALA A C   1 
ATOM   256   O  O   . ALA A  1  39  ? 81.936  -93.255  39.965  1.00 42.33  ? 42   ALA A O   1 
ATOM   257   C  CB  . ALA A  1  39  ? 83.114  -92.036  43.019  1.00 41.77  ? 42   ALA A CB  1 
ATOM   258   N  N   . THR A  1  40  ? 84.121  -93.025  40.438  1.00 41.93  ? 43   THR A N   1 
ATOM   259   C  CA  . THR A  1  40  ? 84.600  -94.014  39.458  1.00 41.55  ? 43   THR A CA  1 
ATOM   260   C  C   . THR A  1  40  ? 84.252  -95.431  39.898  1.00 41.17  ? 43   THR A C   1 
ATOM   261   O  O   . THR A  1  40  ? 83.982  -96.302  39.072  1.00 41.32  ? 43   THR A O   1 
ATOM   262   C  CB  . THR A  1  40  ? 86.155  -93.956  39.267  1.00 41.91  ? 43   THR A CB  1 
ATOM   263   O  OG1 . THR A  1  40  ? 86.811  -94.190  40.526  1.00 42.02  ? 43   THR A OG1 1 
ATOM   264   C  CG2 . THR A  1  40  ? 86.612  -92.607  38.695  1.00 41.16  ? 43   THR A CG2 1 
ATOM   265   N  N   . ASN A  1  41  ? 84.265  -95.638  41.210  1.00 40.45  ? 44   ASN A N   1 
ATOM   266   C  CA  . ASN A  1  41  ? 84.061  -96.942  41.813  1.00 39.83  ? 44   ASN A CA  1 
ATOM   267   C  C   . ASN A  1  41  ? 83.014  -96.873  42.920  1.00 39.62  ? 44   ASN A C   1 
ATOM   268   O  O   . ASN A  1  41  ? 83.187  -97.455  43.997  1.00 39.91  ? 44   ASN A O   1 
ATOM   269   C  CB  . ASN A  1  41  ? 85.385  -97.438  42.387  1.00 39.52  ? 44   ASN A CB  1 
ATOM   270   C  CG  . ASN A  1  41  ? 85.875  -96.585  43.556  1.00 39.80  ? 44   ASN A CG  1 
ATOM   271   O  OD1 . ASN A  1  41  ? 85.656  -95.367  43.608  1.00 39.22  ? 44   ASN A OD1 1 
ATOM   272   N  ND2 . ASN A  1  41  ? 86.541  -97.227  44.502  1.00 40.31  ? 44   ASN A ND2 1 
ATOM   273   N  N   . GLY A  1  42  ? 81.933  -96.146  42.673  1.00 39.16  ? 45   GLY A N   1 
ATOM   274   C  CA  . GLY A  1  42  ? 80.888  -96.004  43.682  1.00 38.72  ? 45   GLY A CA  1 
ATOM   275   C  C   . GLY A  1  42  ? 79.964  -94.830  43.456  1.00 38.40  ? 45   GLY A C   1 
ATOM   276   O  O   . GLY A  1  42  ? 80.197  -94.005  42.575  1.00 38.64  ? 45   GLY A O   1 
ATOM   277   N  N   . VAL A  1  43  ? 78.898  -94.778  44.247  1.00 38.04  ? 46   VAL A N   1 
ATOM   278   C  CA  . VAL A  1  43  ? 77.942  -93.676  44.232  1.00 37.57  ? 46   VAL A CA  1 
ATOM   279   C  C   . VAL A  1  43  ? 77.542  -93.396  45.673  1.00 37.94  ? 46   VAL A C   1 
ATOM   280   O  O   . VAL A  1  43  ? 77.374  -94.313  46.475  1.00 38.00  ? 46   VAL A O   1 
ATOM   281   C  CB  . VAL A  1  43  ? 76.663  -93.992  43.391  1.00 37.45  ? 46   VAL A CB  1 
ATOM   282   C  CG1 . VAL A  1  43  ? 75.772  -92.754  43.265  1.00 36.66  ? 46   VAL A CG1 1 
ATOM   283   C  CG2 . VAL A  1  43  ? 77.015  -94.502  42.001  1.00 36.32  ? 46   VAL A CG2 1 
ATOM   284   N  N   . VAL A  1  44  ? 77.405  -92.123  46.015  1.00 38.47  ? 47   VAL A N   1 
ATOM   285   C  CA  . VAL A  1  44  ? 76.959  -91.759  47.350  1.00 38.88  ? 47   VAL A CA  1 
ATOM   286   C  C   . VAL A  1  44  ? 75.655  -90.993  47.246  1.00 38.98  ? 47   VAL A C   1 
ATOM   287   O  O   . VAL A  1  44  ? 75.518  -90.126  46.397  1.00 38.92  ? 47   VAL A O   1 
ATOM   288   C  CB  . VAL A  1  44  ? 78.049  -90.968  48.134  1.00 38.77  ? 47   VAL A CB  1 
ATOM   289   C  CG1 . VAL A  1  44  ? 78.521  -89.757  47.359  1.00 39.26  ? 47   VAL A CG1 1 
ATOM   290   C  CG2 . VAL A  1  44  ? 77.539  -90.556  49.499  1.00 39.50  ? 47   VAL A CG2 1 
ATOM   291   N  N   . ILE A  1  45  ? 74.686  -91.361  48.076  1.00 39.51  ? 48   ILE A N   1 
ATOM   292   C  CA  . ILE A  1  45  ? 73.476  -90.571  48.247  1.00 40.11  ? 48   ILE A CA  1 
ATOM   293   C  C   . ILE A  1  45  ? 73.373  -90.153  49.702  1.00 40.81  ? 48   ILE A C   1 
ATOM   294   O  O   . ILE A  1  45  ? 73.660  -90.945  50.606  1.00 40.99  ? 48   ILE A O   1 
ATOM   295   C  CB  . ILE A  1  45  ? 72.190  -91.302  47.777  1.00 40.02  ? 48   ILE A CB  1 
ATOM   296   C  CG1 . ILE A  1  45  ? 72.119  -92.733  48.314  1.00 40.46  ? 48   ILE A CG1 1 
ATOM   297   C  CG2 . ILE A  1  45  ? 72.117  -91.318  46.263  1.00 40.16  ? 48   ILE A CG2 1 
ATOM   298   C  CD1 . ILE A  1  45  ? 70.714  -93.315  48.340  1.00 40.30  ? 48   ILE A CD1 1 
ATOM   299   N  N   . ALA A  1  46  ? 72.987  -88.896  49.921  1.00 41.67  ? 49   ALA A N   1 
ATOM   300   C  CA  . ALA A  1  46  ? 72.961  -88.309  51.267  1.00 42.37  ? 49   ALA A CA  1 
ATOM   301   C  C   . ALA A  1  46  ? 71.773  -87.370  51.488  1.00 42.96  ? 49   ALA A C   1 
ATOM   302   O  O   . ALA A  1  46  ? 71.201  -86.842  50.536  1.00 42.65  ? 49   ALA A O   1 
ATOM   303   C  CB  . ALA A  1  46  ? 74.281  -87.587  51.554  1.00 41.84  ? 49   ALA A CB  1 
ATOM   304   N  N   . THR A  1  47  ? 71.408  -87.177  52.750  1.00 44.18  ? 50   THR A N   1 
ATOM   305   C  CA  . THR A  1  47  ? 70.356  -86.234  53.120  1.00 45.72  ? 50   THR A CA  1 
ATOM   306   C  C   . THR A  1  47  ? 70.405  -85.937  54.607  1.00 47.13  ? 50   THR A C   1 
ATOM   307   O  O   . THR A  1  47  ? 71.165  -86.567  55.346  1.00 47.17  ? 50   THR A O   1 
ATOM   308   C  CB  . THR A  1  47  ? 68.947  -86.757  52.764  1.00 45.51  ? 50   THR A CB  1 
ATOM   309   O  OG1 . THR A  1  47  ? 67.975  -85.744  53.053  1.00 44.77  ? 50   THR A OG1 1 
ATOM   310   C  CG2 . THR A  1  47  ? 68.618  -88.021  53.563  1.00 45.70  ? 50   THR A CG2 1 
ATOM   311   N  N   . GLU A  1  48  ? 69.571  -84.997  55.035  1.00 49.05  ? 51   GLU A N   1 
ATOM   312   C  CA  . GLU A  1  48  ? 69.482  -84.602  56.431  1.00 51.47  ? 51   GLU A CA  1 
ATOM   313   C  C   . GLU A  1  48  ? 68.250  -85.221  57.093  1.00 52.48  ? 51   GLU A C   1 
ATOM   314   O  O   . GLU A  1  48  ? 67.149  -85.162  56.548  1.00 52.64  ? 51   GLU A O   1 
ATOM   315   C  CB  . GLU A  1  48  ? 69.429  -83.073  56.521  1.00 51.72  ? 51   GLU A CB  1 
ATOM   316   C  CG  . GLU A  1  48  ? 69.220  -82.497  57.922  1.00 54.43  ? 51   GLU A CG  1 
ATOM   317   C  CD  . GLU A  1  48  ? 68.616  -81.082  57.914  1.00 58.73  ? 51   GLU A CD  1 
ATOM   318   O  OE1 . GLU A  1  48  ? 68.554  -80.447  56.825  1.00 59.63  ? 51   GLU A OE1 1 
ATOM   319   O  OE2 . GLU A  1  48  ? 68.202  -80.606  59.007  1.00 60.31  ? 51   GLU A OE2 1 
ATOM   320   N  N   . LYS A  1  49  ? 68.437  -85.818  58.263  1.00 54.06  ? 52   LYS A N   1 
ATOM   321   C  CA  . LYS A  1  49  ? 67.306  -86.240  59.080  1.00 55.79  ? 52   LYS A CA  1 
ATOM   322   C  C   . LYS A  1  49  ? 66.786  -85.035  59.858  1.00 56.99  ? 52   LYS A C   1 
ATOM   323   O  O   . LYS A  1  49  ? 67.273  -84.713  60.952  1.00 57.54  ? 52   LYS A O   1 
ATOM   324   C  CB  . LYS A  1  49  ? 67.689  -87.390  60.020  1.00 55.74  ? 52   LYS A CB  1 
ATOM   325   C  CG  . LYS A  1  49  ? 67.766  -88.757  59.338  1.00 56.52  ? 52   LYS A CG  1 
ATOM   326   C  CD  . LYS A  1  49  ? 67.812  -89.899  60.346  1.00 58.66  ? 52   LYS A CD  1 
ATOM   327   C  CE  . LYS A  1  49  ? 69.221  -90.098  60.921  1.00 59.49  ? 52   LYS A CE  1 
ATOM   328   N  NZ  . LYS A  1  49  ? 69.265  -91.068  62.062  1.00 59.90  ? 52   LYS A NZ  1 
ATOM   329   N  N   . LYS A  1  50  ? 65.825  -84.338  59.264  1.00 58.15  ? 53   LYS A N   1 
ATOM   330   C  CA  . LYS A  1  50  ? 65.153  -83.246  59.937  1.00 59.36  ? 53   LYS A CA  1 
ATOM   331   C  C   . LYS A  1  50  ? 64.066  -83.860  60.814  1.00 59.91  ? 53   LYS A C   1 
ATOM   332   O  O   . LYS A  1  50  ? 62.949  -84.100  60.351  1.00 60.28  ? 53   LYS A O   1 
ATOM   333   C  CB  . LYS A  1  50  ? 64.566  -82.285  58.898  1.00 59.61  ? 53   LYS A CB  1 
ATOM   334   C  CG  . LYS A  1  50  ? 63.672  -81.163  59.436  1.00 61.14  ? 53   LYS A CG  1 
ATOM   335   C  CD  . LYS A  1  50  ? 64.470  -79.951  59.898  1.00 63.68  ? 53   LYS A CD  1 
ATOM   336   C  CE  . LYS A  1  50  ? 63.547  -78.739  60.067  1.00 66.00  ? 53   LYS A CE  1 
ATOM   337   N  NZ  . LYS A  1  50  ? 64.308  -77.453  60.200  1.00 67.43  ? 53   LYS A NZ  1 
ATOM   338   N  N   . SER A  1  51  ? 64.407  -84.130  62.073  1.00 60.64  ? 54   SER A N   1 
ATOM   339   C  CA  . SER A  1  51  ? 63.484  -84.756  63.032  1.00 61.33  ? 54   SER A CA  1 
ATOM   340   C  C   . SER A  1  51  ? 62.426  -83.770  63.537  1.00 61.63  ? 54   SER A C   1 
ATOM   341   O  O   . SER A  1  51  ? 62.716  -82.593  63.743  1.00 61.73  ? 54   SER A O   1 
ATOM   342   C  CB  . SER A  1  51  ? 64.264  -85.368  64.205  1.00 61.51  ? 54   SER A CB  1 
ATOM   343   O  OG  . SER A  1  51  ? 63.411  -86.056  65.108  1.00 62.08  ? 54   SER A OG  1 
ATOM   344   N  N   . SER A  1  52  ? 61.209  -84.268  63.742  1.00 62.17  ? 55   SER A N   1 
ATOM   345   C  CA  . SER A  1  52  ? 60.045  -83.438  64.089  1.00 62.76  ? 55   SER A CA  1 
ATOM   346   C  C   . SER A  1  52  ? 59.853  -83.216  65.586  1.00 62.85  ? 55   SER A C   1 
ATOM   347   O  O   . SER A  1  52  ? 59.137  -82.302  65.994  1.00 62.80  ? 55   SER A O   1 
ATOM   348   C  CB  . SER A  1  52  ? 58.771  -84.061  63.519  1.00 62.95  ? 55   SER A CB  1 
ATOM   349   O  OG  . SER A  1  52  ? 58.783  -84.002  62.107  1.00 63.88  ? 55   SER A OG  1 
ATOM   350   N  N   . SER A  1  53  ? 60.458  -84.083  66.390  1.00 63.04  ? 56   SER A N   1 
ATOM   351   C  CA  . SER A  1  53  ? 60.491  -83.921  67.839  1.00 63.28  ? 56   SER A CA  1 
ATOM   352   C  C   . SER A  1  53  ? 61.809  -84.499  68.396  1.00 63.30  ? 56   SER A C   1 
ATOM   353   O  O   . SER A  1  53  ? 62.344  -85.476  67.852  1.00 63.45  ? 56   SER A O   1 
ATOM   354   C  CB  . SER A  1  53  ? 59.266  -84.587  68.478  1.00 63.21  ? 56   SER A CB  1 
ATOM   355   O  OG  . SER A  1  53  ? 59.304  -84.490  69.894  1.00 63.77  ? 56   SER A OG  1 
ATOM   356   N  N   . PRO A  1  54  ? 62.368  -83.879  69.455  1.00 63.21  ? 57   PRO A N   1 
ATOM   357   C  CA  . PRO A  1  54  ? 63.520  -84.557  70.075  1.00 62.83  ? 57   PRO A CA  1 
ATOM   358   C  C   . PRO A  1  54  ? 63.073  -85.766  70.902  1.00 62.40  ? 57   PRO A C   1 
ATOM   359   O  O   . PRO A  1  54  ? 63.916  -86.519  71.402  1.00 62.07  ? 57   PRO A O   1 
ATOM   360   C  CB  . PRO A  1  54  ? 64.155  -83.476  70.962  1.00 63.01  ? 57   PRO A CB  1 
ATOM   361   C  CG  . PRO A  1  54  ? 63.086  -82.450  71.170  1.00 63.32  ? 57   PRO A CG  1 
ATOM   362   C  CD  . PRO A  1  54  ? 62.148  -82.519  69.989  1.00 63.33  ? 57   PRO A CD  1 
ATOM   363   N  N   . LEU A  1  55  ? 61.754  -85.942  71.034  1.00 61.85  ? 58   LEU A N   1 
ATOM   364   C  CA  . LEU A  1  55  ? 61.179  -87.129  71.674  1.00 61.38  ? 58   LEU A CA  1 
ATOM   365   C  C   . LEU A  1  55  ? 61.038  -88.304  70.702  1.00 61.31  ? 58   LEU A C   1 
ATOM   366   O  O   . LEU A  1  55  ? 60.828  -89.449  71.111  1.00 61.05  ? 58   LEU A O   1 
ATOM   367   C  CB  . LEU A  1  55  ? 59.834  -86.805  72.319  1.00 61.01  ? 58   LEU A CB  1 
ATOM   368   C  CG  . LEU A  1  55  ? 59.891  -86.165  73.704  1.00 60.30  ? 58   LEU A CG  1 
ATOM   369   C  CD1 . LEU A  1  55  ? 58.489  -85.907  74.174  1.00 59.74  ? 58   LEU A CD1 1 
ATOM   370   C  CD2 . LEU A  1  55  ? 60.623  -87.042  74.703  1.00 59.28  ? 58   LEU A CD2 1 
ATOM   371   N  N   . ALA A  1  56  ? 61.160  -88.002  69.415  1.00 61.20  ? 59   ALA A N   1 
ATOM   372   C  CA  . ALA A  1  56  ? 61.128  -89.004  68.374  1.00 61.31  ? 59   ALA A CA  1 
ATOM   373   C  C   . ALA A  1  56  ? 62.493  -89.657  68.283  1.00 61.48  ? 59   ALA A C   1 
ATOM   374   O  O   . ALA A  1  56  ? 63.492  -89.039  68.636  1.00 61.46  ? 59   ALA A O   1 
ATOM   375   C  CB  . ALA A  1  56  ? 60.754  -88.366  67.052  1.00 61.15  ? 59   ALA A CB  1 
ATOM   376   N  N   . MET A  1  57  ? 62.528  -90.902  67.813  1.00 61.85  ? 60   MET A N   1 
ATOM   377   C  CA  . MET A  1  57  ? 63.777  -91.640  67.641  1.00 62.47  ? 60   MET A CA  1 
ATOM   378   C  C   . MET A  1  57  ? 64.125  -91.726  66.160  1.00 62.49  ? 60   MET A C   1 
ATOM   379   O  O   . MET A  1  57  ? 63.522  -92.489  65.408  1.00 62.58  ? 60   MET A O   1 
ATOM   380   C  CB  . MET A  1  57  ? 63.663  -93.019  68.281  1.00 62.59  ? 60   MET A CB  1 
ATOM   381   C  CG  . MET A  1  57  ? 63.125  -92.943  69.694  1.00 64.46  ? 60   MET A CG  1 
ATOM   382   S  SD  . MET A  1  57  ? 62.901  -94.527  70.500  1.00 69.06  ? 60   MET A SD  1 
ATOM   383   C  CE  . MET A  1  57  ? 61.553  -95.249  69.542  1.00 69.51  ? 60   MET A CE  1 
ATOM   384   N  N   . SER A  1  58  ? 65.104  -90.925  65.748  1.00 62.68  ? 61   SER A N   1 
ATOM   385   C  CA  . SER A  1  58  ? 65.307  -90.622  64.330  1.00 62.86  ? 61   SER A CA  1 
ATOM   386   C  C   . SER A  1  58  ? 65.765  -91.815  63.479  1.00 62.78  ? 61   SER A C   1 
ATOM   387   O  O   . SER A  1  58  ? 65.702  -91.756  62.243  1.00 62.98  ? 61   SER A O   1 
ATOM   388   C  CB  . SER A  1  58  ? 66.243  -89.412  64.158  1.00 62.87  ? 61   SER A CB  1 
ATOM   389   O  OG  . SER A  1  58  ? 67.513  -89.645  64.754  1.00 63.51  ? 61   SER A OG  1 
ATOM   390   N  N   . GLU A  1  59  ? 66.211  -92.890  64.126  1.00 62.46  ? 62   GLU A N   1 
ATOM   391   C  CA  . GLU A  1  59  ? 66.638  -94.085  63.386  1.00 62.39  ? 62   GLU A CA  1 
ATOM   392   C  C   . GLU A  1  59  ? 65.436  -94.913  62.916  1.00 61.70  ? 62   GLU A C   1 
ATOM   393   O  O   . GLU A  1  59  ? 65.538  -95.644  61.925  1.00 61.91  ? 62   GLU A O   1 
ATOM   394   C  CB  . GLU A  1  59  ? 67.615  -94.953  64.187  1.00 62.72  ? 62   GLU A CB  1 
ATOM   395   C  CG  . GLU A  1  59  ? 68.240  -94.270  65.392  1.00 64.55  ? 62   GLU A CG  1 
ATOM   396   C  CD  . GLU A  1  59  ? 67.294  -94.252  66.594  1.00 67.07  ? 62   GLU A CD  1 
ATOM   397   O  OE1 . GLU A  1  59  ? 66.679  -95.310  66.892  1.00 67.44  ? 62   GLU A OE1 1 
ATOM   398   O  OE2 . GLU A  1  59  ? 67.163  -93.179  67.233  1.00 67.52  ? 62   GLU A OE2 1 
ATOM   399   N  N   . THR A  1  60  ? 64.299  -94.777  63.604  1.00 60.57  ? 63   THR A N   1 
ATOM   400   C  CA  . THR A  1  60  ? 63.054  -95.435  63.181  1.00 59.44  ? 63   THR A CA  1 
ATOM   401   C  C   . THR A  1  60  ? 62.458  -94.829  61.906  1.00 59.01  ? 63   THR A C   1 
ATOM   402   O  O   . THR A  1  60  ? 61.432  -95.284  61.426  1.00 59.03  ? 63   THR A O   1 
ATOM   403   C  CB  . THR A  1  60  ? 61.969  -95.429  64.292  1.00 59.54  ? 63   THR A CB  1 
ATOM   404   O  OG1 . THR A  1  60  ? 61.546  -94.084  64.557  1.00 58.61  ? 63   THR A OG1 1 
ATOM   405   C  CG2 . THR A  1  60  ? 62.481  -96.098  65.581  1.00 58.64  ? 63   THR A CG2 1 
ATOM   406   N  N   . LEU A  1  61  ? 63.090  -93.789  61.375  1.00 58.41  ? 64   LEU A N   1 
ATOM   407   C  CA  . LEU A  1  61  ? 62.688  -93.210  60.103  1.00 57.79  ? 64   LEU A CA  1 
ATOM   408   C  C   . LEU A  1  61  ? 63.900  -93.074  59.200  1.00 57.29  ? 64   LEU A C   1 
ATOM   409   O  O   . LEU A  1  61  ? 64.700  -92.138  59.364  1.00 57.59  ? 64   LEU A O   1 
ATOM   410   C  CB  . LEU A  1  61  ? 62.054  -91.828  60.298  1.00 57.93  ? 64   LEU A CB  1 
ATOM   411   C  CG  . LEU A  1  61  ? 60.606  -91.519  59.879  1.00 58.37  ? 64   LEU A CG  1 
ATOM   412   C  CD1 . LEU A  1  61  ? 60.325  -90.029  60.107  1.00 57.99  ? 64   LEU A CD1 1 
ATOM   413   C  CD2 . LEU A  1  61  ? 60.280  -91.902  58.419  1.00 57.82  ? 64   LEU A CD2 1 
ATOM   414   N  N   . SER A  1  62  ? 64.038  -94.006  58.258  1.00 56.08  ? 65   SER A N   1 
ATOM   415   C  CA  . SER A  1  62  ? 65.073  -93.898  57.237  1.00 55.03  ? 65   SER A CA  1 
ATOM   416   C  C   . SER A  1  62  ? 64.562  -93.184  56.006  1.00 53.76  ? 65   SER A C   1 
ATOM   417   O  O   . SER A  1  62  ? 63.508  -93.522  55.476  1.00 53.82  ? 65   SER A O   1 
ATOM   418   C  CB  . SER A  1  62  ? 65.616  -95.266  56.848  1.00 55.29  ? 65   SER A CB  1 
ATOM   419   O  OG  . SER A  1  62  ? 66.640  -95.643  57.745  1.00 56.73  ? 65   SER A OG  1 
ATOM   420   N  N   . LYS A  1  63  ? 65.319  -92.190  55.568  1.00 52.26  ? 66   LYS A N   1 
ATOM   421   C  CA  . LYS A  1  63  ? 65.037  -91.491  54.326  1.00 50.91  ? 66   LYS A CA  1 
ATOM   422   C  C   . LYS A  1  63  ? 65.846  -92.135  53.207  1.00 49.68  ? 66   LYS A C   1 
ATOM   423   O  O   . LYS A  1  63  ? 65.596  -91.886  52.025  1.00 49.54  ? 66   LYS A O   1 
ATOM   424   C  CB  . LYS A  1  63  ? 65.369  -89.995  54.448  1.00 51.32  ? 66   LYS A CB  1 
ATOM   425   C  CG  . LYS A  1  63  ? 64.485  -89.226  55.445  1.00 51.70  ? 66   LYS A CG  1 
ATOM   426   C  CD  . LYS A  1  63  ? 64.927  -87.785  55.609  1.00 52.52  ? 66   LYS A CD  1 
ATOM   427   C  CE  . LYS A  1  63  ? 64.831  -87.017  54.297  1.00 53.55  ? 66   LYS A CE  1 
ATOM   428   N  NZ  . LYS A  1  63  ? 65.262  -85.594  54.417  1.00 54.03  ? 66   LYS A NZ  1 
ATOM   429   N  N   . VAL A  1  64  ? 66.815  -92.964  53.585  1.00 47.78  ? 67   VAL A N   1 
ATOM   430   C  CA  . VAL A  1  64  ? 67.575  -93.713  52.605  1.00 46.43  ? 67   VAL A CA  1 
ATOM   431   C  C   . VAL A  1  64  ? 67.152  -95.174  52.620  1.00 45.20  ? 67   VAL A C   1 
ATOM   432   O  O   . VAL A  1  64  ? 67.153  -95.814  53.671  1.00 45.40  ? 67   VAL A O   1 
ATOM   433   C  CB  . VAL A  1  64  ? 69.078  -93.590  52.827  1.00 46.42  ? 67   VAL A CB  1 
ATOM   434   C  CG1 . VAL A  1  64  ? 69.800  -94.348  51.755  1.00 47.25  ? 67   VAL A CG1 1 
ATOM   435   C  CG2 . VAL A  1  64  ? 69.490  -92.145  52.761  1.00 46.79  ? 67   VAL A CG2 1 
ATOM   436   N  N   . SER A  1  65  ? 66.795  -95.694  51.447  1.00 43.52  ? 68   SER A N   1 
ATOM   437   C  CA  . SER A  1  65  ? 66.202  -97.028  51.340  1.00 41.80  ? 68   SER A CA  1 
ATOM   438   C  C   . SER A  1  65  ? 66.870  -97.934  50.308  1.00 40.62  ? 68   SER A C   1 
ATOM   439   O  O   . SER A  1  65  ? 67.244  -97.486  49.215  1.00 40.03  ? 68   SER A O   1 
ATOM   440   C  CB  . SER A  1  65  ? 64.715  -96.914  51.042  1.00 41.53  ? 68   SER A CB  1 
ATOM   441   O  OG  . SER A  1  65  ? 64.075  -96.227  52.099  1.00 42.64  ? 68   SER A OG  1 
ATOM   442   N  N   . LEU A  1  66  ? 67.024  -99.204  50.679  1.00 39.19  ? 69   LEU A N   1 
ATOM   443   C  CA  . LEU A  1  66  ? 67.441  -100.245 49.747  1.00 38.13  ? 69   LEU A CA  1 
ATOM   444   C  C   . LEU A  1  66  ? 66.246  -100.612 48.862  1.00 37.38  ? 69   LEU A C   1 
ATOM   445   O  O   . LEU A  1  66  ? 65.127  -100.820 49.357  1.00 36.75  ? 69   LEU A O   1 
ATOM   446   C  CB  . LEU A  1  66  ? 67.963  -101.478 50.516  1.00 38.38  ? 69   LEU A CB  1 
ATOM   447   C  CG  . LEU A  1  66  ? 68.666  -102.623 49.760  1.00 38.16  ? 69   LEU A CG  1 
ATOM   448   C  CD1 . LEU A  1  66  ? 69.669  -103.358 50.641  1.00 35.99  ? 69   LEU A CD1 1 
ATOM   449   C  CD2 . LEU A  1  66  ? 67.663  -103.599 49.162  1.00 38.45  ? 69   LEU A CD2 1 
ATOM   450   N  N   . LEU A  1  67  ? 66.476  -100.662 47.556  1.00 36.66  ? 70   LEU A N   1 
ATOM   451   C  CA  . LEU A  1  67  ? 65.420  -101.050 46.622  1.00 36.38  ? 70   LEU A CA  1 
ATOM   452   C  C   . LEU A  1  67  ? 65.705  -102.445 46.092  1.00 36.63  ? 70   LEU A C   1 
ATOM   453   O  O   . LEU A  1  67  ? 64.793  -103.247 45.935  1.00 37.46  ? 70   LEU A O   1 
ATOM   454   C  CB  . LEU A  1  67  ? 65.262  -100.041 45.474  1.00 35.70  ? 70   LEU A CB  1 
ATOM   455   C  CG  . LEU A  1  67  ? 64.902  -98.595  45.845  1.00 34.45  ? 70   LEU A CG  1 
ATOM   456   C  CD1 . LEU A  1  67  ? 64.501  -97.786  44.619  1.00 31.19  ? 70   LEU A CD1 1 
ATOM   457   C  CD2 . LEU A  1  67  ? 63.808  -98.540  46.912  1.00 33.70  ? 70   LEU A CD2 1 
ATOM   458   N  N   . THR A  1  68  ? 66.976  -102.702 45.799  1.00 36.35  ? 71   THR A N   1 
ATOM   459   C  CA  . THR A  1  68  ? 67.491  -104.014 45.475  1.00 36.01  ? 71   THR A CA  1 
ATOM   460   C  C   . THR A  1  68  ? 68.887  -104.056 46.099  1.00 36.04  ? 71   THR A C   1 
ATOM   461   O  O   . THR A  1  68  ? 69.410  -103.017 46.497  1.00 36.34  ? 71   THR A O   1 
ATOM   462   C  CB  . THR A  1  68  ? 67.599  -104.244 43.962  1.00 35.93  ? 71   THR A CB  1 
ATOM   463   O  OG1 . THR A  1  68  ? 68.760  -103.584 43.450  1.00 37.50  ? 71   THR A OG1 1 
ATOM   464   C  CG2 . THR A  1  68  ? 66.377  -103.762 43.232  1.00 34.89  ? 71   THR A CG2 1 
ATOM   465   N  N   . PRO A  1  69  ? 69.501  -105.248 46.210  1.00 36.01  ? 72   PRO A N   1 
ATOM   466   C  CA  . PRO A  1  69  ? 70.850  -105.274 46.812  1.00 35.61  ? 72   PRO A CA  1 
ATOM   467   C  C   . PRO A  1  69  ? 71.864  -104.290 46.206  1.00 35.22  ? 72   PRO A C   1 
ATOM   468   O  O   . PRO A  1  69  ? 72.852  -103.956 46.858  1.00 35.29  ? 72   PRO A O   1 
ATOM   469   C  CB  . PRO A  1  69  ? 71.324  -106.716 46.578  1.00 35.31  ? 72   PRO A CB  1 
ATOM   470   C  CG  . PRO A  1  69  ? 70.071  -107.517 46.389  1.00 35.87  ? 72   PRO A CG  1 
ATOM   471   C  CD  . PRO A  1  69  ? 68.911  -106.596 46.092  1.00 35.70  ? 72   PRO A CD  1 
ATOM   472   N  N   . ASP A  1  70  ? 71.631  -103.842 44.978  1.00 35.03  ? 73   ASP A N   1 
ATOM   473   C  CA  . ASP A  1  70  ? 72.572  -102.941 44.299  1.00 35.13  ? 73   ASP A CA  1 
ATOM   474   C  C   . ASP A  1  70  ? 71.951  -101.573 43.984  1.00 34.65  ? 73   ASP A C   1 
ATOM   475   O  O   . ASP A  1  70  ? 72.536  -100.792 43.249  1.00 34.52  ? 73   ASP A O   1 
ATOM   476   C  CB  . ASP A  1  70  ? 73.077  -103.566 42.985  1.00 35.42  ? 73   ASP A CB  1 
ATOM   477   C  CG  . ASP A  1  70  ? 73.787  -104.906 43.179  1.00 36.75  ? 73   ASP A CG  1 
ATOM   478   O  OD1 . ASP A  1  70  ? 74.290  -105.184 44.299  1.00 37.58  ? 73   ASP A OD1 1 
ATOM   479   O  OD2 . ASP A  1  70  ? 73.855  -105.675 42.182  1.00 38.24  ? 73   ASP A OD2 1 
ATOM   480   N  N   . ILE A  1  71  ? 70.767  -101.290 44.523  1.00 34.02  ? 74   ILE A N   1 
ATOM   481   C  CA  . ILE A  1  71  ? 70.094  -100.024 44.253  1.00 33.44  ? 74   ILE A CA  1 
ATOM   482   C  C   . ILE A  1  71  ? 69.498  -99.400  45.516  1.00 33.45  ? 74   ILE A C   1 
ATOM   483   O  O   . ILE A  1  71  ? 68.738  -100.043 46.246  1.00 33.69  ? 74   ILE A O   1 
ATOM   484   C  CB  . ILE A  1  71  ? 68.974  -100.182 43.215  1.00 33.22  ? 74   ILE A CB  1 
ATOM   485   C  CG1 . ILE A  1  71  ? 69.533  -100.695 41.886  1.00 33.01  ? 74   ILE A CG1 1 
ATOM   486   C  CG2 . ILE A  1  71  ? 68.227  -98.870  43.026  1.00 32.18  ? 74   ILE A CG2 1 
ATOM   487   C  CD1 . ILE A  1  71  ? 68.451  -101.067 40.891  1.00 31.44  ? 74   ILE A CD1 1 
ATOM   488   N  N   . GLY A  1  72  ? 69.831  -98.137  45.752  1.00 32.77  ? 75   GLY A N   1 
ATOM   489   C  CA  . GLY A  1  72  ? 69.241  -97.388  46.844  1.00 32.02  ? 75   GLY A CA  1 
ATOM   490   C  C   . GLY A  1  72  ? 68.595  -96.107  46.363  1.00 31.57  ? 75   GLY A C   1 
ATOM   491   O  O   . GLY A  1  72  ? 68.877  -95.643  45.247  1.00 31.07  ? 75   GLY A O   1 
ATOM   492   N  N   . ALA A  1  73  ? 67.730  -95.548  47.213  1.00 31.01  ? 76   ALA A N   1 
ATOM   493   C  CA  . ALA A  1  73  ? 67.028  -94.305  46.928  1.00 31.11  ? 76   ALA A CA  1 
ATOM   494   C  C   . ALA A  1  73  ? 66.938  -93.345  48.122  1.00 31.43  ? 76   ALA A C   1 
ATOM   495   O  O   . ALA A  1  73  ? 66.969  -93.743  49.297  1.00 31.53  ? 76   ALA A O   1 
ATOM   496   C  CB  . ALA A  1  73  ? 65.633  -94.578  46.359  1.00 30.70  ? 76   ALA A CB  1 
ATOM   497   N  N   . VAL A  1  74  ? 66.832  -92.067  47.778  1.00 31.50  ? 77   VAL A N   1 
ATOM   498   C  CA  . VAL A  1  74  ? 66.624  -90.994  48.720  1.00 31.38  ? 77   VAL A CA  1 
ATOM   499   C  C   . VAL A  1  74  ? 65.667  -90.022  48.037  1.00 31.87  ? 77   VAL A C   1 
ATOM   500   O  O   . VAL A  1  74  ? 65.447  -90.112  46.821  1.00 32.10  ? 77   VAL A O   1 
ATOM   501   C  CB  . VAL A  1  74  ? 67.963  -90.336  49.092  1.00 31.22  ? 77   VAL A CB  1 
ATOM   502   C  CG1 . VAL A  1  74  ? 68.449  -89.375  48.001  1.00 29.89  ? 77   VAL A CG1 1 
ATOM   503   C  CG2 . VAL A  1  74  ? 67.846  -89.659  50.418  1.00 31.86  ? 77   VAL A CG2 1 
ATOM   504   N  N   . TYR A  1  75  ? 65.084  -89.105  48.800  1.00 32.24  ? 78   TYR A N   1 
ATOM   505   C  CA  . TYR A  1  75  ? 64.073  -88.205  48.242  1.00 32.49  ? 78   TYR A CA  1 
ATOM   506   C  C   . TYR A  1  75  ? 64.122  -86.800  48.851  1.00 32.74  ? 78   TYR A C   1 
ATOM   507   O  O   . TYR A  1  75  ? 64.870  -86.532  49.791  1.00 32.83  ? 78   TYR A O   1 
ATOM   508   C  CB  . TYR A  1  75  ? 62.684  -88.789  48.493  1.00 32.30  ? 78   TYR A CB  1 
ATOM   509   C  CG  . TYR A  1  75  ? 62.208  -88.514  49.898  1.00 32.00  ? 78   TYR A CG  1 
ATOM   510   C  CD1 . TYR A  1  75  ? 62.742  -89.199  50.980  1.00 30.85  ? 78   TYR A CD1 1 
ATOM   511   C  CD2 . TYR A  1  75  ? 61.259  -87.531  50.144  1.00 32.84  ? 78   TYR A CD2 1 
ATOM   512   C  CE1 . TYR A  1  75  ? 62.335  -88.925  52.277  1.00 31.54  ? 78   TYR A CE1 1 
ATOM   513   C  CE2 . TYR A  1  75  ? 60.834  -87.256  51.434  1.00 33.26  ? 78   TYR A CE2 1 
ATOM   514   C  CZ  . TYR A  1  75  ? 61.380  -87.952  52.498  1.00 32.11  ? 78   TYR A CZ  1 
ATOM   515   O  OH  . TYR A  1  75  ? 60.952  -87.668  53.773  1.00 32.10  ? 78   TYR A OH  1 
ATOM   516   N  N   . SER A  1  76  ? 63.303  -85.917  48.293  1.00 33.25  ? 79   SER A N   1 
ATOM   517   C  CA  . SER A  1  76  ? 62.967  -84.635  48.892  1.00 33.56  ? 79   SER A CA  1 
ATOM   518   C  C   . SER A  1  76  ? 61.525  -84.385  48.566  1.00 33.62  ? 79   SER A C   1 
ATOM   519   O  O   . SER A  1  76  ? 61.110  -84.569  47.417  1.00 33.69  ? 79   SER A O   1 
ATOM   520   C  CB  . SER A  1  76  ? 63.821  -83.513  48.317  1.00 33.47  ? 79   SER A CB  1 
ATOM   521   O  OG  . SER A  1  76  ? 65.092  -83.497  48.939  1.00 34.47  ? 79   SER A OG  1 
ATOM   522   N  N   . GLY A  1  77  ? 60.764  -83.980  49.578  1.00 33.81  ? 80   GLY A N   1 
ATOM   523   C  CA  . GLY A  1  77  ? 59.355  -83.667  49.411  1.00 34.18  ? 80   GLY A CA  1 
ATOM   524   C  C   . GLY A  1  77  ? 58.556  -84.334  50.503  1.00 34.99  ? 80   GLY A C   1 
ATOM   525   O  O   . GLY A  1  77  ? 58.990  -84.413  51.649  1.00 35.23  ? 80   GLY A O   1 
ATOM   526   N  N   . MET A  1  78  ? 57.385  -84.836  50.144  1.00 35.62  ? 81   MET A N   1 
ATOM   527   C  CA  . MET A  1  78  ? 56.520  -85.486  51.112  1.00 36.33  ? 81   MET A CA  1 
ATOM   528   C  C   . MET A  1  78  ? 56.955  -86.924  51.423  1.00 36.15  ? 81   MET A C   1 
ATOM   529   O  O   . MET A  1  78  ? 56.778  -87.829  50.611  1.00 36.22  ? 81   MET A O   1 
ATOM   530   C  CB  . MET A  1  78  ? 55.085  -85.442  50.604  1.00 36.77  ? 81   MET A CB  1 
ATOM   531   C  CG  . MET A  1  78  ? 54.601  -84.022  50.345  1.00 38.36  ? 81   MET A CG  1 
ATOM   532   S  SD  . MET A  1  78  ? 53.158  -83.994  49.269  1.00 43.38  ? 81   MET A SD  1 
ATOM   533   C  CE  . MET A  1  78  ? 51.911  -84.706  50.340  1.00 41.21  ? 81   MET A CE  1 
ATOM   534   N  N   . GLY A  1  79  ? 57.530  -87.120  52.608  1.00 35.90  ? 82   GLY A N   1 
ATOM   535   C  CA  . GLY A  1  79  ? 57.920  -88.448  53.096  1.00 35.24  ? 82   GLY A CA  1 
ATOM   536   C  C   . GLY A  1  79  ? 56.956  -89.620  52.886  1.00 35.04  ? 82   GLY A C   1 
ATOM   537   O  O   . GLY A  1  79  ? 57.364  -90.666  52.380  1.00 35.27  ? 82   GLY A O   1 
ATOM   538   N  N   . PRO A  1  80  ? 55.672  -89.471  53.278  1.00 34.54  ? 83   PRO A N   1 
ATOM   539   C  CA  . PRO A  1  80  ? 54.756  -90.610  53.112  1.00 33.82  ? 83   PRO A CA  1 
ATOM   540   C  C   . PRO A  1  80  ? 54.606  -91.051  51.659  1.00 33.41  ? 83   PRO A C   1 
ATOM   541   O  O   . PRO A  1  80  ? 54.468  -92.246  51.396  1.00 33.58  ? 83   PRO A O   1 
ATOM   542   C  CB  . PRO A  1  80  ? 53.427  -90.080  53.647  1.00 33.85  ? 83   PRO A CB  1 
ATOM   543   C  CG  . PRO A  1  80  ? 53.808  -88.951  54.556  1.00 34.03  ? 83   PRO A CG  1 
ATOM   544   C  CD  . PRO A  1  80  ? 55.017  -88.328  53.940  1.00 34.03  ? 83   PRO A CD  1 
ATOM   545   N  N   . ASP A  1  81  ? 54.646  -90.100  50.727  1.00 32.96  ? 84   ASP A N   1 
ATOM   546   C  CA  . ASP A  1  81  ? 54.572  -90.412  49.290  1.00 32.60  ? 84   ASP A CA  1 
ATOM   547   C  C   . ASP A  1  81  ? 55.785  -91.223  48.875  1.00 32.27  ? 84   ASP A C   1 
ATOM   548   O  O   . ASP A  1  81  ? 55.680  -92.137  48.053  1.00 32.34  ? 84   ASP A O   1 
ATOM   549   C  CB  . ASP A  1  81  ? 54.483  -89.140  48.429  1.00 32.43  ? 84   ASP A CB  1 
ATOM   550   C  CG  . ASP A  1  81  ? 53.067  -88.584  48.329  1.00 33.54  ? 84   ASP A CG  1 
ATOM   551   O  OD1 . ASP A  1  81  ? 52.810  -87.805  47.388  1.00 34.71  ? 84   ASP A OD1 1 
ATOM   552   O  OD2 . ASP A  1  81  ? 52.207  -88.905  49.183  1.00 35.19  ? 84   ASP A OD2 1 
ATOM   553   N  N   . TYR A  1  82  ? 56.931  -90.881  49.456  1.00 31.97  ? 85   TYR A N   1 
ATOM   554   C  CA  . TYR A  1  82  ? 58.168  -91.618  49.251  1.00 32.02  ? 85   TYR A CA  1 
ATOM   555   C  C   . TYR A  1  82  ? 58.073  -93.046  49.762  1.00 32.29  ? 85   TYR A C   1 
ATOM   556   O  O   . TYR A  1  82  ? 58.438  -93.989  49.057  1.00 32.31  ? 85   TYR A O   1 
ATOM   557   C  CB  . TYR A  1  82  ? 59.301  -90.905  49.965  1.00 31.78  ? 85   TYR A CB  1 
ATOM   558   C  CG  . TYR A  1  82  ? 60.599  -91.666  50.047  1.00 31.21  ? 85   TYR A CG  1 
ATOM   559   C  CD1 . TYR A  1  82  ? 61.406  -91.831  48.911  1.00 31.30  ? 85   TYR A CD1 1 
ATOM   560   C  CD2 . TYR A  1  82  ? 61.035  -92.199  51.259  1.00 28.94  ? 85   TYR A CD2 1 
ATOM   561   C  CE1 . TYR A  1  82  ? 62.621  -92.503  48.987  1.00 30.65  ? 85   TYR A CE1 1 
ATOM   562   C  CE2 . TYR A  1  82  ? 62.243  -92.881  51.347  1.00 29.54  ? 85   TYR A CE2 1 
ATOM   563   C  CZ  . TYR A  1  82  ? 63.035  -93.029  50.208  1.00 31.16  ? 85   TYR A CZ  1 
ATOM   564   O  OH  . TYR A  1  82  ? 64.241  -93.706  50.280  1.00 31.79  ? 85   TYR A OH  1 
ATOM   565   N  N   . ARG A  1  83  ? 57.582  -93.193  50.988  1.00 32.79  ? 86   ARG A N   1 
ATOM   566   C  CA  . ARG A  1  83  ? 57.415  -94.500  51.629  1.00 33.28  ? 86   ARG A CA  1 
ATOM   567   C  C   . ARG A  1  83  ? 56.635  -95.489  50.758  1.00 33.95  ? 86   ARG A C   1 
ATOM   568   O  O   . ARG A  1  83  ? 57.080  -96.627  50.570  1.00 34.02  ? 86   ARG A O   1 
ATOM   569   C  CB  . ARG A  1  83  ? 56.729  -94.348  52.984  1.00 32.74  ? 86   ARG A CB  1 
ATOM   570   C  CG  . ARG A  1  83  ? 56.947  -95.516  53.898  1.00 32.45  ? 86   ARG A CG  1 
ATOM   571   C  CD  . ARG A  1  83  ? 56.271  -95.299  55.239  1.00 33.54  ? 86   ARG A CD  1 
ATOM   572   N  NE  . ARG A  1  83  ? 54.843  -95.006  55.100  1.00 33.04  ? 86   ARG A NE  1 
ATOM   573   C  CZ  . ARG A  1  83  ? 54.246  -93.897  55.527  1.00 32.89  ? 86   ARG A CZ  1 
ATOM   574   N  NH1 . ARG A  1  83  ? 54.950  -92.957  56.156  1.00 31.52  ? 86   ARG A NH1 1 
ATOM   575   N  NH2 . ARG A  1  83  ? 52.934  -93.745  55.342  1.00 32.54  ? 86   ARG A NH2 1 
ATOM   576   N  N   . VAL A  1  84  ? 55.494  -95.059  50.213  1.00 34.38  ? 87   VAL A N   1 
ATOM   577   C  CA  . VAL A  1  84  ? 54.707  -95.977  49.395  1.00 34.99  ? 87   VAL A CA  1 
ATOM   578   C  C   . VAL A  1  84  ? 55.392  -96.238  48.055  1.00 35.22  ? 87   VAL A C   1 
ATOM   579   O  O   . VAL A  1  84  ? 55.339  -97.355  47.549  1.00 35.99  ? 87   VAL A O   1 
ATOM   580   C  CB  . VAL A  1  84  ? 53.210  -95.578  49.211  1.00 34.75  ? 87   VAL A CB  1 
ATOM   581   C  CG1 . VAL A  1  84  ? 52.606  -95.058  50.516  1.00 34.49  ? 87   VAL A CG1 1 
ATOM   582   C  CG2 . VAL A  1  84  ? 53.038  -94.568  48.080  1.00 35.82  ? 87   VAL A CG2 1 
ATOM   583   N  N   . LEU A  1  85  ? 56.035  -95.224  47.490  1.00 34.99  ? 88   LEU A N   1 
ATOM   584   C  CA  . LEU A  1  85  ? 56.782  -95.417  46.260  1.00 35.35  ? 88   LEU A CA  1 
ATOM   585   C  C   . LEU A  1  85  ? 57.897  -96.454  46.427  1.00 35.39  ? 88   LEU A C   1 
ATOM   586   O  O   . LEU A  1  85  ? 58.199  -97.196  45.501  1.00 35.56  ? 88   LEU A O   1 
ATOM   587   C  CB  . LEU A  1  85  ? 57.391  -94.104  45.790  1.00 35.30  ? 88   LEU A CB  1 
ATOM   588   C  CG  . LEU A  1  85  ? 56.528  -93.282  44.844  1.00 36.25  ? 88   LEU A CG  1 
ATOM   589   C  CD1 . LEU A  1  85  ? 57.175  -91.915  44.652  1.00 37.35  ? 88   LEU A CD1 1 
ATOM   590   C  CD2 . LEU A  1  85  ? 56.346  -93.990  43.516  1.00 34.77  ? 88   LEU A CD2 1 
ATOM   591   N  N   . VAL A  1  86  ? 58.508  -96.492  47.604  1.00 35.15  ? 89   VAL A N   1 
ATOM   592   C  CA  . VAL A  1  86  ? 59.552  -97.464  47.892  1.00 35.07  ? 89   VAL A CA  1 
ATOM   593   C  C   . VAL A  1  86  ? 58.970  -98.893  47.895  1.00 35.07  ? 89   VAL A C   1 
ATOM   594   O  O   . VAL A  1  86  ? 59.472  -99.761  47.185  1.00 35.16  ? 89   VAL A O   1 
ATOM   595   C  CB  . VAL A  1  86  ? 60.303  -97.093  49.193  1.00 34.86  ? 89   VAL A CB  1 
ATOM   596   C  CG1 . VAL A  1  86  ? 61.103  -98.260  49.725  1.00 35.43  ? 89   VAL A CG1 1 
ATOM   597   C  CG2 . VAL A  1  86  ? 61.212  -95.926  48.935  1.00 34.01  ? 89   VAL A CG2 1 
ATOM   598   N  N   . ASP A  1  87  ? 57.904  -99.104  48.664  1.00 35.19  ? 90   ASP A N   1 
ATOM   599   C  CA  . ASP A  1  87  ? 57.129  -100.350 48.652  1.00 35.62  ? 90   ASP A CA  1 
ATOM   600   C  C   . ASP A  1  87  ? 56.810  -100.834 47.233  1.00 35.40  ? 90   ASP A C   1 
ATOM   601   O  O   . ASP A  1  87  ? 57.086  -101.994 46.897  1.00 35.63  ? 90   ASP A O   1 
ATOM   602   C  CB  . ASP A  1  87  ? 55.815  -100.190 49.433  1.00 36.12  ? 90   ASP A CB  1 
ATOM   603   C  CG  . ASP A  1  87  ? 56.026  -99.929  50.943  1.00 39.25  ? 90   ASP A CG  1 
ATOM   604   O  OD1 . ASP A  1  87  ? 57.124  -100.268 51.491  1.00 41.48  ? 90   ASP A OD1 1 
ATOM   605   O  OD2 . ASP A  1  87  ? 55.064  -99.405  51.588  1.00 40.43  ? 90   ASP A OD2 1 
ATOM   606   N  N   . LYS A  1  88  ? 56.243  -99.953  46.409  1.00 34.90  ? 91   LYS A N   1 
ATOM   607   C  CA  . LYS A  1  88  ? 55.906  -100.288 45.025  1.00 34.94  ? 91   LYS A CA  1 
ATOM   608   C  C   . LYS A  1  88  ? 57.145  -100.496 44.140  1.00 34.81  ? 91   LYS A C   1 
ATOM   609   O  O   . LYS A  1  88  ? 57.106  -101.266 43.182  1.00 35.14  ? 91   LYS A O   1 
ATOM   610   C  CB  . LYS A  1  88  ? 55.001  -99.226  44.401  1.00 34.91  ? 91   LYS A CB  1 
ATOM   611   C  CG  . LYS A  1  88  ? 53.607  -99.128  44.989  1.00 36.65  ? 91   LYS A CG  1 
ATOM   612   C  CD  . LYS A  1  88  ? 52.874  -97.889  44.466  1.00 39.82  ? 91   LYS A CD  1 
ATOM   613   C  CE  . LYS A  1  88  ? 51.359  -98.053  44.512  1.00 42.19  ? 91   LYS A CE  1 
ATOM   614   N  NZ  . LYS A  1  88  ? 50.881  -98.860  43.320  1.00 44.63  ? 91   LYS A NZ  1 
ATOM   615   N  N   . SER A  1  89  ? 58.238  -99.806  44.441  1.00 34.48  ? 92   SER A N   1 
ATOM   616   C  CA  . SER A  1  89  ? 59.456  -99.960  43.647  1.00 34.19  ? 92   SER A CA  1 
ATOM   617   C  C   . SER A  1  89  ? 60.092  -101.316 43.939  1.00 34.12  ? 92   SER A C   1 
ATOM   618   O  O   . SER A  1  89  ? 60.588  -102.000 43.034  1.00 33.54  ? 92   SER A O   1 
ATOM   619   C  CB  . SER A  1  89  ? 60.452  -98.840  43.937  1.00 33.95  ? 92   SER A CB  1 
ATOM   620   O  OG  . SER A  1  89  ? 59.952  -97.597  43.472  1.00 34.53  ? 92   SER A OG  1 
ATOM   621   N  N   . ARG A  1  90  ? 60.070  -101.690 45.215  1.00 33.81  ? 93   ARG A N   1 
ATOM   622   C  CA  . ARG A  1  90  ? 60.547  -102.985 45.631  1.00 33.73  ? 93   ARG A CA  1 
ATOM   623   C  C   . ARG A  1  90  ? 59.723  -104.097 44.971  1.00 33.78  ? 93   ARG A C   1 
ATOM   624   O  O   . ARG A  1  90  ? 60.278  -105.044 44.409  1.00 33.72  ? 93   ARG A O   1 
ATOM   625   C  CB  . ARG A  1  90  ? 60.502  -103.096 47.150  1.00 33.50  ? 93   ARG A CB  1 
ATOM   626   C  CG  . ARG A  1  90  ? 61.696  -102.480 47.835  1.00 33.33  ? 93   ARG A CG  1 
ATOM   627   C  CD  . ARG A  1  90  ? 61.401  -102.227 49.313  1.00 32.86  ? 93   ARG A CD  1 
ATOM   628   N  NE  . ARG A  1  90  ? 62.540  -101.597 49.974  1.00 32.15  ? 93   ARG A NE  1 
ATOM   629   C  CZ  . ARG A  1  90  ? 62.521  -101.070 51.196  1.00 31.47  ? 93   ARG A CZ  1 
ATOM   630   N  NH1 . ARG A  1  90  ? 61.416  -101.079 51.937  1.00 29.84  ? 93   ARG A NH1 1 
ATOM   631   N  NH2 . ARG A  1  90  ? 63.626  -100.523 51.669  1.00 30.61  ? 93   ARG A NH2 1 
ATOM   632   N  N   . LYS A  1  91  ? 58.401  -103.967 45.009  1.00 33.72  ? 94   LYS A N   1 
ATOM   633   C  CA  . LYS A  1  91  ? 57.558  -104.996 44.450  1.00 33.61  ? 94   LYS A CA  1 
ATOM   634   C  C   . LYS A  1  91  ? 57.795  -105.131 42.950  1.00 33.44  ? 94   LYS A C   1 
ATOM   635   O  O   . LYS A  1  91  ? 57.981  -106.237 42.453  1.00 33.83  ? 94   LYS A O   1 
ATOM   636   C  CB  . LYS A  1  91  ? 56.094  -104.736 44.764  1.00 33.66  ? 94   LYS A CB  1 
ATOM   637   C  CG  . LYS A  1  91  ? 55.205  -105.912 44.441  1.00 35.58  ? 94   LYS A CG  1 
ATOM   638   C  CD  . LYS A  1  91  ? 53.880  -105.787 45.146  1.00 39.91  ? 94   LYS A CD  1 
ATOM   639   C  CE  . LYS A  1  91  ? 52.843  -106.761 44.572  1.00 42.29  ? 94   LYS A CE  1 
ATOM   640   N  NZ  . LYS A  1  91  ? 51.475  -106.155 44.659  1.00 43.27  ? 94   LYS A NZ  1 
ATOM   641   N  N   . VAL A  1  92  ? 57.840  -104.010 42.238  1.00 33.15  ? 95   VAL A N   1 
ATOM   642   C  CA  . VAL A  1  92  ? 57.926  -104.062 40.790  1.00 32.87  ? 95   VAL A CA  1 
ATOM   643   C  C   . VAL A  1  92  ? 59.269  -104.618 40.346  1.00 32.88  ? 95   VAL A C   1 
ATOM   644   O  O   . VAL A  1  92  ? 59.397  -105.132 39.241  1.00 33.26  ? 95   VAL A O   1 
ATOM   645   C  CB  . VAL A  1  92  ? 57.590  -102.707 40.121  1.00 33.06  ? 95   VAL A CB  1 
ATOM   646   C  CG1 . VAL A  1  92  ? 58.801  -101.782 40.083  1.00 33.03  ? 95   VAL A CG1 1 
ATOM   647   C  CG2 . VAL A  1  92  ? 57.048  -102.933 38.726  1.00 32.79  ? 95   VAL A CG2 1 
ATOM   648   N  N   . ALA A  1  93  ? 60.266  -104.533 41.215  1.00 32.98  ? 96   ALA A N   1 
ATOM   649   C  CA  . ALA A  1  93  ? 61.568  -105.104 40.914  1.00 33.25  ? 96   ALA A CA  1 
ATOM   650   C  C   . ALA A  1  93  ? 61.440  -106.620 40.795  1.00 33.58  ? 96   ALA A C   1 
ATOM   651   O  O   . ALA A  1  93  ? 62.124  -107.242 39.981  1.00 33.46  ? 96   ALA A O   1 
ATOM   652   C  CB  . ALA A  1  93  ? 62.586  -104.731 41.978  1.00 32.90  ? 96   ALA A CB  1 
ATOM   653   N  N   . HIS A  1  94  ? 60.556  -107.193 41.611  1.00 33.81  ? 97   HIS A N   1 
ATOM   654   C  CA  . HIS A  1  94  ? 60.316  -108.620 41.631  1.00 34.32  ? 97   HIS A CA  1 
ATOM   655   C  C   . HIS A  1  94  ? 59.338  -109.028 40.531  1.00 34.94  ? 97   HIS A C   1 
ATOM   656   O  O   . HIS A  1  94  ? 59.694  -109.829 39.670  1.00 35.28  ? 97   HIS A O   1 
ATOM   657   C  CB  . HIS A  1  94  ? 59.817  -109.056 43.009  1.00 34.22  ? 97   HIS A CB  1 
ATOM   658   C  CG  . HIS A  1  94  ? 60.896  -109.131 44.046  1.00 34.65  ? 97   HIS A CG  1 
ATOM   659   N  ND1 . HIS A  1  94  ? 61.680  -108.049 44.386  1.00 35.73  ? 97   HIS A ND1 1 
ATOM   660   C  CD2 . HIS A  1  94  ? 61.322  -110.158 44.819  1.00 35.04  ? 97   HIS A CD2 1 
ATOM   661   C  CE1 . HIS A  1  94  ? 62.546  -108.408 45.318  1.00 36.01  ? 97   HIS A CE1 1 
ATOM   662   N  NE2 . HIS A  1  94  ? 62.347  -109.682 45.601  1.00 35.57  ? 97   HIS A NE2 1 
ATOM   663   N  N   . THR A  1  95  ? 58.134  -108.449 40.530  1.00 35.31  ? 98   THR A N   1 
ATOM   664   C  CA  . THR A  1  95  ? 57.065  -108.874 39.621  1.00 35.70  ? 98   THR A CA  1 
ATOM   665   C  C   . THR A  1  95  ? 57.361  -108.619 38.156  1.00 35.97  ? 98   THR A C   1 
ATOM   666   O  O   . THR A  1  95  ? 56.849  -109.319 37.287  1.00 36.62  ? 98   THR A O   1 
ATOM   667   C  CB  . THR A  1  95  ? 55.751  -108.156 39.900  1.00 35.54  ? 98   THR A CB  1 
ATOM   668   O  OG1 . THR A  1  95  ? 55.880  -106.777 39.526  1.00 37.77  ? 98   THR A OG1 1 
ATOM   669   C  CG2 . THR A  1  95  ? 55.358  -108.268 41.357  1.00 36.00  ? 98   THR A CG2 1 
ATOM   670   N  N   . SER A  1  96  ? 58.155  -107.602 37.863  1.00 35.94  ? 99   SER A N   1 
ATOM   671   C  CA  . SER A  1  96  ? 58.426  -107.290 36.473  1.00 36.32  ? 99   SER A CA  1 
ATOM   672   C  C   . SER A  1  96  ? 59.814  -107.690 36.017  1.00 35.84  ? 99   SER A C   1 
ATOM   673   O  O   . SER A  1  96  ? 60.153  -107.497 34.844  1.00 35.99  ? 99   SER A O   1 
ATOM   674   C  CB  . SER A  1  96  ? 58.190  -105.817 36.194  1.00 36.61  ? 99   SER A CB  1 
ATOM   675   O  OG  . SER A  1  96  ? 56.793  -105.575 36.208  1.00 39.50  ? 99   SER A OG  1 
ATOM   676   N  N   . TYR A  1  97  ? 60.621  -108.239 36.922  1.00 35.01  ? 100  TYR A N   1 
ATOM   677   C  CA  . TYR A  1  97  ? 61.996  -108.522 36.547  1.00 34.30  ? 100  TYR A CA  1 
ATOM   678   C  C   . TYR A  1  97  ? 62.593  -109.783 37.135  1.00 34.75  ? 100  TYR A C   1 
ATOM   679   O  O   . TYR A  1  97  ? 63.069  -110.638 36.383  1.00 35.01  ? 100  TYR A O   1 
ATOM   680   C  CB  . TYR A  1  97  ? 62.919  -107.316 36.789  1.00 33.77  ? 100  TYR A CB  1 
ATOM   681   C  CG  . TYR A  1  97  ? 64.090  -107.317 35.845  1.00 31.07  ? 100  TYR A CG  1 
ATOM   682   C  CD1 . TYR A  1  97  ? 65.235  -108.049 36.139  1.00 29.97  ? 100  TYR A CD1 1 
ATOM   683   C  CD2 . TYR A  1  97  ? 64.037  -106.635 34.642  1.00 28.64  ? 100  TYR A CD2 1 
ATOM   684   C  CE1 . TYR A  1  97  ? 66.306  -108.093 35.272  1.00 28.62  ? 100  TYR A CE1 1 
ATOM   685   C  CE2 . TYR A  1  97  ? 65.116  -106.652 33.770  1.00 28.65  ? 100  TYR A CE2 1 
ATOM   686   C  CZ  . TYR A  1  97  ? 66.244  -107.389 34.097  1.00 29.31  ? 100  TYR A CZ  1 
ATOM   687   O  OH  . TYR A  1  97  ? 67.328  -107.445 33.254  1.00 30.84  ? 100  TYR A OH  1 
ATOM   688   N  N   . LYS A  1  98  ? 62.587  -109.898 38.461  1.00 34.98  ? 101  LYS A N   1 
ATOM   689   C  CA  . LYS A  1  98  ? 63.252  -111.018 39.111  1.00 35.20  ? 101  LYS A CA  1 
ATOM   690   C  C   . LYS A  1  98  ? 62.495  -112.335 38.913  1.00 35.03  ? 101  LYS A C   1 
ATOM   691   O  O   . LYS A  1  98  ? 63.101  -113.388 38.741  1.00 35.26  ? 101  LYS A O   1 
ATOM   692   C  CB  . LYS A  1  98  ? 63.497  -110.751 40.587  1.00 35.18  ? 101  LYS A CB  1 
ATOM   693   C  CG  . LYS A  1  98  ? 64.621  -111.596 41.093  1.00 36.37  ? 101  LYS A CG  1 
ATOM   694   C  CD  . LYS A  1  98  ? 64.675  -111.668 42.587  1.00 38.45  ? 101  LYS A CD  1 
ATOM   695   C  CE  . LYS A  1  98  ? 65.989  -112.309 43.006  1.00 38.93  ? 101  LYS A CE  1 
ATOM   696   N  NZ  . LYS A  1  98  ? 65.761  -113.079 44.253  1.00 41.43  ? 101  LYS A NZ  1 
ATOM   697   N  N   . ARG A  1  99  ? 61.172  -112.258 38.916  1.00 34.44  ? 102  ARG A N   1 
ATOM   698   C  CA  . ARG A  1  99  ? 60.348  -113.422 38.670  1.00 33.67  ? 102  ARG A CA  1 
ATOM   699   C  C   . ARG A  1  99  ? 60.324  -113.773 37.189  1.00 33.98  ? 102  ARG A C   1 
ATOM   700   O  O   . ARG A  1  99  ? 59.652  -114.729 36.788  1.00 34.34  ? 102  ARG A O   1 
ATOM   701   C  CB  . ARG A  1  99  ? 58.939  -113.196 39.194  1.00 32.79  ? 102  ARG A CB  1 
ATOM   702   C  CG  . ARG A  1  99  ? 58.904  -113.071 40.687  1.00 32.40  ? 102  ARG A CG  1 
ATOM   703   C  CD  . ARG A  1  99  ? 57.508  -112.834 41.185  1.00 32.18  ? 102  ARG A CD  1 
ATOM   704   N  NE  . ARG A  1  99  ? 57.513  -112.368 42.567  1.00 33.47  ? 102  ARG A NE  1 
ATOM   705   C  CZ  . ARG A  1  99  ? 56.421  -112.036 43.259  1.00 35.10  ? 102  ARG A CZ  1 
ATOM   706   N  NH1 . ARG A  1  99  ? 55.216  -112.133 42.697  1.00 35.77  ? 102  ARG A NH1 1 
ATOM   707   N  NH2 . ARG A  1  99  ? 56.531  -111.606 44.520  1.00 32.86  ? 102  ARG A NH2 1 
ATOM   708   N  N   . ILE A  1  100 A 61.053  -113.015 36.372  1.00 33.81  ? 102  ILE A N   1 
ATOM   709   C  CA  . ILE A  1  100 A 61.097  -113.309 34.942  1.00 33.53  ? 102  ILE A CA  1 
ATOM   710   C  C   . ILE A  1  100 A 62.462  -113.785 34.484  1.00 33.72  ? 102  ILE A C   1 
ATOM   711   O  O   . ILE A  1  100 A 62.549  -114.814 33.806  1.00 33.94  ? 102  ILE A O   1 
ATOM   712   C  CB  . ILE A  1  100 A 60.590  -112.146 34.092  1.00 33.65  ? 102  ILE A CB  1 
ATOM   713   C  CG1 . ILE A  1  100 A 59.066  -112.070 34.193  1.00 33.31  ? 102  ILE A CG1 1 
ATOM   714   C  CG2 . ILE A  1  100 A 61.021  -112.308 32.624  1.00 33.71  ? 102  ILE A CG2 1 
ATOM   715   C  CD1 . ILE A  1  100 A 58.469  -110.874 33.484  1.00 35.17  ? 102  ILE A CD1 1 
ATOM   716   N  N   . TYR A  1  101 ? 63.509  -113.053 34.883  1.00 33.70  ? 103  TYR A N   1 
ATOM   717   C  CA  . TYR A  1  101 ? 64.899  -113.333 34.495  1.00 33.47  ? 103  TYR A CA  1 
ATOM   718   C  C   . TYR A  1  101 ? 65.782  -113.847 35.631  1.00 33.44  ? 103  TYR A C   1 
ATOM   719   O  O   . TYR A  1  101 ? 67.006  -114.027 35.443  1.00 33.40  ? 103  TYR A O   1 
ATOM   720   C  CB  . TYR A  1  101 ? 65.569  -112.075 33.922  1.00 33.38  ? 103  TYR A CB  1 
ATOM   721   C  CG  . TYR A  1  101 ? 64.791  -111.351 32.861  1.00 32.85  ? 103  TYR A CG  1 
ATOM   722   C  CD1 . TYR A  1  101 ? 64.643  -111.891 31.588  1.00 32.83  ? 103  TYR A CD1 1 
ATOM   723   C  CD2 . TYR A  1  101 ? 64.236  -110.100 33.117  1.00 33.30  ? 103  TYR A CD2 1 
ATOM   724   C  CE1 . TYR A  1  101 ? 63.931  -111.213 30.585  1.00 33.33  ? 103  TYR A CE1 1 
ATOM   725   C  CE2 . TYR A  1  101 ? 63.523  -109.405 32.125  1.00 33.85  ? 103  TYR A CE2 1 
ATOM   726   C  CZ  . TYR A  1  101 ? 63.373  -109.974 30.864  1.00 33.99  ? 103  TYR A CZ  1 
ATOM   727   O  OH  . TYR A  1  101 ? 62.674  -109.302 29.889  1.00 34.33  ? 103  TYR A OH  1 
ATOM   728   N  N   . GLY A  1  102 ? 65.196  -114.050 36.809  1.00 33.18  ? 104  GLY A N   1 
ATOM   729   C  CA  . GLY A  1  102 ? 65.957  -114.592 37.948  1.00 33.40  ? 104  GLY A CA  1 
ATOM   730   C  C   . GLY A  1  102 ? 67.139  -113.750 38.429  1.00 33.81  ? 104  GLY A C   1 
ATOM   731   O  O   . GLY A  1  102 ? 68.003  -114.244 39.160  1.00 33.66  ? 104  GLY A O   1 
ATOM   732   N  N   . GLU A  1  103 ? 67.184  -112.486 38.002  1.00 34.10  ? 105  GLU A N   1 
ATOM   733   C  CA  . GLU A  1  103 ? 68.146  -111.516 38.506  1.00 34.30  ? 105  GLU A CA  1 
ATOM   734   C  C   . GLU A  1  103 ? 67.446  -110.199 38.771  1.00 33.71  ? 105  GLU A C   1 
ATOM   735   O  O   . GLU A  1  103 ? 66.287  -110.034 38.402  1.00 33.87  ? 105  GLU A O   1 
ATOM   736   C  CB  . GLU A  1  103 ? 69.324  -111.341 37.535  1.00 35.11  ? 105  GLU A CB  1 
ATOM   737   C  CG  . GLU A  1  103 ? 68.953  -111.053 36.094  1.00 37.32  ? 105  GLU A CG  1 
ATOM   738   C  CD  . GLU A  1  103 ? 70.086  -111.378 35.121  1.00 40.03  ? 105  GLU A CD  1 
ATOM   739   O  OE1 . GLU A  1  103 ? 70.327  -112.580 34.856  1.00 42.20  ? 105  GLU A OE1 1 
ATOM   740   O  OE2 . GLU A  1  103 ? 70.717  -110.435 34.602  1.00 40.69  ? 105  GLU A OE2 1 
ATOM   741   N  N   . TYR A  1  104 ? 68.144  -109.277 39.432  1.00 33.26  ? 106  TYR A N   1 
ATOM   742   C  CA  . TYR A  1  104 ? 67.601  -107.944 39.725  1.00 32.58  ? 106  TYR A CA  1 
ATOM   743   C  C   . TYR A  1  104 ? 67.752  -107.010 38.532  1.00 32.39  ? 106  TYR A C   1 
ATOM   744   O  O   . TYR A  1  104 ? 68.693  -107.161 37.747  1.00 32.55  ? 106  TYR A O   1 
ATOM   745   C  CB  . TYR A  1  104 ? 68.285  -107.340 40.941  1.00 32.18  ? 106  TYR A CB  1 
ATOM   746   C  CG  . TYR A  1  104 ? 67.933  -108.041 42.226  1.00 31.64  ? 106  TYR A CG  1 
ATOM   747   C  CD1 . TYR A  1  104 ? 66.731  -107.778 42.887  1.00 30.26  ? 106  TYR A CD1 1 
ATOM   748   C  CD2 . TYR A  1  104 ? 68.797  -108.975 42.775  1.00 31.20  ? 106  TYR A CD2 1 
ATOM   749   C  CE1 . TYR A  1  104 ? 66.404  -108.430 44.066  1.00 29.59  ? 106  TYR A CE1 1 
ATOM   750   C  CE2 . TYR A  1  104 ? 68.488  -109.630 43.945  1.00 31.27  ? 106  TYR A CE2 1 
ATOM   751   C  CZ  . TYR A  1  104 ? 67.291  -109.352 44.595  1.00 31.48  ? 106  TYR A CZ  1 
ATOM   752   O  OH  . TYR A  1  104 ? 67.005  -110.018 45.775  1.00 32.56  ? 106  TYR A OH  1 
ATOM   753   N  N   . PRO A  1  105 ? 66.826  -106.046 38.384  1.00 32.02  ? 107  PRO A N   1 
ATOM   754   C  CA  . PRO A  1  105 ? 66.907  -105.186 37.205  1.00 32.07  ? 107  PRO A CA  1 
ATOM   755   C  C   . PRO A  1  105 ? 68.114  -104.256 37.234  1.00 32.41  ? 107  PRO A C   1 
ATOM   756   O  O   . PRO A  1  105 ? 68.590  -103.878 38.304  1.00 32.06  ? 107  PRO A O   1 
ATOM   757   C  CB  . PRO A  1  105 ? 65.600  -104.382 37.258  1.00 31.94  ? 107  PRO A CB  1 
ATOM   758   C  CG  . PRO A  1  105 ? 65.189  -104.412 38.700  1.00 31.74  ? 107  PRO A CG  1 
ATOM   759   C  CD  . PRO A  1  105 ? 65.665  -105.725 39.238  1.00 31.91  ? 107  PRO A CD  1 
ATOM   760   N  N   . PRO A  1  106 ? 68.623  -103.897 36.056  1.00 33.01  ? 108  PRO A N   1 
ATOM   761   C  CA  . PRO A  1  106 ? 69.590  -102.816 36.024  1.00 33.48  ? 108  PRO A CA  1 
ATOM   762   C  C   . PRO A  1  106 ? 68.919  -101.495 36.476  1.00 34.38  ? 108  PRO A C   1 
ATOM   763   O  O   . PRO A  1  106 ? 67.685  -101.336 36.343  1.00 34.43  ? 108  PRO A O   1 
ATOM   764   C  CB  . PRO A  1  106 ? 69.986  -102.765 34.554  1.00 33.52  ? 108  PRO A CB  1 
ATOM   765   C  CG  . PRO A  1  106 ? 68.792  -103.311 33.827  1.00 33.34  ? 108  PRO A CG  1 
ATOM   766   C  CD  . PRO A  1  106 ? 68.300  -104.403 34.711  1.00 32.90  ? 108  PRO A CD  1 
ATOM   767   N  N   . THR A  1  107 ? 69.726  -100.573 37.012  1.00 35.01  ? 109  THR A N   1 
ATOM   768   C  CA  . THR A  1  107 ? 69.252  -99.280  37.552  1.00 35.42  ? 109  THR A CA  1 
ATOM   769   C  C   . THR A  1  107 ? 68.287  -98.511  36.620  1.00 36.08  ? 109  THR A C   1 
ATOM   770   O  O   . THR A  1  107 ? 67.168  -98.157  37.038  1.00 35.89  ? 109  THR A O   1 
ATOM   771   C  CB  . THR A  1  107 ? 70.447  -98.385  37.963  1.00 35.26  ? 109  THR A CB  1 
ATOM   772   O  OG1 . THR A  1  107 ? 71.316  -99.123  38.830  1.00 35.35  ? 109  THR A OG1 1 
ATOM   773   C  CG2 . THR A  1  107 ? 69.973  -97.156  38.698  1.00 34.99  ? 109  THR A CG2 1 
ATOM   774   N  N   . LYS A  1  108 ? 68.706  -98.284  35.369  1.00 36.70  ? 110  LYS A N   1 
ATOM   775   C  CA  . LYS A  1  108 ? 67.886  -97.564  34.393  1.00 37.61  ? 110  LYS A CA  1 
ATOM   776   C  C   . LYS A  1  108 ? 66.495  -98.171  34.273  1.00 37.70  ? 110  LYS A C   1 
ATOM   777   O  O   . LYS A  1  108 ? 65.497  -97.440  34.250  1.00 38.25  ? 110  LYS A O   1 
ATOM   778   C  CB  . LYS A  1  108 ? 68.552  -97.496  33.021  1.00 37.96  ? 110  LYS A CB  1 
ATOM   779   C  CG  . LYS A  1  108 ? 68.994  -98.861  32.468  1.00 41.29  ? 110  LYS A CG  1 
ATOM   780   C  CD  . LYS A  1  108 ? 69.952  -98.715  31.288  1.00 44.75  ? 110  LYS A CD  1 
ATOM   781   C  CE  . LYS A  1  108 ? 70.089  -100.015 30.507  1.00 45.64  ? 110  LYS A CE  1 
ATOM   782   N  NZ  . LYS A  1  108 ? 70.577  -99.720  29.114  1.00 48.25  ? 110  LYS A NZ  1 
ATOM   783   N  N   . LEU A  1  109 ? 66.415  -99.498  34.234  1.00 37.50  ? 111  LEU A N   1 
ATOM   784   C  CA  . LEU A  1  109 ? 65.114  -100.152 34.073  1.00 37.13  ? 111  LEU A CA  1 
ATOM   785   C  C   . LEU A  1  109 ? 64.217  -100.056 35.297  1.00 36.32  ? 111  LEU A C   1 
ATOM   786   O  O   . LEU A  1  109 ? 63.013  -99.883  35.155  1.00 36.17  ? 111  LEU A O   1 
ATOM   787   C  CB  . LEU A  1  109 ? 65.256  -101.596 33.601  1.00 37.49  ? 111  LEU A CB  1 
ATOM   788   C  CG  . LEU A  1  109 ? 65.654  -101.699 32.122  1.00 38.84  ? 111  LEU A CG  1 
ATOM   789   C  CD1 . LEU A  1  109 ? 65.666  -103.143 31.690  1.00 40.23  ? 111  LEU A CD1 1 
ATOM   790   C  CD2 . LEU A  1  109 ? 64.744  -100.860 31.199  1.00 39.92  ? 111  LEU A CD2 1 
ATOM   791   N  N   . LEU A  1  110 ? 64.795  -100.146 36.489  1.00 35.47  ? 112  LEU A N   1 
ATOM   792   C  CA  . LEU A  1  110 ? 63.997  -99.950  37.694  1.00 35.16  ? 112  LEU A CA  1 
ATOM   793   C  C   . LEU A  1  110 ? 63.523  -98.477  37.828  1.00 35.84  ? 112  LEU A C   1 
ATOM   794   O  O   . LEU A  1  110 ? 62.364  -98.213  38.193  1.00 35.33  ? 112  LEU A O   1 
ATOM   795   C  CB  . LEU A  1  110 ? 64.748  -100.415 38.938  1.00 34.22  ? 112  LEU A CB  1 
ATOM   796   C  CG  . LEU A  1  110 ? 63.981  -100.280 40.254  1.00 33.19  ? 112  LEU A CG  1 
ATOM   797   C  CD1 . LEU A  1  110 ? 62.658  -101.034 40.235  1.00 32.57  ? 112  LEU A CD1 1 
ATOM   798   C  CD2 . LEU A  1  110 ? 64.823  -100.758 41.394  1.00 31.75  ? 112  LEU A CD2 1 
ATOM   799   N  N   . VAL A  1  111 ? 64.416  -97.530  37.509  1.00 35.99  ? 113  VAL A N   1 
ATOM   800   C  CA  . VAL A  1  111 ? 64.068  -96.110  37.529  1.00 35.90  ? 113  VAL A CA  1 
ATOM   801   C  C   . VAL A  1  111 ? 62.905  -95.908  36.585  1.00 35.90  ? 113  VAL A C   1 
ATOM   802   O  O   . VAL A  1  111 ? 61.934  -95.246  36.912  1.00 35.79  ? 113  VAL A O   1 
ATOM   803   C  CB  . VAL A  1  111 ? 65.269  -95.228  37.123  1.00 35.88  ? 113  VAL A CB  1 
ATOM   804   C  CG1 . VAL A  1  111 ? 64.813  -93.853  36.677  1.00 35.61  ? 113  VAL A CG1 1 
ATOM   805   C  CG2 . VAL A  1  111 ? 66.243  -95.112  38.288  1.00 35.85  ? 113  VAL A CG2 1 
ATOM   806   N  N   . SER A  1  112 ? 63.018  -96.545  35.428  1.00 36.14  ? 114  SER A N   1 
ATOM   807   C  CA  . SER A  1  112 ? 62.026  -96.503  34.385  1.00 36.46  ? 114  SER A CA  1 
ATOM   808   C  C   . SER A  1  112 ? 60.653  -96.943  34.856  1.00 36.39  ? 114  SER A C   1 
ATOM   809   O  O   . SER A  1  112 ? 59.639  -96.383  34.435  1.00 36.45  ? 114  SER A O   1 
ATOM   810   C  CB  . SER A  1  112 ? 62.472  -97.405  33.248  1.00 36.44  ? 114  SER A CB  1 
ATOM   811   O  OG  . SER A  1  112 ? 61.628  -97.206  32.140  1.00 37.90  ? 114  SER A OG  1 
ATOM   812   N  N   . GLU A  1  113 ? 60.633  -97.951  35.721  1.00 36.54  ? 115  GLU A N   1 
ATOM   813   C  CA  . GLU A  1  113 ? 59.406  -98.455  36.305  1.00 36.65  ? 115  GLU A CA  1 
ATOM   814   C  C   . GLU A  1  113 ? 58.837  -97.496  37.334  1.00 36.54  ? 115  GLU A C   1 
ATOM   815   O  O   . GLU A  1  113 ? 57.628  -97.275  37.369  1.00 36.58  ? 115  GLU A O   1 
ATOM   816   C  CB  . GLU A  1  113 ? 59.644  -99.810  36.964  1.00 37.12  ? 115  GLU A CB  1 
ATOM   817   C  CG  . GLU A  1  113 ? 60.059  -100.939 36.014  1.00 39.25  ? 115  GLU A CG  1 
ATOM   818   C  CD  . GLU A  1  113 ? 58.970  -101.331 35.019  1.00 42.18  ? 115  GLU A CD  1 
ATOM   819   O  OE1 . GLU A  1  113 ? 57.767  -101.092 35.297  1.00 42.59  ? 115  GLU A OE1 1 
ATOM   820   O  OE2 . GLU A  1  113 ? 59.331  -101.886 33.953  1.00 43.16  ? 115  GLU A OE2 1 
ATOM   821   N  N   . VAL A  1  114 ? 59.698  -96.939  38.184  1.00 36.63  ? 116  VAL A N   1 
ATOM   822   C  CA  . VAL A  1  114 ? 59.259  -95.968  39.191  1.00 36.77  ? 116  VAL A CA  1 
ATOM   823   C  C   . VAL A  1  114 ? 58.676  -94.736  38.500  1.00 36.65  ? 116  VAL A C   1 
ATOM   824   O  O   . VAL A  1  114 ? 57.615  -94.246  38.886  1.00 36.84  ? 116  VAL A O   1 
ATOM   825   C  CB  . VAL A  1  114 ? 60.389  -95.539  40.155  1.00 36.96  ? 116  VAL A CB  1 
ATOM   826   C  CG1 . VAL A  1  114 ? 59.799  -94.856  41.368  1.00 37.75  ? 116  VAL A CG1 1 
ATOM   827   C  CG2 . VAL A  1  114 ? 61.190  -96.726  40.621  1.00 36.98  ? 116  VAL A CG2 1 
ATOM   828   N  N   . ALA A  1  115 ? 59.369  -94.264  37.465  1.00 36.44  ? 117  ALA A N   1 
ATOM   829   C  CA  . ALA A  1  115 ? 58.906  -93.162  36.628  1.00 36.30  ? 117  ALA A CA  1 
ATOM   830   C  C   . ALA A  1  115 ? 57.501  -93.412  36.109  1.00 36.34  ? 117  ALA A C   1 
ATOM   831   O  O   . ALA A  1  115 ? 56.653  -92.520  36.139  1.00 36.28  ? 117  ALA A O   1 
ATOM   832   C  CB  . ALA A  1  115 ? 59.865  -92.935  35.470  1.00 36.05  ? 117  ALA A CB  1 
ATOM   833   N  N   . LYS A  1  116 ? 57.265  -94.632  35.633  1.00 36.57  ? 118  LYS A N   1 
ATOM   834   C  CA  . LYS A  1  116 ? 55.966  -95.035  35.119  1.00 36.77  ? 118  LYS A CA  1 
ATOM   835   C  C   . LYS A  1  116 ? 54.889  -94.935  36.202  1.00 36.73  ? 118  LYS A C   1 
ATOM   836   O  O   . LYS A  1  116 ? 53.781  -94.483  35.925  1.00 36.71  ? 118  LYS A O   1 
ATOM   837   C  CB  . LYS A  1  116 ? 56.051  -96.450  34.532  1.00 37.24  ? 118  LYS A CB  1 
ATOM   838   C  CG  . LYS A  1  116 ? 54.720  -97.055  34.118  1.00 39.23  ? 118  LYS A CG  1 
ATOM   839   C  CD  . LYS A  1  116 ? 54.850  -98.381  33.383  1.00 41.97  ? 118  LYS A CD  1 
ATOM   840   C  CE  . LYS A  1  116 ? 53.440  -98.959  33.134  1.00 45.34  ? 118  LYS A CE  1 
ATOM   841   N  NZ  . LYS A  1  116 ? 53.409  -100.187 32.262  1.00 47.55  ? 118  LYS A NZ  1 
ATOM   842   N  N   . ILE A  1  117 ? 55.224  -95.327  37.434  1.00 36.72  ? 119  ILE A N   1 
ATOM   843   C  CA  . ILE A  1  117 ? 54.282  -95.260  38.566  1.00 36.57  ? 119  ILE A CA  1 
ATOM   844   C  C   . ILE A  1  117 ? 53.901  -93.820  38.883  1.00 36.82  ? 119  ILE A C   1 
ATOM   845   O  O   . ILE A  1  117 ? 52.738  -93.517  39.159  1.00 37.15  ? 119  ILE A O   1 
ATOM   846   C  CB  . ILE A  1  117 ? 54.832  -95.979  39.817  1.00 36.53  ? 119  ILE A CB  1 
ATOM   847   C  CG1 . ILE A  1  117 ? 54.726  -97.493  39.640  1.00 36.00  ? 119  ILE A CG1 1 
ATOM   848   C  CG2 . ILE A  1  117 ? 54.113  -95.536  41.085  1.00 35.74  ? 119  ILE A CG2 1 
ATOM   849   C  CD1 . ILE A  1  117 ? 55.783  -98.267  40.424  1.00 34.74  ? 119  ILE A CD1 1 
ATOM   850   N  N   . MET A  1  118 ? 54.884  -92.935  38.816  1.00 37.03  ? 120  MET A N   1 
ATOM   851   C  CA  . MET A  1  118 ? 54.645  -91.505  38.960  1.00 37.27  ? 120  MET A CA  1 
ATOM   852   C  C   . MET A  1  118 ? 53.890  -90.906  37.774  1.00 37.28  ? 120  MET A C   1 
ATOM   853   O  O   . MET A  1  118 ? 52.899  -90.203  37.975  1.00 37.54  ? 120  MET A O   1 
ATOM   854   C  CB  . MET A  1  118 ? 55.955  -90.785  39.248  1.00 37.29  ? 120  MET A CB  1 
ATOM   855   C  CG  . MET A  1  118 ? 56.575  -91.339  40.506  1.00 38.40  ? 120  MET A CG  1 
ATOM   856   S  SD  . MET A  1  118 ? 58.200  -90.760  40.925  1.00 40.69  ? 120  MET A SD  1 
ATOM   857   C  CE  . MET A  1  118 ? 57.790  -89.164  41.637  1.00 40.33  ? 120  MET A CE  1 
ATOM   858   N  N   . GLN A  1  119 ? 54.313  -91.215  36.551  1.00 37.34  ? 121  GLN A N   1 
ATOM   859   C  CA  . GLN A  1  119 ? 53.582  -90.769  35.356  1.00 37.84  ? 121  GLN A CA  1 
ATOM   860   C  C   . GLN A  1  119 ? 52.096  -91.083  35.428  1.00 38.45  ? 121  GLN A C   1 
ATOM   861   O  O   . GLN A  1  119 ? 51.284  -90.278  35.002  1.00 38.92  ? 121  GLN A O   1 
ATOM   862   C  CB  . GLN A  1  119 ? 54.154  -91.389  34.085  1.00 37.80  ? 121  GLN A CB  1 
ATOM   863   C  CG  . GLN A  1  119 ? 53.672  -90.746  32.788  1.00 37.90  ? 121  GLN A CG  1 
ATOM   864   C  CD  . GLN A  1  119 ? 52.230  -91.083  32.418  1.00 39.62  ? 121  GLN A CD  1 
ATOM   865   O  OE1 . GLN A  1  119 ? 51.747  -92.200  32.645  1.00 39.99  ? 121  GLN A OE1 1 
ATOM   866   N  NE2 . GLN A  1  119 ? 51.533  -90.106  31.840  1.00 39.33  ? 121  GLN A NE2 1 
ATOM   867   N  N   . GLU A  1  120 ? 51.736  -92.250  35.951  1.00 38.97  ? 122  GLU A N   1 
ATOM   868   C  CA  . GLU A  1  120 ? 50.336  -92.657  35.971  1.00 39.53  ? 122  GLU A CA  1 
ATOM   869   C  C   . GLU A  1  120 ? 49.541  -91.818  36.965  1.00 38.97  ? 122  GLU A C   1 
ATOM   870   O  O   . GLU A  1  120 ? 48.355  -91.590  36.760  1.00 39.18  ? 122  GLU A O   1 
ATOM   871   C  CB  . GLU A  1  120 ? 50.176  -94.177  36.208  1.00 39.80  ? 122  GLU A CB  1 
ATOM   872   C  CG  . GLU A  1  120 ? 50.884  -95.040  35.133  1.00 43.61  ? 122  GLU A CG  1 
ATOM   873   C  CD  . GLU A  1  120 ? 50.856  -96.574  35.384  1.00 48.95  ? 122  GLU A CD  1 
ATOM   874   O  OE1 . GLU A  1  120 ? 50.657  -97.315  34.384  1.00 51.22  ? 122  GLU A OE1 1 
ATOM   875   O  OE2 . GLU A  1  120 ? 51.046  -97.046  36.543  1.00 48.49  ? 122  GLU A OE2 1 
ATOM   876   N  N   . ALA A  1  121 ? 50.195  -91.328  38.014  1.00 38.57  ? 123  ALA A N   1 
ATOM   877   C  CA  . ALA A  1  121 ? 49.512  -90.490  39.009  1.00 38.53  ? 123  ALA A CA  1 
ATOM   878   C  C   . ALA A  1  121 ? 49.265  -89.069  38.466  1.00 38.55  ? 123  ALA A C   1 
ATOM   879   O  O   . ALA A  1  121 ? 48.657  -88.214  39.121  1.00 38.67  ? 123  ALA A O   1 
ATOM   880   C  CB  . ALA A  1  121 ? 50.297  -90.462  40.304  1.00 38.34  ? 123  ALA A CB  1 
ATOM   881   N  N   . THR A  1  122 ? 49.711  -88.876  37.229  1.00 38.64  ? 124  THR A N   1 
ATOM   882   C  CA  . THR A  1  122 ? 49.693  -87.618  36.484  1.00 38.58  ? 124  THR A CA  1 
ATOM   883   C  C   . THR A  1  122 ? 48.606  -87.647  35.401  1.00 38.59  ? 124  THR A C   1 
ATOM   884   O  O   . THR A  1  122 ? 48.221  -86.611  34.857  1.00 38.26  ? 124  THR A O   1 
ATOM   885   C  CB  . THR A  1  122 ? 51.098  -87.438  35.858  1.00 38.65  ? 124  THR A CB  1 
ATOM   886   O  OG1 . THR A  1  122 ? 51.940  -86.720  36.769  1.00 38.82  ? 124  THR A OG1 1 
ATOM   887   C  CG2 . THR A  1  122 ? 51.075  -86.754  34.510  1.00 39.09  ? 124  THR A CG2 1 
ATOM   888   N  N   . GLN A  1  123 ? 48.099  -88.847  35.111  1.00 38.93  ? 125  GLN A N   1 
ATOM   889   C  CA  . GLN A  1  123 ? 47.119  -89.044  34.046  1.00 38.66  ? 125  GLN A CA  1 
ATOM   890   C  C   . GLN A  1  123 ? 45.824  -89.727  34.509  1.00 38.70  ? 125  GLN A C   1 
ATOM   891   O  O   . GLN A  1  123 ? 44.745  -89.320  34.091  1.00 38.90  ? 125  GLN A O   1 
ATOM   892   C  CB  . GLN A  1  123 ? 47.746  -89.779  32.856  1.00 38.50  ? 125  GLN A CB  1 
ATOM   893   C  CG  . GLN A  1  123 ? 46.971  -89.638  31.547  1.00 39.11  ? 125  GLN A CG  1 
ATOM   894   C  CD  . GLN A  1  123 ? 47.795  -90.008  30.325  1.00 40.29  ? 125  GLN A CD  1 
ATOM   895   O  OE1 . GLN A  1  123 ? 48.815  -90.682  30.441  1.00 41.29  ? 125  GLN A OE1 1 
ATOM   896   N  NE2 . GLN A  1  123 ? 47.356  -89.563  29.142  1.00 40.31  ? 125  GLN A NE2 1 
ATOM   897   N  N   . SER A  1  124 ? 45.918  -90.753  35.355  1.00 38.63  ? 126  SER A N   1 
ATOM   898   C  CA  . SER A  1  124 ? 44.714  -91.458  35.857  1.00 38.73  ? 126  SER A CA  1 
ATOM   899   C  C   . SER A  1  124 ? 43.654  -90.559  36.517  1.00 38.32  ? 126  SER A C   1 
ATOM   900   O  O   . SER A  1  124 ? 43.947  -89.476  37.022  1.00 38.19  ? 126  SER A O   1 
ATOM   901   C  CB  . SER A  1  124 ? 45.098  -92.563  36.843  1.00 39.09  ? 126  SER A CB  1 
ATOM   902   O  OG  . SER A  1  124 ? 45.864  -93.565  36.203  1.00 40.09  ? 126  SER A OG  1 
ATOM   903   N  N   . GLY A  1  125 ? 42.416  -91.031  36.518  1.00 38.02  ? 127  GLY A N   1 
ATOM   904   C  CA  . GLY A  1  125 ? 41.336  -90.306  37.161  1.00 37.74  ? 127  GLY A CA  1 
ATOM   905   C  C   . GLY A  1  125 ? 41.490  -90.295  38.669  1.00 37.68  ? 127  GLY A C   1 
ATOM   906   O  O   . GLY A  1  125 ? 41.999  -91.261  39.257  1.00 37.64  ? 127  GLY A O   1 
ATOM   907   N  N   . GLY A  1  126 ? 41.089  -89.178  39.280  1.00 37.30  ? 128  GLY A N   1 
ATOM   908   C  CA  . GLY A  1  126 ? 40.873  -89.092  40.724  1.00 36.84  ? 128  GLY A CA  1 
ATOM   909   C  C   . GLY A  1  126 ? 42.086  -89.106  41.639  1.00 36.59  ? 128  GLY A C   1 
ATOM   910   O  O   . GLY A  1  126 ? 41.940  -89.303  42.841  1.00 36.74  ? 128  GLY A O   1 
ATOM   911   N  N   . VAL A  1  127 ? 43.279  -88.900  41.090  1.00 36.07  ? 129  VAL A N   1 
ATOM   912   C  CA  . VAL A  1  127 ? 44.487  -88.863  41.917  1.00 35.62  ? 129  VAL A CA  1 
ATOM   913   C  C   . VAL A  1  127 ? 45.322  -87.593  41.700  1.00 35.17  ? 129  VAL A C   1 
ATOM   914   O  O   . VAL A  1  127 ? 45.230  -86.950  40.644  1.00 35.73  ? 129  VAL A O   1 
ATOM   915   C  CB  . VAL A  1  127 ? 45.387  -90.130  41.709  1.00 35.64  ? 129  VAL A CB  1 
ATOM   916   C  CG1 . VAL A  1  127 ? 44.639  -91.393  42.072  1.00 35.59  ? 129  VAL A CG1 1 
ATOM   917   C  CG2 . VAL A  1  127 ? 45.935  -90.209  40.273  1.00 35.74  ? 129  VAL A CG2 1 
ATOM   918   N  N   . ARG A  1  128 ? 46.143  -87.255  42.692  1.00 34.20  ? 130  ARG A N   1 
ATOM   919   C  CA  . ARG A  1  128 ? 47.117  -86.177  42.577  1.00 33.41  ? 130  ARG A CA  1 
ATOM   920   C  C   . ARG A  1  128 ? 48.488  -86.768  42.302  1.00 33.16  ? 130  ARG A C   1 
ATOM   921   O  O   . ARG A  1  128 ? 48.762  -87.903  42.700  1.00 33.46  ? 130  ARG A O   1 
ATOM   922   C  CB  . ARG A  1  128 ? 47.170  -85.348  43.864  1.00 33.41  ? 130  ARG A CB  1 
ATOM   923   C  CG  . ARG A  1  128 ? 47.898  -86.028  44.994  1.00 32.15  ? 130  ARG A CG  1 
ATOM   924   C  CD  . ARG A  1  128 ? 48.140  -85.120  46.180  1.00 31.37  ? 130  ARG A CD  1 
ATOM   925   N  NE  . ARG A  1  128 ? 48.474  -85.909  47.368  1.00 30.01  ? 130  ARG A NE  1 
ATOM   926   C  CZ  . ARG A  1  128 ? 49.634  -86.544  47.538  1.00 30.95  ? 130  ARG A CZ  1 
ATOM   927   N  NH1 . ARG A  1  128 ? 50.569  -86.493  46.598  1.00 32.22  ? 130  ARG A NH1 1 
ATOM   928   N  NH2 . ARG A  1  128 ? 49.869  -87.242  48.636  1.00 29.69  ? 130  ARG A NH2 1 
ATOM   929   N  N   . PRO A  1  129 ? 49.370  -86.009  41.630  1.00 32.60  ? 131  PRO A N   1 
ATOM   930   C  CA  . PRO A  1  129 ? 50.729  -86.507  41.447  1.00 32.48  ? 131  PRO A CA  1 
ATOM   931   C  C   . PRO A  1  129 ? 51.433  -86.757  42.774  1.00 32.50  ? 131  PRO A C   1 
ATOM   932   O  O   . PRO A  1  129 ? 50.994  -86.262  43.801  1.00 32.11  ? 131  PRO A O   1 
ATOM   933   C  CB  . PRO A  1  129 ? 51.406  -85.371  40.684  1.00 32.34  ? 131  PRO A CB  1 
ATOM   934   C  CG  . PRO A  1  129 ? 50.312  -84.766  39.904  1.00 32.15  ? 131  PRO A CG  1 
ATOM   935   C  CD  . PRO A  1  129 ? 49.128  -84.796  40.834  1.00 32.45  ? 131  PRO A CD  1 
ATOM   936   N  N   . PHE A  1  130 ? 52.503  -87.544  42.751  1.00 33.01  ? 132  PHE A N   1 
ATOM   937   C  CA  . PHE A  1  130 ? 53.306  -87.752  43.945  1.00 33.27  ? 132  PHE A CA  1 
ATOM   938   C  C   . PHE A  1  130 ? 54.058  -86.462  44.236  1.00 33.62  ? 132  PHE A C   1 
ATOM   939   O  O   . PHE A  1  130 ? 54.542  -85.810  43.312  1.00 33.87  ? 132  PHE A O   1 
ATOM   940   C  CB  . PHE A  1  130 ? 54.291  -88.909  43.752  1.00 33.61  ? 132  PHE A CB  1 
ATOM   941   C  CG  . PHE A  1  130 ? 53.648  -90.275  43.814  1.00 34.48  ? 132  PHE A CG  1 
ATOM   942   C  CD1 . PHE A  1  130 ? 53.346  -90.978  42.642  1.00 34.28  ? 132  PHE A CD1 1 
ATOM   943   C  CD2 . PHE A  1  130 ? 53.345  -90.859  45.039  1.00 34.01  ? 132  PHE A CD2 1 
ATOM   944   C  CE1 . PHE A  1  130 ? 52.730  -92.229  42.694  1.00 33.86  ? 132  PHE A CE1 1 
ATOM   945   C  CE2 . PHE A  1  130 ? 52.733  -92.111  45.095  1.00 34.90  ? 132  PHE A CE2 1 
ATOM   946   C  CZ  . PHE A  1  130 ? 52.426  -92.798  43.917  1.00 33.64  ? 132  PHE A CZ  1 
ATOM   947   N  N   . GLY A  1  131 ? 54.149  -86.089  45.512  1.00 33.67  ? 133  GLY A N   1 
ATOM   948   C  CA  . GLY A  1  131 ? 54.840  -84.873  45.898  1.00 33.36  ? 133  GLY A CA  1 
ATOM   949   C  C   . GLY A  1  131 ? 56.312  -85.074  46.188  1.00 33.72  ? 133  GLY A C   1 
ATOM   950   O  O   . GLY A  1  131 ? 56.841  -84.472  47.127  1.00 34.39  ? 133  GLY A O   1 
ATOM   951   N  N   . VAL A  1  132 ? 56.998  -85.907  45.412  1.00 33.30  ? 134  VAL A N   1 
ATOM   952   C  CA  . VAL A  1  132 ? 58.420  -86.119  45.681  1.00 33.48  ? 134  VAL A CA  1 
ATOM   953   C  C   . VAL A  1  132 ? 59.288  -86.096  44.443  1.00 33.50  ? 134  VAL A C   1 
ATOM   954   O  O   . VAL A  1  132 ? 58.799  -86.285  43.335  1.00 33.70  ? 134  VAL A O   1 
ATOM   955   C  CB  . VAL A  1  132 ? 58.702  -87.461  46.414  1.00 33.89  ? 134  VAL A CB  1 
ATOM   956   C  CG1 . VAL A  1  132 ? 58.108  -87.464  47.833  1.00 33.63  ? 134  VAL A CG1 1 
ATOM   957   C  CG2 . VAL A  1  132 ? 58.213  -88.631  45.593  1.00 33.53  ? 134  VAL A CG2 1 
ATOM   958   N  N   . SER A  1  133 ? 60.579  -85.838  44.644  1.00 33.37  ? 135  SER A N   1 
ATOM   959   C  CA  . SER A  1  133 ? 61.589  -86.176  43.653  1.00 33.48  ? 135  SER A CA  1 
ATOM   960   C  C   . SER A  1  133 ? 62.514  -87.173  44.300  1.00 33.36  ? 135  SER A C   1 
ATOM   961   O  O   . SER A  1  133 ? 62.863  -87.028  45.472  1.00 33.87  ? 135  SER A O   1 
ATOM   962   C  CB  . SER A  1  133 ? 62.392  -84.955  43.209  1.00 33.65  ? 135  SER A CB  1 
ATOM   963   O  OG  . SER A  1  133 ? 61.782  -84.325  42.103  1.00 34.46  ? 135  SER A OG  1 
ATOM   964   N  N   . LEU A  1  134 ? 62.911  -88.188  43.550  1.00 32.97  ? 136  LEU A N   1 
ATOM   965   C  CA  . LEU A  1  134 ? 63.816  -89.178  44.093  1.00 32.84  ? 136  LEU A CA  1 
ATOM   966   C  C   . LEU A  1  134 ? 65.149  -89.113  43.386  1.00 32.53  ? 136  LEU A C   1 
ATOM   967   O  O   . LEU A  1  134 ? 65.222  -88.821  42.189  1.00 32.45  ? 136  LEU A O   1 
ATOM   968   C  CB  . LEU A  1  134 ? 63.252  -90.591  43.921  1.00 33.01  ? 136  LEU A CB  1 
ATOM   969   C  CG  . LEU A  1  134 ? 61.758  -90.874  44.001  1.00 33.20  ? 136  LEU A CG  1 
ATOM   970   C  CD1 . LEU A  1  134 ? 61.521  -92.322  43.594  1.00 35.29  ? 136  LEU A CD1 1 
ATOM   971   C  CD2 . LEU A  1  134 ? 61.252  -90.646  45.391  1.00 33.95  ? 136  LEU A CD2 1 
ATOM   972   N  N   . LEU A  1  135 ? 66.201  -89.390  44.141  1.00 32.18  ? 137  LEU A N   1 
ATOM   973   C  CA  . LEU A  1  135 ? 67.472  -89.759  43.558  1.00 31.91  ? 137  LEU A CA  1 
ATOM   974   C  C   . LEU A  1  135 ? 67.650  -91.244  43.796  1.00 32.04  ? 137  LEU A C   1 
ATOM   975   O  O   . LEU A  1  135 ? 67.431  -91.732  44.914  1.00 31.41  ? 137  LEU A O   1 
ATOM   976   C  CB  . LEU A  1  135 ? 68.620  -89.003  44.207  1.00 31.73  ? 137  LEU A CB  1 
ATOM   977   C  CG  . LEU A  1  135 ? 68.547  -87.488  44.088  1.00 31.10  ? 137  LEU A CG  1 
ATOM   978   C  CD1 . LEU A  1  135 ? 69.781  -86.881  44.762  1.00 29.81  ? 137  LEU A CD1 1 
ATOM   979   C  CD2 . LEU A  1  135 ? 68.388  -87.042  42.632  1.00 28.62  ? 137  LEU A CD2 1 
ATOM   980   N  N   . ILE A  1  136 ? 68.040  -91.946  42.736  1.00 32.06  ? 138  ILE A N   1 
ATOM   981   C  CA  . ILE A  1  136 ? 68.211  -93.376  42.775  1.00 32.26  ? 138  ILE A CA  1 
ATOM   982   C  C   . ILE A  1  136 ? 69.588  -93.684  42.261  1.00 33.10  ? 138  ILE A C   1 
ATOM   983   O  O   . ILE A  1  136 ? 69.939  -93.317  41.143  1.00 33.05  ? 138  ILE A O   1 
ATOM   984   C  CB  . ILE A  1  136 ? 67.146  -94.108  41.932  1.00 32.20  ? 138  ILE A CB  1 
ATOM   985   C  CG1 . ILE A  1  136 ? 65.761  -93.957  42.576  1.00 31.49  ? 138  ILE A CG1 1 
ATOM   986   C  CG2 . ILE A  1  136 ? 67.489  -95.587  41.798  1.00 31.38  ? 138  ILE A CG2 1 
ATOM   987   C  CD1 . ILE A  1  136 ? 64.606  -94.282  41.665  1.00 29.55  ? 138  ILE A CD1 1 
ATOM   988   N  N   . ALA A  1  137 ? 70.367  -94.364  43.095  1.00 34.27  ? 139  ALA A N   1 
ATOM   989   C  CA  . ALA A  1  137 ? 71.722  -94.755  42.758  1.00 35.21  ? 139  ALA A CA  1 
ATOM   990   C  C   . ALA A  1  137 ? 71.844  -96.273  42.761  1.00 35.98  ? 139  ALA A C   1 
ATOM   991   O  O   . ALA A  1  137 ? 71.294  -96.956  43.628  1.00 36.04  ? 139  ALA A O   1 
ATOM   992   C  CB  . ALA A  1  137 ? 72.699  -94.140  43.737  1.00 35.17  ? 139  ALA A CB  1 
ATOM   993   N  N   . GLY A  1  138 ? 72.565  -96.800  41.781  1.00 36.83  ? 140  GLY A N   1 
ATOM   994   C  CA  . GLY A  1  138 ? 72.742  -98.231  41.693  1.00 37.95  ? 140  GLY A CA  1 
ATOM   995   C  C   . GLY A  1  138 ? 73.939  -98.692  40.898  1.00 38.81  ? 140  GLY A C   1 
ATOM   996   O  O   . GLY A  1  138 ? 74.604  -97.909  40.213  1.00 39.06  ? 140  GLY A O   1 
ATOM   997   N  N   . HIS A  1  139 ? 74.207  -99.982  41.008  1.00 39.54  ? 141  HIS A N   1 
ATOM   998   C  CA  . HIS A  1  139 ? 75.170  -100.638 40.165  1.00 40.88  ? 141  HIS A CA  1 
ATOM   999   C  C   . HIS A  1  139 ? 74.517  -101.787 39.407  1.00 41.66  ? 141  HIS A C   1 
ATOM   1000  O  O   . HIS A  1  139 ? 73.574  -102.422 39.893  1.00 41.47  ? 141  HIS A O   1 
ATOM   1001  C  CB  . HIS A  1  139 ? 76.332  -101.176 41.011  1.00 41.05  ? 141  HIS A CB  1 
ATOM   1002  C  CG  . HIS A  1  139 ? 77.389  -101.857 40.200  1.00 41.49  ? 141  HIS A CG  1 
ATOM   1003  N  ND1 . HIS A  1  139 ? 77.388  -103.215 39.971  1.00 41.94  ? 141  HIS A ND1 1 
ATOM   1004  C  CD2 . HIS A  1  139 ? 78.446  -101.359 39.517  1.00 41.90  ? 141  HIS A CD2 1 
ATOM   1005  C  CE1 . HIS A  1  139 ? 78.416  -103.529 39.204  1.00 42.19  ? 141  HIS A CE1 1 
ATOM   1006  N  NE2 . HIS A  1  139 ? 79.072  -102.421 38.912  1.00 42.31  ? 141  HIS A NE2 1 
ATOM   1007  N  N   . ASP A  1  140 ? 75.018  -102.057 38.210  1.00 42.82  ? 142  ASP A N   1 
ATOM   1008  C  CA  . ASP A  1  140 ? 74.706  -103.321 37.558  1.00 44.26  ? 142  ASP A CA  1 
ATOM   1009  C  C   . ASP A  1  140 ? 75.842  -103.741 36.639  1.00 45.00  ? 142  ASP A C   1 
ATOM   1010  O  O   . ASP A  1  140 ? 76.630  -102.888 36.196  1.00 44.86  ? 142  ASP A O   1 
ATOM   1011  C  CB  . ASP A  1  140 ? 73.337  -103.297 36.855  1.00 44.45  ? 142  ASP A CB  1 
ATOM   1012  C  CG  . ASP A  1  140 ? 73.275  -102.317 35.721  1.00 45.53  ? 142  ASP A CG  1 
ATOM   1013  O  OD1 . ASP A  1  140 ? 73.861  -102.607 34.657  1.00 48.31  ? 142  ASP A OD1 1 
ATOM   1014  O  OD2 . ASP A  1  140 ? 72.618  -101.269 35.881  1.00 46.96  ? 142  ASP A OD2 1 
ATOM   1015  N  N   . GLU A  1  141 ? 75.922  -105.051 36.381  1.00 45.87  ? 143  GLU A N   1 
ATOM   1016  C  CA  . GLU A  1  141 ? 77.051  -105.664 35.675  1.00 47.04  ? 143  GLU A CA  1 
ATOM   1017  C  C   . GLU A  1  141 ? 77.416  -104.935 34.389  1.00 47.27  ? 143  GLU A C   1 
ATOM   1018  O  O   . GLU A  1  141 ? 78.588  -104.648 34.146  1.00 47.27  ? 143  GLU A O   1 
ATOM   1019  C  CB  . GLU A  1  141 ? 76.783  -107.143 35.379  1.00 47.23  ? 143  GLU A CB  1 
ATOM   1020  C  CG  . GLU A  1  141 ? 77.974  -107.875 34.749  1.00 49.93  ? 143  GLU A CG  1 
ATOM   1021  C  CD  . GLU A  1  141 ? 77.840  -109.407 34.743  1.00 53.15  ? 143  GLU A CD  1 
ATOM   1022  O  OE1 . GLU A  1  141 ? 78.869  -110.085 34.503  1.00 53.79  ? 143  GLU A OE1 1 
ATOM   1023  O  OE2 . GLU A  1  141 ? 76.721  -109.935 34.965  1.00 54.28  ? 143  GLU A OE2 1 
ATOM   1024  N  N   . PHE A  1  142 ? 76.405  -104.615 33.588  1.00 47.67  ? 144  PHE A N   1 
ATOM   1025  C  CA  . PHE A  1  142 ? 76.639  -104.134 32.232  1.00 48.14  ? 144  PHE A CA  1 
ATOM   1026  C  C   . PHE A  1  142 ? 76.678  -102.620 32.052  1.00 47.90  ? 144  PHE A C   1 
ATOM   1027  O  O   . PHE A  1  142 ? 77.237  -102.142 31.068  1.00 48.27  ? 144  PHE A O   1 
ATOM   1028  C  CB  . PHE A  1  142 ? 75.634  -104.761 31.264  1.00 48.52  ? 144  PHE A CB  1 
ATOM   1029  C  CG  . PHE A  1  142 ? 75.967  -106.185 30.884  1.00 49.95  ? 144  PHE A CG  1 
ATOM   1030  C  CD1 . PHE A  1  142 ? 75.523  -107.254 31.666  1.00 51.13  ? 144  PHE A CD1 1 
ATOM   1031  C  CD2 . PHE A  1  142 ? 76.726  -106.453 29.743  1.00 50.21  ? 144  PHE A CD2 1 
ATOM   1032  C  CE1 . PHE A  1  142 ? 75.828  -108.570 31.313  1.00 52.29  ? 144  PHE A CE1 1 
ATOM   1033  C  CE2 . PHE A  1  142 ? 77.037  -107.758 29.385  1.00 51.30  ? 144  PHE A CE2 1 
ATOM   1034  C  CZ  . PHE A  1  142 ? 76.586  -108.824 30.168  1.00 51.86  ? 144  PHE A CZ  1 
ATOM   1035  N  N   . ASN A  1  143 ? 76.090  -101.869 32.979  1.00 47.27  ? 145  ASN A N   1 
ATOM   1036  C  CA  . ASN A  1  143 ? 76.091  -100.409 32.873  1.00 46.50  ? 145  ASN A CA  1 
ATOM   1037  C  C   . ASN A  1  143 ? 77.023  -99.752  33.881  1.00 46.02  ? 145  ASN A C   1 
ATOM   1038  O  O   . ASN A  1  143 ? 77.283  -98.566  33.799  1.00 46.30  ? 145  ASN A O   1 
ATOM   1039  C  CB  . ASN A  1  143 ? 74.677  -99.839  33.022  1.00 46.53  ? 145  ASN A CB  1 
ATOM   1040  C  CG  . ASN A  1  143 ? 73.689  -100.438 32.030  1.00 46.42  ? 145  ASN A CG  1 
ATOM   1041  O  OD1 . ASN A  1  143 ? 73.646  -100.054 30.864  1.00 45.89  ? 145  ASN A OD1 1 
ATOM   1042  N  ND2 . ASN A  1  143 ? 72.877  -101.372 32.502  1.00 46.34  ? 145  ASN A ND2 1 
ATOM   1043  N  N   . GLY A  1  144 ? 77.532  -100.524 34.831  1.00 45.37  ? 146  GLY A N   1 
ATOM   1044  C  CA  . GLY A  1  144 ? 78.374  -99.968  35.880  1.00 44.28  ? 146  GLY A CA  1 
ATOM   1045  C  C   . GLY A  1  144 ? 77.552  -99.139  36.848  1.00 43.58  ? 146  GLY A C   1 
ATOM   1046  O  O   . GLY A  1  144 ? 76.377  -99.420  37.075  1.00 44.03  ? 146  GLY A O   1 
ATOM   1047  N  N   . PHE A  1  145 ? 78.168  -98.107  37.413  1.00 42.71  ? 147  PHE A N   1 
ATOM   1048  C  CA  . PHE A  1  145 ? 77.491  -97.243  38.372  1.00 41.05  ? 147  PHE A CA  1 
ATOM   1049  C  C   . PHE A  1  145 ? 76.606  -96.214  37.683  1.00 40.45  ? 147  PHE A C   1 
ATOM   1050  O  O   . PHE A  1  145 ? 76.859  -95.826  36.546  1.00 40.42  ? 147  PHE A O   1 
ATOM   1051  C  CB  . PHE A  1  145 ? 78.523  -96.578  39.276  1.00 40.82  ? 147  PHE A CB  1 
ATOM   1052  C  CG  . PHE A  1  145 ? 79.283  -97.553  40.122  1.00 39.91  ? 147  PHE A CG  1 
ATOM   1053  C  CD1 . PHE A  1  145 ? 80.517  -98.049  39.698  1.00 40.33  ? 147  PHE A CD1 1 
ATOM   1054  C  CD2 . PHE A  1  145 ? 78.758  -98.002  41.327  1.00 38.67  ? 147  PHE A CD2 1 
ATOM   1055  C  CE1 . PHE A  1  145 ? 81.232  -98.971  40.476  1.00 39.82  ? 147  PHE A CE1 1 
ATOM   1056  C  CE2 . PHE A  1  145 ? 79.458  -98.922  42.112  1.00 39.66  ? 147  PHE A CE2 1 
ATOM   1057  C  CZ  . PHE A  1  145 ? 80.703  -99.406  41.683  1.00 39.84  ? 147  PHE A CZ  1 
ATOM   1058  N  N   . SER A  1  146 A 75.543  -95.800  38.364  1.00 39.73  ? 147  SER A N   1 
ATOM   1059  C  CA  . SER A  1  146 A 74.673  -94.738  37.858  1.00 39.11  ? 147  SER A CA  1 
ATOM   1060  C  C   . SER A  1  146 A 73.856  -94.022  38.946  1.00 38.36  ? 147  SER A C   1 
ATOM   1061  O  O   . SER A  1  146 A 73.676  -94.523  40.059  1.00 38.10  ? 147  SER A O   1 
ATOM   1062  C  CB  . SER A  1  146 A 73.776  -95.226  36.702  1.00 39.44  ? 147  SER A CB  1 
ATOM   1063  O  OG  . SER A  1  146 A 73.459  -96.605  36.777  1.00 40.52  ? 147  SER A OG  1 
ATOM   1064  N  N   . LEU A  1  147 ? 73.402  -92.821  38.601  1.00 37.41  ? 148  LEU A N   1 
ATOM   1065  C  CA  . LEU A  1  147 ? 72.599  -91.983  39.478  1.00 36.30  ? 148  LEU A CA  1 
ATOM   1066  C  C   . LEU A  1  147 ? 71.515  -91.352  38.623  1.00 35.85  ? 148  LEU A C   1 
ATOM   1067  O  O   . LEU A  1  147 ? 71.778  -90.849  37.519  1.00 35.59  ? 148  LEU A O   1 
ATOM   1068  C  CB  . LEU A  1  147 ? 73.467  -90.915  40.145  1.00 35.95  ? 148  LEU A CB  1 
ATOM   1069  C  CG  . LEU A  1  147 ? 72.773  -89.789  40.912  1.00 36.30  ? 148  LEU A CG  1 
ATOM   1070  C  CD1 . LEU A  1  147 ? 72.191  -90.249  42.238  1.00 35.26  ? 148  LEU A CD1 1 
ATOM   1071  C  CD2 . LEU A  1  147 ? 73.746  -88.641  41.124  1.00 36.72  ? 148  LEU A CD2 1 
ATOM   1072  N  N   . TYR A  1  148 ? 70.289  -91.407  39.123  1.00 35.31  ? 149  TYR A N   1 
ATOM   1073  C  CA  . TYR A  1  148 ? 69.151  -90.898  38.386  1.00 35.11  ? 149  TYR A CA  1 
ATOM   1074  C  C   . TYR A  1  148 ? 68.270  -90.052  39.281  1.00 35.39  ? 149  TYR A C   1 
ATOM   1075  O  O   . TYR A  1  148 ? 68.089  -90.344  40.469  1.00 35.07  ? 149  TYR A O   1 
ATOM   1076  C  CB  . TYR A  1  148 ? 68.325  -92.041  37.781  1.00 35.00  ? 149  TYR A CB  1 
ATOM   1077  C  CG  . TYR A  1  148 ? 68.961  -92.721  36.584  1.00 34.00  ? 149  TYR A CG  1 
ATOM   1078  C  CD1 . TYR A  1  148 ? 68.659  -92.308  35.290  1.00 33.60  ? 149  TYR A CD1 1 
ATOM   1079  C  CD2 . TYR A  1  148 ? 69.862  -93.777  36.748  1.00 33.71  ? 149  TYR A CD2 1 
ATOM   1080  C  CE1 . TYR A  1  148 ? 69.243  -92.920  34.180  1.00 33.94  ? 149  TYR A CE1 1 
ATOM   1081  C  CE2 . TYR A  1  148 ? 70.461  -94.399  35.644  1.00 34.16  ? 149  TYR A CE2 1 
ATOM   1082  C  CZ  . TYR A  1  148 ? 70.137  -93.962  34.366  1.00 34.72  ? 149  TYR A CZ  1 
ATOM   1083  O  OH  . TYR A  1  148 ? 70.698  -94.557  33.268  1.00 35.59  ? 149  TYR A OH  1 
ATOM   1084  N  N   . GLN A  1  149 ? 67.730  -88.990  38.696  1.00 35.56  ? 150  GLN A N   1 
ATOM   1085  C  CA  . GLN A  1  149 ? 66.720  -88.214  39.361  1.00 35.77  ? 150  GLN A CA  1 
ATOM   1086  C  C   . GLN A  1  149 ? 65.378  -88.584  38.754  1.00 35.60  ? 150  GLN A C   1 
ATOM   1087  O  O   . GLN A  1  149 ? 65.290  -88.815  37.556  1.00 35.49  ? 150  GLN A O   1 
ATOM   1088  C  CB  . GLN A  1  149 ? 67.005  -86.729  39.183  1.00 35.79  ? 150  GLN A CB  1 
ATOM   1089  C  CG  . GLN A  1  149 ? 66.058  -85.838  39.956  1.00 37.41  ? 150  GLN A CG  1 
ATOM   1090  C  CD  . GLN A  1  149 ? 66.266  -84.360  39.676  1.00 40.81  ? 150  GLN A CD  1 
ATOM   1091  O  OE1 . GLN A  1  149 ? 67.336  -83.936  39.228  1.00 43.00  ? 150  GLN A OE1 1 
ATOM   1092  N  NE2 . GLN A  1  149 ? 65.238  -83.564  39.948  1.00 40.62  ? 150  GLN A NE2 1 
ATOM   1093  N  N   . VAL A  1  150 ? 64.336  -88.649  39.577  1.00 35.61  ? 151  VAL A N   1 
ATOM   1094  C  CA  . VAL A  1  150 ? 62.987  -88.849  39.057  1.00 35.62  ? 151  VAL A CA  1 
ATOM   1095  C  C   . VAL A  1  150 ? 62.072  -87.780  39.627  1.00 35.93  ? 151  VAL A C   1 
ATOM   1096  O  O   . VAL A  1  150 ? 62.100  -87.543  40.830  1.00 36.32  ? 151  VAL A O   1 
ATOM   1097  C  CB  . VAL A  1  150 ? 62.428  -90.256  39.405  1.00 35.55  ? 151  VAL A CB  1 
ATOM   1098  C  CG1 . VAL A  1  150 ? 61.195  -90.556  38.577  1.00 35.02  ? 151  VAL A CG1 1 
ATOM   1099  C  CG2 . VAL A  1  150 ? 63.474  -91.332  39.187  1.00 34.35  ? 151  VAL A CG2 1 
ATOM   1100  N  N   . ASP A  1  151 ? 61.263  -87.152  38.768  1.00 36.25  ? 152  ASP A N   1 
ATOM   1101  C  CA  . ASP A  1  151 ? 60.371  -86.051  39.156  1.00 36.93  ? 152  ASP A CA  1 
ATOM   1102  C  C   . ASP A  1  151 ? 58.891  -86.421  39.167  1.00 36.97  ? 152  ASP A C   1 
ATOM   1103  O  O   . ASP A  1  151 ? 58.494  -87.405  38.539  1.00 37.73  ? 152  ASP A O   1 
ATOM   1104  C  CB  . ASP A  1  151 ? 60.552  -84.881  38.202  1.00 37.53  ? 152  ASP A CB  1 
ATOM   1105  C  CG  . ASP A  1  151 ? 61.762  -84.036  38.537  1.00 39.71  ? 152  ASP A CG  1 
ATOM   1106  O  OD1 . ASP A  1  151 ? 62.121  -83.178  37.689  1.00 42.05  ? 152  ASP A OD1 1 
ATOM   1107  O  OD2 . ASP A  1  151 ? 62.358  -84.235  39.631  1.00 41.01  ? 152  ASP A OD2 1 
ATOM   1108  N  N   . PRO A  1  152 ? 58.056  -85.610  39.846  1.00 36.50  ? 153  PRO A N   1 
ATOM   1109  C  CA  . PRO A  1  152 ? 56.622  -85.901  39.969  1.00 35.92  ? 153  PRO A CA  1 
ATOM   1110  C  C   . PRO A  1  152 ? 55.900  -86.086  38.628  1.00 35.64  ? 153  PRO A C   1 
ATOM   1111  O  O   . PRO A  1  152 ? 54.817  -86.682  38.592  1.00 35.52  ? 153  PRO A O   1 
ATOM   1112  C  CB  . PRO A  1  152 ? 56.072  -84.669  40.685  1.00 36.16  ? 153  PRO A CB  1 
ATOM   1113  C  CG  . PRO A  1  152 ? 57.232  -84.073  41.385  1.00 36.08  ? 153  PRO A CG  1 
ATOM   1114  C  CD  . PRO A  1  152 ? 58.438  -84.385  40.575  1.00 36.29  ? 153  PRO A CD  1 
ATOM   1115  N  N   . SER A  1  153 ? 56.484  -85.591  37.538  1.00 35.23  ? 154  SER A N   1 
ATOM   1116  C  CA  . SER A  1  153 ? 55.860  -85.736  36.220  1.00 34.88  ? 154  SER A CA  1 
ATOM   1117  C  C   . SER A  1  153 ? 56.129  -87.116  35.658  1.00 35.09  ? 154  SER A C   1 
ATOM   1118  O  O   . SER A  1  153 ? 55.441  -87.562  34.739  1.00 35.18  ? 154  SER A O   1 
ATOM   1119  C  CB  . SER A  1  153 ? 56.408  -84.708  35.249  1.00 34.51  ? 154  SER A CB  1 
ATOM   1120  O  OG  . SER A  1  153 ? 57.762  -84.991  34.980  1.00 34.49  ? 154  SER A OG  1 
ATOM   1121  N  N   . GLY A  1  154 ? 57.150  -87.772  36.202  1.00 35.08  ? 155  GLY A N   1 
ATOM   1122  C  CA  . GLY A  1  154 ? 57.613  -89.047  35.688  1.00 35.51  ? 155  GLY A CA  1 
ATOM   1123  C  C   . GLY A  1  154 ? 58.898  -88.985  34.880  1.00 35.89  ? 155  GLY A C   1 
ATOM   1124  O  O   . GLY A  1  154 ? 59.398  -90.019  34.448  1.00 36.02  ? 155  GLY A O   1 
ATOM   1125  N  N   . SER A  1  155 ? 59.423  -87.779  34.660  1.00 36.31  ? 156  SER A N   1 
ATOM   1126  C  CA  . SER A  1  155 ? 60.698  -87.595  33.963  1.00 36.63  ? 156  SER A CA  1 
ATOM   1127  C  C   . SER A  1  155 ? 61.819  -88.092  34.815  1.00 36.81  ? 156  SER A C   1 
ATOM   1128  O  O   . SER A  1  155 ? 61.762  -88.031  36.036  1.00 37.27  ? 156  SER A O   1 
ATOM   1129  C  CB  . SER A  1  155 ? 60.970  -86.130  33.665  1.00 36.24  ? 156  SER A CB  1 
ATOM   1130  O  OG  . SER A  1  155 ? 59.879  -85.570  32.976  1.00 38.05  ? 156  SER A OG  1 
ATOM   1131  N  N   . TYR A  1  156 ? 62.846  -88.592  34.162  1.00 37.27  ? 157  TYR A N   1 
ATOM   1132  C  CA  . TYR A  1  156 ? 64.047  -88.970  34.855  1.00 37.75  ? 157  TYR A CA  1 
ATOM   1133  C  C   . TYR A  1  156 ? 65.242  -88.640  33.971  1.00 38.07  ? 157  TYR A C   1 
ATOM   1134  O  O   . TYR A  1  156 ? 65.117  -88.531  32.747  1.00 38.06  ? 157  TYR A O   1 
ATOM   1135  C  CB  . TYR A  1  156 ? 64.006  -90.452  35.274  1.00 37.81  ? 157  TYR A CB  1 
ATOM   1136  C  CG  . TYR A  1  156 ? 63.904  -91.447  34.138  1.00 37.72  ? 157  TYR A CG  1 
ATOM   1137  C  CD1 . TYR A  1  156 ? 65.051  -91.902  33.478  1.00 37.70  ? 157  TYR A CD1 1 
ATOM   1138  C  CD2 . TYR A  1  156 ? 62.664  -91.940  33.730  1.00 37.88  ? 157  TYR A CD2 1 
ATOM   1139  C  CE1 . TYR A  1  156 ? 64.966  -92.814  32.437  1.00 38.50  ? 157  TYR A CE1 1 
ATOM   1140  C  CE2 . TYR A  1  156 ? 62.562  -92.862  32.689  1.00 38.77  ? 157  TYR A CE2 1 
ATOM   1141  C  CZ  . TYR A  1  156 ? 63.719  -93.290  32.047  1.00 39.37  ? 157  TYR A CZ  1 
ATOM   1142  O  OH  . TYR A  1  156 ? 63.635  -94.190  31.017  1.00 40.50  ? 157  TYR A OH  1 
ATOM   1143  N  N   . PHE A  1  157 ? 66.388  -88.439  34.605  1.00 38.58  ? 158  PHE A N   1 
ATOM   1144  C  CA  . PHE A  1  157 ? 67.604  -88.086  33.892  1.00 39.26  ? 158  PHE A CA  1 
ATOM   1145  C  C   . PHE A  1  157 ? 68.784  -88.584  34.699  1.00 39.28  ? 158  PHE A C   1 
ATOM   1146  O  O   . PHE A  1  157 ? 68.707  -88.657  35.931  1.00 39.33  ? 158  PHE A O   1 
ATOM   1147  C  CB  . PHE A  1  157 ? 67.730  -86.561  33.681  1.00 39.65  ? 158  PHE A CB  1 
ATOM   1148  C  CG  . PHE A  1  157 ? 66.523  -85.770  34.120  1.00 40.11  ? 158  PHE A CG  1 
ATOM   1149  C  CD1 . PHE A  1  157 ? 66.279  -85.553  35.472  1.00 41.97  ? 158  PHE A CD1 1 
ATOM   1150  C  CD2 . PHE A  1  157 ? 65.652  -85.222  33.187  1.00 40.95  ? 158  PHE A CD2 1 
ATOM   1151  C  CE1 . PHE A  1  157 ? 65.157  -84.819  35.899  1.00 43.83  ? 158  PHE A CE1 1 
ATOM   1152  C  CE2 . PHE A  1  157 ? 64.537  -84.483  33.595  1.00 42.34  ? 158  PHE A CE2 1 
ATOM   1153  C  CZ  . PHE A  1  157 ? 64.284  -84.287  34.961  1.00 43.12  ? 158  PHE A CZ  1 
ATOM   1154  N  N   . PRO A  1  158 ? 69.873  -88.946  34.009  1.00 39.38  ? 159  PRO A N   1 
ATOM   1155  C  CA  . PRO A  1  158 ? 71.082  -89.396  34.668  1.00 39.77  ? 159  PRO A CA  1 
ATOM   1156  C  C   . PRO A  1  158 ? 71.979  -88.219  35.037  1.00 40.33  ? 159  PRO A C   1 
ATOM   1157  O  O   . PRO A  1  158 ? 72.090  -87.260  34.266  1.00 40.54  ? 159  PRO A O   1 
ATOM   1158  C  CB  . PRO A  1  158 ? 71.746  -90.273  33.606  1.00 39.71  ? 159  PRO A CB  1 
ATOM   1159  C  CG  . PRO A  1  158 ? 71.262  -89.750  32.313  1.00 39.18  ? 159  PRO A CG  1 
ATOM   1160  C  CD  . PRO A  1  158 ? 69.984  -89.013  32.542  1.00 39.45  ? 159  PRO A CD  1 
ATOM   1161  N  N   . TRP A  1  159 ? 72.604  -88.296  36.209  1.00 40.71  ? 160  TRP A N   1 
ATOM   1162  C  CA  . TRP A  1  159 ? 73.459  -87.225  36.707  1.00 41.06  ? 160  TRP A CA  1 
ATOM   1163  C  C   . TRP A  1  159 ? 74.821  -87.752  37.121  1.00 41.35  ? 160  TRP A C   1 
ATOM   1164  O  O   . TRP A  1  159 ? 74.944  -88.884  37.611  1.00 41.71  ? 160  TRP A O   1 
ATOM   1165  C  CB  . TRP A  1  159 ? 72.828  -86.568  37.932  1.00 41.02  ? 160  TRP A CB  1 
ATOM   1166  C  CG  . TRP A  1  159 ? 71.625  -85.770  37.657  1.00 41.15  ? 160  TRP A CG  1 
ATOM   1167  C  CD1 . TRP A  1  159 ? 70.337  -86.144  37.863  1.00 41.45  ? 160  TRP A CD1 1 
ATOM   1168  C  CD2 . TRP A  1  159 ? 71.582  -84.440  37.141  1.00 42.24  ? 160  TRP A CD2 1 
ATOM   1169  N  NE1 . TRP A  1  159 ? 69.484  -85.132  37.505  1.00 41.47  ? 160  TRP A NE1 1 
ATOM   1170  C  CE2 . TRP A  1  159 ? 70.222  -84.072  37.057  1.00 42.21  ? 160  TRP A CE2 1 
ATOM   1171  C  CE3 . TRP A  1  159 ? 72.562  -83.519  36.741  1.00 42.82  ? 160  TRP A CE3 1 
ATOM   1172  C  CZ2 . TRP A  1  159 ? 69.811  -82.824  36.586  1.00 42.93  ? 160  TRP A CZ2 1 
ATOM   1173  C  CZ3 . TRP A  1  159 ? 72.156  -82.279  36.274  1.00 43.20  ? 160  TRP A CZ3 1 
ATOM   1174  C  CH2 . TRP A  1  159 ? 70.788  -81.942  36.200  1.00 43.63  ? 160  TRP A CH2 1 
ATOM   1175  N  N   . LYS A  1  160 ? 75.840  -86.916  36.953  1.00 41.30  ? 161  LYS A N   1 
ATOM   1176  C  CA  . LYS A  1  160 ? 77.154  -87.202  37.504  1.00 41.36  ? 161  LYS A CA  1 
ATOM   1177  C  C   . LYS A  1  160 ? 77.093  -86.859  38.981  1.00 40.97  ? 161  LYS A C   1 
ATOM   1178  O  O   . LYS A  1  160 ? 77.664  -87.552  39.826  1.00 41.03  ? 161  LYS A O   1 
ATOM   1179  C  CB  . LYS A  1  160 ? 78.228  -86.391  36.777  1.00 41.50  ? 161  LYS A CB  1 
ATOM   1180  C  CG  . LYS A  1  160 ? 78.450  -86.861  35.340  1.00 43.26  ? 161  LYS A CG  1 
ATOM   1181  C  CD  . LYS A  1  160 ? 79.052  -85.777  34.459  1.00 47.02  ? 161  LYS A CD  1 
ATOM   1182  C  CE  . LYS A  1  160 ? 79.311  -86.313  33.048  1.00 48.65  ? 161  LYS A CE  1 
ATOM   1183  N  NZ  . LYS A  1  160 ? 79.923  -85.295  32.138  1.00 49.03  ? 161  LYS A NZ  1 
ATOM   1184  N  N   . ALA A  1  161 ? 76.382  -85.776  39.271  1.00 40.73  ? 162  ALA A N   1 
ATOM   1185  C  CA  . ALA A  1  161 ? 76.082  -85.352  40.627  1.00 40.45  ? 162  ALA A CA  1 
ATOM   1186  C  C   . ALA A  1  161 ? 74.929  -84.379  40.554  1.00 40.11  ? 162  ALA A C   1 
ATOM   1187  O  O   . ALA A  1  161 ? 74.788  -83.658  39.562  1.00 40.19  ? 162  ALA A O   1 
ATOM   1188  C  CB  . ALA A  1  161 ? 77.290  -84.699  41.281  1.00 40.62  ? 162  ALA A CB  1 
ATOM   1189  N  N   . THR A  1  162 ? 74.083  -84.384  41.581  1.00 39.66  ? 163  THR A N   1 
ATOM   1190  C  CA  . THR A  1  162 ? 73.007  -83.405  41.680  1.00 39.53  ? 163  THR A CA  1 
ATOM   1191  C  C   . THR A  1  162 ? 72.459  -83.304  43.094  1.00 39.46  ? 163  THR A C   1 
ATOM   1192  O  O   . THR A  1  162 ? 72.785  -84.123  43.955  1.00 39.72  ? 163  THR A O   1 
ATOM   1193  C  CB  . THR A  1  162 ? 71.857  -83.691  40.700  1.00 39.44  ? 163  THR A CB  1 
ATOM   1194  O  OG1 . THR A  1  162 ? 70.998  -82.546  40.640  1.00 40.46  ? 163  THR A OG1 1 
ATOM   1195  C  CG2 . THR A  1  162 ? 71.054  -84.894  41.141  1.00 39.10  ? 163  THR A CG2 1 
ATOM   1196  N  N   . ALA A  1  163 ? 71.631  -82.291  43.323  1.00 39.13  ? 164  ALA A N   1 
ATOM   1197  C  CA  . ALA A  1  163 ? 70.985  -82.100  44.608  1.00 39.13  ? 164  ALA A CA  1 
ATOM   1198  C  C   . ALA A  1  163 ? 69.550  -81.695  44.361  1.00 39.10  ? 164  ALA A C   1 
ATOM   1199  O  O   . ALA A  1  163 ? 69.245  -81.141  43.308  1.00 39.03  ? 164  ALA A O   1 
ATOM   1200  C  CB  . ALA A  1  163 ? 71.704  -81.035  45.406  1.00 38.94  ? 164  ALA A CB  1 
ATOM   1201  N  N   . ILE A  1  164 ? 68.677  -81.979  45.327  1.00 39.19  ? 165  ILE A N   1 
ATOM   1202  C  CA  . ILE A  1  164 ? 67.249  -81.640  45.230  1.00 39.44  ? 165  ILE A CA  1 
ATOM   1203  C  C   . ILE A  1  164 ? 66.731  -81.067  46.559  1.00 39.89  ? 165  ILE A C   1 
ATOM   1204  O  O   . ILE A  1  164 ? 67.372  -81.238  47.603  1.00 39.94  ? 165  ILE A O   1 
ATOM   1205  C  CB  . ILE A  1  164 ? 66.379  -82.859  44.757  1.00 39.60  ? 165  ILE A CB  1 
ATOM   1206  C  CG1 . ILE A  1  164 ? 66.776  -84.149  45.501  1.00 39.23  ? 165  ILE A CG1 1 
ATOM   1207  C  CG2 . ILE A  1  164 ? 66.469  -83.043  43.228  1.00 38.76  ? 165  ILE A CG2 1 
ATOM   1208  C  CD1 . ILE A  1  164 ? 65.835  -85.321  45.283  1.00 39.31  ? 165  ILE A CD1 1 
ATOM   1209  N  N   . GLY A  1  165 ? 65.584  -80.391  46.517  1.00 40.38  ? 166  GLY A N   1 
ATOM   1210  C  CA  . GLY A  1  165 ? 65.001  -79.776  47.715  1.00 41.67  ? 166  GLY A CA  1 
ATOM   1211  C  C   . GLY A  1  165 ? 65.489  -78.354  47.981  1.00 42.57  ? 166  GLY A C   1 
ATOM   1212  O  O   . GLY A  1  165 ? 65.992  -77.688  47.077  1.00 42.63  ? 166  GLY A O   1 
ATOM   1213  N  N   . LYS A  1  166 ? 65.347  -77.899  49.226  1.00 43.34  ? 167  LYS A N   1 
ATOM   1214  C  CA  . LYS A  1  166 ? 65.697  -76.525  49.641  1.00 44.35  ? 167  LYS A CA  1 
ATOM   1215  C  C   . LYS A  1  166 ? 66.910  -75.872  48.967  1.00 44.53  ? 167  LYS A C   1 
ATOM   1216  O  O   . LYS A  1  166 ? 66.752  -75.010  48.094  1.00 45.37  ? 167  LYS A O   1 
ATOM   1217  C  CB  . LYS A  1  166 ? 65.871  -76.443  51.153  1.00 44.62  ? 167  LYS A CB  1 
ATOM   1218  C  CG  . LYS A  1  166 ? 64.759  -75.731  51.862  1.00 46.69  ? 167  LYS A CG  1 
ATOM   1219  C  CD  . LYS A  1  166 ? 64.856  -75.932  53.380  1.00 49.63  ? 167  LYS A CD  1 
ATOM   1220  C  CE  . LYS A  1  166 ? 63.843  -75.047  54.134  1.00 51.82  ? 167  LYS A CE  1 
ATOM   1221  N  NZ  . LYS A  1  166 ? 62.433  -75.045  53.560  1.00 51.84  ? 167  LYS A NZ  1 
ATOM   1222  N  N   . GLY A  1  167 ? 68.117  -76.249  49.366  1.00 44.10  ? 168  GLY A N   1 
ATOM   1223  C  CA  . GLY A  1  167 ? 69.278  -75.491  48.908  1.00 43.66  ? 168  GLY A CA  1 
ATOM   1224  C  C   . GLY A  1  167 ? 69.837  -75.982  47.594  1.00 43.41  ? 168  GLY A C   1 
ATOM   1225  O  O   . GLY A  1  167 ? 71.046  -75.878  47.351  1.00 43.28  ? 168  GLY A O   1 
ATOM   1226  N  N   . SER A  1  168 ? 68.961  -76.523  46.749  1.00 43.12  ? 169  SER A N   1 
ATOM   1227  C  CA  . SER A  1  168 ? 69.405  -77.307  45.597  1.00 42.66  ? 169  SER A CA  1 
ATOM   1228  C  C   . SER A  1  168 ? 70.230  -76.488  44.606  1.00 42.80  ? 169  SER A C   1 
ATOM   1229  O  O   . SER A  1  168 ? 71.238  -76.977  44.102  1.00 42.69  ? 169  SER A O   1 
ATOM   1230  C  CB  . SER A  1  168 ? 68.245  -78.058  44.914  1.00 42.16  ? 169  SER A CB  1 
ATOM   1231  O  OG  . SER A  1  168 ? 67.132  -77.228  44.646  1.00 40.66  ? 169  SER A OG  1 
ATOM   1232  N  N   . VAL A  1  169 ? 69.832  -75.236  44.373  1.00 42.99  ? 170  VAL A N   1 
ATOM   1233  C  CA  . VAL A  1  169 ? 70.567  -74.358  43.444  1.00 43.38  ? 170  VAL A CA  1 
ATOM   1234  C  C   . VAL A  1  169 ? 72.002  -74.038  43.897  1.00 43.38  ? 170  VAL A C   1 
ATOM   1235  O  O   . VAL A  1  169 ? 72.924  -74.101  43.088  1.00 43.04  ? 170  VAL A O   1 
ATOM   1236  C  CB  . VAL A  1  169 ? 69.792  -73.070  43.092  1.00 43.49  ? 170  VAL A CB  1 
ATOM   1237  C  CG1 . VAL A  1  169 ? 70.341  -72.486  41.796  1.00 43.27  ? 170  VAL A CG1 1 
ATOM   1238  C  CG2 . VAL A  1  169 ? 68.283  -73.368  42.940  1.00 43.38  ? 170  VAL A CG2 1 
ATOM   1239  N  N   . ALA A  1  170 ? 72.181  -73.711  45.179  1.00 43.74  ? 171  ALA A N   1 
ATOM   1240  C  CA  . ALA A  1  170 ? 73.515  -73.456  45.743  1.00 44.34  ? 171  ALA A CA  1 
ATOM   1241  C  C   . ALA A  1  170 ? 74.364  -74.726  45.762  1.00 44.96  ? 171  ALA A C   1 
ATOM   1242  O  O   . ALA A  1  170 ? 75.573  -74.694  45.465  1.00 45.39  ? 171  ALA A O   1 
ATOM   1243  C  CB  . ALA A  1  170 ? 73.415  -72.857  47.154  1.00 43.90  ? 171  ALA A CB  1 
ATOM   1244  N  N   . ALA A  1  171 ? 73.719  -75.842  46.107  1.00 45.53  ? 172  ALA A N   1 
ATOM   1245  C  CA  . ALA A  1  171 ? 74.384  -77.136  46.218  1.00 45.59  ? 172  ALA A CA  1 
ATOM   1246  C  C   . ALA A  1  171 ? 74.782  -77.657  44.847  1.00 45.81  ? 172  ALA A C   1 
ATOM   1247  O  O   . ALA A  1  171 ? 75.878  -78.183  44.689  1.00 45.54  ? 172  ALA A O   1 
ATOM   1248  C  CB  . ALA A  1  171 ? 73.504  -78.132  46.958  1.00 45.31  ? 172  ALA A CB  1 
ATOM   1249  N  N   . LYS A  1  172 ? 73.913  -77.482  43.852  1.00 46.59  ? 173  LYS A N   1 
ATOM   1250  C  CA  . LYS A  1  172 ? 74.264  -77.850  42.482  1.00 47.83  ? 173  LYS A CA  1 
ATOM   1251  C  C   . LYS A  1  172 ? 75.488  -77.059  42.034  1.00 48.92  ? 173  LYS A C   1 
ATOM   1252  O  O   . LYS A  1  172 ? 76.342  -77.589  41.324  1.00 49.31  ? 173  LYS A O   1 
ATOM   1253  C  CB  . LYS A  1  172 ? 73.106  -77.645  41.492  1.00 47.61  ? 173  LYS A CB  1 
ATOM   1254  C  CG  . LYS A  1  172 ? 71.948  -78.647  41.613  1.00 47.63  ? 173  LYS A CG  1 
ATOM   1255  C  CD  . LYS A  1  172 ? 71.318  -79.003  40.259  1.00 48.83  ? 173  LYS A CD  1 
ATOM   1256  C  CE  . LYS A  1  172 ? 70.380  -77.918  39.694  1.00 50.94  ? 173  LYS A CE  1 
ATOM   1257  N  NZ  . LYS A  1  172 ? 69.213  -77.582  40.571  1.00 51.33  ? 173  LYS A NZ  1 
ATOM   1258  N  N   . THR A  1  173 ? 75.570  -75.793  42.454  1.00 50.13  ? 174  THR A N   1 
ATOM   1259  C  CA  . THR A  1  173 ? 76.732  -74.951  42.162  1.00 51.27  ? 174  THR A CA  1 
ATOM   1260  C  C   . THR A  1  173 ? 77.966  -75.499  42.863  1.00 52.00  ? 174  THR A C   1 
ATOM   1261  O  O   . THR A  1  173 ? 79.001  -75.675  42.223  1.00 51.95  ? 174  THR A O   1 
ATOM   1262  C  CB  . THR A  1  173 ? 76.502  -73.448  42.518  1.00 51.44  ? 174  THR A CB  1 
ATOM   1263  O  OG1 . THR A  1  173 ? 75.547  -72.886  41.613  1.00 51.44  ? 174  THR A OG1 1 
ATOM   1264  C  CG2 . THR A  1  173 ? 77.793  -72.642  42.400  1.00 50.88  ? 174  THR A CG2 1 
ATOM   1265  N  N   . PHE A  1  174 ? 77.857  -75.794  44.158  1.00 53.06  ? 175  PHE A N   1 
ATOM   1266  C  CA  . PHE A  1  174 ? 79.010  -76.332  44.876  1.00 54.68  ? 175  PHE A CA  1 
ATOM   1267  C  C   . PHE A  1  174 ? 79.505  -77.671  44.300  1.00 55.30  ? 175  PHE A C   1 
ATOM   1268  O  O   . PHE A  1  174 ? 80.704  -77.967  44.340  1.00 55.54  ? 175  PHE A O   1 
ATOM   1269  C  CB  . PHE A  1  174 ? 78.787  -76.407  46.397  1.00 54.94  ? 175  PHE A CB  1 
ATOM   1270  C  CG  . PHE A  1  174 ? 80.060  -76.685  47.186  1.00 57.45  ? 175  PHE A CG  1 
ATOM   1271  C  CD1 . PHE A  1  174 ? 81.312  -76.207  46.734  1.00 59.55  ? 175  PHE A CD1 1 
ATOM   1272  C  CD2 . PHE A  1  174 ? 80.019  -77.406  48.375  1.00 58.99  ? 175  PHE A CD2 1 
ATOM   1273  C  CE1 . PHE A  1  174 ? 82.500  -76.463  47.444  1.00 59.94  ? 175  PHE A CE1 1 
ATOM   1274  C  CE2 . PHE A  1  174 ? 81.199  -77.662  49.101  1.00 59.86  ? 175  PHE A CE2 1 
ATOM   1275  C  CZ  . PHE A  1  174 ? 82.442  -77.187  48.631  1.00 60.51  ? 175  PHE A CZ  1 
ATOM   1276  N  N   . LEU A  1  175 ? 78.593  -78.463  43.744  1.00 55.98  ? 176  LEU A N   1 
ATOM   1277  C  CA  . LEU A  1  175 ? 78.976  -79.736  43.148  1.00 56.47  ? 176  LEU A CA  1 
ATOM   1278  C  C   . LEU A  1  175 ? 79.661  -79.515  41.803  1.00 57.36  ? 176  LEU A C   1 
ATOM   1279  O  O   . LEU A  1  175 ? 80.687  -80.129  41.511  1.00 57.35  ? 176  LEU A O   1 
ATOM   1280  C  CB  . LEU A  1  175 ? 77.768  -80.674  43.021  1.00 56.06  ? 176  LEU A CB  1 
ATOM   1281  C  CG  . LEU A  1  175 ? 77.077  -81.123  44.317  1.00 55.06  ? 176  LEU A CG  1 
ATOM   1282  C  CD1 . LEU A  1  175 ? 75.816  -81.923  44.026  1.00 53.75  ? 176  LEU A CD1 1 
ATOM   1283  C  CD2 . LEU A  1  175 ? 78.008  -81.903  45.230  1.00 54.40  ? 176  LEU A CD2 1 
ATOM   1284  N  N   . GLU A  1  176 ? 79.107  -78.603  41.010  1.00 58.62  ? 177  GLU A N   1 
ATOM   1285  C  CA  . GLU A  1  176 ? 79.600  -78.301  39.665  1.00 59.86  ? 177  GLU A CA  1 
ATOM   1286  C  C   . GLU A  1  176 ? 81.056  -77.849  39.673  1.00 60.42  ? 177  GLU A C   1 
ATOM   1287  O  O   . GLU A  1  176 ? 81.770  -78.034  38.689  1.00 60.63  ? 177  GLU A O   1 
ATOM   1288  C  CB  . GLU A  1  176 ? 78.734  -77.213  39.052  1.00 60.11  ? 177  GLU A CB  1 
ATOM   1289  C  CG  . GLU A  1  176 ? 78.654  -77.223  37.541  1.00 62.23  ? 177  GLU A CG  1 
ATOM   1290  C  CD  . GLU A  1  176 ? 77.614  -76.229  37.023  1.00 64.49  ? 177  GLU A CD  1 
ATOM   1291  O  OE1 . GLU A  1  176 ? 78.023  -75.239  36.369  1.00 64.20  ? 177  GLU A OE1 1 
ATOM   1292  O  OE2 . GLU A  1  176 ? 76.399  -76.428  37.297  1.00 64.68  ? 177  GLU A OE2 1 
ATOM   1293  N  N   . LYS A  1  177 ? 81.484  -77.255  40.789  1.00 60.97  ? 178  LYS A N   1 
ATOM   1294  C  CA  . LYS A  1  177 ? 82.861  -76.815  40.965  1.00 61.38  ? 178  LYS A CA  1 
ATOM   1295  C  C   . LYS A  1  177 ? 83.760  -77.975  41.335  1.00 61.16  ? 178  LYS A C   1 
ATOM   1296  O  O   . LYS A  1  177 ? 84.889  -78.074  40.846  1.00 61.41  ? 178  LYS A O   1 
ATOM   1297  C  CB  . LYS A  1  177 ? 82.954  -75.753  42.065  1.00 61.67  ? 178  LYS A CB  1 
ATOM   1298  C  CG  . LYS A  1  177 ? 82.856  -74.319  41.569  1.00 63.53  ? 178  LYS A CG  1 
ATOM   1299  C  CD  . LYS A  1  177 ? 83.382  -73.336  42.634  1.00 67.24  ? 178  LYS A CD  1 
ATOM   1300  C  CE  . LYS A  1  177 ? 83.340  -71.866  42.151  1.00 69.15  ? 178  LYS A CE  1 
ATOM   1301  N  NZ  . LYS A  1  177 ? 81.952  -71.405  41.772  1.00 69.50  ? 178  LYS A NZ  1 
ATOM   1302  N  N   . ARG A  1  178 ? 83.237  -78.856  42.184  1.00 60.80  ? 179  ARG A N   1 
ATOM   1303  C  CA  . ARG A  1  178 ? 84.037  -79.844  42.905  1.00 60.34  ? 179  ARG A CA  1 
ATOM   1304  C  C   . ARG A  1  178 ? 84.166  -81.230  42.254  1.00 59.71  ? 179  ARG A C   1 
ATOM   1305  O  O   . ARG A  1  178 ? 85.079  -81.986  42.587  1.00 59.39  ? 179  ARG A O   1 
ATOM   1306  C  CB  . ARG A  1  178 ? 83.498  -79.977  44.332  1.00 60.45  ? 179  ARG A CB  1 
ATOM   1307  C  CG  . ARG A  1  178 ? 84.064  -78.968  45.303  1.00 61.89  ? 179  ARG A CG  1 
ATOM   1308  C  CD  . ARG A  1  178 ? 85.485  -79.359  45.684  1.00 64.95  ? 179  ARG A CD  1 
ATOM   1309  N  NE  . ARG A  1  178 ? 85.908  -78.757  46.948  1.00 67.01  ? 179  ARG A NE  1 
ATOM   1310  C  CZ  . ARG A  1  178 ? 86.601  -79.398  47.889  1.00 67.56  ? 179  ARG A CZ  1 
ATOM   1311  N  NH1 . ARG A  1  178 ? 86.939  -80.679  47.730  1.00 67.66  ? 179  ARG A NH1 1 
ATOM   1312  N  NH2 . ARG A  1  178 ? 86.944  -78.760  49.002  1.00 67.97  ? 179  ARG A NH2 1 
ATOM   1313  N  N   . TRP A  1  179 ? 83.263  -81.547  41.328  1.00 59.27  ? 180  TRP A N   1 
ATOM   1314  C  CA  . TRP A  1  179 ? 83.207  -82.866  40.687  1.00 58.86  ? 180  TRP A CA  1 
ATOM   1315  C  C   . TRP A  1  179 ? 84.192  -83.018  39.524  1.00 58.77  ? 180  TRP A C   1 
ATOM   1316  O  O   . TRP A  1  179 ? 84.393  -82.089  38.751  1.00 58.53  ? 180  TRP A O   1 
ATOM   1317  C  CB  . TRP A  1  179 ? 81.776  -83.154  40.195  1.00 58.60  ? 180  TRP A CB  1 
ATOM   1318  C  CG  . TRP A  1  179 ? 81.562  -84.577  39.725  1.00 58.45  ? 180  TRP A CG  1 
ATOM   1319  C  CD1 . TRP A  1  179 ? 81.107  -85.624  40.475  1.00 57.57  ? 180  TRP A CD1 1 
ATOM   1320  C  CD2 . TRP A  1  179 ? 81.805  -85.104  38.408  1.00 57.71  ? 180  TRP A CD2 1 
ATOM   1321  N  NE1 . TRP A  1  179 ? 81.052  -86.764  39.712  1.00 57.55  ? 180  TRP A NE1 1 
ATOM   1322  C  CE2 . TRP A  1  179 ? 81.476  -86.477  38.442  1.00 57.58  ? 180  TRP A CE2 1 
ATOM   1323  C  CE3 . TRP A  1  179 ? 82.268  -84.547  37.207  1.00 57.60  ? 180  TRP A CE3 1 
ATOM   1324  C  CZ2 . TRP A  1  179 ? 81.601  -87.309  37.323  1.00 58.59  ? 180  TRP A CZ2 1 
ATOM   1325  C  CZ3 . TRP A  1  179 ? 82.392  -85.370  36.093  1.00 58.72  ? 180  TRP A CZ3 1 
ATOM   1326  C  CH2 . TRP A  1  179 ? 82.059  -86.741  36.159  1.00 59.37  ? 180  TRP A CH2 1 
ATOM   1327  N  N   . ASN A  1  180 ? 84.789  -84.202  39.410  1.00 58.97  ? 181  ASN A N   1 
ATOM   1328  C  CA  . ASN A  1  180 ? 85.548  -84.608  38.221  1.00 59.53  ? 181  ASN A CA  1 
ATOM   1329  C  C   . ASN A  1  180 ? 85.421  -86.122  37.966  1.00 59.92  ? 181  ASN A C   1 
ATOM   1330  O  O   . ASN A  1  180 ? 84.914  -86.864  38.823  1.00 59.95  ? 181  ASN A O   1 
ATOM   1331  C  CB  . ASN A  1  180 ? 87.018  -84.187  38.328  1.00 59.48  ? 181  ASN A CB  1 
ATOM   1332  C  CG  . ASN A  1  180 ? 87.747  -84.886  39.459  1.00 59.86  ? 181  ASN A CG  1 
ATOM   1333  O  OD1 . ASN A  1  180 ? 88.222  -86.011  39.300  1.00 61.28  ? 181  ASN A OD1 1 
ATOM   1334  N  ND2 . ASN A  1  180 ? 87.846  -84.224  40.606  1.00 59.13  ? 181  ASN A ND2 1 
ATOM   1335  N  N   . ASP A  1  181 ? 85.889  -86.579  36.804  1.00 60.10  ? 182  ASP A N   1 
ATOM   1336  C  CA  . ASP A  1  181 ? 85.748  -87.993  36.429  1.00 60.35  ? 182  ASP A CA  1 
ATOM   1337  C  C   . ASP A  1  181 ? 86.836  -88.956  36.964  1.00 60.14  ? 182  ASP A C   1 
ATOM   1338  O  O   . ASP A  1  181 ? 86.945  -90.093  36.494  1.00 59.98  ? 182  ASP A O   1 
ATOM   1339  C  CB  . ASP A  1  181 ? 85.559  -88.142  34.905  1.00 60.73  ? 182  ASP A CB  1 
ATOM   1340  C  CG  . ASP A  1  181 ? 86.752  -87.623  34.084  1.00 61.82  ? 182  ASP A CG  1 
ATOM   1341  O  OD1 . ASP A  1  181 ? 86.534  -87.251  32.907  1.00 64.05  ? 182  ASP A OD1 1 
ATOM   1342  O  OD2 . ASP A  1  181 ? 87.901  -87.597  34.581  1.00 62.38  ? 182  ASP A OD2 1 
ATOM   1343  N  N   . GLU A  1  182 ? 87.626  -88.502  37.938  1.00 59.94  ? 183  GLU A N   1 
ATOM   1344  C  CA  . GLU A  1  182 ? 88.680  -89.329  38.536  1.00 60.11  ? 183  GLU A CA  1 
ATOM   1345  C  C   . GLU A  1  182 ? 88.458  -89.564  40.035  1.00 59.54  ? 183  GLU A C   1 
ATOM   1346  O  O   . GLU A  1  182 ? 89.321  -90.119  40.715  1.00 59.48  ? 183  GLU A O   1 
ATOM   1347  C  CB  . GLU A  1  182 ? 90.074  -88.721  38.298  1.00 60.56  ? 183  GLU A CB  1 
ATOM   1348  C  CG  . GLU A  1  182 ? 90.673  -88.964  36.895  1.00 63.06  ? 183  GLU A CG  1 
ATOM   1349  C  CD  . GLU A  1  182 ? 92.043  -88.271  36.673  1.00 66.53  ? 183  GLU A CD  1 
ATOM   1350  O  OE1 . GLU A  1  182 ? 92.428  -87.371  37.464  1.00 67.41  ? 183  GLU A OE1 1 
ATOM   1351  O  OE2 . GLU A  1  182 ? 92.739  -88.623  35.690  1.00 67.29  ? 183  GLU A OE2 1 
ATOM   1352  N  N   . LEU A  1  183 ? 87.299  -89.144  40.535  1.00 58.90  ? 184  LEU A N   1 
ATOM   1353  C  CA  . LEU A  1  183 ? 86.946  -89.283  41.946  1.00 58.36  ? 184  LEU A CA  1 
ATOM   1354  C  C   . LEU A  1  183 ? 86.831  -90.724  42.416  1.00 58.04  ? 184  LEU A C   1 
ATOM   1355  O  O   . LEU A  1  183 ? 86.113  -91.521  41.824  1.00 58.30  ? 184  LEU A O   1 
ATOM   1356  C  CB  . LEU A  1  183 ? 85.622  -88.571  42.241  1.00 58.29  ? 184  LEU A CB  1 
ATOM   1357  C  CG  . LEU A  1  183 ? 85.612  -87.044  42.264  1.00 58.59  ? 184  LEU A CG  1 
ATOM   1358  C  CD1 . LEU A  1  183 ? 84.186  -86.511  42.248  1.00 57.64  ? 184  LEU A CD1 1 
ATOM   1359  C  CD2 . LEU A  1  183 ? 86.387  -86.516  43.475  1.00 58.69  ? 184  LEU A CD2 1 
ATOM   1360  N  N   . GLU A  1  184 ? 87.542  -91.043  43.490  1.00 57.47  ? 185  GLU A N   1 
ATOM   1361  C  CA  . GLU A  1  184 ? 87.349  -92.282  44.208  1.00 57.15  ? 185  GLU A CA  1 
ATOM   1362  C  C   . GLU A  1  184 ? 86.114  -92.091  45.106  1.00 56.58  ? 185  GLU A C   1 
ATOM   1363  O  O   . GLU A  1  184 ? 85.610  -90.978  45.250  1.00 56.32  ? 185  GLU A O   1 
ATOM   1364  C  CB  . GLU A  1  184 ? 88.609  -92.601  45.020  1.00 57.56  ? 185  GLU A CB  1 
ATOM   1365  C  CG  . GLU A  1  184 ? 88.920  -94.095  45.214  1.00 59.79  ? 185  GLU A CG  1 
ATOM   1366  C  CD  . GLU A  1  184 ? 88.132  -94.749  46.372  1.00 63.27  ? 185  GLU A CD  1 
ATOM   1367  O  OE1 . GLU A  1  184 ? 88.006  -94.144  47.471  1.00 64.03  ? 185  GLU A OE1 1 
ATOM   1368  O  OE2 . GLU A  1  184 ? 87.639  -95.885  46.182  1.00 63.90  ? 185  GLU A OE2 1 
ATOM   1369  N  N   . LEU A  1  185 ? 85.617  -93.173  45.700  1.00 56.01  ? 186  LEU A N   1 
ATOM   1370  C  CA  . LEU A  1  185 ? 84.393  -93.108  46.488  1.00 55.29  ? 186  LEU A CA  1 
ATOM   1371  C  C   . LEU A  1  185 ? 84.568  -92.293  47.755  1.00 55.10  ? 186  LEU A C   1 
ATOM   1372  O  O   . LEU A  1  185 ? 83.692  -91.506  48.103  1.00 55.08  ? 186  LEU A O   1 
ATOM   1373  C  CB  . LEU A  1  185 ? 83.869  -94.512  46.814  1.00 55.17  ? 186  LEU A CB  1 
ATOM   1374  C  CG  . LEU A  1  185 ? 82.612  -94.691  47.680  1.00 54.53  ? 186  LEU A CG  1 
ATOM   1375  C  CD1 . LEU A  1  185 ? 81.414  -93.868  47.207  1.00 53.75  ? 186  LEU A CD1 1 
ATOM   1376  C  CD2 . LEU A  1  185 ? 82.255  -96.149  47.704  1.00 54.31  ? 186  LEU A CD2 1 
ATOM   1377  N  N   . GLU A  1  186 ? 85.694  -92.480  48.438  1.00 54.95  ? 187  GLU A N   1 
ATOM   1378  C  CA  . GLU A  1  186 ? 85.973  -91.745  49.670  1.00 54.85  ? 187  GLU A CA  1 
ATOM   1379  C  C   . GLU A  1  186 ? 85.928  -90.232  49.465  1.00 54.43  ? 187  GLU A C   1 
ATOM   1380  O  O   . GLU A  1  186 ? 85.437  -89.497  50.329  1.00 54.17  ? 187  GLU A O   1 
ATOM   1381  C  CB  . GLU A  1  186 ? 87.318  -92.164  50.267  1.00 55.18  ? 187  GLU A CB  1 
ATOM   1382  C  CG  . GLU A  1  186 ? 87.264  -93.438  51.104  1.00 56.60  ? 187  GLU A CG  1 
ATOM   1383  C  CD  . GLU A  1  186 ? 86.355  -93.322  52.329  1.00 58.90  ? 187  GLU A CD  1 
ATOM   1384  O  OE1 . GLU A  1  186 ? 85.815  -92.222  52.603  1.00 60.24  ? 187  GLU A OE1 1 
ATOM   1385  O  OE2 . GLU A  1  186 ? 86.184  -94.345  53.025  1.00 59.09  ? 187  GLU A OE2 1 
ATOM   1386  N  N   . ASP A  1  187 ? 86.437  -89.785  48.316  1.00 53.79  ? 188  ASP A N   1 
ATOM   1387  C  CA  . ASP A  1  187 ? 86.422  -88.375  47.941  1.00 53.33  ? 188  ASP A CA  1 
ATOM   1388  C  C   . ASP A  1  187 ? 84.999  -87.878  47.749  1.00 52.55  ? 188  ASP A C   1 
ATOM   1389  O  O   . ASP A  1  187 ? 84.635  -86.803  48.226  1.00 52.63  ? 188  ASP A O   1 
ATOM   1390  C  CB  . ASP A  1  187 ? 87.207  -88.162  46.642  1.00 53.87  ? 188  ASP A CB  1 
ATOM   1391  C  CG  . ASP A  1  187 ? 88.711  -88.391  46.805  1.00 54.97  ? 188  ASP A CG  1 
ATOM   1392  O  OD1 . ASP A  1  187 ? 89.339  -88.856  45.821  1.00 55.58  ? 188  ASP A OD1 1 
ATOM   1393  O  OD2 . ASP A  1  187 ? 89.257  -88.110  47.902  1.00 55.70  ? 188  ASP A OD2 1 
ATOM   1394  N  N   . ALA A  1  188 ? 84.198  -88.666  47.039  1.00 51.60  ? 189  ALA A N   1 
ATOM   1395  C  CA  . ALA A  1  188 ? 82.804  -88.319  46.782  1.00 50.41  ? 189  ALA A CA  1 
ATOM   1396  C  C   . ALA A  1  188 ? 82.008  -88.215  48.083  1.00 49.62  ? 189  ALA A C   1 
ATOM   1397  O  O   . ALA A  1  188 ? 81.115  -87.387  48.194  1.00 49.44  ? 189  ALA A O   1 
ATOM   1398  C  CB  . ALA A  1  188 ? 82.175  -89.315  45.833  1.00 49.99  ? 189  ALA A CB  1 
ATOM   1399  N  N   . ILE A  1  189 ? 82.350  -89.048  49.060  1.00 48.91  ? 190  ILE A N   1 
ATOM   1400  C  CA  . ILE A  1  189 ? 81.724  -88.997  50.374  1.00 48.60  ? 190  ILE A CA  1 
ATOM   1401  C  C   . ILE A  1  189 ? 82.111  -87.703  51.095  1.00 48.57  ? 190  ILE A C   1 
ATOM   1402  O  O   . ILE A  1  189 ? 81.269  -87.050  51.718  1.00 48.64  ? 190  ILE A O   1 
ATOM   1403  C  CB  . ILE A  1  189 ? 82.133  -90.208  51.233  1.00 48.48  ? 190  ILE A CB  1 
ATOM   1404  C  CG1 . ILE A  1  189 ? 81.654  -91.509  50.582  1.00 47.96  ? 190  ILE A CG1 1 
ATOM   1405  C  CG2 . ILE A  1  189 ? 81.590  -90.064  52.652  1.00 48.31  ? 190  ILE A CG2 1 
ATOM   1406  C  CD1 . ILE A  1  189 ? 82.031  -92.767  51.349  1.00 47.45  ? 190  ILE A CD1 1 
ATOM   1407  N  N   . HIS A  1  190 ? 83.393  -87.353  51.006  1.00 48.47  ? 191  HIS A N   1 
ATOM   1408  C  CA  . HIS A  1  190 ? 83.905  -86.086  51.504  1.00 48.29  ? 191  HIS A CA  1 
ATOM   1409  C  C   . HIS A  1  190 ? 83.110  -84.931  50.889  1.00 47.68  ? 191  HIS A C   1 
ATOM   1410  O  O   . HIS A  1  190 ? 82.498  -84.143  51.613  1.00 47.54  ? 191  HIS A O   1 
ATOM   1411  C  CB  . HIS A  1  190 ? 85.398  -85.966  51.193  1.00 48.60  ? 191  HIS A CB  1 
ATOM   1412  C  CG  . HIS A  1  190 ? 86.044  -84.744  51.768  1.00 50.96  ? 191  HIS A CG  1 
ATOM   1413  N  ND1 . HIS A  1  190 ? 86.495  -84.683  53.074  1.00 52.48  ? 191  HIS A ND1 1 
ATOM   1414  C  CD2 . HIS A  1  190 ? 86.325  -83.538  51.215  1.00 51.56  ? 191  HIS A CD2 1 
ATOM   1415  C  CE1 . HIS A  1  190 ? 87.016  -83.491  53.301  1.00 52.51  ? 191  HIS A CE1 1 
ATOM   1416  N  NE2 . HIS A  1  190 ? 86.924  -82.776  52.190  1.00 52.75  ? 191  HIS A NE2 1 
ATOM   1417  N  N   . ILE A  1  191 ? 83.079  -84.858  49.560  1.00 47.06  ? 192  ILE A N   1 
ATOM   1418  C  CA  . ILE A  1  191 ? 82.350  -83.790  48.881  1.00 46.92  ? 192  ILE A CA  1 
ATOM   1419  C  C   . ILE A  1  191 ? 80.878  -83.742  49.300  1.00 47.29  ? 192  ILE A C   1 
ATOM   1420  O  O   . ILE A  1  191 ? 80.303  -82.664  49.425  1.00 47.22  ? 192  ILE A O   1 
ATOM   1421  C  CB  . ILE A  1  191 ? 82.463  -83.893  47.350  1.00 46.77  ? 192  ILE A CB  1 
ATOM   1422  C  CG1 . ILE A  1  191 ? 83.932  -83.796  46.917  1.00 46.30  ? 192  ILE A CG1 1 
ATOM   1423  C  CG2 . ILE A  1  191 ? 81.622  -82.798  46.677  1.00 46.65  ? 192  ILE A CG2 1 
ATOM   1424  C  CD1 . ILE A  1  191 ? 84.204  -84.136  45.465  1.00 43.95  ? 192  ILE A CD1 1 
ATOM   1425  N  N   . ALA A  1  192 ? 80.283  -84.910  49.534  1.00 47.49  ? 193  ALA A N   1 
ATOM   1426  C  CA  . ALA A  1  192 ? 78.891  -84.993  49.966  1.00 47.82  ? 193  ALA A CA  1 
ATOM   1427  C  C   . ALA A  1  192 ? 78.674  -84.407  51.361  1.00 48.03  ? 193  ALA A C   1 
ATOM   1428  O  O   . ALA A  1  192 ? 77.641  -83.789  51.627  1.00 47.98  ? 193  ALA A O   1 
ATOM   1429  C  CB  . ALA A  1  192 ? 78.391  -86.428  49.910  1.00 47.53  ? 193  ALA A CB  1 
ATOM   1430  N  N   . LEU A  1  193 ? 79.639  -84.622  52.249  1.00 48.26  ? 194  LEU A N   1 
ATOM   1431  C  CA  . LEU A  1  193 ? 79.532  -84.121  53.617  1.00 48.71  ? 194  LEU A CA  1 
ATOM   1432  C  C   . LEU A  1  193 ? 79.669  -82.600  53.660  1.00 49.30  ? 194  LEU A C   1 
ATOM   1433  O  O   . LEU A  1  193 ? 78.911  -81.920  54.360  1.00 49.05  ? 194  LEU A O   1 
ATOM   1434  C  CB  . LEU A  1  193 ? 80.562  -84.795  54.519  1.00 48.26  ? 194  LEU A CB  1 
ATOM   1435  C  CG  . LEU A  1  193 ? 80.187  -86.223  54.891  1.00 47.69  ? 194  LEU A CG  1 
ATOM   1436  C  CD1 . LEU A  1  193 ? 81.301  -86.842  55.696  1.00 46.99  ? 194  LEU A CD1 1 
ATOM   1437  C  CD2 . LEU A  1  193 ? 78.865  -86.251  55.665  1.00 45.89  ? 194  LEU A CD2 1 
ATOM   1438  N  N   . LEU A  1  194 ? 80.625  -82.083  52.886  1.00 49.86  ? 195  LEU A N   1 
ATOM   1439  C  CA  . LEU A  1  194 ? 80.827  -80.654  52.739  1.00 50.50  ? 195  LEU A CA  1 
ATOM   1440  C  C   . LEU A  1  194 ? 79.585  -79.979  52.192  1.00 51.03  ? 195  LEU A C   1 
ATOM   1441  O  O   . LEU A  1  194 ? 79.126  -78.997  52.777  1.00 51.22  ? 195  LEU A O   1 
ATOM   1442  C  CB  . LEU A  1  194 ? 81.986  -80.371  51.787  1.00 50.58  ? 195  LEU A CB  1 
ATOM   1443  C  CG  . LEU A  1  194 ? 83.424  -80.495  52.264  1.00 51.02  ? 195  LEU A CG  1 
ATOM   1444  C  CD1 . LEU A  1  194 ? 84.334  -80.472  51.051  1.00 51.15  ? 195  LEU A CD1 1 
ATOM   1445  C  CD2 . LEU A  1  194 ? 83.760  -79.368  53.219  1.00 51.64  ? 195  LEU A CD2 1 
ATOM   1446  N  N   . THR A  1  195 ? 79.061  -80.500  51.072  1.00 51.52  ? 196  THR A N   1 
ATOM   1447  C  CA  . THR A  1  195 ? 77.919  -79.899  50.362  1.00 52.15  ? 196  THR A CA  1 
ATOM   1448  C  C   . THR A  1  195 ? 76.695  -79.827  51.254  1.00 52.83  ? 196  THR A C   1 
ATOM   1449  O  O   . THR A  1  195 ? 75.914  -78.874  51.198  1.00 52.62  ? 196  THR A O   1 
ATOM   1450  C  CB  . THR A  1  195 ? 77.526  -80.698  49.112  1.00 51.92  ? 196  THR A CB  1 
ATOM   1451  O  OG1 . THR A  1  195 ? 78.697  -81.065  48.383  1.00 52.19  ? 196  THR A OG1 1 
ATOM   1452  C  CG2 . THR A  1  195 ? 76.639  -79.872  48.216  1.00 51.72  ? 196  THR A CG2 1 
ATOM   1453  N  N   . LEU A  1  196 ? 76.551  -80.850  52.084  1.00 54.03  ? 197  LEU A N   1 
ATOM   1454  C  CA  . LEU A  1  196 ? 75.431  -80.963  52.982  1.00 55.36  ? 197  LEU A CA  1 
ATOM   1455  C  C   . LEU A  1  196 ? 75.541  -80.035  54.180  1.00 56.56  ? 197  LEU A C   1 
ATOM   1456  O  O   . LEU A  1  196 ? 74.522  -79.655  54.738  1.00 56.86  ? 197  LEU A O   1 
ATOM   1457  C  CB  . LEU A  1  196 ? 75.291  -82.404  53.447  1.00 55.20  ? 197  LEU A CB  1 
ATOM   1458  C  CG  . LEU A  1  196 ? 73.864  -82.850  53.743  1.00 54.33  ? 197  LEU A CG  1 
ATOM   1459  C  CD1 . LEU A  1  196 ? 72.973  -82.608  52.538  1.00 52.63  ? 197  LEU A CD1 1 
ATOM   1460  C  CD2 . LEU A  1  196 ? 73.875  -84.313  54.148  1.00 53.06  ? 197  LEU A CD2 1 
ATOM   1461  N  N   . LYS A  1  197 ? 76.765  -79.677  54.572  1.00 58.16  ? 198  LYS A N   1 
ATOM   1462  C  CA  . LYS A  1  197 ? 76.985  -78.765  55.703  1.00 59.82  ? 198  LYS A CA  1 
ATOM   1463  C  C   . LYS A  1  197 ? 76.442  -77.355  55.434  1.00 60.69  ? 198  LYS A C   1 
ATOM   1464  O  O   . LYS A  1  197 ? 75.890  -76.724  56.335  1.00 60.95  ? 198  LYS A O   1 
ATOM   1465  C  CB  . LYS A  1  197 ? 78.467  -78.699  56.095  1.00 59.89  ? 198  LYS A CB  1 
ATOM   1466  C  CG  . LYS A  1  197 ? 78.710  -78.210  57.534  1.00 61.65  ? 198  LYS A CG  1 
ATOM   1467  C  CD  . LYS A  1  197 ? 80.058  -77.479  57.692  1.00 65.27  ? 198  LYS A CD  1 
ATOM   1468  C  CE  . LYS A  1  197 ? 81.284  -78.425  57.657  1.00 66.94  ? 198  LYS A CE  1 
ATOM   1469  N  NZ  . LYS A  1  197 ? 81.524  -79.158  58.945  1.00 67.46  ? 198  LYS A NZ  1 
ATOM   1470  N  N   . GLU A  1  198 ? 76.591  -76.877  54.198  1.00 61.73  ? 199  GLU A N   1 
ATOM   1471  C  CA  . GLU A  1  198 ? 76.101  -75.556  53.805  1.00 62.97  ? 199  GLU A CA  1 
ATOM   1472  C  C   . GLU A  1  198 ? 74.598  -75.447  54.031  1.00 63.46  ? 199  GLU A C   1 
ATOM   1473  O  O   . GLU A  1  198 ? 74.114  -74.452  54.563  1.00 63.86  ? 199  GLU A O   1 
ATOM   1474  C  CB  . GLU A  1  198 ? 76.422  -75.243  52.332  1.00 63.19  ? 199  GLU A CB  1 
ATOM   1475  C  CG  . GLU A  1  198 ? 77.906  -75.314  51.933  1.00 64.98  ? 199  GLU A CG  1 
ATOM   1476  C  CD  . GLU A  1  198 ? 78.842  -74.596  52.916  1.00 67.36  ? 199  GLU A CD  1 
ATOM   1477  O  OE1 . GLU A  1  198 ? 78.752  -73.351  53.040  1.00 67.69  ? 199  GLU A OE1 1 
ATOM   1478  O  OE2 . GLU A  1  198 ? 79.675  -75.285  53.558  1.00 67.93  ? 199  GLU A OE2 1 
ATOM   1479  N  N   . SER A  1  199 ? 73.869  -76.484  53.637  1.00 64.06  ? 200  SER A N   1 
ATOM   1480  C  CA  . SER A  1  199 ? 72.410  -76.479  53.730  1.00 64.66  ? 200  SER A CA  1 
ATOM   1481  C  C   . SER A  1  199 ? 71.861  -76.934  55.094  1.00 64.86  ? 200  SER A C   1 
ATOM   1482  O  O   . SER A  1  199 ? 70.646  -76.927  55.305  1.00 64.90  ? 200  SER A O   1 
ATOM   1483  C  CB  . SER A  1  199 ? 71.792  -77.297  52.582  1.00 64.77  ? 200  SER A CB  1 
ATOM   1484  O  OG  . SER A  1  199 ? 72.455  -78.543  52.417  1.00 65.22  ? 200  SER A OG  1 
ATOM   1485  N  N   . VAL A  1  200 ? 72.739  -77.310  56.022  1.00 65.14  ? 202  VAL A N   1 
ATOM   1486  C  CA  . VAL A  1  200 ? 72.270  -77.774  57.332  1.00 65.40  ? 202  VAL A CA  1 
ATOM   1487  C  C   . VAL A  1  200 ? 72.487  -76.763  58.452  1.00 65.88  ? 202  VAL A C   1 
ATOM   1488  O  O   . VAL A  1  200 ? 73.617  -76.380  58.792  1.00 65.88  ? 202  VAL A O   1 
ATOM   1489  C  CB  . VAL A  1  200 ? 72.788  -79.201  57.708  1.00 65.36  ? 202  VAL A CB  1 
ATOM   1490  C  CG1 . VAL A  1  200 ? 72.430  -79.562  59.159  1.00 64.83  ? 202  VAL A CG1 1 
ATOM   1491  C  CG2 . VAL A  1  200 ? 72.211  -80.240  56.758  1.00 64.74  ? 202  VAL A CG2 1 
ATOM   1492  N  N   . GLU A  1  201 ? 71.354  -76.342  59.005  1.00 66.30  ? 203  GLU A N   1 
ATOM   1493  C  CA  . GLU A  1  201 ? 71.258  -75.355  60.072  1.00 66.66  ? 203  GLU A CA  1 
ATOM   1494  C  C   . GLU A  1  201 ? 71.873  -75.865  61.388  1.00 66.07  ? 203  GLU A C   1 
ATOM   1495  O  O   . GLU A  1  201 ? 72.908  -75.353  61.832  1.00 65.88  ? 203  GLU A O   1 
ATOM   1496  C  CB  . GLU A  1  201 ? 69.778  -74.973  60.290  1.00 67.20  ? 203  GLU A CB  1 
ATOM   1497  C  CG  . GLU A  1  201 ? 68.885  -74.946  59.010  1.00 69.86  ? 203  GLU A CG  1 
ATOM   1498  C  CD  . GLU A  1  201 ? 68.492  -76.356  58.468  1.00 73.90  ? 203  GLU A CD  1 
ATOM   1499  O  OE1 . GLU A  1  201 ? 68.266  -76.481  57.239  1.00 74.89  ? 203  GLU A OE1 1 
ATOM   1500  O  OE2 . GLU A  1  201 ? 68.408  -77.338  59.251  1.00 75.23  ? 203  GLU A OE2 1 
ATOM   1501  N  N   . GLY A  1  202 ? 71.243  -76.886  61.981  1.00 65.47  ? 204  GLY A N   1 
ATOM   1502  C  CA  . GLY A  1  202 ? 71.531  -77.327  63.357  1.00 64.63  ? 204  GLY A CA  1 
ATOM   1503  C  C   . GLY A  1  202 ? 72.810  -78.113  63.597  1.00 64.04  ? 204  GLY A C   1 
ATOM   1504  O  O   . GLY A  1  202 ? 73.880  -77.763  63.090  1.00 63.79  ? 204  GLY A O   1 
ATOM   1505  N  N   . GLU A  1  203 ? 72.695  -79.163  64.405  1.00 63.51  ? 205  GLU A N   1 
ATOM   1506  C  CA  . GLU A  1  203 ? 73.796  -80.094  64.623  1.00 63.09  ? 205  GLU A CA  1 
ATOM   1507  C  C   . GLU A  1  203 ? 74.103  -80.867  63.341  1.00 62.28  ? 205  GLU A C   1 
ATOM   1508  O  O   . GLU A  1  203 ? 73.196  -81.223  62.584  1.00 62.44  ? 205  GLU A O   1 
ATOM   1509  C  CB  . GLU A  1  203 ? 73.480  -81.072  65.769  1.00 63.55  ? 205  GLU A CB  1 
ATOM   1510  C  CG  . GLU A  1  203 ? 73.494  -80.466  67.188  1.00 65.08  ? 205  GLU A CG  1 
ATOM   1511  C  CD  . GLU A  1  203 ? 74.771  -79.675  67.524  1.00 67.63  ? 205  GLU A CD  1 
ATOM   1512  O  OE1 . GLU A  1  203 ? 74.763  -78.982  68.561  1.00 68.21  ? 205  GLU A OE1 1 
ATOM   1513  O  OE2 . GLU A  1  203 ? 75.775  -79.728  66.767  1.00 68.44  ? 205  GLU A OE2 1 
ATOM   1514  N  N   . PHE A  1  204 ? 75.383  -81.112  63.097  1.00 61.14  ? 206  PHE A N   1 
ATOM   1515  C  CA  . PHE A  1  204 ? 75.814  -81.818  61.906  1.00 59.98  ? 206  PHE A CA  1 
ATOM   1516  C  C   . PHE A  1  204 ? 76.726  -82.967  62.326  1.00 59.61  ? 206  PHE A C   1 
ATOM   1517  O  O   . PHE A  1  204 ? 77.942  -82.817  62.436  1.00 59.70  ? 206  PHE A O   1 
ATOM   1518  C  CB  . PHE A  1  204 ? 76.510  -80.853  60.949  1.00 59.66  ? 206  PHE A CB  1 
ATOM   1519  C  CG  . PHE A  1  204 ? 76.729  -81.406  59.567  1.00 59.46  ? 206  PHE A CG  1 
ATOM   1520  C  CD1 . PHE A  1  204 ? 75.668  -81.542  58.674  1.00 58.56  ? 206  PHE A CD1 1 
ATOM   1521  C  CD2 . PHE A  1  204 ? 78.005  -81.768  59.143  1.00 58.96  ? 206  PHE A CD2 1 
ATOM   1522  C  CE1 . PHE A  1  204 ? 75.874  -82.039  57.386  1.00 57.48  ? 206  PHE A CE1 1 
ATOM   1523  C  CE2 . PHE A  1  204 ? 78.213  -82.265  57.855  1.00 57.96  ? 206  PHE A CE2 1 
ATOM   1524  C  CZ  . PHE A  1  204 ? 77.143  -82.404  56.982  1.00 57.48  ? 206  PHE A CZ  1 
ATOM   1525  N  N   . ASN A  1  205 ? 76.113  -84.113  62.590  1.00 58.90  ? 207  ASN A N   1 
ATOM   1526  C  CA  . ASN A  1  205 ? 76.827  -85.302  63.019  1.00 58.12  ? 207  ASN A CA  1 
ATOM   1527  C  C   . ASN A  1  205 ? 76.161  -86.559  62.458  1.00 57.81  ? 207  ASN A C   1 
ATOM   1528  O  O   . ASN A  1  205 ? 75.171  -86.473  61.718  1.00 57.80  ? 207  ASN A O   1 
ATOM   1529  C  CB  . ASN A  1  205 ? 76.892  -85.359  64.548  1.00 57.94  ? 207  ASN A CB  1 
ATOM   1530  C  CG  . ASN A  1  205 ? 75.515  -85.335  65.195  1.00 57.94  ? 207  ASN A CG  1 
ATOM   1531  O  OD1 . ASN A  1  205 ? 74.586  -86.013  64.750  1.00 57.65  ? 207  ASN A OD1 1 
ATOM   1532  N  ND2 . ASN A  1  205 ? 75.380  -84.554  66.254  1.00 58.06  ? 207  ASN A ND2 1 
ATOM   1533  N  N   . GLY A  1  206 ? 76.694  -87.721  62.835  1.00 57.37  ? 208  GLY A N   1 
ATOM   1534  C  CA  . GLY A  1  206 ? 76.216  -89.012  62.341  1.00 56.50  ? 208  GLY A CA  1 
ATOM   1535  C  C   . GLY A  1  206 ? 74.814  -89.396  62.773  1.00 55.95  ? 208  GLY A C   1 
ATOM   1536  O  O   . GLY A  1  206 ? 74.327  -90.469  62.411  1.00 55.65  ? 208  GLY A O   1 
ATOM   1537  N  N   . ASP A  1  207 ? 74.164  -88.514  63.533  1.00 55.49  ? 209  ASP A N   1 
ATOM   1538  C  CA  . ASP A  1  207 ? 72.809  -88.754  64.041  1.00 55.12  ? 209  ASP A CA  1 
ATOM   1539  C  C   . ASP A  1  207 ? 71.758  -87.876  63.343  1.00 54.26  ? 209  ASP A C   1 
ATOM   1540  O  O   . ASP A  1  207 ? 70.550  -88.097  63.477  1.00 54.28  ? 209  ASP A O   1 
ATOM   1541  C  CB  . ASP A  1  207 ? 72.772  -88.546  65.564  1.00 55.45  ? 209  ASP A CB  1 
ATOM   1542  C  CG  . ASP A  1  207 ? 73.718  -89.502  66.322  1.00 57.20  ? 209  ASP A CG  1 
ATOM   1543  O  OD1 . ASP A  1  207 ? 73.529  -90.746  66.232  1.00 58.03  ? 209  ASP A OD1 1 
ATOM   1544  O  OD2 . ASP A  1  207 ? 74.643  -89.008  67.024  1.00 59.02  ? 209  ASP A OD2 1 
ATOM   1545  N  N   . THR A  1  208 A 72.229  -86.885  62.594  1.00 53.17  ? 209  THR A N   1 
ATOM   1546  C  CA  . THR A  1  208 A 71.352  -85.908  61.960  1.00 52.28  ? 209  THR A CA  1 
ATOM   1547  C  C   . THR A  1  208 A 71.476  -85.995  60.448  1.00 51.65  ? 209  THR A C   1 
ATOM   1548  O  O   . THR A  1  208 A 70.673  -85.433  59.711  1.00 51.24  ? 209  THR A O   1 
ATOM   1549  C  CB  . THR A  1  208 A 71.700  -84.474  62.410  1.00 52.51  ? 209  THR A CB  1 
ATOM   1550  O  OG1 . THR A  1  208 A 73.091  -84.223  62.173  1.00 52.19  ? 209  THR A OG1 1 
ATOM   1551  C  CG2 . THR A  1  208 A 71.391  -84.281  63.895  1.00 51.88  ? 209  THR A CG2 1 
ATOM   1552  N  N   . ILE A  1  209 ? 72.494  -86.727  60.015  1.00 51.06  ? 210  ILE A N   1 
ATOM   1553  C  CA  . ILE A  1  209 ? 72.819  -86.931  58.614  1.00 50.49  ? 210  ILE A CA  1 
ATOM   1554  C  C   . ILE A  1  209 ? 72.605  -88.408  58.240  1.00 50.06  ? 210  ILE A C   1 
ATOM   1555  O  O   . ILE A  1  209 ? 72.813  -89.302  59.061  1.00 49.83  ? 210  ILE A O   1 
ATOM   1556  C  CB  . ILE A  1  209 ? 74.279  -86.421  58.346  1.00 50.49  ? 210  ILE A CB  1 
ATOM   1557  C  CG1 . ILE A  1  209 ? 74.289  -84.902  58.369  1.00 50.90  ? 210  ILE A CG1 1 
ATOM   1558  C  CG2 . ILE A  1  209 ? 74.871  -86.900  57.027  1.00 50.20  ? 210  ILE A CG2 1 
ATOM   1559  C  CD1 . ILE A  1  209 ? 73.071  -84.267  57.717  1.00 50.20  ? 210  ILE A CD1 1 
ATOM   1560  N  N   . GLU A  1  210 ? 72.171  -88.646  57.006  1.00 49.64  ? 211  GLU A N   1 
ATOM   1561  C  CA  . GLU A  1  210 ? 71.933  -89.996  56.503  1.00 49.37  ? 211  GLU A CA  1 
ATOM   1562  C  C   . GLU A  1  210 ? 72.671  -90.189  55.180  1.00 48.73  ? 211  GLU A C   1 
ATOM   1563  O  O   . GLU A  1  210 ? 72.362  -89.521  54.183  1.00 48.63  ? 211  GLU A O   1 
ATOM   1564  C  CB  . GLU A  1  210 ? 70.433  -90.216  56.317  1.00 49.53  ? 211  GLU A CB  1 
ATOM   1565  C  CG  . GLU A  1  210 ? 69.964  -91.636  56.500  1.00 51.54  ? 211  GLU A CG  1 
ATOM   1566  C  CD  . GLU A  1  210 ? 68.487  -91.718  56.864  1.00 55.00  ? 211  GLU A CD  1 
ATOM   1567  O  OE1 . GLU A  1  210 ? 68.086  -92.677  57.564  1.00 57.43  ? 211  GLU A OE1 1 
ATOM   1568  O  OE2 . GLU A  1  210 ? 67.720  -90.817  56.466  1.00 56.41  ? 211  GLU A OE2 1 
ATOM   1569  N  N   . LEU A  1  211 ? 73.657  -91.088  55.196  1.00 47.87  ? 212  LEU A N   1 
ATOM   1570  C  CA  . LEU A  1  211 ? 74.448  -91.449  54.013  1.00 47.03  ? 212  LEU A CA  1 
ATOM   1571  C  C   . LEU A  1  211 ? 74.353  -92.925  53.688  1.00 45.99  ? 212  LEU A C   1 
ATOM   1572  O  O   . LEU A  1  211 ? 74.446  -93.769  54.578  1.00 45.84  ? 212  LEU A O   1 
ATOM   1573  C  CB  . LEU A  1  211 ? 75.928  -91.159  54.236  1.00 47.21  ? 212  LEU A CB  1 
ATOM   1574  C  CG  . LEU A  1  211 ? 76.523  -89.948  53.546  1.00 48.53  ? 212  LEU A CG  1 
ATOM   1575  C  CD1 . LEU A  1  211 ? 76.571  -88.791  54.519  1.00 49.53  ? 212  LEU A CD1 1 
ATOM   1576  C  CD2 . LEU A  1  211 ? 77.910  -90.275  53.050  1.00 49.10  ? 212  LEU A CD2 1 
ATOM   1577  N  N   . ALA A  1  212 ? 74.195  -93.232  52.409  1.00 44.84  ? 213  ALA A N   1 
ATOM   1578  C  CA  . ALA A  1  212 ? 74.377  -94.587  51.940  1.00 44.11  ? 213  ALA A CA  1 
ATOM   1579  C  C   . ALA A  1  212 ? 75.218  -94.550  50.694  1.00 43.75  ? 213  ALA A C   1 
ATOM   1580  O  O   . ALA A  1  212 ? 75.192  -93.565  49.956  1.00 43.56  ? 213  ALA A O   1 
ATOM   1581  C  CB  . ALA A  1  212 ? 73.043  -95.268  51.669  1.00 43.86  ? 213  ALA A CB  1 
ATOM   1582  N  N   . ILE A  1  213 ? 75.974  -95.621  50.472  1.00 43.49  ? 214  ILE A N   1 
ATOM   1583  C  CA  . ILE A  1  213 ? 76.740  -95.768  49.247  1.00 43.35  ? 214  ILE A CA  1 
ATOM   1584  C  C   . ILE A  1  213 ? 76.291  -96.954  48.401  1.00 43.59  ? 214  ILE A C   1 
ATOM   1585  O  O   . ILE A  1  213 ? 75.580  -97.844  48.876  1.00 43.59  ? 214  ILE A O   1 
ATOM   1586  C  CB  . ILE A  1  213 ? 78.248  -95.897  49.525  1.00 43.31  ? 214  ILE A CB  1 
ATOM   1587  C  CG1 . ILE A  1  213 ? 78.542  -97.124  50.397  1.00 42.88  ? 214  ILE A CG1 1 
ATOM   1588  C  CG2 . ILE A  1  213 ? 78.794  -94.609  50.131  1.00 42.88  ? 214  ILE A CG2 1 
ATOM   1589  C  CD1 . ILE A  1  213 ? 79.817  -97.855  49.994  1.00 41.95  ? 214  ILE A CD1 1 
ATOM   1590  N  N   . ILE A  1  214 ? 76.708  -96.942  47.141  1.00 43.73  ? 215  ILE A N   1 
ATOM   1591  C  CA  . ILE A  1  214 ? 76.606  -98.086  46.257  1.00 44.14  ? 215  ILE A CA  1 
ATOM   1592  C  C   . ILE A  1  214 ? 78.050  -98.308  45.830  1.00 45.25  ? 215  ILE A C   1 
ATOM   1593  O  O   . ILE A  1  214 ? 78.557  -97.608  44.940  1.00 45.23  ? 215  ILE A O   1 
ATOM   1594  C  CB  . ILE A  1  214 ? 75.736  -97.797  44.992  1.00 43.66  ? 215  ILE A CB  1 
ATOM   1595  C  CG1 . ILE A  1  214 ? 74.344  -97.232  45.331  1.00 43.27  ? 215  ILE A CG1 1 
ATOM   1596  C  CG2 . ILE A  1  214 ? 75.616  -99.016  44.115  1.00 43.79  ? 215  ILE A CG2 1 
ATOM   1597  C  CD1 . ILE A  1  214 ? 73.445  -98.090  46.204  1.00 40.96  ? 215  ILE A CD1 1 
ATOM   1598  N  N   . GLY A  1  215 ? 78.723  -99.263  46.468  1.00 45.98  ? 216  GLY A N   1 
ATOM   1599  C  CA  . GLY A  1  215 ? 80.140  -99.468  46.210  1.00 47.52  ? 216  GLY A CA  1 
ATOM   1600  C  C   . GLY A  1  215 ? 80.545  -100.870 45.809  1.00 48.65  ? 216  GLY A C   1 
ATOM   1601  O  O   . GLY A  1  215 ? 80.098  -101.394 44.779  1.00 48.60  ? 216  GLY A O   1 
ATOM   1602  N  N   . ASP A  1  216 ? 81.424  -101.455 46.623  1.00 49.62  ? 217  ASP A N   1 
ATOM   1603  C  CA  . ASP A  1  216 ? 81.874  -102.835 46.464  1.00 50.61  ? 217  ASP A CA  1 
ATOM   1604  C  C   . ASP A  1  216 ? 80.850  -103.793 47.046  1.00 51.18  ? 217  ASP A C   1 
ATOM   1605  O  O   . ASP A  1  216 ? 80.021  -103.390 47.869  1.00 51.40  ? 217  ASP A O   1 
ATOM   1606  C  CB  . ASP A  1  216 ? 83.201  -103.052 47.199  1.00 50.68  ? 217  ASP A CB  1 
ATOM   1607  C  CG  . ASP A  1  216 ? 84.406  -102.714 46.353  1.00 51.09  ? 217  ASP A CG  1 
ATOM   1608  O  OD1 . ASP A  1  216 ? 84.281  -102.619 45.113  1.00 52.53  ? 217  ASP A OD1 1 
ATOM   1609  O  OD2 . ASP A  1  216 ? 85.489  -102.557 46.940  1.00 51.66  ? 217  ASP A OD2 1 
ATOM   1610  N  N   . GLU A  1  217 A 80.922  -105.058 46.620  1.00 51.81  ? 217  GLU A N   1 
ATOM   1611  C  CA  . GLU A  1  217 A 80.116  -106.135 47.193  1.00 52.21  ? 217  GLU A CA  1 
ATOM   1612  C  C   . GLU A  1  217 A 80.506  -106.370 48.656  1.00 52.27  ? 217  GLU A C   1 
ATOM   1613  O  O   . GLU A  1  217 A 81.687  -106.358 48.995  1.00 52.15  ? 217  GLU A O   1 
ATOM   1614  C  CB  . GLU A  1  217 A 80.289  -107.409 46.364  1.00 52.35  ? 217  GLU A CB  1 
ATOM   1615  C  CG  . GLU A  1  217 A 79.708  -107.307 44.956  1.00 54.13  ? 217  GLU A CG  1 
ATOM   1616  C  CD  . GLU A  1  217 A 80.484  -108.122 43.915  1.00 56.75  ? 217  GLU A CD  1 
ATOM   1617  O  OE1 . GLU A  1  217 A 79.849  -108.675 42.989  1.00 58.30  ? 217  GLU A OE1 1 
ATOM   1618  O  OE2 . GLU A  1  217 A 81.727  -108.211 44.004  1.00 57.58  ? 217  GLU A OE2 1 
ATOM   1619  N  N   . ASN A  1  218 B 79.507  -106.553 49.518  1.00 52.66  ? 217  ASN A N   1 
ATOM   1620  C  CA  . ASN A  1  218 B 79.729  -106.809 50.946  1.00 52.97  ? 217  ASN A CA  1 
ATOM   1621  C  C   . ASN A  1  218 B 79.391  -108.240 51.312  1.00 53.33  ? 217  ASN A C   1 
ATOM   1622  O  O   . ASN A  1  218 B 78.251  -108.526 51.708  1.00 53.58  ? 217  ASN A O   1 
ATOM   1623  C  CB  . ASN A  1  218 B 78.884  -105.878 51.812  1.00 53.11  ? 217  ASN A CB  1 
ATOM   1624  C  CG  . ASN A  1  218 B 79.330  -104.439 51.730  1.00 53.51  ? 217  ASN A CG  1 
ATOM   1625  O  OD1 . ASN A  1  218 B 80.098  -103.977 52.574  1.00 54.59  ? 217  ASN A OD1 1 
ATOM   1626  N  ND2 . ASN A  1  218 B 78.859  -103.718 50.709  1.00 52.66  ? 217  ASN A ND2 1 
ATOM   1627  N  N   . PRO A  1  219 D 80.373  -109.152 51.199  1.00 53.57  ? 217  PRO A N   1 
ATOM   1628  C  CA  . PRO A  1  219 D 80.062  -110.551 51.490  1.00 53.60  ? 217  PRO A CA  1 
ATOM   1629  C  C   . PRO A  1  219 D 79.648  -110.772 52.948  1.00 53.89  ? 217  PRO A C   1 
ATOM   1630  O  O   . PRO A  1  219 D 78.896  -111.702 53.237  1.00 53.99  ? 217  PRO A O   1 
ATOM   1631  C  CB  . PRO A  1  219 D 81.356  -111.286 51.141  1.00 53.38  ? 217  PRO A CB  1 
ATOM   1632  C  CG  . PRO A  1  219 D 82.419  -110.260 51.233  1.00 53.85  ? 217  PRO A CG  1 
ATOM   1633  C  CD  . PRO A  1  219 D 81.795  -108.949 50.872  1.00 53.58  ? 217  PRO A CD  1 
ATOM   1634  N  N   . ASP A  1  220 E 80.094  -109.904 53.851  1.00 54.30  ? 217  ASP A N   1 
ATOM   1635  C  CA  . ASP A  1  220 E 79.688  -110.021 55.252  1.00 55.07  ? 217  ASP A CA  1 
ATOM   1636  C  C   . ASP A  1  220 E 78.212  -109.694 55.464  1.00 54.42  ? 217  ASP A C   1 
ATOM   1637  O  O   . ASP A  1  220 E 77.648  -110.009 56.509  1.00 54.47  ? 217  ASP A O   1 
ATOM   1638  C  CB  . ASP A  1  220 E 80.596  -109.208 56.205  1.00 55.81  ? 217  ASP A CB  1 
ATOM   1639  C  CG  . ASP A  1  220 E 80.733  -107.724 55.806  1.00 59.11  ? 217  ASP A CG  1 
ATOM   1640  O  OD1 . ASP A  1  220 E 80.980  -107.423 54.593  1.00 61.91  ? 217  ASP A OD1 1 
ATOM   1641  O  OD2 . ASP A  1  220 E 80.624  -106.864 56.727  1.00 60.52  ? 217  ASP A OD2 1 
ATOM   1642  N  N   . LEU A  1  221 F 77.587  -109.084 54.462  1.00 53.90  ? 217  LEU A N   1 
ATOM   1643  C  CA  . LEU A  1  221 F 76.176  -108.709 54.555  1.00 53.36  ? 217  LEU A CA  1 
ATOM   1644  C  C   . LEU A  1  221 F 75.242  -109.682 53.843  1.00 52.79  ? 217  LEU A C   1 
ATOM   1645  O  O   . LEU A  1  221 F 74.015  -109.537 53.911  1.00 52.33  ? 217  LEU A O   1 
ATOM   1646  C  CB  . LEU A  1  221 F 75.964  -107.288 54.026  1.00 53.55  ? 217  LEU A CB  1 
ATOM   1647  C  CG  . LEU A  1  221 F 76.317  -106.157 54.996  1.00 54.45  ? 217  LEU A CG  1 
ATOM   1648  C  CD1 . LEU A  1  221 F 76.242  -104.805 54.280  1.00 54.32  ? 217  LEU A CD1 1 
ATOM   1649  C  CD2 . LEU A  1  221 F 75.412  -106.181 56.247  1.00 54.53  ? 217  LEU A CD2 1 
ATOM   1650  N  N   . LEU A  1  222 G 75.833  -110.674 53.173  1.00 52.16  ? 217  LEU A N   1 
ATOM   1651  C  CA  . LEU A  1  222 G 75.087  -111.650 52.379  1.00 51.23  ? 217  LEU A CA  1 
ATOM   1652  C  C   . LEU A  1  222 G 74.155  -112.521 53.215  1.00 50.78  ? 217  LEU A C   1 
ATOM   1653  O  O   . LEU A  1  222 G 73.012  -112.727 52.832  1.00 50.84  ? 217  LEU A O   1 
ATOM   1654  C  CB  . LEU A  1  222 G 76.038  -112.509 51.549  1.00 51.05  ? 217  LEU A CB  1 
ATOM   1655  C  CG  . LEU A  1  222 G 75.414  -113.403 50.473  1.00 51.16  ? 217  LEU A CG  1 
ATOM   1656  C  CD1 . LEU A  1  222 G 74.408  -112.638 49.623  1.00 50.47  ? 217  LEU A CD1 1 
ATOM   1657  C  CD2 . LEU A  1  222 G 76.495  -114.034 49.596  1.00 50.50  ? 217  LEU A CD2 1 
ATOM   1658  N  N   . GLY A  1  223 H 74.645  -113.018 54.348  1.00 50.30  ? 217  GLY A N   1 
ATOM   1659  C  CA  . GLY A  1  223 H 73.862  -113.881 55.231  1.00 49.66  ? 217  GLY A CA  1 
ATOM   1660  C  C   . GLY A  1  223 H 74.206  -115.369 55.148  1.00 49.33  ? 217  GLY A C   1 
ATOM   1661  O  O   . GLY A  1  223 H 73.756  -116.166 55.982  1.00 48.84  ? 217  GLY A O   1 
ATOM   1662  N  N   . TYR A  1  224 I 75.000  -115.740 54.143  1.00 49.02  ? 217  TYR A N   1 
ATOM   1663  C  CA  . TYR A  1  224 I 75.380  -117.131 53.900  1.00 48.93  ? 217  TYR A CA  1 
ATOM   1664  C  C   . TYR A  1  224 I 76.684  -117.222 53.111  1.00 49.50  ? 217  TYR A C   1 
ATOM   1665  O  O   . TYR A  1  224 I 77.036  -116.304 52.371  1.00 49.60  ? 217  TYR A O   1 
ATOM   1666  C  CB  . TYR A  1  224 I 74.261  -117.884 53.153  1.00 48.57  ? 217  TYR A CB  1 
ATOM   1667  C  CG  . TYR A  1  224 I 74.006  -117.421 51.720  1.00 47.36  ? 217  TYR A CG  1 
ATOM   1668  C  CD1 . TYR A  1  224 I 73.113  -116.372 51.448  1.00 46.67  ? 217  TYR A CD1 1 
ATOM   1669  C  CD2 . TYR A  1  224 I 74.649  -118.028 50.639  1.00 45.13  ? 217  TYR A CD2 1 
ATOM   1670  C  CE1 . TYR A  1  224 I 72.876  -115.937 50.141  1.00 44.65  ? 217  TYR A CE1 1 
ATOM   1671  C  CE2 . TYR A  1  224 I 74.412  -117.601 49.328  1.00 44.91  ? 217  TYR A CE2 1 
ATOM   1672  C  CZ  . TYR A  1  224 I 73.524  -116.556 49.093  1.00 44.84  ? 217  TYR A CZ  1 
ATOM   1673  O  OH  . TYR A  1  224 I 73.285  -116.132 47.803  1.00 46.00  ? 217  TYR A OH  1 
ATOM   1674  N  N   . THR A  1  225 J 77.393  -118.335 53.275  1.00 50.24  ? 217  THR A N   1 
ATOM   1675  C  CA  . THR A  1  225 J 78.589  -118.631 52.492  1.00 50.93  ? 217  THR A CA  1 
ATOM   1676  C  C   . THR A  1  225 J 78.368  -119.922 51.707  1.00 51.66  ? 217  THR A C   1 
ATOM   1677  O  O   . THR A  1  225 J 77.422  -120.670 51.974  1.00 51.35  ? 217  THR A O   1 
ATOM   1678  C  CB  . THR A  1  225 J 79.822  -118.824 53.390  1.00 50.85  ? 217  THR A CB  1 
ATOM   1679  O  OG1 . THR A  1  225 J 79.557  -119.869 54.335  1.00 50.89  ? 217  THR A OG1 1 
ATOM   1680  C  CG2 . THR A  1  225 J 80.181  -117.533 54.129  1.00 50.50  ? 217  THR A CG2 1 
ATOM   1681  N  N   . GLY A  1  226 K 79.245  -120.185 50.746  1.00 52.52  ? 217  GLY A N   1 
ATOM   1682  C  CA  . GLY A  1  226 K 79.158  -121.412 49.973  1.00 53.93  ? 217  GLY A CA  1 
ATOM   1683  C  C   . GLY A  1  226 K 79.010  -121.220 48.480  1.00 54.78  ? 217  GLY A C   1 
ATOM   1684  O  O   . GLY A  1  226 K 79.757  -121.809 47.719  1.00 55.14  ? 217  GLY A O   1 
ATOM   1685  N  N   . ILE A  1  227 L 78.038  -120.420 48.052  1.00 55.76  ? 217  ILE A N   1 
ATOM   1686  C  CA  . ILE A  1  227 L 77.937  -120.075 46.635  1.00 56.72  ? 217  ILE A CA  1 
ATOM   1687  C  C   . ILE A  1  227 L 78.888  -118.913 46.325  1.00 57.72  ? 217  ILE A C   1 
ATOM   1688  O  O   . ILE A  1  227 L 78.725  -117.819 46.875  1.00 58.06  ? 217  ILE A O   1 
ATOM   1689  C  CB  . ILE A  1  227 L 76.490  -119.739 46.208  1.00 56.54  ? 217  ILE A CB  1 
ATOM   1690  C  CG1 . ILE A  1  227 L 75.535  -120.876 46.597  1.00 56.32  ? 217  ILE A CG1 1 
ATOM   1691  C  CG2 . ILE A  1  227 L 76.442  -119.487 44.709  1.00 56.44  ? 217  ILE A CG2 1 
ATOM   1692  C  CD1 . ILE A  1  227 L 74.052  -120.514 46.584  1.00 56.53  ? 217  ILE A CD1 1 
ATOM   1693  N  N   . PRO A  1  228 M 79.884  -119.142 45.440  1.00 58.69  ? 217  PRO A N   1 
ATOM   1694  C  CA  . PRO A  1  228 M 80.892  -118.110 45.192  1.00 59.26  ? 217  PRO A CA  1 
ATOM   1695  C  C   . PRO A  1  228 M 80.553  -117.103 44.079  1.00 59.76  ? 217  PRO A C   1 
ATOM   1696  O  O   . PRO A  1  228 M 81.209  -116.072 43.985  1.00 59.88  ? 217  PRO A O   1 
ATOM   1697  C  CB  . PRO A  1  228 M 82.148  -118.928 44.826  1.00 59.37  ? 217  PRO A CB  1 
ATOM   1698  C  CG  . PRO A  1  228 M 81.669  -120.367 44.597  1.00 58.82  ? 217  PRO A CG  1 
ATOM   1699  C  CD  . PRO A  1  228 M 80.166  -120.350 44.644  1.00 58.71  ? 217  PRO A CD  1 
ATOM   1700  N  N   . THR A  1  229 N 79.560  -117.390 43.241  1.00 60.40  ? 217  THR A N   1 
ATOM   1701  C  CA  . THR A  1  229 N 79.136  -116.419 42.220  1.00 61.17  ? 217  THR A CA  1 
ATOM   1702  C  C   . THR A  1  229 N 78.232  -115.334 42.815  1.00 61.34  ? 217  THR A C   1 
ATOM   1703  O  O   . THR A  1  229 N 77.825  -114.405 42.122  1.00 61.68  ? 217  THR A O   1 
ATOM   1704  C  CB  . THR A  1  229 N 78.423  -117.084 41.000  1.00 61.34  ? 217  THR A CB  1 
ATOM   1705  O  OG1 . THR A  1  229 N 77.449  -118.045 41.457  1.00 61.90  ? 217  THR A OG1 1 
ATOM   1706  C  CG2 . THR A  1  229 N 79.438  -117.766 40.066  1.00 61.59  ? 217  THR A CG2 1 
ATOM   1707  N  N   . ASP A  1  230 O 77.919  -115.466 44.100  1.00 61.50  ? 217  ASP A N   1 
ATOM   1708  C  CA  . ASP A  1  230 O 77.082  -114.505 44.801  1.00 61.52  ? 217  ASP A CA  1 
ATOM   1709  C  C   . ASP A  1  230 O 77.923  -113.836 45.865  1.00 60.79  ? 217  ASP A C   1 
ATOM   1710  O  O   . ASP A  1  230 O 78.346  -114.496 46.819  1.00 60.80  ? 217  ASP A O   1 
ATOM   1711  C  CB  . ASP A  1  230 O 75.885  -115.220 45.447  1.00 62.20  ? 217  ASP A CB  1 
ATOM   1712  C  CG  . ASP A  1  230 O 74.620  -115.130 44.603  1.00 64.41  ? 217  ASP A CG  1 
ATOM   1713  O  OD1 . ASP A  1  230 O 73.788  -116.059 44.701  1.00 66.00  ? 217  ASP A OD1 1 
ATOM   1714  O  OD2 . ASP A  1  230 O 74.450  -114.126 43.853  1.00 67.40  ? 217  ASP A OD2 1 
ATOM   1715  N  N   . LYS A  1  231 P 78.171  -112.534 45.715  1.00 59.92  ? 217  LYS A N   1 
ATOM   1716  C  CA  . LYS A  1  231 P 79.162  -111.861 46.592  1.00 58.75  ? 217  LYS A CA  1 
ATOM   1717  C  C   . LYS A  1  231 P 78.626  -110.863 47.639  1.00 57.00  ? 217  LYS A C   1 
ATOM   1718  O  O   . LYS A  1  231 P 79.367  -110.441 48.531  1.00 57.03  ? 217  LYS A O   1 
ATOM   1719  C  CB  . LYS A  1  231 P 80.340  -111.269 45.778  1.00 59.04  ? 217  LYS A CB  1 
ATOM   1720  C  CG  . LYS A  1  231 P 81.446  -112.297 45.439  1.00 59.41  ? 217  LYS A CG  1 
ATOM   1721  C  CD  . LYS A  1  231 P 82.070  -112.072 44.047  1.00 60.72  ? 217  LYS A CD  1 
ATOM   1722  C  CE  . LYS A  1  231 P 81.007  -112.100 42.933  1.00 61.18  ? 217  LYS A CE  1 
ATOM   1723  N  NZ  . LYS A  1  231 P 81.572  -112.404 41.592  1.00 61.91  ? 217  LYS A NZ  1 
ATOM   1724  N  N   . GLY A  1  232 ? 77.352  -110.505 47.550  1.00 54.89  ? 218  GLY A N   1 
ATOM   1725  C  CA  . GLY A  1  232 ? 76.777  -109.600 48.535  1.00 52.07  ? 218  GLY A CA  1 
ATOM   1726  C  C   . GLY A  1  232 ? 76.293  -108.295 47.951  1.00 50.10  ? 218  GLY A C   1 
ATOM   1727  O  O   . GLY A  1  232 ? 76.643  -107.938 46.826  1.00 49.71  ? 218  GLY A O   1 
ATOM   1728  N  N   . PRO A  1  233 ? 75.476  -107.569 48.717  1.00 48.97  ? 219  PRO A N   1 
ATOM   1729  C  CA  . PRO A  1  233 ? 74.916  -106.312 48.250  1.00 48.39  ? 219  PRO A CA  1 
ATOM   1730  C  C   . PRO A  1  233 ? 75.991  -105.237 48.081  1.00 47.86  ? 219  PRO A C   1 
ATOM   1731  O  O   . PRO A  1  233 ? 76.988  -105.221 48.814  1.00 47.76  ? 219  PRO A O   1 
ATOM   1732  C  CB  . PRO A  1  233 ? 73.951  -105.930 49.373  1.00 48.17  ? 219  PRO A CB  1 
ATOM   1733  C  CG  . PRO A  1  233 ? 74.520  -106.568 50.581  1.00 48.19  ? 219  PRO A CG  1 
ATOM   1734  C  CD  . PRO A  1  233 ? 75.081  -107.864 50.103  1.00 48.86  ? 219  PRO A CD  1 
ATOM   1735  N  N   . ARG A  1  234 ? 75.797  -104.362 47.105  1.00 47.09  ? 220  ARG A N   1 
ATOM   1736  C  CA  . ARG A  1  234 ? 76.652  -103.189 46.968  1.00 46.58  ? 220  ARG A CA  1 
ATOM   1737  C  C   . ARG A  1  234 ? 76.068  -101.963 47.690  1.00 46.15  ? 220  ARG A C   1 
ATOM   1738  O  O   . ARG A  1  234 ? 76.779  -100.999 47.959  1.00 46.65  ? 220  ARG A O   1 
ATOM   1739  C  CB  . ARG A  1  234 ? 76.892  -102.874 45.501  1.00 46.42  ? 220  ARG A CB  1 
ATOM   1740  C  CG  . ARG A  1  234 ? 77.546  -103.986 44.726  1.00 46.65  ? 220  ARG A CG  1 
ATOM   1741  C  CD  . ARG A  1  234 ? 77.747  -103.521 43.320  1.00 47.89  ? 220  ARG A CD  1 
ATOM   1742  N  NE  . ARG A  1  234 ? 78.473  -104.463 42.483  1.00 50.12  ? 220  ARG A NE  1 
ATOM   1743  C  CZ  . ARG A  1  234 ? 79.795  -104.472 42.329  1.00 51.42  ? 220  ARG A CZ  1 
ATOM   1744  N  NH1 . ARG A  1  234 ? 80.554  -103.601 42.986  1.00 52.06  ? 220  ARG A NH1 1 
ATOM   1745  N  NH2 . ARG A  1  234 ? 80.360  -105.366 41.522  1.00 51.76  ? 220  ARG A NH2 1 
ATOM   1746  N  N   . PHE A  1  235 ? 74.777  -101.998 47.996  1.00 45.50  ? 221  PHE A N   1 
ATOM   1747  C  CA  . PHE A  1  235 ? 74.161  -100.957 48.799  1.00 45.20  ? 221  PHE A CA  1 
ATOM   1748  C  C   . PHE A  1  235 ? 74.566  -101.085 50.266  1.00 45.72  ? 221  PHE A C   1 
ATOM   1749  O  O   . PHE A  1  235 ? 74.351  -102.124 50.891  1.00 45.56  ? 221  PHE A O   1 
ATOM   1750  C  CB  . PHE A  1  235 ? 72.641  -101.007 48.681  1.00 44.48  ? 221  PHE A CB  1 
ATOM   1751  C  CG  . PHE A  1  235 ? 71.935  -100.066 49.609  1.00 43.18  ? 221  PHE A CG  1 
ATOM   1752  C  CD1 . PHE A  1  235 ? 71.489  -98.831  49.156  1.00 41.61  ? 221  PHE A CD1 1 
ATOM   1753  C  CD2 . PHE A  1  235 ? 71.722  -100.407 50.945  1.00 42.03  ? 221  PHE A CD2 1 
ATOM   1754  C  CE1 . PHE A  1  235 ? 70.843  -97.955  50.015  1.00 40.39  ? 221  PHE A CE1 1 
ATOM   1755  C  CE2 . PHE A  1  235 ? 71.071  -99.540  51.811  1.00 40.27  ? 221  PHE A CE2 1 
ATOM   1756  C  CZ  . PHE A  1  235 ? 70.632  -98.314  51.345  1.00 40.33  ? 221  PHE A CZ  1 
ATOM   1757  N  N   . ARG A  1  236 ? 75.147  -100.020 50.809  1.00 46.44  ? 222  ARG A N   1 
ATOM   1758  C  CA  . ARG A  1  236 ? 75.482  -99.987  52.225  1.00 47.43  ? 222  ARG A CA  1 
ATOM   1759  C  C   . ARG A  1  236 ? 75.134  -98.657  52.850  1.00 47.50  ? 222  ARG A C   1 
ATOM   1760  O  O   . ARG A  1  236 ? 75.540  -97.605  52.368  1.00 47.65  ? 222  ARG A O   1 
ATOM   1761  C  CB  . ARG A  1  236 ? 76.959  -100.283 52.469  1.00 47.56  ? 222  ARG A CB  1 
ATOM   1762  C  CG  . ARG A  1  236 ? 77.166  -101.167 53.682  1.00 50.33  ? 222  ARG A CG  1 
ATOM   1763  C  CD  . ARG A  1  236 ? 78.235  -100.662 54.613  1.00 54.99  ? 222  ARG A CD  1 
ATOM   1764  N  NE  . ARG A  1  236 ? 79.518  -100.513 53.942  1.00 59.58  ? 222  ARG A NE  1 
ATOM   1765  C  CZ  . ARG A  1  236 ? 80.651  -100.210 54.571  1.00 62.72  ? 222  ARG A CZ  1 
ATOM   1766  N  NH1 . ARG A  1  236 ? 80.661  -100.035 55.891  1.00 63.70  ? 222  ARG A NH1 1 
ATOM   1767  N  NH2 . ARG A  1  236 ? 81.779  -100.086 53.883  1.00 64.24  ? 222  ARG A NH2 1 
ATOM   1768  N  N   . LYS A  1  237 ? 74.373  -98.722  53.929  1.00 47.83  ? 223  LYS A N   1 
ATOM   1769  C  CA  . LYS A  1  237 ? 74.101  -97.570  54.742  1.00 48.55  ? 223  LYS A CA  1 
ATOM   1770  C  C   . LYS A  1  237 ? 75.265  -97.434  55.715  1.00 48.78  ? 223  LYS A C   1 
ATOM   1771  O  O   . LYS A  1  237 ? 75.593  -98.390  56.425  1.00 48.70  ? 223  LYS A O   1 
ATOM   1772  C  CB  . LYS A  1  237 ? 72.799  -97.789  55.505  1.00 48.66  ? 223  LYS A CB  1 
ATOM   1773  C  CG  . LYS A  1  237 ? 72.030  -96.537  55.796  1.00 49.56  ? 223  LYS A CG  1 
ATOM   1774  C  CD  . LYS A  1  237 ? 71.132  -96.759  56.993  1.00 52.80  ? 223  LYS A CD  1 
ATOM   1775  C  CE  . LYS A  1  237 ? 69.821  -95.978  56.863  1.00 55.28  ? 223  LYS A CE  1 
ATOM   1776  N  NZ  . LYS A  1  237 ? 68.785  -96.691  56.016  1.00 55.76  ? 223  LYS A NZ  1 
ATOM   1777  N  N   . LEU A  1  238 ? 75.899  -96.259  55.730  1.00 49.24  ? 224  LEU A N   1 
ATOM   1778  C  CA  . LEU A  1  238 ? 76.933  -95.948  56.721  1.00 49.78  ? 224  LEU A CA  1 
ATOM   1779  C  C   . LEU A  1  238 ? 76.305  -95.786  58.100  1.00 50.53  ? 224  LEU A C   1 
ATOM   1780  O  O   . LEU A  1  238 ? 75.184  -95.288  58.235  1.00 50.30  ? 224  LEU A O   1 
ATOM   1781  C  CB  . LEU A  1  238 ? 77.708  -94.681  56.353  1.00 49.55  ? 224  LEU A CB  1 
ATOM   1782  C  CG  . LEU A  1  238 ? 78.358  -94.501  54.969  1.00 49.52  ? 224  LEU A CG  1 
ATOM   1783  C  CD1 . LEU A  1  238 ? 79.339  -93.351  55.030  1.00 49.27  ? 224  LEU A CD1 1 
ATOM   1784  C  CD2 . LEU A  1  238 ? 79.063  -95.740  54.437  1.00 47.78  ? 224  LEU A CD2 1 
ATOM   1785  N  N   . THR A  1  239 ? 77.026  -96.231  59.123  1.00 51.69  ? 225  THR A N   1 
ATOM   1786  C  CA  . THR A  1  239 ? 76.564  -96.093  60.503  1.00 52.85  ? 225  THR A CA  1 
ATOM   1787  C  C   . THR A  1  239 ? 76.825  -94.675  61.006  1.00 53.34  ? 225  THR A C   1 
ATOM   1788  O  O   . THR A  1  239 ? 77.658  -93.954  60.457  1.00 53.09  ? 225  THR A O   1 
ATOM   1789  C  CB  . THR A  1  239 ? 77.293  -97.070  61.455  1.00 52.93  ? 225  THR A CB  1 
ATOM   1790  O  OG1 . THR A  1  239 ? 78.701  -96.793  61.428  1.00 52.97  ? 225  THR A OG1 1 
ATOM   1791  C  CG2 . THR A  1  239 ? 77.033  -98.536  61.065  1.00 53.14  ? 225  THR A CG2 1 
ATOM   1792  N  N   . SER A  1  240 ? 76.120  -94.295  62.064  1.00 54.31  ? 226  SER A N   1 
ATOM   1793  C  CA  . SER A  1  240 ? 76.402  -93.050  62.780  1.00 55.35  ? 226  SER A CA  1 
ATOM   1794  C  C   . SER A  1  240 ? 77.914  -92.823  63.027  1.00 56.14  ? 226  SER A C   1 
ATOM   1795  O  O   . SER A  1  240 ? 78.451  -91.746  62.729  1.00 55.68  ? 226  SER A O   1 
ATOM   1796  C  CB  . SER A  1  240 ? 75.624  -93.038  64.098  1.00 55.21  ? 226  SER A CB  1 
ATOM   1797  O  OG  . SER A  1  240 ? 75.884  -91.856  64.817  1.00 55.78  ? 226  SER A OG  1 
ATOM   1798  N  N   . GLN A  1  241 ? 78.583  -93.858  63.547  1.00 57.46  ? 227  GLN A N   1 
ATOM   1799  C  CA  . GLN A  1  241 ? 80.015  -93.822  63.860  1.00 58.57  ? 227  GLN A CA  1 
ATOM   1800  C  C   . GLN A  1  241 ? 80.912  -93.756  62.615  1.00 59.10  ? 227  GLN A C   1 
ATOM   1801  O  O   . GLN A  1  241 ? 81.941  -93.090  62.634  1.00 59.27  ? 227  GLN A O   1 
ATOM   1802  C  CB  . GLN A  1  241 ? 80.400  -95.002  64.769  1.00 58.67  ? 227  GLN A CB  1 
ATOM   1803  C  CG  . GLN A  1  241 ? 81.898  -95.110  65.122  1.00 59.79  ? 227  GLN A CG  1 
ATOM   1804  C  CD  . GLN A  1  241 ? 82.434  -93.899  65.900  1.00 61.60  ? 227  GLN A CD  1 
ATOM   1805  O  OE1 . GLN A  1  241 ? 81.902  -93.524  66.951  1.00 61.33  ? 227  GLN A OE1 1 
ATOM   1806  N  NE2 . GLN A  1  241 ? 83.501  -93.294  65.384  1.00 61.57  ? 227  GLN A NE2 1 
ATOM   1807  N  N   . GLU A  1  242 ? 80.531  -94.426  61.534  1.00 59.98  ? 228  GLU A N   1 
ATOM   1808  C  CA  . GLU A  1  242 ? 81.297  -94.306  60.286  1.00 61.00  ? 228  GLU A CA  1 
ATOM   1809  C  C   . GLU A  1  242 ? 81.249  -92.881  59.732  1.00 61.31  ? 228  GLU A C   1 
ATOM   1810  O  O   . GLU A  1  242 ? 82.233  -92.408  59.157  1.00 61.31  ? 228  GLU A O   1 
ATOM   1811  C  CB  . GLU A  1  242 ? 80.819  -95.303  59.225  1.00 61.12  ? 228  GLU A CB  1 
ATOM   1812  C  CG  . GLU A  1  242 ? 81.166  -96.758  59.521  1.00 62.30  ? 228  GLU A CG  1 
ATOM   1813  C  CD  . GLU A  1  242 ? 80.648  -97.715  58.460  1.00 63.79  ? 228  GLU A CD  1 
ATOM   1814  O  OE1 . GLU A  1  242 ? 79.409  -97.837  58.308  1.00 64.02  ? 228  GLU A OE1 1 
ATOM   1815  O  OE2 . GLU A  1  242 ? 81.489  -98.351  57.785  1.00 64.52  ? 228  GLU A OE2 1 
ATOM   1816  N  N   . ILE A  1  243 ? 80.104  -92.213  59.909  1.00 61.92  ? 229  ILE A N   1 
ATOM   1817  C  CA  . ILE A  1  243 ? 79.912  -90.823  59.466  1.00 62.46  ? 229  ILE A CA  1 
ATOM   1818  C  C   . ILE A  1  243 ? 80.822  -89.862  60.246  1.00 63.01  ? 229  ILE A C   1 
ATOM   1819  O  O   . ILE A  1  243 ? 81.591  -89.114  59.640  1.00 63.06  ? 229  ILE A O   1 
ATOM   1820  C  CB  . ILE A  1  243 ? 78.411  -90.359  59.553  1.00 62.43  ? 229  ILE A CB  1 
ATOM   1821  C  CG1 . ILE A  1  243 ? 77.530  -91.152  58.580  1.00 62.09  ? 229  ILE A CG1 1 
ATOM   1822  C  CG2 . ILE A  1  243 ? 78.274  -88.852  59.275  1.00 61.58  ? 229  ILE A CG2 1 
ATOM   1823  C  CD1 . ILE A  1  243 ? 76.025  -91.089  58.880  1.00 61.22  ? 229  ILE A CD1 1 
ATOM   1824  N  N   . ASN A  1  244 ? 80.731  -89.906  61.579  1.00 63.64  ? 230  ASN A N   1 
ATOM   1825  C  CA  . ASN A  1  244 ? 81.558  -89.090  62.472  1.00 64.41  ? 230  ASN A CA  1 
ATOM   1826  C  C   . ASN A  1  244 ? 83.064  -89.205  62.209  1.00 65.72  ? 230  ASN A C   1 
ATOM   1827  O  O   . ASN A  1  244 ? 83.793  -88.207  62.300  1.00 65.76  ? 230  ASN A O   1 
ATOM   1828  C  CB  . ASN A  1  244 ? 81.253  -89.419  63.936  1.00 63.84  ? 230  ASN A CB  1 
ATOM   1829  C  CG  . ASN A  1  244 ? 79.923  -88.849  64.405  1.00 62.56  ? 230  ASN A CG  1 
ATOM   1830  O  OD1 . ASN A  1  244 ? 79.516  -87.768  63.997  1.00 61.13  ? 230  ASN A OD1 1 
ATOM   1831  N  ND2 . ASN A  1  244 ? 79.250  -89.574  65.281  1.00 61.14  ? 230  ASN A ND2 1 
ATOM   1832  N  N   . ASP A  1  245 ? 83.516  -90.418  61.879  1.00 67.10  ? 231  ASP A N   1 
ATOM   1833  C  CA  . ASP A  1  245 ? 84.907  -90.670  61.502  1.00 68.75  ? 231  ASP A CA  1 
ATOM   1834  C  C   . ASP A  1  245 ? 85.344  -89.797  60.337  1.00 69.90  ? 231  ASP A C   1 
ATOM   1835  O  O   . ASP A  1  245 ? 86.487  -89.350  60.287  1.00 70.14  ? 231  ASP A O   1 
ATOM   1836  C  CB  . ASP A  1  245 ? 85.114  -92.139  61.124  1.00 68.80  ? 231  ASP A CB  1 
ATOM   1837  C  CG  . ASP A  1  245 ? 85.130  -93.072  62.330  1.00 69.38  ? 231  ASP A CG  1 
ATOM   1838  O  OD1 . ASP A  1  245 ? 85.130  -92.592  63.486  1.00 69.63  ? 231  ASP A OD1 1 
ATOM   1839  O  OD2 . ASP A  1  245 ? 85.147  -94.305  62.116  1.00 70.14  ? 231  ASP A OD2 1 
ATOM   1840  N  N   . ARG A  1  246 ? 84.433  -89.561  59.402  1.00 71.50  ? 232  ARG A N   1 
ATOM   1841  C  CA  . ARG A  1  246 ? 84.739  -88.751  58.231  1.00 73.28  ? 232  ARG A CA  1 
ATOM   1842  C  C   . ARG A  1  246 ? 84.539  -87.252  58.443  1.00 74.68  ? 232  ARG A C   1 
ATOM   1843  O  O   . ARG A  1  246 ? 84.965  -86.440  57.609  1.00 74.88  ? 232  ARG A O   1 
ATOM   1844  C  CB  . ARG A  1  246 ? 83.949  -89.238  57.024  1.00 73.05  ? 232  ARG A CB  1 
ATOM   1845  C  CG  . ARG A  1  246 ? 84.717  -90.230  56.199  1.00 73.23  ? 232  ARG A CG  1 
ATOM   1846  C  CD  . ARG A  1  246 ? 83.802  -91.066  55.327  1.00 73.15  ? 232  ARG A CD  1 
ATOM   1847  N  NE  . ARG A  1  246 ? 84.419  -92.347  55.005  1.00 72.74  ? 232  ARG A NE  1 
ATOM   1848  C  CZ  . ARG A  1  246 ? 84.379  -93.410  55.801  1.00 72.84  ? 232  ARG A CZ  1 
ATOM   1849  N  NH1 . ARG A  1  246 ? 83.743  -93.352  56.966  1.00 72.83  ? 232  ARG A NH1 1 
ATOM   1850  N  NH2 . ARG A  1  246 ? 84.978  -94.531  55.433  1.00 72.79  ? 232  ARG A NH2 1 
ATOM   1851  N  N   . LEU A  1  247 ? 83.903  -86.885  59.554  1.00 76.33  ? 233  LEU A N   1 
ATOM   1852  C  CA  . LEU A  1  247 ? 83.693  -85.475  59.880  1.00 77.99  ? 233  LEU A CA  1 
ATOM   1853  C  C   . LEU A  1  247 ? 84.875  -84.860  60.630  1.00 79.63  ? 233  LEU A C   1 
ATOM   1854  O  O   . LEU A  1  247 ? 85.145  -83.669  60.495  1.00 79.89  ? 233  LEU A O   1 
ATOM   1855  C  CB  . LEU A  1  247 ? 82.387  -85.272  60.655  1.00 77.50  ? 233  LEU A CB  1 
ATOM   1856  C  CG  . LEU A  1  247 ? 81.092  -85.335  59.836  1.00 76.50  ? 233  LEU A CG  1 
ATOM   1857  C  CD1 . LEU A  1  247 ? 79.874  -85.260  60.733  1.00 75.35  ? 233  LEU A CD1 1 
ATOM   1858  C  CD2 . LEU A  1  247 ? 81.039  -84.248  58.776  1.00 75.30  ? 233  LEU A CD2 1 
ATOM   1859  N  N   . GLU A  1  248 ? 85.580  -85.679  61.406  1.00 81.63  ? 234  GLU A N   1 
ATOM   1860  C  CA  . GLU A  1  248 ? 86.716  -85.209  62.202  1.00 83.65  ? 234  GLU A CA  1 
ATOM   1861  C  C   . GLU A  1  248 ? 87.985  -85.005  61.376  1.00 84.57  ? 234  GLU A C   1 
ATOM   1862  O  O   . GLU A  1  248 ? 88.904  -84.306  61.814  1.00 85.03  ? 234  GLU A O   1 
ATOM   1863  C  CB  . GLU A  1  248 ? 86.982  -86.154  63.379  1.00 83.75  ? 234  GLU A CB  1 
ATOM   1864  C  CG  . GLU A  1  248 ? 86.007  -85.955  64.538  1.00 85.63  ? 234  GLU A CG  1 
ATOM   1865  C  CD  . GLU A  1  248 ? 85.772  -87.224  65.354  1.00 87.74  ? 234  GLU A CD  1 
ATOM   1866  O  OE1 . GLU A  1  248 ? 86.606  -88.159  65.272  1.00 88.03  ? 234  GLU A OE1 1 
ATOM   1867  O  OE2 . GLU A  1  248 ? 84.748  -87.282  66.080  1.00 88.16  ? 234  GLU A OE2 1 
ATOM   1868  N  N   . ALA A  1  249 ? 88.034  -85.616  60.194  1.00 85.50  ? 235  ALA A N   1 
ATOM   1869  C  CA  . ALA A  1  249 ? 89.137  -85.402  59.260  1.00 86.38  ? 235  ALA A CA  1 
ATOM   1870  C  C   . ALA A  1  249 ? 88.688  -84.482  58.108  1.00 87.05  ? 235  ALA A C   1 
ATOM   1871  O  O   . ALA A  1  249 ? 89.294  -84.461  57.028  1.00 87.17  ? 235  ALA A O   1 
ATOM   1872  C  CB  . ALA A  1  249 ? 89.653  -86.744  58.736  1.00 86.32  ? 235  ALA A CB  1 
ATOM   1873  N  N   . LEU A  1  250 ? 87.631  -83.711  58.365  1.00 87.70  ? 236  LEU A N   1 
ATOM   1874  C  CA  . LEU A  1  250 ? 86.994  -82.850  57.364  1.00 88.44  ? 236  LEU A CA  1 
ATOM   1875  C  C   . LEU A  1  250 ? 87.941  -81.804  56.750  1.00 88.84  ? 236  LEU A C   1 
ATOM   1876  O  O   . LEU A  1  250 ? 87.869  -81.497  55.554  1.00 89.04  ? 236  LEU A O   1 
ATOM   1877  C  CB  . LEU A  1  250 ? 85.770  -82.162  57.989  1.00 88.45  ? 236  LEU A CB  1 
ATOM   1878  C  CG  . LEU A  1  250 ? 84.640  -81.567  57.138  1.00 88.80  ? 236  LEU A CG  1 
ATOM   1879  C  CD1 . LEU A  1  250 ? 85.023  -80.177  56.589  1.00 89.20  ? 236  LEU A CD1 1 
ATOM   1880  C  CD2 . LEU A  1  250 ? 84.177  -82.528  56.024  1.00 88.35  ? 236  LEU A CD2 1 
ATOM   1881  O  OXT . LEU A  1  250 ? 88.796  -81.227  57.430  1.00 89.22  ? 236  LEU A OXT 1 
ATOM   1882  N  N   . THR B  2  1   ? 38.302  -83.298  26.371  1.00 64.03  ? 13   THR B N   1 
ATOM   1883  C  CA  . THR B  2  1   ? 37.503  -84.220  25.504  1.00 63.82  ? 13   THR B CA  1 
ATOM   1884  C  C   . THR B  2  1   ? 36.171  -83.601  25.070  1.00 63.73  ? 13   THR B C   1 
ATOM   1885  O  O   . THR B  2  1   ? 35.264  -84.317  24.655  1.00 64.25  ? 13   THR B O   1 
ATOM   1886  C  CB  . THR B  2  1   ? 37.227  -85.574  26.200  1.00 63.66  ? 13   THR B CB  1 
ATOM   1887  N  N   . ILE B  2  2   ? 36.043  -82.281  25.173  1.00 63.33  ? 14   ILE B N   1 
ATOM   1888  C  CA  . ILE B  2  2   ? 34.841  -81.599  24.681  1.00 62.90  ? 14   ILE B CA  1 
ATOM   1889  C  C   . ILE B  2  2   ? 35.180  -80.555  23.625  1.00 62.47  ? 14   ILE B C   1 
ATOM   1890  O  O   . ILE B  2  2   ? 36.337  -80.157  23.475  1.00 62.46  ? 14   ILE B O   1 
ATOM   1891  C  CB  . ILE B  2  2   ? 33.969  -80.950  25.816  1.00 63.18  ? 14   ILE B CB  1 
ATOM   1892  C  CG1 . ILE B  2  2   ? 34.589  -79.648  26.340  1.00 62.74  ? 14   ILE B CG1 1 
ATOM   1893  C  CG2 . ILE B  2  2   ? 33.692  -81.947  26.950  1.00 63.20  ? 14   ILE B CG2 1 
ATOM   1894  C  CD1 . ILE B  2  2   ? 33.548  -78.637  26.792  1.00 63.09  ? 14   ILE B CD1 1 
ATOM   1895  N  N   . PHE B  2  3   ? 34.152  -80.121  22.903  1.00 62.04  ? 15   PHE B N   1 
ATOM   1896  C  CA  . PHE B  2  3   ? 34.285  -79.136  21.840  1.00 61.54  ? 15   PHE B CA  1 
ATOM   1897  C  C   . PHE B  2  3   ? 34.074  -77.726  22.370  1.00 61.82  ? 15   PHE B C   1 
ATOM   1898  O  O   . PHE B  2  3   ? 33.247  -77.507  23.259  1.00 61.52  ? 15   PHE B O   1 
ATOM   1899  C  CB  . PHE B  2  3   ? 33.245  -79.397  20.752  1.00 61.19  ? 15   PHE B CB  1 
ATOM   1900  C  CG  . PHE B  2  3   ? 33.678  -80.371  19.699  1.00 59.65  ? 15   PHE B CG  1 
ATOM   1901  C  CD1 . PHE B  2  3   ? 34.782  -80.110  18.898  1.00 58.21  ? 15   PHE B CD1 1 
ATOM   1902  C  CD2 . PHE B  2  3   ? 32.951  -81.538  19.477  1.00 58.44  ? 15   PHE B CD2 1 
ATOM   1903  C  CE1 . PHE B  2  3   ? 35.170  -81.007  17.904  1.00 57.46  ? 15   PHE B CE1 1 
ATOM   1904  C  CE2 . PHE B  2  3   ? 33.329  -82.436  18.488  1.00 57.45  ? 15   PHE B CE2 1 
ATOM   1905  C  CZ  . PHE B  2  3   ? 34.442  -82.169  17.699  1.00 57.18  ? 15   PHE B CZ  1 
ATOM   1906  N  N   . SER B  2  4   ? 34.825  -76.778  21.813  1.00 62.19  ? 16   SER B N   1 
ATOM   1907  C  CA  . SER B  2  4   ? 34.593  -75.359  22.058  1.00 62.65  ? 16   SER B CA  1 
ATOM   1908  C  C   . SER B  2  4   ? 33.505  -74.890  21.095  1.00 62.88  ? 16   SER B C   1 
ATOM   1909  O  O   . SER B  2  4   ? 33.255  -75.558  20.090  1.00 62.97  ? 16   SER B O   1 
ATOM   1910  C  CB  . SER B  2  4   ? 35.878  -74.552  21.830  1.00 62.74  ? 16   SER B CB  1 
ATOM   1911  O  OG  . SER B  2  4   ? 36.054  -74.222  20.459  1.00 62.94  ? 16   SER B OG  1 
ATOM   1912  N  N   . PRO B  2  5   ? 32.854  -73.744  21.390  1.00 63.11  ? 17   PRO B N   1 
ATOM   1913  C  CA  . PRO B  2  5   ? 31.877  -73.204  20.440  1.00 63.07  ? 17   PRO B CA  1 
ATOM   1914  C  C   . PRO B  2  5   ? 32.442  -72.946  19.031  1.00 63.07  ? 17   PRO B C   1 
ATOM   1915  O  O   . PRO B  2  5   ? 31.671  -72.827  18.082  1.00 63.21  ? 17   PRO B O   1 
ATOM   1916  C  CB  . PRO B  2  5   ? 31.434  -71.901  21.106  1.00 63.15  ? 17   PRO B CB  1 
ATOM   1917  C  CG  . PRO B  2  5   ? 31.606  -72.160  22.567  1.00 62.94  ? 17   PRO B CG  1 
ATOM   1918  C  CD  . PRO B  2  5   ? 32.854  -72.986  22.659  1.00 63.01  ? 17   PRO B CD  1 
ATOM   1919  N  N   . GLU B  2  6   ? 33.763  -72.865  18.894  1.00 63.00  ? 18   GLU B N   1 
ATOM   1920  C  CA  . GLU B  2  6   ? 34.373  -72.759  17.567  1.00 63.33  ? 18   GLU B CA  1 
ATOM   1921  C  C   . GLU B  2  6   ? 34.591  -74.129  16.938  1.00 62.89  ? 18   GLU B C   1 
ATOM   1922  O  O   . GLU B  2  6   ? 35.059  -74.217  15.804  1.00 63.02  ? 18   GLU B O   1 
ATOM   1923  C  CB  . GLU B  2  6   ? 35.715  -72.001  17.601  1.00 63.79  ? 18   GLU B CB  1 
ATOM   1924  C  CG  . GLU B  2  6   ? 35.606  -70.477  17.679  1.00 65.52  ? 18   GLU B CG  1 
ATOM   1925  C  CD  . GLU B  2  6   ? 35.365  -69.993  19.102  1.00 68.59  ? 18   GLU B CD  1 
ATOM   1926  O  OE1 . GLU B  2  6   ? 34.615  -69.004  19.270  1.00 69.26  ? 18   GLU B OE1 1 
ATOM   1927  O  OE2 . GLU B  2  6   ? 35.917  -70.615  20.052  1.00 69.75  ? 18   GLU B OE2 1 
ATOM   1928  N  N   . GLY B  2  7   ? 34.267  -75.192  17.673  1.00 62.42  ? 19   GLY B N   1 
ATOM   1929  C  CA  . GLY B  2  7   ? 34.523  -76.561  17.212  1.00 61.63  ? 19   GLY B CA  1 
ATOM   1930  C  C   . GLY B  2  7   ? 35.981  -76.968  17.340  1.00 61.13  ? 19   GLY B C   1 
ATOM   1931  O  O   . GLY B  2  7   ? 36.537  -77.630  16.462  1.00 60.99  ? 19   GLY B O   1 
ATOM   1932  N  N   . ARG B  2  8   ? 36.599  -76.555  18.439  1.00 60.68  ? 20   ARG B N   1 
ATOM   1933  C  CA  . ARG B  2  8   ? 37.996  -76.856  18.705  1.00 60.32  ? 20   ARG B CA  1 
ATOM   1934  C  C   . ARG B  2  8   ? 38.057  -77.644  19.995  1.00 59.52  ? 20   ARG B C   1 
ATOM   1935  O  O   . ARG B  2  8   ? 37.170  -77.523  20.850  1.00 59.43  ? 20   ARG B O   1 
ATOM   1936  C  CB  . ARG B  2  8   ? 38.808  -75.571  18.883  1.00 60.78  ? 20   ARG B CB  1 
ATOM   1937  C  CG  . ARG B  2  8   ? 38.734  -74.584  17.741  1.00 62.47  ? 20   ARG B CG  1 
ATOM   1938  C  CD  . ARG B  2  8   ? 39.489  -73.283  18.077  1.00 65.32  ? 20   ARG B CD  1 
ATOM   1939  N  NE  . ARG B  2  8   ? 39.797  -72.529  16.859  1.00 67.61  ? 20   ARG B NE  1 
ATOM   1940  C  CZ  . ARG B  2  8   ? 40.810  -72.803  16.034  1.00 68.78  ? 20   ARG B CZ  1 
ATOM   1941  N  NH1 . ARG B  2  8   ? 41.644  -73.813  16.289  1.00 68.62  ? 20   ARG B NH1 1 
ATOM   1942  N  NH2 . ARG B  2  8   ? 40.994  -72.062  14.947  1.00 68.99  ? 20   ARG B NH2 1 
ATOM   1943  N  N   . LEU B  2  9   ? 39.116  -78.430  20.146  1.00 58.48  ? 21   LEU B N   1 
ATOM   1944  C  CA  . LEU B  2  9   ? 39.306  -79.233  21.349  1.00 57.39  ? 21   LEU B CA  1 
ATOM   1945  C  C   . LEU B  2  9   ? 40.260  -78.557  22.331  1.00 56.78  ? 21   LEU B C   1 
ATOM   1946  O  O   . LEU B  2  9   ? 41.479  -78.577  22.140  1.00 56.70  ? 21   LEU B O   1 
ATOM   1947  C  CB  . LEU B  2  9   ? 39.791  -80.633  20.961  1.00 57.22  ? 21   LEU B CB  1 
ATOM   1948  C  CG  . LEU B  2  9   ? 38.841  -81.380  20.018  1.00 56.48  ? 21   LEU B CG  1 
ATOM   1949  C  CD1 . LEU B  2  9   ? 39.543  -82.519  19.281  1.00 55.20  ? 21   LEU B CD1 1 
ATOM   1950  C  CD2 . LEU B  2  9   ? 37.600  -81.867  20.771  1.00 55.11  ? 21   LEU B CD2 1 
ATOM   1951  N  N   . TYR B  2  10  ? 39.695  -77.952  23.371  1.00 56.22  ? 22   TYR B N   1 
ATOM   1952  C  CA  . TYR B  2  10  ? 40.470  -77.205  24.362  1.00 56.15  ? 22   TYR B CA  1 
ATOM   1953  C  C   . TYR B  2  10  ? 41.757  -77.917  24.763  1.00 55.11  ? 22   TYR B C   1 
ATOM   1954  O  O   . TYR B  2  10  ? 42.867  -77.452  24.478  1.00 55.03  ? 22   TYR B O   1 
ATOM   1955  C  CB  . TYR B  2  10  ? 39.655  -76.995  25.634  1.00 56.82  ? 22   TYR B CB  1 
ATOM   1956  C  CG  . TYR B  2  10  ? 38.497  -76.025  25.539  1.00 59.98  ? 22   TYR B CG  1 
ATOM   1957  C  CD1 . TYR B  2  10  ? 38.707  -74.661  25.251  1.00 61.22  ? 22   TYR B CD1 1 
ATOM   1958  C  CD2 . TYR B  2  10  ? 37.181  -76.463  25.788  1.00 61.99  ? 22   TYR B CD2 1 
ATOM   1959  C  CE1 . TYR B  2  10  ? 37.629  -73.770  25.193  1.00 62.77  ? 22   TYR B CE1 1 
ATOM   1960  C  CE2 . TYR B  2  10  ? 36.098  -75.583  25.730  1.00 63.00  ? 22   TYR B CE2 1 
ATOM   1961  C  CZ  . TYR B  2  10  ? 36.327  -74.242  25.435  1.00 63.79  ? 22   TYR B CZ  1 
ATOM   1962  O  OH  . TYR B  2  10  ? 35.251  -73.384  25.383  1.00 65.20  ? 22   TYR B OH  1 
ATOM   1963  N  N   . GLN B  2  11  ? 41.587  -79.054  25.430  1.00 53.75  ? 23   GLN B N   1 
ATOM   1964  C  CA  . GLN B  2  11  ? 42.695  -79.798  25.995  1.00 52.52  ? 23   GLN B CA  1 
ATOM   1965  C  C   . GLN B  2  11  ? 43.756  -80.183  24.971  1.00 51.67  ? 23   GLN B C   1 
ATOM   1966  O  O   . GLN B  2  11  ? 44.937  -80.280  25.310  1.00 51.66  ? 23   GLN B O   1 
ATOM   1967  C  CB  . GLN B  2  11  ? 42.171  -81.032  26.726  1.00 52.58  ? 23   GLN B CB  1 
ATOM   1968  C  CG  . GLN B  2  11  ? 41.636  -80.730  28.105  1.00 52.78  ? 23   GLN B CG  1 
ATOM   1969  C  CD  . GLN B  2  11  ? 42.691  -80.134  29.021  1.00 54.04  ? 23   GLN B CD  1 
ATOM   1970  O  OE1 . GLN B  2  11  ? 42.542  -79.008  29.495  1.00 54.96  ? 23   GLN B OE1 1 
ATOM   1971  N  NE2 . GLN B  2  11  ? 43.771  -80.882  29.264  1.00 53.84  ? 23   GLN B NE2 1 
ATOM   1972  N  N   . VAL B  2  12  ? 43.334  -80.387  23.726  1.00 50.44  ? 24   VAL B N   1 
ATOM   1973  C  CA  . VAL B  2  12  ? 44.245  -80.757  22.653  1.00 49.72  ? 24   VAL B CA  1 
ATOM   1974  C  C   . VAL B  2  12  ? 45.055  -79.544  22.250  1.00 49.42  ? 24   VAL B C   1 
ATOM   1975  O  O   . VAL B  2  12  ? 46.276  -79.635  22.105  1.00 49.48  ? 24   VAL B O   1 
ATOM   1976  C  CB  . VAL B  2  12  ? 43.494  -81.334  21.431  1.00 49.83  ? 24   VAL B CB  1 
ATOM   1977  C  CG1 . VAL B  2  12  ? 44.449  -81.650  20.295  1.00 48.83  ? 24   VAL B CG1 1 
ATOM   1978  C  CG2 . VAL B  2  12  ? 42.723  -82.578  21.835  1.00 49.78  ? 24   VAL B CG2 1 
ATOM   1979  N  N   . GLU B  2  13  ? 44.370  -78.409  22.090  1.00 48.89  ? 25   GLU B N   1 
ATOM   1980  C  CA  . GLU B  2  13  ? 45.019  -77.137  21.781  1.00 48.40  ? 25   GLU B CA  1 
ATOM   1981  C  C   . GLU B  2  13  ? 46.062  -76.789  22.834  1.00 47.44  ? 25   GLU B C   1 
ATOM   1982  O  O   . GLU B  2  13  ? 47.194  -76.418  22.501  1.00 47.11  ? 25   GLU B O   1 
ATOM   1983  C  CB  . GLU B  2  13  ? 43.992  -76.000  21.669  1.00 48.80  ? 25   GLU B CB  1 
ATOM   1984  C  CG  . GLU B  2  13  ? 42.935  -76.161  20.570  1.00 51.73  ? 25   GLU B CG  1 
ATOM   1985  C  CD  . GLU B  2  13  ? 43.515  -76.583  19.200  1.00 55.43  ? 25   GLU B CD  1 
ATOM   1986  O  OE1 . GLU B  2  13  ? 42.952  -77.534  18.600  1.00 55.60  ? 25   GLU B OE1 1 
ATOM   1987  O  OE2 . GLU B  2  13  ? 44.518  -75.971  18.731  1.00 55.97  ? 25   GLU B OE2 1 
ATOM   1988  N  N   . TYR B  2  14  ? 45.681  -76.927  24.103  1.00 46.48  ? 26   TYR B N   1 
ATOM   1989  C  CA  . TYR B  2  14  ? 46.578  -76.606  25.213  1.00 45.91  ? 26   TYR B CA  1 
ATOM   1990  C  C   . TYR B  2  14  ? 47.793  -77.542  25.284  1.00 45.46  ? 26   TYR B C   1 
ATOM   1991  O  O   . TYR B  2  14  ? 48.875  -77.135  25.712  1.00 45.10  ? 26   TYR B O   1 
ATOM   1992  C  CB  . TYR B  2  14  ? 45.830  -76.581  26.550  1.00 45.71  ? 26   TYR B CB  1 
ATOM   1993  C  CG  . TYR B  2  14  ? 44.654  -75.627  26.613  1.00 45.85  ? 26   TYR B CG  1 
ATOM   1994  C  CD1 . TYR B  2  14  ? 44.527  -74.562  25.706  1.00 45.16  ? 26   TYR B CD1 1 
ATOM   1995  C  CD2 . TYR B  2  14  ? 43.682  -75.766  27.604  1.00 45.59  ? 26   TYR B CD2 1 
ATOM   1996  C  CE1 . TYR B  2  14  ? 43.459  -73.689  25.764  1.00 45.09  ? 26   TYR B CE1 1 
ATOM   1997  C  CE2 . TYR B  2  14  ? 42.605  -74.889  27.674  1.00 46.64  ? 26   TYR B CE2 1 
ATOM   1998  C  CZ  . TYR B  2  14  ? 42.502  -73.854  26.748  1.00 46.79  ? 26   TYR B CZ  1 
ATOM   1999  O  OH  . TYR B  2  14  ? 41.436  -72.989  26.813  1.00 48.10  ? 26   TYR B OH  1 
ATOM   2000  N  N   . ALA B  2  15  ? 47.604  -78.790  24.860  1.00 44.99  ? 27   ALA B N   1 
ATOM   2001  C  CA  . ALA B  2  15  ? 48.694  -79.747  24.793  1.00 44.69  ? 27   ALA B CA  1 
ATOM   2002  C  C   . ALA B  2  15  ? 49.685  -79.360  23.699  1.00 44.56  ? 27   ALA B C   1 
ATOM   2003  O  O   . ALA B  2  15  ? 50.894  -79.459  23.901  1.00 44.15  ? 27   ALA B O   1 
ATOM   2004  C  CB  . ALA B  2  15  ? 48.154  -81.137  24.569  1.00 44.81  ? 27   ALA B CB  1 
ATOM   2005  N  N   . LEU B  2  16  ? 49.165  -78.906  22.554  1.00 44.60  ? 28   LEU B N   1 
ATOM   2006  C  CA  . LEU B  2  16  ? 49.989  -78.401  21.445  1.00 44.83  ? 28   LEU B CA  1 
ATOM   2007  C  C   . LEU B  2  16  ? 50.815  -77.186  21.857  1.00 45.25  ? 28   LEU B C   1 
ATOM   2008  O  O   . LEU B  2  16  ? 51.955  -77.005  21.407  1.00 45.07  ? 28   LEU B O   1 
ATOM   2009  C  CB  . LEU B  2  16  ? 49.112  -78.035  20.250  1.00 44.45  ? 28   LEU B CB  1 
ATOM   2010  C  CG  . LEU B  2  16  ? 48.501  -79.168  19.429  1.00 44.60  ? 28   LEU B CG  1 
ATOM   2011  C  CD1 . LEU B  2  16  ? 47.359  -78.655  18.579  1.00 44.20  ? 28   LEU B CD1 1 
ATOM   2012  C  CD2 . LEU B  2  16  ? 49.556  -79.830  18.557  1.00 44.73  ? 28   LEU B CD2 1 
ATOM   2013  N  N   . GLU B  2  17  ? 50.215  -76.360  22.715  1.00 45.81  ? 29   GLU B N   1 
ATOM   2014  C  CA  . GLU B  2  17  ? 50.868  -75.188  23.271  1.00 46.28  ? 29   GLU B CA  1 
ATOM   2015  C  C   . GLU B  2  17  ? 52.053  -75.605  24.131  1.00 46.00  ? 29   GLU B C   1 
ATOM   2016  O  O   . GLU B  2  17  ? 53.132  -75.027  24.032  1.00 46.25  ? 29   GLU B O   1 
ATOM   2017  C  CB  . GLU B  2  17  ? 49.857  -74.355  24.071  1.00 46.54  ? 29   GLU B CB  1 
ATOM   2018  C  CG  . GLU B  2  17  ? 50.363  -72.984  24.529  1.00 48.83  ? 29   GLU B CG  1 
ATOM   2019  C  CD  . GLU B  2  17  ? 50.901  -72.105  23.381  1.00 51.68  ? 29   GLU B CD  1 
ATOM   2020  O  OE1 . GLU B  2  17  ? 51.942  -71.442  23.595  1.00 53.86  ? 29   GLU B OE1 1 
ATOM   2021  O  OE2 . GLU B  2  17  ? 50.300  -72.067  22.278  1.00 51.01  ? 29   GLU B OE2 1 
ATOM   2022  N  N   . SER B  2  18  ? 51.843  -76.626  24.958  1.00 45.84  ? 30   SER B N   1 
ATOM   2023  C  CA  . SER B  2  18  ? 52.892  -77.205  25.798  1.00 45.61  ? 30   SER B CA  1 
ATOM   2024  C  C   . SER B  2  18  ? 54.081  -77.687  24.974  1.00 45.80  ? 30   SER B C   1 
ATOM   2025  O  O   . SER B  2  18  ? 55.235  -77.562  25.386  1.00 45.73  ? 30   SER B O   1 
ATOM   2026  C  CB  . SER B  2  18  ? 52.312  -78.359  26.605  1.00 45.33  ? 30   SER B CB  1 
ATOM   2027  O  OG  . SER B  2  18  ? 53.320  -79.176  27.156  1.00 45.49  ? 30   SER B OG  1 
ATOM   2028  N  N   . ILE B  2  19  ? 53.781  -78.218  23.796  1.00 46.20  ? 31   ILE B N   1 
ATOM   2029  C  CA  . ILE B  2  19  ? 54.783  -78.814  22.922  1.00 46.79  ? 31   ILE B CA  1 
ATOM   2030  C  C   . ILE B  2  19  ? 55.705  -77.760  22.296  1.00 47.20  ? 31   ILE B C   1 
ATOM   2031  O  O   . ILE B  2  19  ? 56.907  -77.982  22.174  1.00 47.05  ? 31   ILE B O   1 
ATOM   2032  C  CB  . ILE B  2  19  ? 54.106  -79.743  21.871  1.00 46.73  ? 31   ILE B CB  1 
ATOM   2033  C  CG1 . ILE B  2  19  ? 53.627  -81.016  22.566  1.00 46.71  ? 31   ILE B CG1 1 
ATOM   2034  C  CG2 . ILE B  2  19  ? 55.038  -80.097  20.701  1.00 46.34  ? 31   ILE B CG2 1 
ATOM   2035  C  CD1 . ILE B  2  19  ? 52.781  -81.888  21.691  1.00 47.39  ? 31   ILE B CD1 1 
ATOM   2036  N  N   . SER B  2  20  ? 55.145  -76.613  21.934  1.00 47.86  ? 32   SER B N   1 
ATOM   2037  C  CA  . SER B  2  20  ? 55.929  -75.517  21.369  1.00 48.57  ? 32   SER B CA  1 
ATOM   2038  C  C   . SER B  2  20  ? 57.020  -74.967  22.301  1.00 48.99  ? 32   SER B C   1 
ATOM   2039  O  O   . SER B  2  20  ? 57.874  -74.217  21.851  1.00 49.51  ? 32   SER B O   1 
ATOM   2040  C  CB  . SER B  2  20  ? 55.012  -74.385  20.925  1.00 48.39  ? 32   SER B CB  1 
ATOM   2041  O  OG  . SER B  2  20  ? 54.476  -73.743  22.061  1.00 49.37  ? 32   SER B OG  1 
ATOM   2042  N  N   . HIS B  2  21  ? 57.006  -75.328  23.583  1.00 49.52  ? 33   HIS B N   1 
ATOM   2043  C  CA  . HIS B  2  21  ? 58.108  -74.951  24.490  1.00 50.01  ? 33   HIS B CA  1 
ATOM   2044  C  C   . HIS B  2  21  ? 59.209  -76.002  24.572  1.00 49.57  ? 33   HIS B C   1 
ATOM   2045  O  O   . HIS B  2  21  ? 60.275  -75.752  25.141  1.00 49.95  ? 33   HIS B O   1 
ATOM   2046  C  CB  . HIS B  2  21  ? 57.596  -74.617  25.893  1.00 50.47  ? 33   HIS B CB  1 
ATOM   2047  C  CG  . HIS B  2  21  ? 56.557  -73.540  25.909  1.00 53.53  ? 33   HIS B CG  1 
ATOM   2048  N  ND1 . HIS B  2  21  ? 56.764  -72.297  25.345  1.00 55.70  ? 33   HIS B ND1 1 
ATOM   2049  C  CD2 . HIS B  2  21  ? 55.298  -73.522  26.410  1.00 55.60  ? 33   HIS B CD2 1 
ATOM   2050  C  CE1 . HIS B  2  21  ? 55.677  -71.560  25.496  1.00 57.11  ? 33   HIS B CE1 1 
ATOM   2051  N  NE2 . HIS B  2  21  ? 54.773  -72.280  26.142  1.00 57.45  ? 33   HIS B NE2 1 
ATOM   2052  N  N   . ALA B  2  22  ? 58.952  -77.176  24.003  1.00 48.90  ? 34   ALA B N   1 
ATOM   2053  C  CA  . ALA B  2  22  ? 59.912  -78.279  24.038  1.00 47.99  ? 34   ALA B CA  1 
ATOM   2054  C  C   . ALA B  2  22  ? 61.004  -78.105  22.989  1.00 47.29  ? 34   ALA B C   1 
ATOM   2055  O  O   . ALA B  2  22  ? 60.772  -77.525  21.937  1.00 47.22  ? 34   ALA B O   1 
ATOM   2056  C  CB  . ALA B  2  22  ? 59.197  -79.618  23.856  1.00 47.88  ? 34   ALA B CB  1 
ATOM   2057  N  N   . GLY B  2  23  ? 62.194  -78.613  23.288  1.00 46.73  ? 35   GLY B N   1 
ATOM   2058  C  CA  . GLY B  2  23  ? 63.302  -78.601  22.349  1.00 46.41  ? 35   GLY B CA  1 
ATOM   2059  C  C   . GLY B  2  23  ? 62.890  -79.021  20.951  1.00 46.43  ? 35   GLY B C   1 
ATOM   2060  O  O   . GLY B  2  23  ? 62.097  -79.943  20.773  1.00 46.65  ? 35   GLY B O   1 
ATOM   2061  N  N   . THR B  2  24  ? 63.435  -78.334  19.956  1.00 46.26  ? 36   THR B N   1 
ATOM   2062  C  CA  . THR B  2  24  ? 63.140  -78.618  18.567  1.00 46.00  ? 36   THR B CA  1 
ATOM   2063  C  C   . THR B  2  24  ? 63.687  -79.973  18.130  1.00 46.00  ? 36   THR B C   1 
ATOM   2064  O  O   . THR B  2  24  ? 64.837  -80.315  18.414  1.00 46.02  ? 36   THR B O   1 
ATOM   2065  C  CB  . THR B  2  24  ? 63.695  -77.499  17.662  1.00 45.91  ? 36   THR B CB  1 
ATOM   2066  O  OG1 . THR B  2  24  ? 63.005  -76.282  17.957  1.00 46.27  ? 36   THR B OG1 1 
ATOM   2067  C  CG2 . THR B  2  24  ? 63.512  -77.820  16.180  1.00 45.65  ? 36   THR B CG2 1 
ATOM   2068  N  N   . ALA B  2  25  ? 62.844  -80.738  17.444  1.00 45.91  ? 37   ALA B N   1 
ATOM   2069  C  CA  . ALA B  2  25  ? 63.282  -81.941  16.751  1.00 46.09  ? 37   ALA B CA  1 
ATOM   2070  C  C   . ALA B  2  25  ? 63.057  -81.791  15.249  1.00 46.09  ? 37   ALA B C   1 
ATOM   2071  O  O   . ALA B  2  25  ? 62.034  -81.257  14.811  1.00 45.69  ? 37   ALA B O   1 
ATOM   2072  C  CB  . ALA B  2  25  ? 62.556  -83.163  17.281  1.00 46.04  ? 37   ALA B CB  1 
ATOM   2073  N  N   . ILE B  2  26  ? 64.019  -82.276  14.471  1.00 46.30  ? 38   ILE B N   1 
ATOM   2074  C  CA  . ILE B  2  26  ? 63.995  -82.127  13.026  1.00 46.81  ? 38   ILE B CA  1 
ATOM   2075  C  C   . ILE B  2  26  ? 64.182  -83.466  12.345  1.00 46.93  ? 38   ILE B C   1 
ATOM   2076  O  O   . ILE B  2  26  ? 65.082  -84.229  12.689  1.00 47.27  ? 38   ILE B O   1 
ATOM   2077  C  CB  . ILE B  2  26  ? 65.104  -81.157  12.547  1.00 46.77  ? 38   ILE B CB  1 
ATOM   2078  C  CG1 . ILE B  2  26  ? 64.669  -79.709  12.793  1.00 47.90  ? 38   ILE B CG1 1 
ATOM   2079  C  CG2 . ILE B  2  26  ? 65.418  -81.358  11.064  1.00 46.63  ? 38   ILE B CG2 1 
ATOM   2080  C  CD1 . ILE B  2  26  ? 65.810  -78.696  12.739  1.00 49.44  ? 38   ILE B CD1 1 
ATOM   2081  N  N   . GLY B  2  27  ? 63.338  -83.739  11.364  1.00 46.97  ? 39   GLY B N   1 
ATOM   2082  C  CA  . GLY B  2  27  ? 63.529  -84.904  10.533  1.00 47.39  ? 39   GLY B CA  1 
ATOM   2083  C  C   . GLY B  2  27  ? 63.671  -84.524  9.081   1.00 47.79  ? 39   GLY B C   1 
ATOM   2084  O  O   . GLY B  2  27  ? 62.840  -83.783  8.548   1.00 47.57  ? 39   GLY B O   1 
ATOM   2085  N  N   . ILE B  2  28  ? 64.730  -85.026  8.449   1.00 48.29  ? 40   ILE B N   1 
ATOM   2086  C  CA  . ILE B  2  28  ? 64.925  -84.857  7.012   1.00 49.27  ? 40   ILE B CA  1 
ATOM   2087  C  C   . ILE B  2  28  ? 65.112  -86.202  6.305   1.00 50.05  ? 40   ILE B C   1 
ATOM   2088  O  O   . ILE B  2  28  ? 65.912  -87.040  6.719   1.00 49.99  ? 40   ILE B O   1 
ATOM   2089  C  CB  . ILE B  2  28  ? 66.129  -83.951  6.678   1.00 49.25  ? 40   ILE B CB  1 
ATOM   2090  C  CG1 . ILE B  2  28  ? 66.059  -82.640  7.451   1.00 49.36  ? 40   ILE B CG1 1 
ATOM   2091  C  CG2 . ILE B  2  28  ? 66.190  -83.668  5.177   1.00 49.20  ? 40   ILE B CG2 1 
ATOM   2092  C  CD1 . ILE B  2  28  ? 67.307  -81.824  7.332   1.00 50.89  ? 40   ILE B CD1 1 
ATOM   2093  N  N   . MET B  2  29  ? 64.382  -86.376  5.216   1.00 51.12  ? 41   MET B N   1 
ATOM   2094  C  CA  . MET B  2  29  ? 64.427  -87.595  4.438   1.00 52.61  ? 41   MET B CA  1 
ATOM   2095  C  C   . MET B  2  29  ? 65.149  -87.368  3.095   1.00 53.20  ? 41   MET B C   1 
ATOM   2096  O  O   . MET B  2  29  ? 64.686  -86.586  2.255   1.00 53.50  ? 41   MET B O   1 
ATOM   2097  C  CB  . MET B  2  29  ? 62.987  -88.108  4.238   1.00 52.94  ? 41   MET B CB  1 
ATOM   2098  C  CG  . MET B  2  29  ? 62.860  -89.456  3.550   1.00 54.03  ? 41   MET B CG  1 
ATOM   2099  S  SD  . MET B  2  29  ? 62.773  -89.286  1.757   1.00 58.32  ? 41   MET B SD  1 
ATOM   2100  C  CE  . MET B  2  29  ? 61.002  -89.114  1.472   1.00 57.27  ? 41   MET B CE  1 
ATOM   2101  N  N   . ALA B  2  30  ? 66.286  -88.046  2.917   1.00 53.84  ? 42   ALA B N   1 
ATOM   2102  C  CA  . ALA B  2  30  ? 67.050  -88.059  1.660   1.00 54.32  ? 42   ALA B CA  1 
ATOM   2103  C  C   . ALA B  2  30  ? 66.750  -89.327  0.839   1.00 54.95  ? 42   ALA B C   1 
ATOM   2104  O  O   . ALA B  2  30  ? 65.905  -90.140  1.221   1.00 55.43  ? 42   ALA B O   1 
ATOM   2105  C  CB  . ALA B  2  30  ? 68.538  -87.967  1.954   1.00 54.14  ? 42   ALA B CB  1 
ATOM   2106  N  N   . SER B  2  31  ? 67.441  -89.508  -0.283  1.00 55.33  ? 43   SER B N   1 
ATOM   2107  C  CA  . SER B  2  31  ? 67.185  -90.671  -1.148  1.00 55.65  ? 43   SER B CA  1 
ATOM   2108  C  C   . SER B  2  31  ? 67.809  -91.969  -0.607  1.00 55.39  ? 43   SER B C   1 
ATOM   2109  O  O   . SER B  2  31  ? 67.313  -93.062  -0.880  1.00 55.51  ? 43   SER B O   1 
ATOM   2110  C  CB  . SER B  2  31  ? 67.667  -90.402  -2.584  1.00 55.85  ? 43   SER B CB  1 
ATOM   2111  O  OG  . SER B  2  31  ? 69.066  -90.126  -2.611  1.00 56.89  ? 43   SER B OG  1 
ATOM   2112  N  N   . ASP B  2  32  ? 68.897  -91.842  0.151   1.00 54.89  ? 44   ASP B N   1 
ATOM   2113  C  CA  . ASP B  2  32  ? 69.632  -93.007  0.659   1.00 54.51  ? 44   ASP B CA  1 
ATOM   2114  C  C   . ASP B  2  32  ? 69.660  -93.105  2.195   1.00 53.61  ? 44   ASP B C   1 
ATOM   2115  O  O   . ASP B  2  32  ? 70.549  -93.740  2.773   1.00 53.59  ? 44   ASP B O   1 
ATOM   2116  C  CB  . ASP B  2  32  ? 71.058  -93.057  0.071   1.00 54.98  ? 44   ASP B CB  1 
ATOM   2117  C  CG  . ASP B  2  32  ? 71.794  -91.722  0.168   1.00 56.62  ? 44   ASP B CG  1 
ATOM   2118  O  OD1 . ASP B  2  32  ? 73.032  -91.726  0.374   1.00 58.54  ? 44   ASP B OD1 1 
ATOM   2119  O  OD2 . ASP B  2  32  ? 71.142  -90.663  0.029   1.00 58.98  ? 44   ASP B OD2 1 
ATOM   2120  N  N   . GLY B  2  33  ? 68.675  -92.485  2.844   1.00 52.49  ? 45   GLY B N   1 
ATOM   2121  C  CA  . GLY B  2  33  ? 68.618  -92.441  4.302   1.00 50.89  ? 45   GLY B CA  1 
ATOM   2122  C  C   . GLY B  2  33  ? 67.762  -91.327  4.886   1.00 49.89  ? 45   GLY B C   1 
ATOM   2123  O  O   . GLY B  2  33  ? 67.122  -90.564  4.151   1.00 49.40  ? 45   GLY B O   1 
ATOM   2124  N  N   . ILE B  2  34  ? 67.755  -91.250  6.218   1.00 48.76  ? 46   ILE B N   1 
ATOM   2125  C  CA  . ILE B  2  34  ? 66.953  -90.279  6.964   1.00 47.87  ? 46   ILE B CA  1 
ATOM   2126  C  C   . ILE B  2  34  ? 67.747  -89.699  8.131   1.00 47.69  ? 46   ILE B C   1 
ATOM   2127  O  O   . ILE B  2  34  ? 68.541  -90.398  8.748   1.00 47.48  ? 46   ILE B O   1 
ATOM   2128  C  CB  . ILE B  2  34  ? 65.673  -90.927  7.499   1.00 47.66  ? 46   ILE B CB  1 
ATOM   2129  C  CG1 . ILE B  2  34  ? 64.830  -91.447  6.336   1.00 47.79  ? 46   ILE B CG1 1 
ATOM   2130  C  CG2 . ILE B  2  34  ? 64.876  -89.945  8.339   1.00 46.92  ? 46   ILE B CG2 1 
ATOM   2131  C  CD1 . ILE B  2  34  ? 63.687  -92.299  6.751   1.00 49.42  ? 46   ILE B CD1 1 
ATOM   2132  N  N   . VAL B  2  35  ? 67.534  -88.421  8.428   1.00 47.62  ? 47   VAL B N   1 
ATOM   2133  C  CA  . VAL B  2  35  ? 68.179  -87.793  9.578   1.00 47.85  ? 47   VAL B CA  1 
ATOM   2134  C  C   . VAL B  2  35  ? 67.174  -87.440  10.682  1.00 48.02  ? 47   VAL B C   1 
ATOM   2135  O  O   . VAL B  2  35  ? 66.084  -86.953  10.401  1.00 47.96  ? 47   VAL B O   1 
ATOM   2136  C  CB  . VAL B  2  35  ? 68.991  -86.541  9.153   1.00 47.86  ? 47   VAL B CB  1 
ATOM   2137  C  CG1 . VAL B  2  35  ? 69.633  -85.858  10.354  1.00 47.42  ? 47   VAL B CG1 1 
ATOM   2138  C  CG2 . VAL B  2  35  ? 70.061  -86.934  8.164   1.00 48.13  ? 47   VAL B CG2 1 
ATOM   2139  N  N   . LEU B  2  36  ? 67.548  -87.716  11.929  1.00 48.45  ? 48   LEU B N   1 
ATOM   2140  C  CA  . LEU B  2  36  ? 66.847  -87.184  13.090  1.00 49.17  ? 48   LEU B CA  1 
ATOM   2141  C  C   . LEU B  2  36  ? 67.803  -86.408  13.990  1.00 49.97  ? 48   LEU B C   1 
ATOM   2142  O  O   . LEU B  2  36  ? 68.831  -86.930  14.433  1.00 50.20  ? 48   LEU B O   1 
ATOM   2143  C  CB  . LEU B  2  36  ? 66.201  -88.301  13.891  1.00 49.04  ? 48   LEU B CB  1 
ATOM   2144  C  CG  . LEU B  2  36  ? 65.041  -89.074  13.279  1.00 49.06  ? 48   LEU B CG  1 
ATOM   2145  C  CD1 . LEU B  2  36  ? 64.537  -90.065  14.321  1.00 48.33  ? 48   LEU B CD1 1 
ATOM   2146  C  CD2 . LEU B  2  36  ? 63.919  -88.140  12.825  1.00 48.34  ? 48   LEU B CD2 1 
ATOM   2147  N  N   . ALA B  2  37  ? 67.457  -85.159  14.261  1.00 50.75  ? 49   ALA B N   1 
ATOM   2148  C  CA  . ALA B  2  37  ? 68.287  -84.304  15.086  1.00 51.63  ? 49   ALA B CA  1 
ATOM   2149  C  C   . ALA B  2  37  ? 67.401  -83.611  16.104  1.00 52.47  ? 49   ALA B C   1 
ATOM   2150  O  O   . ALA B  2  37  ? 66.286  -83.209  15.775  1.00 52.61  ? 49   ALA B O   1 
ATOM   2151  C  CB  . ALA B  2  37  ? 68.995  -83.291  14.216  1.00 51.53  ? 49   ALA B CB  1 
ATOM   2152  N  N   . ALA B  2  38  ? 67.882  -83.477  17.336  1.00 53.67  ? 50   ALA B N   1 
ATOM   2153  C  CA  . ALA B  2  38  ? 67.097  -82.818  18.375  1.00 55.30  ? 50   ALA B CA  1 
ATOM   2154  C  C   . ALA B  2  38  ? 67.928  -82.016  19.385  1.00 56.65  ? 50   ALA B C   1 
ATOM   2155  O  O   . ALA B  2  38  ? 69.068  -82.363  19.690  1.00 56.37  ? 50   ALA B O   1 
ATOM   2156  C  CB  . ALA B  2  38  ? 66.221  -83.825  19.085  1.00 55.30  ? 50   ALA B CB  1 
ATOM   2157  N  N   . GLU B  2  39  ? 67.326  -80.945  19.895  1.00 58.55  ? 51   GLU B N   1 
ATOM   2158  C  CA  . GLU B  2  39  ? 67.958  -80.060  20.858  1.00 60.98  ? 51   GLU B CA  1 
ATOM   2159  C  C   . GLU B  2  39  ? 67.450  -80.425  22.244  1.00 62.45  ? 51   GLU B C   1 
ATOM   2160  O  O   . GLU B  2  39  ? 66.244  -80.438  22.480  1.00 62.47  ? 51   GLU B O   1 
ATOM   2161  C  CB  . GLU B  2  39  ? 67.615  -78.600  20.521  1.00 61.08  ? 51   GLU B CB  1 
ATOM   2162  C  CG  . GLU B  2  39  ? 68.401  -77.525  21.286  1.00 62.83  ? 51   GLU B CG  1 
ATOM   2163  C  CD  . GLU B  2  39  ? 67.969  -76.089  20.946  1.00 65.34  ? 51   GLU B CD  1 
ATOM   2164  O  OE1 . GLU B  2  39  ? 67.615  -75.806  19.776  1.00 66.64  ? 51   GLU B OE1 1 
ATOM   2165  O  OE2 . GLU B  2  39  ? 67.991  -75.225  21.851  1.00 66.12  ? 51   GLU B OE2 1 
ATOM   2166  N  N   . ARG B  2  40  ? 68.370  -80.725  23.155  1.00 64.70  ? 52   ARG B N   1 
ATOM   2167  C  CA  . ARG B  2  40  ? 68.011  -81.042  24.534  1.00 67.10  ? 52   ARG B CA  1 
ATOM   2168  C  C   . ARG B  2  40  ? 67.653  -79.773  25.291  1.00 68.61  ? 52   ARG B C   1 
ATOM   2169  O  O   . ARG B  2  40  ? 68.397  -78.792  25.260  1.00 68.78  ? 52   ARG B O   1 
ATOM   2170  C  CB  . ARG B  2  40  ? 69.161  -81.738  25.246  1.00 67.30  ? 52   ARG B CB  1 
ATOM   2171  C  CG  . ARG B  2  40  ? 69.565  -83.081  24.665  1.00 68.50  ? 52   ARG B CG  1 
ATOM   2172  C  CD  . ARG B  2  40  ? 70.974  -83.428  25.140  1.00 70.85  ? 52   ARG B CD  1 
ATOM   2173  N  NE  . ARG B  2  40  ? 71.334  -84.821  24.898  1.00 72.33  ? 52   ARG B NE  1 
ATOM   2174  C  CZ  . ARG B  2  40  ? 71.038  -85.828  25.717  1.00 73.30  ? 52   ARG B CZ  1 
ATOM   2175  N  NH1 . ARG B  2  40  ? 70.363  -85.611  26.844  1.00 73.46  ? 52   ARG B NH1 1 
ATOM   2176  N  NH2 . ARG B  2  40  ? 71.414  -87.061  25.400  1.00 73.80  ? 52   ARG B NH2 1 
ATOM   2177  N  N   . LYS B  2  41  ? 66.505  -79.802  25.961  1.00 70.79  ? 53   LYS B N   1 
ATOM   2178  C  CA  . LYS B  2  41  ? 66.025  -78.666  26.741  1.00 72.98  ? 53   LYS B CA  1 
ATOM   2179  C  C   . LYS B  2  41  ? 66.749  -78.666  28.079  1.00 73.99  ? 53   LYS B C   1 
ATOM   2180  O  O   . LYS B  2  41  ? 66.928  -79.732  28.683  1.00 74.14  ? 53   LYS B O   1 
ATOM   2181  C  CB  . LYS B  2  41  ? 64.501  -78.753  26.946  1.00 73.40  ? 53   LYS B CB  1 
ATOM   2182  C  CG  . LYS B  2  41  ? 63.844  -77.538  27.650  1.00 75.24  ? 53   LYS B CG  1 
ATOM   2183  C  CD  . LYS B  2  41  ? 62.297  -77.596  27.550  1.00 78.17  ? 53   LYS B CD  1 
ATOM   2184  C  CE  . LYS B  2  41  ? 61.617  -76.663  28.567  1.00 78.98  ? 53   LYS B CE  1 
ATOM   2185  N  NZ  . LYS B  2  41  ? 61.489  -77.294  29.935  1.00 79.64  ? 53   LYS B NZ  1 
ATOM   2186  N  N   . VAL B  2  42  ? 67.169  -77.469  28.513  1.00 75.25  ? 54   VAL B N   1 
ATOM   2187  C  CA  . VAL B  2  42  ? 67.836  -77.229  29.815  1.00 76.49  ? 54   VAL B CA  1 
ATOM   2188  C  C   . VAL B  2  42  ? 69.011  -78.184  30.090  1.00 76.88  ? 54   VAL B C   1 
ATOM   2189  O  O   . VAL B  2  42  ? 68.827  -79.389  30.310  1.00 77.18  ? 54   VAL B O   1 
ATOM   2190  C  CB  . VAL B  2  42  ? 66.831  -77.248  31.032  1.00 76.71  ? 54   VAL B CB  1 
ATOM   2191  C  CG1 . VAL B  2  42  ? 67.573  -76.995  32.361  1.00 77.15  ? 54   VAL B CG1 1 
ATOM   2192  C  CG2 . VAL B  2  42  ? 65.683  -76.230  30.837  1.00 77.16  ? 54   VAL B CG2 1 
ATOM   2193  N  N   . THR B  2  43  ? 70.222  -77.648  30.087  1.00 77.10  ? 55   THR B N   1 
ATOM   2194  C  CA  . THR B  2  43  ? 71.368  -78.494  30.364  1.00 77.34  ? 55   THR B CA  1 
ATOM   2195  C  C   . THR B  2  43  ? 72.137  -78.060  31.607  1.00 77.39  ? 55   THR B C   1 
ATOM   2196  O  O   . THR B  2  43  ? 71.853  -77.019  32.211  1.00 77.53  ? 55   THR B O   1 
ATOM   2197  C  CB  . THR B  2  43  ? 72.299  -78.616  29.147  1.00 77.37  ? 55   THR B CB  1 
ATOM   2198  O  OG1 . THR B  2  43  ? 72.524  -77.321  28.583  1.00 77.53  ? 55   THR B OG1 1 
ATOM   2199  C  CG2 . THR B  2  43  ? 71.671  -79.514  28.098  1.00 77.84  ? 55   THR B CG2 1 
ATOM   2200  N  N   . SER B  2  44  ? 73.088  -78.903  31.993  1.00 77.28  ? 56   SER B N   1 
ATOM   2201  C  CA  . SER B  2  44  ? 73.989  -78.649  33.101  1.00 77.00  ? 56   SER B CA  1 
ATOM   2202  C  C   . SER B  2  44  ? 75.282  -79.392  32.794  1.00 76.99  ? 56   SER B C   1 
ATOM   2203  O  O   . SER B  2  44  ? 75.268  -80.414  32.096  1.00 77.00  ? 56   SER B O   1 
ATOM   2204  C  CB  . SER B  2  44  ? 73.374  -79.146  34.410  1.00 77.02  ? 56   SER B CB  1 
ATOM   2205  O  OG  . SER B  2  44  ? 74.312  -79.137  35.471  1.00 76.63  ? 56   SER B OG  1 
ATOM   2206  N  N   . THR B  2  45  ? 76.396  -78.860  33.291  1.00 76.83  ? 57   THR B N   1 
ATOM   2207  C  CA  . THR B  2  45  ? 77.694  -79.527  33.201  1.00 76.61  ? 57   THR B CA  1 
ATOM   2208  C  C   . THR B  2  45  ? 77.589  -80.956  33.743  1.00 76.30  ? 57   THR B C   1 
ATOM   2209  O  O   . THR B  2  45  ? 78.175  -81.888  33.190  1.00 76.20  ? 57   THR B O   1 
ATOM   2210  C  CB  . THR B  2  45  ? 78.759  -78.772  34.030  1.00 76.76  ? 57   THR B CB  1 
ATOM   2211  O  OG1 . THR B  2  45  ? 78.528  -77.358  33.950  1.00 76.70  ? 57   THR B OG1 1 
ATOM   2212  C  CG2 . THR B  2  45  ? 80.174  -79.108  33.550  1.00 76.97  ? 57   THR B CG2 1 
ATOM   2213  N  N   . LEU B  2  46  ? 76.813  -81.108  34.815  1.00 75.95  ? 58   LEU B N   1 
ATOM   2214  C  CA  . LEU B  2  46  ? 76.710  -82.355  35.570  1.00 75.70  ? 58   LEU B CA  1 
ATOM   2215  C  C   . LEU B  2  46  ? 75.822  -83.434  34.948  1.00 75.82  ? 58   LEU B C   1 
ATOM   2216  O  O   . LEU B  2  46  ? 75.878  -84.588  35.370  1.00 75.76  ? 58   LEU B O   1 
ATOM   2217  C  CB  . LEU B  2  46  ? 76.245  -82.055  36.993  1.00 75.44  ? 58   LEU B CB  1 
ATOM   2218  C  CG  . LEU B  2  46  ? 77.269  -81.909  38.122  1.00 74.87  ? 58   LEU B CG  1 
ATOM   2219  C  CD1 . LEU B  2  46  ? 78.686  -81.579  37.652  1.00 74.24  ? 58   LEU B CD1 1 
ATOM   2220  C  CD2 . LEU B  2  46  ? 76.764  -80.882  39.119  1.00 74.18  ? 58   LEU B CD2 1 
ATOM   2221  N  N   . LEU B  2  47  ? 75.007  -83.065  33.960  1.00 75.92  ? 59   LEU B N   1 
ATOM   2222  C  CA  . LEU B  2  47  ? 74.197  -84.034  33.235  1.00 76.15  ? 59   LEU B CA  1 
ATOM   2223  C  C   . LEU B  2  47  ? 75.086  -85.063  32.558  1.00 76.49  ? 59   LEU B C   1 
ATOM   2224  O  O   . LEU B  2  47  ? 76.132  -84.720  32.014  1.00 76.45  ? 59   LEU B O   1 
ATOM   2225  C  CB  . LEU B  2  47  ? 73.333  -83.350  32.183  1.00 76.06  ? 59   LEU B CB  1 
ATOM   2226  C  CG  . LEU B  2  47  ? 72.195  -84.220  31.648  1.00 76.50  ? 59   LEU B CG  1 
ATOM   2227  C  CD1 . LEU B  2  47  ? 70.938  -84.037  32.503  1.00 76.67  ? 59   LEU B CD1 1 
ATOM   2228  C  CD2 . LEU B  2  47  ? 71.906  -83.928  30.173  1.00 76.88  ? 59   LEU B CD2 1 
ATOM   2229  N  N   . GLU B  2  48  ? 74.665  -86.324  32.610  1.00 77.09  ? 60   GLU B N   1 
ATOM   2230  C  CA  . GLU B  2  48  ? 75.399  -87.424  32.001  1.00 77.69  ? 60   GLU B CA  1 
ATOM   2231  C  C   . GLU B  2  48  ? 74.922  -87.613  30.573  1.00 78.02  ? 60   GLU B C   1 
ATOM   2232  O  O   . GLU B  2  48  ? 73.881  -88.207  30.337  1.00 78.18  ? 60   GLU B O   1 
ATOM   2233  C  CB  . GLU B  2  48  ? 75.204  -88.708  32.813  1.00 77.77  ? 60   GLU B CB  1 
ATOM   2234  C  CG  . GLU B  2  48  ? 76.057  -89.900  32.370  1.00 78.72  ? 60   GLU B CG  1 
ATOM   2235  C  CD  . GLU B  2  48  ? 77.555  -89.646  32.505  1.00 80.10  ? 60   GLU B CD  1 
ATOM   2236  O  OE1 . GLU B  2  48  ? 78.174  -89.121  31.541  1.00 80.72  ? 60   GLU B OE1 1 
ATOM   2237  O  OE2 . GLU B  2  48  ? 78.114  -89.985  33.572  1.00 79.96  ? 60   GLU B OE2 1 
ATOM   2238  N  N   . GLN B  2  49  ? 75.689  -87.098  29.621  1.00 78.68  ? 61   GLN B N   1 
ATOM   2239  C  CA  . GLN B  2  49  ? 75.278  -87.095  28.224  1.00 79.42  ? 61   GLN B CA  1 
ATOM   2240  C  C   . GLN B  2  49  ? 75.502  -88.464  27.571  1.00 79.87  ? 61   GLN B C   1 
ATOM   2241  O  O   . GLN B  2  49  ? 74.685  -88.904  26.757  1.00 79.78  ? 61   GLN B O   1 
ATOM   2242  C  CB  . GLN B  2  49  ? 76.022  -85.990  27.468  1.00 79.51  ? 61   GLN B CB  1 
ATOM   2243  C  CG  . GLN B  2  49  ? 75.133  -85.114  26.595  1.00 80.45  ? 61   GLN B CG  1 
ATOM   2244  C  CD  . GLN B  2  49  ? 75.374  -85.295  25.103  1.00 81.60  ? 61   GLN B CD  1 
ATOM   2245  O  OE1 . GLN B  2  49  ? 76.464  -85.015  24.600  1.00 82.11  ? 61   GLN B OE1 1 
ATOM   2246  N  NE2 . GLN B  2  49  ? 74.345  -85.741  24.384  1.00 82.13  ? 61   GLN B NE2 1 
ATOM   2247  N  N   . ASP B  2  50  ? 76.597  -89.130  27.954  1.00 80.42  ? 62   ASP B N   1 
ATOM   2248  C  CA  . ASP B  2  50  ? 77.006  -90.433  27.394  1.00 80.98  ? 62   ASP B CA  1 
ATOM   2249  C  C   . ASP B  2  50  ? 75.912  -91.487  27.452  1.00 80.95  ? 62   ASP B C   1 
ATOM   2250  O  O   . ASP B  2  50  ? 75.635  -92.164  26.456  1.00 81.08  ? 62   ASP B O   1 
ATOM   2251  C  CB  . ASP B  2  50  ? 78.244  -90.979  28.119  1.00 81.17  ? 62   ASP B CB  1 
ATOM   2252  C  CG  . ASP B  2  50  ? 79.446  -90.064  27.995  1.00 82.41  ? 62   ASP B CG  1 
ATOM   2253  O  OD1 . ASP B  2  50  ? 79.312  -88.857  28.307  1.00 83.94  ? 62   ASP B OD1 1 
ATOM   2254  O  OD2 . ASP B  2  50  ? 80.527  -90.556  27.599  1.00 82.85  ? 62   ASP B OD2 1 
ATOM   2255  N  N   . THR B  2  51  ? 75.307  -91.620  28.631  1.00 80.75  ? 63   THR B N   1 
ATOM   2256  C  CA  . THR B  2  51  ? 74.265  -92.610  28.874  1.00 80.58  ? 63   THR B CA  1 
ATOM   2257  C  C   . THR B  2  51  ? 72.916  -91.900  29.009  1.00 79.87  ? 63   THR B C   1 
ATOM   2258  O  O   . THR B  2  51  ? 72.242  -91.999  30.044  1.00 79.89  ? 63   THR B O   1 
ATOM   2259  C  CB  . THR B  2  51  ? 74.567  -93.446  30.149  1.00 80.91  ? 63   THR B CB  1 
ATOM   2260  O  OG1 . THR B  2  51  ? 75.877  -93.126  30.647  1.00 81.67  ? 63   THR B OG1 1 
ATOM   2261  C  CG2 . THR B  2  51  ? 74.458  -94.965  29.858  1.00 81.28  ? 63   THR B CG2 1 
ATOM   2262  N  N   . SER B  2  52  A 72.536  -91.179  27.955  1.00 78.92  ? 63   SER B N   1 
ATOM   2263  C  CA  . SER B  2  52  A 71.288  -90.415  27.945  1.00 77.86  ? 63   SER B CA  1 
ATOM   2264  C  C   . SER B  2  52  A 70.498  -90.626  26.649  1.00 76.93  ? 63   SER B C   1 
ATOM   2265  O  O   . SER B  2  52  A 71.074  -90.806  25.566  1.00 76.84  ? 63   SER B O   1 
ATOM   2266  C  CB  . SER B  2  52  A 71.556  -88.925  28.190  1.00 78.02  ? 63   SER B CB  1 
ATOM   2267  O  OG  . SER B  2  52  A 70.390  -88.253  28.641  1.00 77.90  ? 63   SER B OG  1 
ATOM   2268  N  N   . THR B  2  53  ? 69.173  -90.598  26.793  1.00 75.43  ? 64   THR B N   1 
ATOM   2269  C  CA  . THR B  2  53  ? 68.228  -90.973  25.748  1.00 73.87  ? 64   THR B CA  1 
ATOM   2270  C  C   . THR B  2  53  ? 66.908  -90.298  26.109  1.00 72.62  ? 64   THR B C   1 
ATOM   2271  O  O   . THR B  2  53  ? 66.020  -90.928  26.704  1.00 72.88  ? 64   THR B O   1 
ATOM   2272  C  CB  . THR B  2  53  ? 68.054  -92.528  25.685  1.00 73.97  ? 64   THR B CB  1 
ATOM   2273  O  OG1 . THR B  2  53  ? 69.296  -93.138  25.307  1.00 74.36  ? 64   THR B OG1 1 
ATOM   2274  C  CG2 . THR B  2  53  ? 66.970  -92.949  24.691  1.00 73.83  ? 64   THR B CG2 1 
ATOM   2275  N  N   . GLU B  2  54  ? 66.792  -89.009  25.778  1.00 70.37  ? 65   GLU B N   1 
ATOM   2276  C  CA  . GLU B  2  54  ? 65.589  -88.243  26.123  1.00 68.14  ? 65   GLU B CA  1 
ATOM   2277  C  C   . GLU B  2  54  ? 64.723  -87.820  24.929  1.00 65.88  ? 65   GLU B C   1 
ATOM   2278  O  O   . GLU B  2  54  ? 63.543  -87.514  25.098  1.00 65.93  ? 65   GLU B O   1 
ATOM   2279  C  CB  . GLU B  2  54  ? 65.926  -87.027  27.010  1.00 68.64  ? 65   GLU B CB  1 
ATOM   2280  C  CG  . GLU B  2  54  ? 66.241  -85.723  26.264  1.00 69.71  ? 65   GLU B CG  1 
ATOM   2281  C  CD  . GLU B  2  54  ? 65.846  -84.471  27.049  1.00 71.75  ? 65   GLU B CD  1 
ATOM   2282  O  OE1 . GLU B  2  54  ? 65.888  -83.356  26.469  1.00 71.94  ? 65   GLU B OE1 1 
ATOM   2283  O  OE2 . GLU B  2  54  ? 65.488  -84.600  28.246  1.00 72.71  ? 65   GLU B OE2 1 
ATOM   2284  N  N   . LYS B  2  55  ? 65.294  -87.797  23.732  1.00 62.88  ? 66   LYS B N   1 
ATOM   2285  C  CA  . LYS B  2  55  ? 64.526  -87.360  22.571  1.00 59.91  ? 66   LYS B CA  1 
ATOM   2286  C  C   . LYS B  2  55  ? 64.503  -88.357  21.415  1.00 58.17  ? 66   LYS B C   1 
ATOM   2287  O  O   . LYS B  2  55  ? 63.620  -88.280  20.574  1.00 57.67  ? 66   LYS B O   1 
ATOM   2288  C  CB  . LYS B  2  55  ? 64.971  -85.962  22.116  1.00 59.81  ? 66   LYS B CB  1 
ATOM   2289  C  CG  . LYS B  2  55  ? 64.592  -84.865  23.116  1.00 58.35  ? 66   LYS B CG  1 
ATOM   2290  C  CD  . LYS B  2  55  ? 64.871  -83.476  22.593  1.00 56.41  ? 66   LYS B CD  1 
ATOM   2291  C  CE  . LYS B  2  55  ? 63.714  -82.900  21.754  1.00 53.95  ? 66   LYS B CE  1 
ATOM   2292  N  NZ  . LYS B  2  55  ? 62.547  -82.441  22.551  1.00 51.46  ? 66   LYS B NZ  1 
ATOM   2293  N  N   . LEU B  2  56  ? 65.452  -89.292  21.395  1.00 56.12  ? 67   LEU B N   1 
ATOM   2294  C  CA  . LEU B  2  56  ? 65.586  -90.268  20.307  1.00 54.48  ? 67   LEU B CA  1 
ATOM   2295  C  C   . LEU B  2  56  ? 65.467  -91.725  20.760  1.00 53.49  ? 67   LEU B C   1 
ATOM   2296  O  O   . LEU B  2  56  ? 66.323  -92.240  21.483  1.00 53.51  ? 67   LEU B O   1 
ATOM   2297  C  CB  . LEU B  2  56  ? 66.916  -90.066  19.596  1.00 54.39  ? 67   LEU B CB  1 
ATOM   2298  C  CG  . LEU B  2  56  ? 66.986  -89.291  18.282  1.00 54.17  ? 67   LEU B CG  1 
ATOM   2299  C  CD1 . LEU B  2  56  ? 66.061  -88.087  18.217  1.00 53.18  ? 67   LEU B CD1 1 
ATOM   2300  C  CD2 . LEU B  2  56  ? 68.419  -88.873  18.071  1.00 53.51  ? 67   LEU B CD2 1 
ATOM   2301  N  N   . TYR B  2  57  ? 64.413  -92.394  20.311  1.00 52.02  ? 68   TYR B N   1 
ATOM   2302  C  CA  . TYR B  2  57  ? 64.117  -93.748  20.761  1.00 50.59  ? 68   TYR B CA  1 
ATOM   2303  C  C   . TYR B  2  57  ? 63.998  -94.737  19.616  1.00 49.61  ? 68   TYR B C   1 
ATOM   2304  O  O   . TYR B  2  57  ? 63.406  -94.450  18.582  1.00 49.33  ? 68   TYR B O   1 
ATOM   2305  C  CB  . TYR B  2  57  ? 62.835  -93.762  21.588  1.00 50.64  ? 68   TYR B CB  1 
ATOM   2306  C  CG  . TYR B  2  57  ? 62.942  -93.013  22.900  1.00 51.04  ? 68   TYR B CG  1 
ATOM   2307  C  CD1 . TYR B  2  57  ? 63.207  -93.688  24.094  1.00 51.72  ? 68   TYR B CD1 1 
ATOM   2308  C  CD2 . TYR B  2  57  ? 62.761  -91.631  22.953  1.00 51.21  ? 68   TYR B CD2 1 
ATOM   2309  C  CE1 . TYR B  2  57  ? 63.293  -93.003  25.310  1.00 52.10  ? 68   TYR B CE1 1 
ATOM   2310  C  CE2 . TYR B  2  57  ? 62.847  -90.939  24.153  1.00 51.84  ? 68   TYR B CE2 1 
ATOM   2311  C  CZ  . TYR B  2  57  ? 63.117  -91.627  25.325  1.00 52.41  ? 68   TYR B CZ  1 
ATOM   2312  O  OH  . TYR B  2  57  ? 63.204  -90.931  26.508  1.00 53.59  ? 68   TYR B OH  1 
ATOM   2313  N  N   . LYS B  2  58  ? 64.581  -95.908  19.817  1.00 48.87  ? 69   LYS B N   1 
ATOM   2314  C  CA  . LYS B  2  58  ? 64.466  -97.005  18.876  1.00 48.18  ? 69   LYS B CA  1 
ATOM   2315  C  C   . LYS B  2  58  ? 63.098  -97.671  19.084  1.00 47.44  ? 69   LYS B C   1 
ATOM   2316  O  O   . LYS B  2  58  ? 62.750  -98.051  20.200  1.00 47.30  ? 69   LYS B O   1 
ATOM   2317  C  CB  . LYS B  2  58  ? 65.607  -97.983  19.135  1.00 48.20  ? 69   LYS B CB  1 
ATOM   2318  C  CG  . LYS B  2  58  ? 66.032  -98.801  17.941  1.00 49.97  ? 69   LYS B CG  1 
ATOM   2319  C  CD  . LYS B  2  58  ? 67.374  -99.533  18.172  1.00 52.88  ? 69   LYS B CD  1 
ATOM   2320  C  CE  . LYS B  2  58  ? 68.588  -98.583  18.200  1.00 54.61  ? 69   LYS B CE  1 
ATOM   2321  N  NZ  . LYS B  2  58  ? 69.886  -99.323  18.205  1.00 55.43  ? 69   LYS B NZ  1 
ATOM   2322  N  N   . LEU B  2  59  ? 62.304  -97.774  18.027  1.00 46.95  ? 70   LEU B N   1 
ATOM   2323  C  CA  . LEU B  2  59  ? 61.013  -98.453  18.117  1.00 46.94  ? 70   LEU B CA  1 
ATOM   2324  C  C   . LEU B  2  59  ? 61.126  -99.904  17.705  1.00 47.27  ? 70   LEU B C   1 
ATOM   2325  O  O   . LEU B  2  59  ? 60.308  -100.737 18.089  1.00 47.38  ? 70   LEU B O   1 
ATOM   2326  C  CB  . LEU B  2  59  ? 59.956  -97.773  17.249  1.00 46.55  ? 70   LEU B CB  1 
ATOM   2327  C  CG  . LEU B  2  59  ? 59.312  -96.469  17.725  1.00 46.37  ? 70   LEU B CG  1 
ATOM   2328  C  CD1 . LEU B  2  59  ? 58.045  -96.259  16.931  1.00 46.67  ? 70   LEU B CD1 1 
ATOM   2329  C  CD2 . LEU B  2  59  ? 58.998  -96.454  19.217  1.00 45.36  ? 70   LEU B CD2 1 
ATOM   2330  N  N   . ASN B  2  60  ? 62.169  -100.199 16.943  1.00 47.94  ? 71   ASN B N   1 
ATOM   2331  C  CA  . ASN B  2  60  ? 62.338  -101.473 16.261  1.00 48.60  ? 71   ASN B CA  1 
ATOM   2332  C  C   . ASN B  2  60  ? 63.628  -101.319 15.451  1.00 48.68  ? 71   ASN B C   1 
ATOM   2333  O  O   . ASN B  2  60  ? 64.198  -100.224 15.411  1.00 48.67  ? 71   ASN B O   1 
ATOM   2334  C  CB  . ASN B  2  60  ? 61.060  -101.754 15.448  1.00 48.85  ? 71   ASN B CB  1 
ATOM   2335  C  CG  . ASN B  2  60  ? 61.308  -102.332 14.095  1.00 50.39  ? 71   ASN B CG  1 
ATOM   2336  O  OD1 . ASN B  2  60  ? 60.755  -101.852 13.108  1.00 51.66  ? 71   ASN B OD1 1 
ATOM   2337  N  ND2 . ASN B  2  60  ? 62.096  -103.398 14.029  1.00 54.32  ? 71   ASN B ND2 1 
ATOM   2338  N  N   . ASP B  2  61  ? 64.125  -102.404 14.866  1.00 48.79  ? 72   ASP B N   1 
ATOM   2339  C  CA  . ASP B  2  61  ? 65.359  -102.353 14.072  1.00 48.92  ? 72   ASP B CA  1 
ATOM   2340  C  C   . ASP B  2  61  ? 65.301  -101.448 12.839  1.00 48.15  ? 72   ASP B C   1 
ATOM   2341  O  O   . ASP B  2  61  ? 66.342  -101.112 12.285  1.00 48.38  ? 72   ASP B O   1 
ATOM   2342  C  CB  . ASP B  2  61  ? 65.794  -103.760 13.648  1.00 49.68  ? 72   ASP B CB  1 
ATOM   2343  C  CG  . ASP B  2  61  ? 66.589  -104.491 14.736  1.00 51.99  ? 72   ASP B CG  1 
ATOM   2344  O  OD1 . ASP B  2  61  ? 67.108  -103.836 15.681  1.00 53.23  ? 72   ASP B OD1 1 
ATOM   2345  O  OD2 . ASP B  2  61  ? 66.689  -105.736 14.637  1.00 54.56  ? 72   ASP B OD2 1 
ATOM   2346  N  N   . LYS B  2  62  ? 64.101  -101.055 12.414  1.00 47.10  ? 73   LYS B N   1 
ATOM   2347  C  CA  . LYS B  2  62  ? 63.944  -100.273 11.186  1.00 46.04  ? 73   LYS B CA  1 
ATOM   2348  C  C   . LYS B  2  62  ? 63.198  -98.936  11.357  1.00 44.78  ? 73   LYS B C   1 
ATOM   2349  O  O   . LYS B  2  62  ? 62.986  -98.210  10.383  1.00 44.60  ? 73   LYS B O   1 
ATOM   2350  C  CB  . LYS B  2  62  ? 63.245  -101.121 10.123  1.00 46.30  ? 73   LYS B CB  1 
ATOM   2351  C  CG  . LYS B  2  62  ? 64.090  -102.243 9.574   1.00 48.23  ? 73   LYS B CG  1 
ATOM   2352  C  CD  . LYS B  2  62  ? 63.478  -102.814 8.289   1.00 52.41  ? 73   LYS B CD  1 
ATOM   2353  C  CE  . LYS B  2  62  ? 64.093  -104.176 7.909   1.00 55.11  ? 73   LYS B CE  1 
ATOM   2354  N  NZ  . LYS B  2  62  ? 65.613  -104.194 7.863   1.00 55.92  ? 73   LYS B NZ  1 
ATOM   2355  N  N   . ILE B  2  63  ? 62.795  -98.623  12.588  1.00 43.15  ? 74   ILE B N   1 
ATOM   2356  C  CA  . ILE B  2  63  ? 61.956  -97.455  12.874  1.00 41.09  ? 74   ILE B CA  1 
ATOM   2357  C  C   . ILE B  2  63  ? 62.420  -96.772  14.159  1.00 40.43  ? 74   ILE B C   1 
ATOM   2358  O  O   . ILE B  2  63  ? 62.755  -97.436  15.136  1.00 40.26  ? 74   ILE B O   1 
ATOM   2359  C  CB  . ILE B  2  63  ? 60.453  -97.838  12.987  1.00 40.73  ? 74   ILE B CB  1 
ATOM   2360  C  CG1 . ILE B  2  63  ? 59.982  -98.568  11.714  1.00 40.12  ? 74   ILE B CG1 1 
ATOM   2361  C  CG2 . ILE B  2  63  ? 59.606  -96.603  13.276  1.00 40.18  ? 74   ILE B CG2 1 
ATOM   2362  C  CD1 . ILE B  2  63  ? 58.623  -99.263  11.794  1.00 37.38  ? 74   ILE B CD1 1 
ATOM   2363  N  N   . ALA B  2  64  ? 62.465  -95.444  14.135  1.00 39.55  ? 75   ALA B N   1 
ATOM   2364  C  CA  . ALA B  2  64  ? 62.831  -94.653  15.305  1.00 38.78  ? 75   ALA B CA  1 
ATOM   2365  C  C   . ALA B  2  64  ? 61.946  -93.416  15.398  1.00 38.22  ? 75   ALA B C   1 
ATOM   2366  O  O   . ALA B  2  64  ? 61.290  -93.034  14.421  1.00 37.67  ? 75   ALA B O   1 
ATOM   2367  C  CB  . ALA B  2  64  ? 64.297  -94.260  15.258  1.00 38.74  ? 75   ALA B CB  1 
ATOM   2368  N  N   . VAL B  2  65  ? 61.899  -92.819  16.587  1.00 37.45  ? 76   VAL B N   1 
ATOM   2369  C  CA  . VAL B  2  65  ? 61.177  -91.577  16.772  1.00 37.13  ? 76   VAL B CA  1 
ATOM   2370  C  C   . VAL B  2  65  ? 61.992  -90.532  17.492  1.00 36.97  ? 76   VAL B C   1 
ATOM   2371  O  O   . VAL B  2  65  ? 62.799  -90.852  18.374  1.00 36.68  ? 76   VAL B O   1 
ATOM   2372  C  CB  . VAL B  2  65  ? 59.845  -91.738  17.532  1.00 37.02  ? 76   VAL B CB  1 
ATOM   2373  C  CG1 . VAL B  2  65  ? 58.874  -92.534  16.716  1.00 37.47  ? 76   VAL B CG1 1 
ATOM   2374  C  CG2 . VAL B  2  65  ? 60.061  -92.349  18.918  1.00 37.18  ? 76   VAL B CG2 1 
ATOM   2375  N  N   . ALA B  2  66  ? 61.755  -89.283  17.096  1.00 36.80  ? 77   ALA B N   1 
ATOM   2376  C  CA  . ALA B  2  66  ? 62.193  -88.114  17.842  1.00 36.64  ? 77   ALA B CA  1 
ATOM   2377  C  C   . ALA B  2  66  ? 60.990  -87.521  18.599  1.00 36.69  ? 77   ALA B C   1 
ATOM   2378  O  O   . ALA B  2  66  ? 59.890  -87.392  18.055  1.00 36.78  ? 77   ALA B O   1 
ATOM   2379  C  CB  . ALA B  2  66  ? 62.826  -87.094  16.908  1.00 36.15  ? 77   ALA B CB  1 
ATOM   2380  N  N   . VAL B  2  67  ? 61.212  -87.168  19.855  1.00 36.93  ? 78   VAL B N   1 
ATOM   2381  C  CA  . VAL B  2  67  ? 60.140  -86.771  20.758  1.00 37.56  ? 78   VAL B CA  1 
ATOM   2382  C  C   . VAL B  2  67  ? 60.146  -85.255  21.044  1.00 37.86  ? 78   VAL B C   1 
ATOM   2383  O  O   . VAL B  2  67  ? 61.203  -84.671  21.261  1.00 37.68  ? 78   VAL B O   1 
ATOM   2384  C  CB  . VAL B  2  67  ? 60.283  -87.542  22.106  1.00 37.45  ? 78   VAL B CB  1 
ATOM   2385  C  CG1 . VAL B  2  67  ? 59.254  -87.083  23.122  1.00 37.38  ? 78   VAL B CG1 1 
ATOM   2386  C  CG2 . VAL B  2  67  ? 60.158  -89.029  21.876  1.00 37.89  ? 78   VAL B CG2 1 
ATOM   2387  N  N   . ALA B  2  68  ? 58.969  -84.632  21.055  1.00 38.08  ? 79   ALA B N   1 
ATOM   2388  C  CA  . ALA B  2  68  ? 58.831  -83.284  21.595  1.00 38.42  ? 79   ALA B CA  1 
ATOM   2389  C  C   . ALA B  2  68  ? 57.679  -83.237  22.593  1.00 38.96  ? 79   ALA B C   1 
ATOM   2390  O  O   . ALA B  2  68  ? 56.511  -83.355  22.201  1.00 39.48  ? 79   ALA B O   1 
ATOM   2391  C  CB  . ALA B  2  68  ? 58.612  -82.277  20.483  1.00 38.34  ? 79   ALA B CB  1 
ATOM   2392  N  N   . GLY B  2  69  ? 58.001  -83.086  23.876  1.00 38.94  ? 80   GLY B N   1 
ATOM   2393  C  CA  . GLY B  2  69  ? 56.979  -82.900  24.884  1.00 39.49  ? 80   GLY B CA  1 
ATOM   2394  C  C   . GLY B  2  69  ? 57.362  -83.535  26.195  1.00 40.34  ? 80   GLY B C   1 
ATOM   2395  O  O   . GLY B  2  69  ? 58.540  -83.562  26.541  1.00 40.61  ? 80   GLY B O   1 
ATOM   2396  N  N   . LEU B  2  70  ? 56.364  -84.031  26.931  1.00 40.79  ? 81   LEU B N   1 
ATOM   2397  C  CA  . LEU B  2  70  ? 56.603  -84.747  28.170  1.00 41.55  ? 81   LEU B CA  1 
ATOM   2398  C  C   . LEU B  2  70  ? 57.294  -86.057  27.859  1.00 42.34  ? 81   LEU B C   1 
ATOM   2399  O  O   . LEU B  2  70  ? 56.772  -86.870  27.088  1.00 42.54  ? 81   LEU B O   1 
ATOM   2400  C  CB  . LEU B  2  70  ? 55.289  -85.050  28.886  1.00 41.61  ? 81   LEU B CB  1 
ATOM   2401  C  CG  . LEU B  2  70  ? 54.533  -83.957  29.628  1.00 41.94  ? 81   LEU B CG  1 
ATOM   2402  C  CD1 . LEU B  2  70  ? 55.501  -83.061  30.405  1.00 43.60  ? 81   LEU B CD1 1 
ATOM   2403  C  CD2 . LEU B  2  70  ? 53.688  -83.150  28.668  1.00 42.68  ? 81   LEU B CD2 1 
ATOM   2404  N  N   . THR B  2  71  ? 58.461  -86.263  28.466  1.00 43.14  ? 82   THR B N   1 
ATOM   2405  C  CA  . THR B  2  71  ? 59.252  -87.472  28.235  1.00 43.67  ? 82   THR B CA  1 
ATOM   2406  C  C   . THR B  2  71  ? 58.534  -88.690  28.809  1.00 43.62  ? 82   THR B C   1 
ATOM   2407  O  O   . THR B  2  71  ? 58.513  -89.751  28.185  1.00 43.94  ? 82   THR B O   1 
ATOM   2408  C  CB  . THR B  2  71  ? 60.676  -87.367  28.842  1.00 43.86  ? 82   THR B CB  1 
ATOM   2409  O  OG1 . THR B  2  71  ? 61.209  -86.064  28.599  1.00 44.84  ? 82   THR B OG1 1 
ATOM   2410  C  CG2 . THR B  2  71  ? 61.613  -88.390  28.212  1.00 44.58  ? 82   THR B CG2 1 
ATOM   2411  N  N   . ALA B  2  72  ? 57.934  -88.526  29.986  1.00 43.47  ? 83   ALA B N   1 
ATOM   2412  C  CA  . ALA B  2  72  ? 57.211  -89.615  30.638  1.00 43.13  ? 83   ALA B CA  1 
ATOM   2413  C  C   . ALA B  2  72  ? 55.985  -90.079  29.829  1.00 43.17  ? 83   ALA B C   1 
ATOM   2414  O  O   . ALA B  2  72  ? 55.693  -91.279  29.769  1.00 43.31  ? 83   ALA B O   1 
ATOM   2415  C  CB  . ALA B  2  72  ? 56.821  -89.217  32.041  1.00 42.99  ? 83   ALA B CB  1 
ATOM   2416  N  N   . ASP B  2  73  ? 55.276  -89.137  29.207  1.00 43.01  ? 84   ASP B N   1 
ATOM   2417  C  CA  . ASP B  2  73  ? 54.133  -89.477  28.362  1.00 43.01  ? 84   ASP B CA  1 
ATOM   2418  C  C   . ASP B  2  73  ? 54.626  -90.257  27.152  1.00 42.77  ? 84   ASP B C   1 
ATOM   2419  O  O   . ASP B  2  73  ? 54.027  -91.258  26.756  1.00 42.52  ? 84   ASP B O   1 
ATOM   2420  C  CB  . ASP B  2  73  ? 53.377  -88.218  27.909  1.00 43.11  ? 84   ASP B CB  1 
ATOM   2421  C  CG  . ASP B  2  73  ? 52.516  -87.605  29.014  1.00 44.56  ? 84   ASP B CG  1 
ATOM   2422  O  OD1 . ASP B  2  73  ? 51.607  -86.791  28.691  1.00 45.22  ? 84   ASP B OD1 1 
ATOM   2423  O  OD2 . ASP B  2  73  ? 52.748  -87.925  30.207  1.00 44.95  ? 84   ASP B OD2 1 
ATOM   2424  N  N   . ALA B  2  74  ? 55.737  -89.790  26.581  1.00 42.50  ? 85   ALA B N   1 
ATOM   2425  C  CA  . ALA B  2  74  ? 56.320  -90.386  25.390  1.00 41.91  ? 85   ALA B CA  1 
ATOM   2426  C  C   . ALA B  2  74  ? 56.756  -91.823  25.658  1.00 41.70  ? 85   ALA B C   1 
ATOM   2427  O  O   . ALA B  2  74  ? 56.573  -92.705  24.820  1.00 41.24  ? 85   ALA B O   1 
ATOM   2428  C  CB  . ALA B  2  74  ? 57.485  -89.559  24.921  1.00 41.63  ? 85   ALA B CB  1 
ATOM   2429  N  N   . GLU B  2  75  ? 57.320  -92.060  26.833  1.00 41.73  ? 86   GLU B N   1 
ATOM   2430  C  CA  . GLU B  2  75  ? 57.759  -93.407  27.168  1.00 42.26  ? 86   GLU B CA  1 
ATOM   2431  C  C   . GLU B  2  75  ? 56.569  -94.379  27.219  1.00 41.82  ? 86   GLU B C   1 
ATOM   2432  O  O   . GLU B  2  75  ? 56.668  -95.499  26.706  1.00 41.78  ? 86   GLU B O   1 
ATOM   2433  C  CB  . GLU B  2  75  ? 58.637  -93.438  28.425  1.00 42.18  ? 86   GLU B CB  1 
ATOM   2434  C  CG  . GLU B  2  75  ? 60.009  -92.804  28.178  1.00 44.81  ? 86   GLU B CG  1 
ATOM   2435  C  CD  . GLU B  2  75  ? 61.138  -93.305  29.095  1.00 48.42  ? 86   GLU B CD  1 
ATOM   2436  O  OE1 . GLU B  2  75  ? 62.271  -92.782  28.942  1.00 50.48  ? 86   GLU B OE1 1 
ATOM   2437  O  OE2 . GLU B  2  75  ? 60.923  -94.205  29.949  1.00 48.42  ? 86   GLU B OE2 1 
ATOM   2438  N  N   . ILE B  2  76  ? 55.440  -93.926  27.768  1.00 40.94  ? 87   ILE B N   1 
ATOM   2439  C  CA  . ILE B  2  76  ? 54.225  -94.731  27.763  1.00 40.48  ? 87   ILE B CA  1 
ATOM   2440  C  C   . ILE B  2  76  ? 53.919  -95.183  26.342  1.00 40.20  ? 87   ILE B C   1 
ATOM   2441  O  O   . ILE B  2  76  ? 53.786  -96.389  26.098  1.00 40.44  ? 87   ILE B O   1 
ATOM   2442  C  CB  . ILE B  2  76  ? 52.988  -93.988  28.366  1.00 40.61  ? 87   ILE B CB  1 
ATOM   2443  C  CG1 . ILE B  2  76  ? 53.210  -93.630  29.845  1.00 41.25  ? 87   ILE B CG1 1 
ATOM   2444  C  CG2 . ILE B  2  76  ? 51.703  -94.814  28.203  1.00 40.39  ? 87   ILE B CG2 1 
ATOM   2445  C  CD1 . ILE B  2  76  ? 53.252  -94.820  30.799  1.00 41.47  ? 87   ILE B CD1 1 
ATOM   2446  N  N   . LEU B  2  77  ? 53.836  -94.220  25.416  1.00 39.59  ? 88   LEU B N   1 
ATOM   2447  C  CA  . LEU B  2  77  ? 53.439  -94.484  24.026  1.00 38.67  ? 88   LEU B CA  1 
ATOM   2448  C  C   . LEU B  2  77  ? 54.466  -95.318  23.263  1.00 38.44  ? 88   LEU B C   1 
ATOM   2449  O  O   . LEU B  2  77  ? 54.098  -96.233  22.513  1.00 38.37  ? 88   LEU B O   1 
ATOM   2450  C  CB  . LEU B  2  77  ? 53.161  -93.182  23.280  1.00 38.43  ? 88   LEU B CB  1 
ATOM   2451  C  CG  . LEU B  2  77  ? 51.952  -92.361  23.739  1.00 39.03  ? 88   LEU B CG  1 
ATOM   2452  C  CD1 . LEU B  2  77  ? 51.946  -91.016  23.043  1.00 38.40  ? 88   LEU B CD1 1 
ATOM   2453  C  CD2 . LEU B  2  77  ? 50.611  -93.086  23.532  1.00 37.61  ? 88   LEU B CD2 1 
ATOM   2454  N  N   . ILE B  2  78  ? 55.746  -94.997  23.461  1.00 37.83  ? 89   ILE B N   1 
ATOM   2455  C  CA  . ILE B  2  78  ? 56.842  -95.737  22.846  1.00 37.60  ? 89   ILE B CA  1 
ATOM   2456  C  C   . ILE B  2  78  ? 56.748  -97.224  23.165  1.00 37.75  ? 89   ILE B C   1 
ATOM   2457  O  O   . ILE B  2  78  ? 56.886  -98.076  22.285  1.00 37.33  ? 89   ILE B O   1 
ATOM   2458  C  CB  . ILE B  2  78  ? 58.207  -95.191  23.304  1.00 37.52  ? 89   ILE B CB  1 
ATOM   2459  C  CG1 . ILE B  2  78  ? 58.599  -93.996  22.433  1.00 37.39  ? 89   ILE B CG1 1 
ATOM   2460  C  CG2 . ILE B  2  78  ? 59.283  -96.274  23.263  1.00 36.19  ? 89   ILE B CG2 1 
ATOM   2461  C  CD1 . ILE B  2  78  ? 59.535  -93.053  23.115  1.00 36.88  ? 89   ILE B CD1 1 
ATOM   2462  N  N   . ASN B  2  79  ? 56.486  -97.519  24.429  1.00 38.01  ? 90   ASN B N   1 
ATOM   2463  C  CA  . ASN B  2  79  ? 56.368  -98.879  24.853  1.00 38.38  ? 90   ASN B CA  1 
ATOM   2464  C  C   . ASN B  2  79  ? 55.200  -99.618  24.214  1.00 37.94  ? 90   ASN B C   1 
ATOM   2465  O  O   . ASN B  2  79  ? 55.358  -100.757 23.774  1.00 38.20  ? 90   ASN B O   1 
ATOM   2466  C  CB  . ASN B  2  79  ? 56.298  -98.977  26.355  1.00 38.99  ? 90   ASN B CB  1 
ATOM   2467  C  CG  . ASN B  2  79  ? 56.861  -100.276 26.841  1.00 42.28  ? 90   ASN B CG  1 
ATOM   2468  O  OD1 . ASN B  2  79  ? 58.097  -100.464 26.855  1.00 47.01  ? 90   ASN B OD1 1 
ATOM   2469  N  ND2 . ASN B  2  79  ? 55.974  -101.213 27.208  1.00 42.29  ? 90   ASN B ND2 1 
ATOM   2470  N  N   . THR B  2  80  ? 54.036  -98.991  24.122  1.00 37.19  ? 91   THR B N   1 
ATOM   2471  C  CA  . THR B  2  80  ? 52.957  -99.668  23.413  1.00 36.91  ? 91   THR B CA  1 
ATOM   2472  C  C   . THR B  2  80  ? 53.323  -99.881  21.933  1.00 36.57  ? 91   THR B C   1 
ATOM   2473  O  O   . THR B  2  80  ? 52.902  -100.867 21.311  1.00 36.97  ? 91   THR B O   1 
ATOM   2474  C  CB  . THR B  2  80  ? 51.572  -98.996  23.559  1.00 36.52  ? 91   THR B CB  1 
ATOM   2475  O  OG1 . THR B  2  80  ? 51.347  -98.125  22.454  1.00 37.62  ? 91   THR B OG1 1 
ATOM   2476  C  CG2 . THR B  2  80  ? 51.441  -98.237  24.877  1.00 36.28  ? 91   THR B CG2 1 
ATOM   2477  N  N   . ALA B  2  81  ? 54.123  -98.969  21.391  1.00 35.98  ? 92   ALA B N   1 
ATOM   2478  C  CA  . ALA B  2  81  ? 54.513  -99.021  19.987  1.00 35.56  ? 92   ALA B CA  1 
ATOM   2479  C  C   . ALA B  2  81  ? 55.507  -100.136 19.741  1.00 35.05  ? 92   ALA B C   1 
ATOM   2480  O  O   . ALA B  2  81  ? 55.477  -100.782 18.699  1.00 34.82  ? 92   ALA B O   1 
ATOM   2481  C  CB  . ALA B  2  81  ? 55.104  -97.695  19.551  1.00 35.85  ? 92   ALA B CB  1 
ATOM   2482  N  N   . ARG B  2  82  ? 56.396  -100.358 20.700  1.00 34.61  ? 93   ARG B N   1 
ATOM   2483  C  CA  . ARG B  2  82  ? 57.375  -101.423 20.574  1.00 34.15  ? 93   ARG B CA  1 
ATOM   2484  C  C   . ARG B  2  82  ? 56.690  -102.773 20.620  1.00 34.19  ? 93   ARG B C   1 
ATOM   2485  O  O   . ARG B  2  82  ? 57.068  -103.694 19.880  1.00 34.25  ? 93   ARG B O   1 
ATOM   2486  C  CB  . ARG B  2  82  ? 58.414  -101.322 21.668  1.00 34.06  ? 93   ARG B CB  1 
ATOM   2487  C  CG  . ARG B  2  82  ? 59.463  -100.290 21.368  1.00 33.36  ? 93   ARG B CG  1 
ATOM   2488  C  CD  . ARG B  2  82  ? 60.321  -100.103 22.576  1.00 32.31  ? 93   ARG B CD  1 
ATOM   2489  N  NE  . ARG B  2  82  ? 61.381  -99.136  22.340  1.00 30.60  ? 93   ARG B NE  1 
ATOM   2490  C  CZ  . ARG B  2  82  ? 62.163  -98.677  23.297  1.00 28.82  ? 93   ARG B CZ  1 
ATOM   2491  N  NH1 . ARG B  2  82  ? 61.996  -99.099  24.531  1.00 28.72  ? 93   ARG B NH1 1 
ATOM   2492  N  NH2 . ARG B  2  82  ? 63.096  -97.796  23.021  1.00 29.61  ? 93   ARG B NH2 1 
ATOM   2493  N  N   . ILE B  2  83  ? 55.668  -102.867 21.471  1.00 33.63  ? 94   ILE B N   1 
ATOM   2494  C  CA  . ILE B  2  83  ? 54.858  -104.055 21.565  1.00 33.22  ? 94   ILE B CA  1 
ATOM   2495  C  C   . ILE B  2  83  ? 54.136  -104.260 20.242  1.00 33.76  ? 94   ILE B C   1 
ATOM   2496  O  O   . ILE B  2  83  ? 54.288  -105.325 19.635  1.00 34.30  ? 94   ILE B O   1 
ATOM   2497  C  CB  . ILE B  2  83  ? 53.895  -104.017 22.784  1.00 33.05  ? 94   ILE B CB  1 
ATOM   2498  C  CG1 . ILE B  2  83  ? 54.688  -104.248 24.075  1.00 32.32  ? 94   ILE B CG1 1 
ATOM   2499  C  CG2 . ILE B  2  83  ? 52.778  -105.046 22.651  1.00 31.45  ? 94   ILE B CG2 1 
ATOM   2500  C  CD1 . ILE B  2  83  ? 53.981  -103.789 25.360  1.00 29.69  ? 94   ILE B CD1 1 
ATOM   2501  N  N   . HIS B  2  84  ? 53.385  -103.258 19.775  1.00 33.89  ? 95   HIS B N   1 
ATOM   2502  C  CA  . HIS B  2  84  ? 52.609  -103.411 18.535  1.00 34.22  ? 95   HIS B CA  1 
ATOM   2503  C  C   . HIS B  2  84  ? 53.485  -103.973 17.406  1.00 33.73  ? 95   HIS B C   1 
ATOM   2504  O  O   . HIS B  2  84  ? 53.068  -104.869 16.679  1.00 33.38  ? 95   HIS B O   1 
ATOM   2505  C  CB  . HIS B  2  84  ? 51.909  -102.109 18.123  1.00 34.52  ? 95   HIS B CB  1 
ATOM   2506  C  CG  . HIS B  2  84  ? 51.004  -102.260 16.934  1.00 38.33  ? 95   HIS B CG  1 
ATOM   2507  N  ND1 . HIS B  2  84  ? 49.881  -103.067 16.943  1.00 42.95  ? 95   HIS B ND1 1 
ATOM   2508  C  CD2 . HIS B  2  84  ? 51.053  -101.707 15.698  1.00 41.03  ? 95   HIS B CD2 1 
ATOM   2509  C  CE1 . HIS B  2  84  ? 49.284  -103.012 15.763  1.00 42.84  ? 95   HIS B CE1 1 
ATOM   2510  N  NE2 . HIS B  2  84  ? 49.975  -102.193 14.989  1.00 43.24  ? 95   HIS B NE2 1 
ATOM   2511  N  N   . ALA B  2  85  ? 54.713  -103.473 17.299  1.00 33.55  ? 96   ALA B N   1 
ATOM   2512  C  CA  . ALA B  2  85  ? 55.644  -103.943 16.278  1.00 33.45  ? 96   ALA B CA  1 
ATOM   2513  C  C   . ALA B  2  85  ? 55.891  -105.457 16.391  1.00 33.67  ? 96   ALA B C   1 
ATOM   2514  O  O   . ALA B  2  85  ? 55.781  -106.186 15.389  1.00 34.44  ? 96   ALA B O   1 
ATOM   2515  C  CB  . ALA B  2  85  ? 56.934  -103.180 16.347  1.00 33.14  ? 96   ALA B CB  1 
ATOM   2516  N  N   . GLN B  2  86  ? 56.205  -105.926 17.600  1.00 32.95  ? 97   GLN B N   1 
ATOM   2517  C  CA  . GLN B  2  86  ? 56.390  -107.355 17.850  1.00 32.10  ? 97   GLN B CA  1 
ATOM   2518  C  C   . GLN B  2  86  ? 55.119  -108.217 17.669  1.00 32.23  ? 97   GLN B C   1 
ATOM   2519  O  O   . GLN B  2  86  ? 55.233  -109.368 17.270  1.00 32.64  ? 97   GLN B O   1 
ATOM   2520  C  CB  . GLN B  2  86  ? 56.993  -107.607 19.227  1.00 31.63  ? 97   GLN B CB  1 
ATOM   2521  C  CG  . GLN B  2  86  ? 58.367  -107.013 19.464  1.00 30.84  ? 97   GLN B CG  1 
ATOM   2522  C  CD  . GLN B  2  86  ? 59.373  -107.346 18.386  1.00 30.97  ? 97   GLN B CD  1 
ATOM   2523  O  OE1 . GLN B  2  86  ? 60.056  -106.460 17.891  1.00 30.26  ? 97   GLN B OE1 1 
ATOM   2524  N  NE2 . GLN B  2  86  ? 59.489  -108.630 18.028  1.00 32.27  ? 97   GLN B NE2 1 
ATOM   2525  N  N   . ASN B  2  87  ? 53.925  -107.687 17.946  1.00 31.67  ? 98   ASN B N   1 
ATOM   2526  C  CA  . ASN B  2  87  ? 52.704  -108.449 17.657  1.00 31.59  ? 98   ASN B CA  1 
ATOM   2527  C  C   . ASN B  2  87  ? 52.577  -108.704 16.170  1.00 31.03  ? 98   ASN B C   1 
ATOM   2528  O  O   . ASN B  2  87  ? 52.191  -109.803 15.740  1.00 30.91  ? 98   ASN B O   1 
ATOM   2529  C  CB  . ASN B  2  87  ? 51.443  -107.737 18.137  1.00 31.67  ? 98   ASN B CB  1 
ATOM   2530  C  CG  . ASN B  2  87  ? 51.333  -107.685 19.640  1.00 34.39  ? 98   ASN B CG  1 
ATOM   2531  O  OD1 . ASN B  2  87  ? 51.955  -108.470 20.366  1.00 36.39  ? 98   ASN B OD1 1 
ATOM   2532  N  ND2 . ASN B  2  87  ? 50.528  -106.743 20.130  1.00 38.35  ? 98   ASN B ND2 1 
ATOM   2533  N  N   . TYR B  2  88  ? 52.894  -107.665 15.396  1.00 30.38  ? 99   TYR B N   1 
ATOM   2534  C  CA  . TYR B  2  88  ? 52.832  -107.716 13.946  1.00 29.52  ? 99   TYR B CA  1 
ATOM   2535  C  C   . TYR B  2  88  ? 53.856  -108.722 13.435  1.00 29.72  ? 99   TYR B C   1 
ATOM   2536  O  O   . TYR B  2  88  ? 53.517  -109.573 12.617  1.00 29.63  ? 99   TYR B O   1 
ATOM   2537  C  CB  . TYR B  2  88  ? 53.064  -106.330 13.324  1.00 28.76  ? 99   TYR B CB  1 
ATOM   2538  C  CG  . TYR B  2  88  ? 52.770  -106.289 11.836  1.00 26.69  ? 99   TYR B CG  1 
ATOM   2539  C  CD1 . TYR B  2  88  ? 51.554  -105.802 11.353  1.00 23.46  ? 99   TYR B CD1 1 
ATOM   2540  C  CD2 . TYR B  2  88  ? 53.708  -106.754 10.912  1.00 24.01  ? 99   TYR B CD2 1 
ATOM   2541  C  CE1 . TYR B  2  88  ? 51.282  -105.779 9.982   1.00 23.37  ? 99   TYR B CE1 1 
ATOM   2542  C  CE2 . TYR B  2  88  ? 53.451  -106.731 9.551   1.00 23.86  ? 99   TYR B CE2 1 
ATOM   2543  C  CZ  . TYR B  2  88  ? 52.241  -106.246 9.087   1.00 24.15  ? 99   TYR B CZ  1 
ATOM   2544  O  OH  . TYR B  2  88  ? 52.007  -106.243 7.727   1.00 24.19  ? 99   TYR B OH  1 
ATOM   2545  N  N   . LEU B  2  89  ? 55.093  -108.634 13.933  1.00 29.85  ? 100  LEU B N   1 
ATOM   2546  C  CA  . LEU B  2  89  ? 56.145  -109.580 13.547  1.00 30.31  ? 100  LEU B CA  1 
ATOM   2547  C  C   . LEU B  2  89  ? 55.751  -111.020 13.878  1.00 31.29  ? 100  LEU B C   1 
ATOM   2548  O  O   . LEU B  2  89  ? 56.017  -111.924 13.095  1.00 31.61  ? 100  LEU B O   1 
ATOM   2549  C  CB  . LEU B  2  89  ? 57.483  -109.242 14.206  1.00 29.42  ? 100  LEU B CB  1 
ATOM   2550  C  CG  . LEU B  2  89  ? 58.700  -110.139 13.933  1.00 27.97  ? 100  LEU B CG  1 
ATOM   2551  C  CD1 . LEU B  2  89  ? 58.856  -110.554 12.477  1.00 27.38  ? 100  LEU B CD1 1 
ATOM   2552  C  CD2 . LEU B  2  89  ? 59.971  -109.468 14.388  1.00 25.73  ? 100  LEU B CD2 1 
ATOM   2553  N  N   . LYS B  2  90  ? 55.108  -111.217 15.028  1.00 32.09  ? 101  LYS B N   1 
ATOM   2554  C  CA  . LYS B  2  90  ? 54.635  -112.530 15.444  1.00 33.00  ? 101  LYS B CA  1 
ATOM   2555  C  C   . LYS B  2  90  ? 53.461  -113.021 14.590  1.00 33.08  ? 101  LYS B C   1 
ATOM   2556  O  O   . LYS B  2  90  ? 53.371  -114.207 14.309  1.00 33.82  ? 101  LYS B O   1 
ATOM   2557  C  CB  . LYS B  2  90  ? 54.268  -112.514 16.934  1.00 33.39  ? 101  LYS B CB  1 
ATOM   2558  C  CG  . LYS B  2  90  ? 53.786  -113.846 17.506  1.00 35.73  ? 101  LYS B CG  1 
ATOM   2559  C  CD  . LYS B  2  90  ? 53.688  -113.813 19.035  1.00 39.28  ? 101  LYS B CD  1 
ATOM   2560  C  CE  . LYS B  2  90  ? 52.338  -113.281 19.509  1.00 42.85  ? 101  LYS B CE  1 
ATOM   2561  N  NZ  . LYS B  2  90  ? 51.183  -114.155 19.079  1.00 44.63  ? 101  LYS B NZ  1 
ATOM   2562  N  N   . THR B  2  91  ? 52.575  -112.124 14.169  1.00 32.91  ? 102  THR B N   1 
ATOM   2563  C  CA  . THR B  2  91  ? 51.410  -112.534 13.393  1.00 33.17  ? 102  THR B CA  1 
ATOM   2564  C  C   . THR B  2  91  ? 51.734  -112.878 11.934  1.00 33.61  ? 102  THR B C   1 
ATOM   2565  O  O   . THR B  2  91  ? 51.202  -113.853 11.385  1.00 33.96  ? 102  THR B O   1 
ATOM   2566  C  CB  . THR B  2  91  ? 50.303  -111.460 13.417  1.00 32.94  ? 102  THR B CB  1 
ATOM   2567  O  OG1 . THR B  2  91  ? 49.883  -111.249 14.760  1.00 33.28  ? 102  THR B OG1 1 
ATOM   2568  C  CG2 . THR B  2  91  ? 49.095  -111.894 12.598  1.00 32.40  ? 102  THR B CG2 1 
ATOM   2569  N  N   . TYR B  2  92  ? 52.594  -112.077 11.313  1.00 33.73  ? 103  TYR B N   1 
ATOM   2570  C  CA  . TYR B  2  92  ? 52.783  -112.130 9.872   1.00 33.87  ? 103  TYR B CA  1 
ATOM   2571  C  C   . TYR B  2  92  ? 54.180  -112.564 9.487   1.00 34.43  ? 103  TYR B C   1 
ATOM   2572  O  O   . TYR B  2  92  ? 54.453  -112.813 8.321   1.00 34.35  ? 103  TYR B O   1 
ATOM   2573  C  CB  . TYR B  2  92  ? 52.478  -110.763 9.250   1.00 33.67  ? 103  TYR B CB  1 
ATOM   2574  C  CG  . TYR B  2  92  ? 51.064  -110.289 9.453   1.00 32.61  ? 103  TYR B CG  1 
ATOM   2575  C  CD1 . TYR B  2  92  ? 50.012  -110.865 8.748   1.00 31.92  ? 103  TYR B CD1 1 
ATOM   2576  C  CD2 . TYR B  2  92  ? 50.772  -109.267 10.353  1.00 32.94  ? 103  TYR B CD2 1 
ATOM   2577  C  CE1 . TYR B  2  92  ? 48.709  -110.436 8.923   1.00 30.91  ? 103  TYR B CE1 1 
ATOM   2578  C  CE2 . TYR B  2  92  ? 49.462  -108.829 10.540  1.00 31.83  ? 103  TYR B CE2 1 
ATOM   2579  C  CZ  . TYR B  2  92  ? 48.442  -109.423 9.816   1.00 31.90  ? 103  TYR B CZ  1 
ATOM   2580  O  OH  . TYR B  2  92  ? 47.143  -109.004 9.976   1.00 33.85  ? 103  TYR B OH  1 
ATOM   2581  N  N   . ASN B  2  93  ? 55.069  -112.650 10.465  1.00 35.47  ? 104  ASN B N   1 
ATOM   2582  C  CA  . ASN B  2  93  ? 56.471  -112.972 10.192  1.00 36.83  ? 104  ASN B CA  1 
ATOM   2583  C  C   . ASN B  2  93  ? 57.171  -111.966 9.274   1.00 36.97  ? 104  ASN B C   1 
ATOM   2584  O  O   . ASN B  2  93  ? 58.095  -112.310 8.540   1.00 37.34  ? 104  ASN B O   1 
ATOM   2585  C  CB  . ASN B  2  93  ? 56.616  -114.410 9.685   1.00 37.46  ? 104  ASN B CB  1 
ATOM   2586  C  CG  . ASN B  2  93  ? 57.262  -115.312 10.712  1.00 40.09  ? 104  ASN B CG  1 
ATOM   2587  O  OD1 . ASN B  2  93  ? 58.477  -115.488 10.690  1.00 44.96  ? 104  ASN B OD1 1 
ATOM   2588  N  ND2 . ASN B  2  93  ? 56.472  -115.841 11.651  1.00 40.61  ? 104  ASN B ND2 1 
ATOM   2589  N  N   . GLU B  2  94  ? 56.707  -110.718 9.337   1.00 37.24  ? 105  GLU B N   1 
ATOM   2590  C  CA  . GLU B  2  94  ? 57.280  -109.588 8.607   1.00 36.84  ? 105  GLU B CA  1 
ATOM   2591  C  C   . GLU B  2  94  ? 57.409  -108.400 9.553   1.00 36.42  ? 105  GLU B C   1 
ATOM   2592  O  O   . GLU B  2  94  ? 56.614  -108.268 10.503  1.00 36.00  ? 105  GLU B O   1 
ATOM   2593  C  CB  . GLU B  2  94  ? 56.407  -109.234 7.400   1.00 36.95  ? 105  GLU B CB  1 
ATOM   2594  C  CG  . GLU B  2  94  ? 56.360  -110.362 6.389   1.00 38.33  ? 105  GLU B CG  1 
ATOM   2595  C  CD  . GLU B  2  94  ? 55.747  -110.001 5.051   1.00 40.28  ? 105  GLU B CD  1 
ATOM   2596  O  OE1 . GLU B  2  94  ? 56.214  -110.578 4.039   1.00 42.20  ? 105  GLU B OE1 1 
ATOM   2597  O  OE2 . GLU B  2  94  ? 54.795  -109.188 4.998   1.00 40.51  ? 105  GLU B OE2 1 
ATOM   2598  N  N   . ASP B  2  95  ? 58.431  -107.566 9.321   1.00 36.01  ? 106  ASP B N   1 
ATOM   2599  C  CA  . ASP B  2  95  ? 58.606  -106.313 10.073  1.00 35.08  ? 106  ASP B CA  1 
ATOM   2600  C  C   . ASP B  2  95  ? 57.424  -105.418 9.730   1.00 34.00  ? 106  ASP B C   1 
ATOM   2601  O  O   . ASP B  2  95  ? 56.941  -105.432 8.590   1.00 33.69  ? 106  ASP B O   1 
ATOM   2602  C  CB  . ASP B  2  95  ? 59.896  -105.614 9.679   1.00 35.55  ? 106  ASP B CB  1 
ATOM   2603  C  CG  . ASP B  2  95  ? 61.156  -106.452 9.963   1.00 38.74  ? 106  ASP B CG  1 
ATOM   2604  O  OD1 . ASP B  2  95  ? 61.273  -107.045 11.071  1.00 40.25  ? 106  ASP B OD1 1 
ATOM   2605  O  OD2 . ASP B  2  95  ? 62.049  -106.486 9.068   1.00 42.01  ? 106  ASP B OD2 1 
ATOM   2606  N  N   . ILE B  2  96  ? 56.931  -104.666 10.708  1.00 32.78  ? 107  ILE B N   1 
ATOM   2607  C  CA  . ILE B  2  96  ? 55.730  -103.862 10.483  1.00 31.71  ? 107  ILE B CA  1 
ATOM   2608  C  C   . ILE B  2  96  ? 56.008  -102.694 9.511   1.00 31.89  ? 107  ILE B C   1 
ATOM   2609  O  O   . ILE B  2  96  ? 56.996  -101.973 9.672   1.00 31.92  ? 107  ILE B O   1 
ATOM   2610  C  CB  . ILE B  2  96  ? 55.056  -103.404 11.822  1.00 31.18  ? 107  ILE B CB  1 
ATOM   2611  C  CG1 . ILE B  2  96  ? 53.660  -102.815 11.566  1.00 30.30  ? 107  ILE B CG1 1 
ATOM   2612  C  CG2 . ILE B  2  96  ? 55.952  -102.458 12.628  1.00 29.96  ? 107  ILE B CG2 1 
ATOM   2613  C  CD1 . ILE B  2  96  ? 52.876  -102.517 12.827  1.00 28.25  ? 107  ILE B CD1 1 
ATOM   2614  N  N   . PRO B  2  97  ? 55.161  -102.540 8.475   1.00 31.83  ? 108  PRO B N   1 
ATOM   2615  C  CA  . PRO B  2  97  ? 55.247  -101.348 7.636   1.00 32.21  ? 108  PRO B CA  1 
ATOM   2616  C  C   . PRO B  2  97  ? 55.120  -100.083 8.486   1.00 32.45  ? 108  PRO B C   1 
ATOM   2617  O  O   . PRO B  2  97  ? 54.267  -100.018 9.377   1.00 32.58  ? 108  PRO B O   1 
ATOM   2618  C  CB  . PRO B  2  97  ? 54.032  -101.489 6.705   1.00 32.07  ? 108  PRO B CB  1 
ATOM   2619  C  CG  . PRO B  2  97  ? 53.808  -102.950 6.618   1.00 31.51  ? 108  PRO B CG  1 
ATOM   2620  C  CD  . PRO B  2  97  ? 54.131  -103.476 7.985   1.00 31.51  ? 108  PRO B CD  1 
ATOM   2621  N  N   . VAL B  2  98  ? 55.963  -99.094  8.210   1.00 32.56  ? 109  VAL B N   1 
ATOM   2622  C  CA  . VAL B  2  98  ? 56.002  -97.872  9.013   1.00 32.94  ? 109  VAL B CA  1 
ATOM   2623  C  C   . VAL B  2  98  ? 54.634  -97.210  9.220   1.00 33.28  ? 109  VAL B C   1 
ATOM   2624  O  O   . VAL B  2  98  ? 54.305  -96.842  10.348  1.00 33.22  ? 109  VAL B O   1 
ATOM   2625  C  CB  . VAL B  2  98  ? 57.014  -96.846  8.459   1.00 32.92  ? 109  VAL B CB  1 
ATOM   2626  C  CG1 . VAL B  2  98  ? 57.093  -95.637  9.374   1.00 32.37  ? 109  VAL B CG1 1 
ATOM   2627  C  CG2 . VAL B  2  98  ? 58.396  -97.493  8.288   1.00 32.40  ? 109  VAL B CG2 1 
ATOM   2628  N  N   . GLU B  2  99  ? 53.837  -97.069  8.163   1.00 33.92  ? 110  GLU B N   1 
ATOM   2629  C  CA  . GLU B  2  99  ? 52.550  -96.387  8.318   1.00 35.03  ? 110  GLU B CA  1 
ATOM   2630  C  C   . GLU B  2  99  ? 51.627  -97.076  9.320   1.00 34.74  ? 110  GLU B C   1 
ATOM   2631  O  O   . GLU B  2  99  ? 51.013  -96.408  10.157  1.00 34.74  ? 110  GLU B O   1 
ATOM   2632  C  CB  . GLU B  2  99  ? 51.815  -96.192  6.993   1.00 35.69  ? 110  GLU B CB  1 
ATOM   2633  C  CG  . GLU B  2  99  ? 50.618  -95.234  7.137   1.00 39.36  ? 110  GLU B CG  1 
ATOM   2634  C  CD  . GLU B  2  99  ? 49.652  -95.261  5.953   1.00 44.75  ? 110  GLU B CD  1 
ATOM   2635  O  OE1 . GLU B  2  99  ? 50.069  -95.647  4.830   1.00 46.27  ? 110  GLU B OE1 1 
ATOM   2636  O  OE2 . GLU B  2  99  ? 48.473  -94.875  6.152   1.00 46.14  ? 110  GLU B OE2 1 
ATOM   2637  N  N   . ILE B  2  100 ? 51.534  -98.400  9.227   1.00 34.47  ? 111  ILE B N   1 
ATOM   2638  C  CA  . ILE B  2  100 ? 50.709  -99.183  10.136  1.00 34.39  ? 111  ILE B CA  1 
ATOM   2639  C  C   . ILE B  2  100 ? 51.071  -98.890  11.590  1.00 34.14  ? 111  ILE B C   1 
ATOM   2640  O  O   . ILE B  2  100 ? 50.184  -98.631  12.408  1.00 34.32  ? 111  ILE B O   1 
ATOM   2641  C  CB  . ILE B  2  100 ? 50.775  -100.713 9.812   1.00 34.90  ? 111  ILE B CB  1 
ATOM   2642  C  CG1 . ILE B  2  100 ? 50.342  -100.947 8.358   1.00 35.70  ? 111  ILE B CG1 1 
ATOM   2643  C  CG2 . ILE B  2  100 ? 49.917  -101.531 10.790  1.00 34.12  ? 111  ILE B CG2 1 
ATOM   2644  C  CD1 . ILE B  2  100 ? 50.366  -102.380 7.893   1.00 36.80  ? 111  ILE B CD1 1 
ATOM   2645  N  N   . LEU B  2  101 ? 52.361  -98.894  11.904  1.00 33.90  ? 112  LEU B N   1 
ATOM   2646  C  CA  . LEU B  2  101 ? 52.805  -98.535  13.246  1.00 34.38  ? 112  LEU B CA  1 
ATOM   2647  C  C   . LEU B  2  101 ? 52.395  -97.112  13.634  1.00 35.08  ? 112  LEU B C   1 
ATOM   2648  O  O   . LEU B  2  101 ? 51.861  -96.885  14.726  1.00 35.88  ? 112  LEU B O   1 
ATOM   2649  C  CB  . LEU B  2  101 ? 54.312  -98.719  13.400  1.00 34.05  ? 112  LEU B CB  1 
ATOM   2650  C  CG  . LEU B  2  101 ? 54.885  -98.539  14.805  1.00 33.48  ? 112  LEU B CG  1 
ATOM   2651  C  CD1 . LEU B  2  101 ? 56.250  -99.169  14.930  1.00 32.76  ? 112  LEU B CD1 1 
ATOM   2652  C  CD2 . LEU B  2  101 ? 55.009  -97.061  15.101  1.00 35.06  ? 112  LEU B CD2 1 
ATOM   2653  N  N   . VAL B  2  102 ? 52.639  -96.152  12.751  1.00 35.39  ? 113  VAL B N   1 
ATOM   2654  C  CA  . VAL B  2  102 ? 52.250  -94.765  13.017  1.00 35.62  ? 113  VAL B CA  1 
ATOM   2655  C  C   . VAL B  2  102 ? 50.738  -94.604  13.198  1.00 36.12  ? 113  VAL B C   1 
ATOM   2656  O  O   . VAL B  2  102 ? 50.292  -93.883  14.087  1.00 35.89  ? 113  VAL B O   1 
ATOM   2657  C  CB  . VAL B  2  102 ? 52.774  -93.818  11.917  1.00 35.56  ? 113  VAL B CB  1 
ATOM   2658  C  CG1 . VAL B  2  102 ? 52.301  -92.407  12.153  1.00 34.53  ? 113  VAL B CG1 1 
ATOM   2659  C  CG2 . VAL B  2  102 ? 54.303  -93.887  11.860  1.00 34.79  ? 113  VAL B CG2 1 
ATOM   2660  N  N   . ARG B  2  103 ? 49.954  -95.288  12.369  1.00 37.03  ? 114  ARG B N   1 
ATOM   2661  C  CA  . ARG B  2  103 ? 48.497  -95.174  12.445  1.00 38.15  ? 114  ARG B CA  1 
ATOM   2662  C  C   . ARG B  2  103 ? 47.934  -95.673  13.779  1.00 38.61  ? 114  ARG B C   1 
ATOM   2663  O  O   . ARG B  2  103 ? 46.983  -95.095  14.303  1.00 38.34  ? 114  ARG B O   1 
ATOM   2664  C  CB  . ARG B  2  103 ? 47.813  -95.893  11.279  1.00 38.11  ? 114  ARG B CB  1 
ATOM   2665  C  CG  . ARG B  2  103 ? 46.296  -95.742  11.326  1.00 39.48  ? 114  ARG B CG  1 
ATOM   2666  C  CD  . ARG B  2  103 ? 45.567  -96.752  10.482  1.00 41.21  ? 114  ARG B CD  1 
ATOM   2667  N  NE  . ARG B  2  103 ? 46.088  -96.771  9.125   1.00 42.36  ? 114  ARG B NE  1 
ATOM   2668  C  CZ  . ARG B  2  103 ? 46.502  -97.865  8.493   1.00 42.91  ? 114  ARG B CZ  1 
ATOM   2669  N  NH1 . ARG B  2  103 ? 46.957  -97.750  7.247   1.00 42.73  ? 114  ARG B NH1 1 
ATOM   2670  N  NH2 . ARG B  2  103 ? 46.445  -99.065  9.086   1.00 41.35  ? 114  ARG B NH2 1 
ATOM   2671  N  N   . ARG B  2  104 ? 48.531  -96.742  14.314  1.00 39.40  ? 115  ARG B N   1 
ATOM   2672  C  CA  . ARG B  2  104 ? 48.120  -97.290  15.596  1.00 40.20  ? 115  ARG B CA  1 
ATOM   2673  C  C   . ARG B  2  104 ? 48.360  -96.296  16.711  1.00 39.89  ? 115  ARG B C   1 
ATOM   2674  O  O   . ARG B  2  104 ? 47.437  -95.969  17.458  1.00 40.11  ? 115  ARG B O   1 
ATOM   2675  C  CB  . ARG B  2  104 ? 48.845  -98.606  15.915  1.00 41.18  ? 115  ARG B CB  1 
ATOM   2676  C  CG  . ARG B  2  104 ? 48.409  -99.255  17.248  1.00 44.10  ? 115  ARG B CG  1 
ATOM   2677  C  CD  . ARG B  2  104 ? 47.000  -99.836  17.139  1.00 51.35  ? 115  ARG B CD  1 
ATOM   2678  N  NE  . ARG B  2  104 ? 46.409  -100.154 18.443  1.00 57.88  ? 115  ARG B NE  1 
ATOM   2679  C  CZ  . ARG B  2  104 ? 45.340  -99.541  18.967  1.00 60.86  ? 115  ARG B CZ  1 
ATOM   2680  N  NH1 . ARG B  2  104 ? 44.725  -98.556  18.304  1.00 61.61  ? 115  ARG B NH1 1 
ATOM   2681  N  NH2 . ARG B  2  104 ? 44.874  -99.915  20.162  1.00 60.76  ? 115  ARG B NH2 1 
ATOM   2682  N  N   . LEU B  2  105 ? 49.596  -95.823  16.835  1.00 39.47  ? 116  LEU B N   1 
ATOM   2683  C  CA  . LEU B  2  105 ? 49.919  -94.835  17.853  1.00 39.32  ? 116  LEU B CA  1 
ATOM   2684  C  C   . LEU B  2  105 ? 48.998  -93.617  17.791  1.00 39.40  ? 116  LEU B C   1 
ATOM   2685  O  O   . LEU B  2  105 ? 48.457  -93.194  18.819  1.00 39.52  ? 116  LEU B O   1 
ATOM   2686  C  CB  . LEU B  2  105 ? 51.366  -94.405  17.740  1.00 39.38  ? 116  LEU B CB  1 
ATOM   2687  C  CG  . LEU B  2  105 ? 52.346  -95.064  18.694  1.00 39.37  ? 116  LEU B CG  1 
ATOM   2688  C  CD1 . LEU B  2  105 ? 53.688  -94.405  18.509  1.00 39.11  ? 116  LEU B CD1 1 
ATOM   2689  C  CD2 . LEU B  2  105 ? 51.877  -94.897  20.124  1.00 39.79  ? 116  LEU B CD2 1 
ATOM   2690  N  N   . SER B  2  106 ? 48.801  -93.078  16.588  1.00 39.28  ? 117  SER B N   1 
ATOM   2691  C  CA  . SER B  2  106 ? 47.873  -91.962  16.373  1.00 39.45  ? 117  SER B CA  1 
ATOM   2692  C  C   . SER B  2  106 ? 46.452  -92.267  16.851  1.00 39.67  ? 117  SER B C   1 
ATOM   2693  O  O   . SER B  2  106 ? 45.782  -91.395  17.424  1.00 39.79  ? 117  SER B O   1 
ATOM   2694  C  CB  . SER B  2  106 ? 47.853  -91.556  14.904  1.00 39.32  ? 117  SER B CB  1 
ATOM   2695  O  OG  . SER B  2  106 ? 49.136  -91.132  14.485  1.00 39.40  ? 117  SER B OG  1 
ATOM   2696  N  N   . ASP B  2  107 ? 46.005  -93.504  16.625  1.00 39.63  ? 118  ASP B N   1 
ATOM   2697  C  CA  . ASP B  2  107 ? 44.673  -93.925  17.044  1.00 39.71  ? 118  ASP B CA  1 
ATOM   2698  C  C   . ASP B  2  107 ? 44.537  -93.951  18.570  1.00 39.31  ? 118  ASP B C   1 
ATOM   2699  O  O   . ASP B  2  107 ? 43.482  -93.614  19.113  1.00 39.30  ? 118  ASP B O   1 
ATOM   2700  C  CB  . ASP B  2  107 ? 44.276  -95.259  16.392  1.00 39.83  ? 118  ASP B CB  1 
ATOM   2701  C  CG  . ASP B  2  107 ? 43.840  -95.095  14.921  1.00 41.89  ? 118  ASP B CG  1 
ATOM   2702  O  OD1 . ASP B  2  107 ? 43.919  -96.078  14.143  1.00 42.77  ? 118  ASP B OD1 1 
ATOM   2703  O  OD2 . ASP B  2  107 ? 43.404  -93.980  14.532  1.00 45.12  ? 118  ASP B OD2 1 
ATOM   2704  N  N   . ILE B  2  108 ? 45.610  -94.318  19.259  1.00 38.92  ? 119  ILE B N   1 
ATOM   2705  C  CA  . ILE B  2  108 ? 45.599  -94.321  20.711  1.00 38.84  ? 119  ILE B CA  1 
ATOM   2706  C  C   . ILE B  2  108 ? 45.452  -92.892  21.227  1.00 39.13  ? 119  ILE B C   1 
ATOM   2707  O  O   . ILE B  2  108 ? 44.717  -92.648  22.191  1.00 39.28  ? 119  ILE B O   1 
ATOM   2708  C  CB  . ILE B  2  108 ? 46.870  -94.953  21.277  1.00 38.68  ? 119  ILE B CB  1 
ATOM   2709  C  CG1 . ILE B  2  108 ? 46.897  -96.451  20.976  1.00 38.06  ? 119  ILE B CG1 1 
ATOM   2710  C  CG2 . ILE B  2  108 ? 46.990  -94.690  22.781  1.00 38.47  ? 119  ILE B CG2 1 
ATOM   2711  C  CD1 . ILE B  2  108 ? 48.287  -97.059  21.086  1.00 37.00  ? 119  ILE B CD1 1 
ATOM   2712  N  N   . LYS B  2  109 ? 46.148  -91.957  20.571  1.00 39.38  ? 120  LYS B N   1 
ATOM   2713  C  CA  . LYS B  2  109 ? 46.096  -90.522  20.909  1.00 38.98  ? 120  LYS B CA  1 
ATOM   2714  C  C   . LYS B  2  109 ? 44.715  -89.942  20.647  1.00 38.80  ? 120  LYS B C   1 
ATOM   2715  O  O   . LYS B  2  109 ? 44.125  -89.285  21.514  1.00 38.66  ? 120  LYS B O   1 
ATOM   2716  C  CB  . LYS B  2  109 ? 47.138  -89.748  20.114  1.00 38.91  ? 120  LYS B CB  1 
ATOM   2717  C  CG  . LYS B  2  109 ? 48.566  -89.822  20.648  1.00 38.76  ? 120  LYS B CG  1 
ATOM   2718  C  CD  . LYS B  2  109 ? 49.510  -89.473  19.517  1.00 39.31  ? 120  LYS B CD  1 
ATOM   2719  C  CE  . LYS B  2  109 ? 50.845  -88.990  20.030  1.00 40.99  ? 120  LYS B CE  1 
ATOM   2720  N  NZ  . LYS B  2  109 ? 51.709  -88.521  18.894  1.00 40.38  ? 120  LYS B NZ  1 
ATOM   2721  N  N   . GLN B  2  110 ? 44.193  -90.214  19.457  1.00 38.74  ? 121  GLN B N   1 
ATOM   2722  C  CA  . GLN B  2  110 ? 42.835  -89.831  19.109  1.00 38.99  ? 121  GLN B CA  1 
ATOM   2723  C  C   . GLN B  2  110 ? 41.836  -90.286  20.183  1.00 39.42  ? 121  GLN B C   1 
ATOM   2724  O  O   . GLN B  2  110 ? 40.919  -89.553  20.515  1.00 39.76  ? 121  GLN B O   1 
ATOM   2725  C  CB  . GLN B  2  110 ? 42.470  -90.405  17.738  1.00 38.72  ? 121  GLN B CB  1 
ATOM   2726  C  CG  . GLN B  2  110 ? 41.190  -89.868  17.118  1.00 38.68  ? 121  GLN B CG  1 
ATOM   2727  C  CD  . GLN B  2  110 ? 39.909  -90.407  17.751  1.00 40.05  ? 121  GLN B CD  1 
ATOM   2728  O  OE1 . GLN B  2  110 ? 38.874  -89.732  17.727  1.00 41.63  ? 121  GLN B OE1 1 
ATOM   2729  N  NE2 . GLN B  2  110 ? 39.966  -91.620  18.317  1.00 39.35  ? 121  GLN B NE2 1 
ATOM   2730  N  N   . GLY B  2  111 ? 42.010  -91.493  20.714  1.00 39.75  ? 122  GLY B N   1 
ATOM   2731  C  CA  . GLY B  2  111 ? 41.104  -92.031  21.711  1.00 40.53  ? 122  GLY B CA  1 
ATOM   2732  C  C   . GLY B  2  111 ? 40.903  -91.137  22.925  1.00 41.60  ? 122  GLY B C   1 
ATOM   2733  O  O   . GLY B  2  111 ? 39.761  -90.891  23.343  1.00 41.76  ? 122  GLY B O   1 
ATOM   2734  N  N   . TYR B  2  112 ? 42.016  -90.654  23.488  1.00 42.34  ? 123  TYR B N   1 
ATOM   2735  C  CA  . TYR B  2  112 ? 42.015  -89.770  24.654  1.00 42.74  ? 123  TYR B CA  1 
ATOM   2736  C  C   . TYR B  2  112 ? 41.321  -88.441  24.345  1.00 43.31  ? 123  TYR B C   1 
ATOM   2737  O  O   . TYR B  2  112 ? 40.865  -87.741  25.238  1.00 43.59  ? 123  TYR B O   1 
ATOM   2738  C  CB  . TYR B  2  112 ? 43.451  -89.562  25.151  1.00 42.79  ? 123  TYR B CB  1 
ATOM   2739  C  CG  . TYR B  2  112 ? 43.968  -90.716  25.995  1.00 42.59  ? 123  TYR B CG  1 
ATOM   2740  C  CD1 . TYR B  2  112 ? 44.344  -91.924  25.415  1.00 42.95  ? 123  TYR B CD1 1 
ATOM   2741  C  CD2 . TYR B  2  112 ? 44.058  -90.603  27.380  1.00 42.46  ? 123  TYR B CD2 1 
ATOM   2742  C  CE1 . TYR B  2  112 ? 44.799  -92.988  26.193  1.00 42.78  ? 123  TYR B CE1 1 
ATOM   2743  C  CE2 . TYR B  2  112 ? 44.519  -91.652  28.165  1.00 42.29  ? 123  TYR B CE2 1 
ATOM   2744  C  CZ  . TYR B  2  112 ? 44.886  -92.841  27.566  1.00 43.20  ? 123  TYR B CZ  1 
ATOM   2745  O  OH  . TYR B  2  112 ? 45.336  -93.883  28.345  1.00 44.44  ? 123  TYR B OH  1 
ATOM   2746  N  N   . THR B  2  113 ? 41.231  -88.135  23.056  1.00 43.97  ? 124  THR B N   1 
ATOM   2747  C  CA  . THR B  2  113 ? 40.536  -86.983  22.503  1.00 44.33  ? 124  THR B CA  1 
ATOM   2748  C  C   . THR B  2  113 ? 39.010  -87.159  22.483  1.00 45.02  ? 124  THR B C   1 
ATOM   2749  O  O   . THR B  2  113 ? 38.277  -86.172  22.404  1.00 45.14  ? 124  THR B O   1 
ATOM   2750  C  CB  . THR B  2  113 ? 41.072  -86.774  21.064  1.00 44.50  ? 124  THR B CB  1 
ATOM   2751  O  OG1 . THR B  2  113 ? 42.279  -86.009  21.114  1.00 45.07  ? 124  THR B OG1 1 
ATOM   2752  C  CG2 . THR B  2  113 ? 40.072  -86.122  20.121  1.00 44.16  ? 124  THR B CG2 1 
ATOM   2753  N  N   . GLN B  2  114 ? 38.526  -88.402  22.548  1.00 45.66  ? 125  GLN B N   1 
ATOM   2754  C  CA  . GLN B  2  114 ? 37.099  -88.648  22.342  1.00 46.46  ? 125  GLN B CA  1 
ATOM   2755  C  C   . GLN B  2  114 ? 36.341  -89.328  23.486  1.00 47.64  ? 125  GLN B C   1 
ATOM   2756  O  O   . GLN B  2  114 ? 35.114  -89.210  23.573  1.00 47.62  ? 125  GLN B O   1 
ATOM   2757  C  CB  . GLN B  2  114 ? 36.842  -89.373  21.023  1.00 46.12  ? 125  GLN B CB  1 
ATOM   2758  C  CG  . GLN B  2  114 ? 35.418  -89.185  20.551  1.00 45.52  ? 125  GLN B CG  1 
ATOM   2759  C  CD  . GLN B  2  114 ? 35.158  -89.661  19.145  1.00 45.73  ? 125  GLN B CD  1 
ATOM   2760  O  OE1 . GLN B  2  114 ? 34.142  -89.294  18.552  1.00 46.11  ? 125  GLN B OE1 1 
ATOM   2761  N  NE2 . GLN B  2  114 ? 36.051  -90.491  18.604  1.00 45.09  ? 125  GLN B NE2 1 
ATOM   2762  N  N   . HIS B  2  115 ? 37.046  -90.038  24.360  1.00 49.05  ? 126  HIS B N   1 
ATOM   2763  C  CA  . HIS B  2  115 ? 36.376  -90.627  25.521  1.00 50.61  ? 126  HIS B CA  1 
ATOM   2764  C  C   . HIS B  2  115 ? 37.259  -90.770  26.739  1.00 50.83  ? 126  HIS B C   1 
ATOM   2765  O  O   . HIS B  2  115 ? 38.483  -90.824  26.626  1.00 50.97  ? 126  HIS B O   1 
ATOM   2766  C  CB  . HIS B  2  115 ? 35.730  -91.986  25.194  1.00 51.27  ? 126  HIS B CB  1 
ATOM   2767  C  CG  . HIS B  2  115 ? 36.516  -92.825  24.238  1.00 53.66  ? 126  HIS B CG  1 
ATOM   2768  N  ND1 . HIS B  2  115 ? 37.686  -93.462  24.594  1.00 56.52  ? 126  HIS B ND1 1 
ATOM   2769  C  CD2 . HIS B  2  115 ? 36.298  -93.133  22.936  1.00 56.09  ? 126  HIS B CD2 1 
ATOM   2770  C  CE1 . HIS B  2  115 ? 38.160  -94.124  23.550  1.00 57.82  ? 126  HIS B CE1 1 
ATOM   2771  N  NE2 . HIS B  2  115 ? 37.336  -93.938  22.530  1.00 58.28  ? 126  HIS B NE2 1 
ATOM   2772  N  N   . GLY B  2  116 ? 36.612  -90.815  27.903  1.00 51.02  ? 127  GLY B N   1 
ATOM   2773  C  CA  . GLY B  2  116 ? 37.262  -91.213  29.137  1.00 51.17  ? 127  GLY B CA  1 
ATOM   2774  C  C   . GLY B  2  116 ? 37.488  -90.079  30.115  1.00 51.44  ? 127  GLY B C   1 
ATOM   2775  O  O   . GLY B  2  116 ? 37.550  -90.309  31.338  1.00 51.99  ? 127  GLY B O   1 
ATOM   2776  N  N   . GLY B  2  117 ? 37.623  -88.857  29.597  1.00 50.83  ? 128  GLY B N   1 
ATOM   2777  C  CA  . GLY B  2  117 ? 38.003  -87.725  30.446  1.00 49.92  ? 128  GLY B CA  1 
ATOM   2778  C  C   . GLY B  2  117 ? 39.358  -87.890  31.134  1.00 49.15  ? 128  GLY B C   1 
ATOM   2779  O  O   . GLY B  2  117 ? 39.517  -87.537  32.307  1.00 49.32  ? 128  GLY B O   1 
ATOM   2780  N  N   . LEU B  2  118 ? 40.326  -88.461  30.418  1.00 47.91  ? 129  LEU B N   1 
ATOM   2781  C  CA  . LEU B  2  118 ? 41.725  -88.370  30.824  1.00 46.56  ? 129  LEU B CA  1 
ATOM   2782  C  C   . LEU B  2  118 ? 42.416  -87.321  29.936  1.00 45.77  ? 129  LEU B C   1 
ATOM   2783  O  O   . LEU B  2  118 ? 42.077  -87.163  28.756  1.00 45.89  ? 129  LEU B O   1 
ATOM   2784  C  CB  . LEU B  2  118 ? 42.422  -89.743  30.740  1.00 46.40  ? 129  LEU B CB  1 
ATOM   2785  C  CG  . LEU B  2  118 ? 41.847  -90.938  31.533  1.00 46.34  ? 129  LEU B CG  1 
ATOM   2786  C  CD1 . LEU B  2  118 ? 42.747  -92.165  31.465  1.00 45.43  ? 129  LEU B CD1 1 
ATOM   2787  C  CD2 . LEU B  2  118 ? 41.571  -90.603  32.995  1.00 45.95  ? 129  LEU B CD2 1 
ATOM   2788  N  N   . ARG B  2  119 ? 43.371  -86.588  30.494  1.00 44.62  ? 130  ARG B N   1 
ATOM   2789  C  CA  . ARG B  2  119 ? 44.118  -85.607  29.699  1.00 43.46  ? 130  ARG B CA  1 
ATOM   2790  C  C   . ARG B  2  119 ? 44.755  -86.280  28.490  1.00 43.06  ? 130  ARG B C   1 
ATOM   2791  O  O   . ARG B  2  119 ? 45.075  -87.461  28.555  1.00 42.91  ? 130  ARG B O   1 
ATOM   2792  C  CB  . ARG B  2  119 ? 45.182  -84.890  30.549  1.00 43.29  ? 130  ARG B CB  1 
ATOM   2793  C  CG  . ARG B  2  119 ? 46.352  -85.743  31.000  1.00 41.59  ? 130  ARG B CG  1 
ATOM   2794  C  CD  . ARG B  2  119 ? 47.457  -84.881  31.547  1.00 40.01  ? 130  ARG B CD  1 
ATOM   2795  N  NE  . ARG B  2  119 ? 48.623  -85.665  31.941  1.00 38.80  ? 130  ARG B NE  1 
ATOM   2796  C  CZ  . ARG B  2  119 ? 49.555  -86.100  31.097  1.00 39.00  ? 130  ARG B CZ  1 
ATOM   2797  N  NH1 . ARG B  2  119 ? 49.470  -85.837  29.798  1.00 38.78  ? 130  ARG B NH1 1 
ATOM   2798  N  NH2 . ARG B  2  119 ? 50.577  -86.807  31.548  1.00 38.35  ? 130  ARG B NH2 1 
ATOM   2799  N  N   . PRO B  2  120 ? 44.937  -85.541  27.378  1.00 42.96  ? 131  PRO B N   1 
ATOM   2800  C  CA  . PRO B  2  120 ? 45.666  -86.153  26.261  1.00 42.79  ? 131  PRO B CA  1 
ATOM   2801  C  C   . PRO B  2  120 ? 47.153  -86.291  26.587  1.00 42.53  ? 131  PRO B C   1 
ATOM   2802  O  O   . PRO B  2  120 ? 47.604  -85.828  27.630  1.00 42.43  ? 131  PRO B O   1 
ATOM   2803  C  CB  . PRO B  2  120 ? 45.460  -85.163  25.107  1.00 42.80  ? 131  PRO B CB  1 
ATOM   2804  C  CG  . PRO B  2  120 ? 44.378  -84.223  25.566  1.00 43.07  ? 131  PRO B CG  1 
ATOM   2805  C  CD  . PRO B  2  120 ? 44.471  -84.183  27.047  1.00 42.82  ? 131  PRO B CD  1 
ATOM   2806  N  N   . PHE B  2  121 ? 47.898  -86.942  25.707  1.00 42.60  ? 132  PHE B N   1 
ATOM   2807  C  CA  . PHE B  2  121 ? 49.338  -87.070  25.873  1.00 42.32  ? 132  PHE B CA  1 
ATOM   2808  C  C   . PHE B  2  121 ? 49.989  -85.806  25.346  1.00 41.96  ? 132  PHE B C   1 
ATOM   2809  O  O   . PHE B  2  121 ? 49.711  -85.382  24.219  1.00 41.72  ? 132  PHE B O   1 
ATOM   2810  C  CB  . PHE B  2  121 ? 49.870  -88.276  25.093  1.00 42.62  ? 132  PHE B CB  1 
ATOM   2811  C  CG  . PHE B  2  121 ? 49.433  -89.606  25.638  1.00 43.10  ? 132  PHE B CG  1 
ATOM   2812  C  CD1 . PHE B  2  121 ? 48.301  -90.234  25.137  1.00 43.96  ? 132  PHE B CD1 1 
ATOM   2813  C  CD2 . PHE B  2  121 ? 50.167  -90.239  26.641  1.00 43.87  ? 132  PHE B CD2 1 
ATOM   2814  C  CE1 . PHE B  2  121 ? 47.895  -91.469  25.638  1.00 45.23  ? 132  PHE B CE1 1 
ATOM   2815  C  CE2 . PHE B  2  121 ? 49.773  -91.474  27.150  1.00 44.47  ? 132  PHE B CE2 1 
ATOM   2816  C  CZ  . PHE B  2  121 ? 48.636  -92.091  26.651  1.00 45.03  ? 132  PHE B CZ  1 
ATOM   2817  N  N   . GLY B  2  122 ? 50.862  -85.212  26.153  1.00 41.57  ? 133  GLY B N   1 
ATOM   2818  C  CA  . GLY B  2  122 ? 51.549  -83.984  25.764  1.00 40.78  ? 133  GLY B CA  1 
ATOM   2819  C  C   . GLY B  2  122 ? 52.781  -84.285  24.945  1.00 40.07  ? 133  GLY B C   1 
ATOM   2820  O  O   . GLY B  2  122 ? 53.895  -83.948  25.339  1.00 40.34  ? 133  GLY B O   1 
ATOM   2821  N  N   . VAL B  2  123 ? 52.566  -84.910  23.794  1.00 39.48  ? 134  VAL B N   1 
ATOM   2822  C  CA  . VAL B  2  123 ? 53.644  -85.476  22.991  1.00 39.12  ? 134  VAL B CA  1 
ATOM   2823  C  C   . VAL B  2  123 ? 53.400  -85.286  21.497  1.00 38.44  ? 134  VAL B C   1 
ATOM   2824  O  O   . VAL B  2  123 ? 52.276  -85.435  21.027  1.00 37.83  ? 134  VAL B O   1 
ATOM   2825  C  CB  . VAL B  2  123 ? 53.797  -87.000  23.275  1.00 39.07  ? 134  VAL B CB  1 
ATOM   2826  C  CG1 . VAL B  2  123 ? 54.632  -87.669  22.208  1.00 39.33  ? 134  VAL B CG1 1 
ATOM   2827  C  CG2 . VAL B  2  123 ? 54.425  -87.234  24.630  1.00 39.99  ? 134  VAL B CG2 1 
ATOM   2828  N  N   . SER B  2  124 ? 54.461  -84.942  20.770  1.00 38.15  ? 135  SER B N   1 
ATOM   2829  C  CA  . SER B  2  124 ? 54.459  -85.003  19.310  1.00 38.33  ? 135  SER B CA  1 
ATOM   2830  C  C   . SER B  2  124 ? 55.644  -85.833  18.841  1.00 38.24  ? 135  SER B C   1 
ATOM   2831  O  O   . SER B  2  124 ? 56.748  -85.726  19.401  1.00 38.38  ? 135  SER B O   1 
ATOM   2832  C  CB  . SER B  2  124 ? 54.506  -83.605  18.682  1.00 38.57  ? 135  SER B CB  1 
ATOM   2833  O  OG  . SER B  2  124 ? 53.224  -82.983  18.675  1.00 38.67  ? 135  SER B OG  1 
ATOM   2834  N  N   . PHE B  2  125 ? 55.413  -86.658  17.821  1.00 38.04  ? 136  PHE B N   1 
ATOM   2835  C  CA  . PHE B  2  125 ? 56.441  -87.571  17.313  1.00 38.14  ? 136  PHE B CA  1 
ATOM   2836  C  C   . PHE B  2  125 ? 56.863  -87.261  15.875  1.00 37.83  ? 136  PHE B C   1 
ATOM   2837  O  O   . PHE B  2  125 ? 56.037  -86.892  15.042  1.00 37.39  ? 136  PHE B O   1 
ATOM   2838  C  CB  . PHE B  2  125 ? 55.943  -89.024  17.342  1.00 38.41  ? 136  PHE B CB  1 
ATOM   2839  C  CG  . PHE B  2  125 ? 55.876  -89.647  18.718  1.00 39.13  ? 136  PHE B CG  1 
ATOM   2840  C  CD1 . PHE B  2  125 ? 54.673  -90.163  19.196  1.00 40.66  ? 136  PHE B CD1 1 
ATOM   2841  C  CD2 . PHE B  2  125 ? 57.007  -89.758  19.515  1.00 39.40  ? 136  PHE B CD2 1 
ATOM   2842  C  CE1 . PHE B  2  125 ? 54.594  -90.773  20.462  1.00 40.63  ? 136  PHE B CE1 1 
ATOM   2843  C  CE2 . PHE B  2  125 ? 56.939  -90.354  20.782  1.00 39.61  ? 136  PHE B CE2 1 
ATOM   2844  C  CZ  . PHE B  2  125 ? 55.732  -90.866  21.251  1.00 39.92  ? 136  PHE B CZ  1 
ATOM   2845  N  N   . ILE B  2  126 ? 58.156  -87.417  15.601  1.00 37.77  ? 137  ILE B N   1 
ATOM   2846  C  CA  . ILE B  2  126 ? 58.648  -87.602  14.231  1.00 37.54  ? 137  ILE B CA  1 
ATOM   2847  C  C   . ILE B  2  126 ? 59.133  -89.048  14.084  1.00 37.64  ? 137  ILE B C   1 
ATOM   2848  O  O   . ILE B  2  126 ? 60.072  -89.472  14.785  1.00 37.29  ? 137  ILE B O   1 
ATOM   2849  C  CB  . ILE B  2  126 ? 59.828  -86.674  13.868  1.00 37.34  ? 137  ILE B CB  1 
ATOM   2850  C  CG1 . ILE B  2  126 ? 59.443  -85.208  14.026  1.00 37.67  ? 137  ILE B CG1 1 
ATOM   2851  C  CG2 . ILE B  2  126 ? 60.302  -86.953  12.438  1.00 36.82  ? 137  ILE B CG2 1 
ATOM   2852  C  CD1 . ILE B  2  126 ? 60.627  -84.285  13.979  1.00 37.67  ? 137  ILE B CD1 1 
ATOM   2853  N  N   . TYR B  2  127 ? 58.502  -89.780  13.164  1.00 37.39  ? 138  TYR B N   1 
ATOM   2854  C  CA  . TYR B  2  127 ? 58.852  -91.168  12.885  1.00 37.45  ? 138  TYR B CA  1 
ATOM   2855  C  C   . TYR B  2  127 ? 59.784  -91.269  11.690  1.00 37.93  ? 138  TYR B C   1 
ATOM   2856  O  O   . TYR B  2  127 ? 59.507  -90.741  10.614  1.00 37.85  ? 138  TYR B O   1 
ATOM   2857  C  CB  . TYR B  2  127 ? 57.600  -91.996  12.590  1.00 37.33  ? 138  TYR B CB  1 
ATOM   2858  C  CG  . TYR B  2  127 ? 56.508  -91.911  13.630  1.00 36.43  ? 138  TYR B CG  1 
ATOM   2859  C  CD1 . TYR B  2  127 ? 55.522  -90.930  13.546  1.00 34.65  ? 138  TYR B CD1 1 
ATOM   2860  C  CD2 . TYR B  2  127 ? 56.443  -92.833  14.680  1.00 34.33  ? 138  TYR B CD2 1 
ATOM   2861  C  CE1 . TYR B  2  127 ? 54.519  -90.851  14.488  1.00 34.75  ? 138  TYR B CE1 1 
ATOM   2862  C  CE2 . TYR B  2  127 ? 55.448  -92.765  15.627  1.00 33.24  ? 138  TYR B CE2 1 
ATOM   2863  C  CZ  . TYR B  2  127 ? 54.484  -91.775  15.527  1.00 34.99  ? 138  TYR B CZ  1 
ATOM   2864  O  OH  . TYR B  2  127 ? 53.475  -91.695  16.466  1.00 35.63  ? 138  TYR B OH  1 
ATOM   2865  N  N   . ALA B  2  128 ? 60.883  -91.980  11.883  1.00 38.71  ? 139  ALA B N   1 
ATOM   2866  C  CA  . ALA B  2  128 ? 61.851  -92.217  10.834  1.00 39.21  ? 139  ALA B CA  1 
ATOM   2867  C  C   . ALA B  2  128 ? 61.881  -93.714  10.543  1.00 39.88  ? 139  ALA B C   1 
ATOM   2868  O  O   . ALA B  2  128 ? 62.225  -94.500  11.413  1.00 40.23  ? 139  ALA B O   1 
ATOM   2869  C  CB  . ALA B  2  128 ? 63.214  -91.733  11.294  1.00 38.68  ? 139  ALA B CB  1 
ATOM   2870  N  N   . GLY B  2  129 ? 61.527  -94.127  9.336   1.00 40.81  ? 140  GLY B N   1 
ATOM   2871  C  CA  . GLY B  2  129 ? 61.562  -95.556  9.041   1.00 41.96  ? 140  GLY B CA  1 
ATOM   2872  C  C   . GLY B  2  129 ? 61.771  -95.995  7.610   1.00 42.82  ? 140  GLY B C   1 
ATOM   2873  O  O   . GLY B  2  129 ? 61.620  -95.206  6.676   1.00 42.48  ? 140  GLY B O   1 
ATOM   2874  N  N   . TYR B  2  130 ? 62.127  -97.272  7.460   1.00 44.03  ? 141  TYR B N   1 
ATOM   2875  C  CA  . TYR B  2  130 ? 62.257  -97.931  6.166   1.00 45.22  ? 141  TYR B CA  1 
ATOM   2876  C  C   . TYR B  2  130 ? 61.409  -99.197  6.111   1.00 46.03  ? 141  TYR B C   1 
ATOM   2877  O  O   . TYR B  2  130 ? 61.337  -99.949  7.080   1.00 46.19  ? 141  TYR B O   1 
ATOM   2878  C  CB  . TYR B  2  130 ? 63.718  -98.294  5.886   1.00 45.22  ? 141  TYR B CB  1 
ATOM   2879  C  CG  . TYR B  2  130 ? 63.900  -99.008  4.571   1.00 46.58  ? 141  TYR B CG  1 
ATOM   2880  C  CD1 . TYR B  2  130 ? 63.755  -100.390 4.482   1.00 48.36  ? 141  TYR B CD1 1 
ATOM   2881  C  CD2 . TYR B  2  130 ? 64.197  -98.300  3.406   1.00 48.12  ? 141  TYR B CD2 1 
ATOM   2882  C  CE1 . TYR B  2  130 ? 63.894  -101.053 3.264   1.00 49.96  ? 141  TYR B CE1 1 
ATOM   2883  C  CE2 . TYR B  2  130 ? 64.354  -98.952  2.180   1.00 48.73  ? 141  TYR B CE2 1 
ATOM   2884  C  CZ  . TYR B  2  130 ? 64.198  -100.327 2.114   1.00 50.20  ? 141  TYR B CZ  1 
ATOM   2885  O  OH  . TYR B  2  130 ? 64.344  -100.992 0.909   1.00 50.90  ? 141  TYR B OH  1 
ATOM   2886  N  N   . ASP B  2  131 ? 60.766  -99.426  4.967   1.00 47.07  ? 142  ASP B N   1 
ATOM   2887  C  CA  . ASP B  2  131 ? 60.192  -100.735 4.645   1.00 47.67  ? 142  ASP B CA  1 
ATOM   2888  C  C   . ASP B  2  131 ? 60.213  -100.992 3.134   1.00 48.18  ? 142  ASP B C   1 
ATOM   2889  O  O   . ASP B  2  131 ? 60.436  -100.077 2.348   1.00 48.14  ? 142  ASP B O   1 
ATOM   2890  C  CB  . ASP B  2  131 ? 58.784  -100.901 5.243   1.00 47.77  ? 142  ASP B CB  1 
ATOM   2891  C  CG  . ASP B  2  131 ? 57.772  -99.925  4.673   1.00 47.82  ? 142  ASP B CG  1 
ATOM   2892  O  OD1 . ASP B  2  131 ? 57.668  -99.794  3.436   1.00 47.62  ? 142  ASP B OD1 1 
ATOM   2893  O  OD2 . ASP B  2  131 ? 57.048  -99.304  5.475   1.00 49.59  ? 142  ASP B OD2 1 
ATOM   2894  N  N   . ASP B  2  132 ? 59.967  -102.240 2.743   1.00 48.96  ? 143  ASP B N   1 
ATOM   2895  C  CA  . ASP B  2  132 ? 60.076  -102.685 1.349   1.00 49.71  ? 143  ASP B CA  1 
ATOM   2896  C  C   . ASP B  2  132 ? 58.959  -102.153 0.455   1.00 49.29  ? 143  ASP B C   1 
ATOM   2897  O  O   . ASP B  2  132 ? 58.975  -102.396 -0.758  1.00 49.89  ? 143  ASP B O   1 
ATOM   2898  C  CB  . ASP B  2  132 ? 60.032  -104.208 1.294   1.00 50.18  ? 143  ASP B CB  1 
ATOM   2899  C  CG  . ASP B  2  132 ? 58.775  -104.753 1.944   1.00 53.36  ? 143  ASP B CG  1 
ATOM   2900  O  OD1 . ASP B  2  132 ? 58.742  -104.764 3.198   1.00 57.15  ? 143  ASP B OD1 1 
ATOM   2901  O  OD2 . ASP B  2  132 ? 57.808  -105.114 1.220   1.00 56.09  ? 143  ASP B OD2 1 
ATOM   2902  N  N   . ARG B  2  133 ? 57.977  -101.470 1.037   1.00 48.43  ? 144  ARG B N   1 
ATOM   2903  C  CA  . ARG B  2  133 ? 56.863  -100.941 0.243   1.00 47.77  ? 144  ARG B CA  1 
ATOM   2904  C  C   . ARG B  2  133 ? 57.099  -99.502  -0.226  1.00 47.39  ? 144  ARG B C   1 
ATOM   2905  O  O   . ARG B  2  133 ? 56.886  -99.198  -1.392  1.00 47.73  ? 144  ARG B O   1 
ATOM   2906  C  CB  . ARG B  2  133 ? 55.525  -101.040 0.988   1.00 47.51  ? 144  ARG B CB  1 
ATOM   2907  C  CG  . ARG B  2  133 ? 54.343  -100.611 0.133   1.00 47.49  ? 144  ARG B CG  1 
ATOM   2908  C  CD  . ARG B  2  133 ? 53.055  -100.475 0.912   1.00 47.94  ? 144  ARG B CD  1 
ATOM   2909  N  NE  . ARG B  2  133 ? 51.988  -100.004 0.037   1.00 48.96  ? 144  ARG B NE  1 
ATOM   2910  C  CZ  . ARG B  2  133 ? 50.711  -99.876  0.389   1.00 50.15  ? 144  ARG B CZ  1 
ATOM   2911  N  NH1 . ARG B  2  133 ? 50.315  -100.187 1.618   1.00 50.96  ? 144  ARG B NH1 1 
ATOM   2912  N  NH2 . ARG B  2  133 ? 49.820  -99.443  -0.499  1.00 50.25  ? 144  ARG B NH2 1 
ATOM   2913  N  N   . TYR B  2  134 A 57.526  -98.632  0.684   1.00 46.54  ? 144  TYR B N   1 
ATOM   2914  C  CA  . TYR B  2  134 A 57.659  -97.212  0.395   1.00 46.04  ? 144  TYR B CA  1 
ATOM   2915  C  C   . TYR B  2  134 A 59.071  -96.693  0.618   1.00 45.52  ? 144  TYR B C   1 
ATOM   2916  O  O   . TYR B  2  134 A 59.291  -95.486  0.578   1.00 45.59  ? 144  TYR B O   1 
ATOM   2917  C  CB  . TYR B  2  134 A 56.695  -96.389  1.268   1.00 46.21  ? 144  TYR B CB  1 
ATOM   2918  C  CG  . TYR B  2  134 A 55.243  -96.452  0.853   1.00 46.77  ? 144  TYR B CG  1 
ATOM   2919  C  CD1 . TYR B  2  134 A 54.840  -96.026  -0.410  1.00 47.10  ? 144  TYR B CD1 1 
ATOM   2920  C  CD2 . TYR B  2  134 A 54.268  -96.914  1.733   1.00 47.13  ? 144  TYR B CD2 1 
ATOM   2921  C  CE1 . TYR B  2  134 A 53.508  -96.074  -0.794  1.00 47.89  ? 144  TYR B CE1 1 
ATOM   2922  C  CE2 . TYR B  2  134 A 52.926  -96.964  1.361   1.00 48.39  ? 144  TYR B CE2 1 
ATOM   2923  C  CZ  . TYR B  2  134 A 52.554  -96.544  0.091   1.00 48.72  ? 144  TYR B CZ  1 
ATOM   2924  O  OH  . TYR B  2  134 A 51.227  -96.590  -0.300  1.00 50.12  ? 144  TYR B OH  1 
ATOM   2925  N  N   . GLY B  2  135 ? 60.022  -97.588  0.867   1.00 44.76  ? 145  GLY B N   1 
ATOM   2926  C  CA  . GLY B  2  135 ? 61.382  -97.173  1.203   1.00 44.07  ? 145  GLY B CA  1 
ATOM   2927  C  C   . GLY B  2  135 ? 61.404  -96.248  2.414   1.00 43.85  ? 145  GLY B C   1 
ATOM   2928  O  O   . GLY B  2  135 ? 60.624  -96.426  3.359   1.00 44.02  ? 145  GLY B O   1 
ATOM   2929  N  N   . TYR B  2  136 ? 62.281  -95.248  2.383   1.00 43.19  ? 146  TYR B N   1 
ATOM   2930  C  CA  . TYR B  2  136 ? 62.410  -94.311  3.491   1.00 42.55  ? 146  TYR B CA  1 
ATOM   2931  C  C   . TYR B  2  136 ? 61.190  -93.421  3.649   1.00 42.12  ? 146  TYR B C   1 
ATOM   2932  O  O   . TYR B  2  136 ? 60.615  -92.962  2.664   1.00 42.23  ? 146  TYR B O   1 
ATOM   2933  C  CB  . TYR B  2  136 ? 63.635  -93.453  3.306   1.00 42.54  ? 146  TYR B CB  1 
ATOM   2934  C  CG  . TYR B  2  136 ? 64.908  -94.240  3.289   1.00 43.41  ? 146  TYR B CG  1 
ATOM   2935  C  CD1 . TYR B  2  136 ? 65.438  -94.766  4.466   1.00 43.67  ? 146  TYR B CD1 1 
ATOM   2936  C  CD2 . TYR B  2  136 ? 65.591  -94.461  2.093   1.00 44.42  ? 146  TYR B CD2 1 
ATOM   2937  C  CE1 . TYR B  2  136 ? 66.620  -95.488  4.460   1.00 44.35  ? 146  TYR B CE1 1 
ATOM   2938  C  CE2 . TYR B  2  136 ? 66.774  -95.179  2.073   1.00 45.26  ? 146  TYR B CE2 1 
ATOM   2939  C  CZ  . TYR B  2  136 ? 67.285  -95.689  3.260   1.00 45.46  ? 146  TYR B CZ  1 
ATOM   2940  O  OH  . TYR B  2  136 ? 68.469  -96.392  3.240   1.00 45.91  ? 146  TYR B OH  1 
ATOM   2941  N  N   . GLN B  2  137 ? 60.807  -93.188  4.901   1.00 41.39  ? 147  GLN B N   1 
ATOM   2942  C  CA  . GLN B  2  137 ? 59.580  -92.473  5.228   1.00 40.98  ? 147  GLN B CA  1 
ATOM   2943  C  C   . GLN B  2  137 ? 59.759  -91.607  6.470   1.00 40.79  ? 147  GLN B C   1 
ATOM   2944  O  O   . GLN B  2  137 ? 60.504  -91.972  7.387   1.00 40.76  ? 147  GLN B O   1 
ATOM   2945  C  CB  . GLN B  2  137 ? 58.445  -93.454  5.492   1.00 40.77  ? 147  GLN B CB  1 
ATOM   2946  C  CG  . GLN B  2  137 ? 58.007  -94.239  4.300   1.00 41.34  ? 147  GLN B CG  1 
ATOM   2947  C  CD  . GLN B  2  137 ? 57.251  -95.485  4.691   1.00 41.58  ? 147  GLN B CD  1 
ATOM   2948  O  OE1 . GLN B  2  137 ? 56.043  -95.448  4.926   1.00 42.79  ? 147  GLN B OE1 1 
ATOM   2949  N  NE2 . GLN B  2  137 ? 57.957  -96.601  4.756   1.00 40.45  ? 147  GLN B NE2 1 
ATOM   2950  N  N   . LEU B  2  138 ? 59.055  -90.477  6.493   1.00 40.08  ? 148  LEU B N   1 
ATOM   2951  C  CA  . LEU B  2  138 ? 59.052  -89.596  7.644   1.00 39.66  ? 148  LEU B CA  1 
ATOM   2952  C  C   . LEU B  2  138 ? 57.604  -89.253  7.983   1.00 39.43  ? 148  LEU B C   1 
ATOM   2953  O  O   . LEU B  2  138 ? 56.827  -88.918  7.105   1.00 39.42  ? 148  LEU B O   1 
ATOM   2954  C  CB  . LEU B  2  138 ? 59.829  -88.337  7.291   1.00 39.70  ? 148  LEU B CB  1 
ATOM   2955  C  CG  . LEU B  2  138 ? 60.783  -87.629  8.242   1.00 39.56  ? 148  LEU B CG  1 
ATOM   2956  C  CD1 . LEU B  2  138 ? 61.672  -88.578  9.024   1.00 39.00  ? 148  LEU B CD1 1 
ATOM   2957  C  CD2 . LEU B  2  138 ? 61.622  -86.701  7.393   1.00 39.39  ? 148  LEU B CD2 1 
ATOM   2958  N  N   . TYR B  2  139 ? 57.223  -89.353  9.244   1.00 39.30  ? 149  TYR B N   1 
ATOM   2959  C  CA  . TYR B  2  139 ? 55.858  -89.004  9.623   1.00 39.38  ? 149  TYR B CA  1 
ATOM   2960  C  C   . TYR B  2  139 ? 55.850  -88.199  10.886  1.00 39.40  ? 149  TYR B C   1 
ATOM   2961  O  O   . TYR B  2  139 ? 56.830  -88.185  11.635  1.00 39.37  ? 149  TYR B O   1 
ATOM   2962  C  CB  . TYR B  2  139 ? 55.008  -90.238  9.888   1.00 39.37  ? 149  TYR B CB  1 
ATOM   2963  C  CG  . TYR B  2  139 ? 54.730  -91.116  8.705   1.00 39.96  ? 149  TYR B CG  1 
ATOM   2964  C  CD1 . TYR B  2  139 ? 53.620  -90.889  7.894   1.00 40.08  ? 149  TYR B CD1 1 
ATOM   2965  C  CD2 . TYR B  2  139 ? 55.557  -92.210  8.421   1.00 40.24  ? 149  TYR B CD2 1 
ATOM   2966  C  CE1 . TYR B  2  139 ? 53.348  -91.723  6.809   1.00 40.67  ? 149  TYR B CE1 1 
ATOM   2967  C  CE2 . TYR B  2  139 ? 55.299  -93.044  7.346   1.00 40.47  ? 149  TYR B CE2 1 
ATOM   2968  C  CZ  . TYR B  2  139 ? 54.192  -92.798  6.546   1.00 41.34  ? 149  TYR B CZ  1 
ATOM   2969  O  OH  . TYR B  2  139 ? 53.936  -93.625  5.479   1.00 42.89  ? 149  TYR B OH  1 
ATOM   2970  N  N   . THR B  2  140 ? 54.710  -87.578  11.143  1.00 39.40  ? 150  THR B N   1 
ATOM   2971  C  CA  . THR B  2  140 ? 54.554  -86.740  12.296  1.00 40.01  ? 150  THR B CA  1 
ATOM   2972  C  C   . THR B  2  140 ? 53.186  -87.005  12.902  1.00 40.27  ? 150  THR B C   1 
ATOM   2973  O  O   . THR B  2  140 ? 52.209  -87.180  12.180  1.00 40.68  ? 150  THR B O   1 
ATOM   2974  C  CB  . THR B  2  140 ? 54.773  -85.233  11.911  1.00 40.10  ? 150  THR B CB  1 
ATOM   2975  O  OG1 . THR B  2  140 ? 55.431  -84.551  12.980  1.00 40.85  ? 150  THR B OG1 1 
ATOM   2976  C  CG2 . THR B  2  140 ? 53.463  -84.501  11.547  1.00 40.23  ? 150  THR B CG2 1 
ATOM   2977  N  N   . SER B  2  141 ? 53.129  -87.066  14.225  1.00 40.64  ? 151  SER B N   1 
ATOM   2978  C  CA  . SER B  2  141 ? 51.867  -87.201  14.943  1.00 40.85  ? 151  SER B CA  1 
ATOM   2979  C  C   . SER B  2  141 ? 51.883  -86.273  16.142  1.00 41.32  ? 151  SER B C   1 
ATOM   2980  O  O   . SER B  2  141 ? 52.936  -86.039  16.750  1.00 41.39  ? 151  SER B O   1 
ATOM   2981  C  CB  . SER B  2  141 ? 51.630  -88.648  15.393  1.00 40.94  ? 151  SER B CB  1 
ATOM   2982  O  OG  . SER B  2  141 ? 52.530  -89.057  16.418  1.00 41.00  ? 151  SER B OG  1 
ATOM   2983  N  N   . ASN B  2  142 ? 50.716  -85.739  16.474  1.00 41.74  ? 152  ASN B N   1 
ATOM   2984  C  CA  . ASN B  2  142 ? 50.588  -84.803  17.578  1.00 42.42  ? 152  ASN B CA  1 
ATOM   2985  C  C   . ASN B  2  142 ? 49.398  -85.184  18.481  1.00 42.27  ? 152  ASN B C   1 
ATOM   2986  O  O   . ASN B  2  142 ? 48.654  -86.105  18.138  1.00 42.16  ? 152  ASN B O   1 
ATOM   2987  C  CB  . ASN B  2  142 ? 50.480  -83.371  17.027  1.00 42.80  ? 152  ASN B CB  1 
ATOM   2988  C  CG  . ASN B  2  142 ? 49.217  -83.141  16.213  1.00 44.11  ? 152  ASN B CG  1 
ATOM   2989  O  OD1 . ASN B  2  142 ? 48.091  -83.365  16.679  1.00 45.02  ? 152  ASN B OD1 1 
ATOM   2990  N  ND2 . ASN B  2  142 ? 49.399  -82.670  14.994  1.00 45.80  ? 152  ASN B ND2 1 
ATOM   2991  N  N   . PRO B  2  143 ? 49.208  -84.482  19.627  1.00 42.06  ? 153  PRO B N   1 
ATOM   2992  C  CA  . PRO B  2  143 ? 48.180  -84.884  20.604  1.00 42.12  ? 153  PRO B CA  1 
ATOM   2993  C  C   . PRO B  2  143 ? 46.765  -85.098  20.054  1.00 42.27  ? 153  PRO B C   1 
ATOM   2994  O  O   . PRO B  2  143 ? 45.959  -85.758  20.710  1.00 42.10  ? 153  PRO B O   1 
ATOM   2995  C  CB  . PRO B  2  143 ? 48.182  -83.726  21.609  1.00 41.82  ? 153  PRO B CB  1 
ATOM   2996  C  CG  . PRO B  2  143 ? 49.565  -83.235  21.575  1.00 41.71  ? 153  PRO B CG  1 
ATOM   2997  C  CD  . PRO B  2  143 ? 49.980  -83.331  20.123  1.00 42.03  ? 153  PRO B CD  1 
ATOM   2998  N  N   . SER B  2  144 ? 46.465  -84.549  18.878  1.00 42.52  ? 154  SER B N   1 
ATOM   2999  C  CA  . SER B  2  144 ? 45.139  -84.710  18.304  1.00 42.93  ? 154  SER B CA  1 
ATOM   3000  C  C   . SER B  2  144 ? 44.961  -86.116  17.749  1.00 43.07  ? 154  SER B C   1 
ATOM   3001  O  O   . SER B  2  144 ? 43.833  -86.612  17.674  1.00 43.53  ? 154  SER B O   1 
ATOM   3002  C  CB  . SER B  2  144 ? 44.862  -83.668  17.219  1.00 42.86  ? 154  SER B CB  1 
ATOM   3003  O  OG  . SER B  2  144 ? 45.680  -83.874  16.083  1.00 44.09  ? 154  SER B OG  1 
ATOM   3004  N  N   . GLY B  2  145 ? 46.074  -86.754  17.388  1.00 42.81  ? 155  GLY B N   1 
ATOM   3005  C  CA  . GLY B  2  145 ? 46.053  -88.051  16.731  1.00 42.62  ? 155  GLY B CA  1 
ATOM   3006  C  C   . GLY B  2  145 ? 46.056  -87.907  15.224  1.00 42.77  ? 155  GLY B C   1 
ATOM   3007  O  O   . GLY B  2  145 ? 45.877  -88.878  14.492  1.00 42.81  ? 155  GLY B O   1 
ATOM   3008  N  N   . ASN B  2  146 ? 46.235  -86.685  14.746  1.00 42.98  ? 156  ASN B N   1 
ATOM   3009  C  CA  . ASN B  2  146 ? 46.434  -86.478  13.323  1.00 43.27  ? 156  ASN B CA  1 
ATOM   3010  C  C   . ASN B  2  146 ? 47.873  -86.861  12.982  1.00 42.88  ? 156  ASN B C   1 
ATOM   3011  O  O   . ASN B  2  146 ? 48.761  -86.731  13.826  1.00 43.13  ? 156  ASN B O   1 
ATOM   3012  C  CB  . ASN B  2  146 ? 46.110  -85.031  12.924  1.00 43.46  ? 156  ASN B CB  1 
ATOM   3013  C  CG  . ASN B  2  146 ? 45.953  -84.859  11.412  1.00 45.84  ? 156  ASN B CG  1 
ATOM   3014  O  OD1 . ASN B  2  146 ? 46.216  -83.780  10.868  1.00 46.22  ? 156  ASN B OD1 1 
ATOM   3015  N  ND2 . ASN B  2  146 ? 45.542  -85.937  10.719  1.00 47.68  ? 156  ASN B ND2 1 
ATOM   3016  N  N   . TYR B  2  147 ? 48.100  -87.388  11.782  1.00 42.27  ? 157  TYR B N   1 
ATOM   3017  C  CA  . TYR B  2  147 ? 49.458  -87.709  11.340  1.00 41.95  ? 157  TYR B CA  1 
ATOM   3018  C  C   . TYR B  2  147 ? 49.608  -87.409  9.852   1.00 41.82  ? 157  TYR B C   1 
ATOM   3019  O  O   . TYR B  2  147 ? 48.652  -87.520  9.092   1.00 41.65  ? 157  TYR B O   1 
ATOM   3020  C  CB  . TYR B  2  147 ? 49.873  -89.159  11.695  1.00 41.89  ? 157  TYR B CB  1 
ATOM   3021  C  CG  . TYR B  2  147 ? 49.241  -90.241  10.839  1.00 42.62  ? 157  TYR B CG  1 
ATOM   3022  C  CD1 . TYR B  2  147 ? 49.849  -90.672  9.660   1.00 42.39  ? 157  TYR B CD1 1 
ATOM   3023  C  CD2 . TYR B  2  147 ? 48.032  -90.835  11.211  1.00 44.19  ? 157  TYR B CD2 1 
ATOM   3024  C  CE1 . TYR B  2  147 ? 49.265  -91.643  8.866   1.00 43.18  ? 157  TYR B CE1 1 
ATOM   3025  C  CE2 . TYR B  2  147 ? 47.441  -91.823  10.422  1.00 44.47  ? 157  TYR B CE2 1 
ATOM   3026  C  CZ  . TYR B  2  147 ? 48.062  -92.212  9.251   1.00 44.31  ? 157  TYR B CZ  1 
ATOM   3027  O  OH  . TYR B  2  147 ? 47.476  -93.178  8.469   1.00 45.98  ? 157  TYR B OH  1 
ATOM   3028  N  N   . THR B  2  148 ? 50.807  -87.013  9.447   1.00 41.76  ? 158  THR B N   1 
ATOM   3029  C  CA  . THR B  2  148 ? 51.074  -86.653  8.057   1.00 42.22  ? 158  THR B CA  1 
ATOM   3030  C  C   . THR B  2  148 ? 52.495  -87.079  7.688   1.00 42.07  ? 158  THR B C   1 
ATOM   3031  O  O   . THR B  2  148 ? 53.323  -87.313  8.566   1.00 42.06  ? 158  THR B O   1 
ATOM   3032  C  CB  . THR B  2  148 ? 50.878  -85.112  7.786   1.00 42.27  ? 158  THR B CB  1 
ATOM   3033  O  OG1 . THR B  2  148 ? 51.481  -84.351  8.834   1.00 43.22  ? 158  THR B OG1 1 
ATOM   3034  C  CG2 . THR B  2  148 ? 49.402  -84.722  7.726   1.00 42.65  ? 158  THR B CG2 1 
ATOM   3035  N  N   . GLY B  2  149 ? 52.757  -87.191  6.390   1.00 42.13  ? 159  GLY B N   1 
ATOM   3036  C  CA  . GLY B  2  149 ? 54.048  -87.626  5.874   1.00 42.16  ? 159  GLY B CA  1 
ATOM   3037  C  C   . GLY B  2  149 ? 54.791  -86.455  5.268   1.00 42.70  ? 159  GLY B C   1 
ATOM   3038  O  O   . GLY B  2  149 ? 54.180  -85.540  4.701   1.00 43.03  ? 159  GLY B O   1 
ATOM   3039  N  N   . TRP B  2  150 ? 56.113  -86.475  5.390   1.00 42.75  ? 160  TRP B N   1 
ATOM   3040  C  CA  . TRP B  2  150 ? 56.925  -85.314  5.057   1.00 42.90  ? 160  TRP B CA  1 
ATOM   3041  C  C   . TRP B  2  150 ? 58.267  -85.709  4.450   1.00 42.98  ? 160  TRP B C   1 
ATOM   3042  O  O   . TRP B  2  150 ? 58.765  -86.809  4.696   1.00 42.93  ? 160  TRP B O   1 
ATOM   3043  C  CB  . TRP B  2  150 ? 57.186  -84.495  6.314   1.00 42.84  ? 160  TRP B CB  1 
ATOM   3044  C  CG  . TRP B  2  150 ? 55.969  -84.045  7.034   1.00 43.00  ? 160  TRP B CG  1 
ATOM   3045  C  CD1 . TRP B  2  150 ? 55.320  -84.703  8.033   1.00 42.60  ? 160  TRP B CD1 1 
ATOM   3046  C  CD2 . TRP B  2  150 ? 55.265  -82.818  6.836   1.00 43.28  ? 160  TRP B CD2 1 
ATOM   3047  N  NE1 . TRP B  2  150 ? 54.244  -83.977  8.461   1.00 42.34  ? 160  TRP B NE1 1 
ATOM   3048  C  CE2 . TRP B  2  150 ? 54.186  -82.809  7.746   1.00 43.63  ? 160  TRP B CE2 1 
ATOM   3049  C  CE3 . TRP B  2  150 ? 55.443  -81.721  5.985   1.00 43.65  ? 160  TRP B CE3 1 
ATOM   3050  C  CZ2 . TRP B  2  150 ? 53.279  -81.741  7.829   1.00 44.29  ? 160  TRP B CZ2 1 
ATOM   3051  C  CZ3 . TRP B  2  150 ? 54.541  -80.665  6.060   1.00 44.77  ? 160  TRP B CZ3 1 
ATOM   3052  C  CH2 . TRP B  2  150 ? 53.470  -80.683  6.981   1.00 44.74  ? 160  TRP B CH2 1 
ATOM   3053  N  N   . LYS B  2  151 ? 58.844  -84.799  3.662   1.00 42.99  ? 161  LYS B N   1 
ATOM   3054  C  CA  . LYS B  2  151 ? 60.216  -84.943  3.158   1.00 42.96  ? 161  LYS B CA  1 
ATOM   3055  C  C   . LYS B  2  151 ? 61.189  -84.308  4.148   1.00 42.56  ? 161  LYS B C   1 
ATOM   3056  O  O   . LYS B  2  151 ? 62.326  -84.773  4.291   1.00 42.88  ? 161  LYS B O   1 
ATOM   3057  C  CB  . LYS B  2  151 ? 60.380  -84.310  1.775   1.00 43.11  ? 161  LYS B CB  1 
ATOM   3058  C  CG  . LYS B  2  151 ? 59.330  -84.737  0.741   1.00 45.25  ? 161  LYS B CG  1 
ATOM   3059  C  CD  . LYS B  2  151 ? 59.697  -84.252  -0.660  1.00 48.94  ? 161  LYS B CD  1 
ATOM   3060  C  CE  . LYS B  2  151 ? 58.451  -83.930  -1.475  1.00 51.22  ? 161  LYS B CE  1 
ATOM   3061  N  NZ  . LYS B  2  151 ? 58.724  -82.862  -2.493  1.00 52.28  ? 161  LYS B NZ  1 
ATOM   3062  N  N   . ALA B  2  152 ? 60.736  -83.240  4.817   1.00 41.92  ? 162  ALA B N   1 
ATOM   3063  C  CA  . ALA B  2  152 ? 61.435  -82.650  5.973   1.00 41.24  ? 162  ALA B CA  1 
ATOM   3064  C  C   . ALA B  2  152 ? 60.440  -81.992  6.942   1.00 40.57  ? 162  ALA B C   1 
ATOM   3065  O  O   . ALA B  2  152 ? 59.456  -81.404  6.517   1.00 40.82  ? 162  ALA B O   1 
ATOM   3066  C  CB  . ALA B  2  152 ? 62.489  -81.670  5.521   1.00 40.87  ? 162  ALA B CB  1 
ATOM   3067  N  N   . ILE B  2  153 ? 60.677  -82.105  8.241   1.00 39.69  ? 163  ILE B N   1 
ATOM   3068  C  CA  . ILE B  2  153 ? 59.719  -81.581  9.211   1.00 39.31  ? 163  ILE B CA  1 
ATOM   3069  C  C   . ILE B  2  153 ? 60.415  -81.301  10.536  1.00 38.91  ? 163  ILE B C   1 
ATOM   3070  O  O   . ILE B  2  153 ? 61.526  -81.770  10.777  1.00 39.04  ? 163  ILE B O   1 
ATOM   3071  C  CB  . ILE B  2  153 ? 58.484  -82.552  9.388   1.00 39.56  ? 163  ILE B CB  1 
ATOM   3072  C  CG1 . ILE B  2  153 ? 57.370  -81.948  10.257  1.00 39.43  ? 163  ILE B CG1 1 
ATOM   3073  C  CG2 . ILE B  2  153 ? 58.913  -83.897  9.982   1.00 39.73  ? 163  ILE B CG2 1 
ATOM   3074  C  CD1 . ILE B  2  153 ? 56.504  -80.889  9.593   1.00 39.86  ? 163  ILE B CD1 1 
ATOM   3075  N  N   . SER B  2  154 ? 59.755  -80.526  11.383  1.00 38.73  ? 164  SER B N   1 
ATOM   3076  C  CA  . SER B  2  154 ? 60.249  -80.199  12.709  1.00 38.67  ? 164  SER B CA  1 
ATOM   3077  C  C   . SER B  2  154 ? 59.080  -80.178  13.682  1.00 38.71  ? 164  SER B C   1 
ATOM   3078  O  O   . SER B  2  154 ? 57.927  -79.991  13.273  1.00 38.41  ? 164  SER B O   1 
ATOM   3079  C  CB  . SER B  2  154 ? 60.882  -78.820  12.686  1.00 38.69  ? 164  SER B CB  1 
ATOM   3080  O  OG  . SER B  2  154 ? 59.902  -77.853  12.326  1.00 39.70  ? 164  SER B OG  1 
ATOM   3081  N  N   . VAL B  2  155 ? 59.376  -80.367  14.967  1.00 38.91  ? 165  VAL B N   1 
ATOM   3082  C  CA  . VAL B  2  155 ? 58.361  -80.259  16.023  1.00 39.23  ? 165  VAL B CA  1 
ATOM   3083  C  C   . VAL B  2  155 ? 58.973  -79.573  17.236  1.00 40.04  ? 165  VAL B C   1 
ATOM   3084  O  O   . VAL B  2  155 ? 60.193  -79.441  17.317  1.00 39.82  ? 165  VAL B O   1 
ATOM   3085  C  CB  . VAL B  2  155 ? 57.742  -81.638  16.445  1.00 39.08  ? 165  VAL B CB  1 
ATOM   3086  C  CG1 . VAL B  2  155 ? 56.893  -82.244  15.313  1.00 38.84  ? 165  VAL B CG1 1 
ATOM   3087  C  CG2 . VAL B  2  155 ? 58.815  -82.609  16.936  1.00 38.07  ? 165  VAL B CG2 1 
ATOM   3088  N  N   . GLY B  2  156 ? 58.125  -79.158  18.177  1.00 40.94  ? 166  GLY B N   1 
ATOM   3089  C  CA  . GLY B  2  156 ? 58.576  -78.426  19.349  1.00 42.35  ? 166  GLY B CA  1 
ATOM   3090  C  C   . GLY B  2  156 ? 58.686  -76.936  19.068  1.00 43.53  ? 166  GLY B C   1 
ATOM   3091  O  O   . GLY B  2  156 ? 57.917  -76.390  18.260  1.00 43.86  ? 166  GLY B O   1 
ATOM   3092  N  N   . ALA B  2  157 ? 59.641  -76.281  19.728  1.00 44.30  ? 167  ALA B N   1 
ATOM   3093  C  CA  . ALA B  2  157 ? 59.836  -74.835  19.588  1.00 45.65  ? 167  ALA B CA  1 
ATOM   3094  C  C   . ALA B  2  157 ? 60.247  -74.413  18.171  1.00 46.68  ? 167  ALA B C   1 
ATOM   3095  O  O   . ALA B  2  157 ? 60.912  -75.168  17.439  1.00 46.51  ? 167  ALA B O   1 
ATOM   3096  C  CB  . ALA B  2  157 ? 60.858  -74.332  20.604  1.00 45.39  ? 167  ALA B CB  1 
ATOM   3097  N  N   . ASN B  2  158 ? 59.821  -73.209  17.785  1.00 47.68  ? 168  ASN B N   1 
ATOM   3098  C  CA  . ASN B  2  158 ? 60.317  -72.568  16.560  1.00 48.55  ? 168  ASN B CA  1 
ATOM   3099  C  C   . ASN B  2  158 ? 60.079  -73.385  15.277  1.00 48.87  ? 168  ASN B C   1 
ATOM   3100  O  O   . ASN B  2  158 ? 60.888  -73.367  14.353  1.00 48.78  ? 168  ASN B O   1 
ATOM   3101  C  CB  . ASN B  2  158 ? 61.808  -72.198  16.729  1.00 48.42  ? 168  ASN B CB  1 
ATOM   3102  C  CG  . ASN B  2  158 ? 62.086  -71.449  18.040  1.00 48.84  ? 168  ASN B CG  1 
ATOM   3103  O  OD1 . ASN B  2  158 ? 61.320  -70.575  18.445  1.00 49.77  ? 168  ASN B OD1 1 
ATOM   3104  N  ND2 . ASN B  2  158 ? 63.181  -71.798  18.705  1.00 48.77  ? 168  ASN B ND2 1 
ATOM   3105  N  N   . THR B  2  159 ? 58.959  -74.093  15.228  1.00 49.71  ? 169  THR B N   1 
ATOM   3106  C  CA  . THR B  2  159 ? 58.632  -74.932  14.076  1.00 50.79  ? 169  THR B CA  1 
ATOM   3107  C  C   . THR B  2  159 ? 58.485  -74.085  12.831  1.00 51.16  ? 169  THR B C   1 
ATOM   3108  O  O   . THR B  2  159 ? 58.966  -74.458  11.766  1.00 51.63  ? 169  THR B O   1 
ATOM   3109  C  CB  . THR B  2  159 ? 57.321  -75.729  14.277  1.00 50.91  ? 169  THR B CB  1 
ATOM   3110  O  OG1 . THR B  2  159 ? 56.299  -74.852  14.772  1.00 51.47  ? 169  THR B OG1 1 
ATOM   3111  C  CG2 . THR B  2  159 ? 57.526  -76.861  15.257  1.00 50.77  ? 169  THR B CG2 1 
ATOM   3112  N  N   . SER B  2  160 ? 57.817  -72.946  12.988  1.00 51.73  ? 170  SER B N   1 
ATOM   3113  C  CA  . SER B  2  160 ? 57.594  -71.971  11.920  1.00 52.00  ? 170  SER B CA  1 
ATOM   3114  C  C   . SER B  2  160 ? 58.912  -71.476  11.297  1.00 51.78  ? 170  SER B C   1 
ATOM   3115  O  O   . SER B  2  160 ? 59.071  -71.454  10.068  1.00 51.54  ? 170  SER B O   1 
ATOM   3116  C  CB  . SER B  2  160 ? 56.793  -70.792  12.489  1.00 52.13  ? 170  SER B CB  1 
ATOM   3117  O  OG  . SER B  2  160 ? 56.480  -69.845  11.483  1.00 53.75  ? 170  SER B OG  1 
ATOM   3118  N  N   . ALA B  2  161 ? 59.850  -71.089  12.159  1.00 51.56  ? 171  ALA B N   1 
ATOM   3119  C  CA  . ALA B  2  161 ? 61.172  -70.654  11.729  1.00 51.46  ? 171  ALA B CA  1 
ATOM   3120  C  C   . ALA B  2  161 ? 61.915  -71.773  11.002  1.00 51.49  ? 171  ALA B C   1 
ATOM   3121  O  O   . ALA B  2  161 ? 62.437  -71.567  9.903   1.00 51.59  ? 171  ALA B O   1 
ATOM   3122  C  CB  . ALA B  2  161 ? 61.977  -70.156  12.920  1.00 51.41  ? 171  ALA B CB  1 
ATOM   3123  N  N   . ALA B  2  162 ? 61.946  -72.959  11.610  1.00 51.48  ? 172  ALA B N   1 
ATOM   3124  C  CA  . ALA B  2  162 ? 62.650  -74.111  11.037  1.00 51.54  ? 172  ALA B CA  1 
ATOM   3125  C  C   . ALA B  2  162 ? 61.978  -74.635  9.774   1.00 51.65  ? 172  ALA B C   1 
ATOM   3126  O  O   . ALA B  2  162 ? 62.641  -75.119  8.865   1.00 51.19  ? 172  ALA B O   1 
ATOM   3127  C  CB  . ALA B  2  162 ? 62.777  -75.214  12.062  1.00 51.44  ? 172  ALA B CB  1 
ATOM   3128  N  N   . GLN B  2  163 ? 60.657  -74.531  9.720   1.00 52.16  ? 173  GLN B N   1 
ATOM   3129  C  CA  . GLN B  2  163 ? 59.914  -75.002  8.561   1.00 53.09  ? 173  GLN B CA  1 
ATOM   3130  C  C   . GLN B  2  163 ? 60.259  -74.205  7.310   1.00 53.43  ? 173  GLN B C   1 
ATOM   3131  O  O   . GLN B  2  163 ? 60.439  -74.780  6.238   1.00 53.35  ? 173  GLN B O   1 
ATOM   3132  C  CB  . GLN B  2  163 ? 58.403  -74.975  8.826   1.00 53.13  ? 173  GLN B CB  1 
ATOM   3133  C  CG  . GLN B  2  163 ? 57.626  -76.020  8.051   1.00 53.92  ? 173  GLN B CG  1 
ATOM   3134  C  CD  . GLN B  2  163 ? 58.222  -77.413  8.185   1.00 55.35  ? 173  GLN B CD  1 
ATOM   3135  O  OE1 . GLN B  2  163 ? 58.729  -77.805  9.250   1.00 55.80  ? 173  GLN B OE1 1 
ATOM   3136  N  NE2 . GLN B  2  163 ? 58.170  -78.173  7.094   1.00 56.14  ? 173  GLN B NE2 1 
ATOM   3137  N  N   . THR B  2  164 ? 60.358  -72.884  7.472   1.00 54.05  ? 174  THR B N   1 
ATOM   3138  C  CA  . THR B  2  164 ? 60.707  -71.965  6.390   1.00 54.78  ? 174  THR B CA  1 
ATOM   3139  C  C   . THR B  2  164 ? 62.143  -72.195  5.892   1.00 54.77  ? 174  THR B C   1 
ATOM   3140  O  O   . THR B  2  164 ? 62.389  -72.173  4.680   1.00 54.61  ? 174  THR B O   1 
ATOM   3141  C  CB  . THR B  2  164 ? 60.499  -70.486  6.815   1.00 54.95  ? 174  THR B CB  1 
ATOM   3142  O  OG1 . THR B  2  164 ? 59.205  -70.336  7.413   1.00 56.30  ? 174  THR B OG1 1 
ATOM   3143  C  CG2 . THR B  2  164 ? 60.573  -69.564  5.620   1.00 55.39  ? 174  THR B CG2 1 
ATOM   3144  N  N   . LEU B  2  165 ? 63.073  -72.425  6.823   1.00 54.86  ? 175  LEU B N   1 
ATOM   3145  C  CA  . LEU B  2  165 ? 64.476  -72.707  6.480   1.00 55.38  ? 175  LEU B CA  1 
ATOM   3146  C  C   . LEU B  2  165 ? 64.656  -74.014  5.700   1.00 55.86  ? 175  LEU B C   1 
ATOM   3147  O  O   . LEU B  2  165 ? 65.464  -74.083  4.762   1.00 56.26  ? 175  LEU B O   1 
ATOM   3148  C  CB  . LEU B  2  165 ? 65.361  -72.715  7.731   1.00 55.07  ? 175  LEU B CB  1 
ATOM   3149  C  CG  . LEU B  2  165 ? 65.510  -71.376  8.466   1.00 55.44  ? 175  LEU B CG  1 
ATOM   3150  C  CD1 . LEU B  2  165 ? 65.915  -71.566  9.920   1.00 55.70  ? 175  LEU B CD1 1 
ATOM   3151  C  CD2 . LEU B  2  165 ? 66.502  -70.470  7.755   1.00 54.99  ? 175  LEU B CD2 1 
ATOM   3152  N  N   . LEU B  2  166 ? 63.901  -75.040  6.093   1.00 56.19  ? 176  LEU B N   1 
ATOM   3153  C  CA  . LEU B  2  166 ? 63.952  -76.343  5.451   1.00 56.39  ? 176  LEU B CA  1 
ATOM   3154  C  C   . LEU B  2  166 ? 63.332  -76.241  4.077   1.00 57.09  ? 176  LEU B C   1 
ATOM   3155  O  O   . LEU B  2  166 ? 63.834  -76.831  3.121   1.00 57.16  ? 176  LEU B O   1 
ATOM   3156  C  CB  . LEU B  2  166 ? 63.210  -77.397  6.283   1.00 56.06  ? 176  LEU B CB  1 
ATOM   3157  C  CG  . LEU B  2  166 ? 63.776  -77.821  7.641   1.00 54.53  ? 176  LEU B CG  1 
ATOM   3158  C  CD1 . LEU B  2  166 ? 62.692  -78.494  8.471   1.00 53.01  ? 176  LEU B CD1 1 
ATOM   3159  C  CD2 . LEU B  2  166 ? 64.994  -78.718  7.488   1.00 52.59  ? 176  LEU B CD2 1 
ATOM   3160  N  N   . GLN B  2  167 ? 62.246  -75.483  3.980   1.00 58.04  ? 177  GLN B N   1 
ATOM   3161  C  CA  . GLN B  2  167 ? 61.559  -75.287  2.710   1.00 59.51  ? 177  GLN B CA  1 
ATOM   3162  C  C   . GLN B  2  167 ? 62.493  -74.638  1.691   1.00 60.18  ? 177  GLN B C   1 
ATOM   3163  O  O   . GLN B  2  167 ? 62.582  -75.073  0.542   1.00 60.17  ? 177  GLN B O   1 
ATOM   3164  C  CB  . GLN B  2  167 ? 60.305  -74.446  2.909   1.00 59.49  ? 177  GLN B CB  1 
ATOM   3165  C  CG  . GLN B  2  167 ? 59.368  -74.472  1.728   1.00 61.39  ? 177  GLN B CG  1 
ATOM   3166  C  CD  . GLN B  2  167 ? 57.922  -74.238  2.125   1.00 64.64  ? 177  GLN B CD  1 
ATOM   3167  O  OE1 . GLN B  2  167 ? 57.050  -74.103  1.256   1.00 66.08  ? 177  GLN B OE1 1 
ATOM   3168  N  NE2 . GLN B  2  167 ? 57.650  -74.198  3.441   1.00 64.32  ? 177  GLN B NE2 1 
ATOM   3169  N  N   . MET B  2  168 ? 63.201  -73.609  2.146   1.00 61.31  ? 178  MET B N   1 
ATOM   3170  C  CA  . MET B  2  168 ? 64.208  -72.927  1.364   1.00 62.39  ? 178  MET B CA  1 
ATOM   3171  C  C   . MET B  2  168 ? 65.260  -73.892  0.804   1.00 63.11  ? 178  MET B C   1 
ATOM   3172  O  O   . MET B  2  168 ? 65.333  -74.069  -0.399  1.00 63.22  ? 178  MET B O   1 
ATOM   3173  C  CB  . MET B  2  168 ? 64.844  -71.838  2.224   1.00 62.57  ? 178  MET B CB  1 
ATOM   3174  C  CG  . MET B  2  168 ? 65.873  -70.945  1.531   1.00 63.46  ? 178  MET B CG  1 
ATOM   3175  S  SD  . MET B  2  168 ? 66.350  -69.571  2.612   1.00 65.57  ? 178  MET B SD  1 
ATOM   3176  C  CE  . MET B  2  168 ? 64.803  -68.640  2.629   1.00 64.52  ? 178  MET B CE  1 
ATOM   3177  N  N   . ASP B  2  169 ? 66.038  -74.544  1.667   1.00 64.33  ? 179  ASP B N   1 
ATOM   3178  C  CA  . ASP B  2  169 ? 67.228  -75.312  1.224   1.00 65.59  ? 179  ASP B CA  1 
ATOM   3179  C  C   . ASP B  2  169 ? 67.079  -76.812  0.883   1.00 66.13  ? 179  ASP B C   1 
ATOM   3180  O  O   . ASP B  2  169 ? 68.060  -77.446  0.470   1.00 66.11  ? 179  ASP B O   1 
ATOM   3181  C  CB  . ASP B  2  169 ? 68.382  -75.140  2.229   1.00 65.85  ? 179  ASP B CB  1 
ATOM   3182  C  CG  . ASP B  2  169 ? 69.064  -73.779  2.123   1.00 66.60  ? 179  ASP B CG  1 
ATOM   3183  O  OD1 . ASP B  2  169 ? 69.028  -73.148  1.038   1.00 66.61  ? 179  ASP B OD1 1 
ATOM   3184  O  OD2 . ASP B  2  169 ? 69.649  -73.347  3.139   1.00 67.72  ? 179  ASP B OD2 1 
ATOM   3185  N  N   . TYR B  2  170 ? 65.885  -77.379  1.060   1.00 66.92  ? 180  TYR B N   1 
ATOM   3186  C  CA  . TYR B  2  170 ? 65.671  -78.797  0.759   1.00 67.75  ? 180  TYR B CA  1 
ATOM   3187  C  C   . TYR B  2  170 ? 65.565  -79.038  -0.739  1.00 68.61  ? 180  TYR B C   1 
ATOM   3188  O  O   . TYR B  2  170 ? 64.873  -78.300  -1.430  1.00 68.84  ? 180  TYR B O   1 
ATOM   3189  C  CB  . TYR B  2  170 ? 64.409  -79.329  1.451   1.00 67.48  ? 180  TYR B CB  1 
ATOM   3190  C  CG  . TYR B  2  170 ? 64.160  -80.798  1.191   1.00 66.65  ? 180  TYR B CG  1 
ATOM   3191  C  CD1 . TYR B  2  170 ? 64.908  -81.768  1.846   1.00 65.86  ? 180  TYR B CD1 1 
ATOM   3192  C  CD2 . TYR B  2  170 ? 63.188  -81.220  0.280   1.00 66.09  ? 180  TYR B CD2 1 
ATOM   3193  C  CE1 . TYR B  2  170 ? 64.703  -83.126  1.608   1.00 65.62  ? 180  TYR B CE1 1 
ATOM   3194  C  CE2 . TYR B  2  170 ? 62.973  -82.583  0.035   1.00 65.21  ? 180  TYR B CE2 1 
ATOM   3195  C  CZ  . TYR B  2  170 ? 63.739  -83.527  0.708   1.00 64.90  ? 180  TYR B CZ  1 
ATOM   3196  O  OH  . TYR B  2  170 ? 63.555  -84.873  0.500   1.00 63.92  ? 180  TYR B OH  1 
ATOM   3197  N  N   . LYS B  2  171 ? 66.238  -80.069  -1.241  1.00 69.81  ? 181  LYS B N   1 
ATOM   3198  C  CA  . LYS B  2  171 ? 66.031  -80.476  -2.634  1.00 71.16  ? 181  LYS B CA  1 
ATOM   3199  C  C   . LYS B  2  171 ? 65.934  -81.997  -2.837  1.00 71.63  ? 181  LYS B C   1 
ATOM   3200  O  O   . LYS B  2  171 ? 66.822  -82.749  -2.435  1.00 71.62  ? 181  LYS B O   1 
ATOM   3201  C  CB  . LYS B  2  171 ? 67.046  -79.815  -3.584  1.00 71.49  ? 181  LYS B CB  1 
ATOM   3202  C  CG  . LYS B  2  171 ? 68.526  -80.126  -3.330  1.00 73.15  ? 181  LYS B CG  1 
ATOM   3203  C  CD  . LYS B  2  171 ? 69.416  -79.362  -4.340  1.00 75.53  ? 181  LYS B CD  1 
ATOM   3204  C  CE  . LYS B  2  171 ? 70.562  -80.251  -4.898  1.00 76.36  ? 181  LYS B CE  1 
ATOM   3205  N  NZ  . LYS B  2  171 ? 71.571  -80.673  -3.852  1.00 76.53  ? 181  LYS B NZ  1 
ATOM   3206  N  N   . ASP B  2  172 ? 64.838  -82.420  -3.475  1.00 72.13  ? 182  ASP B N   1 
ATOM   3207  C  CA  . ASP B  2  172 ? 64.482  -83.836  -3.676  1.00 72.45  ? 182  ASP B CA  1 
ATOM   3208  C  C   . ASP B  2  172 ? 65.647  -84.800  -3.883  1.00 72.68  ? 182  ASP B C   1 
ATOM   3209  O  O   . ASP B  2  172 ? 65.705  -85.846  -3.242  1.00 72.82  ? 182  ASP B O   1 
ATOM   3210  C  CB  . ASP B  2  172 ? 63.486  -83.986  -4.833  1.00 72.49  ? 182  ASP B CB  1 
ATOM   3211  C  CG  . ASP B  2  172 ? 62.078  -83.521  -4.468  1.00 73.22  ? 182  ASP B CG  1 
ATOM   3212  O  OD1 . ASP B  2  172 ? 61.379  -83.015  -5.368  1.00 73.77  ? 182  ASP B OD1 1 
ATOM   3213  O  OD2 . ASP B  2  172 ? 61.658  -83.664  -3.294  1.00 74.15  ? 182  ASP B OD2 1 
ATOM   3214  N  N   . ASP B  2  173 ? 66.571  -84.449  -4.771  1.00 72.96  ? 183  ASP B N   1 
ATOM   3215  C  CA  . ASP B  2  173 ? 67.669  -85.350  -5.111  1.00 73.20  ? 183  ASP B CA  1 
ATOM   3216  C  C   . ASP B  2  173 ? 68.817  -85.310  -4.096  1.00 72.85  ? 183  ASP B C   1 
ATOM   3217  O  O   . ASP B  2  173 ? 69.939  -85.708  -4.406  1.00 72.95  ? 183  ASP B O   1 
ATOM   3218  C  CB  . ASP B  2  173 ? 68.168  -85.099  -6.549  1.00 73.57  ? 183  ASP B CB  1 
ATOM   3219  C  CG  . ASP B  2  173 ? 68.634  -83.655  -6.781  1.00 74.85  ? 183  ASP B CG  1 
ATOM   3220  O  OD1 . ASP B  2  173 ? 69.855  -83.446  -6.967  1.00 76.16  ? 183  ASP B OD1 1 
ATOM   3221  O  OD2 . ASP B  2  173 ? 67.789  -82.730  -6.786  1.00 75.73  ? 183  ASP B OD2 1 
ATOM   3222  N  N   . MET B  2  174 ? 68.528  -84.849  -2.882  1.00 72.54  ? 184  MET B N   1 
ATOM   3223  C  CA  . MET B  2  174 ? 69.531  -84.776  -1.819  1.00 72.38  ? 184  MET B CA  1 
ATOM   3224  C  C   . MET B  2  174 ? 70.135  -86.125  -1.471  1.00 72.13  ? 184  MET B C   1 
ATOM   3225  O  O   . MET B  2  174 ? 69.539  -87.178  -1.696  1.00 72.36  ? 184  MET B O   1 
ATOM   3226  C  CB  . MET B  2  174 ? 68.937  -84.200  -0.537  1.00 72.55  ? 184  MET B CB  1 
ATOM   3227  C  CG  . MET B  2  174 ? 68.765  -82.702  -0.511  1.00 73.31  ? 184  MET B CG  1 
ATOM   3228  S  SD  . MET B  2  174 ? 68.209  -82.159  1.119   1.00 74.84  ? 184  MET B SD  1 
ATOM   3229  C  CE  . MET B  2  174 ? 69.792  -81.927  1.928   1.00 74.93  ? 184  MET B CE  1 
ATOM   3230  N  N   . LYS B  2  175 ? 71.328  -86.066  -0.906  1.00 71.74  ? 185  LYS B N   1 
ATOM   3231  C  CA  . LYS B  2  175 ? 71.990  -87.215  -0.341  1.00 71.48  ? 185  LYS B CA  1 
ATOM   3232  C  C   . LYS B  2  175 ? 71.971  -87.007  1.177   1.00 70.98  ? 185  LYS B C   1 
ATOM   3233  O  O   . LYS B  2  175 ? 71.871  -85.872  1.658   1.00 71.01  ? 185  LYS B O   1 
ATOM   3234  C  CB  . LYS B  2  175 ? 73.421  -87.283  -0.896  1.00 71.85  ? 185  LYS B CB  1 
ATOM   3235  C  CG  . LYS B  2  175 ? 74.204  -88.565  -0.624  1.00 73.45  ? 185  LYS B CG  1 
ATOM   3236  C  CD  . LYS B  2  175 ? 74.843  -88.552  0.775   1.00 75.81  ? 185  LYS B CD  1 
ATOM   3237  C  CE  . LYS B  2  175 ? 75.821  -89.698  0.994   1.00 76.66  ? 185  LYS B CE  1 
ATOM   3238  N  NZ  . LYS B  2  175 ? 77.195  -89.296  0.585   1.00 77.44  ? 185  LYS B NZ  1 
ATOM   3239  N  N   . VAL B  2  176 ? 72.061  -88.105  1.923   1.00 70.29  ? 186  VAL B N   1 
ATOM   3240  C  CA  . VAL B  2  176 ? 72.048  -88.089  3.392   1.00 69.54  ? 186  VAL B CA  1 
ATOM   3241  C  C   . VAL B  2  176 ? 73.066  -87.136  4.028   1.00 69.04  ? 186  VAL B C   1 
ATOM   3242  O  O   . VAL B  2  176 ? 72.709  -86.366  4.920   1.00 68.83  ? 186  VAL B O   1 
ATOM   3243  C  CB  . VAL B  2  176 ? 72.238  -89.518  3.971   1.00 69.63  ? 186  VAL B CB  1 
ATOM   3244  C  CG1 . VAL B  2  176 ? 72.209  -89.504  5.488   1.00 69.41  ? 186  VAL B CG1 1 
ATOM   3245  C  CG2 . VAL B  2  176 ? 71.168  -90.434  3.452   1.00 69.32  ? 186  VAL B CG2 1 
ATOM   3246  N  N   . ASP B  2  177 ? 74.321  -87.189  3.580   1.00 68.45  ? 187  ASP B N   1 
ATOM   3247  C  CA  . ASP B  2  177 ? 75.371  -86.315  4.116   1.00 68.06  ? 187  ASP B CA  1 
ATOM   3248  C  C   . ASP B  2  177 ? 74.975  -84.847  4.053   1.00 67.36  ? 187  ASP B C   1 
ATOM   3249  O  O   . ASP B  2  177 ? 75.253  -84.078  4.981   1.00 67.24  ? 187  ASP B O   1 
ATOM   3250  C  CB  . ASP B  2  177 ? 76.686  -86.525  3.374   1.00 68.37  ? 187  ASP B CB  1 
ATOM   3251  C  CG  . ASP B  2  177 ? 77.469  -87.711  3.904   1.00 69.91  ? 187  ASP B CG  1 
ATOM   3252  O  OD1 . ASP B  2  177 ? 76.907  -88.829  3.976   1.00 70.39  ? 187  ASP B OD1 1 
ATOM   3253  O  OD2 . ASP B  2  177 ? 78.659  -87.522  4.243   1.00 71.70  ? 187  ASP B OD2 1 
ATOM   3254  N  N   . ASP B  2  178 ? 74.312  -84.482  2.956   1.00 66.39  ? 188  ASP B N   1 
ATOM   3255  C  CA  . ASP B  2  178 ? 73.806  -83.131  2.744   1.00 65.37  ? 188  ASP B CA  1 
ATOM   3256  C  C   . ASP B  2  178 ? 72.668  -82.821  3.712   1.00 64.42  ? 188  ASP B C   1 
ATOM   3257  O  O   . ASP B  2  178 ? 72.573  -81.707  4.225   1.00 64.25  ? 188  ASP B O   1 
ATOM   3258  C  CB  . ASP B  2  178 ? 73.348  -82.954  1.288   1.00 65.56  ? 188  ASP B CB  1 
ATOM   3259  C  CG  . ASP B  2  178 ? 74.439  -83.321  0.272   1.00 66.07  ? 188  ASP B CG  1 
ATOM   3260  O  OD1 . ASP B  2  178 ? 74.074  -83.703  -0.866  1.00 66.29  ? 188  ASP B OD1 1 
ATOM   3261  O  OD2 . ASP B  2  178 ? 75.651  -83.236  0.606   1.00 65.97  ? 188  ASP B OD2 1 
ATOM   3262  N  N   . ALA B  2  179 ? 71.821  -83.821  3.963   1.00 63.31  ? 189  ALA B N   1 
ATOM   3263  C  CA  . ALA B  2  179 ? 70.709  -83.706  4.906   1.00 61.99  ? 189  ALA B CA  1 
ATOM   3264  C  C   . ALA B  2  179 ? 71.171  -83.609  6.358   1.00 61.25  ? 189  ALA B C   1 
ATOM   3265  O  O   . ALA B  2  179 ? 70.525  -82.948  7.171   1.00 60.95  ? 189  ALA B O   1 
ATOM   3266  C  CB  . ALA B  2  179 ? 69.744  -84.858  4.732   1.00 61.93  ? 189  ALA B CB  1 
ATOM   3267  N  N   . ILE B  2  180 ? 72.280  -84.269  6.683   1.00 60.61  ? 190  ILE B N   1 
ATOM   3268  C  CA  . ILE B  2  180 ? 72.887  -84.119  8.004   1.00 60.15  ? 190  ILE B CA  1 
ATOM   3269  C  C   . ILE B  2  180 ? 73.240  -82.650  8.174   1.00 60.01  ? 190  ILE B C   1 
ATOM   3270  O  O   . ILE B  2  180 ? 72.824  -82.018  9.144   1.00 60.13  ? 190  ILE B O   1 
ATOM   3271  C  CB  . ILE B  2  180 ? 74.152  -84.993  8.195   1.00 60.06  ? 190  ILE B CB  1 
ATOM   3272  C  CG1 . ILE B  2  180 ? 73.786  -86.480  8.314   1.00 60.28  ? 190  ILE B CG1 1 
ATOM   3273  C  CG2 . ILE B  2  180 ? 74.916  -84.555  9.428   1.00 59.89  ? 190  ILE B CG2 1 
ATOM   3274  C  CD1 . ILE B  2  180 ? 74.993  -87.445  8.373   1.00 60.21  ? 190  ILE B CD1 1 
ATOM   3275  N  N   . GLU B  2  181 ? 73.980  -82.113  7.200   1.00 59.77  ? 191  GLU B N   1 
ATOM   3276  C  CA  . GLU B  2  181 ? 74.355  -80.702  7.176   1.00 59.33  ? 191  GLU B CA  1 
ATOM   3277  C  C   . GLU B  2  181 ? 73.136  -79.800  7.345   1.00 58.22  ? 191  GLU B C   1 
ATOM   3278  O  O   . GLU B  2  181 ? 73.157  -78.891  8.176   1.00 58.24  ? 191  GLU B O   1 
ATOM   3279  C  CB  . GLU B  2  181 ? 75.123  -80.347  5.889   1.00 59.90  ? 191  GLU B CB  1 
ATOM   3280  C  CG  . GLU B  2  181 ? 75.724  -78.922  5.895   1.00 62.48  ? 191  GLU B CG  1 
ATOM   3281  C  CD  . GLU B  2  181 ? 76.375  -78.499  4.565   1.00 65.45  ? 191  GLU B CD  1 
ATOM   3282  O  OE1 . GLU B  2  181 ? 77.212  -79.266  4.029   1.00 66.64  ? 191  GLU B OE1 1 
ATOM   3283  O  OE2 . GLU B  2  181 ? 76.068  -77.380  4.073   1.00 66.32  ? 191  GLU B OE2 1 
ATOM   3284  N  N   . LEU B  2  182 ? 72.077  -80.066  6.578   1.00 56.87  ? 192  LEU B N   1 
ATOM   3285  C  CA  . LEU B  2  182 ? 70.885  -79.219  6.585   1.00 55.69  ? 192  LEU B CA  1 
ATOM   3286  C  C   . LEU B  2  182 ? 70.224  -79.151  7.966   1.00 55.42  ? 192  LEU B C   1 
ATOM   3287  O  O   . LEU B  2  182 ? 69.886  -78.066  8.436   1.00 55.38  ? 192  LEU B O   1 
ATOM   3288  C  CB  . LEU B  2  182 ? 69.878  -79.688  5.534   1.00 55.30  ? 192  LEU B CB  1 
ATOM   3289  C  CG  . LEU B  2  182 ? 68.944  -78.717  4.793   1.00 54.58  ? 192  LEU B CG  1 
ATOM   3290  C  CD1 . LEU B  2  182 ? 67.825  -79.508  4.152   1.00 53.93  ? 192  LEU B CD1 1 
ATOM   3291  C  CD2 . LEU B  2  182 ? 68.348  -77.586  5.642   1.00 53.63  ? 192  LEU B CD2 1 
ATOM   3292  N  N   . ALA B  2  183 ? 70.062  -80.308  8.610   1.00 54.95  ? 193  ALA B N   1 
ATOM   3293  C  CA  . ALA B  2  183 ? 69.420  -80.402  9.919   1.00 54.21  ? 193  ALA B CA  1 
ATOM   3294  C  C   . ALA B  2  183 ? 70.159  -79.618  10.986  1.00 54.05  ? 193  ALA B C   1 
ATOM   3295  O  O   . ALA B  2  183 ? 69.541  -78.882  11.748  1.00 53.97  ? 193  ALA B O   1 
ATOM   3296  C  CB  . ALA B  2  183 ? 69.289  -81.845  10.336  1.00 54.25  ? 193  ALA B CB  1 
ATOM   3297  N  N   . LEU B  2  184 ? 71.476  -79.774  11.039  1.00 53.94  ? 194  LEU B N   1 
ATOM   3298  C  CA  . LEU B  2  184 ? 72.292  -79.046  12.011  1.00 54.26  ? 194  LEU B CA  1 
ATOM   3299  C  C   . LEU B  2  184 ? 72.310  -77.529  11.784  1.00 54.55  ? 194  LEU B C   1 
ATOM   3300  O  O   . LEU B  2  184 ? 72.242  -76.762  12.745  1.00 54.57  ? 194  LEU B O   1 
ATOM   3301  C  CB  . LEU B  2  184 ? 73.720  -79.596  12.051  1.00 54.11  ? 194  LEU B CB  1 
ATOM   3302  C  CG  . LEU B  2  184 ? 73.890  -81.033  12.544  1.00 54.19  ? 194  LEU B CG  1 
ATOM   3303  C  CD1 . LEU B  2  184 ? 75.148  -81.661  11.956  1.00 54.59  ? 194  LEU B CD1 1 
ATOM   3304  C  CD2 . LEU B  2  184 ? 73.898  -81.114  14.064  1.00 52.98  ? 194  LEU B CD2 1 
ATOM   3305  N  N   . LYS B  2  185 ? 72.401  -77.100  10.523  1.00 54.99  ? 195  LYS B N   1 
ATOM   3306  C  CA  . LYS B  2  185 ? 72.350  -75.673  10.196  1.00 55.55  ? 195  LYS B CA  1 
ATOM   3307  C  C   . LYS B  2  185 ? 71.038  -75.090  10.674  1.00 55.15  ? 195  LYS B C   1 
ATOM   3308  O  O   . LYS B  2  185 ? 71.023  -73.996  11.226  1.00 55.53  ? 195  LYS B O   1 
ATOM   3309  C  CB  . LYS B  2  185 ? 72.481  -75.413  8.685   1.00 56.16  ? 195  LYS B CB  1 
ATOM   3310  C  CG  . LYS B  2  185 ? 73.759  -75.930  8.021   1.00 58.17  ? 195  LYS B CG  1 
ATOM   3311  C  CD  . LYS B  2  185 ? 74.809  -74.854  7.829   1.00 60.74  ? 195  LYS B CD  1 
ATOM   3312  C  CE  . LYS B  2  185 ? 75.765  -75.245  6.702   1.00 62.22  ? 195  LYS B CE  1 
ATOM   3313  N  NZ  . LYS B  2  185 ? 76.599  -74.087  6.258   1.00 63.75  ? 195  LYS B NZ  1 
ATOM   3314  N  N   . THR B  2  186 ? 69.949  -75.830  10.468  1.00 54.75  ? 196  THR B N   1 
ATOM   3315  C  CA  . THR B  2  186 ? 68.603  -75.354  10.790  1.00 54.67  ? 196  THR B CA  1 
ATOM   3316  C  C   . THR B  2  186 ? 68.367  -75.191  12.296  1.00 55.23  ? 196  THR B C   1 
ATOM   3317  O  O   . THR B  2  186 ? 67.740  -74.221  12.723  1.00 55.14  ? 196  THR B O   1 
ATOM   3318  C  CB  . THR B  2  186 ? 67.525  -76.260  10.171  1.00 54.38  ? 196  THR B CB  1 
ATOM   3319  O  OG1 . THR B  2  186 ? 67.888  -76.572  8.824   1.00 53.26  ? 196  THR B OG1 1 
ATOM   3320  C  CG2 . THR B  2  186 ? 66.166  -75.574  10.173  1.00 53.79  ? 196  THR B CG2 1 
ATOM   3321  N  N   . LEU B  2  187 ? 68.873  -76.136  13.085  1.00 55.88  ? 197  LEU B N   1 
ATOM   3322  C  CA  . LEU B  2  187 ? 68.786  -76.064  14.534  1.00 56.76  ? 197  LEU B CA  1 
ATOM   3323  C  C   . LEU B  2  187 ? 69.638  -74.915  15.020  1.00 57.63  ? 197  LEU B C   1 
ATOM   3324  O  O   . LEU B  2  187 ? 69.213  -74.140  15.882  1.00 57.56  ? 197  LEU B O   1 
ATOM   3325  C  CB  . LEU B  2  187 ? 69.274  -77.364  15.186  1.00 56.74  ? 197  LEU B CB  1 
ATOM   3326  C  CG  . LEU B  2  187 ? 68.345  -78.581  15.239  1.00 56.75  ? 197  LEU B CG  1 
ATOM   3327  C  CD1 . LEU B  2  187 ? 69.144  -79.849  15.477  1.00 56.16  ? 197  LEU B CD1 1 
ATOM   3328  C  CD2 . LEU B  2  187 ? 67.260  -78.422  16.297  1.00 56.49  ? 197  LEU B CD2 1 
ATOM   3329  N  N   . SER B  2  188 ? 70.843  -74.823  14.457  1.00 58.81  ? 198  SER B N   1 
ATOM   3330  C  CA  . SER B  2  188 ? 71.814  -73.775  14.791  1.00 60.23  ? 198  SER B CA  1 
ATOM   3331  C  C   . SER B  2  188 ? 71.218  -72.370  14.650  1.00 60.84  ? 198  SER B C   1 
ATOM   3332  O  O   . SER B  2  188 ? 71.438  -71.500  15.499  1.00 60.61  ? 198  SER B O   1 
ATOM   3333  C  CB  . SER B  2  188 ? 73.052  -73.905  13.894  1.00 60.33  ? 198  SER B CB  1 
ATOM   3334  O  OG  . SER B  2  188 ? 74.147  -73.169  14.418  1.00 61.35  ? 198  SER B OG  1 
ATOM   3335  N  N   . LYS B  2  189 ? 70.449  -72.180  13.578  1.00 61.77  ? 199  LYS B N   1 
ATOM   3336  C  CA  . LYS B  2  189 ? 69.806  -70.911  13.271  1.00 62.77  ? 199  LYS B CA  1 
ATOM   3337  C  C   . LYS B  2  189 ? 68.562  -70.616  14.104  1.00 63.20  ? 199  LYS B C   1 
ATOM   3338  O  O   . LYS B  2  189 ? 68.116  -69.481  14.141  1.00 63.36  ? 199  LYS B O   1 
ATOM   3339  C  CB  . LYS B  2  189 ? 69.425  -70.865  11.792  1.00 62.89  ? 199  LYS B CB  1 
ATOM   3340  C  CG  . LYS B  2  189 ? 70.603  -70.827  10.825  1.00 63.99  ? 199  LYS B CG  1 
ATOM   3341  C  CD  . LYS B  2  189 ? 70.219  -70.087  9.547   1.00 65.59  ? 199  LYS B CD  1 
ATOM   3342  C  CE  . LYS B  2  189 ? 69.964  -68.608  9.845   1.00 66.63  ? 199  LYS B CE  1 
ATOM   3343  N  NZ  . LYS B  2  189 ? 69.513  -67.867  8.643   1.00 67.80  ? 199  LYS B NZ  1 
ATOM   3344  N  N   . THR B  2  190 ? 67.987  -71.622  14.758  1.00 64.02  ? 200  THR B N   1 
ATOM   3345  C  CA  . THR B  2  190 ? 66.731  -71.411  15.490  1.00 64.86  ? 200  THR B CA  1 
ATOM   3346  C  C   . THR B  2  190 ? 66.844  -71.510  17.012  1.00 65.29  ? 200  THR B C   1 
ATOM   3347  O  O   . THR B  2  190 ? 65.894  -71.187  17.719  1.00 65.37  ? 200  THR B O   1 
ATOM   3348  C  CB  . THR B  2  190 ? 65.603  -72.337  14.988  1.00 64.96  ? 200  THR B CB  1 
ATOM   3349  O  OG1 . THR B  2  190 ? 66.014  -73.705  15.099  1.00 66.07  ? 200  THR B OG1 1 
ATOM   3350  C  CG2 . THR B  2  190 ? 65.259  -72.033  13.539  1.00 64.83  ? 200  THR B CG2 1 
ATOM   3351  N  N   . THR B  2  191 ? 68.007  -71.934  17.501  1.00 66.17  ? 202  THR B N   1 
ATOM   3352  C  CA  . THR B  2  191 ? 68.283  -72.071  18.936  1.00 67.22  ? 202  THR B CA  1 
ATOM   3353  C  C   . THR B  2  191 ? 67.983  -70.797  19.706  1.00 68.01  ? 202  THR B C   1 
ATOM   3354  O  O   . THR B  2  191 ? 68.270  -69.699  19.236  1.00 68.25  ? 202  THR B O   1 
ATOM   3355  C  CB  . THR B  2  191 ? 69.772  -72.377  19.194  1.00 67.09  ? 202  THR B CB  1 
ATOM   3356  O  OG1 . THR B  2  191 ? 70.355  -72.990  18.039  1.00 67.99  ? 202  THR B OG1 1 
ATOM   3357  C  CG2 . THR B  2  191 ? 69.939  -73.287  20.377  1.00 66.80  ? 202  THR B CG2 1 
ATOM   3358  N  N   . ASP B  2  192 ? 67.416  -70.958  20.896  1.00 69.12  ? 203  ASP B N   1 
ATOM   3359  C  CA  . ASP B  2  192 ? 67.323  -69.872  21.867  1.00 70.20  ? 203  ASP B CA  1 
ATOM   3360  C  C   . ASP B  2  192 ? 68.592  -69.845  22.736  1.00 70.73  ? 203  ASP B C   1 
ATOM   3361  O  O   . ASP B  2  192 ? 68.637  -69.163  23.766  1.00 71.04  ? 203  ASP B O   1 
ATOM   3362  C  CB  . ASP B  2  192 ? 66.074  -70.032  22.743  1.00 70.30  ? 203  ASP B CB  1 
ATOM   3363  C  CG  . ASP B  2  192 ? 64.782  -70.010  21.936  1.00 71.59  ? 203  ASP B CG  1 
ATOM   3364  O  OD1 . ASP B  2  192 ? 64.371  -68.900  21.500  1.00 72.00  ? 203  ASP B OD1 1 
ATOM   3365  O  OD2 . ASP B  2  192 ? 64.166  -71.105  21.754  1.00 73.20  ? 203  ASP B OD2 1 
ATOM   3366  N  N   . SER B  2  193 ? 69.619  -70.583  22.319  1.00 71.19  ? 204  SER B N   1 
ATOM   3367  C  CA  . SER B  2  193 ? 70.871  -70.655  23.074  1.00 71.91  ? 204  SER B CA  1 
ATOM   3368  C  C   . SER B  2  193 ? 72.000  -69.913  22.382  1.00 72.07  ? 204  SER B C   1 
ATOM   3369  O  O   . SER B  2  193 ? 71.908  -69.602  21.194  1.00 71.89  ? 204  SER B O   1 
ATOM   3370  C  CB  . SER B  2  193 ? 71.284  -72.112  23.316  1.00 72.02  ? 204  SER B CB  1 
ATOM   3371  O  OG  . SER B  2  193 ? 70.349  -72.779  24.149  1.00 72.84  ? 204  SER B OG  1 
ATOM   3372  N  N   . SER B  2  194 A 73.057  -69.638  23.145  1.00 72.39  ? 204  SER B N   1 
ATOM   3373  C  CA  . SER B  2  194 A 74.267  -69.001  22.632  1.00 72.94  ? 204  SER B CA  1 
ATOM   3374  C  C   . SER B  2  194 A 74.722  -69.681  21.343  1.00 73.01  ? 204  SER B C   1 
ATOM   3375  O  O   . SER B  2  194 A 74.703  -69.082  20.264  1.00 73.16  ? 204  SER B O   1 
ATOM   3376  C  CB  . SER B  2  194 A 75.405  -69.080  23.664  1.00 73.14  ? 204  SER B CB  1 
ATOM   3377  O  OG  . SER B  2  194 A 74.957  -68.783  24.975  1.00 74.10  ? 204  SER B OG  1 
ATOM   3378  N  N   . ALA B  2  195 B 75.122  -70.942  21.471  1.00 72.71  ? 204  ALA B N   1 
ATOM   3379  C  CA  . ALA B  2  195 B 75.648  -71.701  20.354  1.00 72.37  ? 204  ALA B CA  1 
ATOM   3380  C  C   . ALA B  2  195 B 75.268  -73.174  20.497  1.00 72.16  ? 204  ALA B C   1 
ATOM   3381  O  O   . ALA B  2  195 B 74.992  -73.660  21.604  1.00 72.34  ? 204  ALA B O   1 
ATOM   3382  C  CB  . ALA B  2  195 B 77.167  -71.534  20.268  1.00 72.40  ? 204  ALA B CB  1 
ATOM   3383  N  N   . LEU B  2  196 ? 75.259  -73.878  19.370  1.00 71.53  ? 205  LEU B N   1 
ATOM   3384  C  CA  . LEU B  2  196 ? 74.864  -75.271  19.336  1.00 70.85  ? 205  LEU B CA  1 
ATOM   3385  C  C   . LEU B  2  196 ? 76.067  -76.187  19.552  1.00 70.34  ? 205  LEU B C   1 
ATOM   3386  O  O   . LEU B  2  196 ? 76.829  -76.452  18.620  1.00 70.53  ? 205  LEU B O   1 
ATOM   3387  C  CB  . LEU B  2  196 ? 74.181  -75.574  18.004  1.00 70.89  ? 205  LEU B CB  1 
ATOM   3388  C  CG  . LEU B  2  196 ? 73.214  -76.756  17.969  1.00 71.20  ? 205  LEU B CG  1 
ATOM   3389  C  CD1 . LEU B  2  196 ? 71.981  -76.516  18.860  1.00 71.02  ? 205  LEU B CD1 1 
ATOM   3390  C  CD2 . LEU B  2  196 ? 72.811  -77.019  16.531  1.00 71.24  ? 205  LEU B CD2 1 
ATOM   3391  N  N   . THR B  2  197 ? 76.228  -76.656  20.790  1.00 69.51  ? 206  THR B N   1 
ATOM   3392  C  CA  . THR B  2  197 ? 77.336  -77.541  21.174  1.00 68.63  ? 206  THR B CA  1 
ATOM   3393  C  C   . THR B  2  197 ? 76.878  -79.004  21.218  1.00 67.98  ? 206  THR B C   1 
ATOM   3394  O  O   . THR B  2  197 ? 75.682  -79.272  21.308  1.00 67.90  ? 206  THR B O   1 
ATOM   3395  C  CB  . THR B  2  197 ? 77.946  -77.127  22.548  1.00 68.73  ? 206  THR B CB  1 
ATOM   3396  O  OG1 . THR B  2  197 ? 76.907  -76.668  23.427  1.00 68.55  ? 206  THR B OG1 1 
ATOM   3397  C  CG2 . THR B  2  197 ? 78.972  -76.014  22.377  1.00 68.26  ? 206  THR B CG2 1 
ATOM   3398  N  N   . TYR B  2  198 ? 77.827  -79.940  21.154  1.00 67.20  ? 207  TYR B N   1 
ATOM   3399  C  CA  . TYR B  2  198 ? 77.520  -81.382  21.129  1.00 66.40  ? 207  TYR B CA  1 
ATOM   3400  C  C   . TYR B  2  198 ? 76.665  -81.830  22.309  1.00 65.83  ? 207  TYR B C   1 
ATOM   3401  O  O   . TYR B  2  198 ? 75.817  -82.711  22.172  1.00 65.84  ? 207  TYR B O   1 
ATOM   3402  C  CB  . TYR B  2  198 ? 78.806  -82.224  21.075  1.00 66.48  ? 207  TYR B CB  1 
ATOM   3403  C  CG  . TYR B  2  198 ? 79.600  -82.234  22.367  1.00 66.80  ? 207  TYR B CG  1 
ATOM   3404  C  CD1 . TYR B  2  198 ? 80.358  -81.123  22.751  1.00 67.47  ? 207  TYR B CD1 1 
ATOM   3405  C  CD2 . TYR B  2  198 ? 79.588  -83.345  23.207  1.00 66.25  ? 207  TYR B CD2 1 
ATOM   3406  C  CE1 . TYR B  2  198 ? 81.074  -81.118  23.937  1.00 67.22  ? 207  TYR B CE1 1 
ATOM   3407  C  CE2 . TYR B  2  198 ? 80.304  -83.348  24.397  1.00 66.55  ? 207  TYR B CE2 1 
ATOM   3408  C  CZ  . TYR B  2  198 ? 81.043  -82.233  24.752  1.00 66.98  ? 207  TYR B CZ  1 
ATOM   3409  O  OH  . TYR B  2  198 ? 81.759  -82.223  25.921  1.00 68.09  ? 207  TYR B OH  1 
ATOM   3410  N  N   . ASP B  2  199 ? 76.885  -81.211  23.461  1.00 65.06  ? 208  ASP B N   1 
ATOM   3411  C  CA  . ASP B  2  199 ? 76.232  -81.624  24.691  1.00 64.64  ? 208  ASP B CA  1 
ATOM   3412  C  C   . ASP B  2  199 ? 74.803  -81.089  24.790  1.00 64.10  ? 208  ASP B C   1 
ATOM   3413  O  O   . ASP B  2  199 ? 74.203  -81.079  25.864  1.00 64.45  ? 208  ASP B O   1 
ATOM   3414  C  CB  . ASP B  2  199 ? 77.065  -81.193  25.905  1.00 64.79  ? 208  ASP B CB  1 
ATOM   3415  C  CG  . ASP B  2  199 ? 77.079  -79.684  26.102  1.00 65.40  ? 208  ASP B CG  1 
ATOM   3416  O  OD1 . ASP B  2  199 ? 77.464  -78.953  25.163  1.00 66.03  ? 208  ASP B OD1 1 
ATOM   3417  O  OD2 . ASP B  2  199 ? 76.706  -79.230  27.203  1.00 66.22  ? 208  ASP B OD2 1 
ATOM   3418  N  N   . ARG B  2  200 ? 74.258  -80.640  23.671  1.00 63.29  ? 209  ARG B N   1 
ATOM   3419  C  CA  . ARG B  2  200 ? 72.907  -80.094  23.654  1.00 62.71  ? 209  ARG B CA  1 
ATOM   3420  C  C   . ARG B  2  200 ? 72.121  -80.732  22.506  1.00 61.77  ? 209  ARG B C   1 
ATOM   3421  O  O   . ARG B  2  200 ? 71.023  -80.294  22.164  1.00 61.34  ? 209  ARG B O   1 
ATOM   3422  C  CB  . ARG B  2  200 ? 72.955  -78.565  23.541  1.00 62.97  ? 209  ARG B CB  1 
ATOM   3423  C  CG  . ARG B  2  200 ? 73.595  -77.842  24.755  1.00 65.02  ? 209  ARG B CG  1 
ATOM   3424  C  CD  . ARG B  2  200 ? 73.555  -76.307  24.628  1.00 68.34  ? 209  ARG B CD  1 
ATOM   3425  N  NE  . ARG B  2  200 ? 72.438  -75.874  23.787  1.00 71.49  ? 209  ARG B NE  1 
ATOM   3426  C  CZ  . ARG B  2  200 ? 71.162  -75.826  24.176  1.00 73.44  ? 209  ARG B CZ  1 
ATOM   3427  N  NH1 . ARG B  2  200 ? 70.813  -76.163  25.416  1.00 74.21  ? 209  ARG B NH1 1 
ATOM   3428  N  NH2 . ARG B  2  200 ? 70.226  -75.437  23.318  1.00 73.78  ? 209  ARG B NH2 1 
ATOM   3429  N  N   . LEU B  2  201 ? 72.699  -81.794  21.944  1.00 60.96  ? 210  LEU B N   1 
ATOM   3430  C  CA  . LEU B  2  201 ? 72.161  -82.477  20.778  1.00 60.20  ? 210  LEU B CA  1 
ATOM   3431  C  C   . LEU B  2  201 ? 71.997  -83.983  20.923  1.00 60.06  ? 210  LEU B C   1 
ATOM   3432  O  O   . LEU B  2  201 ? 72.758  -84.651  21.620  1.00 59.90  ? 210  LEU B O   1 
ATOM   3433  C  CB  . LEU B  2  201 ? 73.058  -82.232  19.579  1.00 59.87  ? 210  LEU B CB  1 
ATOM   3434  C  CG  . LEU B  2  201 ? 72.944  -80.879  18.905  1.00 59.41  ? 210  LEU B CG  1 
ATOM   3435  C  CD1 . LEU B  2  201 ? 74.045  -80.793  17.882  1.00 59.19  ? 210  LEU B CD1 1 
ATOM   3436  C  CD2 . LEU B  2  201 ? 71.579  -80.704  18.259  1.00 58.30  ? 210  LEU B CD2 1 
ATOM   3437  N  N   . GLU B  2  202 ? 70.981  -84.495  20.242  1.00 59.87  ? 211  GLU B N   1 
ATOM   3438  C  CA  . GLU B  2  202 ? 70.846  -85.908  19.962  1.00 59.76  ? 211  GLU B CA  1 
ATOM   3439  C  C   . GLU B  2  202 ? 70.768  -86.061  18.455  1.00 59.47  ? 211  GLU B C   1 
ATOM   3440  O  O   . GLU B  2  202 ? 70.146  -85.252  17.760  1.00 59.08  ? 211  GLU B O   1 
ATOM   3441  C  CB  . GLU B  2  202 ? 69.589  -86.473  20.612  1.00 60.07  ? 211  GLU B CB  1 
ATOM   3442  C  CG  . GLU B  2  202 ? 69.831  -87.275  21.880  1.00 61.34  ? 211  GLU B CG  1 
ATOM   3443  C  CD  . GLU B  2  202 ? 68.572  -87.420  22.722  1.00 63.11  ? 211  GLU B CD  1 
ATOM   3444  O  OE1 . GLU B  2  202 ? 67.951  -86.378  23.036  1.00 63.06  ? 211  GLU B OE1 1 
ATOM   3445  O  OE2 . GLU B  2  202 ? 68.208  -88.573  23.072  1.00 64.24  ? 211  GLU B OE2 1 
ATOM   3446  N  N   . PHE B  2  203 ? 71.397  -87.109  17.949  1.00 59.39  ? 212  PHE B N   1 
ATOM   3447  C  CA  . PHE B  2  203 ? 71.500  -87.275  16.521  1.00 59.40  ? 212  PHE B CA  1 
ATOM   3448  C  C   . PHE B  2  203 ? 71.403  -88.741  16.141  1.00 59.55  ? 212  PHE B C   1 
ATOM   3449  O  O   . PHE B  2  203 ? 71.897  -89.601  16.868  1.00 59.48  ? 212  PHE B O   1 
ATOM   3450  C  CB  . PHE B  2  203 ? 72.826  -86.685  16.051  1.00 59.48  ? 212  PHE B CB  1 
ATOM   3451  C  CG  . PHE B  2  203 ? 72.758  -86.071  14.701  1.00 59.59  ? 212  PHE B CG  1 
ATOM   3452  C  CD1 . PHE B  2  203 ? 72.242  -84.795  14.539  1.00 59.84  ? 212  PHE B CD1 1 
ATOM   3453  C  CD2 . PHE B  2  203 ? 73.203  -86.772  13.583  1.00 60.07  ? 212  PHE B CD2 1 
ATOM   3454  C  CE1 . PHE B  2  203 ? 72.166  -84.225  13.291  1.00 60.37  ? 212  PHE B CE1 1 
ATOM   3455  C  CE2 . PHE B  2  203 ? 73.135  -86.215  12.326  1.00 59.92  ? 212  PHE B CE2 1 
ATOM   3456  C  CZ  . PHE B  2  203 ? 72.612  -84.935  12.179  1.00 61.19  ? 212  PHE B CZ  1 
ATOM   3457  N  N   . ALA B  2  204 ? 70.758  -89.021  15.008  1.00 59.92  ? 213  ALA B N   1 
ATOM   3458  C  CA  . ALA B  2  204 ? 70.594  -90.390  14.517  1.00 60.52  ? 213  ALA B CA  1 
ATOM   3459  C  C   . ALA B  2  204 ? 70.298  -90.442  13.030  1.00 61.09  ? 213  ALA B C   1 
ATOM   3460  O  O   . ALA B  2  204 ? 69.598  -89.577  12.504  1.00 60.69  ? 213  ALA B O   1 
ATOM   3461  C  CB  . ALA B  2  204 ? 69.496  -91.119  15.290  1.00 60.33  ? 213  ALA B CB  1 
ATOM   3462  N  N   . THR B  2  205 ? 70.834  -91.471  12.368  1.00 62.13  ? 214  THR B N   1 
ATOM   3463  C  CA  . THR B  2  205 ? 70.577  -91.716  10.949  1.00 63.21  ? 214  THR B CA  1 
ATOM   3464  C  C   . THR B  2  205 ? 70.031  -93.109  10.695  1.00 64.35  ? 214  THR B C   1 
ATOM   3465  O  O   . THR B  2  205 ? 70.224  -94.028  11.486  1.00 64.30  ? 214  THR B O   1 
ATOM   3466  C  CB  . THR B  2  205 ? 71.840  -91.559  10.077  1.00 62.95  ? 214  THR B CB  1 
ATOM   3467  O  OG1 . THR B  2  205 ? 72.906  -92.330  10.635  1.00 62.84  ? 214  THR B OG1 1 
ATOM   3468  C  CG2 . THR B  2  205 ? 72.259  -90.107  9.976   1.00 63.04  ? 214  THR B CG2 1 
ATOM   3469  N  N   . ILE B  2  206 ? 69.349  -93.253  9.570   1.00 65.84  ? 215  ILE B N   1 
ATOM   3470  C  CA  . ILE B  2  206 ? 68.899  -94.542  9.115   1.00 67.60  ? 215  ILE B CA  1 
ATOM   3471  C  C   . ILE B  2  206 ? 69.405  -94.682  7.686   1.00 69.15  ? 215  ILE B C   1 
ATOM   3472  O  O   . ILE B  2  206 ? 68.955  -93.977  6.789   1.00 69.23  ? 215  ILE B O   1 
ATOM   3473  C  CB  . ILE B  2  206 ? 67.365  -94.673  9.244   1.00 67.37  ? 215  ILE B CB  1 
ATOM   3474  C  CG1 . ILE B  2  206 ? 66.985  -94.799  10.719  1.00 67.64  ? 215  ILE B CG1 1 
ATOM   3475  C  CG2 . ILE B  2  206 ? 66.854  -95.883  8.505   1.00 67.17  ? 215  ILE B CG2 1 
ATOM   3476  C  CD1 . ILE B  2  206 ? 65.496  -94.778  11.001  1.00 68.35  ? 215  ILE B CD1 1 
ATOM   3477  N  N   . ARG B  2  207 ? 70.372  -95.579  7.504   1.00 71.38  ? 216  ARG B N   1 
ATOM   3478  C  CA  . ARG B  2  207 ? 71.087  -95.758  6.237   1.00 73.51  ? 216  ARG B CA  1 
ATOM   3479  C  C   . ARG B  2  207 ? 71.018  -97.192  5.733   1.00 75.18  ? 216  ARG B C   1 
ATOM   3480  O  O   . ARG B  2  207 ? 71.096  -98.140  6.514   1.00 75.39  ? 216  ARG B O   1 
ATOM   3481  C  CB  . ARG B  2  207 ? 72.566  -95.407  6.400   1.00 73.33  ? 216  ARG B CB  1 
ATOM   3482  C  CG  . ARG B  2  207 ? 72.899  -93.947  6.400   1.00 73.29  ? 216  ARG B CG  1 
ATOM   3483  C  CD  . ARG B  2  207 ? 74.023  -93.718  5.421   1.00 74.10  ? 216  ARG B CD  1 
ATOM   3484  N  NE  . ARG B  2  207 ? 74.972  -92.696  5.861   1.00 74.48  ? 216  ARG B NE  1 
ATOM   3485  C  CZ  . ARG B  2  207 ? 75.605  -91.856  5.044   1.00 73.85  ? 216  ARG B CZ  1 
ATOM   3486  N  NH1 . ARG B  2  207 ? 75.378  -91.886  3.733   1.00 72.84  ? 216  ARG B NH1 1 
ATOM   3487  N  NH2 . ARG B  2  207 ? 76.456  -90.973  5.545   1.00 74.03  ? 216  ARG B NH2 1 
ATOM   3488  N  N   . LYS B  2  208 A 70.909  -97.338  4.418   1.00 77.42  ? 216  LYS B N   1 
ATOM   3489  C  CA  . LYS B  2  208 A 70.934  -98.646  3.764   1.00 79.61  ? 216  LYS B CA  1 
ATOM   3490  C  C   . LYS B  2  208 A 72.247  -98.804  3.002   1.00 80.94  ? 216  LYS B C   1 
ATOM   3491  O  O   . LYS B  2  208 A 72.302  -98.507  1.803   1.00 81.16  ? 216  LYS B O   1 
ATOM   3492  C  CB  . LYS B  2  208 A 69.730  -98.781  2.809   1.00 79.61  ? 216  LYS B CB  1 
ATOM   3493  C  CG  . LYS B  2  208 A 69.610  -100.097 2.043   1.00 80.08  ? 216  LYS B CG  1 
ATOM   3494  C  CD  . LYS B  2  208 A 68.419  -100.076 1.093   1.00 80.57  ? 216  LYS B CD  1 
ATOM   3495  C  CE  . LYS B  2  208 A 68.536  -101.189 0.063   1.00 81.75  ? 216  LYS B CE  1 
ATOM   3496  N  NZ  . LYS B  2  208 A 67.323  -101.294 -0.798  1.00 82.60  ? 216  LYS B NZ  1 
ATOM   3497  N  N   . GLY B  2  209 B 73.297  -99.257  3.694   1.00 82.50  ? 216  GLY B N   1 
ATOM   3498  C  CA  . GLY B  2  209 B 74.616  -99.506  3.067   1.00 84.58  ? 216  GLY B CA  1 
ATOM   3499  C  C   . GLY B  2  209 B 74.552  -100.072 1.643   1.00 85.89  ? 216  GLY B C   1 
ATOM   3500  O  O   . GLY B  2  209 B 73.856  -101.071 1.402   1.00 86.23  ? 216  GLY B O   1 
ATOM   3501  N  N   . ALA B  2  210 ? 75.259  -99.424  0.705   1.00 86.97  ? 217  ALA B N   1 
ATOM   3502  C  CA  . ALA B  2  210 ? 75.251  -99.802  -0.734  1.00 88.00  ? 217  ALA B CA  1 
ATOM   3503  C  C   . ALA B  2  210 ? 75.900  -101.175 -0.999  1.00 88.63  ? 217  ALA B C   1 
ATOM   3504  O  O   . ALA B  2  210 ? 75.449  -101.936 -1.871  1.00 88.67  ? 217  ALA B O   1 
ATOM   3505  C  CB  . ALA B  2  210 ? 75.907  -98.700  -1.606  1.00 87.78  ? 217  ALA B CB  1 
ATOM   3506  N  N   . ASN B  2  211 ? 76.956  -101.463 -0.231  1.00 89.27  ? 218  ASN B N   1 
ATOM   3507  C  CA  . ASN B  2  211 ? 77.597  -102.782 -0.160  1.00 89.63  ? 218  ASN B CA  1 
ATOM   3508  C  C   . ASN B  2  211 ? 76.915  -103.671 0.921   1.00 89.64  ? 218  ASN B C   1 
ATOM   3509  O  O   . ASN B  2  211 ? 77.563  -104.155 1.864   1.00 89.70  ? 218  ASN B O   1 
ATOM   3510  C  CB  . ASN B  2  211 ? 79.109  -102.602 0.107   1.00 89.69  ? 218  ASN B CB  1 
ATOM   3511  C  CG  . ASN B  2  211 ? 79.954  -103.772 -0.405  1.00 90.04  ? 218  ASN B CG  1 
ATOM   3512  O  OD1 . ASN B  2  211 ? 80.763  -104.334 0.337   1.00 89.95  ? 218  ASN B OD1 1 
ATOM   3513  N  ND2 . ASN B  2  211 ? 79.776  -104.134 -1.675  1.00 89.95  ? 218  ASN B ND2 1 
ATOM   3514  N  N   . ASP B  2  212 C 75.597  -103.857 0.775   1.00 89.47  ? 218  ASP B N   1 
ATOM   3515  C  CA  . ASP B  2  212 C 74.773  -104.640 1.709   1.00 89.11  ? 218  ASP B CA  1 
ATOM   3516  C  C   . ASP B  2  212 C 73.422  -104.942 1.045   1.00 88.67  ? 218  ASP B C   1 
ATOM   3517  O  O   . ASP B  2  212 C 73.380  -105.519 -0.048  1.00 88.61  ? 218  ASP B O   1 
ATOM   3518  C  CB  . ASP B  2  212 C 74.579  -103.887 3.038   1.00 89.23  ? 218  ASP B CB  1 
ATOM   3519  C  CG  . ASP B  2  212 C 74.501  -104.819 4.242   1.00 89.72  ? 218  ASP B CG  1 
ATOM   3520  O  OD1 . ASP B  2  212 C 75.542  -105.423 4.585   1.00 89.34  ? 218  ASP B OD1 1 
ATOM   3521  O  OD2 . ASP B  2  212 C 73.407  -104.927 4.858   1.00 90.10  ? 218  ASP B OD2 1 
ATOM   3522  N  N   . GLY B  2  213 D 72.330  -104.534 1.699   1.00 88.12  ? 218  GLY B N   1 
ATOM   3523  C  CA  . GLY B  2  213 D 70.967  -104.727 1.190   1.00 87.23  ? 218  GLY B CA  1 
ATOM   3524  C  C   . GLY B  2  213 D 69.939  -104.464 2.278   1.00 86.61  ? 218  GLY B C   1 
ATOM   3525  O  O   . GLY B  2  213 D 68.748  -104.287 2.000   1.00 86.54  ? 218  GLY B O   1 
ATOM   3526  N  N   . GLU B  2  214 E 70.411  -104.434 3.523   1.00 85.88  ? 218  GLU B N   1 
ATOM   3527  C  CA  . GLU B  2  214 E 69.553  -104.202 4.682   1.00 85.04  ? 218  GLU B CA  1 
ATOM   3528  C  C   . GLU B  2  214 E 69.930  -102.891 5.398   1.00 83.81  ? 218  GLU B C   1 
ATOM   3529  O  O   . GLU B  2  214 E 70.953  -102.277 5.085   1.00 83.77  ? 218  GLU B O   1 
ATOM   3530  C  CB  . GLU B  2  214 E 69.598  -105.412 5.632   1.00 85.46  ? 218  GLU B CB  1 
ATOM   3531  C  CG  . GLU B  2  214 E 68.234  -105.777 6.247   1.00 86.44  ? 218  GLU B CG  1 
ATOM   3532  C  CD  . GLU B  2  214 E 68.327  -106.810 7.373   1.00 87.73  ? 218  GLU B CD  1 
ATOM   3533  O  OE1 . GLU B  2  214 E 67.336  -107.541 7.588   1.00 87.96  ? 218  GLU B OE1 1 
ATOM   3534  O  OE2 . GLU B  2  214 E 69.380  -106.894 8.047   1.00 88.22  ? 218  GLU B OE2 1 
ATOM   3535  N  N   . VAL B  2  215 F 69.106  -102.487 6.365   1.00 82.14  ? 218  VAL B N   1 
ATOM   3536  C  CA  . VAL B  2  215 F 69.103  -101.119 6.888   1.00 80.56  ? 218  VAL B CA  1 
ATOM   3537  C  C   . VAL B  2  215 F 69.647  -100.995 8.312   1.00 79.51  ? 218  VAL B C   1 
ATOM   3538  O  O   . VAL B  2  215 F 69.295  -101.783 9.188   1.00 79.61  ? 218  VAL B O   1 
ATOM   3539  C  CB  . VAL B  2  215 F 67.675  -100.534 6.834   1.00 80.51  ? 218  VAL B CB  1 
ATOM   3540  C  CG1 . VAL B  2  215 F 67.657  -99.113  7.330   1.00 80.50  ? 218  VAL B CG1 1 
ATOM   3541  C  CG2 . VAL B  2  215 F 67.135  -100.588 5.415   1.00 80.58  ? 218  VAL B CG2 1 
ATOM   3542  N  N   . TYR B  2  216 ? 70.477  -99.976  8.533   1.00 78.02  ? 220  TYR B N   1 
ATOM   3543  C  CA  . TYR B  2  216 ? 71.170  -99.765  9.804   1.00 76.59  ? 220  TYR B CA  1 
ATOM   3544  C  C   . TYR B  2  216 ? 70.799  -98.434  10.480  1.00 75.53  ? 220  TYR B C   1 
ATOM   3545  O  O   . TYR B  2  216 ? 70.825  -97.381  9.842   1.00 75.34  ? 220  TYR B O   1 
ATOM   3546  C  CB  . TYR B  2  216 ? 72.686  -99.858  9.574   1.00 76.68  ? 220  TYR B CB  1 
ATOM   3547  C  CG  . TYR B  2  216 ? 73.549  -99.509  10.773  1.00 77.22  ? 220  TYR B CG  1 
ATOM   3548  C  CD1 . TYR B  2  216 ? 74.374  -98.379  10.757  1.00 77.61  ? 220  TYR B CD1 1 
ATOM   3549  C  CD2 . TYR B  2  216 ? 73.547  -100.310 11.923  1.00 77.68  ? 220  TYR B CD2 1 
ATOM   3550  C  CE1 . TYR B  2  216 ? 75.176  -98.053  11.860  1.00 78.27  ? 220  TYR B CE1 1 
ATOM   3551  C  CE2 . TYR B  2  216 ? 74.340  -99.993  13.032  1.00 77.96  ? 220  TYR B CE2 1 
ATOM   3552  C  CZ  . TYR B  2  216 ? 75.151  -98.866  12.995  1.00 78.42  ? 220  TYR B CZ  1 
ATOM   3553  O  OH  . TYR B  2  216 ? 75.933  -98.553  14.088  1.00 78.47  ? 220  TYR B OH  1 
ATOM   3554  N  N   . GLN B  2  217 ? 70.450  -98.494  11.767  1.00 74.15  ? 221  GLN B N   1 
ATOM   3555  C  CA  . GLN B  2  217 ? 70.181  -97.301  12.571  1.00 72.92  ? 221  GLN B CA  1 
ATOM   3556  C  C   . GLN B  2  217 ? 71.415  -96.916  13.357  1.00 72.48  ? 221  GLN B C   1 
ATOM   3557  O  O   . GLN B  2  217 ? 71.919  -97.711  14.145  1.00 72.54  ? 221  GLN B O   1 
ATOM   3558  C  CB  . GLN B  2  217 ? 69.088  -97.566  13.590  1.00 72.70  ? 221  GLN B CB  1 
ATOM   3559  C  CG  . GLN B  2  217 ? 67.687  -97.674  13.074  1.00 72.26  ? 221  GLN B CG  1 
ATOM   3560  C  CD  . GLN B  2  217 ? 66.702  -97.805  14.218  1.00 72.31  ? 221  GLN B CD  1 
ATOM   3561  O  OE1 . GLN B  2  217 ? 67.067  -97.640  15.378  1.00 72.20  ? 221  GLN B OE1 1 
ATOM   3562  N  NE2 . GLN B  2  217 ? 65.452  -98.101  13.901  1.00 72.76  ? 221  GLN B NE2 1 
ATOM   3563  N  N   . LYS B  2  218 ? 71.893  -95.692  13.174  1.00 71.92  ? 222  LYS B N   1 
ATOM   3564  C  CA  . LYS B  2  218 ? 73.029  -95.217  13.954  1.00 71.44  ? 222  LYS B CA  1 
ATOM   3565  C  C   . LYS B  2  218 ? 72.596  -94.112  14.902  1.00 71.11  ? 222  LYS B C   1 
ATOM   3566  O  O   . LYS B  2  218 ? 72.254  -93.007  14.465  1.00 70.78  ? 222  LYS B O   1 
ATOM   3567  C  CB  . LYS B  2  218 ? 74.150  -94.725  13.039  1.00 71.49  ? 222  LYS B CB  1 
ATOM   3568  C  CG  . LYS B  2  218 ? 75.497  -94.552  13.723  1.00 71.49  ? 222  LYS B CG  1 
ATOM   3569  C  CD  . LYS B  2  218 ? 76.476  -93.840  12.793  1.00 72.69  ? 222  LYS B CD  1 
ATOM   3570  C  CE  . LYS B  2  218 ? 77.925  -94.214  13.076  1.00 73.77  ? 222  LYS B CE  1 
ATOM   3571  N  NZ  . LYS B  2  218 ? 78.264  -94.024  14.514  1.00 74.52  ? 222  LYS B NZ  1 
ATOM   3572  N  N   . ILE B  2  219 ? 72.589  -94.425  16.196  1.00 70.82  ? 223  ILE B N   1 
ATOM   3573  C  CA  . ILE B  2  219 ? 72.382  -93.402  17.213  1.00 70.66  ? 223  ILE B CA  1 
ATOM   3574  C  C   . ILE B  2  219 ? 73.742  -92.840  17.601  1.00 70.53  ? 223  ILE B C   1 
ATOM   3575  O  O   . ILE B  2  219 ? 74.586  -93.547  18.141  1.00 70.51  ? 223  ILE B O   1 
ATOM   3576  C  CB  . ILE B  2  219 ? 71.572  -93.906  18.431  1.00 70.71  ? 223  ILE B CB  1 
ATOM   3577  C  CG1 . ILE B  2  219 ? 70.119  -94.171  18.003  1.00 70.80  ? 223  ILE B CG1 1 
ATOM   3578  C  CG2 . ILE B  2  219 ? 71.613  -92.867  19.567  1.00 70.03  ? 223  ILE B CG2 1 
ATOM   3579  C  CD1 . ILE B  2  219 ? 69.288  -94.958  19.002  1.00 71.57  ? 223  ILE B CD1 1 
ATOM   3580  N  N   . PHE B  2  220 ? 73.942  -91.566  17.286  1.00 70.43  ? 224  PHE B N   1 
ATOM   3581  C  CA  . PHE B  2  220 ? 75.230  -90.919  17.427  1.00 70.54  ? 224  PHE B CA  1 
ATOM   3582  C  C   . PHE B  2  220 ? 75.638  -90.804  18.885  1.00 70.93  ? 224  PHE B C   1 
ATOM   3583  O  O   . PHE B  2  220 ? 74.892  -90.288  19.718  1.00 70.78  ? 224  PHE B O   1 
ATOM   3584  C  CB  . PHE B  2  220 ? 75.196  -89.534  16.779  1.00 70.40  ? 224  PHE B CB  1 
ATOM   3585  C  CG  . PHE B  2  220 ? 75.318  -89.552  15.277  1.00 69.94  ? 224  PHE B CG  1 
ATOM   3586  C  CD1 . PHE B  2  220 ? 76.426  -88.993  14.657  1.00 69.23  ? 224  PHE B CD1 1 
ATOM   3587  C  CD2 . PHE B  2  220 ? 74.325  -90.116  14.481  1.00 69.67  ? 224  PHE B CD2 1 
ATOM   3588  C  CE1 . PHE B  2  220 ? 76.544  -89.002  13.271  1.00 69.17  ? 224  PHE B CE1 1 
ATOM   3589  C  CE2 . PHE B  2  220 ? 74.440  -90.126  13.090  1.00 69.07  ? 224  PHE B CE2 1 
ATOM   3590  C  CZ  . PHE B  2  220 ? 75.547  -89.571  12.487  1.00 68.56  ? 224  PHE B CZ  1 
ATOM   3591  N  N   . LYS B  2  221 ? 76.823  -91.317  19.186  1.00 71.60  ? 225  LYS B N   1 
ATOM   3592  C  CA  . LYS B  2  221 ? 77.426  -91.153  20.501  1.00 72.38  ? 225  LYS B CA  1 
ATOM   3593  C  C   . LYS B  2  221 ? 77.989  -89.724  20.575  1.00 72.66  ? 225  LYS B C   1 
ATOM   3594  O  O   . LYS B  2  221 ? 78.427  -89.185  19.554  1.00 72.32  ? 225  LYS B O   1 
ATOM   3595  C  CB  . LYS B  2  221 ? 78.507  -92.218  20.732  1.00 72.40  ? 225  LYS B CB  1 
ATOM   3596  C  CG  . LYS B  2  221 ? 77.948  -93.659  20.822  1.00 73.59  ? 225  LYS B CG  1 
ATOM   3597  C  CD  . LYS B  2  221 ? 78.926  -94.743  20.315  1.00 74.88  ? 225  LYS B CD  1 
ATOM   3598  C  CE  . LYS B  2  221 ? 80.123  -94.941  21.260  1.00 76.06  ? 225  LYS B CE  1 
ATOM   3599  N  NZ  . LYS B  2  221 ? 79.724  -95.191  22.687  1.00 76.12  ? 225  LYS B NZ  1 
ATOM   3600  N  N   . PRO B  2  222 ? 77.961  -89.104  21.774  1.00 73.10  ? 226  PRO B N   1 
ATOM   3601  C  CA  . PRO B  2  222 ? 78.362  -87.699  21.925  1.00 73.50  ? 226  PRO B CA  1 
ATOM   3602  C  C   . PRO B  2  222 ? 79.632  -87.330  21.150  1.00 73.92  ? 226  PRO B C   1 
ATOM   3603  O  O   . PRO B  2  222 ? 79.630  -86.342  20.419  1.00 73.85  ? 226  PRO B O   1 
ATOM   3604  C  CB  . PRO B  2  222 ? 78.583  -87.556  23.433  1.00 73.42  ? 226  PRO B CB  1 
ATOM   3605  C  CG  . PRO B  2  222 ? 77.676  -88.562  24.039  1.00 73.29  ? 226  PRO B CG  1 
ATOM   3606  C  CD  . PRO B  2  222 ? 77.566  -89.705  23.064  1.00 73.07  ? 226  PRO B CD  1 
ATOM   3607  N  N   . GLN B  2  223 ? 80.690  -88.128  21.292  1.00 74.59  ? 227  GLN B N   1 
ATOM   3608  C  CA  . GLN B  2  223 ? 81.957  -87.882  20.591  1.00 75.37  ? 227  GLN B CA  1 
ATOM   3609  C  C   . GLN B  2  223 ? 81.755  -87.649  19.085  1.00 75.57  ? 227  GLN B C   1 
ATOM   3610  O  O   . GLN B  2  223 ? 82.338  -86.730  18.507  1.00 75.68  ? 227  GLN B O   1 
ATOM   3611  C  CB  . GLN B  2  223 ? 82.955  -89.029  20.847  1.00 75.55  ? 227  GLN B CB  1 
ATOM   3612  C  CG  . GLN B  2  223 ? 84.347  -88.848  20.213  1.00 76.38  ? 227  GLN B CG  1 
ATOM   3613  C  CD  . GLN B  2  223 ? 85.059  -87.574  20.665  1.00 77.72  ? 227  GLN B CD  1 
ATOM   3614  O  OE1 . GLN B  2  223 ? 85.360  -86.694  19.851  1.00 78.17  ? 227  GLN B OE1 1 
ATOM   3615  N  NE2 . GLN B  2  223 ? 85.321  -87.468  21.966  1.00 77.47  ? 227  GLN B NE2 1 
ATOM   3616  N  N   . GLU B  2  224 ? 80.911  -88.472  18.466  1.00 75.79  ? 228  GLU B N   1 
ATOM   3617  C  CA  . GLU B  2  224 ? 80.654  -88.388  17.031  1.00 76.01  ? 228  GLU B CA  1 
ATOM   3618  C  C   . GLU B  2  224 ? 79.868  -87.136  16.645  1.00 76.15  ? 228  GLU B C   1 
ATOM   3619  O  O   . GLU B  2  224 ? 80.052  -86.610  15.548  1.00 76.33  ? 228  GLU B O   1 
ATOM   3620  C  CB  . GLU B  2  224 ? 79.918  -89.634  16.554  1.00 76.07  ? 228  GLU B CB  1 
ATOM   3621  C  CG  . GLU B  2  224 ? 80.509  -90.915  17.093  1.00 76.59  ? 228  GLU B CG  1 
ATOM   3622  C  CD  . GLU B  2  224 ? 79.686  -92.119  16.731  1.00 77.28  ? 228  GLU B CD  1 
ATOM   3623  O  OE1 . GLU B  2  224 ? 78.601  -92.317  17.325  1.00 77.20  ? 228  GLU B OE1 1 
ATOM   3624  O  OE2 . GLU B  2  224 ? 80.134  -92.872  15.846  1.00 77.75  ? 228  GLU B OE2 1 
ATOM   3625  N  N   . ILE B  2  225 ? 78.990  -86.674  17.538  1.00 76.20  ? 229  ILE B N   1 
ATOM   3626  C  CA  . ILE B  2  225 ? 78.255  -85.425  17.330  1.00 76.25  ? 229  ILE B CA  1 
ATOM   3627  C  C   . ILE B  2  225 ? 79.244  -84.261  17.282  1.00 76.78  ? 229  ILE B C   1 
ATOM   3628  O  O   . ILE B  2  225 ? 79.196  -83.445  16.369  1.00 76.80  ? 229  ILE B O   1 
ATOM   3629  C  CB  . ILE B  2  225 ? 77.155  -85.188  18.410  1.00 76.04  ? 229  ILE B CB  1 
ATOM   3630  C  CG1 . ILE B  2  225 ? 76.055  -86.247  18.310  1.00 75.37  ? 229  ILE B CG1 1 
ATOM   3631  C  CG2 . ILE B  2  225 ? 76.526  -83.807  18.265  1.00 75.79  ? 229  ILE B CG2 1 
ATOM   3632  C  CD1 . ILE B  2  225 ? 75.083  -86.264  19.486  1.00 74.08  ? 229  ILE B CD1 1 
ATOM   3633  N  N   . LYS B  2  226 ? 80.152  -84.211  18.255  1.00 77.48  ? 230  LYS B N   1 
ATOM   3634  C  CA  . LYS B  2  226 ? 81.237  -83.227  18.286  1.00 78.29  ? 230  LYS B CA  1 
ATOM   3635  C  C   . LYS B  2  226 ? 81.993  -83.194  16.951  1.00 78.67  ? 230  LYS B C   1 
ATOM   3636  O  O   . LYS B  2  226 ? 82.248  -82.115  16.417  1.00 78.60  ? 230  LYS B O   1 
ATOM   3637  C  CB  . LYS B  2  226 ? 82.183  -83.530  19.462  1.00 78.48  ? 230  LYS B CB  1 
ATOM   3638  C  CG  . LYS B  2  226 ? 83.406  -82.616  19.623  1.00 79.32  ? 230  LYS B CG  1 
ATOM   3639  C  CD  . LYS B  2  226 ? 84.528  -83.373  20.370  1.00 81.12  ? 230  LYS B CD  1 
ATOM   3640  C  CE  . LYS B  2  226 ? 85.844  -82.578  20.479  1.00 81.11  ? 230  LYS B CE  1 
ATOM   3641  N  NZ  . LYS B  2  226 ? 85.829  -81.617  21.626  1.00 81.07  ? 230  LYS B NZ  1 
ATOM   3642  N  N   . ASP B  2  227 ? 82.320  -84.373  16.413  1.00 79.27  ? 231  ASP B N   1 
ATOM   3643  C  CA  . ASP B  2  227 ? 83.030  -84.492  15.129  1.00 79.97  ? 231  ASP B CA  1 
ATOM   3644  C  C   . ASP B  2  227 ? 82.206  -83.962  13.954  1.00 80.37  ? 231  ASP B C   1 
ATOM   3645  O  O   . ASP B  2  227 ? 82.671  -83.106  13.201  1.00 80.55  ? 231  ASP B O   1 
ATOM   3646  C  CB  . ASP B  2  227 ? 83.463  -85.942  14.857  1.00 79.99  ? 231  ASP B CB  1 
ATOM   3647  C  CG  . ASP B  2  227 ? 84.462  -86.470  15.886  1.00 80.26  ? 231  ASP B CG  1 
ATOM   3648  O  OD1 . ASP B  2  227 ? 84.668  -87.703  15.933  1.00 80.32  ? 231  ASP B OD1 1 
ATOM   3649  O  OD2 . ASP B  2  227 ? 85.040  -85.665  16.651  1.00 80.18  ? 231  ASP B OD2 1 
ATOM   3650  N  N   . ILE B  2  228 ? 80.983  -84.466  13.813  1.00 80.86  ? 232  ILE B N   1 
ATOM   3651  C  CA  . ILE B  2  228 ? 80.071  -84.054  12.738  1.00 81.44  ? 232  ILE B CA  1 
ATOM   3652  C  C   . ILE B  2  228 ? 79.659  -82.571  12.836  1.00 81.76  ? 232  ILE B C   1 
ATOM   3653  O  O   . ILE B  2  228 ? 79.317  -81.944  11.830  1.00 81.81  ? 232  ILE B O   1 
ATOM   3654  C  CB  . ILE B  2  228 ? 78.849  -85.028  12.635  1.00 81.52  ? 232  ILE B CB  1 
ATOM   3655  C  CG1 . ILE B  2  228 ? 79.144  -86.169  11.640  1.00 81.97  ? 232  ILE B CG1 1 
ATOM   3656  C  CG2 . ILE B  2  228 ? 77.572  -84.312  12.229  1.00 81.30  ? 232  ILE B CG2 1 
ATOM   3657  C  CD1 . ILE B  2  228 ? 80.018  -87.320  12.190  1.00 82.07  ? 232  ILE B CD1 1 
ATOM   3658  N  N   . LEU B  2  229 ? 79.725  -82.018  14.045  1.00 82.13  ? 233  LEU B N   1 
ATOM   3659  C  CA  . LEU B  2  229 ? 79.484  -80.596  14.279  1.00 82.40  ? 233  LEU B CA  1 
ATOM   3660  C  C   . LEU B  2  229 ? 80.686  -79.752  13.824  1.00 83.06  ? 233  LEU B C   1 
ATOM   3661  O  O   . LEU B  2  229 ? 80.537  -78.568  13.524  1.00 83.12  ? 233  LEU B O   1 
ATOM   3662  C  CB  . LEU B  2  229 ? 79.169  -80.358  15.762  1.00 82.11  ? 233  LEU B CB  1 
ATOM   3663  C  CG  . LEU B  2  229 ? 78.153  -79.303  16.225  1.00 81.35  ? 233  LEU B CG  1 
ATOM   3664  C  CD1 . LEU B  2  229 ? 76.924  -79.237  15.336  1.00 80.65  ? 233  LEU B CD1 1 
ATOM   3665  C  CD2 . LEU B  2  229 ? 77.742  -79.567  17.666  1.00 80.12  ? 233  LEU B CD2 1 
ATOM   3666  N  N   . VAL B  2  230 ? 81.869  -80.366  13.770  1.00 83.83  ? 234  VAL B N   1 
ATOM   3667  C  CA  . VAL B  2  230 ? 83.073  -79.709  13.237  1.00 84.58  ? 234  VAL B CA  1 
ATOM   3668  C  C   . VAL B  2  230 ? 83.160  -79.844  11.708  1.00 85.09  ? 234  VAL B C   1 
ATOM   3669  O  O   . VAL B  2  230 ? 83.449  -78.860  11.022  1.00 84.89  ? 234  VAL B O   1 
ATOM   3670  C  CB  . VAL B  2  230 ? 84.380  -80.235  13.914  1.00 84.62  ? 234  VAL B CB  1 
ATOM   3671  C  CG1 . VAL B  2  230 ? 85.623  -79.831  13.121  1.00 84.68  ? 234  VAL B CG1 1 
ATOM   3672  C  CG2 . VAL B  2  230 ? 84.484  -79.739  15.351  1.00 84.45  ? 234  VAL B CG2 1 
ATOM   3673  N  N   . LYS B  2  231 ? 82.909  -81.056  11.197  1.00 85.86  ? 235  LYS B N   1 
ATOM   3674  C  CA  . LYS B  2  231 ? 82.922  -81.348  9.750   1.00 86.84  ? 235  LYS B CA  1 
ATOM   3675  C  C   . LYS B  2  231 ? 82.041  -80.379  8.965   1.00 87.23  ? 235  LYS B C   1 
ATOM   3676  O  O   . LYS B  2  231 ? 82.462  -79.834  7.944   1.00 87.38  ? 235  LYS B O   1 
ATOM   3677  C  CB  . LYS B  2  231 ? 82.453  -82.784  9.451   1.00 87.00  ? 235  LYS B CB  1 
ATOM   3678  C  CG  . LYS B  2  231 ? 83.319  -83.923  10.002  1.00 88.09  ? 235  LYS B CG  1 
ATOM   3679  C  CD  . LYS B  2  231 ? 84.511  -84.275  9.094   1.00 89.34  ? 235  LYS B CD  1 
ATOM   3680  C  CE  . LYS B  2  231 ? 85.216  -85.542  9.591   1.00 89.99  ? 235  LYS B CE  1 
ATOM   3681  N  NZ  . LYS B  2  231 ? 86.670  -85.590  9.212   1.00 90.02  ? 235  LYS B NZ  1 
ATOM   3682  N  N   . THR B  2  232 ? 80.817  -80.173  9.451   1.00 87.66  ? 236  THR B N   1 
ATOM   3683  C  CA  . THR B  2  232 ? 79.863  -79.258  8.824   1.00 87.96  ? 236  THR B CA  1 
ATOM   3684  C  C   . THR B  2  232 ? 80.214  -77.793  9.091   1.00 88.14  ? 236  THR B C   1 
ATOM   3685  O  O   . THR B  2  232 ? 79.548  -76.886  8.587   1.00 88.23  ? 236  THR B O   1 
ATOM   3686  C  CB  . THR B  2  232 ? 78.413  -79.538  9.284   1.00 88.05  ? 236  THR B CB  1 
ATOM   3687  O  OG1 . THR B  2  232 ? 78.359  -79.576  10.717  1.00 88.18  ? 236  THR B OG1 1 
ATOM   3688  C  CG2 . THR B  2  232 ? 77.907  -80.868  8.710   1.00 88.15  ? 236  THR B CG2 1 
ATOM   3689  N  N   . GLY B  2  233 ? 81.257  -77.573  9.891   1.00 88.31  ? 237  GLY B N   1 
ATOM   3690  C  CA  . GLY B  2  233 ? 81.782  -76.236  10.142  1.00 88.52  ? 237  GLY B CA  1 
ATOM   3691  C  C   . GLY B  2  233 ? 80.909  -75.372  11.030  1.00 88.65  ? 237  GLY B C   1 
ATOM   3692  O  O   . GLY B  2  233 ? 80.401  -74.340  10.596  1.00 88.59  ? 237  GLY B O   1 
ATOM   3693  N  N   . ILE B  2  234 ? 80.713  -75.818  12.268  1.00 88.83  ? 238  ILE B N   1 
ATOM   3694  C  CA  . ILE B  2  234 ? 80.134  -74.987  13.327  1.00 88.91  ? 238  ILE B CA  1 
ATOM   3695  C  C   . ILE B  2  234 ? 81.025  -75.121  14.570  1.00 89.09  ? 238  ILE B C   1 
ATOM   3696  O  O   . ILE B  2  234 ? 80.687  -74.615  15.643  1.00 88.90  ? 238  ILE B O   1 
ATOM   3697  C  CB  . ILE B  2  234 ? 78.658  -75.369  13.652  1.00 88.83  ? 238  ILE B CB  1 
ATOM   3698  C  CG1 . ILE B  2  234 ? 77.862  -75.649  12.368  1.00 88.74  ? 238  ILE B CG1 1 
ATOM   3699  C  CG2 . ILE B  2  234 ? 77.986  -74.262  14.474  1.00 88.96  ? 238  ILE B CG2 1 
ATOM   3700  C  CD1 . ILE B  2  234 ? 76.499  -76.292  12.582  1.00 88.38  ? 238  ILE B CD1 1 
ATOM   3701  N  N   . THR B  2  235 ? 82.179  -75.778  14.384  1.00 89.43  ? 239  THR B N   1 
ATOM   3702  C  CA  . THR B  2  235 ? 83.118  -76.184  15.452  1.00 89.73  ? 239  THR B CA  1 
ATOM   3703  C  C   . THR B  2  235 ? 82.400  -76.433  16.785  1.00 89.94  ? 239  THR B C   1 
ATOM   3704  O  O   . THR B  2  235 ? 81.332  -77.056  16.817  1.00 89.83  ? 239  THR B O   1 
ATOM   3705  C  CB  . THR B  2  235 ? 84.331  -75.199  15.628  1.00 89.75  ? 239  THR B CB  1 
ATOM   3706  O  OG1 . THR B  2  235 ? 84.706  -74.648  14.362  1.00 90.05  ? 239  THR B OG1 1 
ATOM   3707  C  CG2 . THR B  2  235 ? 85.555  -75.918  16.235  1.00 89.67  ? 239  THR B CG2 1 
ATOM   3708  O  OXT . THR B  2  235 ? 82.857  -76.021  17.857  1.00 90.18  ? 239  THR B OXT 1 
ATOM   3709  N  N   . ARG C  3  4   ? 29.977  -89.688  32.313  1.00 77.78  ? 10   ARG C N   1 
ATOM   3710  C  CA  . ARG C  3  4   ? 29.418  -88.309  32.444  1.00 78.02  ? 10   ARG C CA  1 
ATOM   3711  C  C   . ARG C  3  4   ? 28.862  -87.827  31.108  1.00 78.07  ? 10   ARG C C   1 
ATOM   3712  O  O   . ARG C  3  4   ? 29.496  -88.008  30.062  1.00 78.15  ? 10   ARG C O   1 
ATOM   3713  C  CB  . ARG C  3  4   ? 30.481  -87.328  32.956  1.00 77.93  ? 10   ARG C CB  1 
ATOM   3714  N  N   . ALA C  3  5   ? 27.677  -87.218  31.151  1.00 77.98  ? 11   ALA C N   1 
ATOM   3715  C  CA  . ALA C  3  5   ? 27.025  -86.680  29.952  1.00 77.85  ? 11   ALA C CA  1 
ATOM   3716  C  C   . ALA C  3  5   ? 27.705  -85.390  29.467  1.00 77.79  ? 11   ALA C C   1 
ATOM   3717  O  O   . ALA C  3  5   ? 27.780  -84.398  30.201  1.00 77.85  ? 11   ALA C O   1 
ATOM   3718  C  CB  . ALA C  3  5   ? 25.527  -86.451  30.208  1.00 77.77  ? 11   ALA C CB  1 
ATOM   3719  N  N   . LEU C  3  6   ? 28.217  -85.421  28.236  1.00 77.53  ? 12   LEU C N   1 
ATOM   3720  C  CA  . LEU C  3  6   ? 28.868  -84.255  27.634  1.00 77.18  ? 12   LEU C CA  1 
ATOM   3721  C  C   . LEU C  3  6   ? 27.937  -83.588  26.617  1.00 76.60  ? 12   LEU C C   1 
ATOM   3722  O  O   . LEU C  3  6   ? 27.913  -82.363  26.501  1.00 76.70  ? 12   LEU C O   1 
ATOM   3723  C  CB  . LEU C  3  6   ? 30.217  -84.638  26.991  1.00 77.46  ? 12   LEU C CB  1 
ATOM   3724  C  CG  . LEU C  3  6   ? 31.300  -85.340  27.842  1.00 77.98  ? 12   LEU C CG  1 
ATOM   3725  C  CD1 . LEU C  3  6   ? 32.503  -85.775  26.987  1.00 77.97  ? 12   LEU C CD1 1 
ATOM   3726  C  CD2 . LEU C  3  6   ? 31.772  -84.489  29.038  1.00 78.37  ? 12   LEU C CD2 1 
ATOM   3727  N  N   . SER C  3  7   ? 27.177  -84.409  25.892  1.00 75.80  ? 13   SER C N   1 
ATOM   3728  C  CA  . SER C  3  7   ? 26.150  -83.946  24.960  1.00 75.04  ? 13   SER C CA  1 
ATOM   3729  C  C   . SER C  3  7   ? 24.773  -83.892  25.645  1.00 74.44  ? 13   SER C C   1 
ATOM   3730  O  O   . SER C  3  7   ? 24.154  -84.934  25.880  1.00 74.49  ? 13   SER C O   1 
ATOM   3731  C  CB  . SER C  3  7   ? 26.084  -84.875  23.738  1.00 75.05  ? 13   SER C CB  1 
ATOM   3732  O  OG  . SER C  3  7   ? 27.359  -85.074  23.145  1.00 75.37  ? 13   SER C OG  1 
ATOM   3733  N  N   . ILE C  3  8   ? 24.306  -82.683  25.964  1.00 73.58  ? 14   ILE C N   1 
ATOM   3734  C  CA  . ILE C  3  8   ? 22.988  -82.478  26.596  1.00 72.64  ? 14   ILE C CA  1 
ATOM   3735  C  C   . ILE C  3  8   ? 22.165  -81.370  25.913  1.00 72.01  ? 14   ILE C C   1 
ATOM   3736  O  O   . ILE C  3  8   ? 22.669  -80.663  25.037  1.00 71.80  ? 14   ILE C O   1 
ATOM   3737  C  CB  . ILE C  3  8   ? 23.089  -82.212  28.139  1.00 72.76  ? 14   ILE C CB  1 
ATOM   3738  C  CG1 . ILE C  3  8   ? 23.996  -80.999  28.444  1.00 72.83  ? 14   ILE C CG1 1 
ATOM   3739  C  CG2 . ILE C  3  8   ? 23.522  -83.488  28.885  1.00 72.36  ? 14   ILE C CG2 1 
ATOM   3740  C  CD1 . ILE C  3  8   ? 23.703  -80.288  29.777  1.00 72.54  ? 14   ILE C CD1 1 
ATOM   3741  N  N   . PHE C  3  9   ? 20.901  -81.235  26.320  1.00 71.30  ? 15   PHE C N   1 
ATOM   3742  C  CA  . PHE C  3  9   ? 19.983  -80.260  25.731  1.00 70.73  ? 15   PHE C CA  1 
ATOM   3743  C  C   . PHE C  3  9   ? 20.128  -78.876  26.346  1.00 70.71  ? 15   PHE C C   1 
ATOM   3744  O  O   . PHE C  3  9   ? 20.251  -78.732  27.560  1.00 70.61  ? 15   PHE C O   1 
ATOM   3745  C  CB  . PHE C  3  9   ? 18.525  -80.710  25.876  1.00 70.36  ? 15   PHE C CB  1 
ATOM   3746  C  CG  . PHE C  3  9   ? 18.141  -81.857  24.989  1.00 69.87  ? 15   PHE C CG  1 
ATOM   3747  C  CD1 . PHE C  3  9   ? 18.106  -81.710  23.607  1.00 69.79  ? 15   PHE C CD1 1 
ATOM   3748  C  CD2 . PHE C  3  9   ? 17.790  -83.079  25.534  1.00 69.18  ? 15   PHE C CD2 1 
ATOM   3749  C  CE1 . PHE C  3  9   ? 17.742  -82.774  22.782  1.00 69.22  ? 15   PHE C CE1 1 
ATOM   3750  C  CE2 . PHE C  3  9   ? 17.429  -84.143  24.719  1.00 69.14  ? 15   PHE C CE2 1 
ATOM   3751  C  CZ  . PHE C  3  9   ? 17.404  -83.989  23.340  1.00 68.98  ? 15   PHE C CZ  1 
ATOM   3752  N  N   . SER C  3  10  ? 20.097  -77.866  25.488  1.00 70.76  ? 16   SER C N   1 
ATOM   3753  C  CA  . SER C  3  10  ? 20.071  -76.469  25.889  1.00 70.95  ? 16   SER C CA  1 
ATOM   3754  C  C   . SER C  3  10  ? 18.623  -75.986  26.037  1.00 70.78  ? 16   SER C C   1 
ATOM   3755  O  O   . SER C  3  10  ? 17.730  -76.536  25.389  1.00 70.85  ? 16   SER C O   1 
ATOM   3756  C  CB  . SER C  3  10  ? 20.750  -75.629  24.811  1.00 71.27  ? 16   SER C CB  1 
ATOM   3757  O  OG  . SER C  3  10  ? 19.960  -75.585  23.620  1.00 72.17  ? 16   SER C OG  1 
ATOM   3758  N  N   . PRO C  3  11  ? 18.387  -74.946  26.875  1.00 70.60  ? 17   PRO C N   1 
ATOM   3759  C  CA  . PRO C  3  11  ? 17.086  -74.260  27.001  1.00 70.26  ? 17   PRO C CA  1 
ATOM   3760  C  C   . PRO C  3  11  ? 16.287  -74.030  25.708  1.00 69.81  ? 17   PRO C C   1 
ATOM   3761  O  O   . PRO C  3  11  ? 15.064  -74.086  25.735  1.00 69.80  ? 17   PRO C O   1 
ATOM   3762  C  CB  . PRO C  3  11  ? 17.470  -72.932  27.651  1.00 70.36  ? 17   PRO C CB  1 
ATOM   3763  C  CG  . PRO C  3  11  ? 18.640  -73.304  28.553  1.00 70.42  ? 17   PRO C CG  1 
ATOM   3764  C  CD  . PRO C  3  11  ? 19.305  -74.537  27.962  1.00 70.46  ? 17   PRO C CD  1 
ATOM   3765  N  N   . ASP C  3  12  ? 16.966  -73.784  24.594  1.00 69.50  ? 18   ASP C N   1 
ATOM   3766  C  CA  . ASP C  3  12  ? 16.299  -73.616  23.294  1.00 69.45  ? 18   ASP C CA  1 
ATOM   3767  C  C   . ASP C  3  12  ? 16.060  -74.940  22.527  1.00 68.61  ? 18   ASP C C   1 
ATOM   3768  O  O   . ASP C  3  12  ? 15.341  -74.962  21.521  1.00 68.38  ? 18   ASP C O   1 
ATOM   3769  C  CB  . ASP C  3  12  ? 17.052  -72.592  22.424  1.00 69.97  ? 18   ASP C CB  1 
ATOM   3770  C  CG  . ASP C  3  12  ? 18.554  -72.559  22.717  1.00 72.01  ? 18   ASP C CG  1 
ATOM   3771  O  OD1 . ASP C  3  12  ? 18.933  -72.182  23.856  1.00 74.21  ? 18   ASP C OD1 1 
ATOM   3772  O  OD2 . ASP C  3  12  ? 19.356  -72.910  21.815  1.00 73.66  ? 18   ASP C OD2 1 
ATOM   3773  N  N   . GLY C  3  13  ? 16.659  -76.031  23.007  1.00 67.74  ? 19   GLY C N   1 
ATOM   3774  C  CA  . GLY C  3  13  ? 16.410  -77.368  22.456  1.00 66.70  ? 19   GLY C CA  1 
ATOM   3775  C  C   . GLY C  3  13  ? 17.492  -77.901  21.529  1.00 66.00  ? 19   GLY C C   1 
ATOM   3776  O  O   . GLY C  3  13  ? 17.285  -78.875  20.813  1.00 65.94  ? 19   GLY C O   1 
ATOM   3777  N  N   . HIS C  3  14  ? 18.652  -77.258  21.535  1.00 65.22  ? 20   HIS C N   1 
ATOM   3778  C  CA  . HIS C  3  14  ? 19.769  -77.693  20.706  1.00 64.28  ? 20   HIS C CA  1 
ATOM   3779  C  C   . HIS C  3  14  ? 20.687  -78.579  21.552  1.00 62.74  ? 20   HIS C C   1 
ATOM   3780  O  O   . HIS C  3  14  ? 20.692  -78.479  22.784  1.00 62.34  ? 20   HIS C O   1 
ATOM   3781  C  CB  . HIS C  3  14  ? 20.522  -76.468  20.149  1.00 64.88  ? 20   HIS C CB  1 
ATOM   3782  C  CG  . HIS C  3  14  ? 19.682  -75.589  19.261  1.00 67.48  ? 20   HIS C CG  1 
ATOM   3783  N  ND1 . HIS C  3  14  ? 19.716  -75.668  17.880  1.00 69.95  ? 20   HIS C ND1 1 
ATOM   3784  C  CD2 . HIS C  3  14  ? 18.771  -74.626  19.560  1.00 68.84  ? 20   HIS C CD2 1 
ATOM   3785  C  CE1 . HIS C  3  14  ? 18.872  -74.787  17.369  1.00 70.01  ? 20   HIS C CE1 1 
ATOM   3786  N  NE2 . HIS C  3  14  ? 18.286  -74.141  18.367  1.00 69.68  ? 20   HIS C NE2 1 
ATOM   3787  N  N   . ILE C  3  15  ? 21.434  -79.470  20.907  1.00 60.93  ? 21   ILE C N   1 
ATOM   3788  C  CA  . ILE C  3  15  ? 22.486  -80.194  21.616  1.00 59.17  ? 21   ILE C CA  1 
ATOM   3789  C  C   . ILE C  3  15  ? 23.810  -79.539  21.293  1.00 58.40  ? 21   ILE C C   1 
ATOM   3790  O  O   . ILE C  3  15  ? 24.404  -79.778  20.237  1.00 58.12  ? 21   ILE C O   1 
ATOM   3791  C  CB  . ILE C  3  15  ? 22.537  -81.705  21.291  1.00 59.00  ? 21   ILE C CB  1 
ATOM   3792  C  CG1 . ILE C  3  15  ? 21.195  -82.378  21.603  1.00 58.41  ? 21   ILE C CG1 1 
ATOM   3793  C  CG2 . ILE C  3  15  ? 23.656  -82.363  22.088  1.00 58.20  ? 21   ILE C CG2 1 
ATOM   3794  C  CD1 . ILE C  3  15  ? 21.004  -83.731  20.947  1.00 56.61  ? 21   ILE C CD1 1 
ATOM   3795  N  N   . PHE C  3  16  ? 24.271  -78.713  22.225  1.00 57.67  ? 22   PHE C N   1 
ATOM   3796  C  CA  . PHE C  3  16  ? 25.434  -77.859  21.991  1.00 57.08  ? 22   PHE C CA  1 
ATOM   3797  C  C   . PHE C  3  16  ? 26.655  -78.569  21.401  1.00 55.59  ? 22   PHE C C   1 
ATOM   3798  O  O   . PHE C  3  16  ? 27.249  -78.075  20.442  1.00 55.21  ? 22   PHE C O   1 
ATOM   3799  C  CB  . PHE C  3  16  ? 25.804  -77.073  23.258  1.00 57.78  ? 22   PHE C CB  1 
ATOM   3800  C  CG  . PHE C  3  16  ? 24.980  -75.821  23.463  1.00 60.33  ? 22   PHE C CG  1 
ATOM   3801  C  CD1 . PHE C  3  16  ? 24.591  -75.033  22.372  1.00 61.91  ? 22   PHE C CD1 1 
ATOM   3802  C  CD2 . PHE C  3  16  ? 24.613  -75.417  24.751  1.00 62.76  ? 22   PHE C CD2 1 
ATOM   3803  C  CE1 . PHE C  3  16  ? 23.835  -73.875  22.556  1.00 62.87  ? 22   PHE C CE1 1 
ATOM   3804  C  CE2 . PHE C  3  16  ? 23.863  -74.257  24.949  1.00 63.23  ? 22   PHE C CE2 1 
ATOM   3805  C  CZ  . PHE C  3  16  ? 23.472  -73.485  23.846  1.00 63.65  ? 22   PHE C CZ  1 
ATOM   3806  N  N   . GLN C  3  17  ? 27.010  -79.721  21.966  1.00 54.03  ? 23   GLN C N   1 
ATOM   3807  C  CA  . GLN C  3  17  ? 28.182  -80.472  21.528  1.00 52.74  ? 23   GLN C CA  1 
ATOM   3808  C  C   . GLN C  3  17  ? 28.106  -80.969  20.076  1.00 51.89  ? 23   GLN C C   1 
ATOM   3809  O  O   . GLN C  3  17  ? 29.120  -81.008  19.386  1.00 51.16  ? 23   GLN C O   1 
ATOM   3810  C  CB  . GLN C  3  17  ? 28.469  -81.616  22.498  1.00 52.86  ? 23   GLN C CB  1 
ATOM   3811  C  CG  . GLN C  3  17  ? 29.233  -81.172  23.749  1.00 53.04  ? 23   GLN C CG  1 
ATOM   3812  C  CD  . GLN C  3  17  ? 30.648  -80.700  23.436  1.00 53.08  ? 23   GLN C CD  1 
ATOM   3813  O  OE1 . GLN C  3  17  ? 31.024  -79.574  23.766  1.00 53.59  ? 23   GLN C OE1 1 
ATOM   3814  N  NE2 . GLN C  3  17  ? 31.433  -81.557  22.790  1.00 52.10  ? 23   GLN C NE2 1 
ATOM   3815  N  N   . VAL C  3  18  ? 26.906  -81.329  19.622  1.00 51.05  ? 24   VAL C N   1 
ATOM   3816  C  CA  . VAL C  3  18  ? 26.681  -81.698  18.229  1.00 50.70  ? 24   VAL C CA  1 
ATOM   3817  C  C   . VAL C  3  18  ? 26.820  -80.459  17.348  1.00 50.72  ? 24   VAL C C   1 
ATOM   3818  O  O   . VAL C  3  18  ? 27.428  -80.504  16.273  1.00 50.41  ? 24   VAL C O   1 
ATOM   3819  C  CB  . VAL C  3  18  ? 25.276  -82.348  18.019  1.00 50.82  ? 24   VAL C CB  1 
ATOM   3820  C  CG1 . VAL C  3  18  ? 25.030  -82.700  16.551  1.00 49.75  ? 24   VAL C CG1 1 
ATOM   3821  C  CG2 . VAL C  3  18  ? 25.125  -83.590  18.877  1.00 50.85  ? 24   VAL C CG2 1 
ATOM   3822  N  N   . GLU C  3  19  ? 26.251  -79.350  17.815  1.00 50.92  ? 25   GLU C N   1 
ATOM   3823  C  CA  . GLU C  3  19  ? 26.311  -78.087  17.086  1.00 51.20  ? 25   GLU C CA  1 
ATOM   3824  C  C   . GLU C  3  19  ? 27.761  -77.615  16.917  1.00 50.66  ? 25   GLU C C   1 
ATOM   3825  O  O   . GLU C  3  19  ? 28.136  -77.111  15.857  1.00 50.55  ? 25   GLU C O   1 
ATOM   3826  C  CB  . GLU C  3  19  ? 25.470  -77.031  17.787  1.00 51.45  ? 25   GLU C CB  1 
ATOM   3827  C  CG  . GLU C  3  19  ? 24.522  -76.280  16.865  1.00 54.18  ? 25   GLU C CG  1 
ATOM   3828  C  CD  . GLU C  3  19  ? 23.267  -77.079  16.530  1.00 57.55  ? 25   GLU C CD  1 
ATOM   3829  O  OE1 . GLU C  3  19  ? 22.695  -77.719  17.448  1.00 58.30  ? 25   GLU C OE1 1 
ATOM   3830  O  OE2 . GLU C  3  19  ? 22.850  -77.057  15.344  1.00 59.06  ? 25   GLU C OE2 1 
ATOM   3831  N  N   . TYR C  3  20  ? 28.572  -77.806  17.953  1.00 50.22  ? 26   TYR C N   1 
ATOM   3832  C  CA  . TYR C  3  20  ? 29.978  -77.434  17.891  1.00 50.27  ? 26   TYR C CA  1 
ATOM   3833  C  C   . TYR C  3  20  ? 30.756  -78.427  17.044  1.00 49.81  ? 26   TYR C C   1 
ATOM   3834  O  O   . TYR C  3  20  ? 31.790  -78.081  16.467  1.00 49.60  ? 26   TYR C O   1 
ATOM   3835  C  CB  . TYR C  3  20  ? 30.603  -77.328  19.286  1.00 50.47  ? 26   TYR C CB  1 
ATOM   3836  C  CG  . TYR C  3  20  ? 29.922  -76.351  20.221  1.00 52.61  ? 26   TYR C CG  1 
ATOM   3837  C  CD1 . TYR C  3  20  ? 29.010  -75.407  19.740  1.00 54.57  ? 26   TYR C CD1 1 
ATOM   3838  C  CD2 . TYR C  3  20  ? 30.207  -76.351  21.592  1.00 54.24  ? 26   TYR C CD2 1 
ATOM   3839  C  CE1 . TYR C  3  20  ? 28.380  -74.513  20.594  1.00 56.12  ? 26   TYR C CE1 1 
ATOM   3840  C  CE2 . TYR C  3  20  ? 29.581  -75.456  22.460  1.00 55.14  ? 26   TYR C CE2 1 
ATOM   3841  C  CZ  . TYR C  3  20  ? 28.668  -74.540  21.949  1.00 56.68  ? 26   TYR C CZ  1 
ATOM   3842  O  OH  . TYR C  3  20  ? 28.038  -73.635  22.773  1.00 58.08  ? 26   TYR C OH  1 
ATOM   3843  N  N   . ALA C  3  21  ? 30.259  -79.662  16.973  1.00 49.26  ? 27   ALA C N   1 
ATOM   3844  C  CA  . ALA C  3  21  ? 30.847  -80.666  16.102  1.00 48.61  ? 27   ALA C CA  1 
ATOM   3845  C  C   . ALA C  3  21  ? 30.723  -80.207  14.655  1.00 48.39  ? 27   ALA C C   1 
ATOM   3846  O  O   . ALA C  3  21  ? 31.672  -80.324  13.888  1.00 48.02  ? 27   ALA C O   1 
ATOM   3847  C  CB  . ALA C  3  21  ? 30.197  -82.006  16.307  1.00 48.44  ? 27   ALA C CB  1 
ATOM   3848  N  N   . LEU C  3  22  ? 29.561  -79.654  14.307  1.00 48.60  ? 28   LEU C N   1 
ATOM   3849  C  CA  . LEU C  3  22  ? 29.336  -79.057  12.980  1.00 48.78  ? 28   LEU C CA  1 
ATOM   3850  C  C   . LEU C  3  22  ? 30.297  -77.935  12.650  1.00 48.88  ? 28   LEU C C   1 
ATOM   3851  O  O   . LEU C  3  22  ? 30.718  -77.808  11.501  1.00 48.95  ? 28   LEU C O   1 
ATOM   3852  C  CB  . LEU C  3  22  ? 27.906  -78.563  12.831  1.00 48.63  ? 28   LEU C CB  1 
ATOM   3853  C  CG  . LEU C  3  22  ? 27.001  -79.579  12.149  1.00 49.06  ? 28   LEU C CG  1 
ATOM   3854  C  CD1 . LEU C  3  22  ? 25.540  -79.229  12.394  1.00 49.33  ? 28   LEU C CD1 1 
ATOM   3855  C  CD2 . LEU C  3  22  ? 27.325  -79.671  10.646  1.00 49.81  ? 28   LEU C CD2 1 
ATOM   3856  N  N   . GLU C  3  23  ? 30.638  -77.134  13.660  1.00 49.07  ? 29   GLU C N   1 
ATOM   3857  C  CA  . GLU C  3  23  ? 31.634  -76.073  13.515  1.00 49.54  ? 29   GLU C CA  1 
ATOM   3858  C  C   . GLU C  3  23  ? 32.994  -76.618  13.091  1.00 49.42  ? 29   GLU C C   1 
ATOM   3859  O  O   . GLU C  3  23  ? 33.676  -76.015  12.265  1.00 49.77  ? 29   GLU C O   1 
ATOM   3860  C  CB  . GLU C  3  23  ? 31.770  -75.249  14.808  1.00 49.78  ? 29   GLU C CB  1 
ATOM   3861  C  CG  . GLU C  3  23  ? 30.543  -74.396  15.208  1.00 51.40  ? 29   GLU C CG  1 
ATOM   3862  C  CD  . GLU C  3  23  ? 30.085  -73.413  14.113  1.00 54.10  ? 29   GLU C CD  1 
ATOM   3863  O  OE1 . GLU C  3  23  ? 30.943  -72.784  13.443  1.00 55.25  ? 29   GLU C OE1 1 
ATOM   3864  O  OE2 . GLU C  3  23  ? 28.855  -73.278  13.922  1.00 54.67  ? 29   GLU C OE2 1 
ATOM   3865  N  N   . ALA C  3  24  ? 33.379  -77.759  13.647  1.00 49.57  ? 30   ALA C N   1 
ATOM   3866  C  CA  . ALA C  3  24  ? 34.630  -78.415  13.275  1.00 49.92  ? 30   ALA C CA  1 
ATOM   3867  C  C   . ALA C  3  24  ? 34.634  -78.852  11.809  1.00 50.19  ? 30   ALA C C   1 
ATOM   3868  O  O   . ALA C  3  24  ? 35.655  -78.758  11.127  1.00 50.02  ? 30   ALA C O   1 
ATOM   3869  C  CB  . ALA C  3  24  ? 34.899  -79.600  14.192  1.00 49.94  ? 30   ALA C CB  1 
ATOM   3870  N  N   . VAL C  3  25  ? 33.486  -79.321  11.328  1.00 50.66  ? 31   VAL C N   1 
ATOM   3871  C  CA  . VAL C  3  25  ? 33.328  -79.659  9.920   1.00 51.35  ? 31   VAL C CA  1 
ATOM   3872  C  C   . VAL C  3  25  ? 33.517  -78.413  9.055   1.00 52.20  ? 31   VAL C C   1 
ATOM   3873  O  O   . VAL C  3  25  ? 34.318  -78.436  8.116   1.00 52.25  ? 31   VAL C O   1 
ATOM   3874  C  CB  . VAL C  3  25  ? 31.960  -80.303  9.637   1.00 51.14  ? 31   VAL C CB  1 
ATOM   3875  C  CG1 . VAL C  3  25  ? 31.770  -80.546  8.141   1.00 50.55  ? 31   VAL C CG1 1 
ATOM   3876  C  CG2 . VAL C  3  25  ? 31.832  -81.603  10.406  1.00 50.91  ? 31   VAL C CG2 1 
ATOM   3877  N  N   . LYS C  3  26  ? 32.794  -77.338  9.401   1.00 53.10  ? 32   LYS C N   1 
ATOM   3878  C  CA  . LYS C  3  26  ? 32.908  -76.023  8.747   1.00 54.18  ? 32   LYS C CA  1 
ATOM   3879  C  C   . LYS C  3  26  ? 34.360  -75.572  8.569   1.00 54.57  ? 32   LYS C C   1 
ATOM   3880  O  O   . LYS C  3  26  ? 34.693  -74.927  7.577   1.00 54.36  ? 32   LYS C O   1 
ATOM   3881  C  CB  . LYS C  3  26  ? 32.152  -74.940  9.534   1.00 54.43  ? 32   LYS C CB  1 
ATOM   3882  C  CG  . LYS C  3  26  ? 30.616  -75.041  9.544   1.00 55.53  ? 32   LYS C CG  1 
ATOM   3883  C  CD  . LYS C  3  26  ? 30.013  -73.802  10.232  1.00 57.60  ? 32   LYS C CD  1 
ATOM   3884  C  CE  . LYS C  3  26  ? 28.613  -74.043  10.819  1.00 58.28  ? 32   LYS C CE  1 
ATOM   3885  N  NZ  . LYS C  3  26  ? 27.557  -74.401  9.818   1.00 58.29  ? 32   LYS C NZ  1 
ATOM   3886  N  N   . ARG C  3  27  ? 35.206  -75.918  9.540   1.00 55.05  ? 33   ARG C N   1 
ATOM   3887  C  CA  . ARG C  3  27  ? 36.622  -75.554  9.535   1.00 55.71  ? 33   ARG C CA  1 
ATOM   3888  C  C   . ARG C  3  27  ? 37.472  -76.480  8.665   1.00 55.34  ? 33   ARG C C   1 
ATOM   3889  O  O   . ARG C  3  27  ? 38.562  -76.094  8.229   1.00 55.55  ? 33   ARG C O   1 
ATOM   3890  C  CB  . ARG C  3  27  ? 37.159  -75.533  10.974  1.00 56.20  ? 33   ARG C CB  1 
ATOM   3891  C  CG  . ARG C  3  27  ? 38.686  -75.581  11.123  1.00 59.08  ? 33   ARG C CG  1 
ATOM   3892  C  CD  . ARG C  3  27  ? 39.134  -75.317  12.565  1.00 64.16  ? 33   ARG C CD  1 
ATOM   3893  N  NE  . ARG C  3  27  ? 38.582  -74.055  13.067  1.00 67.93  ? 33   ARG C NE  1 
ATOM   3894  C  CZ  . ARG C  3  27  ? 37.497  -73.962  13.838  1.00 70.14  ? 33   ARG C CZ  1 
ATOM   3895  N  NH1 . ARG C  3  27  ? 36.847  -75.061  14.223  1.00 70.84  ? 33   ARG C NH1 1 
ATOM   3896  N  NH2 . ARG C  3  27  ? 37.063  -72.768  14.236  1.00 70.66  ? 33   ARG C NH2 1 
ATOM   3897  N  N   . GLY C  3  28  ? 36.983  -77.697  8.427   1.00 54.83  ? 34   GLY C N   1 
ATOM   3898  C  CA  . GLY C  3  28  ? 37.723  -78.680  7.637   1.00 53.69  ? 34   GLY C CA  1 
ATOM   3899  C  C   . GLY C  3  28  ? 37.823  -78.281  6.180   1.00 53.03  ? 34   GLY C C   1 
ATOM   3900  O  O   . GLY C  3  28  ? 37.005  -77.506  5.688   1.00 52.89  ? 34   GLY C O   1 
ATOM   3901  N  N   . THR C  3  29  ? 38.835  -78.806  5.496   1.00 52.51  ? 35   THR C N   1 
ATOM   3902  C  CA  . THR C  3  29  ? 38.994  -78.620  4.050   1.00 52.24  ? 35   THR C CA  1 
ATOM   3903  C  C   . THR C  3  29  ? 37.742  -79.073  3.289   1.00 52.07  ? 35   THR C C   1 
ATOM   3904  O  O   . THR C  3  29  ? 37.039  -79.986  3.720   1.00 52.31  ? 35   THR C O   1 
ATOM   3905  C  CB  . THR C  3  29  ? 40.243  -79.359  3.508   1.00 52.29  ? 35   THR C CB  1 
ATOM   3906  O  OG1 . THR C  3  29  ? 39.985  -80.763  3.424   1.00 52.43  ? 35   THR C OG1 1 
ATOM   3907  C  CG2 . THR C  3  29  ? 41.453  -79.128  4.410   1.00 52.42  ? 35   THR C CG2 1 
ATOM   3908  N  N   . CYS C  3  30  ? 37.462  -78.427  2.163   1.00 51.88  ? 36   CYS C N   1 
ATOM   3909  C  CA  . CYS C  3  30  ? 36.225  -78.669  1.410   1.00 51.51  ? 36   CYS C CA  1 
ATOM   3910  C  C   . CYS C  3  30  ? 36.229  -80.001  0.658   1.00 51.01  ? 36   CYS C C   1 
ATOM   3911  O  O   . CYS C  3  30  ? 37.228  -80.386  0.036   1.00 51.22  ? 36   CYS C O   1 
ATOM   3912  C  CB  . CYS C  3  30  ? 35.957  -77.513  0.431   1.00 51.64  ? 36   CYS C CB  1 
ATOM   3913  S  SG  . CYS C  3  30  ? 34.406  -77.641  -0.519  1.00 52.31  ? 36   CYS C SG  1 
ATOM   3914  N  N   . ALA C  3  31  ? 35.100  -80.698  0.714   1.00 50.34  ? 37   ALA C N   1 
ATOM   3915  C  CA  . ALA C  3  31  ? 34.907  -81.898  -0.092  1.00 49.85  ? 37   ALA C CA  1 
ATOM   3916  C  C   . ALA C  3  31  ? 33.607  -81.788  -0.854  1.00 49.31  ? 37   ALA C C   1 
ATOM   3917  O  O   . ALA C  3  31  ? 32.629  -81.233  -0.358  1.00 49.01  ? 37   ALA C O   1 
ATOM   3918  C  CB  . ALA C  3  31  ? 34.922  -83.154  0.771   1.00 49.73  ? 37   ALA C CB  1 
ATOM   3919  N  N   . VAL C  3  32  ? 33.609  -82.317  -2.066  1.00 49.00  ? 38   VAL C N   1 
ATOM   3920  C  CA  . VAL C  3  32  ? 32.449  -82.247  -2.923  1.00 49.21  ? 38   VAL C CA  1 
ATOM   3921  C  C   . VAL C  3  32  ? 32.286  -83.562  -3.696  1.00 49.63  ? 38   VAL C C   1 
ATOM   3922  O  O   . VAL C  3  32  ? 33.276  -84.237  -4.040  1.00 49.78  ? 38   VAL C O   1 
ATOM   3923  C  CB  . VAL C  3  32  ? 32.545  -81.029  -3.885  1.00 49.03  ? 38   VAL C CB  1 
ATOM   3924  C  CG1 . VAL C  3  32  ? 33.786  -81.121  -4.751  1.00 49.21  ? 38   VAL C CG1 1 
ATOM   3925  C  CG2 . VAL C  3  32  ? 31.318  -80.916  -4.758  1.00 48.64  ? 38   VAL C CG2 1 
ATOM   3926  N  N   . GLY C  3  33  ? 31.037  -83.929  -3.951  1.00 49.61  ? 39   GLY C N   1 
ATOM   3927  C  CA  . GLY C  3  33  ? 30.748  -85.053  -4.811  1.00 50.44  ? 39   GLY C CA  1 
ATOM   3928  C  C   . GLY C  3  33  ? 29.587  -84.731  -5.717  1.00 51.16  ? 39   GLY C C   1 
ATOM   3929  O  O   . GLY C  3  33  ? 28.608  -84.118  -5.284  1.00 51.24  ? 39   GLY C O   1 
ATOM   3930  N  N   . VAL C  3  34  ? 29.698  -85.127  -6.983  1.00 51.72  ? 40   VAL C N   1 
ATOM   3931  C  CA  . VAL C  3  34  ? 28.588  -84.976  -7.927  1.00 52.47  ? 40   VAL C CA  1 
ATOM   3932  C  C   . VAL C  3  34  ? 28.393  -86.296  -8.643  1.00 52.81  ? 40   VAL C C   1 
ATOM   3933  O  O   . VAL C  3  34  ? 29.360  -87.022  -8.871  1.00 52.71  ? 40   VAL C O   1 
ATOM   3934  C  CB  . VAL C  3  34  ? 28.801  -83.798  -8.961  1.00 52.64  ? 40   VAL C CB  1 
ATOM   3935  C  CG1 . VAL C  3  34  ? 29.205  -82.504  -8.258  1.00 52.90  ? 40   VAL C CG1 1 
ATOM   3936  C  CG2 . VAL C  3  34  ? 29.830  -84.145  -10.015 1.00 52.24  ? 40   VAL C CG2 1 
ATOM   3937  N  N   . LYS C  3  35  ? 27.158  -86.628  -8.994  1.00 53.43  ? 41   LYS C N   1 
ATOM   3938  C  CA  . LYS C  3  35  ? 26.960  -87.887  -9.684  1.00 54.62  ? 41   LYS C CA  1 
ATOM   3939  C  C   . LYS C  3  35  ? 26.562  -87.754  -11.147 1.00 56.03  ? 41   LYS C C   1 
ATOM   3940  O  O   . LYS C  3  35  ? 25.660  -86.983  -11.502 1.00 56.47  ? 41   LYS C O   1 
ATOM   3941  C  CB  . LYS C  3  35  ? 26.068  -88.864  -8.890  1.00 54.53  ? 41   LYS C CB  1 
ATOM   3942  C  CG  . LYS C  3  35  ? 24.574  -88.617  -8.821  1.00 53.03  ? 41   LYS C CG  1 
ATOM   3943  C  CD  . LYS C  3  35  ? 23.999  -89.443  -7.663  1.00 50.63  ? 41   LYS C CD  1 
ATOM   3944  C  CE  . LYS C  3  35  ? 22.502  -89.644  -7.794  1.00 50.42  ? 41   LYS C CE  1 
ATOM   3945  N  NZ  . LYS C  3  35  ? 21.887  -90.009  -6.502  1.00 49.32  ? 41   LYS C NZ  1 
ATOM   3946  N  N   . GLY C  3  36  ? 27.275  -88.504  -11.985 1.00 57.19  ? 42   GLY C N   1 
ATOM   3947  C  CA  . GLY C  3  36  ? 27.005  -88.569  -13.416 1.00 58.75  ? 42   GLY C CA  1 
ATOM   3948  C  C   . GLY C  3  36  ? 25.814  -89.452  -13.734 1.00 59.83  ? 42   GLY C C   1 
ATOM   3949  O  O   . GLY C  3  36  ? 24.993  -89.761  -12.864 1.00 59.82  ? 42   GLY C O   1 
ATOM   3950  N  N   . LYS C  3  37  ? 25.712  -89.848  -14.994 1.00 61.12  ? 43   LYS C N   1 
ATOM   3951  C  CA  . LYS C  3  37  ? 24.619  -90.704  -15.429 1.00 62.65  ? 43   LYS C CA  1 
ATOM   3952  C  C   . LYS C  3  37  ? 25.048  -92.152  -15.251 1.00 63.16  ? 43   LYS C C   1 
ATOM   3953  O  O   . LYS C  3  37  ? 24.217  -93.040  -15.058 1.00 63.16  ? 43   LYS C O   1 
ATOM   3954  C  CB  . LYS C  3  37  ? 24.268  -90.419  -16.893 1.00 62.79  ? 43   LYS C CB  1 
ATOM   3955  C  CG  . LYS C  3  37  ? 22.902  -90.924  -17.309 1.00 64.22  ? 43   LYS C CG  1 
ATOM   3956  C  CD  . LYS C  3  37  ? 22.885  -91.268  -18.787 1.00 66.81  ? 43   LYS C CD  1 
ATOM   3957  C  CE  . LYS C  3  37  ? 21.551  -91.866  -19.197 1.00 67.86  ? 43   LYS C CE  1 
ATOM   3958  N  NZ  . LYS C  3  37  ? 21.615  -92.388  -20.589 1.00 69.29  ? 43   LYS C NZ  1 
ATOM   3959  N  N   . ASN C  3  38  ? 26.360  -92.363  -15.324 1.00 63.90  ? 44   ASN C N   1 
ATOM   3960  C  CA  . ASN C  3  38  ? 26.968  -93.674  -15.158 1.00 64.67  ? 44   ASN C CA  1 
ATOM   3961  C  C   . ASN C  3  38  ? 28.255  -93.597  -14.340 1.00 64.68  ? 44   ASN C C   1 
ATOM   3962  O  O   . ASN C  3  38  ? 29.158  -94.412  -14.524 1.00 64.60  ? 44   ASN C O   1 
ATOM   3963  C  CB  . ASN C  3  38  ? 27.216  -94.347  -16.525 1.00 65.21  ? 44   ASN C CB  1 
ATOM   3964  C  CG  . ASN C  3  38  ? 27.796  -93.385  -17.571 1.00 66.53  ? 44   ASN C CG  1 
ATOM   3965  O  OD1 . ASN C  3  38  ? 27.064  -92.892  -18.439 1.00 68.70  ? 44   ASN C OD1 1 
ATOM   3966  N  ND2 . ASN C  3  38  ? 29.108  -93.114  -17.490 1.00 66.08  ? 44   ASN C ND2 1 
ATOM   3967  N  N   . CYS C  3  39  ? 28.333  -92.610  -13.445 1.00 64.85  ? 45   CYS C N   1 
ATOM   3968  C  CA  . CYS C  3  39  ? 29.467  -92.481  -12.522 1.00 65.38  ? 45   CYS C CA  1 
ATOM   3969  C  C   . CYS C  3  39  ? 29.183  -91.543  -11.343 1.00 65.21  ? 45   CYS C C   1 
ATOM   3970  O  O   . CYS C  3  39  ? 28.124  -90.923  -11.279 1.00 65.13  ? 45   CYS C O   1 
ATOM   3971  C  CB  . CYS C  3  39  ? 30.729  -92.026  -13.264 1.00 65.43  ? 45   CYS C CB  1 
ATOM   3972  S  SG  . CYS C  3  39  ? 30.732  -90.275  -13.699 1.00 67.93  ? 45   CYS C SG  1 
ATOM   3973  N  N   . VAL C  3  40  ? 30.129  -91.476  -10.406 1.00 65.19  ? 46   VAL C N   1 
ATOM   3974  C  CA  . VAL C  3  40  ? 30.146  -90.463  -9.348  1.00 65.50  ? 46   VAL C CA  1 
ATOM   3975  C  C   . VAL C  3  40  ? 31.593  -89.990  -9.198  1.00 65.97  ? 46   VAL C C   1 
ATOM   3976  O  O   . VAL C  3  40  ? 32.524  -90.808  -9.205  1.00 65.85  ? 46   VAL C O   1 
ATOM   3977  C  CB  . VAL C  3  40  ? 29.646  -90.986  -7.958  1.00 65.43  ? 46   VAL C CB  1 
ATOM   3978  C  CG1 . VAL C  3  40  ? 29.590  -89.852  -6.944  1.00 64.88  ? 46   VAL C CG1 1 
ATOM   3979  C  CG2 . VAL C  3  40  ? 28.287  -91.635  -8.048  1.00 65.11  ? 46   VAL C CG2 1 
ATOM   3980  N  N   . VAL C  3  41  ? 31.780  -88.676  -9.067  1.00 66.39  ? 47   VAL C N   1 
ATOM   3981  C  CA  . VAL C  3  41  ? 33.111  -88.104  -8.877  1.00 66.86  ? 47   VAL C CA  1 
ATOM   3982  C  C   . VAL C  3  41  ? 33.224  -87.503  -7.481  1.00 67.28  ? 47   VAL C C   1 
ATOM   3983  O  O   . VAL C  3  41  ? 32.298  -86.847  -7.005  1.00 67.07  ? 47   VAL C O   1 
ATOM   3984  C  CB  . VAL C  3  41  ? 33.454  -87.049  -9.968  1.00 66.91  ? 47   VAL C CB  1 
ATOM   3985  C  CG1 . VAL C  3  41  ? 34.894  -86.581  -9.835  1.00 66.71  ? 47   VAL C CG1 1 
ATOM   3986  C  CG2 . VAL C  3  41  ? 33.229  -87.623  -11.365 1.00 66.58  ? 47   VAL C CG2 1 
ATOM   3987  N  N   . LEU C  3  42  ? 34.358  -87.753  -6.831  1.00 68.27  ? 48   LEU C N   1 
ATOM   3988  C  CA  . LEU C  3  42  ? 34.643  -87.227  -5.498  1.00 69.29  ? 48   LEU C CA  1 
ATOM   3989  C  C   . LEU C  3  42  ? 35.844  -86.307  -5.531  1.00 70.27  ? 48   LEU C C   1 
ATOM   3990  O  O   . LEU C  3  42  ? 36.941  -86.733  -5.903  1.00 70.35  ? 48   LEU C O   1 
ATOM   3991  C  CB  . LEU C  3  42  ? 34.923  -88.361  -4.512  1.00 69.03  ? 48   LEU C CB  1 
ATOM   3992  C  CG  . LEU C  3  42  ? 33.796  -89.086  -3.780  1.00 68.70  ? 48   LEU C CG  1 
ATOM   3993  C  CD1 . LEU C  3  42  ? 34.372  -89.639  -2.489  1.00 69.28  ? 48   LEU C CD1 1 
ATOM   3994  C  CD2 . LEU C  3  42  ? 32.629  -88.177  -3.466  1.00 68.05  ? 48   LEU C CD2 1 
ATOM   3995  N  N   . GLY C  3  43  ? 35.639  -85.056  -5.126  1.00 71.52  ? 49   GLY C N   1 
ATOM   3996  C  CA  . GLY C  3  43  ? 36.706  -84.057  -5.127  1.00 73.29  ? 49   GLY C CA  1 
ATOM   3997  C  C   . GLY C  3  43  ? 36.946  -83.423  -3.776  1.00 74.61  ? 49   GLY C C   1 
ATOM   3998  O  O   . GLY C  3  43  ? 36.006  -83.155  -3.029  1.00 74.44  ? 49   GLY C O   1 
ATOM   3999  N  N   . CYS C  3  44  ? 38.215  -83.181  -3.470  1.00 76.34  ? 50   CYS C N   1 
ATOM   4000  C  CA  . CYS C  3  44  ? 38.613  -82.577  -2.199  1.00 78.68  ? 50   CYS C CA  1 
ATOM   4001  C  C   . CYS C  3  44  ? 39.711  -81.532  -2.412  1.00 79.90  ? 50   CYS C C   1 
ATOM   4002  O  O   . CYS C  3  44  ? 40.452  -81.600  -3.396  1.00 80.01  ? 50   CYS C O   1 
ATOM   4003  C  CB  . CYS C  3  44  ? 39.123  -83.651  -1.230  1.00 78.70  ? 50   CYS C CB  1 
ATOM   4004  S  SG  . CYS C  3  44  ? 38.037  -85.088  -1.017  1.00 80.39  ? 50   CYS C SG  1 
ATOM   4005  N  N   . GLU C  3  45  ? 39.820  -80.575  -1.489  1.00 81.57  ? 51   GLU C N   1 
ATOM   4006  C  CA  . GLU C  3  45  ? 40.917  -79.603  -1.527  1.00 83.14  ? 51   GLU C CA  1 
ATOM   4007  C  C   . GLU C  3  45  ? 42.037  -79.967  -0.544  1.00 84.43  ? 51   GLU C C   1 
ATOM   4008  O  O   . GLU C  3  45  ? 41.779  -80.597  0.487   1.00 84.45  ? 51   GLU C O   1 
ATOM   4009  C  CB  . GLU C  3  45  ? 40.411  -78.167  -1.296  1.00 82.95  ? 51   GLU C CB  1 
ATOM   4010  C  CG  . GLU C  3  45  ? 39.738  -77.907  0.047   1.00 82.78  ? 51   GLU C CG  1 
ATOM   4011  C  CD  . GLU C  3  45  ? 39.842  -76.453  0.508   1.00 82.49  ? 51   GLU C CD  1 
ATOM   4012  O  OE1 . GLU C  3  45  ? 40.906  -75.827  0.306   1.00 81.90  ? 51   GLU C OE1 1 
ATOM   4013  O  OE2 . GLU C  3  45  ? 38.863  -75.939  1.095   1.00 82.36  ? 51   GLU C OE2 1 
ATOM   4014  N  N   . ARG C  3  46  ? 43.271  -79.580  -0.879  1.00 86.15  ? 52   ARG C N   1 
ATOM   4015  C  CA  . ARG C  3  46  ? 44.436  -79.774  -0.001  1.00 88.01  ? 52   ARG C CA  1 
ATOM   4016  C  C   . ARG C  3  46  ? 44.841  -78.501  0.740   1.00 88.82  ? 52   ARG C C   1 
ATOM   4017  O  O   . ARG C  3  46  ? 45.003  -77.443  0.127   1.00 88.73  ? 52   ARG C O   1 
ATOM   4018  C  CB  . ARG C  3  46  ? 45.637  -80.292  -0.788  1.00 88.28  ? 52   ARG C CB  1 
ATOM   4019  C  CG  . ARG C  3  46  ? 45.801  -81.796  -0.761  1.00 90.22  ? 52   ARG C CG  1 
ATOM   4020  C  CD  . ARG C  3  46  ? 47.077  -82.195  -1.486  1.00 93.40  ? 52   ARG C CD  1 
ATOM   4021  N  NE  . ARG C  3  46  ? 47.033  -83.586  -1.940  1.00 95.96  ? 52   ARG C NE  1 
ATOM   4022  C  CZ  . ARG C  3  46  ? 47.615  -84.037  -3.052  1.00 97.33  ? 52   ARG C CZ  1 
ATOM   4023  N  NH1 . ARG C  3  46  ? 48.290  -83.210  -3.849  1.00 97.92  ? 52   ARG C NH1 1 
ATOM   4024  N  NH2 . ARG C  3  46  ? 47.515  -85.321  -3.374  1.00 97.77  ? 52   ARG C NH2 1 
ATOM   4025  N  N   . ARG C  3  47  ? 45.027  -78.631  2.057   1.00 90.12  ? 53   ARG C N   1 
ATOM   4026  C  CA  . ARG C  3  47  ? 45.359  -77.505  2.947   1.00 91.26  ? 53   ARG C CA  1 
ATOM   4027  C  C   . ARG C  3  47  ? 46.713  -76.866  2.594   1.00 91.82  ? 53   ARG C C   1 
ATOM   4028  O  O   . ARG C  3  47  ? 47.559  -77.495  1.939   1.00 91.86  ? 53   ARG C O   1 
ATOM   4029  C  CB  . ARG C  3  47  ? 45.345  -77.965  4.417   1.00 91.40  ? 53   ARG C CB  1 
ATOM   4030  C  CG  . ARG C  3  47  ? 44.618  -77.013  5.381   1.00 92.38  ? 53   ARG C CG  1 
ATOM   4031  C  CD  . ARG C  3  47  ? 44.937  -77.321  6.857   1.00 94.13  ? 53   ARG C CD  1 
ATOM   4032  N  NE  . ARG C  3  47  ? 44.326  -78.561  7.359   1.00 95.08  ? 53   ARG C NE  1 
ATOM   4033  C  CZ  . ARG C  3  47  ? 44.569  -79.099  8.558   1.00 95.44  ? 53   ARG C CZ  1 
ATOM   4034  N  NH1 . ARG C  3  47  ? 45.419  -78.520  9.403   1.00 95.36  ? 53   ARG C NH1 1 
ATOM   4035  N  NH2 . ARG C  3  47  ? 43.961  -80.227  8.913   1.00 95.46  ? 53   ARG C NH2 1 
ATOM   4036  N  N   . SER C  3  48  ? 46.904  -75.616  3.030   1.00 92.46  ? 54   SER C N   1 
ATOM   4037  C  CA  . SER C  3  48  ? 48.129  -74.848  2.742   1.00 92.77  ? 54   SER C CA  1 
ATOM   4038  C  C   . SER C  3  48  ? 48.874  -74.304  3.974   1.00 93.04  ? 54   SER C C   1 
ATOM   4039  O  O   . SER C  3  48  ? 49.719  -73.415  3.830   1.00 92.95  ? 54   SER C O   1 
ATOM   4040  C  CB  . SER C  3  48  ? 47.825  -73.703  1.768   1.00 92.69  ? 54   SER C CB  1 
ATOM   4041  O  OG  . SER C  3  48  ? 47.670  -74.193  0.450   1.00 92.67  ? 54   SER C OG  1 
ATOM   4042  N  N   . THR C  3  49  ? 48.559  -74.829  5.167   1.00 93.41  ? 55   THR C N   1 
ATOM   4043  C  CA  . THR C  3  49  ? 49.274  -74.472  6.413   1.00 93.71  ? 55   THR C CA  1 
ATOM   4044  C  C   . THR C  3  49  ? 50.788  -74.618  6.188   1.00 93.60  ? 55   THR C C   1 
ATOM   4045  O  O   . THR C  3  49  ? 51.513  -73.623  6.021   1.00 93.72  ? 55   THR C O   1 
ATOM   4046  C  CB  . THR C  3  49  ? 48.850  -75.358  7.652   1.00 93.89  ? 55   THR C CB  1 
ATOM   4047  O  OG1 . THR C  3  49  ? 47.478  -75.761  7.546   1.00 94.11  ? 55   THR C OG1 1 
ATOM   4048  C  CG2 . THR C  3  49  ? 49.083  -74.615  8.989   1.00 94.06  ? 55   THR C CG2 1 
ATOM   4049  N  N   . LEU C  3  50  ? 51.245  -75.872  6.178   1.00 93.16  ? 56   LEU C N   1 
ATOM   4050  C  CA  . LEU C  3  50  ? 52.621  -76.215  5.839   1.00 92.50  ? 56   LEU C CA  1 
ATOM   4051  C  C   . LEU C  3  50  ? 52.636  -77.036  4.539   1.00 91.84  ? 56   LEU C C   1 
ATOM   4052  O  O   . LEU C  3  50  ? 51.697  -77.795  4.246   1.00 91.85  ? 56   LEU C O   1 
ATOM   4053  C  CB  . LEU C  3  50  ? 53.307  -76.981  6.992   1.00 92.56  ? 56   LEU C CB  1 
ATOM   4054  C  CG  . LEU C  3  50  ? 53.447  -76.421  8.427   1.00 92.86  ? 56   LEU C CG  1 
ATOM   4055  C  CD1 . LEU C  3  50  ? 53.887  -74.939  8.466   1.00 92.82  ? 56   LEU C CD1 1 
ATOM   4056  C  CD2 . LEU C  3  50  ? 52.190  -76.642  9.287   1.00 92.57  ? 56   LEU C CD2 1 
ATOM   4057  N  N   . LYS C  3  51  ? 53.692  -76.846  3.751   1.00 90.67  ? 57   LYS C N   1 
ATOM   4058  C  CA  . LYS C  3  51  ? 53.963  -77.683  2.591   1.00 89.47  ? 57   LYS C CA  1 
ATOM   4059  C  C   . LYS C  3  51  ? 55.393  -78.215  2.752   1.00 88.62  ? 57   LYS C C   1 
ATOM   4060  O  O   . LYS C  3  51  ? 56.133  -77.759  3.639   1.00 88.52  ? 57   LYS C O   1 
ATOM   4061  C  CB  . LYS C  3  51  ? 53.778  -76.890  1.289   1.00 89.57  ? 57   LYS C CB  1 
ATOM   4062  C  CG  . LYS C  3  51  ? 53.529  -77.733  0.022   1.00 89.34  ? 57   LYS C CG  1 
ATOM   4063  C  CD  . LYS C  3  51  ? 54.820  -78.307  -0.596  1.00 88.49  ? 57   LYS C CD  1 
ATOM   4064  C  CE  . LYS C  3  51  ? 55.918  -77.246  -0.747  1.00 87.76  ? 57   LYS C CE  1 
ATOM   4065  N  NZ  . LYS C  3  51  ? 57.278  -77.837  -0.640  1.00 87.00  ? 57   LYS C NZ  1 
ATOM   4066  N  N   . LEU C  3  52  ? 55.758  -79.172  1.893   1.00 87.27  ? 58   LEU C N   1 
ATOM   4067  C  CA  . LEU C  3  52  ? 56.990  -79.968  1.973   1.00 85.77  ? 58   LEU C CA  1 
ATOM   4068  C  C   . LEU C  3  52  ? 56.561  -81.398  2.289   1.00 84.87  ? 58   LEU C C   1 
ATOM   4069  O  O   . LEU C  3  52  ? 57.332  -82.211  2.804   1.00 84.57  ? 58   LEU C O   1 
ATOM   4070  C  CB  . LEU C  3  52  ? 57.963  -79.420  3.023   1.00 85.65  ? 58   LEU C CB  1 
ATOM   4071  C  CG  . LEU C  3  52  ? 59.457  -79.644  2.833   1.00 85.20  ? 58   LEU C CG  1 
ATOM   4072  C  CD1 . LEU C  3  52  ? 59.877  -79.304  1.420   1.00 85.77  ? 58   LEU C CD1 1 
ATOM   4073  C  CD2 . LEU C  3  52  ? 60.213  -78.796  3.829   1.00 84.64  ? 58   LEU C CD2 1 
ATOM   4074  N  N   . GLN C  3  53  ? 55.302  -81.680  1.961   1.00 83.80  ? 59   GLN C N   1 
ATOM   4075  C  CA  . GLN C  3  53  ? 54.687  -82.973  2.202   1.00 82.82  ? 59   GLN C CA  1 
ATOM   4076  C  C   . GLN C  3  53  ? 55.161  -84.019  1.209   1.00 82.38  ? 59   GLN C C   1 
ATOM   4077  O  O   . GLN C  3  53  ? 55.502  -83.701  0.063   1.00 82.31  ? 59   GLN C O   1 
ATOM   4078  C  CB  . GLN C  3  53  ? 53.165  -82.862  2.141   1.00 82.60  ? 59   GLN C CB  1 
ATOM   4079  C  CG  . GLN C  3  53  ? 52.569  -82.004  3.243   1.00 82.48  ? 59   GLN C CG  1 
ATOM   4080  C  CD  . GLN C  3  53  ? 51.187  -82.463  3.674   1.00 82.14  ? 59   GLN C CD  1 
ATOM   4081  O  OE1 . GLN C  3  53  ? 50.708  -83.520  3.260   1.00 81.76  ? 59   GLN C OE1 1 
ATOM   4082  N  NE2 . GLN C  3  53  ? 50.540  -81.667  4.517   1.00 82.01  ? 59   GLN C NE2 1 
ATOM   4083  N  N   . ASP C  3  54  ? 55.195  -85.264  1.679   1.00 81.67  ? 60   ASP C N   1 
ATOM   4084  C  CA  . ASP C  3  54  ? 55.443  -86.429  0.849   1.00 80.86  ? 60   ASP C CA  1 
ATOM   4085  C  C   . ASP C  3  54  ? 54.071  -86.965  0.465   1.00 80.34  ? 60   ASP C C   1 
ATOM   4086  O  O   . ASP C  3  54  ? 53.359  -87.493  1.314   1.00 80.42  ? 60   ASP C O   1 
ATOM   4087  C  CB  . ASP C  3  54  ? 56.227  -87.470  1.660   1.00 80.92  ? 60   ASP C CB  1 
ATOM   4088  C  CG  . ASP C  3  54  ? 56.791  -88.601  0.804   1.00 80.96  ? 60   ASP C CG  1 
ATOM   4089  O  OD1 . ASP C  3  54  ? 57.464  -89.493  1.373   1.00 80.94  ? 60   ASP C OD1 1 
ATOM   4090  O  OD2 . ASP C  3  54  ? 56.575  -88.606  -0.426  1.00 81.42  ? 60   ASP C OD2 1 
ATOM   4091  N  N   . THR C  3  55  ? 53.679  -86.795  -0.796  1.00 79.72  ? 61   THR C N   1 
ATOM   4092  C  CA  . THR C  3  55  ? 52.323  -87.180  -1.234  1.00 79.16  ? 61   THR C CA  1 
ATOM   4093  C  C   . THR C  3  55  ? 52.118  -88.683  -1.387  1.00 78.47  ? 61   THR C C   1 
ATOM   4094  O  O   . THR C  3  55  ? 50.981  -89.160  -1.342  1.00 78.25  ? 61   THR C O   1 
ATOM   4095  C  CB  . THR C  3  55  ? 51.923  -86.515  -2.561  1.00 79.28  ? 61   THR C CB  1 
ATOM   4096  O  OG1 . THR C  3  55  ? 53.045  -86.521  -3.456  1.00 79.54  ? 61   THR C OG1 1 
ATOM   4097  C  CG2 . THR C  3  55  ? 51.439  -85.088  -2.318  1.00 79.51  ? 61   THR C CG2 1 
ATOM   4098  N  N   . ARG C  3  56  ? 53.216  -89.413  -1.582  1.00 77.70  ? 62   ARG C N   1 
ATOM   4099  C  CA  . ARG C  3  56  ? 53.184  -90.867  -1.710  1.00 77.00  ? 62   ARG C CA  1 
ATOM   4100  C  C   . ARG C  3  56  ? 52.525  -91.513  -0.499  1.00 76.39  ? 62   ARG C C   1 
ATOM   4101  O  O   . ARG C  3  56  ? 51.720  -92.434  -0.632  1.00 76.08  ? 62   ARG C O   1 
ATOM   4102  C  CB  . ARG C  3  56  ? 54.600  -91.423  -1.835  1.00 76.96  ? 62   ARG C CB  1 
ATOM   4103  C  CG  . ARG C  3  56  ? 55.395  -90.944  -3.033  1.00 77.52  ? 62   ARG C CG  1 
ATOM   4104  C  CD  . ARG C  3  56  ? 56.763  -91.617  -3.045  1.00 78.33  ? 62   ARG C CD  1 
ATOM   4105  N  NE  . ARG C  3  56  ? 57.480  -91.401  -1.787  1.00 78.60  ? 62   ARG C NE  1 
ATOM   4106  C  CZ  . ARG C  3  56  ? 58.170  -92.335  -1.138  1.00 78.71  ? 62   ARG C CZ  1 
ATOM   4107  N  NH1 . ARG C  3  56  ? 58.240  -93.572  -1.619  1.00 78.50  ? 62   ARG C NH1 1 
ATOM   4108  N  NH2 . ARG C  3  56  ? 58.783  -92.035  0.004   1.00 78.42  ? 62   ARG C NH2 1 
ATOM   4109  N  N   . ILE C  3  57  A 52.863  -90.990  0.677   1.00 75.86  ? 62   ILE C N   1 
ATOM   4110  C  CA  . ILE C  3  57  A 52.604  -91.663  1.946   1.00 75.34  ? 62   ILE C CA  1 
ATOM   4111  C  C   . ILE C  3  57  A 51.595  -90.970  2.869   1.00 75.20  ? 62   ILE C C   1 
ATOM   4112  O  O   . ILE C  3  57  A 51.092  -91.593  3.810   1.00 75.32  ? 62   ILE C O   1 
ATOM   4113  C  CB  . ILE C  3  57  A 53.927  -91.933  2.722   1.00 75.17  ? 62   ILE C CB  1 
ATOM   4114  C  CG1 . ILE C  3  57  A 54.572  -90.624  3.189   1.00 74.57  ? 62   ILE C CG1 1 
ATOM   4115  C  CG2 . ILE C  3  57  A 54.888  -92.749  1.867   1.00 74.99  ? 62   ILE C CG2 1 
ATOM   4116  C  CD1 . ILE C  3  57  A 55.737  -90.806  4.137   1.00 74.05  ? 62   ILE C CD1 1 
ATOM   4117  N  N   . THR C  3  58  ? 51.312  -89.691  2.613   1.00 74.85  ? 63   THR C N   1 
ATOM   4118  C  CA  . THR C  3  58  ? 50.329  -88.941  3.412   1.00 74.60  ? 63   THR C CA  1 
ATOM   4119  C  C   . THR C  3  58  ? 48.930  -89.517  3.168   1.00 74.21  ? 63   THR C C   1 
ATOM   4120  O  O   . THR C  3  58  ? 48.525  -89.686  2.013   1.00 74.26  ? 63   THR C O   1 
ATOM   4121  C  CB  . THR C  3  58  ? 50.368  -87.398  3.131   1.00 74.62  ? 63   THR C CB  1 
ATOM   4122  O  OG1 . THR C  3  58  ? 51.603  -86.847  3.610   1.00 74.65  ? 63   THR C OG1 1 
ATOM   4123  C  CG2 . THR C  3  58  ? 49.214  -86.662  3.827   1.00 74.77  ? 63   THR C CG2 1 
ATOM   4124  N  N   . PRO C  3  59  ? 48.196  -89.842  4.255   1.00 73.79  ? 64   PRO C N   1 
ATOM   4125  C  CA  . PRO C  3  59  ? 46.849  -90.392  4.066   1.00 73.32  ? 64   PRO C CA  1 
ATOM   4126  C  C   . PRO C  3  59  ? 46.018  -89.486  3.146   1.00 72.67  ? 64   PRO C C   1 
ATOM   4127  O  O   . PRO C  3  59  ? 45.837  -88.301  3.458   1.00 72.70  ? 64   PRO C O   1 
ATOM   4128  C  CB  . PRO C  3  59  ? 46.267  -90.428  5.496   1.00 73.36  ? 64   PRO C CB  1 
ATOM   4129  C  CG  . PRO C  3  59  ? 47.204  -89.601  6.343   1.00 73.50  ? 64   PRO C CG  1 
ATOM   4130  C  CD  . PRO C  3  59  ? 48.542  -89.704  5.684   1.00 73.67  ? 64   PRO C CD  1 
ATOM   4131  N  N   . SER C  3  60  ? 45.564  -90.023  2.009   1.00 71.67  ? 65   SER C N   1 
ATOM   4132  C  CA  . SER C  3  60  ? 44.699  -89.256  1.100   1.00 70.72  ? 65   SER C CA  1 
ATOM   4133  C  C   . SER C  3  60  ? 43.278  -89.155  1.670   1.00 69.64  ? 65   SER C C   1 
ATOM   4134  O  O   . SER C  3  60  ? 42.944  -89.816  2.664   1.00 69.57  ? 65   SER C O   1 
ATOM   4135  C  CB  . SER C  3  60  ? 44.705  -89.825  -0.323  1.00 70.82  ? 65   SER C CB  1 
ATOM   4136  O  OG  . SER C  3  60  ? 44.051  -91.077  -0.366  1.00 71.39  ? 65   SER C OG  1 
ATOM   4137  N  N   . LYS C  3  61  ? 42.455  -88.315  1.053   1.00 68.18  ? 66   LYS C N   1 
ATOM   4138  C  CA  . LYS C  3  61  ? 41.195  -87.917  1.666   1.00 66.74  ? 66   LYS C CA  1 
ATOM   4139  C  C   . LYS C  3  61  ? 40.034  -88.830  1.262   1.00 65.15  ? 66   LYS C C   1 
ATOM   4140  O  O   . LYS C  3  61  ? 39.114  -89.054  2.053   1.00 64.99  ? 66   LYS C O   1 
ATOM   4141  C  CB  . LYS C  3  61  ? 40.892  -86.448  1.341   1.00 67.23  ? 66   LYS C CB  1 
ATOM   4142  C  CG  . LYS C  3  61  ? 40.230  -85.669  2.481   1.00 68.31  ? 66   LYS C CG  1 
ATOM   4143  C  CD  . LYS C  3  61  ? 41.197  -84.699  3.177   1.00 68.66  ? 66   LYS C CD  1 
ATOM   4144  C  CE  . LYS C  3  61  ? 40.505  -83.982  4.340   1.00 69.54  ? 66   LYS C CE  1 
ATOM   4145  N  NZ  . LYS C  3  61  ? 39.113  -83.498  4.011   1.00 69.01  ? 66   LYS C NZ  1 
ATOM   4146  N  N   . VAL C  3  62  ? 40.086  -89.351  0.036   1.00 63.14  ? 67   VAL C N   1 
ATOM   4147  C  CA  . VAL C  3  62  ? 39.115  -90.350  -0.429  1.00 61.09  ? 67   VAL C CA  1 
ATOM   4148  C  C   . VAL C  3  62  ? 39.541  -91.741  0.059   1.00 59.44  ? 67   VAL C C   1 
ATOM   4149  O  O   . VAL C  3  62  ? 40.693  -92.144  -0.108  1.00 59.07  ? 67   VAL C O   1 
ATOM   4150  C  CB  . VAL C  3  62  ? 38.978  -90.349  -1.974  1.00 61.15  ? 67   VAL C CB  1 
ATOM   4151  C  CG1 . VAL C  3  62  ? 37.870  -91.281  -2.421  1.00 61.01  ? 67   VAL C CG1 1 
ATOM   4152  C  CG2 . VAL C  3  62  ? 38.703  -88.959  -2.477  1.00 61.08  ? 67   VAL C CG2 1 
ATOM   4153  N  N   . SER C  3  63  ? 38.611  -92.467  0.669   1.00 57.30  ? 68   SER C N   1 
ATOM   4154  C  CA  . SER C  3  63  ? 38.912  -93.802  1.186   1.00 55.16  ? 68   SER C CA  1 
ATOM   4155  C  C   . SER C  3  63  ? 38.011  -94.892  0.620   1.00 53.55  ? 68   SER C C   1 
ATOM   4156  O  O   . SER C  3  63  ? 36.792  -94.731  0.539   1.00 52.94  ? 68   SER C O   1 
ATOM   4157  C  CB  . SER C  3  63  ? 38.829  -93.818  2.711   1.00 55.26  ? 68   SER C CB  1 
ATOM   4158  O  OG  . SER C  3  63  ? 39.940  -93.162  3.288   1.00 55.69  ? 68   SER C OG  1 
ATOM   4159  N  N   . LYS C  3  64  ? 38.631  -96.004  0.234   1.00 51.80  ? 69   LYS C N   1 
ATOM   4160  C  CA  . LYS C  3  64  ? 37.900  -97.212  -0.117  1.00 50.06  ? 69   LYS C CA  1 
ATOM   4161  C  C   . LYS C  3  64  ? 37.341  -97.868  1.140   1.00 49.09  ? 69   LYS C C   1 
ATOM   4162  O  O   . LYS C  3  64  ? 38.082  -98.176  2.081   1.00 48.74  ? 69   LYS C O   1 
ATOM   4163  C  CB  . LYS C  3  64  ? 38.812  -98.190  -0.838  1.00 50.09  ? 69   LYS C CB  1 
ATOM   4164  C  CG  . LYS C  3  64  ? 38.898  -97.982  -2.320  1.00 50.01  ? 69   LYS C CG  1 
ATOM   4165  C  CD  . LYS C  3  64  ? 39.371  -99.254  -2.979  1.00 51.35  ? 69   LYS C CD  1 
ATOM   4166  C  CE  . LYS C  3  64  ? 39.591  -99.050  -4.467  1.00 53.40  ? 69   LYS C CE  1 
ATOM   4167  N  NZ  . LYS C  3  64  ? 40.732  -99.872  -4.975  1.00 53.08  ? 69   LYS C NZ  1 
ATOM   4168  N  N   . ILE C  3  65  ? 36.028  -98.048  1.172   1.00 47.89  ? 70   ILE C N   1 
ATOM   4169  C  CA  . ILE C  3  65  ? 35.412  -98.776  2.264   1.00 47.00  ? 70   ILE C CA  1 
ATOM   4170  C  C   . ILE C  3  65  ? 35.323  -100.238 1.835   1.00 46.71  ? 70   ILE C C   1 
ATOM   4171  O  O   . ILE C  3  65  ? 35.568  -101.148 2.621   1.00 46.83  ? 70   ILE C O   1 
ATOM   4172  C  CB  . ILE C  3  65  ? 34.038  -98.196  2.632   1.00 46.84  ? 70   ILE C CB  1 
ATOM   4173  C  CG1 . ILE C  3  65  ? 34.166  -96.734  3.073   1.00 46.05  ? 70   ILE C CG1 1 
ATOM   4174  C  CG2 . ILE C  3  65  ? 33.362  -99.034  3.712   1.00 46.52  ? 70   ILE C CG2 1 
ATOM   4175  C  CD1 . ILE C  3  65  ? 35.238  -96.458  4.126   1.00 45.79  ? 70   ILE C CD1 1 
ATOM   4176  N  N   . ASP C  3  66  ? 34.979  -100.439 0.570   1.00 46.09  ? 71   ASP C N   1 
ATOM   4177  C  CA  . ASP C  3  66  ? 35.057  -101.734 -0.081  1.00 45.67  ? 71   ASP C CA  1 
ATOM   4178  C  C   . ASP C  3  66  ? 35.500  -101.487 -1.527  1.00 45.36  ? 71   ASP C C   1 
ATOM   4179  O  O   . ASP C  3  66  ? 35.890  -100.370 -1.876  1.00 45.40  ? 71   ASP C O   1 
ATOM   4180  C  CB  . ASP C  3  66  ? 33.710  -102.451 -0.021  1.00 45.84  ? 71   ASP C CB  1 
ATOM   4181  C  CG  . ASP C  3  66  ? 33.844  -103.962 -0.016  1.00 46.00  ? 71   ASP C CG  1 
ATOM   4182  O  OD1 . ASP C  3  66  ? 32.937  -104.621 0.536   1.00 46.46  ? 71   ASP C OD1 1 
ATOM   4183  O  OD2 . ASP C  3  66  ? 34.835  -104.499 -0.572  1.00 46.12  ? 71   ASP C OD2 1 
ATOM   4184  N  N   . SER C  3  67  ? 35.466  -102.516 -2.369  1.00 44.79  ? 72   SER C N   1 
ATOM   4185  C  CA  . SER C  3  67  ? 35.986  -102.391 -3.728  1.00 44.04  ? 72   SER C CA  1 
ATOM   4186  C  C   . SER C  3  67  ? 35.071  -101.540 -4.609  1.00 43.30  ? 72   SER C C   1 
ATOM   4187  O  O   . SER C  3  67  ? 35.481  -101.068 -5.668  1.00 43.68  ? 72   SER C O   1 
ATOM   4188  C  CB  . SER C  3  67  ? 36.190  -103.773 -4.337  1.00 44.03  ? 72   SER C CB  1 
ATOM   4189  O  OG  . SER C  3  67  ? 34.959  -104.466 -4.358  1.00 45.05  ? 72   SER C OG  1 
ATOM   4190  N  N   . HIS C  3  68  ? 33.847  -101.323 -4.141  1.00 42.49  ? 73   HIS C N   1 
ATOM   4191  C  CA  . HIS C  3  68  ? 32.800  -100.648 -4.904  1.00 41.54  ? 73   HIS C CA  1 
ATOM   4192  C  C   . HIS C  3  68  ? 32.233  -99.411  -4.185  1.00 41.23  ? 73   HIS C C   1 
ATOM   4193  O  O   . HIS C  3  68  ? 31.257  -98.812  -4.658  1.00 40.66  ? 73   HIS C O   1 
ATOM   4194  C  CB  . HIS C  3  68  ? 31.662  -101.637 -5.171  1.00 41.44  ? 73   HIS C CB  1 
ATOM   4195  C  CG  . HIS C  3  68  ? 30.881  -101.996 -3.945  1.00 40.89  ? 73   HIS C CG  1 
ATOM   4196  N  ND1 . HIS C  3  68  ? 31.466  -102.545 -2.822  1.00 42.11  ? 73   HIS C ND1 1 
ATOM   4197  C  CD2 . HIS C  3  68  ? 29.563  -101.881 -3.661  1.00 41.26  ? 73   HIS C CD2 1 
ATOM   4198  C  CE1 . HIS C  3  68  ? 30.543  -102.744 -1.897  1.00 42.15  ? 73   HIS C CE1 1 
ATOM   4199  N  NE2 . HIS C  3  68  ? 29.377  -102.351 -2.380  1.00 41.16  ? 73   HIS C NE2 1 
ATOM   4200  N  N   . VAL C  3  69  ? 32.822  -99.041  -3.045  1.00 40.94  ? 74   VAL C N   1 
ATOM   4201  C  CA  . VAL C  3  69  ? 32.310  -97.924  -2.244  1.00 40.98  ? 74   VAL C CA  1 
ATOM   4202  C  C   . VAL C  3  69  ? 33.412  -97.068  -1.616  1.00 41.14  ? 74   VAL C C   1 
ATOM   4203  O  O   . VAL C  3  69  ? 34.310  -97.573  -0.937  1.00 41.08  ? 74   VAL C O   1 
ATOM   4204  C  CB  . VAL C  3  69  ? 31.350  -98.391  -1.130  1.00 40.86  ? 74   VAL C CB  1 
ATOM   4205  C  CG1 . VAL C  3  69  ? 30.885  -97.207  -0.317  1.00 41.34  ? 74   VAL C CG1 1 
ATOM   4206  C  CG2 . VAL C  3  69  ? 30.145  -99.052  -1.712  1.00 40.88  ? 74   VAL C CG2 1 
ATOM   4207  N  N   . VAL C  3  70  ? 33.313  -95.756  -1.819  1.00 41.29  ? 75   VAL C N   1 
ATOM   4208  C  CA  . VAL C  3  70  ? 34.321  -94.831  -1.316  1.00 40.99  ? 75   VAL C CA  1 
ATOM   4209  C  C   . VAL C  3  70  ? 33.741  -93.853  -0.306  1.00 40.91  ? 75   VAL C C   1 
ATOM   4210  O  O   . VAL C  3  70  ? 32.551  -93.557  -0.326  1.00 40.79  ? 75   VAL C O   1 
ATOM   4211  C  CB  . VAL C  3  70  ? 35.037  -94.090  -2.465  1.00 41.04  ? 75   VAL C CB  1 
ATOM   4212  C  CG1 . VAL C  3  70  ? 36.144  -94.941  -3.038  1.00 40.74  ? 75   VAL C CG1 1 
ATOM   4213  C  CG2 . VAL C  3  70  ? 34.066  -93.720  -3.555  1.00 41.03  ? 75   VAL C CG2 1 
ATOM   4214  N  N   . LEU C  3  71  ? 34.592  -93.383  0.599   1.00 41.26  ? 76   LEU C N   1 
ATOM   4215  C  CA  . LEU C  3  71  ? 34.201  -92.386  1.597   1.00 41.55  ? 76   LEU C CA  1 
ATOM   4216  C  C   . LEU C  3  71  ? 35.181  -91.227  1.669   1.00 41.50  ? 76   LEU C C   1 
ATOM   4217  O  O   . LEU C  3  71  ? 36.401  -91.423  1.705   1.00 41.76  ? 76   LEU C O   1 
ATOM   4218  C  CB  . LEU C  3  71  ? 34.062  -93.018  2.978   1.00 41.55  ? 76   LEU C CB  1 
ATOM   4219  C  CG  . LEU C  3  71  ? 33.677  -92.144  4.181   1.00 41.75  ? 76   LEU C CG  1 
ATOM   4220  C  CD1 . LEU C  3  71  ? 32.938  -92.988  5.216   1.00 42.20  ? 76   LEU C CD1 1 
ATOM   4221  C  CD2 . LEU C  3  71  ? 34.896  -91.458  4.821   1.00 40.85  ? 76   LEU C CD2 1 
ATOM   4222  N  N   . SER C  3  72  ? 34.633  -90.019  1.690   1.00 41.33  ? 77   SER C N   1 
ATOM   4223  C  CA  . SER C  3  72  ? 35.417  -88.825  1.988   1.00 41.19  ? 77   SER C CA  1 
ATOM   4224  C  C   . SER C  3  72  ? 34.673  -88.009  3.026   1.00 41.17  ? 77   SER C C   1 
ATOM   4225  O  O   . SER C  3  72  ? 33.496  -88.272  3.340   1.00 40.60  ? 77   SER C O   1 
ATOM   4226  C  CB  . SER C  3  72  ? 35.681  -87.988  0.733   1.00 41.27  ? 77   SER C CB  1 
ATOM   4227  O  OG  . SER C  3  72  ? 34.491  -87.392  0.255   1.00 41.36  ? 77   SER C OG  1 
ATOM   4228  N  N   . PHE C  3  73  ? 35.367  -87.005  3.542   1.00 41.35  ? 78   PHE C N   1 
ATOM   4229  C  CA  . PHE C  3  73  ? 34.916  -86.301  4.730   1.00 41.53  ? 78   PHE C CA  1 
ATOM   4230  C  C   . PHE C  3  73  ? 35.477  -84.870  4.831   1.00 41.48  ? 78   PHE C C   1 
ATOM   4231  O  O   . PHE C  3  73  ? 36.443  -84.506  4.146   1.00 41.62  ? 78   PHE C O   1 
ATOM   4232  C  CB  . PHE C  3  73  ? 35.371  -87.100  5.958   1.00 41.33  ? 78   PHE C CB  1 
ATOM   4233  C  CG  . PHE C  3  73  ? 36.829  -86.947  6.255   1.00 41.14  ? 78   PHE C CG  1 
ATOM   4234  C  CD1 . PHE C  3  73  ? 37.261  -86.039  7.232   1.00 41.59  ? 78   PHE C CD1 1 
ATOM   4235  C  CD2 . PHE C  3  73  ? 37.778  -87.669  5.531   1.00 40.64  ? 78   PHE C CD2 1 
ATOM   4236  C  CE1 . PHE C  3  73  ? 38.627  -85.872  7.506   1.00 42.35  ? 78   PHE C CE1 1 
ATOM   4237  C  CE2 . PHE C  3  73  ? 39.143  -87.520  5.786   1.00 41.50  ? 78   PHE C CE2 1 
ATOM   4238  C  CZ  . PHE C  3  73  ? 39.575  -86.617  6.777   1.00 42.61  ? 78   PHE C CZ  1 
ATOM   4239  N  N   . SER C  3  74  ? 34.876  -84.084  5.717   1.00 41.32  ? 79   SER C N   1 
ATOM   4240  C  CA  . SER C  3  74  ? 35.464  -82.836  6.167   1.00 41.34  ? 79   SER C CA  1 
ATOM   4241  C  C   . SER C  3  74  ? 35.313  -82.782  7.663   1.00 41.05  ? 79   SER C C   1 
ATOM   4242  O  O   . SER C  3  74  ? 34.272  -83.148  8.201   1.00 40.98  ? 79   SER C O   1 
ATOM   4243  C  CB  . SER C  3  74  ? 34.772  -81.627  5.538   1.00 41.54  ? 79   SER C CB  1 
ATOM   4244  O  OG  . SER C  3  74  ? 34.975  -81.592  4.135   1.00 42.59  ? 79   SER C OG  1 
ATOM   4245  N  N   . GLY C  3  75  ? 36.362  -82.329  8.331   1.00 41.02  ? 80   GLY C N   1 
ATOM   4246  C  CA  . GLY C  3  75  ? 36.371  -82.244  9.774   1.00 40.86  ? 80   GLY C CA  1 
ATOM   4247  C  C   . GLY C  3  75  ? 37.677  -82.767  10.325  1.00 41.12  ? 80   GLY C C   1 
ATOM   4248  O  O   . GLY C  3  75  ? 38.718  -82.728  9.654   1.00 40.96  ? 80   GLY C O   1 
ATOM   4249  N  N   . LEU C  3  76  ? 37.620  -83.262  11.556  1.00 41.33  ? 81   LEU C N   1 
ATOM   4250  C  CA  . LEU C  3  76  ? 38.801  -83.764  12.237  1.00 41.68  ? 81   LEU C CA  1 
ATOM   4251  C  C   . LEU C  3  76  ? 39.315  -85.018  11.563  1.00 41.83  ? 81   LEU C C   1 
ATOM   4252  O  O   . LEU C  3  76  ? 38.635  -86.033  11.507  1.00 41.67  ? 81   LEU C O   1 
ATOM   4253  C  CB  . LEU C  3  76  ? 38.500  -84.038  13.708  1.00 41.77  ? 81   LEU C CB  1 
ATOM   4254  C  CG  . LEU C  3  76  ? 37.973  -82.880  14.563  1.00 41.90  ? 81   LEU C CG  1 
ATOM   4255  C  CD1 . LEU C  3  76  ? 37.728  -83.377  15.980  1.00 42.84  ? 81   LEU C CD1 1 
ATOM   4256  C  CD2 . LEU C  3  76  ? 38.920  -81.693  14.574  1.00 41.07  ? 81   LEU C CD2 1 
ATOM   4257  N  N   . ASN C  3  77  ? 40.530  -84.930  11.046  1.00 42.27  ? 82   ASN C N   1 
ATOM   4258  C  CA  . ASN C  3  77  ? 41.127  -86.031  10.315  1.00 42.69  ? 82   ASN C CA  1 
ATOM   4259  C  C   . ASN C  3  77  ? 41.225  -87.280  11.168  1.00 42.47  ? 82   ASN C C   1 
ATOM   4260  O  O   . ASN C  3  77  ? 40.880  -88.380  10.721  1.00 42.91  ? 82   ASN C O   1 
ATOM   4261  C  CB  . ASN C  3  77  ? 42.494  -85.622  9.752   1.00 43.10  ? 82   ASN C CB  1 
ATOM   4262  C  CG  . ASN C  3  77  ? 42.378  -84.711  8.528   1.00 44.40  ? 82   ASN C CG  1 
ATOM   4263  O  OD1 . ASN C  3  77  ? 43.264  -84.703  7.671   1.00 47.22  ? 82   ASN C OD1 1 
ATOM   4264  N  ND2 . ASN C  3  77  ? 41.276  -83.959  8.430   1.00 44.17  ? 82   ASN C ND2 1 
ATOM   4265  N  N   . ALA C  3  78  ? 41.665  -87.108  12.408  1.00 42.02  ? 83   ALA C N   1 
ATOM   4266  C  CA  . ALA C  3  78  ? 41.775  -88.238  13.319  1.00 41.55  ? 83   ALA C CA  1 
ATOM   4267  C  C   . ALA C  3  78  ? 40.408  -88.907  13.548  1.00 41.33  ? 83   ALA C C   1 
ATOM   4268  O  O   . ALA C  3  78  ? 40.286  -90.125  13.453  1.00 41.63  ? 83   ALA C O   1 
ATOM   4269  C  CB  . ALA C  3  78  ? 42.434  -87.814  14.620  1.00 41.19  ? 83   ALA C CB  1 
ATOM   4270  N  N   . ASP C  3  79  ? 39.374  -88.114  13.808  1.00 41.12  ? 84   ASP C N   1 
ATOM   4271  C  CA  . ASP C  3  79  ? 38.029  -88.652  13.982  1.00 40.55  ? 84   ASP C CA  1 
ATOM   4272  C  C   . ASP C  3  79  ? 37.603  -89.495  12.774  1.00 40.32  ? 84   ASP C C   1 
ATOM   4273  O  O   . ASP C  3  79  ? 36.918  -90.506  12.938  1.00 40.73  ? 84   ASP C O   1 
ATOM   4274  C  CB  . ASP C  3  79  ? 37.015  -87.524  14.226  1.00 40.83  ? 84   ASP C CB  1 
ATOM   4275  C  CG  . ASP C  3  79  ? 37.063  -86.963  15.654  1.00 41.62  ? 84   ASP C CG  1 
ATOM   4276  O  OD1 . ASP C  3  79  ? 36.044  -86.377  16.092  1.00 41.65  ? 84   ASP C OD1 1 
ATOM   4277  O  OD2 . ASP C  3  79  ? 38.106  -87.093  16.338  1.00 42.62  ? 84   ASP C OD2 1 
ATOM   4278  N  N   . SER C  3  80  ? 38.011  -89.097  11.566  1.00 39.71  ? 85   SER C N   1 
ATOM   4279  C  CA  . SER C  3  80  ? 37.558  -89.782  10.351  1.00 39.14  ? 85   SER C CA  1 
ATOM   4280  C  C   . SER C  3  80  ? 38.062  -91.217  10.263  1.00 38.97  ? 85   SER C C   1 
ATOM   4281  O  O   . SER C  3  80  ? 37.345  -92.102  9.786   1.00 38.82  ? 85   SER C O   1 
ATOM   4282  C  CB  . SER C  3  80  ? 37.960  -89.020  9.097   1.00 38.90  ? 85   SER C CB  1 
ATOM   4283  O  OG  . SER C  3  80  ? 39.361  -89.021  8.933   1.00 39.05  ? 85   SER C OG  1 
ATOM   4284  N  N   . ARG C  3  81  ? 39.291  -91.428  10.729  1.00 38.64  ? 86   ARG C N   1 
ATOM   4285  C  CA  . ARG C  3  81  ? 39.906  -92.744  10.736  1.00 38.70  ? 86   ARG C CA  1 
ATOM   4286  C  C   . ARG C  3  81  ? 39.080  -93.762  11.524  1.00 38.57  ? 86   ARG C C   1 
ATOM   4287  O  O   . ARG C  3  81  ? 38.942  -94.908  11.102  1.00 38.42  ? 86   ARG C O   1 
ATOM   4288  C  CB  . ARG C  3  81  ? 41.345  -92.686  11.272  1.00 38.77  ? 86   ARG C CB  1 
ATOM   4289  C  CG  . ARG C  3  81  ? 42.376  -92.098  10.288  1.00 39.27  ? 86   ARG C CG  1 
ATOM   4290  C  CD  . ARG C  3  81  ? 43.823  -92.495  10.640  1.00 41.31  ? 86   ARG C CD  1 
ATOM   4291  N  NE  . ARG C  3  81  ? 44.075  -92.449  12.083  1.00 43.84  ? 86   ARG C NE  1 
ATOM   4292  C  CZ  . ARG C  3  81  ? 44.454  -91.360  12.752  1.00 44.92  ? 86   ARG C CZ  1 
ATOM   4293  N  NH1 . ARG C  3  81  ? 44.653  -90.215  12.111  1.00 45.44  ? 86   ARG C NH1 1 
ATOM   4294  N  NH2 . ARG C  3  81  ? 44.637  -91.414  14.065  1.00 44.55  ? 86   ARG C NH2 1 
ATOM   4295  N  N   . ILE C  3  82  ? 38.524  -93.343  12.655  1.00 38.43  ? 87   ILE C N   1 
ATOM   4296  C  CA  . ILE C  3  82  ? 37.685  -94.242  13.439  1.00 38.76  ? 87   ILE C CA  1 
ATOM   4297  C  C   . ILE C  3  82  ? 36.452  -94.697  12.654  1.00 38.93  ? 87   ILE C C   1 
ATOM   4298  O  O   . ILE C  3  82  ? 36.113  -95.878  12.671  1.00 39.35  ? 87   ILE C O   1 
ATOM   4299  C  CB  . ILE C  3  82  ? 37.265  -93.632  14.794  1.00 38.85  ? 87   ILE C CB  1 
ATOM   4300  C  CG1 . ILE C  3  82  ? 38.362  -93.806  15.862  1.00 39.11  ? 87   ILE C CG1 1 
ATOM   4301  C  CG2 . ILE C  3  82  ? 36.038  -94.352  15.322  1.00 38.88  ? 87   ILE C CG2 1 
ATOM   4302  C  CD1 . ILE C  3  82  ? 39.828  -93.595  15.398  1.00 41.19  ? 87   ILE C CD1 1 
ATOM   4303  N  N   . LEU C  3  83  ? 35.789  -93.774  11.959  1.00 38.93  ? 88   LEU C N   1 
ATOM   4304  C  CA  . LEU C  3  83  ? 34.614  -94.126  11.158  1.00 38.67  ? 88   LEU C CA  1 
ATOM   4305  C  C   . LEU C  3  83  ? 34.947  -95.039  9.987   1.00 38.59  ? 88   LEU C C   1 
ATOM   4306  O  O   . LEU C  3  83  ? 34.222  -95.998  9.724   1.00 38.44  ? 88   LEU C O   1 
ATOM   4307  C  CB  . LEU C  3  83  ? 33.894  -92.878  10.654  1.00 38.71  ? 88   LEU C CB  1 
ATOM   4308  C  CG  . LEU C  3  83  ? 33.113  -92.090  11.709  1.00 39.45  ? 88   LEU C CG  1 
ATOM   4309  C  CD1 . LEU C  3  83  ? 32.634  -90.775  11.124  1.00 39.63  ? 88   LEU C CD1 1 
ATOM   4310  C  CD2 . LEU C  3  83  ? 31.939  -92.893  12.293  1.00 39.33  ? 88   LEU C CD2 1 
ATOM   4311  N  N   . ILE C  3  84  ? 36.040  -94.738  9.287   1.00 38.27  ? 89   ILE C N   1 
ATOM   4312  C  CA  . ILE C  3  84  ? 36.427  -95.510  8.117   1.00 37.98  ? 89   ILE C CA  1 
ATOM   4313  C  C   . ILE C  3  84  ? 36.709  -96.953  8.519   1.00 38.40  ? 89   ILE C C   1 
ATOM   4314  O  O   . ILE C  3  84  ? 36.229  -97.891  7.874   1.00 38.59  ? 89   ILE C O   1 
ATOM   4315  C  CB  . ILE C  3  84  ? 37.628  -94.874  7.404   1.00 37.89  ? 89   ILE C CB  1 
ATOM   4316  C  CG1 . ILE C  3  84  ? 37.167  -93.621  6.659   1.00 37.28  ? 89   ILE C CG1 1 
ATOM   4317  C  CG2 . ILE C  3  84  ? 38.281  -95.849  6.438   1.00 37.06  ? 89   ILE C CG2 1 
ATOM   4318  C  CD1 . ILE C  3  84  ? 38.239  -92.552  6.518   1.00 37.21  ? 89   ILE C CD1 1 
ATOM   4319  N  N   . GLU C  3  85  ? 37.461  -97.127  9.601   1.00 38.42  ? 90   GLU C N   1 
ATOM   4320  C  CA  . GLU C  3  85  ? 37.762  -98.452  10.110  1.00 38.62  ? 90   GLU C CA  1 
ATOM   4321  C  C   . GLU C  3  85  ? 36.488  -99.258  10.409  1.00 38.31  ? 90   GLU C C   1 
ATOM   4322  O  O   . GLU C  3  85  ? 36.334  -100.378 9.924   1.00 38.59  ? 90   GLU C O   1 
ATOM   4323  C  CB  . GLU C  3  85  ? 38.653  -98.359  11.343  1.00 38.81  ? 90   GLU C CB  1 
ATOM   4324  C  CG  . GLU C  3  85  ? 39.116  -99.714  11.894  1.00 41.74  ? 90   GLU C CG  1 
ATOM   4325  C  CD  . GLU C  3  85  ? 39.927  -100.556 10.898  1.00 45.01  ? 90   GLU C CD  1 
ATOM   4326  O  OE1 . GLU C  3  85  ? 39.868  -101.807 11.034  1.00 45.98  ? 90   GLU C OE1 1 
ATOM   4327  O  OE2 . GLU C  3  85  ? 40.615  -99.983  10.000  1.00 46.43  ? 90   GLU C OE2 1 
ATOM   4328  N  N   . LYS C  3  86  ? 35.563  -98.688  11.178  1.00 37.52  ? 91   LYS C N   1 
ATOM   4329  C  CA  . LYS C  3  86  ? 34.350  -99.403  11.534  1.00 36.57  ? 91   LYS C CA  1 
ATOM   4330  C  C   . LYS C  3  86  ? 33.543  -99.749  10.298  1.00 36.38  ? 91   LYS C C   1 
ATOM   4331  O  O   . LYS C  3  86  ? 32.878  -100.790 10.254  1.00 36.77  ? 91   LYS C O   1 
ATOM   4332  C  CB  . LYS C  3  86  ? 33.504  -98.599  12.504  1.00 36.36  ? 91   LYS C CB  1 
ATOM   4333  C  CG  . LYS C  3  86  ? 34.151  -98.412  13.821  1.00 36.38  ? 91   LYS C CG  1 
ATOM   4334  C  CD  . LYS C  3  86  ? 33.177  -97.950  14.858  1.00 37.69  ? 91   LYS C CD  1 
ATOM   4335  C  CE  . LYS C  3  86  ? 33.912  -97.756  16.166  1.00 38.83  ? 91   LYS C CE  1 
ATOM   4336  N  NZ  . LYS C  3  86  ? 33.031  -98.056  17.313  1.00 40.42  ? 91   LYS C NZ  1 
ATOM   4337  N  N   . ALA C  3  87  ? 33.614  -98.878  9.297   1.00 35.74  ? 92   ALA C N   1 
ATOM   4338  C  CA  . ALA C  3  87  ? 32.872  -99.052  8.054   1.00 35.23  ? 92   ALA C CA  1 
ATOM   4339  C  C   . ALA C  3  87  ? 33.428  -100.208 7.249   1.00 35.00  ? 92   ALA C C   1 
ATOM   4340  O  O   . ALA C  3  87  ? 32.668  -100.989 6.675   1.00 34.73  ? 92   ALA C O   1 
ATOM   4341  C  CB  . ALA C  3  87  ? 32.906  -97.772  7.222   1.00 35.35  ? 92   ALA C CB  1 
ATOM   4342  N  N   . ARG C  3  88  ? 34.757  -100.305 7.212   1.00 34.61  ? 93   ARG C N   1 
ATOM   4343  C  CA  . ARG C  3  88  ? 35.437  -101.375 6.510   1.00 34.65  ? 93   ARG C CA  1 
ATOM   4344  C  C   . ARG C  3  88  ? 35.149  -102.725 7.155   1.00 35.38  ? 93   ARG C C   1 
ATOM   4345  O  O   . ARG C  3  88  ? 34.883  -103.710 6.451   1.00 35.92  ? 93   ARG C O   1 
ATOM   4346  C  CB  . ARG C  3  88  ? 36.931  -101.105 6.483   1.00 34.36  ? 93   ARG C CB  1 
ATOM   4347  C  CG  . ARG C  3  88  ? 37.283  -99.986  5.548   1.00 33.62  ? 93   ARG C CG  1 
ATOM   4348  C  CD  . ARG C  3  88  ? 38.667  -99.501  5.776   1.00 32.58  ? 93   ARG C CD  1 
ATOM   4349  N  NE  . ARG C  3  88  ? 39.114  -98.728  4.627   1.00 34.19  ? 93   ARG C NE  1 
ATOM   4350  C  CZ  . ARG C  3  88  ? 40.237  -98.024  4.576   1.00 32.81  ? 93   ARG C CZ  1 
ATOM   4351  N  NH1 . ARG C  3  88  ? 41.061  -97.977  5.619   1.00 31.50  ? 93   ARG C NH1 1 
ATOM   4352  N  NH2 . ARG C  3  88  ? 40.524  -97.361  3.475   1.00 31.55  ? 93   ARG C NH2 1 
ATOM   4353  N  N   . VAL C  3  89  ? 35.187  -102.757 8.487   1.00 35.38  ? 94   VAL C N   1 
ATOM   4354  C  CA  . VAL C  3  89  ? 34.865  -103.951 9.246   1.00 35.67  ? 94   VAL C CA  1 
ATOM   4355  C  C   . VAL C  3  89  ? 33.419  -104.369 8.986   1.00 35.97  ? 94   VAL C C   1 
ATOM   4356  O  O   . VAL C  3  89  ? 33.134  -105.551 8.783   1.00 36.27  ? 94   VAL C O   1 
ATOM   4357  C  CB  . VAL C  3  89  ? 35.129  -103.760 10.781  1.00 36.00  ? 94   VAL C CB  1 
ATOM   4358  C  CG1 . VAL C  3  89  ? 34.473  -104.881 11.623  1.00 35.03  ? 94   VAL C CG1 1 
ATOM   4359  C  CG2 . VAL C  3  89  ? 36.635  -103.690 11.064  1.00 35.74  ? 94   VAL C CG2 1 
ATOM   4360  N  N   . GLU C  3  90  ? 32.506  -103.405 8.989   1.00 35.97  ? 95   GLU C N   1 
ATOM   4361  C  CA  . GLU C  3  90  ? 31.111  -103.729 8.761   1.00 36.12  ? 95   GLU C CA  1 
ATOM   4362  C  C   . GLU C  3  90  ? 30.878  -104.241 7.344   1.00 35.88  ? 95   GLU C C   1 
ATOM   4363  O  O   . GLU C  3  90  ? 29.981  -105.052 7.114   1.00 36.12  ? 95   GLU C O   1 
ATOM   4364  C  CB  . GLU C  3  90  ? 30.220  -102.524 9.028   1.00 36.16  ? 95   GLU C CB  1 
ATOM   4365  C  CG  . GLU C  3  90  ? 28.723  -102.815 8.838   1.00 38.27  ? 95   GLU C CG  1 
ATOM   4366  C  CD  . GLU C  3  90  ? 28.182  -103.958 9.731   1.00 40.19  ? 95   GLU C CD  1 
ATOM   4367  O  OE1 . GLU C  3  90  ? 27.140  -104.556 9.367   1.00 39.51  ? 95   GLU C OE1 1 
ATOM   4368  O  OE2 . GLU C  3  90  ? 28.792  -104.250 10.790  1.00 41.65  ? 95   GLU C OE2 1 
ATOM   4369  N  N   . ALA C  3  91  ? 31.678  -103.761 6.397   1.00 35.34  ? 96   ALA C N   1 
ATOM   4370  C  CA  . ALA C  3  91  ? 31.525  -104.171 5.012   1.00 34.82  ? 96   ALA C CA  1 
ATOM   4371  C  C   . ALA C  3  91  ? 31.889  -105.641 4.863   1.00 34.43  ? 96   ALA C C   1 
ATOM   4372  O  O   . ALA C  3  91  ? 31.132  -106.404 4.276   1.00 34.08  ? 96   ALA C O   1 
ATOM   4373  C  CB  . ALA C  3  91  ? 32.354  -103.296 4.087   1.00 34.69  ? 96   ALA C CB  1 
ATOM   4374  N  N   . GLN C  3  92  ? 33.027  -106.035 5.437   1.00 34.71  ? 97   GLN C N   1 
ATOM   4375  C  CA  . GLN C  3  92  ? 33.500  -107.438 5.411   1.00 34.48  ? 97   GLN C CA  1 
ATOM   4376  C  C   . GLN C  3  92  ? 32.551  -108.390 6.116   1.00 34.30  ? 97   GLN C C   1 
ATOM   4377  O  O   . GLN C  3  92  ? 32.336  -109.519 5.673   1.00 33.68  ? 97   GLN C O   1 
ATOM   4378  C  CB  . GLN C  3  92  ? 34.901  -107.566 5.999   1.00 34.01  ? 97   GLN C CB  1 
ATOM   4379  C  CG  . GLN C  3  92  ? 35.994  -107.023 5.088   1.00 35.06  ? 97   GLN C CG  1 
ATOM   4380  C  CD  . GLN C  3  92  ? 35.852  -107.487 3.653   1.00 36.32  ? 97   GLN C CD  1 
ATOM   4381  O  OE1 . GLN C  3  92  ? 36.159  -106.744 2.717   1.00 37.47  ? 97   GLN C OE1 1 
ATOM   4382  N  NE2 . GLN C  3  92  ? 35.384  -108.721 3.469   1.00 37.25  ? 97   GLN C NE2 1 
ATOM   4383  N  N   . SER C  3  93  ? 31.971  -107.903 7.203   1.00 34.55  ? 98   SER C N   1 
ATOM   4384  C  CA  . SER C  3  93  ? 31.044  -108.678 7.987   1.00 35.16  ? 98   SER C CA  1 
ATOM   4385  C  C   . SER C  3  93  ? 29.737  -108.903 7.250   1.00 35.68  ? 98   SER C C   1 
ATOM   4386  O  O   . SER C  3  93  ? 29.112  -109.939 7.415   1.00 36.16  ? 98   SER C O   1 
ATOM   4387  C  CB  . SER C  3  93  ? 30.784  -107.973 9.301   1.00 34.96  ? 98   SER C CB  1 
ATOM   4388  O  OG  . SER C  3  93  ? 29.683  -108.561 9.942   1.00 36.19  ? 98   SER C OG  1 
ATOM   4389  N  N   . HIS C  3  94  ? 29.314  -107.921 6.457   1.00 36.21  ? 99   HIS C N   1 
ATOM   4390  C  CA  . HIS C  3  94  ? 28.094  -108.024 5.668   1.00 36.40  ? 99   HIS C CA  1 
ATOM   4391  C  C   . HIS C  3  94  ? 28.270  -109.073 4.551   1.00 36.90  ? 99   HIS C C   1 
ATOM   4392  O  O   . HIS C  3  94  ? 27.355  -109.861 4.287   1.00 36.94  ? 99   HIS C O   1 
ATOM   4393  C  CB  . HIS C  3  94  ? 27.735  -106.648 5.096   1.00 36.41  ? 99   HIS C CB  1 
ATOM   4394  C  CG  . HIS C  3  94  ? 26.392  -106.585 4.436   1.00 36.39  ? 99   HIS C CG  1 
ATOM   4395  N  ND1 . HIS C  3  94  ? 26.210  -106.831 3.092   1.00 36.37  ? 99   HIS C ND1 1 
ATOM   4396  C  CD2 . HIS C  3  94  ? 25.168  -106.282 4.933   1.00 36.73  ? 99   HIS C CD2 1 
ATOM   4397  C  CE1 . HIS C  3  94  ? 24.929  -106.695 2.791   1.00 37.21  ? 99   HIS C CE1 1 
ATOM   4398  N  NE2 . HIS C  3  94  ? 24.275  -106.359 3.890   1.00 36.54  ? 99   HIS C NE2 1 
ATOM   4399  N  N   . ARG C  3  95  ? 29.439  -109.083 3.901   1.00 37.12  ? 100  ARG C N   1 
ATOM   4400  C  CA  . ARG C  3  95  ? 29.763  -110.097 2.888   1.00 37.43  ? 100  ARG C CA  1 
ATOM   4401  C  C   . ARG C  3  95  ? 29.763  -111.502 3.500   1.00 37.88  ? 100  ARG C C   1 
ATOM   4402  O  O   . ARG C  3  95  ? 29.286  -112.461 2.905   1.00 38.47  ? 100  ARG C O   1 
ATOM   4403  C  CB  . ARG C  3  95  ? 31.137  -109.825 2.271   1.00 37.18  ? 100  ARG C CB  1 
ATOM   4404  C  CG  . ARG C  3  95  ? 31.209  -108.604 1.411   1.00 37.61  ? 100  ARG C CG  1 
ATOM   4405  C  CD  . ARG C  3  95  ? 32.636  -108.270 1.085   1.00 38.79  ? 100  ARG C CD  1 
ATOM   4406  N  NE  . ARG C  3  95  ? 33.015  -108.722 -0.244  1.00 41.39  ? 100  ARG C NE  1 
ATOM   4407  C  CZ  . ARG C  3  95  ? 33.259  -107.908 -1.268  1.00 44.29  ? 100  ARG C CZ  1 
ATOM   4408  N  NH1 . ARG C  3  95  ? 33.169  -106.592 -1.115  1.00 45.09  ? 100  ARG C NH1 1 
ATOM   4409  N  NH2 . ARG C  3  95  ? 33.602  -108.408 -2.452  1.00 45.11  ? 100  ARG C NH2 1 
ATOM   4410  N  N   . LEU C  3  96  ? 30.308  -111.601 4.704   1.00 38.30  ? 101  LEU C N   1 
ATOM   4411  C  CA  . LEU C  3  96  ? 30.393  -112.844 5.441   1.00 38.57  ? 101  LEU C CA  1 
ATOM   4412  C  C   . LEU C  3  96  ? 29.033  -113.415 5.847   1.00 38.83  ? 101  LEU C C   1 
ATOM   4413  O  O   . LEU C  3  96  ? 28.878  -114.630 5.838   1.00 39.27  ? 101  LEU C O   1 
ATOM   4414  C  CB  . LEU C  3  96  ? 31.278  -112.650 6.681   1.00 38.53  ? 101  LEU C CB  1 
ATOM   4415  C  CG  . LEU C  3  96  ? 31.819  -113.867 7.417   1.00 38.14  ? 101  LEU C CG  1 
ATOM   4416  C  CD1 . LEU C  3  96  ? 32.882  -114.562 6.596   1.00 38.77  ? 101  LEU C CD1 1 
ATOM   4417  C  CD2 . LEU C  3  96  ? 32.376  -113.451 8.758   1.00 38.14  ? 101  LEU C CD2 1 
ATOM   4418  N  N   . THR C  3  97  ? 28.061  -112.573 6.204   1.00 38.97  ? 102  THR C N   1 
ATOM   4419  C  CA  . THR C  3  97  ? 26.773  -113.095 6.701   1.00 39.83  ? 102  THR C CA  1 
ATOM   4420  C  C   . THR C  3  97  ? 25.616  -113.080 5.705   1.00 40.72  ? 102  THR C C   1 
ATOM   4421  O  O   . THR C  3  97  ? 24.645  -113.814 5.874   1.00 41.17  ? 102  THR C O   1 
ATOM   4422  C  CB  . THR C  3  97  ? 26.297  -112.426 8.013   1.00 39.62  ? 102  THR C CB  1 
ATOM   4423  O  OG1 . THR C  3  97  ? 26.118  -111.026 7.800   1.00 39.85  ? 102  THR C OG1 1 
ATOM   4424  C  CG2 . THR C  3  97  ? 27.291  -112.655 9.149   1.00 39.22  ? 102  THR C CG2 1 
ATOM   4425  N  N   . LEU C  3  98  ? 25.714  -112.247 4.675   1.00 41.78  ? 103  LEU C N   1 
ATOM   4426  C  CA  . LEU C  3  98  ? 24.655  -112.124 3.669   1.00 42.38  ? 103  LEU C CA  1 
ATOM   4427  C  C   . LEU C  3  98  ? 25.147  -112.609 2.297   1.00 42.84  ? 103  LEU C C   1 
ATOM   4428  O  O   . LEU C  3  98  ? 24.371  -112.688 1.344   1.00 43.31  ? 103  LEU C O   1 
ATOM   4429  C  CB  . LEU C  3  98  ? 24.157  -110.660 3.574   1.00 42.45  ? 103  LEU C CB  1 
ATOM   4430  C  CG  . LEU C  3  98  ? 23.233  -109.920 4.575   1.00 41.81  ? 103  LEU C CG  1 
ATOM   4431  C  CD1 . LEU C  3  98  ? 21.776  -110.385 4.544   1.00 39.63  ? 103  LEU C CD1 1 
ATOM   4432  C  CD2 . LEU C  3  98  ? 23.749  -109.918 6.005   1.00 41.43  ? 103  LEU C CD2 1 
ATOM   4433  N  N   . GLU C  3  99  ? 26.438  -112.924 2.209   1.00 43.19  ? 104  GLU C N   1 
ATOM   4434  C  CA  . GLU C  3  99  ? 27.084  -113.360 0.957   1.00 43.59  ? 104  GLU C CA  1 
ATOM   4435  C  C   . GLU C  3  99  ? 26.825  -112.384 -0.194  1.00 43.33  ? 104  GLU C C   1 
ATOM   4436  O  O   . GLU C  3  99  ? 26.595  -112.783 -1.335  1.00 43.32  ? 104  GLU C O   1 
ATOM   4437  C  CB  . GLU C  3  99  ? 26.712  -114.809 0.601   1.00 43.71  ? 104  GLU C CB  1 
ATOM   4438  C  CG  . GLU C  3  99  ? 26.993  -115.798 1.732   1.00 45.16  ? 104  GLU C CG  1 
ATOM   4439  C  CD  . GLU C  3  99  ? 27.152  -117.234 1.253   1.00 47.93  ? 104  GLU C CD  1 
ATOM   4440  O  OE1 . GLU C  3  99  ? 28.035  -117.935 1.806   1.00 46.88  ? 104  GLU C OE1 1 
ATOM   4441  O  OE2 . GLU C  3  99  ? 26.404  -117.661 0.328   1.00 49.44  ? 104  GLU C OE2 1 
ATOM   4442  N  N   . ASP C  3  100 ? 26.876  -111.099 0.145   1.00 43.38  ? 105  ASP C N   1 
ATOM   4443  C  CA  . ASP C  3  100 ? 26.653  -109.989 -0.782  1.00 43.17  ? 105  ASP C CA  1 
ATOM   4444  C  C   . ASP C  3  100 ? 27.337  -108.753 -0.202  1.00 42.67  ? 105  ASP C C   1 
ATOM   4445  O  O   . ASP C  3  100 ? 27.204  -108.485 0.999   1.00 42.78  ? 105  ASP C O   1 
ATOM   4446  C  CB  . ASP C  3  100 ? 25.153  -109.713 -0.937  1.00 43.25  ? 105  ASP C CB  1 
ATOM   4447  C  CG  . ASP C  3  100 ? 24.777  -109.196 -2.330  1.00 44.51  ? 105  ASP C CG  1 
ATOM   4448  O  OD1 . ASP C  3  100 ? 23.585  -108.855 -2.534  1.00 44.56  ? 105  ASP C OD1 1 
ATOM   4449  O  OD2 . ASP C  3  100 ? 25.655  -109.147 -3.227  1.00 45.55  ? 105  ASP C OD2 1 
ATOM   4450  N  N   . PRO C  3  101 ? 28.091  -108.007 -1.035  1.00 42.14  ? 106  PRO C N   1 
ATOM   4451  C  CA  . PRO C  3  101 ? 28.615  -106.715 -0.555  1.00 41.40  ? 106  PRO C CA  1 
ATOM   4452  C  C   . PRO C  3  101 ? 27.499  -105.724 -0.217  1.00 40.28  ? 106  PRO C C   1 
ATOM   4453  O  O   . PRO C  3  101 ? 26.388  -105.861 -0.703  1.00 40.33  ? 106  PRO C O   1 
ATOM   4454  C  CB  . PRO C  3  101 ? 29.476  -106.197 -1.717  1.00 41.47  ? 106  PRO C CB  1 
ATOM   4455  C  CG  . PRO C  3  101 ? 29.320  -107.172 -2.838  1.00 42.31  ? 106  PRO C CG  1 
ATOM   4456  C  CD  . PRO C  3  101 ? 28.662  -108.410 -2.334  1.00 42.20  ? 106  PRO C CD  1 
ATOM   4457  N  N   . VAL C  3  102 ? 27.807  -104.747 0.629   1.00 39.41  ? 107  VAL C N   1 
ATOM   4458  C  CA  . VAL C  3  102 ? 26.845  -103.733 1.065   1.00 38.12  ? 107  VAL C CA  1 
ATOM   4459  C  C   . VAL C  3  102 ? 26.298  -102.891 -0.089  1.00 37.58  ? 107  VAL C C   1 
ATOM   4460  O  O   . VAL C  3  102 ? 26.983  -102.688 -1.099  1.00 37.00  ? 107  VAL C O   1 
ATOM   4461  C  CB  . VAL C  3  102 ? 27.486  -102.758 2.091   1.00 37.97  ? 107  VAL C CB  1 
ATOM   4462  C  CG1 . VAL C  3  102 ? 27.455  -103.339 3.477   1.00 38.09  ? 107  VAL C CG1 1 
ATOM   4463  C  CG2 . VAL C  3  102 ? 28.906  -102.409 1.694   1.00 37.19  ? 107  VAL C CG2 1 
ATOM   4464  N  N   . THR C  3  103 ? 25.066  -102.408 0.070   1.00 36.83  ? 108  THR C N   1 
ATOM   4465  C  CA  . THR C  3  103 ? 24.594  -101.296 -0.734  1.00 36.78  ? 108  THR C CA  1 
ATOM   4466  C  C   . THR C  3  103 ? 25.148  -100.006 -0.133  1.00 37.02  ? 108  THR C C   1 
ATOM   4467  O  O   . THR C  3  103 ? 25.485  -99.968  1.059   1.00 37.23  ? 108  THR C O   1 
ATOM   4468  C  CB  . THR C  3  103 ? 23.064  -101.197 -0.797  1.00 36.75  ? 108  THR C CB  1 
ATOM   4469  O  OG1 . THR C  3  103 ? 22.525  -101.077 0.527   1.00 37.03  ? 108  THR C OG1 1 
ATOM   4470  C  CG2 . THR C  3  103 ? 22.470  -102.394 -1.509  1.00 35.46  ? 108  THR C CG2 1 
ATOM   4471  N  N   . VAL C  3  104 ? 25.252  -98.962  -0.959  1.00 36.82  ? 109  VAL C N   1 
ATOM   4472  C  CA  . VAL C  3  104 ? 25.709  -97.643  -0.503  1.00 36.40  ? 109  VAL C CA  1 
ATOM   4473  C  C   . VAL C  3  104 ? 24.768  -97.080  0.572   1.00 36.37  ? 109  VAL C C   1 
ATOM   4474  O  O   . VAL C  3  104 ? 25.216  -96.473  1.549   1.00 35.94  ? 109  VAL C O   1 
ATOM   4475  C  CB  . VAL C  3  104 ? 25.863  -96.654  -1.688  1.00 36.16  ? 109  VAL C CB  1 
ATOM   4476  C  CG1 . VAL C  3  104 ? 26.535  -95.373  -1.245  1.00 35.62  ? 109  VAL C CG1 1 
ATOM   4477  C  CG2 . VAL C  3  104 ? 26.682  -97.292  -2.791  1.00 36.40  ? 109  VAL C CG2 1 
ATOM   4478  N  N   . GLU C  3  105 ? 23.466  -97.295  0.402   1.00 36.57  ? 110  GLU C N   1 
ATOM   4479  C  CA  . GLU C  3  105 ? 22.527  -96.887  1.446   1.00 37.15  ? 110  GLU C CA  1 
ATOM   4480  C  C   . GLU C  3  105 ? 22.783  -97.627  2.768   1.00 36.50  ? 110  GLU C C   1 
ATOM   4481  O  O   . GLU C  3  105 ? 22.833  -97.003  3.819   1.00 36.47  ? 110  GLU C O   1 
ATOM   4482  C  CB  . GLU C  3  105 ? 21.081  -97.023  0.987   1.00 37.47  ? 110  GLU C CB  1 
ATOM   4483  C  CG  . GLU C  3  105 ? 20.080  -96.413  1.942   1.00 40.55  ? 110  GLU C CG  1 
ATOM   4484  C  CD  . GLU C  3  105 ? 19.736  -97.358  3.077   1.00 47.39  ? 110  GLU C CD  1 
ATOM   4485  O  OE1 . GLU C  3  105 ? 19.458  -96.864  4.207   1.00 50.24  ? 110  GLU C OE1 1 
ATOM   4486  O  OE2 . GLU C  3  105 ? 19.753  -98.601  2.841   1.00 49.63  ? 110  GLU C OE2 1 
ATOM   4487  N  N   . TYR C  3  106 ? 22.975  -98.947  2.710   1.00 36.15  ? 111  TYR C N   1 
ATOM   4488  C  CA  . TYR C  3  106 ? 23.286  -99.719  3.920   1.00 35.31  ? 111  TYR C CA  1 
ATOM   4489  C  C   . TYR C  3  106 ? 24.517  -99.178  4.647   1.00 34.95  ? 111  TYR C C   1 
ATOM   4490  O  O   . TYR C  3  106 ? 24.482  -98.962  5.859   1.00 34.96  ? 111  TYR C O   1 
ATOM   4491  C  CB  . TYR C  3  106 ? 23.475  -101.216 3.633   1.00 35.03  ? 111  TYR C CB  1 
ATOM   4492  C  CG  . TYR C  3  106 ? 23.694  -101.994 4.909   1.00 35.11  ? 111  TYR C CG  1 
ATOM   4493  C  CD1 . TYR C  3  106 ? 22.612  -102.524 5.612   1.00 34.64  ? 111  TYR C CD1 1 
ATOM   4494  C  CD2 . TYR C  3  106 ? 24.980  -102.159 5.445   1.00 35.72  ? 111  TYR C CD2 1 
ATOM   4495  C  CE1 . TYR C  3  106 ? 22.797  -103.218 6.800   1.00 36.77  ? 111  TYR C CE1 1 
ATOM   4496  C  CE2 . TYR C  3  106 ? 25.186  -102.852 6.642   1.00 36.21  ? 111  TYR C CE2 1 
ATOM   4497  C  CZ  . TYR C  3  106 ? 24.084  -103.378 7.316   1.00 37.75  ? 111  TYR C CZ  1 
ATOM   4498  O  OH  . TYR C  3  106 ? 24.247  -104.053 8.503   1.00 36.98  ? 111  TYR C OH  1 
ATOM   4499  N  N   . LEU C  3  107 ? 25.599  -98.963  3.907   1.00 34.43  ? 112  LEU C N   1 
ATOM   4500  C  CA  . LEU C  3  107 ? 26.845  -98.509  4.506   1.00 34.23  ? 112  LEU C CA  1 
ATOM   4501  C  C   . LEU C  3  107 ? 26.713  -97.134  5.186   1.00 34.53  ? 112  LEU C C   1 
ATOM   4502  O  O   . LEU C  3  107 ? 27.276  -96.905  6.267   1.00 34.55  ? 112  LEU C O   1 
ATOM   4503  C  CB  . LEU C  3  107 ? 27.944  -98.510  3.452   1.00 33.81  ? 112  LEU C CB  1 
ATOM   4504  C  CG  . LEU C  3  107 ? 29.399  -98.577  3.903   1.00 34.10  ? 112  LEU C CG  1 
ATOM   4505  C  CD1 . LEU C  3  107 ? 29.912  -97.187  4.272   1.00 34.25  ? 112  LEU C CD1 1 
ATOM   4506  C  CD2 . LEU C  3  107 ? 29.627  -99.584  5.057   1.00 32.81  ? 112  LEU C CD2 1 
ATOM   4507  N  N   . THR C  3  108 ? 25.960  -96.239  4.543   1.00 34.55  ? 113  THR C N   1 
ATOM   4508  C  CA  . THR C  3  108 ? 25.675  -94.899  5.041   1.00 34.33  ? 113  THR C CA  1 
ATOM   4509  C  C   . THR C  3  108 ? 24.853  -94.997  6.324   1.00 34.27  ? 113  THR C C   1 
ATOM   4510  O  O   . THR C  3  108 ? 25.206  -94.406  7.346   1.00 34.48  ? 113  THR C O   1 
ATOM   4511  C  CB  . THR C  3  108 ? 24.859  -94.090  4.003   1.00 34.65  ? 113  THR C CB  1 
ATOM   4512  O  OG1 . THR C  3  108 ? 25.501  -94.127  2.717   1.00 35.10  ? 113  THR C OG1 1 
ATOM   4513  C  CG2 . THR C  3  108 ? 24.684  -92.655  4.454   1.00 34.66  ? 113  THR C CG2 1 
ATOM   4514  N  N   . ARG C  3  109 ? 23.753  -95.743  6.278   1.00 33.95  ? 114  ARG C N   1 
ATOM   4515  C  CA  . ARG C  3  109 ? 22.937  -95.947  7.468   1.00 33.93  ? 114  ARG C CA  1 
ATOM   4516  C  C   . ARG C  3  109 ? 23.814  -96.469  8.618   1.00 34.02  ? 114  ARG C C   1 
ATOM   4517  O  O   . ARG C  3  109 ? 23.571  -96.154  9.791   1.00 34.21  ? 114  ARG C O   1 
ATOM   4518  C  CB  . ARG C  3  109 ? 21.759  -96.885  7.174   1.00 33.68  ? 114  ARG C CB  1 
ATOM   4519  C  CG  . ARG C  3  109 ? 20.954  -97.329  8.409   1.00 33.91  ? 114  ARG C CG  1 
ATOM   4520  C  CD  . ARG C  3  109 ? 19.551  -97.873  8.062   1.00 34.97  ? 114  ARG C CD  1 
ATOM   4521  N  NE  . ARG C  3  109 ? 19.493  -98.463  6.719   1.00 37.32  ? 114  ARG C NE  1 
ATOM   4522  C  CZ  . ARG C  3  109 ? 19.616  -99.765  6.445   1.00 38.14  ? 114  ARG C CZ  1 
ATOM   4523  N  NH1 . ARG C  3  109 ? 19.567  -100.179 5.179   1.00 37.71  ? 114  ARG C NH1 1 
ATOM   4524  N  NH2 . ARG C  3  109 ? 19.785  -100.660 7.426   1.00 37.30  ? 114  ARG C NH2 1 
ATOM   4525  N  N   . TYR C  3  110 ? 24.852  -97.233  8.282   1.00 33.63  ? 115  TYR C N   1 
ATOM   4526  C  CA  . TYR C  3  110 ? 25.693  -97.789  9.317   1.00 33.65  ? 115  TYR C CA  1 
ATOM   4527  C  C   . TYR C  3  110 ? 26.591  -96.744  9.951   1.00 33.31  ? 115  TYR C C   1 
ATOM   4528  O  O   . TYR C  3  110 ? 26.578  -96.587  11.180  1.00 33.55  ? 115  TYR C O   1 
ATOM   4529  C  CB  . TYR C  3  110 ? 26.505  -99.007  8.858   1.00 33.70  ? 115  TYR C CB  1 
ATOM   4530  C  CG  . TYR C  3  110 ? 27.470  -99.423  9.936   1.00 34.89  ? 115  TYR C CG  1 
ATOM   4531  C  CD1 . TYR C  3  110 ? 27.057  -100.206 11.021  1.00 35.92  ? 115  TYR C CD1 1 
ATOM   4532  C  CD2 . TYR C  3  110 ? 28.786  -98.967  9.921   1.00 35.80  ? 115  TYR C CD2 1 
ATOM   4533  C  CE1 . TYR C  3  110 ? 27.954  -100.558 12.034  1.00 35.27  ? 115  TYR C CE1 1 
ATOM   4534  C  CE2 . TYR C  3  110 ? 29.674  -99.310  10.931  1.00 35.78  ? 115  TYR C CE2 1 
ATOM   4535  C  CZ  . TYR C  3  110 ? 29.254  -100.097 11.971  1.00 35.70  ? 115  TYR C CZ  1 
ATOM   4536  O  OH  . TYR C  3  110 ? 30.171  -100.414 12.940  1.00 39.50  ? 115  TYR C OH  1 
ATOM   4537  N  N   . VAL C  3  111 ? 27.370  -96.044  9.124   1.00 32.64  ? 116  VAL C N   1 
ATOM   4538  C  CA  . VAL C  3  111 ? 28.192  -94.918  9.585   1.00 31.87  ? 116  VAL C CA  1 
ATOM   4539  C  C   . VAL C  3  111 ? 27.339  -93.884  10.345  1.00 31.65  ? 116  VAL C C   1 
ATOM   4540  O  O   . VAL C  3  111 ? 27.718  -93.402  11.413  1.00 31.53  ? 116  VAL C O   1 
ATOM   4541  C  CB  . VAL C  3  111 ? 28.927  -94.236  8.412   1.00 31.78  ? 116  VAL C CB  1 
ATOM   4542  C  CG1 . VAL C  3  111 ? 29.546  -92.918  8.852   1.00 31.39  ? 116  VAL C CG1 1 
ATOM   4543  C  CG2 . VAL C  3  111 ? 30.003  -95.155  7.841   1.00 31.87  ? 116  VAL C CG2 1 
ATOM   4544  N  N   . ALA C  3  112 ? 26.172  -93.572  9.800   1.00 31.37  ? 117  ALA C N   1 
ATOM   4545  C  CA  . ALA C  3  112 ? 25.301  -92.585  10.412  1.00 31.46  ? 117  ALA C CA  1 
ATOM   4546  C  C   . ALA C  3  112 ? 24.887  -92.984  11.834  1.00 31.38  ? 117  ALA C C   1 
ATOM   4547  O  O   . ALA C  3  112 ? 24.831  -92.139  12.729  1.00 31.16  ? 117  ALA C O   1 
ATOM   4548  C  CB  . ALA C  3  112 ? 24.082  -92.335  9.529   1.00 31.47  ? 117  ALA C CB  1 
ATOM   4549  N  N   . GLY C  3  113 ? 24.618  -94.274  12.033  1.00 31.55  ? 118  GLY C N   1 
ATOM   4550  C  CA  . GLY C  3  113 ? 24.247  -94.802  13.344  1.00 31.67  ? 118  GLY C CA  1 
ATOM   4551  C  C   . GLY C  3  113 ? 25.383  -94.746  14.350  1.00 31.99  ? 118  GLY C C   1 
ATOM   4552  O  O   . GLY C  3  113 ? 25.152  -94.567  15.544  1.00 31.97  ? 118  GLY C O   1 
ATOM   4553  N  N   . VAL C  3  114 ? 26.614  -94.911  13.881  1.00 32.27  ? 119  VAL C N   1 
ATOM   4554  C  CA  . VAL C  3  114 ? 27.741  -94.802  14.782  1.00 33.14  ? 119  VAL C CA  1 
ATOM   4555  C  C   . VAL C  3  114 ? 27.818  -93.339  15.213  1.00 33.96  ? 119  VAL C C   1 
ATOM   4556  O  O   . VAL C  3  114 ? 27.869  -93.035  16.413  1.00 34.32  ? 119  VAL C O   1 
ATOM   4557  C  CB  . VAL C  3  114 ? 29.065  -95.244  14.133  1.00 33.26  ? 119  VAL C CB  1 
ATOM   4558  C  CG1 . VAL C  3  114 ? 30.239  -94.927  15.052  1.00 33.41  ? 119  VAL C CG1 1 
ATOM   4559  C  CG2 . VAL C  3  114 ? 29.038  -96.722  13.796  1.00 32.76  ? 119  VAL C CG2 1 
ATOM   4560  N  N   . GLN C  3  115 ? 27.790  -92.433  14.234  1.00 34.43  ? 120  GLN C N   1 
ATOM   4561  C  CA  . GLN C  3  115 ? 27.767  -90.999  14.523  1.00 34.86  ? 120  GLN C CA  1 
ATOM   4562  C  C   . GLN C  3  115 ? 26.688  -90.643  15.552  1.00 35.23  ? 120  GLN C C   1 
ATOM   4563  O  O   . GLN C  3  115 ? 26.987  -90.011  16.567  1.00 35.03  ? 120  GLN C O   1 
ATOM   4564  C  CB  . GLN C  3  115 ? 27.637  -90.183  13.242  1.00 34.30  ? 120  GLN C CB  1 
ATOM   4565  C  CG  . GLN C  3  115 ? 28.940  -90.158  12.491  1.00 35.56  ? 120  GLN C CG  1 
ATOM   4566  C  CD  . GLN C  3  115 ? 28.919  -89.288  11.249  1.00 37.91  ? 120  GLN C CD  1 
ATOM   4567  O  OE1 . GLN C  3  115 ? 28.131  -89.511  10.329  1.00 39.06  ? 120  GLN C OE1 1 
ATOM   4568  N  NE2 . GLN C  3  115 ? 29.813  -88.300  11.205  1.00 38.09  ? 120  GLN C NE2 1 
ATOM   4569  N  N   . GLN C  3  116 ? 25.458  -91.092  15.310  1.00 35.83  ? 121  GLN C N   1 
ATOM   4570  C  CA  . GLN C  3  116 ? 24.359  -90.826  16.223  1.00 36.89  ? 121  GLN C CA  1 
ATOM   4571  C  C   . GLN C  3  116 ? 24.662  -91.334  17.625  1.00 38.08  ? 121  GLN C C   1 
ATOM   4572  O  O   . GLN C  3  116 ? 24.414  -90.635  18.594  1.00 38.13  ? 121  GLN C O   1 
ATOM   4573  C  CB  . GLN C  3  116 ? 23.070  -91.455  15.705  1.00 36.62  ? 121  GLN C CB  1 
ATOM   4574  C  CG  . GLN C  3  116 ? 21.805  -91.052  16.468  1.00 36.46  ? 121  GLN C CG  1 
ATOM   4575  C  CD  . GLN C  3  116 ? 21.621  -91.739  17.820  1.00 36.52  ? 121  GLN C CD  1 
ATOM   4576  O  OE1 . GLN C  3  116 ? 20.972  -91.194  18.714  1.00 36.71  ? 121  GLN C OE1 1 
ATOM   4577  N  NE2 . GLN C  3  116 ? 22.180  -92.937  17.972  1.00 35.97  ? 121  GLN C NE2 1 
ATOM   4578  N  N   . ARG C  3  117 ? 25.192  -92.554  17.718  1.00 39.73  ? 122  ARG C N   1 
ATOM   4579  C  CA  . ARG C  3  117 ? 25.450  -93.222  19.009  1.00 41.47  ? 122  ARG C CA  1 
ATOM   4580  C  C   . ARG C  3  117 ? 26.385  -92.402  19.912  1.00 41.52  ? 122  ARG C C   1 
ATOM   4581  O  O   . ARG C  3  117 ? 26.203  -92.334  21.129  1.00 41.48  ? 122  ARG C O   1 
ATOM   4582  C  CB  . ARG C  3  117 ? 26.008  -94.639  18.778  1.00 41.88  ? 122  ARG C CB  1 
ATOM   4583  C  CG  . ARG C  3  117 ? 25.291  -95.751  19.553  1.00 45.07  ? 122  ARG C CG  1 
ATOM   4584  C  CD  . ARG C  3  117 ? 25.591  -97.168  18.986  1.00 49.67  ? 122  ARG C CD  1 
ATOM   4585  N  NE  . ARG C  3  117 ? 24.824  -97.493  17.768  1.00 51.83  ? 122  ARG C NE  1 
ATOM   4586  C  CZ  . ARG C  3  117 ? 25.363  -97.844  16.592  1.00 53.21  ? 122  ARG C CZ  1 
ATOM   4587  N  NH1 . ARG C  3  117 ? 26.684  -97.941  16.448  1.00 53.92  ? 122  ARG C NH1 1 
ATOM   4588  N  NH2 . ARG C  3  117 ? 24.583  -98.114  15.549  1.00 52.45  ? 122  ARG C NH2 1 
ATOM   4589  N  N   . TYR C  3  118 ? 27.372  -91.766  19.291  1.00 41.98  ? 123  TYR C N   1 
ATOM   4590  C  CA  . TYR C  3  118 ? 28.303  -90.886  19.985  1.00 42.29  ? 123  TYR C CA  1 
ATOM   4591  C  C   . TYR C  3  118 ? 27.677  -89.563  20.479  1.00 42.69  ? 123  TYR C C   1 
ATOM   4592  O  O   . TYR C  3  118 ? 28.306  -88.812  21.229  1.00 43.28  ? 123  TYR C O   1 
ATOM   4593  C  CB  . TYR C  3  118 ? 29.526  -90.637  19.097  1.00 41.87  ? 123  TYR C CB  1 
ATOM   4594  C  CG  . TYR C  3  118 ? 30.544  -91.744  19.174  1.00 41.47  ? 123  TYR C CG  1 
ATOM   4595  C  CD1 . TYR C  3  118 ? 30.215  -93.051  18.825  1.00 41.58  ? 123  TYR C CD1 1 
ATOM   4596  C  CD2 . TYR C  3  118 ? 31.838  -91.492  19.606  1.00 41.81  ? 123  TYR C CD2 1 
ATOM   4597  C  CE1 . TYR C  3  118 ? 31.153  -94.078  18.907  1.00 40.66  ? 123  TYR C CE1 1 
ATOM   4598  C  CE2 . TYR C  3  118 ? 32.780  -92.502  19.688  1.00 41.15  ? 123  TYR C CE2 1 
ATOM   4599  C  CZ  . TYR C  3  118 ? 32.433  -93.794  19.336  1.00 41.37  ? 123  TYR C CZ  1 
ATOM   4600  O  OH  . TYR C  3  118 ? 33.376  -94.797  19.421  1.00 41.30  ? 123  TYR C OH  1 
ATOM   4601  N  N   . THR C  3  119 ? 26.444  -89.280  20.075  1.00 42.87  ? 124  THR C N   1 
ATOM   4602  C  CA  . THR C  3  119 ? 25.762  -88.098  20.583  1.00 42.99  ? 124  THR C CA  1 
ATOM   4603  C  C   . THR C  3  119 ? 24.876  -88.403  21.794  1.00 43.93  ? 124  THR C C   1 
ATOM   4604  O  O   . THR C  3  119 ? 24.351  -87.473  22.416  1.00 44.40  ? 124  THR C O   1 
ATOM   4605  C  CB  . THR C  3  119 ? 24.923  -87.386  19.514  1.00 42.47  ? 124  THR C CB  1 
ATOM   4606  O  OG1 . THR C  3  119 ? 23.692  -88.090  19.322  1.00 42.26  ? 124  THR C OG1 1 
ATOM   4607  C  CG2 . THR C  3  119 ? 25.669  -87.296  18.212  1.00 41.90  ? 124  THR C CG2 1 
ATOM   4608  N  N   . GLN C  3  120 ? 24.682  -89.678  22.133  1.00 44.45  ? 125  GLN C N   1 
ATOM   4609  C  CA  . GLN C  3  120 ? 23.906  -89.978  23.343  1.00 45.59  ? 125  GLN C CA  1 
ATOM   4610  C  C   . GLN C  3  120 ? 24.502  -90.993  24.300  1.00 45.44  ? 125  GLN C C   1 
ATOM   4611  O  O   . GLN C  3  120 ? 23.783  -91.653  25.051  1.00 46.03  ? 125  GLN C O   1 
ATOM   4612  C  CB  . GLN C  3  120 ? 22.418  -90.251  23.053  1.00 45.85  ? 125  GLN C CB  1 
ATOM   4613  C  CG  . GLN C  3  120 ? 22.071  -91.530  22.313  1.00 48.66  ? 125  GLN C CG  1 
ATOM   4614  C  CD  . GLN C  3  120 ? 20.566  -91.632  22.037  1.00 52.69  ? 125  GLN C CD  1 
ATOM   4615  O  OE1 . GLN C  3  120 ? 19.725  -91.076  22.781  1.00 53.67  ? 125  GLN C OE1 1 
ATOM   4616  N  NE2 . GLN C  3  120 ? 20.218  -92.335  20.959  1.00 53.46  ? 125  GLN C NE2 1 
ATOM   4617  N  N   . SER C  3  121 ? 25.822  -91.087  24.296  1.00 45.51  ? 126  SER C N   1 
ATOM   4618  C  CA  . SER C  3  121 ? 26.518  -91.974  25.211  1.00 45.60  ? 126  SER C CA  1 
ATOM   4619  C  C   . SER C  3  121 ? 27.399  -91.207  26.182  1.00 45.63  ? 126  SER C C   1 
ATOM   4620  O  O   . SER C  3  121 ? 28.046  -90.219  25.810  1.00 45.48  ? 126  SER C O   1 
ATOM   4621  C  CB  . SER C  3  121 ? 27.328  -93.008  24.438  1.00 45.51  ? 126  SER C CB  1 
ATOM   4622  O  OG  . SER C  3  121 ? 26.471  -93.753  23.586  1.00 45.77  ? 126  SER C OG  1 
ATOM   4623  N  N   . GLY C  3  122 ? 27.402  -91.671  27.431  1.00 45.81  ? 127  GLY C N   1 
ATOM   4624  C  CA  . GLY C  3  122 ? 28.190  -91.066  28.500  1.00 45.62  ? 127  GLY C CA  1 
ATOM   4625  C  C   . GLY C  3  122 ? 29.676  -91.068  28.206  1.00 45.55  ? 127  GLY C C   1 
ATOM   4626  O  O   . GLY C  3  122 ? 30.218  -92.028  27.648  1.00 45.51  ? 127  GLY C O   1 
ATOM   4627  N  N   . GLY C  3  123 ? 30.328  -89.966  28.552  1.00 45.39  ? 128  GLY C N   1 
ATOM   4628  C  CA  . GLY C  3  123 ? 31.781  -89.862  28.466  1.00 45.17  ? 128  GLY C CA  1 
ATOM   4629  C  C   . GLY C  3  123 ? 32.405  -89.823  27.083  1.00 45.04  ? 128  GLY C C   1 
ATOM   4630  O  O   . GLY C  3  123 ? 33.624  -89.948  26.968  1.00 45.70  ? 128  GLY C O   1 
ATOM   4631  N  N   . VAL C  3  124 ? 31.592  -89.664  26.035  1.00 44.25  ? 129  VAL C N   1 
ATOM   4632  C  CA  . VAL C  3  124 ? 32.120  -89.555  24.670  1.00 43.21  ? 129  VAL C CA  1 
ATOM   4633  C  C   . VAL C  3  124 ? 31.624  -88.293  23.955  1.00 42.47  ? 129  VAL C C   1 
ATOM   4634  O  O   . VAL C  3  124 ? 30.480  -87.883  24.130  1.00 42.64  ? 129  VAL C O   1 
ATOM   4635  C  CB  . VAL C  3  124 ? 31.811  -90.811  23.817  1.00 43.20  ? 129  VAL C CB  1 
ATOM   4636  C  CG1 . VAL C  3  124 ? 32.204  -92.077  24.559  1.00 43.01  ? 129  VAL C CG1 1 
ATOM   4637  C  CG2 . VAL C  3  124 ? 30.352  -90.869  23.450  1.00 43.73  ? 129  VAL C CG2 1 
ATOM   4638  N  N   . ARG C  3  125 ? 32.487  -87.678  23.154  1.00 41.38  ? 130  ARG C N   1 
ATOM   4639  C  CA  . ARG C  3  125 ? 32.076  -86.519  22.372  1.00 40.39  ? 130  ARG C CA  1 
ATOM   4640  C  C   . ARG C  3  125 ? 31.663  -86.956  20.966  1.00 40.19  ? 130  ARG C C   1 
ATOM   4641  O  O   . ARG C  3  125 ? 32.105  -88.008  20.484  1.00 40.12  ? 130  ARG C O   1 
ATOM   4642  C  CB  . ARG C  3  125 ? 33.179  -85.456  22.334  1.00 40.10  ? 130  ARG C CB  1 
ATOM   4643  C  CG  . ARG C  3  125 ? 34.295  -85.775  21.387  1.00 38.79  ? 130  ARG C CG  1 
ATOM   4644  C  CD  . ARG C  3  125 ? 35.370  -84.705  21.283  1.00 36.39  ? 130  ARG C CD  1 
ATOM   4645  N  NE  . ARG C  3  125 ? 36.509  -85.228  20.516  1.00 34.31  ? 130  ARG C NE  1 
ATOM   4646  C  CZ  . ARG C  3  125 ? 36.443  -85.581  19.232  1.00 33.19  ? 130  ARG C CZ  1 
ATOM   4647  N  NH1 . ARG C  3  125 ? 35.300  -85.475  18.550  1.00 30.83  ? 130  ARG C NH1 1 
ATOM   4648  N  NH2 . ARG C  3  125 ? 37.514  -86.059  18.630  1.00 32.93  ? 130  ARG C NH2 1 
ATOM   4649  N  N   . PRO C  3  126 ? 30.794  -86.169  20.307  1.00 39.97  ? 131  PRO C N   1 
ATOM   4650  C  CA  . PRO C  3  126 ? 30.380  -86.508  18.955  1.00 39.66  ? 131  PRO C CA  1 
ATOM   4651  C  C   . PRO C  3  126 ? 31.558  -86.467  18.012  1.00 39.32  ? 131  PRO C C   1 
ATOM   4652  O  O   . PRO C  3  126 ? 32.603  -85.933  18.365  1.00 39.44  ? 131  PRO C O   1 
ATOM   4653  C  CB  . PRO C  3  126 ? 29.387  -85.394  18.609  1.00 39.60  ? 131  PRO C CB  1 
ATOM   4654  C  CG  . PRO C  3  126 ? 28.848  -84.972  19.896  1.00 39.56  ? 131  PRO C CG  1 
ATOM   4655  C  CD  . PRO C  3  126 ? 30.027  -85.019  20.819  1.00 40.21  ? 131  PRO C CD  1 
ATOM   4656  N  N   . PHE C  3  127 ? 31.394  -87.061  16.836  1.00 39.59  ? 132  PHE C N   1 
ATOM   4657  C  CA  . PHE C  3  127 ? 32.421  -87.030  15.799  1.00 39.61  ? 132  PHE C CA  1 
ATOM   4658  C  C   . PHE C  3  127 ? 32.433  -85.663  15.145  1.00 39.50  ? 132  PHE C C   1 
ATOM   4659  O  O   . PHE C  3  127 ? 31.391  -85.175  14.707  1.00 39.82  ? 132  PHE C O   1 
ATOM   4660  C  CB  . PHE C  3  127 ? 32.148  -88.094  14.734  1.00 39.62  ? 132  PHE C CB  1 
ATOM   4661  C  CG  . PHE C  3  127 ? 32.538  -89.474  15.152  1.00 40.25  ? 132  PHE C CG  1 
ATOM   4662  C  CD1 . PHE C  3  127 ? 31.596  -90.350  15.664  1.00 39.83  ? 132  PHE C CD1 1 
ATOM   4663  C  CD2 . PHE C  3  127 ? 33.860  -89.899  15.031  1.00 41.10  ? 132  PHE C CD2 1 
ATOM   4664  C  CE1 . PHE C  3  127 ? 31.958  -91.621  16.055  1.00 41.08  ? 132  PHE C CE1 1 
ATOM   4665  C  CE2 . PHE C  3  127 ? 34.233  -91.169  15.426  1.00 41.16  ? 132  PHE C CE2 1 
ATOM   4666  C  CZ  . PHE C  3  127 ? 33.277  -92.034  15.943  1.00 41.34  ? 132  PHE C CZ  1 
ATOM   4667  N  N   . GLY C  3  128 ? 33.606  -85.045  15.070  1.00 39.17  ? 133  GLY C N   1 
ATOM   4668  C  CA  . GLY C  3  128 ? 33.723  -83.768  14.376  1.00 38.86  ? 133  GLY C CA  1 
ATOM   4669  C  C   . GLY C  3  128 ? 33.848  -83.916  12.869  1.00 38.64  ? 133  GLY C C   1 
ATOM   4670  O  O   . GLY C  3  128 ? 34.681  -83.235  12.261  1.00 38.52  ? 133  GLY C O   1 
ATOM   4671  N  N   . VAL C  3  129 ? 33.021  -84.785  12.268  1.00 38.12  ? 134  VAL C N   1 
ATOM   4672  C  CA  . VAL C  3  129 ? 33.159  -85.165  10.851  1.00 37.97  ? 134  VAL C CA  1 
ATOM   4673  C  C   . VAL C  3  129 ? 31.817  -85.237  10.110  1.00 37.96  ? 134  VAL C C   1 
ATOM   4674  O  O   . VAL C  3  129 ? 30.823  -85.715  10.663  1.00 37.85  ? 134  VAL C O   1 
ATOM   4675  C  CB  . VAL C  3  129 ? 33.874  -86.541  10.714  1.00 37.92  ? 134  VAL C CB  1 
ATOM   4676  C  CG1 . VAL C  3  129 ? 33.826  -87.059  9.286   1.00 38.18  ? 134  VAL C CG1 1 
ATOM   4677  C  CG2 . VAL C  3  129 ? 35.300  -86.458  11.171  1.00 37.83  ? 134  VAL C CG2 1 
ATOM   4678  N  N   . SER C  3  130 ? 31.796  -84.750  8.868   1.00 37.82  ? 135  SER C N   1 
ATOM   4679  C  CA  . SER C  3  130 ? 30.695  -85.016  7.935   1.00 38.18  ? 135  SER C CA  1 
ATOM   4680  C  C   . SER C  3  130 ? 31.236  -85.843  6.787   1.00 38.40  ? 135  SER C C   1 
ATOM   4681  O  O   . SER C  3  130 ? 32.371  -85.616  6.334   1.00 38.27  ? 135  SER C O   1 
ATOM   4682  C  CB  . SER C  3  130 ? 30.115  -83.720  7.365   1.00 38.33  ? 135  SER C CB  1 
ATOM   4683  O  OG  . SER C  3  130 ? 29.146  -83.147  8.225   1.00 39.11  ? 135  SER C OG  1 
ATOM   4684  N  N   . THR C  3  131 ? 30.437  -86.792  6.300   1.00 38.53  ? 136  THR C N   1 
ATOM   4685  C  CA  . THR C  3  131 ? 30.932  -87.723  5.274   1.00 38.80  ? 136  THR C CA  1 
ATOM   4686  C  C   . THR C  3  131 ? 30.158  -87.685  3.964   1.00 38.99  ? 136  THR C C   1 
ATOM   4687  O  O   . THR C  3  131 ? 28.973  -87.343  3.924   1.00 39.04  ? 136  THR C O   1 
ATOM   4688  C  CB  . THR C  3  131 ? 31.029  -89.205  5.781   1.00 38.71  ? 136  THR C CB  1 
ATOM   4689  O  OG1 . THR C  3  131 ? 29.721  -89.793  5.883   1.00 38.18  ? 136  THR C OG1 1 
ATOM   4690  C  CG2 . THR C  3  131 ? 31.719  -89.275  7.120   1.00 38.95  ? 136  THR C CG2 1 
ATOM   4691  N  N   . LEU C  3  132 ? 30.861  -88.042  2.897   1.00 39.28  ? 137  LEU C N   1 
ATOM   4692  C  CA  . LEU C  3  132 ? 30.254  -88.289  1.605   1.00 39.58  ? 137  LEU C CA  1 
ATOM   4693  C  C   . LEU C  3  132 ? 30.607  -89.714  1.193   1.00 39.79  ? 137  LEU C C   1 
ATOM   4694  O  O   . LEU C  3  132 ? 31.784  -90.082  1.013   1.00 39.83  ? 137  LEU C O   1 
ATOM   4695  C  CB  . LEU C  3  132 ? 30.716  -87.264  0.548   1.00 39.63  ? 137  LEU C CB  1 
ATOM   4696  C  CG  . LEU C  3  132 ? 30.259  -85.791  0.632   1.00 39.59  ? 137  LEU C CG  1 
ATOM   4697  C  CD1 . LEU C  3  132 ? 30.963  -84.942  -0.422  1.00 38.58  ? 137  LEU C CD1 1 
ATOM   4698  C  CD2 . LEU C  3  132 ? 28.736  -85.627  0.514   1.00 38.94  ? 137  LEU C CD2 1 
ATOM   4699  N  N   . ILE C  3  133 ? 29.570  -90.519  1.073   1.00 39.74  ? 138  ILE C N   1 
ATOM   4700  C  CA  . ILE C  3  133 ? 29.730  -91.896  0.699   1.00 40.11  ? 138  ILE C CA  1 
ATOM   4701  C  C   . ILE C  3  133 ? 29.128  -92.069  -0.683  1.00 40.61  ? 138  ILE C C   1 
ATOM   4702  O  O   . ILE C  3  133 ? 27.992  -91.644  -0.939  1.00 40.44  ? 138  ILE C O   1 
ATOM   4703  C  CB  . ILE C  3  133 ? 29.083  -92.815  1.754   1.00 40.24  ? 138  ILE C CB  1 
ATOM   4704  C  CG1 . ILE C  3  133 ? 29.800  -92.609  3.102   1.00 40.36  ? 138  ILE C CG1 1 
ATOM   4705  C  CG2 . ILE C  3  133 ? 29.150  -94.261  1.318   1.00 39.10  ? 138  ILE C CG2 1 
ATOM   4706  C  CD1 . ILE C  3  133 ? 29.030  -93.059  4.304   1.00 39.99  ? 138  ILE C CD1 1 
ATOM   4707  N  N   . ALA C  3  134 ? 29.910  -92.671  -1.574  1.00 41.26  ? 139  ALA C N   1 
ATOM   4708  C  CA  . ALA C  3  134 ? 29.538  -92.793  -2.973  1.00 42.08  ? 139  ALA C CA  1 
ATOM   4709  C  C   . ALA C  3  134 ? 29.977  -94.123  -3.579  1.00 42.93  ? 139  ALA C C   1 
ATOM   4710  O  O   . ALA C  3  134 ? 31.073  -94.625  -3.295  1.00 42.87  ? 139  ALA C O   1 
ATOM   4711  C  CB  . ALA C  3  134 ? 30.130  -91.644  -3.756  1.00 41.99  ? 139  ALA C CB  1 
ATOM   4712  N  N   . GLY C  3  135 ? 29.119  -94.692  -4.416  1.00 43.71  ? 140  GLY C N   1 
ATOM   4713  C  CA  . GLY C  3  135 ? 29.451  -95.930  -5.095  1.00 45.70  ? 140  GLY C CA  1 
ATOM   4714  C  C   . GLY C  3  135 ? 28.269  -96.586  -5.765  1.00 47.19  ? 140  GLY C C   1 
ATOM   4715  O  O   . GLY C  3  135 ? 27.220  -95.968  -5.936  1.00 47.30  ? 140  GLY C O   1 
ATOM   4716  N  N   . PHE C  3  136 ? 28.439  -97.849  -6.142  1.00 48.85  ? 141  PHE C N   1 
ATOM   4717  C  CA  . PHE C  3  136 ? 27.389  -98.584  -6.842  1.00 50.57  ? 141  PHE C CA  1 
ATOM   4718  C  C   . PHE C  3  136 ? 26.972  -99.842  -6.107  1.00 51.52  ? 141  PHE C C   1 
ATOM   4719  O  O   . PHE C  3  136 ? 27.816  -100.674 -5.774  1.00 51.57  ? 141  PHE C O   1 
ATOM   4720  C  CB  . PHE C  3  136 ? 27.854  -98.951  -8.254  1.00 50.72  ? 141  PHE C CB  1 
ATOM   4721  C  CG  . PHE C  3  136 ? 27.957  -97.779  -9.176  1.00 51.32  ? 141  PHE C CG  1 
ATOM   4722  C  CD1 . PHE C  3  136 ? 26.852  -97.364  -9.917  1.00 51.25  ? 141  PHE C CD1 1 
ATOM   4723  C  CD2 . PHE C  3  136 ? 29.157  -97.079  -9.299  1.00 52.14  ? 141  PHE C CD2 1 
ATOM   4724  C  CE1 . PHE C  3  136 ? 26.945  -96.270  -10.773 1.00 52.20  ? 141  PHE C CE1 1 
ATOM   4725  C  CE2 . PHE C  3  136 ? 29.258  -95.977  -10.158 1.00 52.50  ? 141  PHE C CE2 1 
ATOM   4726  C  CZ  . PHE C  3  136 ? 28.152  -95.574  -10.891 1.00 52.08  ? 141  PHE C CZ  1 
ATOM   4727  N  N   . ASP C  3  137 ? 25.670  -99.979  -5.865  1.00 52.95  ? 142  ASP C N   1 
ATOM   4728  C  CA  . ASP C  3  137 ? 25.110  -101.226 -5.339  1.00 54.64  ? 142  ASP C CA  1 
ATOM   4729  C  C   . ASP C  3  137 ? 25.551  -102.409 -6.221  1.00 55.53  ? 142  ASP C C   1 
ATOM   4730  O  O   . ASP C  3  137 ? 25.729  -102.232 -7.433  1.00 55.58  ? 142  ASP C O   1 
ATOM   4731  C  CB  . ASP C  3  137 ? 23.579  -101.152 -5.266  1.00 54.74  ? 142  ASP C CB  1 
ATOM   4732  C  CG  . ASP C  3  137 ? 23.071  -100.130 -4.232  1.00 56.14  ? 142  ASP C CG  1 
ATOM   4733  O  OD1 . ASP C  3  137 ? 23.887  -99.419  -3.587  1.00 56.46  ? 142  ASP C OD1 1 
ATOM   4734  O  OD2 . ASP C  3  137 ? 21.830  -100.046 -4.064  1.00 57.10  ? 142  ASP C OD2 1 
ATOM   4735  N  N   . PRO C  3  138 ? 25.757  -103.608 -5.618  1.00 56.52  ? 143  PRO C N   1 
ATOM   4736  C  CA  . PRO C  3  138 ? 26.168  -104.776 -6.409  1.00 57.09  ? 143  PRO C CA  1 
ATOM   4737  C  C   . PRO C  3  138 ? 25.203  -105.039 -7.565  1.00 57.67  ? 143  PRO C C   1 
ATOM   4738  O  O   . PRO C  3  138 ? 23.979  -105.076 -7.356  1.00 57.51  ? 143  PRO C O   1 
ATOM   4739  C  CB  . PRO C  3  138 ? 26.105  -105.932 -5.401  1.00 57.06  ? 143  PRO C CB  1 
ATOM   4740  C  CG  . PRO C  3  138 ? 26.226  -105.290 -4.065  1.00 56.74  ? 143  PRO C CG  1 
ATOM   4741  C  CD  . PRO C  3  138 ? 25.555  -103.958 -4.195  1.00 56.61  ? 143  PRO C CD  1 
ATOM   4742  N  N   . ARG C  3  139 A 25.765  -105.189 -8.766  1.00 58.34  ? 143  ARG C N   1 
ATOM   4743  C  CA  . ARG C  3  139 A 25.005  -105.489 -9.982  1.00 59.44  ? 143  ARG C CA  1 
ATOM   4744  C  C   . ARG C  3  139 A 24.086  -104.343 -10.429 1.00 59.99  ? 143  ARG C C   1 
ATOM   4745  O  O   . ARG C  3  139 A 23.240  -104.533 -11.302 1.00 60.26  ? 143  ARG C O   1 
ATOM   4746  C  CB  . ARG C  3  139 A 24.206  -106.798 -9.831  1.00 59.43  ? 143  ARG C CB  1 
ATOM   4747  C  CG  . ARG C  3  139 A 25.069  -108.030 -9.534  1.00 60.09  ? 143  ARG C CG  1 
ATOM   4748  C  CD  . ARG C  3  139 A 24.215  -109.240 -9.152  1.00 60.79  ? 143  ARG C CD  1 
ATOM   4749  N  NE  . ARG C  3  139 A 23.270  -108.931 -8.078  1.00 61.14  ? 143  ARG C NE  1 
ATOM   4750  C  CZ  . ARG C  3  139 A 23.550  -108.984 -6.774  1.00 60.35  ? 143  ARG C CZ  1 
ATOM   4751  N  NH1 . ARG C  3  139 A 24.766  -109.332 -6.355  1.00 59.55  ? 143  ARG C NH1 1 
ATOM   4752  N  NH2 . ARG C  3  139 A 22.608  -108.679 -5.883  1.00 59.01  ? 143  ARG C NH2 1 
ATOM   4753  N  N   . ASP C  3  140 ? 24.259  -103.160 -9.839  1.00 60.60  ? 144  ASP C N   1 
ATOM   4754  C  CA  . ASP C  3  140 ? 23.462  -101.984 -10.204 1.00 61.12  ? 144  ASP C CA  1 
ATOM   4755  C  C   . ASP C  3  140 ? 24.306  -100.970 -10.987 1.00 61.34  ? 144  ASP C C   1 
ATOM   4756  O  O   . ASP C  3  140 ? 25.507  -100.816 -10.730 1.00 61.31  ? 144  ASP C O   1 
ATOM   4757  C  CB  . ASP C  3  140 ? 22.852  -101.338 -8.955  1.00 61.20  ? 144  ASP C CB  1 
ATOM   4758  C  CG  . ASP C  3  140 ? 21.637  -100.467 -9.266  1.00 62.13  ? 144  ASP C CG  1 
ATOM   4759  O  OD1 . ASP C  3  140 ? 21.177  -99.743  -8.353  1.00 62.88  ? 144  ASP C OD1 1 
ATOM   4760  O  OD2 . ASP C  3  140 ? 21.138  -100.502 -10.413 1.00 63.08  ? 144  ASP C OD2 1 
ATOM   4761  N  N   . ASP C  3  141 B 23.680  -100.301 -11.955 1.00 61.53  ? 144  ASP C N   1 
ATOM   4762  C  CA  . ASP C  3  141 B 24.371  -99.284  -12.767 1.00 61.99  ? 144  ASP C CA  1 
ATOM   4763  C  C   . ASP C  3  141 B 23.997  -97.855  -12.343 1.00 61.46  ? 144  ASP C C   1 
ATOM   4764  O  O   . ASP C  3  141 B 24.596  -96.877  -12.806 1.00 61.45  ? 144  ASP C O   1 
ATOM   4765  C  CB  . ASP C  3  141 B 24.132  -99.502  -14.276 1.00 62.29  ? 144  ASP C CB  1 
ATOM   4766  C  CG  . ASP C  3  141 B 22.654  -99.702  -14.628 1.00 64.40  ? 144  ASP C CG  1 
ATOM   4767  O  OD1 . ASP C  3  141 B 22.375  -100.022 -15.808 1.00 66.91  ? 144  ASP C OD1 1 
ATOM   4768  O  OD2 . ASP C  3  141 B 21.772  -99.553  -13.742 1.00 65.97  ? 144  ASP C OD2 1 
ATOM   4769  N  N   . GLU C  3  142 ? 23.020  -97.764  -11.442 1.00 60.76  ? 145  GLU C N   1 
ATOM   4770  C  CA  . GLU C  3  142 ? 22.487  -96.506  -10.943 1.00 60.20  ? 145  GLU C CA  1 
ATOM   4771  C  C   . GLU C  3  142 ? 23.338  -95.955  -9.781  1.00 58.89  ? 145  GLU C C   1 
ATOM   4772  O  O   . GLU C  3  142 ? 23.358  -96.538  -8.686  1.00 59.15  ? 145  GLU C O   1 
ATOM   4773  C  CB  . GLU C  3  142 ? 21.041  -96.730  -10.514 1.00 60.70  ? 145  GLU C CB  1 
ATOM   4774  C  CG  . GLU C  3  142 ? 20.264  -95.479  -10.165 1.00 63.59  ? 145  GLU C CG  1 
ATOM   4775  C  CD  . GLU C  3  142 ? 19.094  -95.770  -9.219  1.00 67.20  ? 145  GLU C CD  1 
ATOM   4776  O  OE1 . GLU C  3  142 ? 18.659  -94.826  -8.520  1.00 68.18  ? 145  GLU C OE1 1 
ATOM   4777  O  OE2 . GLU C  3  142 ? 18.617  -96.936  -9.167  1.00 67.89  ? 145  GLU C OE2 1 
ATOM   4778  N  N   . PRO C  3  143 ? 24.036  -94.817  -10.016 1.00 57.57  ? 146  PRO C N   1 
ATOM   4779  C  CA  . PRO C  3  143 ? 25.030  -94.254  -9.083  1.00 56.02  ? 146  PRO C CA  1 
ATOM   4780  C  C   . PRO C  3  143 ? 24.428  -93.712  -7.790  1.00 54.52  ? 146  PRO C C   1 
ATOM   4781  O  O   . PRO C  3  143 ? 23.278  -93.249  -7.784  1.00 54.32  ? 146  PRO C O   1 
ATOM   4782  C  CB  . PRO C  3  143 ? 25.669  -93.125  -9.892  1.00 55.95  ? 146  PRO C CB  1 
ATOM   4783  C  CG  . PRO C  3  143 ? 24.632  -92.725  -10.860 1.00 56.84  ? 146  PRO C CG  1 
ATOM   4784  C  CD  . PRO C  3  143 ? 23.839  -93.947  -11.193 1.00 57.33  ? 146  PRO C CD  1 
ATOM   4785  N  N   . LYS C  3  144 ? 25.205  -93.780  -6.708  1.00 52.69  ? 147  LYS C N   1 
ATOM   4786  C  CA  . LYS C  3  144 ? 24.722  -93.393  -5.381  1.00 50.92  ? 147  LYS C CA  1 
ATOM   4787  C  C   . LYS C  3  144 ? 25.659  -92.432  -4.681  1.00 49.64  ? 147  LYS C C   1 
ATOM   4788  O  O   . LYS C  3  144 ? 26.880  -92.622  -4.667  1.00 49.35  ? 147  LYS C O   1 
ATOM   4789  C  CB  . LYS C  3  144 ? 24.517  -94.617  -4.488  1.00 51.06  ? 147  LYS C CB  1 
ATOM   4790  C  CG  . LYS C  3  144 ? 23.698  -95.730  -5.102  1.00 50.84  ? 147  LYS C CG  1 
ATOM   4791  C  CD  . LYS C  3  144 ? 22.225  -95.478  -4.972  1.00 50.19  ? 147  LYS C CD  1 
ATOM   4792  C  CE  . LYS C  3  144 ? 21.477  -96.527  -5.764  1.00 50.98  ? 147  LYS C CE  1 
ATOM   4793  N  NZ  . LYS C  3  144 ? 20.037  -96.509  -5.414  1.00 51.09  ? 147  LYS C NZ  1 
ATOM   4794  N  N   . LEU C  3  145 ? 25.075  -91.392  -4.101  1.00 47.97  ? 148  LEU C N   1 
ATOM   4795  C  CA  . LEU C  3  145 ? 25.839  -90.449  -3.300  1.00 46.34  ? 148  LEU C CA  1 
ATOM   4796  C  C   . LEU C  3  145 ? 25.028  -90.041  -2.092  1.00 44.87  ? 148  LEU C C   1 
ATOM   4797  O  O   . LEU C  3  145 ? 23.886  -89.582  -2.222  1.00 43.89  ? 148  LEU C O   1 
ATOM   4798  C  CB  . LEU C  3  145 ? 26.240  -89.221  -4.117  1.00 46.81  ? 148  LEU C CB  1 
ATOM   4799  C  CG  . LEU C  3  145 ? 26.882  -88.044  -3.378  1.00 46.69  ? 148  LEU C CG  1 
ATOM   4800  C  CD1 . LEU C  3  145 ? 28.346  -88.310  -3.022  1.00 45.57  ? 148  LEU C CD1 1 
ATOM   4801  C  CD2 . LEU C  3  145 ? 26.746  -86.810  -4.254  1.00 47.41  ? 148  LEU C CD2 1 
ATOM   4802  N  N   . TYR C  3  146 ? 25.639  -90.224  -0.923  1.00 43.23  ? 149  TYR C N   1 
ATOM   4803  C  CA  . TYR C  3  146 ? 24.997  -89.934  0.346   1.00 41.86  ? 149  TYR C CA  1 
ATOM   4804  C  C   . TYR C  3  146 ? 25.875  -89.073  1.223   1.00 41.52  ? 149  TYR C C   1 
ATOM   4805  O  O   . TYR C  3  146 ? 27.094  -89.053  1.086   1.00 41.09  ? 149  TYR C O   1 
ATOM   4806  C  CB  . TYR C  3  146 ? 24.683  -91.226  1.097   1.00 41.39  ? 149  TYR C CB  1 
ATOM   4807  C  CG  . TYR C  3  146 ? 23.502  -92.000  0.601   1.00 38.65  ? 149  TYR C CG  1 
ATOM   4808  C  CD1 . TYR C  3  146 ? 22.257  -91.842  1.197   1.00 38.06  ? 149  TYR C CD1 1 
ATOM   4809  C  CD2 . TYR C  3  146 ? 23.631  -92.926  -0.435  1.00 37.59  ? 149  TYR C CD2 1 
ATOM   4810  C  CE1 . TYR C  3  146 ? 21.157  -92.569  0.771   1.00 37.26  ? 149  TYR C CE1 1 
ATOM   4811  C  CE2 . TYR C  3  146 ? 22.536  -93.663  -0.882  1.00 36.72  ? 149  TYR C CE2 1 
ATOM   4812  C  CZ  . TYR C  3  146 ? 21.303  -93.474  -0.266  1.00 37.73  ? 149  TYR C CZ  1 
ATOM   4813  O  OH  . TYR C  3  146 ? 20.197  -94.179  -0.674  1.00 39.59  ? 149  TYR C OH  1 
ATOM   4814  N  N   . GLN C  3  147 ? 25.239  -88.384  2.152   1.00 41.51  ? 150  GLN C N   1 
ATOM   4815  C  CA  . GLN C  3  147 ? 25.952  -87.503  3.047   1.00 41.82  ? 150  GLN C CA  1 
ATOM   4816  C  C   . GLN C  3  147 ? 25.509  -87.786  4.462   1.00 41.79  ? 150  GLN C C   1 
ATOM   4817  O  O   . GLN C  3  147 ? 24.321  -87.990  4.714   1.00 41.97  ? 150  GLN C O   1 
ATOM   4818  C  CB  . GLN C  3  147 ? 25.641  -86.047  2.705   1.00 41.83  ? 150  GLN C CB  1 
ATOM   4819  C  CG  . GLN C  3  147 ? 26.589  -85.066  3.326   1.00 42.21  ? 150  GLN C CG  1 
ATOM   4820  C  CD  . GLN C  3  147 ? 25.884  -83.952  4.068   1.00 42.76  ? 150  GLN C CD  1 
ATOM   4821  O  OE1 . GLN C  3  147 ? 26.314  -83.576  5.150   1.00 43.80  ? 150  GLN C OE1 1 
ATOM   4822  N  NE2 . GLN C  3  147 ? 24.807  -83.415  3.495   1.00 42.58  ? 150  GLN C NE2 1 
ATOM   4823  N  N   . THR C  3  148 ? 26.465  -87.795  5.381   1.00 41.66  ? 151  THR C N   1 
ATOM   4824  C  CA  . THR C  3  148 ? 26.157  -87.944  6.793   1.00 41.69  ? 151  THR C CA  1 
ATOM   4825  C  C   . THR C  3  148 ? 26.749  -86.762  7.541   1.00 41.88  ? 151  THR C C   1 
ATOM   4826  O  O   . THR C  3  148 ? 27.723  -86.150  7.075   1.00 42.16  ? 151  THR C O   1 
ATOM   4827  C  CB  . THR C  3  148 ? 26.707  -89.270  7.397   1.00 41.70  ? 151  THR C CB  1 
ATOM   4828  O  OG1 . THR C  3  148 ? 28.104  -89.139  7.685   1.00 41.18  ? 151  THR C OG1 1 
ATOM   4829  C  CG2 . THR C  3  148 ? 26.491  -90.446  6.453   1.00 41.40  ? 151  THR C CG2 1 
ATOM   4830  N  N   . GLU C  3  149 ? 26.159  -86.449  8.691   1.00 41.60  ? 152  GLU C N   1 
ATOM   4831  C  CA  . GLU C  3  149 ? 26.646  -85.375  9.544   1.00 41.99  ? 152  GLU C CA  1 
ATOM   4832  C  C   . GLU C  3  149 ? 26.709  -85.817  11.029  1.00 41.19  ? 152  GLU C C   1 
ATOM   4833  O  O   . GLU C  3  149 ? 26.135  -86.842  11.394  1.00 41.28  ? 152  GLU C O   1 
ATOM   4834  C  CB  . GLU C  3  149 ? 25.811  -84.102  9.331   1.00 42.34  ? 152  GLU C CB  1 
ATOM   4835  C  CG  . GLU C  3  149 ? 24.378  -84.159  9.863   1.00 45.45  ? 152  GLU C CG  1 
ATOM   4836  C  CD  . GLU C  3  149 ? 23.665  -82.803  9.780   1.00 49.77  ? 152  GLU C CD  1 
ATOM   4837  O  OE1 . GLU C  3  149 ? 23.129  -82.332  10.824  1.00 49.85  ? 152  GLU C OE1 1 
ATOM   4838  O  OE2 . GLU C  3  149 ? 23.652  -82.211  8.667   1.00 51.09  ? 152  GLU C OE2 1 
ATOM   4839  N  N   . PRO C  3  150 ? 27.425  -85.060  11.880  1.00 40.35  ? 153  PRO C N   1 
ATOM   4840  C  CA  . PRO C  3  150 ? 27.636  -85.448  13.286  1.00 39.83  ? 153  PRO C CA  1 
ATOM   4841  C  C   . PRO C  3  150 ? 26.392  -85.859  14.091  1.00 39.49  ? 153  PRO C C   1 
ATOM   4842  O  O   . PRO C  3  150 ? 26.499  -86.663  15.025  1.00 39.03  ? 153  PRO C O   1 
ATOM   4843  C  CB  . PRO C  3  150 ? 28.275  -84.198  13.892  1.00 39.79  ? 153  PRO C CB  1 
ATOM   4844  C  CG  . PRO C  3  150 ? 29.051  -83.613  12.747  1.00 40.04  ? 153  PRO C CG  1 
ATOM   4845  C  CD  . PRO C  3  150 ? 28.228  -83.878  11.509  1.00 40.04  ? 153  PRO C CD  1 
ATOM   4846  N  N   . SER C  3  151 ? 25.227  -85.325  13.744  1.00 39.34  ? 154  SER C N   1 
ATOM   4847  C  CA  . SER C  3  151 ? 24.003  -85.724  14.430  1.00 39.49  ? 154  SER C CA  1 
ATOM   4848  C  C   . SER C  3  151 ? 23.666  -87.203  14.168  1.00 39.43  ? 154  SER C C   1 
ATOM   4849  O  O   . SER C  3  151 ? 23.041  -87.867  15.000  1.00 39.58  ? 154  SER C O   1 
ATOM   4850  C  CB  . SER C  3  151 ? 22.842  -84.853  13.985  1.00 39.15  ? 154  SER C CB  1 
ATOM   4851  O  OG  . SER C  3  151 ? 22.608  -85.068  12.606  1.00 40.40  ? 154  SER C OG  1 
ATOM   4852  N  N   . GLY C  3  152 ? 24.083  -87.707  13.013  1.00 39.07  ? 155  GLY C N   1 
ATOM   4853  C  CA  . GLY C  3  152 ? 23.682  -89.028  12.568  1.00 39.05  ? 155  GLY C CA  1 
ATOM   4854  C  C   . GLY C  3  152 ? 22.646  -88.990  11.456  1.00 39.10  ? 155  GLY C C   1 
ATOM   4855  O  O   . GLY C  3  152 ? 22.224  -90.036  10.963  1.00 39.01  ? 155  GLY C O   1 
ATOM   4856  N  N   . ILE C  3  153 ? 22.218  -87.786  11.073  1.00 39.08  ? 156  ILE C N   1 
ATOM   4857  C  CA  . ILE C  3  153 ? 21.298  -87.616  9.953   1.00 39.11  ? 156  ILE C CA  1 
ATOM   4858  C  C   . ILE C  3  153 ? 22.028  -87.936  8.644   1.00 38.84  ? 156  ILE C C   1 
ATOM   4859  O  O   . ILE C  3  153 ? 23.216  -87.641  8.489   1.00 38.47  ? 156  ILE C O   1 
ATOM   4860  C  CB  . ILE C  3  153 ? 20.629  -86.191  9.946   1.00 39.48  ? 156  ILE C CB  1 
ATOM   4861  C  CG1 . ILE C  3  153 ? 19.281  -86.224  10.663  1.00 39.85  ? 156  ILE C CG1 1 
ATOM   4862  C  CG2 . ILE C  3  153 ? 20.366  -85.680  8.538   1.00 39.88  ? 156  ILE C CG2 1 
ATOM   4863  C  CD1 . ILE C  3  153 ? 19.377  -85.909  12.121  1.00 43.41  ? 156  ILE C CD1 1 
ATOM   4864  N  N   . TYR C  3  154 ? 21.322  -88.575  7.722   1.00 38.65  ? 157  TYR C N   1 
ATOM   4865  C  CA  . TYR C  3  154 ? 21.919  -88.899  6.445   1.00 38.66  ? 157  TYR C CA  1 
ATOM   4866  C  C   . TYR C  3  154 ? 20.869  -88.760  5.357   1.00 38.99  ? 157  TYR C C   1 
ATOM   4867  O  O   . TYR C  3  154 ? 19.661  -88.825  5.634   1.00 38.98  ? 157  TYR C O   1 
ATOM   4868  C  CB  . TYR C  3  154 ? 22.558  -90.299  6.467   1.00 38.63  ? 157  TYR C CB  1 
ATOM   4869  C  CG  . TYR C  3  154 ? 21.572  -91.460  6.492   1.00 38.59  ? 157  TYR C CG  1 
ATOM   4870  C  CD1 . TYR C  3  154 ? 20.964  -91.862  7.685   1.00 38.08  ? 157  TYR C CD1 1 
ATOM   4871  C  CD2 . TYR C  3  154 ? 21.254  -92.153  5.322   1.00 39.10  ? 157  TYR C CD2 1 
ATOM   4872  C  CE1 . TYR C  3  154 ? 20.063  -92.914  7.715   1.00 38.09  ? 157  TYR C CE1 1 
ATOM   4873  C  CE2 . TYR C  3  154 ? 20.348  -93.203  5.339   1.00 39.52  ? 157  TYR C CE2 1 
ATOM   4874  C  CZ  . TYR C  3  154 ? 19.758  -93.579  6.537   1.00 39.24  ? 157  TYR C CZ  1 
ATOM   4875  O  OH  . TYR C  3  154 ? 18.871  -94.630  6.555   1.00 40.28  ? 157  TYR C OH  1 
ATOM   4876  N  N   . SER C  3  155 ? 21.334  -88.553  4.128   1.00 39.16  ? 158  SER C N   1 
ATOM   4877  C  CA  . SER C  3  155 ? 20.445  -88.359  2.993   1.00 39.89  ? 158  SER C CA  1 
ATOM   4878  C  C   . SER C  3  155 ? 21.206  -88.490  1.678   1.00 40.17  ? 158  SER C C   1 
ATOM   4879  O  O   . SER C  3  155 ? 22.437  -88.423  1.665   1.00 40.11  ? 158  SER C O   1 
ATOM   4880  C  CB  . SER C  3  155 ? 19.771  -86.986  3.090   1.00 40.10  ? 158  SER C CB  1 
ATOM   4881  O  OG  . SER C  3  155 ? 20.734  -85.975  3.354   1.00 40.51  ? 158  SER C OG  1 
ATOM   4882  N  N   . SER C  3  156 ? 20.479  -88.697  0.580   1.00 40.85  ? 159  SER C N   1 
ATOM   4883  C  CA  . SER C  3  156 ? 21.113  -88.764  -0.736  1.00 42.09  ? 159  SER C CA  1 
ATOM   4884  C  C   . SER C  3  156 ? 21.003  -87.453  -1.529  1.00 42.69  ? 159  SER C C   1 
ATOM   4885  O  O   . SER C  3  156 ? 20.022  -86.714  -1.419  1.00 43.00  ? 159  SER C O   1 
ATOM   4886  C  CB  . SER C  3  156 ? 20.593  -89.944  -1.558  1.00 42.03  ? 159  SER C CB  1 
ATOM   4887  O  OG  . SER C  3  156 ? 19.205  -89.834  -1.753  1.00 42.93  ? 159  SER C OG  1 
ATOM   4888  N  N   . TRP C  3  157 ? 22.025  -87.195  -2.337  1.00 43.30  ? 160  TRP C N   1 
ATOM   4889  C  CA  . TRP C  3  157 ? 22.180  -85.942  -3.054  1.00 44.13  ? 160  TRP C CA  1 
ATOM   4890  C  C   . TRP C  3  157 ? 22.607  -86.203  -4.494  1.00 44.51  ? 160  TRP C C   1 
ATOM   4891  O  O   . TRP C  3  157 ? 23.464  -87.063  -4.752  1.00 44.95  ? 160  TRP C O   1 
ATOM   4892  C  CB  . TRP C  3  157 ? 23.259  -85.105  -2.374  1.00 44.22  ? 160  TRP C CB  1 
ATOM   4893  C  CG  . TRP C  3  157 ? 22.917  -84.694  -0.988  1.00 45.38  ? 160  TRP C CG  1 
ATOM   4894  C  CD1 . TRP C  3  157 ? 22.981  -85.462  0.137   1.00 45.75  ? 160  TRP C CD1 1 
ATOM   4895  C  CD2 . TRP C  3  157 ? 22.457  -83.409  -0.570  1.00 46.68  ? 160  TRP C CD2 1 
ATOM   4896  N  NE1 . TRP C  3  157 ? 22.586  -84.735  1.232   1.00 46.20  ? 160  TRP C NE1 1 
ATOM   4897  C  CE2 . TRP C  3  157 ? 22.263  -83.468  0.825   1.00 47.22  ? 160  TRP C CE2 1 
ATOM   4898  C  CE3 . TRP C  3  157 ? 22.186  -82.210  -1.240  1.00 47.19  ? 160  TRP C CE3 1 
ATOM   4899  C  CZ2 . TRP C  3  157 ? 21.808  -82.367  1.567   1.00 47.95  ? 160  TRP C CZ2 1 
ATOM   4900  C  CZ3 . TRP C  3  157 ? 21.739  -81.118  -0.504  1.00 47.53  ? 160  TRP C CZ3 1 
ATOM   4901  C  CH2 . TRP C  3  157 ? 21.555  -81.204  0.884   1.00 47.44  ? 160  TRP C CH2 1 
ATOM   4902  N  N   . SER C  3  158 ? 22.012  -85.463  -5.428  1.00 44.56  ? 161  SER C N   1 
ATOM   4903  C  CA  . SER C  3  158 ? 22.462  -85.462  -6.819  1.00 44.55  ? 161  SER C CA  1 
ATOM   4904  C  C   . SER C  3  158 ? 23.911  -84.989  -6.831  1.00 44.52  ? 161  SER C C   1 
ATOM   4905  O  O   . SER C  3  158 ? 24.775  -85.595  -7.474  1.00 44.37  ? 161  SER C O   1 
ATOM   4906  C  CB  . SER C  3  158 ? 21.605  -84.508  -7.646  1.00 44.57  ? 161  SER C CB  1 
ATOM   4907  O  OG  . SER C  3  158 ? 20.222  -84.745  -7.454  1.00 45.32  ? 161  SER C OG  1 
ATOM   4908  N  N   . ALA C  3  159 ? 24.154  -83.897  -6.104  1.00 44.58  ? 162  ALA C N   1 
ATOM   4909  C  CA  . ALA C  3  159 ? 25.494  -83.392  -5.812  1.00 44.51  ? 162  ALA C CA  1 
ATOM   4910  C  C   . ALA C  3  159 ? 25.454  -82.675  -4.475  1.00 44.67  ? 162  ALA C C   1 
ATOM   4911  O  O   . ALA C  3  159 ? 24.410  -82.143  -4.067  1.00 44.62  ? 162  ALA C O   1 
ATOM   4912  C  CB  . ALA C  3  159 ? 25.957  -82.452  -6.881  1.00 44.54  ? 162  ALA C CB  1 
ATOM   4913  N  N   . GLN C  3  160 ? 26.594  -82.654  -3.798  1.00 44.65  ? 163  GLN C N   1 
ATOM   4914  C  CA  . GLN C  3  160 ? 26.675  -82.078  -2.479  1.00 45.03  ? 163  GLN C CA  1 
ATOM   4915  C  C   . GLN C  3  160 ? 28.120  -81.739  -2.162  1.00 45.20  ? 163  GLN C C   1 
ATOM   4916  O  O   . GLN C  3  160 ? 29.046  -82.261  -2.774  1.00 45.17  ? 163  GLN C O   1 
ATOM   4917  C  CB  . GLN C  3  160 ? 26.079  -83.054  -1.448  1.00 45.14  ? 163  GLN C CB  1 
ATOM   4918  C  CG  . GLN C  3  160 ? 26.212  -82.662  0.035   1.00 46.33  ? 163  GLN C CG  1 
ATOM   4919  C  CD  . GLN C  3  160 ? 25.626  -81.303  0.365   1.00 47.70  ? 163  GLN C CD  1 
ATOM   4920  O  OE1 . GLN C  3  160 ? 24.690  -81.201  1.152   1.00 48.44  ? 163  GLN C OE1 1 
ATOM   4921  N  NE2 . GLN C  3  160 ? 26.181  -80.251  -0.229  1.00 47.72  ? 163  GLN C NE2 1 
ATOM   4922  N  N   . THR C  3  161 ? 28.303  -80.852  -1.200  1.00 45.67  ? 164  THR C N   1 
ATOM   4923  C  CA  . THR C  3  161 ? 29.620  -80.429  -0.784  1.00 46.46  ? 164  THR C CA  1 
ATOM   4924  C  C   . THR C  3  161 ? 29.543  -80.130  0.709   1.00 46.84  ? 164  THR C C   1 
ATOM   4925  O  O   . THR C  3  161 ? 28.466  -79.860  1.240   1.00 46.80  ? 164  THR C O   1 
ATOM   4926  C  CB  . THR C  3  161 ? 30.088  -79.194  -1.611  1.00 46.57  ? 164  THR C CB  1 
ATOM   4927  O  OG1 . THR C  3  161 ? 31.372  -78.745  -1.158  1.00 47.39  ? 164  THR C OG1 1 
ATOM   4928  C  CG2 . THR C  3  161 ? 29.073  -78.046  -1.524  1.00 46.54  ? 164  THR C CG2 1 
ATOM   4929  N  N   . ILE C  3  162 ? 30.680  -80.207  1.385   1.00 47.57  ? 165  ILE C N   1 
ATOM   4930  C  CA  . ILE C  3  162 ? 30.739  -80.024  2.836   1.00 48.37  ? 165  ILE C CA  1 
ATOM   4931  C  C   . ILE C  3  162 ? 32.084  -79.407  3.182   1.00 48.86  ? 165  ILE C C   1 
ATOM   4932  O  O   . ILE C  3  162 ? 33.012  -79.458  2.371   1.00 48.65  ? 165  ILE C O   1 
ATOM   4933  C  CB  . ILE C  3  162 ? 30.572  -81.372  3.606   1.00 48.63  ? 165  ILE C CB  1 
ATOM   4934  C  CG1 . ILE C  3  162 ? 31.474  -82.464  3.002   1.00 48.52  ? 165  ILE C CG1 1 
ATOM   4935  C  CG2 . ILE C  3  162 ? 29.107  -81.806  3.649   1.00 48.21  ? 165  ILE C CG2 1 
ATOM   4936  C  CD1 . ILE C  3  162 ? 31.523  -83.738  3.794   1.00 49.20  ? 165  ILE C CD1 1 
ATOM   4937  N  N   . GLY C  3  163 ? 32.191  -78.839  4.379   1.00 49.79  ? 166  GLY C N   1 
ATOM   4938  C  CA  . GLY C  3  163 ? 33.435  -78.195  4.813   1.00 51.64  ? 166  GLY C CA  1 
ATOM   4939  C  C   . GLY C  3  163 ? 33.505  -76.707  4.494   1.00 53.04  ? 166  GLY C C   1 
ATOM   4940  O  O   . GLY C  3  163 ? 32.497  -76.093  4.117   1.00 52.97  ? 166  GLY C O   1 
ATOM   4941  N  N   . ARG C  3  164 ? 34.698  -76.128  4.630   1.00 54.29  ? 167  ARG C N   1 
ATOM   4942  C  CA  . ARG C  3  164 ? 34.871  -74.680  4.489   1.00 55.62  ? 167  ARG C CA  1 
ATOM   4943  C  C   . ARG C  3  164 ? 34.511  -74.162  3.101   1.00 56.15  ? 167  ARG C C   1 
ATOM   4944  O  O   . ARG C  3  164 ? 34.939  -74.713  2.083   1.00 56.41  ? 167  ARG C O   1 
ATOM   4945  C  CB  . ARG C  3  164 ? 36.286  -74.231  4.898   1.00 55.91  ? 167  ARG C CB  1 
ATOM   4946  C  CG  . ARG C  3  164 ? 37.401  -74.564  3.918   1.00 57.08  ? 167  ARG C CG  1 
ATOM   4947  C  CD  . ARG C  3  164 ? 38.730  -74.038  4.426   1.00 59.30  ? 167  ARG C CD  1 
ATOM   4948  N  NE  . ARG C  3  164 ? 39.808  -74.384  3.506   1.00 61.20  ? 167  ARG C NE  1 
ATOM   4949  C  CZ  . ARG C  3  164 ? 41.102  -74.192  3.745   1.00 62.50  ? 167  ARG C CZ  1 
ATOM   4950  N  NH1 . ARG C  3  164 ? 41.993  -74.554  2.829   1.00 63.19  ? 167  ARG C NH1 1 
ATOM   4951  N  NH2 . ARG C  3  164 ? 41.510  -73.646  4.888   1.00 62.68  ? 167  ARG C NH2 1 
ATOM   4952  N  N   . ASN C  3  165 ? 33.712  -73.099  3.092   1.00 56.93  ? 168  ASN C N   1 
ATOM   4953  C  CA  . ASN C  3  165 ? 33.237  -72.456  1.873   1.00 57.84  ? 168  ASN C CA  1 
ATOM   4954  C  C   . ASN C  3  165 ? 32.345  -73.373  1.042   1.00 58.33  ? 168  ASN C C   1 
ATOM   4955  O  O   . ASN C  3  165 ? 32.278  -73.242  -0.189  1.00 58.58  ? 168  ASN C O   1 
ATOM   4956  C  CB  . ASN C  3  165 ? 34.406  -71.914  1.026   1.00 58.08  ? 168  ASN C CB  1 
ATOM   4957  C  CG  . ASN C  3  165 ? 35.243  -70.860  1.758   1.00 58.42  ? 168  ASN C CG  1 
ATOM   4958  O  OD1 . ASN C  3  165 ? 36.469  -70.978  1.831   1.00 58.57  ? 168  ASN C OD1 1 
ATOM   4959  N  ND2 . ASN C  3  165 ? 34.585  -69.824  2.290   1.00 58.00  ? 168  ASN C ND2 1 
ATOM   4960  N  N   . SER C  3  166 ? 31.659  -74.296  1.720   1.00 58.74  ? 169  SER C N   1 
ATOM   4961  C  CA  . SER C  3  166 ? 30.699  -75.188  1.069   1.00 58.66  ? 169  SER C CA  1 
ATOM   4962  C  C   . SER C  3  166 ? 29.436  -74.436  0.639   1.00 58.99  ? 169  SER C C   1 
ATOM   4963  O  O   . SER C  3  166 ? 28.774  -74.861  -0.303  1.00 59.22  ? 169  SER C O   1 
ATOM   4964  C  CB  . SER C  3  166 ? 30.353  -76.383  1.957   1.00 58.45  ? 169  SER C CB  1 
ATOM   4965  O  OG  . SER C  3  166 ? 29.857  -75.968  3.218   1.00 57.30  ? 169  SER C OG  1 
ATOM   4966  N  N   . LYS C  3  167 ? 29.108  -73.331  1.316   1.00 59.31  ? 170  LYS C N   1 
ATOM   4967  C  CA  . LYS C  3  167 ? 28.038  -72.422  0.853   1.00 59.81  ? 170  LYS C CA  1 
ATOM   4968  C  C   . LYS C  3  167 ? 28.272  -71.943  -0.587  1.00 59.47  ? 170  LYS C C   1 
ATOM   4969  O  O   . LYS C  3  167 ? 27.386  -72.060  -1.437  1.00 59.35  ? 170  LYS C O   1 
ATOM   4970  C  CB  . LYS C  3  167 ? 27.901  -71.204  1.770   1.00 60.20  ? 170  LYS C CB  1 
ATOM   4971  C  CG  . LYS C  3  167 ? 26.687  -71.215  2.682   1.00 61.79  ? 170  LYS C CG  1 
ATOM   4972  C  CD  . LYS C  3  167 ? 26.986  -71.915  4.010   1.00 64.51  ? 170  LYS C CD  1 
ATOM   4973  C  CE  . LYS C  3  167 ? 25.777  -71.852  4.936   1.00 65.55  ? 170  LYS C CE  1 
ATOM   4974  N  NZ  . LYS C  3  167 ? 25.493  -73.201  5.515   1.00 67.11  ? 170  LYS C NZ  1 
ATOM   4975  N  N   . THR C  3  168 ? 29.469  -71.413  -0.844  1.00 59.16  ? 171  THR C N   1 
ATOM   4976  C  CA  . THR C  3  168 ? 29.882  -70.970  -2.181  1.00 59.15  ? 171  THR C CA  1 
ATOM   4977  C  C   . THR C  3  168 ? 29.716  -72.065  -3.237  1.00 59.08  ? 171  THR C C   1 
ATOM   4978  O  O   . THR C  3  168 ? 28.998  -71.876  -4.222  1.00 58.88  ? 171  THR C O   1 
ATOM   4979  C  CB  . THR C  3  168 ? 31.355  -70.468  -2.193  1.00 59.18  ? 171  THR C CB  1 
ATOM   4980  O  OG1 . THR C  3  168 ? 31.511  -69.407  -1.243  1.00 59.28  ? 171  THR C OG1 1 
ATOM   4981  C  CG2 . THR C  3  168 ? 31.769  -69.979  -3.588  1.00 58.62  ? 171  THR C CG2 1 
ATOM   4982  N  N   . VAL C  3  169 ? 30.385  -73.201  -3.030  1.00 59.14  ? 172  VAL C N   1 
ATOM   4983  C  CA  . VAL C  3  169 ? 30.319  -74.315  -3.990  1.00 58.94  ? 172  VAL C CA  1 
ATOM   4984  C  C   . VAL C  3  169 ? 28.921  -74.941  -4.105  1.00 59.03  ? 172  VAL C C   1 
ATOM   4985  O  O   . VAL C  3  169 ? 28.528  -75.365  -5.188  1.00 58.58  ? 172  VAL C O   1 
ATOM   4986  C  CB  . VAL C  3  169 ? 31.489  -75.341  -3.818  1.00 58.78  ? 172  VAL C CB  1 
ATOM   4987  C  CG1 . VAL C  3  169 ? 31.960  -75.408  -2.392  1.00 58.85  ? 172  VAL C CG1 1 
ATOM   4988  C  CG2 . VAL C  3  169 ? 31.115  -76.710  -4.345  1.00 58.13  ? 172  VAL C CG2 1 
ATOM   4989  N  N   . ARG C  3  170 ? 28.155  -74.966  -3.019  1.00 59.68  ? 173  ARG C N   1 
ATOM   4990  C  CA  . ARG C  3  170 ? 26.780  -75.445  -3.126  1.00 60.80  ? 173  ARG C CA  1 
ATOM   4991  C  C   . ARG C  3  170 ? 26.001  -74.531  -4.057  1.00 61.90  ? 173  ARG C C   1 
ATOM   4992  O  O   . ARG C  3  170 ? 25.319  -75.018  -4.966  1.00 62.01  ? 173  ARG C O   1 
ATOM   4993  C  CB  . ARG C  3  170 ? 26.083  -75.577  -1.769  1.00 60.49  ? 173  ARG C CB  1 
ATOM   4994  C  CG  . ARG C  3  170 ? 24.749  -76.333  -1.855  1.00 60.52  ? 173  ARG C CG  1 
ATOM   4995  C  CD  . ARG C  3  170 ? 24.211  -76.811  -0.501  1.00 60.91  ? 173  ARG C CD  1 
ATOM   4996  N  NE  . ARG C  3  170 ? 25.266  -77.368  0.343   1.00 61.25  ? 173  ARG C NE  1 
ATOM   4997  C  CZ  . ARG C  3  170 ? 25.674  -76.826  1.486   1.00 61.06  ? 173  ARG C CZ  1 
ATOM   4998  N  NH1 . ARG C  3  170 ? 25.101  -75.722  1.947   1.00 61.42  ? 173  ARG C NH1 1 
ATOM   4999  N  NH2 . ARG C  3  170 ? 26.653  -77.392  2.171   1.00 61.15  ? 173  ARG C NH2 1 
ATOM   5000  N  N   . GLU C  3  171 ? 26.119  -73.214  -3.826  1.00 63.27  ? 174  GLU C N   1 
ATOM   5001  C  CA  . GLU C  3  171 ? 25.572  -72.172  -4.721  1.00 64.39  ? 174  GLU C CA  1 
ATOM   5002  C  C   . GLU C  3  171 ? 25.879  -72.469  -6.191  1.00 64.46  ? 174  GLU C C   1 
ATOM   5003  O  O   . GLU C  3  171 ? 24.963  -72.535  -7.023  1.00 64.26  ? 174  GLU C O   1 
ATOM   5004  C  CB  . GLU C  3  171 ? 26.101  -70.774  -4.342  1.00 64.73  ? 174  GLU C CB  1 
ATOM   5005  C  CG  . GLU C  3  171 ? 25.048  -69.762  -3.872  1.00 67.28  ? 174  GLU C CG  1 
ATOM   5006  C  CD  . GLU C  3  171 ? 24.228  -70.239  -2.666  1.00 71.24  ? 174  GLU C CD  1 
ATOM   5007  O  OE1 . GLU C  3  171 ? 22.978  -70.127  -2.716  1.00 72.27  ? 174  GLU C OE1 1 
ATOM   5008  O  OE2 . GLU C  3  171 ? 24.823  -70.725  -1.671  1.00 72.84  ? 174  GLU C OE2 1 
ATOM   5009  N  N   . PHE C  3  172 ? 27.164  -72.663  -6.485  1.00 64.73  ? 175  PHE C N   1 
ATOM   5010  C  CA  . PHE C  3  172 ? 27.622  -72.980  -7.825  1.00 65.53  ? 175  PHE C CA  1 
ATOM   5011  C  C   . PHE C  3  172 ? 26.848  -74.163  -8.404  1.00 66.09  ? 175  PHE C C   1 
ATOM   5012  O  O   . PHE C  3  172 ? 26.213  -74.048  -9.458  1.00 66.14  ? 175  PHE C O   1 
ATOM   5013  C  CB  . PHE C  3  172 ? 29.126  -73.262  -7.811  1.00 65.57  ? 175  PHE C CB  1 
ATOM   5014  C  CG  . PHE C  3  172 ? 29.699  -73.590  -9.158  1.00 66.35  ? 175  PHE C CG  1 
ATOM   5015  C  CD1 . PHE C  3  172 ? 30.059  -72.576  -10.044 1.00 67.58  ? 175  PHE C CD1 1 
ATOM   5016  C  CD2 . PHE C  3  172 ? 29.887  -74.911  -9.545  1.00 67.17  ? 175  PHE C CD2 1 
ATOM   5017  C  CE1 . PHE C  3  172 ? 30.598  -72.874  -11.304 1.00 68.03  ? 175  PHE C CE1 1 
ATOM   5018  C  CE2 . PHE C  3  172 ? 30.426  -75.223  -10.797 1.00 68.16  ? 175  PHE C CE2 1 
ATOM   5019  C  CZ  . PHE C  3  172 ? 30.781  -74.199  -11.679 1.00 68.29  ? 175  PHE C CZ  1 
ATOM   5020  N  N   . LEU C  3  173 ? 26.883  -75.287  -7.693  1.00 66.76  ? 176  LEU C N   1 
ATOM   5021  C  CA  . LEU C  3  173 ? 26.243  -76.512  -8.151  1.00 67.29  ? 176  LEU C CA  1 
ATOM   5022  C  C   . LEU C  3  173 ? 24.732  -76.367  -8.281  1.00 68.14  ? 176  LEU C C   1 
ATOM   5023  O  O   . LEU C  3  173 ? 24.128  -76.976  -9.163  1.00 68.12  ? 176  LEU C O   1 
ATOM   5024  C  CB  . LEU C  3  173 ? 26.579  -77.676  -7.221  1.00 67.09  ? 176  LEU C CB  1 
ATOM   5025  C  CG  . LEU C  3  173 ? 28.052  -78.034  -7.009  1.00 66.44  ? 176  LEU C CG  1 
ATOM   5026  C  CD1 . LEU C  3  173 ? 28.190  -78.893  -5.766  1.00 65.29  ? 176  LEU C CD1 1 
ATOM   5027  C  CD2 . LEU C  3  173 ? 28.660  -78.716  -8.230  1.00 65.29  ? 176  LEU C CD2 1 
ATOM   5028  N  N   . GLU C  3  174 ? 24.127  -75.562  -7.411  1.00 69.30  ? 177  GLU C N   1 
ATOM   5029  C  CA  . GLU C  3  174 ? 22.677  -75.334  -7.458  1.00 70.69  ? 177  GLU C CA  1 
ATOM   5030  C  C   . GLU C  3  174 ? 22.170  -74.749  -8.781  1.00 71.44  ? 177  GLU C C   1 
ATOM   5031  O  O   . GLU C  3  174 ? 21.048  -75.048  -9.192  1.00 71.44  ? 177  GLU C O   1 
ATOM   5032  C  CB  . GLU C  3  174 ? 22.201  -74.488  -6.274  1.00 70.68  ? 177  GLU C CB  1 
ATOM   5033  C  CG  . GLU C  3  174 ? 21.745  -75.330  -5.097  1.00 71.71  ? 177  GLU C CG  1 
ATOM   5034  C  CD  . GLU C  3  174 ? 21.191  -74.509  -3.954  1.00 72.75  ? 177  GLU C CD  1 
ATOM   5035  O  OE1 . GLU C  3  174 ? 20.279  -73.693  -4.196  1.00 72.93  ? 177  GLU C OE1 1 
ATOM   5036  O  OE2 . GLU C  3  174 ? 21.662  -74.692  -2.808  1.00 73.37  ? 177  GLU C OE2 1 
ATOM   5037  N  N   . LYS C  3  175 ? 22.985  -73.929  -9.447  1.00 72.39  ? 178  LYS C N   1 
ATOM   5038  C  CA  . LYS C  3  175 ? 22.608  -73.442  -10.776 1.00 73.40  ? 178  LYS C CA  1 
ATOM   5039  C  C   . LYS C  3  175 ? 23.216  -74.269  -11.912 1.00 73.70  ? 178  LYS C C   1 
ATOM   5040  O  O   . LYS C  3  175 ? 22.597  -74.423  -12.967 1.00 73.80  ? 178  LYS C O   1 
ATOM   5041  C  CB  . LYS C  3  175 ? 22.845  -71.927  -10.961 1.00 73.57  ? 178  LYS C CB  1 
ATOM   5042  C  CG  . LYS C  3  175 ? 24.301  -71.456  -11.025 1.00 74.63  ? 178  LYS C CG  1 
ATOM   5043  C  CD  . LYS C  3  175 ? 24.662  -70.560  -9.834  1.00 76.48  ? 178  LYS C CD  1 
ATOM   5044  C  CE  . LYS C  3  175 ? 23.943  -69.199  -9.882  1.00 77.24  ? 178  LYS C CE  1 
ATOM   5045  N  NZ  . LYS C  3  175 ? 23.991  -68.502  -8.559  1.00 77.32  ? 178  LYS C NZ  1 
ATOM   5046  N  N   . ASN C  3  176 ? 24.407  -74.816  -11.690 1.00 74.19  ? 179  ASN C N   1 
ATOM   5047  C  CA  . ASN C  3  176 ? 25.088  -75.575  -12.742 1.00 74.82  ? 179  ASN C CA  1 
ATOM   5048  C  C   . ASN C  3  176 ? 24.697  -77.053  -12.890 1.00 75.03  ? 179  ASN C C   1 
ATOM   5049  O  O   . ASN C  3  176 ? 25.010  -77.670  -13.909 1.00 75.00  ? 179  ASN C O   1 
ATOM   5050  C  CB  . ASN C  3  176 ? 26.611  -75.410  -12.645 1.00 74.91  ? 179  ASN C CB  1 
ATOM   5051  C  CG  . ASN C  3  176 ? 27.083  -74.052  -13.149 1.00 75.48  ? 179  ASN C CG  1 
ATOM   5052  O  OD1 . ASN C  3  176 ? 27.555  -73.929  -14.283 1.00 75.57  ? 179  ASN C OD1 1 
ATOM   5053  N  ND2 . ASN C  3  176 ? 26.946  -73.023  -12.312 1.00 75.51  ? 179  ASN C ND2 1 
ATOM   5054  N  N   . TYR C  3  177 ? 24.018  -77.621  -11.894 1.00 75.41  ? 180  TYR C N   1 
ATOM   5055  C  CA  . TYR C  3  177 ? 23.583  -79.022  -11.982 1.00 75.70  ? 180  TYR C CA  1 
ATOM   5056  C  C   . TYR C  3  177 ? 22.144  -79.137  -12.465 1.00 76.31  ? 180  TYR C C   1 
ATOM   5057  O  O   . TYR C  3  177 ? 21.235  -78.551  -11.876 1.00 76.31  ? 180  TYR C O   1 
ATOM   5058  C  CB  . TYR C  3  177 ? 23.754  -79.756  -10.647 1.00 75.36  ? 180  TYR C CB  1 
ATOM   5059  C  CG  . TYR C  3  177 ? 23.630  -81.265  -10.755 1.00 74.43  ? 180  TYR C CG  1 
ATOM   5060  C  CD1 . TYR C  3  177 ? 22.382  -81.890  -10.726 1.00 74.00  ? 180  TYR C CD1 1 
ATOM   5061  C  CD2 . TYR C  3  177 ? 24.759  -82.068  -10.890 1.00 73.64  ? 180  TYR C CD2 1 
ATOM   5062  C  CE1 . TYR C  3  177 ? 22.264  -83.270  -10.834 1.00 73.09  ? 180  TYR C CE1 1 
ATOM   5063  C  CE2 . TYR C  3  177 ? 24.651  -83.450  -10.991 1.00 73.05  ? 180  TYR C CE2 1 
ATOM   5064  C  CZ  . TYR C  3  177 ? 23.401  -84.040  -10.960 1.00 72.89  ? 180  TYR C CZ  1 
ATOM   5065  O  OH  . TYR C  3  177 ? 23.290  -85.401  -11.061 1.00 72.97  ? 180  TYR C OH  1 
ATOM   5066  N  N   . ASP C  3  178 A 21.951  -79.907  -13.532 1.00 77.16  ? 180  ASP C N   1 
ATOM   5067  C  CA  . ASP C  3  178 A 20.630  -80.114  -14.106 1.00 78.25  ? 180  ASP C CA  1 
ATOM   5068  C  C   . ASP C  3  178 A 20.200  -81.569  -13.919 1.00 78.95  ? 180  ASP C C   1 
ATOM   5069  O  O   . ASP C  3  178 A 20.854  -82.493  -14.415 1.00 78.98  ? 180  ASP C O   1 
ATOM   5070  C  CB  . ASP C  3  178 A 20.625  -79.722  -15.596 1.00 78.30  ? 180  ASP C CB  1 
ATOM   5071  C  CG  . ASP C  3  178 A 19.216  -79.717  -16.220 1.00 78.51  ? 180  ASP C CG  1 
ATOM   5072  O  OD1 . ASP C  3  178 A 19.136  -79.705  -17.471 1.00 78.27  ? 180  ASP C OD1 1 
ATOM   5073  O  OD2 . ASP C  3  178 A 18.201  -79.718  -15.479 1.00 78.21  ? 180  ASP C OD2 1 
ATOM   5074  N  N   . ARG C  3  179 B 19.092  -81.760  -13.207 1.00 79.80  ? 180  ARG C N   1 
ATOM   5075  C  CA  . ARG C  3  179 B 18.542  -83.095  -12.970 1.00 80.56  ? 180  ARG C CA  1 
ATOM   5076  C  C   . ARG C  3  179 B 17.894  -83.729  -14.206 1.00 81.35  ? 180  ARG C C   1 
ATOM   5077  O  O   . ARG C  3  179 B 17.755  -84.951  -14.276 1.00 81.46  ? 180  ARG C O   1 
ATOM   5078  C  CB  . ARG C  3  179 B 17.545  -83.066  -11.816 1.00 80.35  ? 180  ARG C CB  1 
ATOM   5079  C  CG  . ARG C  3  179 B 18.195  -82.996  -10.451 1.00 80.04  ? 180  ARG C CG  1 
ATOM   5080  C  CD  . ARG C  3  179 B 17.365  -83.758  -9.439  1.00 79.18  ? 180  ARG C CD  1 
ATOM   5081  N  NE  . ARG C  3  179 B 17.708  -83.406  -8.069  1.00 77.81  ? 180  ARG C NE  1 
ATOM   5082  C  CZ  . ARG C  3  179 B 17.078  -83.876  -7.000  1.00 77.08  ? 180  ARG C CZ  1 
ATOM   5083  N  NH1 . ARG C  3  179 B 16.067  -84.724  -7.138  1.00 76.76  ? 180  ARG C NH1 1 
ATOM   5084  N  NH2 . ARG C  3  179 B 17.461  -83.497  -5.791  1.00 76.77  ? 180  ARG C NH2 1 
ATOM   5085  N  N   . LYS C  3  180 C 17.490  -82.896  -15.166 1.00 82.21  ? 180  LYS C N   1 
ATOM   5086  C  CA  . LYS C  3  180 C 16.947  -83.370  -16.444 1.00 82.90  ? 180  LYS C CA  1 
ATOM   5087  C  C   . LYS C  3  180 C 18.043  -84.036  -17.284 1.00 83.03  ? 180  LYS C C   1 
ATOM   5088  O  O   . LYS C  3  180 C 17.814  -85.075  -17.910 1.00 82.87  ? 180  LYS C O   1 
ATOM   5089  C  CB  . LYS C  3  180 C 16.326  -82.210  -17.237 1.00 83.19  ? 180  LYS C CB  1 
ATOM   5090  C  CG  . LYS C  3  180 C 15.376  -81.296  -16.453 1.00 83.97  ? 180  LYS C CG  1 
ATOM   5091  C  CD  . LYS C  3  180 C 13.960  -81.848  -16.388 1.00 84.63  ? 180  LYS C CD  1 
ATOM   5092  C  CE  . LYS C  3  180 C 12.999  -80.756  -15.952 1.00 85.01  ? 180  LYS C CE  1 
ATOM   5093  N  NZ  . LYS C  3  180 C 11.632  -81.290  -15.734 1.00 85.55  ? 180  LYS C NZ  1 
ATOM   5094  N  N   . GLU C  3  181 D 19.229  -83.429  -17.284 1.00 83.25  ? 180  GLU C N   1 
ATOM   5095  C  CA  . GLU C  3  181 D 20.369  -83.943  -18.037 1.00 83.55  ? 180  GLU C CA  1 
ATOM   5096  C  C   . GLU C  3  181 D 21.644  -83.938  -17.164 1.00 83.39  ? 180  GLU C C   1 
ATOM   5097  O  O   . GLU C  3  181 D 22.451  -83.006  -17.220 1.00 83.25  ? 180  GLU C O   1 
ATOM   5098  C  CB  . GLU C  3  181 D 20.549  -83.140  -19.339 1.00 83.77  ? 180  GLU C CB  1 
ATOM   5099  C  CG  . GLU C  3  181 D 21.351  -83.848  -20.448 1.00 84.79  ? 180  GLU C CG  1 
ATOM   5100  C  CD  . GLU C  3  181 D 21.598  -82.954  -21.672 1.00 85.96  ? 180  GLU C CD  1 
ATOM   5101  O  OE1 . GLU C  3  181 D 22.773  -82.588  -21.916 1.00 85.84  ? 180  GLU C OE1 1 
ATOM   5102  O  OE2 . GLU C  3  181 D 20.620  -82.611  -22.384 1.00 86.14  ? 180  GLU C OE2 1 
ATOM   5103  N  N   . PRO C  3  182 ? 21.809  -84.978  -16.346 1.00 83.26  ? 182  PRO C N   1 
ATOM   5104  C  CA  . PRO C  3  182 ? 23.014  -85.122  -15.524 1.00 83.12  ? 182  PRO C CA  1 
ATOM   5105  C  C   . PRO C  3  182 ? 24.254  -85.388  -16.381 1.00 83.00  ? 182  PRO C C   1 
ATOM   5106  O  O   . PRO C  3  182 ? 24.136  -86.033  -17.430 1.00 82.98  ? 182  PRO C O   1 
ATOM   5107  C  CB  . PRO C  3  182 ? 22.709  -86.354  -14.662 1.00 83.06  ? 182  PRO C CB  1 
ATOM   5108  C  CG  . PRO C  3  182 ? 21.237  -86.510  -14.713 1.00 83.25  ? 182  PRO C CG  1 
ATOM   5109  C  CD  . PRO C  3  182 ? 20.836  -86.047  -16.067 1.00 83.24  ? 182  PRO C CD  1 
ATOM   5110  N  N   . PRO C  3  183 ? 25.432  -84.895  -15.942 1.00 82.79  ? 183  PRO C N   1 
ATOM   5111  C  CA  . PRO C  3  183 ? 26.695  -85.047  -16.667 1.00 82.70  ? 183  PRO C CA  1 
ATOM   5112  C  C   . PRO C  3  183 ? 26.843  -86.434  -17.295 1.00 82.75  ? 183  PRO C C   1 
ATOM   5113  O  O   . PRO C  3  183 ? 27.291  -87.376  -16.636 1.00 82.99  ? 183  PRO C O   1 
ATOM   5114  C  CB  . PRO C  3  183 ? 27.744  -84.832  -15.577 1.00 82.64  ? 183  PRO C CB  1 
ATOM   5115  C  CG  . PRO C  3  183 ? 27.087  -83.935  -14.588 1.00 82.60  ? 183  PRO C CG  1 
ATOM   5116  C  CD  . PRO C  3  183 ? 25.597  -84.081  -14.723 1.00 82.66  ? 183  PRO C CD  1 
ATOM   5117  N  N   . ALA C  3  184 ? 26.476  -86.540  -18.571 1.00 82.72  ? 184  ALA C N   1 
ATOM   5118  C  CA  . ALA C  3  184 ? 26.336  -87.833  -19.255 1.00 82.67  ? 184  ALA C CA  1 
ATOM   5119  C  C   . ALA C  3  184 ? 27.614  -88.677  -19.393 1.00 82.56  ? 184  ALA C C   1 
ATOM   5120  O  O   . ALA C  3  184 ? 27.538  -89.847  -19.773 1.00 82.54  ? 184  ALA C O   1 
ATOM   5121  C  CB  . ALA C  3  184 ? 25.666  -87.639  -20.623 1.00 82.73  ? 184  ALA C CB  1 
ATOM   5122  N  N   . THR C  3  185 ? 28.771  -88.096  -19.075 1.00 82.39  ? 185  THR C N   1 
ATOM   5123  C  CA  . THR C  3  185 ? 30.051  -88.794  -19.228 1.00 82.41  ? 185  THR C CA  1 
ATOM   5124  C  C   . THR C  3  185 ? 30.958  -88.601  -18.014 1.00 82.24  ? 185  THR C C   1 
ATOM   5125  O  O   . THR C  3  185 ? 30.746  -87.698  -17.206 1.00 82.20  ? 185  THR C O   1 
ATOM   5126  C  CB  . THR C  3  185 ? 30.810  -88.318  -20.501 1.00 82.52  ? 185  THR C CB  1 
ATOM   5127  O  OG1 . THR C  3  185 ? 29.868  -87.981  -21.525 1.00 83.09  ? 185  THR C OG1 1 
ATOM   5128  C  CG2 . THR C  3  185 ? 31.765  -89.404  -21.027 1.00 82.47  ? 185  THR C CG2 1 
ATOM   5129  N  N   . VAL C  3  186 ? 31.963  -89.468  -17.904 1.00 82.12  ? 186  VAL C N   1 
ATOM   5130  C  CA  . VAL C  3  186 ? 33.052  -89.342  -16.934 1.00 81.99  ? 186  VAL C CA  1 
ATOM   5131  C  C   . VAL C  3  186 ? 33.767  -87.984  -17.074 1.00 82.07  ? 186  VAL C C   1 
ATOM   5132  O  O   . VAL C  3  186 ? 33.904  -87.237  -16.094 1.00 81.96  ? 186  VAL C O   1 
ATOM   5133  C  CB  . VAL C  3  186 ? 34.073  -90.511  -17.101 1.00 81.92  ? 186  VAL C CB  1 
ATOM   5134  C  CG1 . VAL C  3  186 ? 35.247  -90.378  -16.127 1.00 81.71  ? 186  VAL C CG1 1 
ATOM   5135  C  CG2 . VAL C  3  186 ? 33.379  -91.859  -16.940 1.00 81.68  ? 186  VAL C CG2 1 
ATOM   5136  N  N   . GLU C  3  187 ? 34.209  -87.674  -18.295 1.00 82.18  ? 187  GLU C N   1 
ATOM   5137  C  CA  . GLU C  3  187 ? 34.930  -86.432  -18.579 1.00 82.17  ? 187  GLU C CA  1 
ATOM   5138  C  C   . GLU C  3  187 ? 34.110  -85.206  -18.172 1.00 82.01  ? 187  GLU C C   1 
ATOM   5139  O  O   . GLU C  3  187 ? 34.616  -84.339  -17.459 1.00 82.14  ? 187  GLU C O   1 
ATOM   5140  C  CB  . GLU C  3  187 ? 35.355  -86.348  -20.058 1.00 82.25  ? 187  GLU C CB  1 
ATOM   5141  C  CG  . GLU C  3  187 ? 36.173  -85.087  -20.407 1.00 82.81  ? 187  GLU C CG  1 
ATOM   5142  C  CD  . GLU C  3  187 ? 36.615  -84.994  -21.876 1.00 83.12  ? 187  GLU C CD  1 
ATOM   5143  O  OE1 . GLU C  3  187 ? 37.587  -84.256  -22.154 1.00 82.70  ? 187  GLU C OE1 1 
ATOM   5144  O  OE2 . GLU C  3  187 ? 36.001  -85.641  -22.749 1.00 83.20  ? 187  GLU C OE2 1 
ATOM   5145  N  N   . GLU C  3  188 ? 32.848  -85.139  -18.595 1.00 81.65  ? 188  GLU C N   1 
ATOM   5146  C  CA  . GLU C  3  188 ? 32.051  -83.948  -18.311 1.00 81.37  ? 188  GLU C CA  1 
ATOM   5147  C  C   . GLU C  3  188 ? 31.535  -83.866  -16.868 1.00 81.02  ? 188  GLU C C   1 
ATOM   5148  O  O   . GLU C  3  188 ? 31.153  -82.792  -16.400 1.00 81.17  ? 188  GLU C O   1 
ATOM   5149  C  CB  . GLU C  3  188 ? 30.958  -83.698  -19.369 1.00 81.56  ? 188  GLU C CB  1 
ATOM   5150  C  CG  . GLU C  3  188 ? 29.787  -84.671  -19.406 1.00 82.20  ? 188  GLU C CG  1 
ATOM   5151  C  CD  . GLU C  3  188 ? 28.612  -84.134  -20.236 1.00 82.66  ? 188  GLU C CD  1 
ATOM   5152  O  OE1 . GLU C  3  188 ? 27.880  -83.229  -19.760 1.00 82.27  ? 188  GLU C OE1 1 
ATOM   5153  O  OE2 . GLU C  3  188 ? 28.419  -84.627  -21.367 1.00 82.82  ? 188  GLU C OE2 1 
ATOM   5154  N  N   . CYS C  3  189 ? 31.559  -84.990  -16.160 1.00 80.57  ? 189  CYS C N   1 
ATOM   5155  C  CA  . CYS C  3  189 ? 31.248  -84.995  -14.734 1.00 79.93  ? 189  CYS C CA  1 
ATOM   5156  C  C   . CYS C  3  189 ? 32.439  -84.517  -13.922 1.00 79.41  ? 189  CYS C C   1 
ATOM   5157  O  O   . CYS C  3  189 ? 32.272  -83.814  -12.927 1.00 79.13  ? 189  CYS C O   1 
ATOM   5158  C  CB  . CYS C  3  189 ? 30.839  -86.387  -14.271 1.00 80.07  ? 189  CYS C CB  1 
ATOM   5159  S  SG  . CYS C  3  189 ? 30.020  -86.408  -12.660 1.00 80.47  ? 189  CYS C SG  1 
ATOM   5160  N  N   . VAL C  3  190 ? 33.637  -84.910  -14.347 1.00 79.01  ? 190  VAL C N   1 
ATOM   5161  C  CA  . VAL C  3  190 ? 34.870  -84.474  -13.690 1.00 78.73  ? 190  VAL C CA  1 
ATOM   5162  C  C   . VAL C  3  190 ? 35.052  -82.971  -13.841 1.00 78.60  ? 190  VAL C C   1 
ATOM   5163  O  O   . VAL C  3  190 ? 35.345  -82.278  -12.868 1.00 78.66  ? 190  VAL C O   1 
ATOM   5164  C  CB  . VAL C  3  190 ? 36.118  -85.221  -14.226 1.00 78.70  ? 190  VAL C CB  1 
ATOM   5165  C  CG1 . VAL C  3  190 ? 37.404  -84.494  -13.835 1.00 78.52  ? 190  VAL C CG1 1 
ATOM   5166  C  CG2 . VAL C  3  190 ? 36.148  -86.648  -13.710 1.00 78.47  ? 190  VAL C CG2 1 
ATOM   5167  N  N   . LYS C  3  191 ? 34.853  -82.475  -15.061 1.00 78.44  ? 191  LYS C N   1 
ATOM   5168  C  CA  . LYS C  3  191 ? 35.057  -81.064  -15.374 1.00 78.25  ? 191  LYS C CA  1 
ATOM   5169  C  C   . LYS C  3  191 ? 34.207  -80.179  -14.464 1.00 77.78  ? 191  LYS C C   1 
ATOM   5170  O  O   . LYS C  3  191 ? 34.708  -79.212  -13.888 1.00 77.63  ? 191  LYS C O   1 
ATOM   5171  C  CB  . LYS C  3  191 ? 34.754  -80.791  -16.854 1.00 78.46  ? 191  LYS C CB  1 
ATOM   5172  C  CG  . LYS C  3  191 ? 35.201  -79.419  -17.359 1.00 79.13  ? 191  LYS C CG  1 
ATOM   5173  C  CD  . LYS C  3  191 ? 34.734  -79.180  -18.790 1.00 80.18  ? 191  LYS C CD  1 
ATOM   5174  C  CE  . LYS C  3  191 ? 34.936  -77.734  -19.219 1.00 80.47  ? 191  LYS C CE  1 
ATOM   5175  N  NZ  . LYS C  3  191 ? 34.616  -77.566  -20.666 1.00 80.98  ? 191  LYS C NZ  1 
ATOM   5176  N  N   . LEU C  3  192 ? 32.931  -80.533  -14.329 1.00 77.31  ? 192  LEU C N   1 
ATOM   5177  C  CA  . LEU C  3  192 ? 32.015  -79.819  -13.443 1.00 76.86  ? 192  LEU C CA  1 
ATOM   5178  C  C   . LEU C  3  192 ? 32.496  -79.851  -11.989 1.00 76.81  ? 192  LEU C C   1 
ATOM   5179  O  O   . LEU C  3  192 ? 32.440  -78.837  -11.293 1.00 76.84  ? 192  LEU C O   1 
ATOM   5180  C  CB  . LEU C  3  192 ? 30.600  -80.392  -13.561 1.00 76.68  ? 192  LEU C CB  1 
ATOM   5181  C  CG  . LEU C  3  192 ? 29.499  -79.802  -12.678 1.00 75.89  ? 192  LEU C CG  1 
ATOM   5182  C  CD1 . LEU C  3  192 ? 29.202  -78.370  -13.068 1.00 75.75  ? 192  LEU C CD1 1 
ATOM   5183  C  CD2 . LEU C  3  192 ? 28.252  -80.639  -12.792 1.00 75.53  ? 192  LEU C CD2 1 
ATOM   5184  N  N   . THR C  3  193 ? 32.976  -81.011  -11.543 1.00 76.71  ? 193  THR C N   1 
ATOM   5185  C  CA  . THR C  3  193 ? 33.516  -81.158  -10.193 1.00 76.66  ? 193  THR C CA  1 
ATOM   5186  C  C   . THR C  3  193 ? 34.712  -80.224  -9.979  1.00 76.86  ? 193  THR C C   1 
ATOM   5187  O  O   . THR C  3  193 ? 34.813  -79.572  -8.936  1.00 76.80  ? 193  THR C O   1 
ATOM   5188  C  CB  . THR C  3  193 ? 33.895  -82.632  -9.881  1.00 76.62  ? 193  THR C CB  1 
ATOM   5189  O  OG1 . THR C  3  193 ? 32.767  -83.478  -10.122 1.00 76.27  ? 193  THR C OG1 1 
ATOM   5190  C  CG2 . THR C  3  193 ? 34.324  -82.801  -8.432  1.00 76.28  ? 193  THR C CG2 1 
ATOM   5191  N  N   . VAL C  3  194 ? 35.596  -80.148  -10.973 1.00 77.13  ? 194  VAL C N   1 
ATOM   5192  C  CA  . VAL C  3  194 ? 36.764  -79.259  -10.910 1.00 77.52  ? 194  VAL C CA  1 
ATOM   5193  C  C   . VAL C  3  194 ? 36.347  -77.784  -10.955 1.00 77.81  ? 194  VAL C C   1 
ATOM   5194  O  O   . VAL C  3  194 ? 36.932  -76.945  -10.267 1.00 77.83  ? 194  VAL C O   1 
ATOM   5195  C  CB  . VAL C  3  194 ? 37.786  -79.561  -12.030 1.00 77.51  ? 194  VAL C CB  1 
ATOM   5196  C  CG1 . VAL C  3  194 ? 39.020  -78.675  -11.887 1.00 77.77  ? 194  VAL C CG1 1 
ATOM   5197  C  CG2 . VAL C  3  194 ? 38.199  -81.027  -12.000 1.00 77.52  ? 194  VAL C CG2 1 
ATOM   5198  N  N   . ARG C  3  195 ? 35.327  -77.484  -11.756 1.00 78.16  ? 195  ARG C N   1 
ATOM   5199  C  CA  . ARG C  3  195 ? 34.786  -76.135  -11.853 1.00 78.53  ? 195  ARG C CA  1 
ATOM   5200  C  C   . ARG C  3  195 ? 34.338  -75.609  -10.496 1.00 78.70  ? 195  ARG C C   1 
ATOM   5201  O  O   . ARG C  3  195 ? 34.629  -74.462  -10.142 1.00 78.77  ? 195  ARG C O   1 
ATOM   5202  C  CB  . ARG C  3  195 ? 33.620  -76.091  -12.844 1.00 78.60  ? 195  ARG C CB  1 
ATOM   5203  C  CG  . ARG C  3  195 ? 34.041  -75.927  -14.297 1.00 79.31  ? 195  ARG C CG  1 
ATOM   5204  C  CD  . ARG C  3  195 ? 32.836  -75.866  -15.224 1.00 80.63  ? 195  ARG C CD  1 
ATOM   5205  N  NE  . ARG C  3  195 ? 32.046  -74.652  -15.020 1.00 81.53  ? 195  ARG C NE  1 
ATOM   5206  C  CZ  . ARG C  3  195 ? 30.833  -74.449  -15.527 1.00 81.92  ? 195  ARG C CZ  1 
ATOM   5207  N  NH1 . ARG C  3  195 ? 30.251  -75.381  -16.275 1.00 82.38  ? 195  ARG C NH1 1 
ATOM   5208  N  NH2 . ARG C  3  195 ? 30.199  -73.312  -15.284 1.00 81.78  ? 195  ARG C NH2 1 
ATOM   5209  N  N   . SER C  3  196 ? 33.642  -76.458  -9.741  1.00 78.90  ? 196  SER C N   1 
ATOM   5210  C  CA  . SER C  3  196 ? 33.081  -76.076  -8.444  1.00 79.16  ? 196  SER C CA  1 
ATOM   5211  C  C   . SER C  3  196 ? 34.149  -75.870  -7.373  1.00 79.37  ? 196  SER C C   1 
ATOM   5212  O  O   . SER C  3  196 ? 33.976  -75.066  -6.454  1.00 79.19  ? 196  SER C O   1 
ATOM   5213  C  CB  . SER C  3  196 ? 32.028  -77.089  -7.981  1.00 79.12  ? 196  SER C CB  1 
ATOM   5214  O  OG  . SER C  3  196 ? 32.454  -78.421  -8.193  1.00 79.27  ? 196  SER C OG  1 
ATOM   5215  N  N   . LEU C  3  197 ? 35.253  -76.595  -7.505  1.00 79.87  ? 197  LEU C N   1 
ATOM   5216  C  CA  . LEU C  3  197 ? 36.379  -76.435  -6.596  1.00 80.43  ? 197  LEU C CA  1 
ATOM   5217  C  C   . LEU C  3  197 ? 37.190  -75.183  -6.937  1.00 80.95  ? 197  LEU C C   1 
ATOM   5218  O  O   . LEU C  3  197 ? 37.720  -74.520  -6.042  1.00 81.02  ? 197  LEU C O   1 
ATOM   5219  C  CB  . LEU C  3  197 ? 37.261  -77.687  -6.588  1.00 80.31  ? 197  LEU C CB  1 
ATOM   5220  C  CG  . LEU C  3  197 ? 36.699  -78.929  -5.882  1.00 80.16  ? 197  LEU C CG  1 
ATOM   5221  C  CD1 . LEU C  3  197 ? 37.351  -80.199  -6.407  1.00 79.77  ? 197  LEU C CD1 1 
ATOM   5222  C  CD2 . LEU C  3  197 ? 36.843  -78.839  -4.366  1.00 80.18  ? 197  LEU C CD2 1 
ATOM   5223  N  N   . LEU C  3  198 ? 37.259  -74.846  -8.225  1.00 81.60  ? 198  LEU C N   1 
ATOM   5224  C  CA  . LEU C  3  198 ? 37.936  -73.625  -8.664  1.00 82.26  ? 198  LEU C CA  1 
ATOM   5225  C  C   . LEU C  3  198 ? 37.306  -72.343  -8.103  1.00 82.89  ? 198  LEU C C   1 
ATOM   5226  O  O   . LEU C  3  198 ? 37.958  -71.298  -8.063  1.00 82.95  ? 198  LEU C O   1 
ATOM   5227  C  CB  . LEU C  3  198 ? 38.039  -73.567  -10.189 1.00 82.06  ? 198  LEU C CB  1 
ATOM   5228  C  CG  . LEU C  3  198 ? 39.052  -74.531  -10.816 1.00 81.96  ? 198  LEU C CG  1 
ATOM   5229  C  CD1 . LEU C  3  198 ? 39.023  -74.434  -12.334 1.00 82.04  ? 198  LEU C CD1 1 
ATOM   5230  C  CD2 . LEU C  3  198 ? 40.461  -74.293  -10.292 1.00 81.68  ? 198  LEU C CD2 1 
ATOM   5231  N  N   . GLU C  3  199 ? 36.056  -72.439  -7.650  1.00 83.67  ? 199  GLU C N   1 
ATOM   5232  C  CA  . GLU C  3  199 ? 35.382  -71.331  -6.968  1.00 84.57  ? 199  GLU C CA  1 
ATOM   5233  C  C   . GLU C  3  199 ? 35.992  -71.031  -5.599  1.00 85.20  ? 199  GLU C C   1 
ATOM   5234  O  O   . GLU C  3  199 ? 35.956  -69.891  -5.133  1.00 85.22  ? 199  GLU C O   1 
ATOM   5235  C  CB  . GLU C  3  199 ? 33.891  -71.628  -6.785  1.00 84.45  ? 199  GLU C CB  1 
ATOM   5236  C  CG  . GLU C  3  199 ? 33.134  -71.950  -8.062  1.00 84.87  ? 199  GLU C CG  1 
ATOM   5237  C  CD  . GLU C  3  199 ? 32.936  -70.748  -8.966  1.00 85.21  ? 199  GLU C CD  1 
ATOM   5238  O  OE1 . GLU C  3  199 ? 32.325  -69.749  -8.522  1.00 85.13  ? 199  GLU C OE1 1 
ATOM   5239  O  OE2 . GLU C  3  199 ? 33.379  -70.816  -10.134 1.00 85.72  ? 199  GLU C OE2 1 
ATOM   5240  N  N   . VAL C  3  200 ? 36.550  -72.057  -4.961  1.00 86.13  ? 200  VAL C N   1 
ATOM   5241  C  CA  . VAL C  3  200 ? 36.927  -71.976  -3.549  1.00 86.94  ? 200  VAL C CA  1 
ATOM   5242  C  C   . VAL C  3  200 ? 38.429  -72.164  -3.307  1.00 87.52  ? 200  VAL C C   1 
ATOM   5243  O  O   . VAL C  3  200 ? 38.990  -71.587  -2.375  1.00 87.44  ? 200  VAL C O   1 
ATOM   5244  C  CB  . VAL C  3  200 ? 36.070  -72.965  -2.697  1.00 86.84  ? 200  VAL C CB  1 
ATOM   5245  C  CG1 . VAL C  3  200 ? 36.667  -73.192  -1.316  1.00 87.18  ? 200  VAL C CG1 1 
ATOM   5246  C  CG2 . VAL C  3  200 ? 34.644  -72.453  -2.574  1.00 86.67  ? 200  VAL C CG2 1 
ATOM   5247  N  N   . VAL C  3  201 ? 39.077  -72.953  -4.153  1.00 88.55  ? 201  VAL C N   1 
ATOM   5248  C  CA  . VAL C  3  201 ? 40.492  -73.277  -3.962  1.00 89.70  ? 201  VAL C CA  1 
ATOM   5249  C  C   . VAL C  3  201 ? 41.420  -72.125  -4.370  1.00 90.62  ? 201  VAL C C   1 
ATOM   5250  O  O   . VAL C  3  201 ? 42.421  -71.862  -3.696  1.00 90.64  ? 201  VAL C O   1 
ATOM   5251  C  CB  . VAL C  3  201 ? 40.875  -74.598  -4.682  1.00 89.57  ? 201  VAL C CB  1 
ATOM   5252  C  CG1 . VAL C  3  201 ? 42.382  -74.864  -4.612  1.00 89.65  ? 201  VAL C CG1 1 
ATOM   5253  C  CG2 . VAL C  3  201 ? 40.110  -75.763  -4.074  1.00 89.52  ? 201  VAL C CG2 1 
ATOM   5254  N  N   . GLN C  3  202 ? 41.067  -71.433  -5.454  1.00 91.79  ? 202  GLN C N   1 
ATOM   5255  C  CA  . GLN C  3  202 ? 41.893  -70.355  -6.017  1.00 93.02  ? 202  GLN C CA  1 
ATOM   5256  C  C   . GLN C  3  202 ? 43.241  -70.913  -6.516  1.00 93.66  ? 202  GLN C C   1 
ATOM   5257  O  O   . GLN C  3  202 ? 44.285  -70.728  -5.871  1.00 93.66  ? 202  GLN C O   1 
ATOM   5258  C  CB  . GLN C  3  202 ? 42.102  -69.190  -5.017  1.00 93.13  ? 202  GLN C CB  1 
ATOM   5259  C  CG  . GLN C  3  202 ? 40.836  -68.660  -4.300  1.00 93.68  ? 202  GLN C CG  1 
ATOM   5260  C  CD  . GLN C  3  202 ? 39.948  -67.765  -5.168  1.00 94.18  ? 202  GLN C CD  1 
ATOM   5261  O  OE1 . GLN C  3  202 ? 40.404  -67.162  -6.145  1.00 94.35  ? 202  GLN C OE1 1 
ATOM   5262  N  NE2 . GLN C  3  202 ? 38.672  -67.670  -4.798  1.00 93.74  ? 202  GLN C NE2 1 
ATOM   5263  N  N   . THR C  3  203 ? 43.184  -71.604  -7.661  1.00 94.46  ? 203  THR C N   1 
ATOM   5264  C  CA  . THR C  3  203 ? 44.351  -72.195  -8.361  1.00 95.14  ? 203  THR C CA  1 
ATOM   5265  C  C   . THR C  3  203 ? 45.149  -73.237  -7.553  1.00 95.41  ? 203  THR C C   1 
ATOM   5266  O  O   . THR C  3  203 ? 45.803  -72.918  -6.549  1.00 95.37  ? 203  THR C O   1 
ATOM   5267  C  CB  . THR C  3  203 ? 45.298  -71.110  -8.995  1.00 95.25  ? 203  THR C CB  1 
ATOM   5268  O  OG1 . THR C  3  203 ? 44.546  -70.280  -9.890  1.00 95.38  ? 203  THR C OG1 1 
ATOM   5269  C  CG2 . THR C  3  203 ? 46.456  -71.759  -9.772  1.00 95.28  ? 203  THR C CG2 1 
ATOM   5270  N  N   . GLY C  3  204 ? 45.087  -74.482  -8.023  1.00 95.74  ? 206  GLY C N   1 
ATOM   5271  C  CA  . GLY C  3  204 ? 45.842  -75.580  -7.433  1.00 96.01  ? 206  GLY C CA  1 
ATOM   5272  C  C   . GLY C  3  204 ? 45.892  -76.806  -8.323  1.00 96.19  ? 206  GLY C C   1 
ATOM   5273  O  O   . GLY C  3  204 ? 44.906  -77.535  -8.452  1.00 96.10  ? 206  GLY C O   1 
ATOM   5274  N  N   . ALA C  3  205 ? 47.048  -77.020  -8.948  1.00 96.42  ? 207  ALA C N   1 
ATOM   5275  C  CA  . ALA C  3  205 ? 47.287  -78.209  -9.763  1.00 96.50  ? 207  ALA C CA  1 
ATOM   5276  C  C   . ALA C  3  205 ? 47.259  -79.447  -8.860  1.00 96.48  ? 207  ALA C C   1 
ATOM   5277  O  O   . ALA C  3  205 ? 46.373  -80.302  -8.991  1.00 96.59  ? 207  ALA C O   1 
ATOM   5278  C  CB  . ALA C  3  205 ? 48.623  -78.095  -10.516 1.00 96.47  ? 207  ALA C CB  1 
ATOM   5279  N  N   . LYS C  3  206 ? 48.221  -79.515  -7.935  1.00 96.21  ? 208  LYS C N   1 
ATOM   5280  C  CA  . LYS C  3  206 ? 48.247  -80.545  -6.891  1.00 95.81  ? 208  LYS C CA  1 
ATOM   5281  C  C   . LYS C  3  206 ? 47.190  -80.267  -5.807  1.00 95.25  ? 208  LYS C C   1 
ATOM   5282  O  O   . LYS C  3  206 ? 46.882  -81.149  -4.995  1.00 95.38  ? 208  LYS C O   1 
ATOM   5283  C  CB  . LYS C  3  206 ? 49.648  -80.649  -6.250  1.00 95.95  ? 208  LYS C CB  1 
ATOM   5284  C  CG  . LYS C  3  206 ? 50.119  -79.364  -5.534  1.00 96.81  ? 208  LYS C CG  1 
ATOM   5285  C  CD  . LYS C  3  206 ? 50.642  -79.633  -4.110  1.00 97.80  ? 208  LYS C CD  1 
ATOM   5286  C  CE  . LYS C  3  206 ? 50.418  -78.417  -3.189  1.00 97.71  ? 208  LYS C CE  1 
ATOM   5287  N  NZ  . LYS C  3  206 ? 50.958  -78.605  -1.809  1.00 97.04  ? 208  LYS C NZ  1 
ATOM   5288  N  N   . ASN C  3  207 ? 46.638  -79.048  -5.807  1.00 94.33  ? 209  ASN C N   1 
ATOM   5289  C  CA  . ASN C  3  207 ? 45.743  -78.580  -4.739  1.00 93.37  ? 209  ASN C CA  1 
ATOM   5290  C  C   . ASN C  3  207 ? 44.287  -79.062  -4.843  1.00 92.38  ? 209  ASN C C   1 
ATOM   5291  O  O   . ASN C  3  207 ? 43.449  -78.750  -3.986  1.00 92.38  ? 209  ASN C O   1 
ATOM   5292  C  CB  . ASN C  3  207 ? 45.805  -77.053  -4.627  1.00 93.64  ? 209  ASN C CB  1 
ATOM   5293  C  CG  . ASN C  3  207 ? 45.986  -76.573  -3.193  1.00 94.09  ? 209  ASN C CG  1 
ATOM   5294  O  OD1 . ASN C  3  207 ? 45.499  -75.501  -2.824  1.00 94.35  ? 209  ASN C OD1 1 
ATOM   5295  N  ND2 . ASN C  3  207 ? 46.702  -77.355  -2.381  1.00 94.77  ? 209  ASN C ND2 1 
ATOM   5296  N  N   . ILE C  3  208 ? 43.999  -79.814  -5.902  1.00 91.00  ? 210  ILE C N   1 
ATOM   5297  C  CA  . ILE C  3  208 ? 42.736  -80.526  -6.050  1.00 89.56  ? 210  ILE C CA  1 
ATOM   5298  C  C   . ILE C  3  208 ? 43.050  -82.005  -6.261  1.00 88.61  ? 210  ILE C C   1 
ATOM   5299  O  O   . ILE C  3  208 ? 43.955  -82.340  -7.030  1.00 88.56  ? 210  ILE C O   1 
ATOM   5300  C  CB  . ILE C  3  208 ? 41.932  -79.985  -7.253  1.00 89.56  ? 210  ILE C CB  1 
ATOM   5301  C  CG1 . ILE C  3  208 ? 41.269  -78.654  -6.897  1.00 89.42  ? 210  ILE C CG1 1 
ATOM   5302  C  CG2 . ILE C  3  208 ? 40.888  -81.000  -7.725  1.00 89.53  ? 210  ILE C CG2 1 
ATOM   5303  C  CD1 . ILE C  3  208 ? 40.688  -77.907  -8.096  1.00 89.39  ? 210  ILE C CD1 1 
ATOM   5304  N  N   . GLU C  3  209 ? 42.328  -82.884  -5.564  1.00 87.28  ? 211  GLU C N   1 
ATOM   5305  C  CA  . GLU C  3  209 ? 42.363  -84.311  -5.885  1.00 85.92  ? 211  GLU C CA  1 
ATOM   5306  C  C   . GLU C  3  209 ? 40.987  -84.843  -6.272  1.00 84.60  ? 211  GLU C C   1 
ATOM   5307  O  O   . GLU C  3  209 ? 39.960  -84.416  -5.749  1.00 84.30  ? 211  GLU C O   1 
ATOM   5308  C  CB  . GLU C  3  209 ? 43.055  -85.155  -4.801  1.00 86.21  ? 211  GLU C CB  1 
ATOM   5309  C  CG  . GLU C  3  209 ? 42.314  -85.333  -3.476  1.00 87.45  ? 211  GLU C CG  1 
ATOM   5310  C  CD  . GLU C  3  209 ? 43.140  -86.106  -2.438  1.00 89.18  ? 211  GLU C CD  1 
ATOM   5311  O  OE1 . GLU C  3  209 ? 42.540  -86.777  -1.564  1.00 89.58  ? 211  GLU C OE1 1 
ATOM   5312  O  OE2 . GLU C  3  209 ? 44.393  -86.044  -2.498  1.00 89.66  ? 211  GLU C OE2 1 
ATOM   5313  N  N   . ILE C  3  210 ? 40.993  -85.760  -7.228  1.00 83.27  ? 212  ILE C N   1 
ATOM   5314  C  CA  . ILE C  3  210 ? 39.779  -86.272  -7.833  1.00 81.92  ? 212  ILE C CA  1 
ATOM   5315  C  C   . ILE C  3  210 ? 39.843  -87.782  -7.887  1.00 81.13  ? 212  ILE C C   1 
ATOM   5316  O  O   . ILE C  3  210 ? 40.881  -88.361  -8.213  1.00 81.12  ? 212  ILE C O   1 
ATOM   5317  C  CB  . ILE C  3  210 ? 39.591  -85.716  -9.270  1.00 81.92  ? 212  ILE C CB  1 
ATOM   5318  C  CG1 . ILE C  3  210 ? 39.312  -84.203  -9.249  1.00 81.83  ? 212  ILE C CG1 1 
ATOM   5319  C  CG2 . ILE C  3  210 ? 38.500  -86.475  -10.038 1.00 81.50  ? 212  ILE C CG2 1 
ATOM   5320  C  CD1 . ILE C  3  210 ? 38.049  -83.776  -8.510  1.00 81.39  ? 212  ILE C CD1 1 
ATOM   5321  N  N   . THR C  3  211 ? 38.723  -88.414  -7.558  1.00 80.05  ? 213  THR C N   1 
ATOM   5322  C  CA  . THR C  3  211 ? 38.595  -89.853  -7.670  1.00 78.89  ? 213  THR C CA  1 
ATOM   5323  C  C   . THR C  3  211 ? 37.297  -90.173  -8.404  1.00 78.16  ? 213  THR C C   1 
ATOM   5324  O  O   . THR C  3  211 ? 36.236  -89.659  -8.059  1.00 77.92  ? 213  THR C O   1 
ATOM   5325  C  CB  . THR C  3  211 ? 38.657  -90.530  -6.281  1.00 78.87  ? 213  THR C CB  1 
ATOM   5326  O  OG1 . THR C  3  211 ? 39.738  -89.968  -5.526  1.00 78.34  ? 213  THR C OG1 1 
ATOM   5327  C  CG2 . THR C  3  211 ? 38.887  -92.022  -6.420  1.00 78.88  ? 213  THR C CG2 1 
ATOM   5328  N  N   . VAL C  3  212 ? 37.404  -91.003  -9.437  1.00 77.43  ? 214  VAL C N   1 
ATOM   5329  C  CA  . VAL C  3  212 ? 36.256  -91.406  -10.245 1.00 76.80  ? 214  VAL C CA  1 
ATOM   5330  C  C   . VAL C  3  212 ? 35.813  -92.820  -9.894  1.00 76.39  ? 214  VAL C C   1 
ATOM   5331  O  O   . VAL C  3  212 ? 36.630  -93.741  -9.830  1.00 76.40  ? 214  VAL C O   1 
ATOM   5332  C  CB  . VAL C  3  212 ? 36.578  -91.348  -11.748 1.00 76.78  ? 214  VAL C CB  1 
ATOM   5333  C  CG1 . VAL C  3  212 ? 35.388  -91.819  -12.585 1.00 76.67  ? 214  VAL C CG1 1 
ATOM   5334  C  CG2 . VAL C  3  212 ? 36.976  -89.946  -12.142 1.00 77.15  ? 214  VAL C CG2 1 
ATOM   5335  N  N   . VAL C  3  213 ? 34.514  -92.982  -9.672  1.00 75.83  ? 215  VAL C N   1 
ATOM   5336  C  CA  . VAL C  3  213 ? 33.944  -94.294  -9.397  1.00 75.35  ? 215  VAL C CA  1 
ATOM   5337  C  C   . VAL C  3  213 ? 32.883  -94.677  -10.436 1.00 75.09  ? 215  VAL C C   1 
ATOM   5338  O  O   . VAL C  3  213 ? 31.865  -94.007  -10.588 1.00 74.74  ? 215  VAL C O   1 
ATOM   5339  C  CB  . VAL C  3  213 ? 33.474  -94.455  -7.899  1.00 75.25  ? 215  VAL C CB  1 
ATOM   5340  C  CG1 . VAL C  3  213 ? 33.284  -93.112  -7.220  1.00 75.04  ? 215  VAL C CG1 1 
ATOM   5341  C  CG2 . VAL C  3  213 ? 32.228  -95.326  -7.771  1.00 75.00  ? 215  VAL C CG2 1 
ATOM   5342  N  N   . LYS C  3  214 ? 33.175  -95.757  -11.157 1.00 75.05  ? 216  LYS C N   1 
ATOM   5343  C  CA  . LYS C  3  214 ? 32.301  -96.330  -12.179 1.00 74.87  ? 216  LYS C CA  1 
ATOM   5344  C  C   . LYS C  3  214 ? 31.658  -97.616  -11.642 1.00 74.56  ? 216  LYS C C   1 
ATOM   5345  O  O   . LYS C  3  214 ? 32.040  -98.087  -10.572 1.00 74.33  ? 216  LYS C O   1 
ATOM   5346  C  CB  . LYS C  3  214 ? 33.117  -96.643  -13.440 1.00 75.14  ? 216  LYS C CB  1 
ATOM   5347  C  CG  . LYS C  3  214 ? 33.819  -95.450  -14.079 1.00 75.54  ? 216  LYS C CG  1 
ATOM   5348  C  CD  . LYS C  3  214 ? 34.496  -95.869  -15.370 1.00 76.68  ? 216  LYS C CD  1 
ATOM   5349  C  CE  . LYS C  3  214 ? 35.630  -94.897  -15.716 1.00 77.91  ? 216  LYS C CE  1 
ATOM   5350  N  NZ  . LYS C  3  214 ? 36.096  -95.085  -17.119 1.00 78.48  ? 216  LYS C NZ  1 
ATOM   5351  N  N   . PRO C  3  215 ? 30.676  -98.187  -12.372 1.00 74.47  ? 217  PRO C N   1 
ATOM   5352  C  CA  . PRO C  3  215 ? 30.052  -99.429  -11.914 1.00 74.48  ? 217  PRO C CA  1 
ATOM   5353  C  C   . PRO C  3  215 ? 31.012  -100.624 -11.794 1.00 74.74  ? 217  PRO C C   1 
ATOM   5354  O  O   . PRO C  3  215 ? 32.150  -100.574 -12.290 1.00 74.48  ? 217  PRO C O   1 
ATOM   5355  C  CB  . PRO C  3  215 ? 28.993  -99.702  -12.987 1.00 74.39  ? 217  PRO C CB  1 
ATOM   5356  C  CG  . PRO C  3  215 ? 28.686  -98.376  -13.551 1.00 74.27  ? 217  PRO C CG  1 
ATOM   5357  C  CD  . PRO C  3  215 ? 29.995  -97.661  -13.570 1.00 74.36  ? 217  PRO C CD  1 
ATOM   5358  N  N   . ASP C  3  216 ? 30.533  -101.672 -11.116 1.00 74.97  ? 218  ASP C N   1 
ATOM   5359  C  CA  . ASP C  3  216 ? 31.250  -102.944 -10.920 1.00 75.18  ? 218  ASP C CA  1 
ATOM   5360  C  C   . ASP C  3  216 ? 32.715  -102.820 -10.476 1.00 75.00  ? 218  ASP C C   1 
ATOM   5361  O  O   . ASP C  3  216 ? 33.610  -103.416 -11.082 1.00 74.88  ? 218  ASP C O   1 
ATOM   5362  C  CB  . ASP C  3  216 ? 31.100  -103.855 -12.151 1.00 75.33  ? 218  ASP C CB  1 
ATOM   5363  C  CG  . ASP C  3  216 ? 29.675  -104.406 -12.306 1.00 76.34  ? 218  ASP C CG  1 
ATOM   5364  O  OD1 . ASP C  3  216 ? 29.076  -104.202 -13.387 1.00 77.01  ? 218  ASP C OD1 1 
ATOM   5365  O  OD2 . ASP C  3  216 ? 29.150  -105.036 -11.351 1.00 76.38  ? 218  ASP C OD2 1 
ATOM   5366  N  N   . SER C  3  217 ? 32.928  -102.037 -9.415  1.00 74.86  ? 219  SER C N   1 
ATOM   5367  C  CA  . SER C  3  217 ? 34.220  -101.910 -8.714  1.00 74.84  ? 219  SER C CA  1 
ATOM   5368  C  C   . SER C  3  217 ? 35.351  -101.262 -9.515  1.00 74.98  ? 219  SER C C   1 
ATOM   5369  O  O   . SER C  3  217 ? 36.525  -101.546 -9.291  1.00 74.69  ? 219  SER C O   1 
ATOM   5370  C  CB  . SER C  3  217 ? 34.663  -103.258 -8.130  1.00 74.86  ? 219  SER C CB  1 
ATOM   5371  O  OG  . SER C  3  217 ? 33.711  -103.734 -7.193  1.00 74.60  ? 219  SER C OG  1 
ATOM   5372  N  N   . ASP C  3  218 ? 34.986  -100.374 -10.433 1.00 75.38  ? 220  ASP C N   1 
ATOM   5373  C  CA  . ASP C  3  218 ? 35.964  -99.608  -11.183 1.00 75.79  ? 220  ASP C CA  1 
ATOM   5374  C  C   . ASP C  3  218 ? 36.194  -98.265  -10.490 1.00 76.27  ? 220  ASP C C   1 
ATOM   5375  O  O   . ASP C  3  218 ? 35.351  -97.373  -10.547 1.00 76.24  ? 220  ASP C O   1 
ATOM   5376  C  CB  . ASP C  3  218 ? 35.498  -99.420  -12.629 1.00 75.67  ? 220  ASP C CB  1 
ATOM   5377  C  CG  . ASP C  3  218 ? 36.632  -99.033  -13.572 1.00 75.48  ? 220  ASP C CG  1 
ATOM   5378  O  OD1 . ASP C  3  218 ? 36.332  -98.653  -14.721 1.00 74.93  ? 220  ASP C OD1 1 
ATOM   5379  O  OD2 . ASP C  3  218 ? 37.816  -99.110  -13.176 1.00 74.99  ? 220  ASP C OD2 1 
ATOM   5380  N  N   . ILE C  3  219 ? 37.336  -98.143  -9.820  1.00 76.99  ? 221  ILE C N   1 
ATOM   5381  C  CA  . ILE C  3  219 ? 37.675  -96.951  -9.041  1.00 77.74  ? 221  ILE C CA  1 
ATOM   5382  C  C   . ILE C  3  219 ? 39.115  -96.530  -9.320  1.00 78.57  ? 221  ILE C C   1 
ATOM   5383  O  O   . ILE C  3  219 ? 40.034  -97.340  -9.187  1.00 78.75  ? 221  ILE C O   1 
ATOM   5384  C  CB  . ILE C  3  219 ? 37.485  -97.206  -7.519  1.00 77.62  ? 221  ILE C CB  1 
ATOM   5385  C  CG1 . ILE C  3  219 ? 35.999  -97.159  -7.145  1.00 77.20  ? 221  ILE C CG1 1 
ATOM   5386  C  CG2 . ILE C  3  219 ? 38.284  -96.202  -6.678  1.00 77.58  ? 221  ILE C CG2 1 
ATOM   5387  C  CD1 . ILE C  3  219 ? 35.689  -97.666  -5.755  1.00 76.36  ? 221  ILE C CD1 1 
ATOM   5388  N  N   . VAL C  3  220 ? 39.311  -95.271  -9.712  1.00 79.54  ? 222  VAL C N   1 
ATOM   5389  C  CA  . VAL C  3  220 ? 40.660  -94.744  -9.934  1.00 80.44  ? 222  VAL C CA  1 
ATOM   5390  C  C   . VAL C  3  220 ? 40.830  -93.325  -9.399  1.00 81.22  ? 222  VAL C C   1 
ATOM   5391  O  O   . VAL C  3  220 ? 39.964  -92.469  -9.584  1.00 81.12  ? 222  VAL C O   1 
ATOM   5392  C  CB  . VAL C  3  220 ? 41.084  -94.827  -11.431 1.00 80.40  ? 222  VAL C CB  1 
ATOM   5393  C  CG1 . VAL C  3  220 ? 40.169  -93.977  -12.322 1.00 80.42  ? 222  VAL C CG1 1 
ATOM   5394  C  CG2 . VAL C  3  220 ? 42.565  -94.445  -11.608 1.00 80.46  ? 222  VAL C CG2 1 
ATOM   5395  N  N   . ALA C  3  221 ? 41.948  -93.102  -8.715  1.00 82.35  ? 223  ALA C N   1 
ATOM   5396  C  CA  . ALA C  3  221 ? 42.360  -91.764  -8.310  1.00 83.44  ? 223  ALA C CA  1 
ATOM   5397  C  C   . ALA C  3  221 ? 43.071  -91.110  -9.487  1.00 84.29  ? 223  ALA C C   1 
ATOM   5398  O  O   . ALA C  3  221 ? 43.898  -91.746  -10.148 1.00 84.57  ? 223  ALA C O   1 
ATOM   5399  C  CB  . ALA C  3  221 ? 43.278  -91.834  -7.091  1.00 83.27  ? 223  ALA C CB  1 
ATOM   5400  N  N   . LEU C  3  222 ? 42.735  -89.851  -9.761  1.00 85.29  ? 224  LEU C N   1 
ATOM   5401  C  CA  . LEU C  3  222 ? 43.346  -89.116  -10.868 1.00 86.20  ? 224  LEU C CA  1 
ATOM   5402  C  C   . LEU C  3  222 ? 44.714  -88.553  -10.490 1.00 87.17  ? 224  LEU C C   1 
ATOM   5403  O  O   . LEU C  3  222 ? 44.895  -88.025  -9.392  1.00 87.09  ? 224  LEU C O   1 
ATOM   5404  C  CB  . LEU C  3  222 ? 42.410  -88.011  -11.365 1.00 85.85  ? 224  LEU C CB  1 
ATOM   5405  C  CG  . LEU C  3  222 ? 41.555  -88.308  -12.602 1.00 85.44  ? 224  LEU C CG  1 
ATOM   5406  C  CD1 . LEU C  3  222 ? 40.720  -89.568  -12.446 1.00 85.10  ? 224  LEU C CD1 1 
ATOM   5407  C  CD2 . LEU C  3  222 ? 40.667  -87.124  -12.945 1.00 84.29  ? 224  LEU C CD2 1 
ATOM   5408  N  N   . SER C  3  223 ? 45.672  -88.684  -11.406 1.00 88.62  ? 225  SER C N   1 
ATOM   5409  C  CA  . SER C  3  223 ? 47.026  -88.156  -11.208 1.00 90.05  ? 225  SER C CA  1 
ATOM   5410  C  C   . SER C  3  223 ? 47.067  -86.643  -11.440 1.00 91.03  ? 225  SER C C   1 
ATOM   5411  O  O   . SER C  3  223 ? 46.107  -86.061  -11.954 1.00 91.14  ? 225  SER C O   1 
ATOM   5412  C  CB  . SER C  3  223 ? 48.041  -88.872  -12.117 1.00 89.91  ? 225  SER C CB  1 
ATOM   5413  O  OG  . SER C  3  223 ? 47.989  -88.383  -13.448 1.00 90.02  ? 225  SER C OG  1 
ATOM   5414  N  N   . SER C  3  224 ? 48.188  -86.026  -11.066 1.00 92.34  ? 226  SER C N   1 
ATOM   5415  C  CA  . SER C  3  224 ? 48.380  -84.573  -11.142 1.00 93.60  ? 226  SER C CA  1 
ATOM   5416  C  C   . SER C  3  224 ? 48.128  -83.994  -12.535 1.00 94.57  ? 226  SER C C   1 
ATOM   5417  O  O   . SER C  3  224 ? 47.353  -83.040  -12.680 1.00 94.58  ? 226  SER C O   1 
ATOM   5418  C  CB  . SER C  3  224 ? 49.794  -84.208  -10.688 1.00 93.50  ? 226  SER C CB  1 
ATOM   5419  O  OG  . SER C  3  224 ? 50.291  -85.177  -9.783  1.00 93.50  ? 226  SER C OG  1 
ATOM   5420  N  N   . GLU C  3  225 ? 48.778  -84.575  -13.545 1.00 95.75  ? 227  GLU C N   1 
ATOM   5421  C  CA  . GLU C  3  225 ? 48.688  -84.081  -14.925 1.00 97.09  ? 227  GLU C CA  1 
ATOM   5422  C  C   . GLU C  3  225 ? 47.307  -84.264  -15.550 1.00 97.65  ? 227  GLU C C   1 
ATOM   5423  O  O   . GLU C  3  225 ? 46.890  -83.460  -16.391 1.00 97.87  ? 227  GLU C O   1 
ATOM   5424  C  CB  . GLU C  3  225 ? 49.769  -84.703  -15.821 1.00 97.29  ? 227  GLU C CB  1 
ATOM   5425  C  CG  . GLU C  3  225 ? 51.103  -83.948  -15.810 1.00 98.46  ? 227  GLU C CG  1 
ATOM   5426  C  CD  . GLU C  3  225 ? 51.973  -84.297  -14.604 1.00 99.87  ? 227  GLU C CD  1 
ATOM   5427  O  OE1 . GLU C  3  225 ? 51.997  -83.506  -13.632 1.00 100.35 ? 227  GLU C OE1 1 
ATOM   5428  O  OE2 . GLU C  3  225 ? 52.624  -85.368  -14.626 1.00 100.10 ? 227  GLU C OE2 1 
ATOM   5429  N  N   . GLU C  3  226 ? 46.612  -85.324  -15.142 1.00 98.27  ? 228  GLU C N   1 
ATOM   5430  C  CA  . GLU C  3  226 ? 45.238  -85.568  -15.578 1.00 98.77  ? 228  GLU C CA  1 
ATOM   5431  C  C   . GLU C  3  226 ? 44.296  -84.486  -15.037 1.00 98.99  ? 228  GLU C C   1 
ATOM   5432  O  O   . GLU C  3  226 ? 43.435  -83.991  -15.764 1.00 98.90  ? 228  GLU C O   1 
ATOM   5433  C  CB  . GLU C  3  226 ? 44.777  -86.961  -15.148 1.00 98.81  ? 228  GLU C CB  1 
ATOM   5434  C  CG  . GLU C  3  226 ? 45.566  -88.099  -15.786 1.00 99.39  ? 228  GLU C CG  1 
ATOM   5435  C  CD  . GLU C  3  226 ? 45.210  -89.460  -15.209 1.00 100.05 ? 228  GLU C CD  1 
ATOM   5436  O  OE1 . GLU C  3  226 ? 44.922  -90.383  -16.003 1.00 100.01 ? 228  GLU C OE1 1 
ATOM   5437  O  OE2 . GLU C  3  226 ? 45.212  -89.608  -13.966 1.00 100.16 ? 228  GLU C OE2 1 
ATOM   5438  N  N   . ILE C  3  227 ? 44.481  -84.127  -13.764 1.00 99.40  ? 229  ILE C N   1 
ATOM   5439  C  CA  . ILE C  3  227 ? 43.754  -83.019  -13.126 1.00 99.81  ? 229  ILE C CA  1 
ATOM   5440  C  C   . ILE C  3  227 ? 44.156  -81.693  -13.769 1.00 100.24 ? 229  ILE C C   1 
ATOM   5441  O  O   . ILE C  3  227 ? 43.306  -80.856  -14.090 1.00 100.09 ? 229  ILE C O   1 
ATOM   5442  C  CB  . ILE C  3  227 ? 44.035  -82.953  -11.593 1.00 99.70  ? 229  ILE C CB  1 
ATOM   5443  C  CG1 . ILE C  3  227 ? 43.409  -84.150  -10.871 1.00 99.48  ? 229  ILE C CG1 1 
ATOM   5444  C  CG2 . ILE C  3  227 ? 43.507  -81.656  -10.994 1.00 99.46  ? 229  ILE C CG2 1 
ATOM   5445  C  CD1 . ILE C  3  227 ? 44.019  -84.451  -9.514  1.00 98.91  ? 229  ILE C CD1 1 
ATOM   5446  N  N   . ASN C  3  228 ? 45.464  -81.530  -13.964 1.00 100.90 ? 230  ASN C N   1 
ATOM   5447  C  CA  . ASN C  3  228 ? 46.046  -80.306  -14.506 1.00 101.59 ? 230  ASN C CA  1 
ATOM   5448  C  C   . ASN C  3  228 ? 45.508  -79.932  -15.891 1.00 101.91 ? 230  ASN C C   1 
ATOM   5449  O  O   . ASN C  3  228 ? 45.318  -78.750  -16.187 1.00 101.91 ? 230  ASN C O   1 
ATOM   5450  C  CB  . ASN C  3  228 ? 47.578  -80.421  -14.532 1.00 101.66 ? 230  ASN C CB  1 
ATOM   5451  C  CG  . ASN C  3  228 ? 48.277  -79.095  -14.261 1.00 101.77 ? 230  ASN C CG  1 
ATOM   5452  O  OD1 . ASN C  3  228 ? 47.662  -78.130  -13.796 1.00 102.19 ? 230  ASN C OD1 1 
ATOM   5453  N  ND2 . ASN C  3  228 ? 49.575  -79.048  -14.542 1.00 101.74 ? 230  ASN C ND2 1 
ATOM   5454  N  N   . GLN C  3  229 ? 45.258  -80.943  -16.724 1.00 102.41 ? 231  GLN C N   1 
ATOM   5455  C  CA  . GLN C  3  229 ? 44.696  -80.735  -18.062 1.00 103.01 ? 231  GLN C CA  1 
ATOM   5456  C  C   . GLN C  3  229 ? 43.244  -80.265  -18.014 1.00 103.36 ? 231  GLN C C   1 
ATOM   5457  O  O   . GLN C  3  229 ? 42.759  -79.627  -18.956 1.00 103.37 ? 231  GLN C O   1 
ATOM   5458  C  CB  . GLN C  3  229 ? 44.798  -82.011  -18.899 1.00 103.05 ? 231  GLN C CB  1 
ATOM   5459  C  CG  . GLN C  3  229 ? 46.188  -82.303  -19.433 1.00 103.12 ? 231  GLN C CG  1 
ATOM   5460  C  CD  . GLN C  3  229 ? 46.319  -83.729  -19.917 1.00 103.34 ? 231  GLN C CD  1 
ATOM   5461  O  OE1 . GLN C  3  229 ? 45.668  -84.128  -20.890 1.00 103.28 ? 231  GLN C OE1 1 
ATOM   5462  N  NE2 . GLN C  3  229 ? 47.160  -84.510  -19.236 1.00 103.40 ? 231  GLN C NE2 1 
ATOM   5463  N  N   . TYR C  3  230 ? 42.559  -80.588  -16.918 1.00 103.82 ? 232  TYR C N   1 
ATOM   5464  C  CA  . TYR C  3  230 ? 41.178  -80.159  -16.717 1.00 104.26 ? 232  TYR C CA  1 
ATOM   5465  C  C   . TYR C  3  230 ? 41.100  -78.688  -16.325 1.00 104.75 ? 232  TYR C C   1 
ATOM   5466  O  O   . TYR C  3  230 ? 40.207  -77.966  -16.785 1.00 104.80 ? 232  TYR C O   1 
ATOM   5467  C  CB  . TYR C  3  230 ? 40.473  -81.040  -15.681 1.00 104.09 ? 232  TYR C CB  1 
ATOM   5468  C  CG  . TYR C  3  230 ? 39.880  -82.303  -16.264 1.00 103.54 ? 232  TYR C CG  1 
ATOM   5469  C  CD1 . TYR C  3  230 ? 40.631  -83.475  -16.346 1.00 103.08 ? 232  TYR C CD1 1 
ATOM   5470  C  CD2 . TYR C  3  230 ? 38.569  -82.325  -16.738 1.00 102.96 ? 232  TYR C CD2 1 
ATOM   5471  C  CE1 . TYR C  3  230 ? 40.094  -84.636  -16.884 1.00 102.81 ? 232  TYR C CE1 1 
ATOM   5472  C  CE2 . TYR C  3  230 ? 38.023  -83.481  -17.279 1.00 102.74 ? 232  TYR C CE2 1 
ATOM   5473  C  CZ  . TYR C  3  230 ? 38.791  -84.632  -17.346 1.00 102.77 ? 232  TYR C CZ  1 
ATOM   5474  O  OH  . TYR C  3  230 ? 38.254  -85.779  -17.878 1.00 103.00 ? 232  TYR C OH  1 
ATOM   5475  N  N   . VAL C  3  231 ? 42.044  -78.255  -15.488 1.00 105.33 ? 233  VAL C N   1 
ATOM   5476  C  CA  . VAL C  3  231 ? 42.153  -76.853  -15.068 1.00 105.90 ? 233  VAL C CA  1 
ATOM   5477  C  C   . VAL C  3  231 ? 42.432  -75.936  -16.272 1.00 106.34 ? 233  VAL C C   1 
ATOM   5478  O  O   . VAL C  3  231 ? 41.730  -74.939  -16.475 1.00 106.35 ? 233  VAL C O   1 
ATOM   5479  C  CB  . VAL C  3  231 ? 43.247  -76.664  -13.975 1.00 105.89 ? 233  VAL C CB  1 
ATOM   5480  C  CG1 . VAL C  3  231 ? 43.216  -75.247  -13.410 1.00 105.87 ? 233  VAL C CG1 1 
ATOM   5481  C  CG2 . VAL C  3  231 ? 43.082  -77.683  -12.852 1.00 105.75 ? 233  VAL C CG2 1 
ATOM   5482  N  N   . THR C  3  232 ? 43.444  -76.301  -17.066 1.00 106.86 ? 234  THR C N   1 
ATOM   5483  C  CA  . THR C  3  232 ? 43.859  -75.547  -18.256 1.00 107.42 ? 234  THR C CA  1 
ATOM   5484  C  C   . THR C  3  232 ? 42.688  -75.250  -19.188 1.00 107.87 ? 234  THR C C   1 
ATOM   5485  O  O   . THR C  3  232 ? 42.486  -74.099  -19.585 1.00 107.95 ? 234  THR C O   1 
ATOM   5486  C  CB  . THR C  3  232 ? 44.942  -76.303  -19.063 1.00 107.40 ? 234  THR C CB  1 
ATOM   5487  O  OG1 . THR C  3  232 ? 45.890  -76.892  -18.167 1.00 107.51 ? 234  THR C OG1 1 
ATOM   5488  C  CG2 . THR C  3  232 ? 45.669  -75.359  -20.017 1.00 107.39 ? 234  THR C CG2 1 
ATOM   5489  N  N   . GLN C  3  233 ? 41.926  -76.293  -19.522 1.00 108.40 ? 235  GLN C N   1 
ATOM   5490  C  CA  . GLN C  3  233 ? 40.792  -76.191  -20.441 1.00 108.94 ? 235  GLN C CA  1 
ATOM   5491  C  C   . GLN C  3  233 ? 39.704  -75.252  -19.915 1.00 109.51 ? 235  GLN C C   1 
ATOM   5492  O  O   . GLN C  3  233 ? 39.098  -74.499  -20.688 1.00 109.56 ? 235  GLN C O   1 
ATOM   5493  C  CB  . GLN C  3  233 ? 40.212  -77.579  -20.727 1.00 108.75 ? 235  GLN C CB  1 
ATOM   5494  C  CG  . GLN C  3  233 ? 39.295  -77.637  -21.943 1.00 108.32 ? 235  GLN C CG  1 
ATOM   5495  C  CD  . GLN C  3  233 ? 38.876  -79.048  -22.291 1.00 107.97 ? 235  GLN C CD  1 
ATOM   5496  O  OE1 . GLN C  3  233 ? 37.707  -79.306  -22.565 1.00 107.73 ? 235  GLN C OE1 1 
ATOM   5497  N  NE2 . GLN C  3  233 ? 39.828  -79.973  -22.279 1.00 107.86 ? 235  GLN C NE2 1 
ATOM   5498  N  N   . ILE C  3  234 ? 39.470  -75.300  -18.603 1.00 110.16 ? 236  ILE C N   1 
ATOM   5499  C  CA  . ILE C  3  234 ? 38.455  -74.467  -17.956 1.00 110.77 ? 236  ILE C CA  1 
ATOM   5500  C  C   . ILE C  3  234 ? 38.781  -72.985  -18.108 1.00 111.32 ? 236  ILE C C   1 
ATOM   5501  O  O   . ILE C  3  234 ? 37.943  -72.209  -18.571 1.00 111.37 ? 236  ILE C O   1 
ATOM   5502  C  CB  . ILE C  3  234 ? 38.257  -74.848  -16.465 1.00 110.71 ? 236  ILE C CB  1 
ATOM   5503  C  CG1 . ILE C  3  234 ? 37.604  -76.231  -16.360 1.00 110.57 ? 236  ILE C CG1 1 
ATOM   5504  C  CG2 . ILE C  3  234 ? 37.402  -73.805  -15.743 1.00 110.54 ? 236  ILE C CG2 1 
ATOM   5505  C  CD1 . ILE C  3  234 ? 37.693  -76.870  -14.992 1.00 110.21 ? 236  ILE C CD1 1 
ATOM   5506  N  N   . GLU C  3  235 ? 40.006  -72.609  -17.742 1.00 112.06 ? 237  GLU C N   1 
ATOM   5507  C  CA  . GLU C  3  235 ? 40.459  -71.217  -17.831 1.00 112.82 ? 237  GLU C CA  1 
ATOM   5508  C  C   . GLU C  3  235 ? 40.736  -70.746  -19.265 1.00 113.19 ? 237  GLU C C   1 
ATOM   5509  O  O   . GLU C  3  235 ? 40.817  -69.543  -19.521 1.00 113.18 ? 237  GLU C O   1 
ATOM   5510  C  CB  . GLU C  3  235 ? 41.666  -70.981  -16.916 1.00 112.84 ? 237  GLU C CB  1 
ATOM   5511  C  CG  . GLU C  3  235 ? 41.282  -70.917  -15.438 1.00 113.41 ? 237  GLU C CG  1 
ATOM   5512  C  CD  . GLU C  3  235 ? 42.466  -70.688  -14.514 1.00 113.83 ? 237  GLU C CD  1 
ATOM   5513  O  OE1 . GLU C  3  235 ? 43.422  -71.494  -14.545 1.00 114.04 ? 237  GLU C OE1 1 
ATOM   5514  O  OE2 . GLU C  3  235 ? 42.429  -69.709  -13.742 1.00 113.86 ? 237  GLU C OE2 1 
ATOM   5515  N  N   . GLN C  3  236 ? 40.875  -71.699  -20.186 1.00 113.77 ? 238  GLN C N   1 
ATOM   5516  C  CA  . GLN C  3  236 ? 40.942  -71.401  -21.615 1.00 114.39 ? 238  GLN C CA  1 
ATOM   5517  C  C   . GLN C  3  236 ? 39.586  -70.943  -22.143 1.00 114.72 ? 238  GLN C C   1 
ATOM   5518  O  O   . GLN C  3  236 ? 39.517  -70.051  -22.990 1.00 114.91 ? 238  GLN C O   1 
ATOM   5519  C  CB  . GLN C  3  236 ? 41.414  -72.622  -22.406 1.00 114.43 ? 238  GLN C CB  1 
ATOM   5520  C  CG  . GLN C  3  236 ? 42.928  -72.749  -22.518 1.00 114.95 ? 238  GLN C CG  1 
ATOM   5521  C  CD  . GLN C  3  236 ? 43.355  -73.892  -23.430 1.00 115.51 ? 238  GLN C CD  1 
ATOM   5522  O  OE1 . GLN C  3  236 ? 42.602  -74.322  -24.307 1.00 115.73 ? 238  GLN C OE1 1 
ATOM   5523  N  NE2 . GLN C  3  236 ? 44.572  -74.386  -23.227 1.00 115.43 ? 238  GLN C NE2 1 
ATOM   5524  N  N   . GLU C  3  237 ? 38.517  -71.560  -21.642 1.00 115.09 ? 239  GLU C N   1 
ATOM   5525  C  CA  . GLU C  3  237 ? 37.150  -71.184  -22.013 1.00 115.48 ? 239  GLU C CA  1 
ATOM   5526  C  C   . GLU C  3  237 ? 36.677  -69.947  -21.245 1.00 115.76 ? 239  GLU C C   1 
ATOM   5527  O  O   . GLU C  3  237 ? 35.688  -69.311  -21.621 1.00 115.74 ? 239  GLU C O   1 
ATOM   5528  C  CB  . GLU C  3  237 ? 36.190  -72.357  -21.792 1.00 115.45 ? 239  GLU C CB  1 
ATOM   5529  C  CG  . GLU C  3  237 ? 36.473  -73.570  -22.684 1.00 115.52 ? 239  GLU C CG  1 
ATOM   5530  C  CD  . GLU C  3  237 ? 35.676  -74.808  -22.290 1.00 115.42 ? 239  GLU C CD  1 
ATOM   5531  O  OE1 . GLU C  3  237 ? 34.500  -74.669  -21.887 1.00 115.27 ? 239  GLU C OE1 1 
ATOM   5532  O  OE2 . GLU C  3  237 ? 36.229  -75.926  -22.393 1.00 115.04 ? 239  GLU C OE2 1 
ATOM   5533  N  N   . LYS C  3  238 ? 37.402  -69.618  -20.175 1.00 116.19 ? 240  LYS C N   1 
ATOM   5534  C  CA  . LYS C  3  238 ? 37.131  -68.438  -19.348 1.00 116.65 ? 240  LYS C CA  1 
ATOM   5535  C  C   . LYS C  3  238 ? 37.593  -67.153  -20.044 1.00 117.00 ? 240  LYS C C   1 
ATOM   5536  O  O   . LYS C  3  238 ? 37.069  -66.064  -19.777 1.00 117.11 ? 240  LYS C O   1 
ATOM   5537  C  CB  . LYS C  3  238 ? 37.839  -68.573  -17.997 1.00 116.60 ? 240  LYS C CB  1 
ATOM   5538  C  CG  . LYS C  3  238 ? 36.994  -68.198  -16.793 1.00 116.60 ? 240  LYS C CG  1 
ATOM   5539  C  CD  . LYS C  3  238 ? 37.715  -68.572  -15.501 1.00 116.78 ? 240  LYS C CD  1 
ATOM   5540  C  CE  . LYS C  3  238 ? 36.744  -69.068  -14.432 1.00 116.72 ? 240  LYS C CE  1 
ATOM   5541  N  NZ  . LYS C  3  238 ? 35.842  -67.997  -13.922 1.00 116.59 ? 240  LYS C NZ  1 
ATOM   5542  N  N   . GLN C  3  239 ? 38.581  -67.290  -20.930 1.00 117.28 ? 241  GLN C N   1 
ATOM   5543  C  CA  . GLN C  3  239 ? 39.122  -66.155  -21.676 1.00 117.40 ? 241  GLN C CA  1 
ATOM   5544  C  C   . GLN C  3  239 ? 38.747  -66.127  -23.160 1.00 117.57 ? 241  GLN C C   1 
ATOM   5545  O  O   . GLN C  3  239 ? 39.151  -65.218  -23.882 1.00 117.66 ? 241  GLN C O   1 
ATOM   5546  C  CB  . GLN C  3  239 ? 40.634  -66.038  -21.472 1.00 117.36 ? 241  GLN C CB  1 
ATOM   5547  C  CG  . GLN C  3  239 ? 40.994  -65.207  -20.251 1.00 117.25 ? 241  GLN C CG  1 
ATOM   5548  C  CD  . GLN C  3  239 ? 42.434  -65.375  -19.815 1.00 117.24 ? 241  GLN C CD  1 
ATOM   5549  O  OE1 . GLN C  3  239 ? 43.267  -65.914  -20.548 1.00 117.29 ? 241  GLN C OE1 1 
ATOM   5550  N  NE2 . GLN C  3  239 ? 42.737  -64.908  -18.610 1.00 116.93 ? 241  GLN C NE2 1 
ATOM   5551  N  N   . GLU C  3  240 ? 37.972  -67.115  -23.608 1.00 117.81 ? 242  GLU C N   1 
ATOM   5552  C  CA  . GLU C  3  240 ? 37.267  -67.017  -24.891 1.00 118.06 ? 242  GLU C CA  1 
ATOM   5553  C  C   . GLU C  3  240 ? 36.083  -66.060  -24.739 1.00 118.16 ? 242  GLU C C   1 
ATOM   5554  O  O   . GLU C  3  240 ? 35.424  -65.698  -25.721 1.00 118.23 ? 242  GLU C O   1 
ATOM   5555  C  CB  . GLU C  3  240 ? 36.775  -68.388  -25.366 1.00 118.12 ? 242  GLU C CB  1 
ATOM   5556  C  CG  . GLU C  3  240 ? 37.791  -69.193  -26.175 1.00 118.28 ? 242  GLU C CG  1 
ATOM   5557  C  CD  . GLU C  3  240 ? 37.244  -70.541  -26.651 1.00 118.54 ? 242  GLU C CD  1 
ATOM   5558  O  OE1 . GLU C  3  240 ? 37.778  -71.078  -27.647 1.00 118.50 ? 242  GLU C OE1 1 
ATOM   5559  O  OE2 . GLU C  3  240 ? 36.286  -71.069  -26.035 1.00 118.58 ? 242  GLU C OE2 1 
ATOM   5560  N  N   . GLN C  3  241 ? 35.832  -65.655  -23.493 1.00 118.19 ? 243  GLN C N   1 
ATOM   5561  C  CA  . GLN C  3  241 ? 34.740  -64.757  -23.156 1.00 118.18 ? 243  GLN C CA  1 
ATOM   5562  C  C   . GLN C  3  241 ? 35.227  -63.614  -22.253 1.00 118.09 ? 243  GLN C C   1 
ATOM   5563  O  O   . GLN C  3  241 ? 35.357  -63.741  -21.032 1.00 117.93 ? 243  GLN C O   1 
ATOM   5564  C  CB  . GLN C  3  241 ? 33.617  -65.546  -22.483 1.00 118.24 ? 243  GLN C CB  1 
ATOM   5565  C  CG  . GLN C  3  241 ? 32.254  -64.895  -22.586 1.00 118.53 ? 243  GLN C CG  1 
ATOM   5566  C  CD  . GLN C  3  241 ? 31.276  -65.446  -21.574 1.00 118.92 ? 243  GLN C CD  1 
ATOM   5567  O  OE1 . GLN C  3  241 ? 30.274  -66.066  -21.938 1.00 119.13 ? 243  GLN C OE1 1 
ATOM   5568  N  NE2 . GLN C  3  241 ? 31.564  -65.229  -20.291 1.00 119.10 ? 243  GLN C NE2 1 
ATOM   5569  O  OXT . GLN C  3  241 ? 35.514  -62.518  -22.737 1.00 118.06 ? 243  GLN C OXT 1 
ATOM   5570  N  N   . VAL D  4  12  ? 20.834  -83.469  34.129  1.00 60.52  ? 12   VAL D N   1 
ATOM   5571  C  CA  . VAL D  4  12  ? 20.208  -84.648  33.445  1.00 60.51  ? 12   VAL D CA  1 
ATOM   5572  C  C   . VAL D  4  12  ? 19.010  -85.181  34.234  1.00 60.17  ? 12   VAL D C   1 
ATOM   5573  O  O   . VAL D  4  12  ? 17.919  -85.355  33.685  1.00 60.13  ? 12   VAL D O   1 
ATOM   5574  C  CB  . VAL D  4  12  ? 21.238  -85.797  33.206  1.00 60.84  ? 12   VAL D CB  1 
ATOM   5575  N  N   . SER D  4  13  ? 19.223  -85.431  35.525  1.00 59.57  ? 13   SER D N   1 
ATOM   5576  C  CA  . SER D  4  13  ? 18.172  -85.928  36.402  1.00 58.97  ? 13   SER D CA  1 
ATOM   5577  C  C   . SER D  4  13  ? 17.884  -84.951  37.555  1.00 58.24  ? 13   SER D C   1 
ATOM   5578  O  O   . SER D  4  13  ? 17.610  -85.350  38.682  1.00 58.25  ? 13   SER D O   1 
ATOM   5579  C  CB  . SER D  4  13  ? 18.543  -87.322  36.920  1.00 59.35  ? 13   SER D CB  1 
ATOM   5580  O  OG  . SER D  4  13  ? 19.807  -87.304  37.574  1.00 60.05  ? 13   SER D OG  1 
ATOM   5581  N  N   . THR D  4  14  ? 17.925  -83.662  37.251  1.00 57.47  ? 14   THR D N   1 
ATOM   5582  C  CA  . THR D  4  14  ? 17.678  -82.621  38.234  1.00 56.65  ? 14   THR D CA  1 
ATOM   5583  C  C   . THR D  4  14  ? 16.255  -82.084  38.074  1.00 56.17  ? 14   THR D C   1 
ATOM   5584  O  O   . THR D  4  14  ? 15.817  -81.795  36.961  1.00 55.92  ? 14   THR D O   1 
ATOM   5585  C  CB  . THR D  4  14  ? 18.699  -81.491  38.050  1.00 56.66  ? 14   THR D CB  1 
ATOM   5586  O  OG1 . THR D  4  14  ? 19.997  -82.065  37.871  1.00 56.55  ? 14   THR D OG1 1 
ATOM   5587  C  CG2 . THR D  4  14  ? 18.733  -80.571  39.246  1.00 57.04  ? 14   THR D CG2 1 
ATOM   5588  N  N   . PHE D  4  15  ? 15.529  -81.985  39.182  1.00 55.83  ? 15   PHE D N   1 
ATOM   5589  C  CA  . PHE D  4  15  ? 14.227  -81.320  39.206  1.00 55.68  ? 15   PHE D CA  1 
ATOM   5590  C  C   . PHE D  4  15  ? 14.416  -79.812  39.327  1.00 55.78  ? 15   PHE D C   1 
ATOM   5591  O  O   . PHE D  4  15  ? 15.321  -79.348  40.017  1.00 55.52  ? 15   PHE D O   1 
ATOM   5592  C  CB  . PHE D  4  15  ? 13.394  -81.782  40.406  1.00 55.50  ? 15   PHE D CB  1 
ATOM   5593  C  CG  . PHE D  4  15  ? 12.621  -83.049  40.179  1.00 55.08  ? 15   PHE D CG  1 
ATOM   5594  C  CD1 . PHE D  4  15  ? 11.509  -83.063  39.340  1.00 54.43  ? 15   PHE D CD1 1 
ATOM   5595  C  CD2 . PHE D  4  15  ? 12.978  -84.222  40.840  1.00 54.39  ? 15   PHE D CD2 1 
ATOM   5596  C  CE1 . PHE D  4  15  ? 10.783  -84.230  39.140  1.00 54.43  ? 15   PHE D CE1 1 
ATOM   5597  C  CE2 . PHE D  4  15  ? 12.261  -85.395  40.647  1.00 53.88  ? 15   PHE D CE2 1 
ATOM   5598  C  CZ  . PHE D  4  15  ? 11.160  -85.401  39.795  1.00 54.42  ? 15   PHE D CZ  1 
ATOM   5599  N  N   . SER D  4  16  ? 13.550  -79.053  38.663  1.00 56.19  ? 16   SER D N   1 
ATOM   5600  C  CA  . SER D  4  16  ? 13.457  -77.607  38.879  1.00 56.49  ? 16   SER D CA  1 
ATOM   5601  C  C   . SER D  4  16  ? 12.624  -77.366  40.132  1.00 56.80  ? 16   SER D C   1 
ATOM   5602  O  O   . SER D  4  16  ? 11.943  -78.279  40.602  1.00 56.85  ? 16   SER D O   1 
ATOM   5603  C  CB  . SER D  4  16  ? 12.788  -76.934  37.686  1.00 56.40  ? 16   SER D CB  1 
ATOM   5604  O  OG  . SER D  4  16  ? 11.409  -77.253  37.646  1.00 56.24  ? 16   SER D OG  1 
ATOM   5605  N  N   . PRO D  4  17  ? 12.664  -76.141  40.682  1.00 57.16  ? 17   PRO D N   1 
ATOM   5606  C  CA  . PRO D  4  17  ? 11.816  -75.862  41.850  1.00 57.44  ? 17   PRO D CA  1 
ATOM   5607  C  C   . PRO D  4  17  ? 10.316  -76.037  41.573  1.00 57.83  ? 17   PRO D C   1 
ATOM   5608  O  O   . PRO D  4  17  ? 9.535   -76.194  42.508  1.00 57.66  ? 17   PRO D O   1 
ATOM   5609  C  CB  . PRO D  4  17  ? 12.140  -74.404  42.180  1.00 57.41  ? 17   PRO D CB  1 
ATOM   5610  C  CG  . PRO D  4  17  ? 13.534  -74.196  41.628  1.00 57.44  ? 17   PRO D CG  1 
ATOM   5611  C  CD  . PRO D  4  17  ? 13.577  -75.022  40.374  1.00 57.14  ? 17   PRO D CD  1 
ATOM   5612  N  N   . GLU D  4  18  ? 9.931   -76.017  40.298  1.00 58.52  ? 18   GLU D N   1 
ATOM   5613  C  CA  . GLU D  4  18  ? 8.545   -76.232  39.890  1.00 59.27  ? 18   GLU D CA  1 
ATOM   5614  C  C   . GLU D  4  18  ? 8.180   -77.710  39.969  1.00 59.42  ? 18   GLU D C   1 
ATOM   5615  O  O   . GLU D  4  18  ? 7.022   -78.063  40.196  1.00 59.65  ? 18   GLU D O   1 
ATOM   5616  C  CB  . GLU D  4  18  ? 8.301   -75.709  38.466  1.00 59.55  ? 18   GLU D CB  1 
ATOM   5617  C  CG  . GLU D  4  18  ? 8.052   -74.198  38.350  1.00 60.88  ? 18   GLU D CG  1 
ATOM   5618  C  CD  . GLU D  4  18  ? 9.299   -73.357  38.630  1.00 64.12  ? 18   GLU D CD  1 
ATOM   5619  O  OE1 . GLU D  4  18  ? 9.202   -72.417  39.453  1.00 65.28  ? 18   GLU D OE1 1 
ATOM   5620  O  OE2 . GLU D  4  18  ? 10.379  -73.632  38.044  1.00 64.96  ? 18   GLU D OE2 1 
ATOM   5621  N  N   . GLY D  4  19  ? 9.176   -78.571  39.788  1.00 59.63  ? 19   GLY D N   1 
ATOM   5622  C  CA  . GLY D  4  19  ? 8.958   -80.010  39.810  1.00 59.69  ? 19   GLY D CA  1 
ATOM   5623  C  C   . GLY D  4  19  ? 8.947   -80.624  38.424  1.00 59.88  ? 19   GLY D C   1 
ATOM   5624  O  O   . GLY D  4  19  ? 8.307   -81.656  38.203  1.00 59.91  ? 19   GLY D O   1 
ATOM   5625  N  N   . ARG D  4  20  ? 9.649   -79.988  37.489  1.00 59.96  ? 20   ARG D N   1 
ATOM   5626  C  CA  . ARG D  4  20  ? 9.803   -80.533  36.147  1.00 60.31  ? 20   ARG D CA  1 
ATOM   5627  C  C   . ARG D  4  20  ? 11.253  -80.935  35.928  1.00 59.80  ? 20   ARG D C   1 
ATOM   5628  O  O   . ARG D  4  20  ? 12.173  -80.345  36.504  1.00 59.65  ? 20   ARG D O   1 
ATOM   5629  C  CB  . ARG D  4  20  ? 9.365   -79.538  35.069  1.00 60.76  ? 20   ARG D CB  1 
ATOM   5630  C  CG  . ARG D  4  20  ? 8.177   -78.651  35.438  1.00 63.33  ? 20   ARG D CG  1 
ATOM   5631  C  CD  . ARG D  4  20  ? 7.553   -78.043  34.195  1.00 67.41  ? 20   ARG D CD  1 
ATOM   5632  N  NE  . ARG D  4  20  ? 6.593   -78.964  33.583  1.00 70.97  ? 20   ARG D NE  1 
ATOM   5633  C  CZ  . ARG D  4  20  ? 5.298   -78.697  33.389  1.00 73.35  ? 20   ARG D CZ  1 
ATOM   5634  N  NH1 . ARG D  4  20  ? 4.792   -77.513  33.741  1.00 73.78  ? 20   ARG D NH1 1 
ATOM   5635  N  NH2 . ARG D  4  20  ? 4.507   -79.613  32.827  1.00 73.44  ? 20   ARG D NH2 1 
ATOM   5636  N  N   . LEU D  4  21  ? 11.444  -81.953  35.098  1.00 59.26  ? 21   LEU D N   1 
ATOM   5637  C  CA  . LEU D  4  21  ? 12.770  -82.425  34.766  1.00 58.79  ? 21   LEU D CA  1 
ATOM   5638  C  C   . LEU D  4  21  ? 13.325  -81.588  33.630  1.00 58.48  ? 21   LEU D C   1 
ATOM   5639  O  O   . LEU D  4  21  ? 12.817  -81.624  32.510  1.00 58.38  ? 21   LEU D O   1 
ATOM   5640  C  CB  . LEU D  4  21  ? 12.740  -83.908  34.392  1.00 58.77  ? 21   LEU D CB  1 
ATOM   5641  C  CG  . LEU D  4  21  ? 12.447  -84.880  35.534  1.00 59.10  ? 21   LEU D CG  1 
ATOM   5642  C  CD1 . LEU D  4  21  ? 12.009  -86.244  34.993  1.00 59.29  ? 21   LEU D CD1 1 
ATOM   5643  C  CD2 . LEU D  4  21  ? 13.655  -85.017  36.451  1.00 58.31  ? 21   LEU D CD2 1 
ATOM   5644  N  N   . PHE D  4  22  ? 14.373  -80.834  33.940  1.00 58.24  ? 22   PHE D N   1 
ATOM   5645  C  CA  . PHE D  4  22  ? 14.999  -79.903  33.004  1.00 58.10  ? 22   PHE D CA  1 
ATOM   5646  C  C   . PHE D  4  22  ? 15.181  -80.457  31.591  1.00 57.31  ? 22   PHE D C   1 
ATOM   5647  O  O   . PHE D  4  22  ? 14.598  -79.940  30.630  1.00 57.07  ? 22   PHE D O   1 
ATOM   5648  C  CB  . PHE D  4  22  ? 16.362  -79.447  33.545  1.00 58.62  ? 22   PHE D CB  1 
ATOM   5649  C  CG  . PHE D  4  22  ? 16.292  -78.284  34.503  1.00 60.21  ? 22   PHE D CG  1 
ATOM   5650  C  CD1 . PHE D  4  22  ? 16.875  -78.379  35.769  1.00 60.81  ? 22   PHE D CD1 1 
ATOM   5651  C  CD2 . PHE D  4  22  ? 15.661  -77.088  34.133  1.00 61.68  ? 22   PHE D CD2 1 
ATOM   5652  C  CE1 . PHE D  4  22  ? 16.839  -77.310  36.660  1.00 61.91  ? 22   PHE D CE1 1 
ATOM   5653  C  CE2 . PHE D  4  22  ? 15.608  -76.010  35.021  1.00 62.84  ? 22   PHE D CE2 1 
ATOM   5654  C  CZ  . PHE D  4  22  ? 16.204  -76.122  36.291  1.00 62.90  ? 22   PHE D CZ  1 
ATOM   5655  N  N   . GLN D  4  23  ? 15.992  -81.510  31.485  1.00 56.41  ? 23   GLN D N   1 
ATOM   5656  C  CA  . GLN D  4  23  ? 16.375  -82.090  30.204  1.00 55.42  ? 23   GLN D CA  1 
ATOM   5657  C  C   . GLN D  4  23  ? 15.193  -82.612  29.382  1.00 54.85  ? 23   GLN D C   1 
ATOM   5658  O  O   . GLN D  4  23  ? 15.209  -82.517  28.153  1.00 54.68  ? 23   GLN D O   1 
ATOM   5659  C  CB  . GLN D  4  23  ? 17.433  -83.170  30.414  1.00 55.45  ? 23   GLN D CB  1 
ATOM   5660  C  CG  . GLN D  4  23  ? 18.777  -82.606  30.816  1.00 55.40  ? 23   GLN D CG  1 
ATOM   5661  C  CD  . GLN D  4  23  ? 19.449  -81.839  29.688  1.00 55.46  ? 23   GLN D CD  1 
ATOM   5662  O  OE1 . GLN D  4  23  ? 19.745  -80.646  29.815  1.00 54.65  ? 23   GLN D OE1 1 
ATOM   5663  N  NE2 . GLN D  4  23  ? 19.683  -82.522  28.569  1.00 54.95  ? 23   GLN D NE2 1 
ATOM   5664  N  N   . VAL D  4  24  ? 14.174  -83.141  30.060  1.00 53.99  ? 24   VAL D N   1 
ATOM   5665  C  CA  . VAL D  4  24  ? 12.940  -83.568  29.402  1.00 53.55  ? 24   VAL D CA  1 
ATOM   5666  C  C   . VAL D  4  24  ? 12.259  -82.386  28.691  1.00 53.42  ? 24   VAL D C   1 
ATOM   5667  O  O   . VAL D  4  24  ? 11.860  -82.506  27.530  1.00 53.35  ? 24   VAL D O   1 
ATOM   5668  C  CB  . VAL D  4  24  ? 11.969  -84.255  30.409  1.00 53.65  ? 24   VAL D CB  1 
ATOM   5669  C  CG1 . VAL D  4  24  ? 10.591  -84.509  29.791  1.00 53.46  ? 24   VAL D CG1 1 
ATOM   5670  C  CG2 . VAL D  4  24  ? 12.563  -85.548  30.927  1.00 53.12  ? 24   VAL D CG2 1 
ATOM   5671  N  N   . GLU D  4  25  ? 12.152  -81.253  29.391  1.00 53.22  ? 25   GLU D N   1 
ATOM   5672  C  CA  . GLU D  4  25  ? 11.468  -80.059  28.888  1.00 53.17  ? 25   GLU D CA  1 
ATOM   5673  C  C   . GLU D  4  25  ? 12.167  -79.490  27.669  1.00 52.71  ? 25   GLU D C   1 
ATOM   5674  O  O   . GLU D  4  25  ? 11.527  -79.111  26.693  1.00 52.52  ? 25   GLU D O   1 
ATOM   5675  C  CB  . GLU D  4  25  ? 11.386  -78.985  29.969  1.00 53.38  ? 25   GLU D CB  1 
ATOM   5676  C  CG  . GLU D  4  25  ? 10.652  -79.401  31.232  1.00 56.18  ? 25   GLU D CG  1 
ATOM   5677  C  CD  . GLU D  4  25  ? 9.143   -79.511  31.039  1.00 60.70  ? 25   GLU D CD  1 
ATOM   5678  O  OE1 . GLU D  4  25  ? 8.621   -80.661  31.008  1.00 61.68  ? 25   GLU D OE1 1 
ATOM   5679  O  OE2 . GLU D  4  25  ? 8.483   -78.442  30.917  1.00 62.59  ? 25   GLU D OE2 1 
ATOM   5680  N  N   . TYR D  4  26  ? 13.490  -79.430  27.731  1.00 52.58  ? 26   TYR D N   1 
ATOM   5681  C  CA  . TYR D  4  26  ? 14.279  -78.913  26.622  1.00 52.63  ? 26   TYR D CA  1 
ATOM   5682  C  C   . TYR D  4  26  ? 14.197  -79.848  25.425  1.00 52.06  ? 26   TYR D C   1 
ATOM   5683  O  O   . TYR D  4  26  ? 14.184  -79.409  24.286  1.00 51.99  ? 26   TYR D O   1 
ATOM   5684  C  CB  . TYR D  4  26  ? 15.743  -78.724  27.021  1.00 53.05  ? 26   TYR D CB  1 
ATOM   5685  C  CG  . TYR D  4  26  ? 16.026  -77.784  28.184  1.00 54.71  ? 26   TYR D CG  1 
ATOM   5686  C  CD1 . TYR D  4  26  ? 15.172  -76.721  28.501  1.00 56.24  ? 26   TYR D CD1 1 
ATOM   5687  C  CD2 . TYR D  4  26  ? 17.189  -77.947  28.948  1.00 56.24  ? 26   TYR D CD2 1 
ATOM   5688  C  CE1 . TYR D  4  26  ? 15.458  -75.863  29.571  1.00 58.26  ? 26   TYR D CE1 1 
ATOM   5689  C  CE2 . TYR D  4  26  ? 17.489  -77.104  30.006  1.00 57.68  ? 26   TYR D CE2 1 
ATOM   5690  C  CZ  . TYR D  4  26  ? 16.626  -76.064  30.317  1.00 59.44  ? 26   TYR D CZ  1 
ATOM   5691  O  OH  . TYR D  4  26  ? 16.950  -75.231  31.375  1.00 61.48  ? 26   TYR D OH  1 
ATOM   5692  N  N   . SER D  4  27  ? 14.159  -81.144  25.697  1.00 51.67  ? 27   SER D N   1 
ATOM   5693  C  CA  . SER D  4  27  ? 13.941  -82.140  24.667  1.00 51.23  ? 27   SER D CA  1 
ATOM   5694  C  C   . SER D  4  27  ? 12.645  -81.854  23.891  1.00 50.81  ? 27   SER D C   1 
ATOM   5695  O  O   . SER D  4  27  ? 12.619  -81.939  22.667  1.00 50.61  ? 27   SER D O   1 
ATOM   5696  C  CB  . SER D  4  27  ? 13.933  -83.527  25.306  1.00 50.97  ? 27   SER D CB  1 
ATOM   5697  O  OG  . SER D  4  27  ? 12.957  -84.361  24.732  1.00 51.60  ? 27   SER D OG  1 
ATOM   5698  N  N   . LEU D  4  28  ? 11.586  -81.497  24.614  1.00 50.52  ? 28   LEU D N   1 
ATOM   5699  C  CA  . LEU D  4  28  ? 10.315  -81.108  23.998  1.00 50.42  ? 28   LEU D CA  1 
ATOM   5700  C  C   . LEU D  4  28  ? 10.457  -79.879  23.088  1.00 50.43  ? 28   LEU D C   1 
ATOM   5701  O  O   . LEU D  4  28  ? 9.756   -79.769  22.086  1.00 50.08  ? 28   LEU D O   1 
ATOM   5702  C  CB  . LEU D  4  28  ? 9.247   -80.869  25.074  1.00 50.17  ? 28   LEU D CB  1 
ATOM   5703  C  CG  . LEU D  4  28  ? 8.275   -81.971  25.537  1.00 49.97  ? 28   LEU D CG  1 
ATOM   5704  C  CD1 . LEU D  4  28  ? 8.691   -83.385  25.169  1.00 49.51  ? 28   LEU D CD1 1 
ATOM   5705  C  CD2 . LEU D  4  28  ? 7.987   -81.871  27.049  1.00 49.60  ? 28   LEU D CD2 1 
ATOM   5706  N  N   . GLU D  4  29  ? 11.367  -78.969  23.440  1.00 50.76  ? 29   GLU D N   1 
ATOM   5707  C  CA  . GLU D  4  29  ? 11.674  -77.809  22.598  1.00 51.28  ? 29   GLU D CA  1 
ATOM   5708  C  C   . GLU D  4  29  ? 12.299  -78.232  21.272  1.00 51.29  ? 29   GLU D C   1 
ATOM   5709  O  O   . GLU D  4  29  ? 11.983  -77.662  20.220  1.00 51.48  ? 29   GLU D O   1 
ATOM   5710  C  CB  . GLU D  4  29  ? 12.608  -76.815  23.309  1.00 51.47  ? 29   GLU D CB  1 
ATOM   5711  C  CG  . GLU D  4  29  ? 11.989  -76.000  24.458  1.00 53.12  ? 29   GLU D CG  1 
ATOM   5712  C  CD  . GLU D  4  29  ? 10.640  -75.355  24.115  1.00 55.31  ? 29   GLU D CD  1 
ATOM   5713  O  OE1 . GLU D  4  29  ? 9.692   -75.553  24.908  1.00 55.93  ? 29   GLU D OE1 1 
ATOM   5714  O  OE2 . GLU D  4  29  ? 10.520  -74.667  23.066  1.00 55.96  ? 29   GLU D OE2 1 
ATOM   5715  N  N   . ALA D  4  30  ? 13.184  -79.230  21.330  1.00 51.40  ? 30   ALA D N   1 
ATOM   5716  C  CA  . ALA D  4  30  ? 13.872  -79.764  20.146  1.00 51.23  ? 30   ALA D CA  1 
ATOM   5717  C  C   . ALA D  4  30  ? 12.877  -80.287  19.112  1.00 51.11  ? 30   ALA D C   1 
ATOM   5718  O  O   . ALA D  4  30  ? 13.121  -80.209  17.898  1.00 51.05  ? 30   ALA D O   1 
ATOM   5719  C  CB  . ALA D  4  30  ? 14.841  -80.867  20.547  1.00 51.16  ? 30   ALA D CB  1 
ATOM   5720  N  N   . ILE D  4  31  ? 11.757  -80.803  19.614  1.00 50.80  ? 31   ILE D N   1 
ATOM   5721  C  CA  . ILE D  4  31  ? 10.697  -81.358  18.787  1.00 50.88  ? 31   ILE D CA  1 
ATOM   5722  C  C   . ILE D  4  31  ? 9.924   -80.281  18.036  1.00 50.97  ? 31   ILE D C   1 
ATOM   5723  O  O   . ILE D  4  31  ? 9.508   -80.504  16.896  1.00 50.98  ? 31   ILE D O   1 
ATOM   5724  C  CB  . ILE D  4  31  ? 9.750   -82.250  19.633  1.00 51.06  ? 31   ILE D CB  1 
ATOM   5725  C  CG1 . ILE D  4  31  ? 10.479  -83.543  20.025  1.00 51.13  ? 31   ILE D CG1 1 
ATOM   5726  C  CG2 . ILE D  4  31  ? 8.436   -82.557  18.889  1.00 50.69  ? 31   ILE D CG2 1 
ATOM   5727  C  CD1 . ILE D  4  31  ? 10.030  -84.134  21.332  1.00 50.87  ? 31   ILE D CD1 1 
ATOM   5728  N  N   . LYS D  4  32  ? 9.751   -79.118  18.672  1.00 51.27  ? 32   LYS D N   1 
ATOM   5729  C  CA  . LYS D  4  32  ? 9.038   -77.969  18.079  1.00 51.32  ? 32   LYS D CA  1 
ATOM   5730  C  C   . LYS D  4  32  ? 9.738   -77.408  16.854  1.00 50.93  ? 32   LYS D C   1 
ATOM   5731  O  O   . LYS D  4  32  ? 9.119   -76.704  16.061  1.00 51.11  ? 32   LYS D O   1 
ATOM   5732  C  CB  . LYS D  4  32  ? 8.854   -76.845  19.097  1.00 51.50  ? 32   LYS D CB  1 
ATOM   5733  C  CG  . LYS D  4  32  ? 7.678   -77.030  20.033  1.00 53.30  ? 32   LYS D CG  1 
ATOM   5734  C  CD  . LYS D  4  32  ? 7.612   -75.889  21.036  1.00 55.81  ? 32   LYS D CD  1 
ATOM   5735  C  CE  . LYS D  4  32  ? 6.656   -76.203  22.182  1.00 57.38  ? 32   LYS D CE  1 
ATOM   5736  N  NZ  . LYS D  4  32  ? 7.047   -75.476  23.437  1.00 57.15  ? 32   LYS D NZ  1 
ATOM   5737  N  N   . LEU D  4  33  ? 11.025  -77.721  16.715  1.00 50.40  ? 33   LEU D N   1 
ATOM   5738  C  CA  . LEU D  4  33  ? 11.841  -77.255  15.593  1.00 49.93  ? 33   LEU D CA  1 
ATOM   5739  C  C   . LEU D  4  33  ? 11.859  -78.254  14.435  1.00 49.23  ? 33   LEU D C   1 
ATOM   5740  O  O   . LEU D  4  33  ? 12.527  -78.034  13.417  1.00 49.20  ? 33   LEU D O   1 
ATOM   5741  C  CB  . LEU D  4  33  ? 13.279  -76.967  16.064  1.00 50.24  ? 33   LEU D CB  1 
ATOM   5742  C  CG  . LEU D  4  33  ? 13.498  -76.111  17.326  1.00 51.04  ? 33   LEU D CG  1 
ATOM   5743  C  CD1 . LEU D  4  33  ? 14.997  -75.939  17.606  1.00 50.31  ? 33   LEU D CD1 1 
ATOM   5744  C  CD2 . LEU D  4  33  ? 12.772  -74.736  17.242  1.00 51.06  ? 33   LEU D CD2 1 
ATOM   5745  N  N   . GLY D  4  34  ? 11.133  -79.356  14.596  1.00 48.31  ? 34   GLY D N   1 
ATOM   5746  C  CA  . GLY D  4  34  ? 11.092  -80.393  13.579  1.00 47.14  ? 34   GLY D CA  1 
ATOM   5747  C  C   . GLY D  4  34  ? 9.992   -80.197  12.553  1.00 46.56  ? 34   GLY D C   1 
ATOM   5748  O  O   . GLY D  4  34  ? 9.073   -79.398  12.740  1.00 46.29  ? 34   GLY D O   1 
ATOM   5749  N  N   . SER D  4  35  ? 10.087  -80.954  11.466  1.00 46.11  ? 35   SER D N   1 
ATOM   5750  C  CA  . SER D  4  35  ? 9.076   -80.963  10.436  1.00 45.67  ? 35   SER D CA  1 
ATOM   5751  C  C   . SER D  4  35  ? 7.747   -81.391  10.982  1.00 45.41  ? 35   SER D C   1 
ATOM   5752  O  O   . SER D  4  35  ? 7.675   -82.148  11.943  1.00 45.53  ? 35   SER D O   1 
ATOM   5753  C  CB  . SER D  4  35  ? 9.482   -81.909  9.338   1.00 45.82  ? 35   SER D CB  1 
ATOM   5754  O  OG  . SER D  4  35  ? 10.483  -81.288  8.568   1.00 47.12  ? 35   SER D OG  1 
ATOM   5755  N  N   . THR D  4  36  ? 6.688   -80.902  10.355  1.00 44.98  ? 36   THR D N   1 
ATOM   5756  C  CA  . THR D  4  36  ? 5.339   -81.210  10.793  1.00 44.24  ? 36   THR D CA  1 
ATOM   5757  C  C   . THR D  4  36  ? 4.992   -82.652  10.433  1.00 43.99  ? 36   THR D C   1 
ATOM   5758  O  O   . THR D  4  36  ? 5.371   -83.157  9.360   1.00 43.68  ? 36   THR D O   1 
ATOM   5759  C  CB  . THR D  4  36  ? 4.318   -80.208  10.195  1.00 44.10  ? 36   THR D CB  1 
ATOM   5760  O  OG1 . THR D  4  36  ? 4.869   -78.885  10.268  1.00 44.23  ? 36   THR D OG1 1 
ATOM   5761  C  CG2 . THR D  4  36  ? 2.995   -80.242  10.957  1.00 42.72  ? 36   THR D CG2 1 
ATOM   5762  N  N   . ALA D  4  37  ? 4.304   -83.307  11.366  1.00 43.66  ? 37   ALA D N   1 
ATOM   5763  C  CA  . ALA D  4  37  ? 3.760   -84.642  11.168  1.00 43.64  ? 37   ALA D CA  1 
ATOM   5764  C  C   . ALA D  4  37  ? 2.354   -84.678  11.719  1.00 43.68  ? 37   ALA D C   1 
ATOM   5765  O  O   . ALA D  4  37  ? 2.095   -84.219  12.839  1.00 43.54  ? 37   ALA D O   1 
ATOM   5766  C  CB  . ALA D  4  37  ? 4.626   -85.679  11.861  1.00 43.62  ? 37   ALA D CB  1 
ATOM   5767  N  N   . ILE D  4  38  ? 1.442   -85.228  10.928  1.00 44.16  ? 38   ILE D N   1 
ATOM   5768  C  CA  . ILE D  4  38  ? 0.024   -85.246  11.288  1.00 44.53  ? 38   ILE D CA  1 
ATOM   5769  C  C   . ILE D  4  38  ? -0.571  -86.651  11.155  1.00 44.59  ? 38   ILE D C   1 
ATOM   5770  O  O   . ILE D  4  38  ? -0.315  -87.353  10.170  1.00 43.97  ? 38   ILE D O   1 
ATOM   5771  C  CB  . ILE D  4  38  ? -0.797  -84.232  10.419  1.00 44.62  ? 38   ILE D CB  1 
ATOM   5772  C  CG1 . ILE D  4  38  ? -0.114  -82.865  10.393  1.00 44.68  ? 38   ILE D CG1 1 
ATOM   5773  C  CG2 . ILE D  4  38  ? -2.226  -84.079  10.946  1.00 44.49  ? 38   ILE D CG2 1 
ATOM   5774  C  CD1 . ILE D  4  38  ? -0.590  -81.952  9.277   1.00 46.62  ? 38   ILE D CD1 1 
ATOM   5775  N  N   . GLY D  4  39  ? -1.368  -87.040  12.151  1.00 45.00  ? 39   GLY D N   1 
ATOM   5776  C  CA  . GLY D  4  39  ? -2.101  -88.300  12.118  1.00 45.91  ? 39   GLY D CA  1 
ATOM   5777  C  C   . GLY D  4  39  ? -3.588  -88.151  12.396  1.00 46.76  ? 39   GLY D C   1 
ATOM   5778  O  O   . GLY D  4  39  ? -3.987  -87.380  13.278  1.00 46.77  ? 39   GLY D O   1 
ATOM   5779  N  N   . ILE D  4  40  ? -4.406  -88.889  11.640  1.00 47.32  ? 40   ILE D N   1 
ATOM   5780  C  CA  . ILE D  4  40  ? -5.868  -88.869  11.800  1.00 48.11  ? 40   ILE D CA  1 
ATOM   5781  C  C   . ILE D  4  40  ? -6.455  -90.298  11.830  1.00 48.81  ? 40   ILE D C   1 
ATOM   5782  O  O   . ILE D  4  40  ? -6.349  -91.044  10.841  1.00 48.52  ? 40   ILE D O   1 
ATOM   5783  C  CB  . ILE D  4  40  ? -6.574  -88.048  10.673  1.00 47.92  ? 40   ILE D CB  1 
ATOM   5784  C  CG1 . ILE D  4  40  ? -6.080  -86.601  10.644  1.00 48.23  ? 40   ILE D CG1 1 
ATOM   5785  C  CG2 . ILE D  4  40  ? -8.086  -88.068  10.861  1.00 47.80  ? 40   ILE D CG2 1 
ATOM   5786  C  CD1 . ILE D  4  40  ? -6.514  -85.822  9.403   1.00 48.49  ? 40   ILE D CD1 1 
ATOM   5787  N  N   . ALA D  4  41  ? -7.081  -90.655  12.957  1.00 49.41  ? 41   ALA D N   1 
ATOM   5788  C  CA  . ALA D  4  41  ? -7.687  -91.981  13.144  1.00 50.20  ? 41   ALA D CA  1 
ATOM   5789  C  C   . ALA D  4  41  ? -9.181  -91.969  12.833  1.00 50.84  ? 41   ALA D C   1 
ATOM   5790  O  O   . ALA D  4  41  ? -9.931  -91.166  13.392  1.00 51.16  ? 41   ALA D O   1 
ATOM   5791  C  CB  . ALA D  4  41  ? -7.446  -92.494  14.569  1.00 49.81  ? 41   ALA D CB  1 
ATOM   5792  N  N   . THR D  4  42  ? -9.609  -92.862  11.946  1.00 51.41  ? 42   THR D N   1 
ATOM   5793  C  CA  . THR D  4  42  ? -11.019 -92.981  11.595  1.00 51.95  ? 42   THR D CA  1 
ATOM   5794  C  C   . THR D  4  42  ? -11.509 -94.386  11.939  1.00 52.60  ? 42   THR D C   1 
ATOM   5795  O  O   . THR D  4  42  ? -10.801 -95.153  12.605  1.00 53.16  ? 42   THR D O   1 
ATOM   5796  C  CB  . THR D  4  42  ? -11.261 -92.714  10.087  1.00 51.98  ? 42   THR D CB  1 
ATOM   5797  O  OG1 . THR D  4  42  ? -10.645 -93.742  9.303   1.00 51.40  ? 42   THR D OG1 1 
ATOM   5798  C  CG2 . THR D  4  42  ? -10.699 -91.366  9.673   1.00 52.22  ? 42   THR D CG2 1 
ATOM   5799  N  N   . LYS D  4  43  ? -12.710 -94.727  11.478  1.00 52.60  ? 43   LYS D N   1 
ATOM   5800  C  CA  . LYS D  4  43  ? -13.210 -96.087  11.612  1.00 52.39  ? 43   LYS D CA  1 
ATOM   5801  C  C   . LYS D  4  43  ? -12.923 -96.910  10.351  1.00 52.10  ? 43   LYS D C   1 
ATOM   5802  O  O   . LYS D  4  43  ? -13.381 -98.049  10.218  1.00 52.01  ? 43   LYS D O   1 
ATOM   5803  C  CB  . LYS D  4  43  ? -14.697 -96.072  11.971  1.00 52.55  ? 43   LYS D CB  1 
ATOM   5804  C  CG  . LYS D  4  43  ? -14.934 -95.815  13.438  1.00 53.14  ? 43   LYS D CG  1 
ATOM   5805  C  CD  . LYS D  4  43  ? -16.325 -95.288  13.683  1.00 57.06  ? 43   LYS D CD  1 
ATOM   5806  C  CE  . LYS D  4  43  ? -16.528 -94.966  15.168  1.00 59.23  ? 43   LYS D CE  1 
ATOM   5807  N  NZ  . LYS D  4  43  ? -17.795 -94.205  15.387  1.00 60.69  ? 43   LYS D NZ  1 
ATOM   5808  N  N   . GLU D  4  44  ? -12.141 -96.334  9.442   1.00 51.65  ? 44   GLU D N   1 
ATOM   5809  C  CA  . GLU D  4  44  ? -11.791 -96.996  8.189   1.00 51.52  ? 44   GLU D CA  1 
ATOM   5810  C  C   . GLU D  4  44  ? -10.286 -97.025  7.963   1.00 50.90  ? 44   GLU D C   1 
ATOM   5811  O  O   . GLU D  4  44  ? -9.818  -97.395  6.877   1.00 50.95  ? 44   GLU D O   1 
ATOM   5812  C  CB  . GLU D  4  44  ? -12.432 -96.271  7.010   1.00 51.90  ? 44   GLU D CB  1 
ATOM   5813  C  CG  . GLU D  4  44  ? -13.920 -96.512  6.819   1.00 53.74  ? 44   GLU D CG  1 
ATOM   5814  C  CD  . GLU D  4  44  ? -14.426 -95.913  5.522   1.00 56.67  ? 44   GLU D CD  1 
ATOM   5815  O  OE1 . GLU D  4  44  ? -13.587 -95.428  4.722   1.00 57.57  ? 44   GLU D OE1 1 
ATOM   5816  O  OE2 . GLU D  4  44  ? -15.657 -95.926  5.302   1.00 58.15  ? 44   GLU D OE2 1 
ATOM   5817  N  N   . GLY D  4  45  ? -9.527  -96.628  8.978   1.00 49.98  ? 45   GLY D N   1 
ATOM   5818  C  CA  . GLY D  4  45  ? -8.088  -96.498  8.822   1.00 49.00  ? 45   GLY D CA  1 
ATOM   5819  C  C   . GLY D  4  45  ? -7.485  -95.312  9.547   1.00 48.48  ? 45   GLY D C   1 
ATOM   5820  O  O   . GLY D  4  45  ? -8.201  -94.471  10.117  1.00 48.47  ? 45   GLY D O   1 
ATOM   5821  N  N   . VAL D  4  46  ? -6.155  -95.258  9.541   1.00 47.49  ? 46   VAL D N   1 
ATOM   5822  C  CA  . VAL D  4  46  ? -5.441  -94.144  10.138  1.00 46.53  ? 46   VAL D CA  1 
ATOM   5823  C  C   . VAL D  4  46  ? -4.456  -93.619  9.115   1.00 46.27  ? 46   VAL D C   1 
ATOM   5824  O  O   . VAL D  4  46  ? -3.698  -94.392  8.524   1.00 46.11  ? 46   VAL D O   1 
ATOM   5825  C  CB  . VAL D  4  46  ? -4.727  -94.519  11.452  1.00 46.38  ? 46   VAL D CB  1 
ATOM   5826  C  CG1 . VAL D  4  46  ? -4.186  -93.279  12.133  1.00 45.85  ? 46   VAL D CG1 1 
ATOM   5827  C  CG2 . VAL D  4  46  ? -5.679  -95.223  12.389  1.00 46.21  ? 46   VAL D CG2 1 
ATOM   5828  N  N   . VAL D  4  47  ? -4.504  -92.302  8.903   1.00 45.65  ? 47   VAL D N   1 
ATOM   5829  C  CA  . VAL D  4  47  ? -3.662  -91.616  7.931   1.00 45.04  ? 47   VAL D CA  1 
ATOM   5830  C  C   . VAL D  4  47  ? -2.504  -90.940  8.644   1.00 44.52  ? 47   VAL D C   1 
ATOM   5831  O  O   . VAL D  4  47  ? -2.673  -90.296  9.680   1.00 44.24  ? 47   VAL D O   1 
ATOM   5832  C  CB  . VAL D  4  47  ? -4.459  -90.547  7.120   1.00 45.33  ? 47   VAL D CB  1 
ATOM   5833  C  CG1 . VAL D  4  47  ? -3.560  -89.843  6.086   1.00 45.25  ? 47   VAL D CG1 1 
ATOM   5834  C  CG2 . VAL D  4  47  ? -5.663  -91.175  6.429   1.00 45.04  ? 47   VAL D CG2 1 
ATOM   5835  N  N   . LEU D  4  48  ? -1.323  -91.092  8.076   1.00 44.16  ? 48   LEU D N   1 
ATOM   5836  C  CA  . LEU D  4  48  ? -0.146  -90.480  8.635   1.00 44.05  ? 48   LEU D CA  1 
ATOM   5837  C  C   . LEU D  4  48  ? 0.536   -89.701  7.514   1.00 44.20  ? 48   LEU D C   1 
ATOM   5838  O  O   . LEU D  4  48  ? 0.840   -90.265  6.451   1.00 44.26  ? 48   LEU D O   1 
ATOM   5839  C  CB  . LEU D  4  48  ? 0.760   -91.560  9.214   1.00 43.87  ? 48   LEU D CB  1 
ATOM   5840  C  CG  . LEU D  4  48  ? 1.264   -91.441  10.652  1.00 43.66  ? 48   LEU D CG  1 
ATOM   5841  C  CD1 . LEU D  4  48  ? 0.129   -91.323  11.661  1.00 43.74  ? 48   LEU D CD1 1 
ATOM   5842  C  CD2 . LEU D  4  48  ? 2.087   -92.661  10.962  1.00 42.71  ? 48   LEU D CD2 1 
ATOM   5843  N  N   . GLY D  4  49  ? 0.722   -88.399  7.740   1.00 43.93  ? 49   GLY D N   1 
ATOM   5844  C  CA  . GLY D  4  49  ? 1.338   -87.516  6.763   1.00 43.68  ? 49   GLY D CA  1 
ATOM   5845  C  C   . GLY D  4  49  ? 2.456   -86.712  7.389   1.00 44.04  ? 49   GLY D C   1 
ATOM   5846  O  O   . GLY D  4  49  ? 2.377   -86.333  8.564   1.00 43.59  ? 49   GLY D O   1 
ATOM   5847  N  N   . VAL D  4  50  ? 3.506   -86.467  6.605   1.00 44.45  ? 50   VAL D N   1 
ATOM   5848  C  CA  . VAL D  4  50  ? 4.637   -85.662  7.059   1.00 45.31  ? 50   VAL D CA  1 
ATOM   5849  C  C   . VAL D  4  50  ? 5.102   -84.647  6.015   1.00 46.06  ? 50   VAL D C   1 
ATOM   5850  O  O   . VAL D  4  50  ? 4.943   -84.849  4.815   1.00 46.23  ? 50   VAL D O   1 
ATOM   5851  C  CB  . VAL D  4  50  ? 5.877   -86.521  7.468   1.00 45.19  ? 50   VAL D CB  1 
ATOM   5852  C  CG1 . VAL D  4  50  ? 5.547   -87.460  8.593   1.00 45.45  ? 50   VAL D CG1 1 
ATOM   5853  C  CG2 . VAL D  4  50  ? 6.451   -87.285  6.279   1.00 44.94  ? 50   VAL D CG2 1 
ATOM   5854  N  N   . GLU D  4  51  ? 5.693   -83.567  6.505   1.00 46.93  ? 51   GLU D N   1 
ATOM   5855  C  CA  . GLU D  4  51  ? 6.405   -82.609  5.690   1.00 47.69  ? 51   GLU D CA  1 
ATOM   5856  C  C   . GLU D  4  51  ? 7.842   -83.097  5.559   1.00 48.04  ? 51   GLU D C   1 
ATOM   5857  O  O   . GLU D  4  51  ? 8.541   -83.293  6.563   1.00 47.89  ? 51   GLU D O   1 
ATOM   5858  C  CB  . GLU D  4  51  ? 6.336   -81.230  6.371   1.00 47.92  ? 51   GLU D CB  1 
ATOM   5859  C  CG  . GLU D  4  51  ? 7.303   -80.148  5.866   1.00 49.04  ? 51   GLU D CG  1 
ATOM   5860  C  CD  . GLU D  4  51  ? 7.592   -79.071  6.931   1.00 51.61  ? 51   GLU D CD  1 
ATOM   5861  O  OE1 . GLU D  4  51  ? 8.676   -78.461  6.858   1.00 52.00  ? 51   GLU D OE1 1 
ATOM   5862  O  OE2 . GLU D  4  51  ? 6.754   -78.834  7.845   1.00 52.24  ? 51   GLU D OE2 1 
ATOM   5863  N  N   . LYS D  4  52  ? 8.278   -83.309  4.326   1.00 48.64  ? 52   LYS D N   1 
ATOM   5864  C  CA  . LYS D  4  52  ? 9.642   -83.739  4.083   1.00 49.70  ? 52   LYS D CA  1 
ATOM   5865  C  C   . LYS D  4  52  ? 10.681  -82.682  4.499   1.00 50.67  ? 52   LYS D C   1 
ATOM   5866  O  O   . LYS D  4  52  ? 11.578  -82.983  5.296   1.00 51.04  ? 52   LYS D O   1 
ATOM   5867  C  CB  . LYS D  4  52  ? 9.835   -84.152  2.625   1.00 49.68  ? 52   LYS D CB  1 
ATOM   5868  C  CG  . LYS D  4  52  ? 9.861   -85.654  2.390   1.00 49.90  ? 52   LYS D CG  1 
ATOM   5869  C  CD  . LYS D  4  52  ? 8.616   -86.157  1.694   1.00 50.35  ? 52   LYS D CD  1 
ATOM   5870  C  CE  . LYS D  4  52  ? 8.832   -87.552  1.086   1.00 50.63  ? 52   LYS D CE  1 
ATOM   5871  N  NZ  . LYS D  4  52  ? 9.832   -87.598  -0.027  1.00 50.14  ? 52   LYS D NZ  1 
ATOM   5872  N  N   . ARG D  4  53  ? 10.552  -81.458  3.972   1.00 51.51  ? 53   ARG D N   1 
ATOM   5873  C  CA  . ARG D  4  53  ? 11.487  -80.331  4.246   1.00 51.99  ? 53   ARG D CA  1 
ATOM   5874  C  C   . ARG D  4  53  ? 12.934  -80.587  3.818   1.00 52.27  ? 53   ARG D C   1 
ATOM   5875  O  O   . ARG D  4  53  ? 13.824  -80.737  4.652   1.00 52.35  ? 53   ARG D O   1 
ATOM   5876  C  CB  . ARG D  4  53  ? 11.438  -79.860  5.720   1.00 51.71  ? 53   ARG D CB  1 
ATOM   5877  C  CG  . ARG D  4  53  ? 12.177  -78.522  5.985   1.00 51.73  ? 53   ARG D CG  1 
ATOM   5878  C  CD  . ARG D  4  53  ? 12.229  -78.124  7.470   1.00 51.57  ? 53   ARG D CD  1 
ATOM   5879  N  NE  . ARG D  4  53  ? 10.900  -77.751  7.959   1.00 53.05  ? 53   ARG D NE  1 
ATOM   5880  C  CZ  . ARG D  4  53  ? 10.548  -77.602  9.237   1.00 53.16  ? 53   ARG D CZ  1 
ATOM   5881  N  NH1 . ARG D  4  53  ? 11.425  -77.789  10.222  1.00 54.07  ? 53   ARG D NH1 1 
ATOM   5882  N  NH2 . ARG D  4  53  ? 9.297   -77.277  9.532   1.00 51.51  ? 53   ARG D NH2 1 
ATOM   5883  N  N   . ALA D  4  54  ? 13.166  -80.623  2.516   1.00 53.00  ? 54   ALA D N   1 
ATOM   5884  C  CA  . ALA D  4  54  ? 14.536  -80.667  1.998   1.00 53.94  ? 54   ALA D CA  1 
ATOM   5885  C  C   . ALA D  4  54  ? 15.299  -79.362  2.301   1.00 54.51  ? 54   ALA D C   1 
ATOM   5886  O  O   . ALA D  4  54  ? 14.827  -78.260  1.986   1.00 54.30  ? 54   ALA D O   1 
ATOM   5887  C  CB  . ALA D  4  54  ? 14.525  -80.943  0.493   1.00 54.06  ? 54   ALA D CB  1 
ATOM   5888  N  N   . THR D  4  55  ? 16.478  -79.491  2.906   1.00 55.18  ? 55   THR D N   1 
ATOM   5889  C  CA  . THR D  4  55  ? 17.312  -78.323  3.213   1.00 55.96  ? 55   THR D CA  1 
ATOM   5890  C  C   . THR D  4  55  ? 17.993  -77.717  1.971   1.00 56.35  ? 55   THR D C   1 
ATOM   5891  O  O   . THR D  4  55  ? 18.848  -76.849  2.102   1.00 56.70  ? 55   THR D O   1 
ATOM   5892  C  CB  . THR D  4  55  ? 18.402  -78.635  4.295   1.00 56.16  ? 55   THR D CB  1 
ATOM   5893  O  OG1 . THR D  4  55  ? 19.436  -79.457  3.729   1.00 55.87  ? 55   THR D OG1 1 
ATOM   5894  C  CG2 . THR D  4  55  ? 17.793  -79.313  5.541   1.00 56.04  ? 55   THR D CG2 1 
ATOM   5895  N  N   . SER D  4  56  ? 17.609  -78.168  0.779   1.00 56.57  ? 56   SER D N   1 
ATOM   5896  C  CA  . SER D  4  56  ? 18.215  -77.716  -0.472  1.00 57.03  ? 56   SER D CA  1 
ATOM   5897  C  C   . SER D  4  56  ? 17.540  -78.446  -1.623  1.00 57.31  ? 56   SER D C   1 
ATOM   5898  O  O   . SER D  4  56  ? 16.976  -79.513  -1.410  1.00 57.69  ? 56   SER D O   1 
ATOM   5899  C  CB  . SER D  4  56  ? 19.723  -78.005  -0.486  1.00 56.93  ? 56   SER D CB  1 
ATOM   5900  O  OG  . SER D  4  56  ? 20.200  -78.179  -1.810  1.00 56.75  ? 56   SER D OG  1 
ATOM   5901  N  N   . PRO D  4  57  ? 17.588  -77.881  -2.847  1.00 57.54  ? 57   PRO D N   1 
ATOM   5902  C  CA  . PRO D  4  57  ? 16.948  -78.592  -3.963  1.00 57.47  ? 57   PRO D CA  1 
ATOM   5903  C  C   . PRO D  4  57  ? 17.821  -79.684  -4.594  1.00 57.32  ? 57   PRO D C   1 
ATOM   5904  O  O   . PRO D  4  57  ? 17.362  -80.388  -5.496  1.00 57.40  ? 57   PRO D O   1 
ATOM   5905  C  CB  . PRO D  4  57  ? 16.625  -77.477  -4.972  1.00 57.36  ? 57   PRO D CB  1 
ATOM   5906  C  CG  . PRO D  4  57  ? 17.522  -76.339  -4.626  1.00 57.47  ? 57   PRO D CG  1 
ATOM   5907  C  CD  . PRO D  4  57  ? 18.100  -76.553  -3.246  1.00 57.62  ? 57   PRO D CD  1 
ATOM   5908  N  N   . LEU D  4  58  ? 19.058  -79.823  -4.122  1.00 57.06  ? 58   LEU D N   1 
ATOM   5909  C  CA  . LEU D  4  58  ? 19.927  -80.923  -4.553  1.00 57.03  ? 58   LEU D CA  1 
ATOM   5910  C  C   . LEU D  4  58  ? 19.710  -82.222  -3.754  1.00 56.96  ? 58   LEU D C   1 
ATOM   5911  O  O   . LEU D  4  58  ? 20.196  -83.289  -4.133  1.00 56.98  ? 58   LEU D O   1 
ATOM   5912  C  CB  . LEU D  4  58  ? 21.385  -80.501  -4.465  1.00 57.03  ? 58   LEU D CB  1 
ATOM   5913  C  CG  . LEU D  4  58  ? 21.837  -79.414  -5.430  1.00 56.90  ? 58   LEU D CG  1 
ATOM   5914  C  CD1 . LEU D  4  58  ? 23.086  -78.777  -4.847  1.00 57.78  ? 58   LEU D CD1 1 
ATOM   5915  C  CD2 . LEU D  4  58  ? 22.091  -79.976  -6.828  1.00 55.16  ? 58   LEU D CD2 1 
ATOM   5916  N  N   . LEU D  4  59  ? 18.988  -82.113  -2.643  1.00 56.85  ? 59   LEU D N   1 
ATOM   5917  C  CA  . LEU D  4  59  ? 18.577  -83.250  -1.838  1.00 56.85  ? 59   LEU D CA  1 
ATOM   5918  C  C   . LEU D  4  59  ? 17.537  -84.083  -2.597  1.00 56.82  ? 59   LEU D C   1 
ATOM   5919  O  O   . LEU D  4  59  ? 16.531  -83.552  -3.066  1.00 56.88  ? 59   LEU D O   1 
ATOM   5920  C  CB  . LEU D  4  59  ? 17.967  -82.730  -0.531  1.00 56.97  ? 59   LEU D CB  1 
ATOM   5921  C  CG  . LEU D  4  59  ? 17.743  -83.582  0.726   1.00 57.17  ? 59   LEU D CG  1 
ATOM   5922  C  CD1 . LEU D  4  59  ? 16.912  -84.839  0.464   1.00 56.81  ? 59   LEU D CD1 1 
ATOM   5923  C  CD2 . LEU D  4  59  ? 19.065  -83.955  1.331   1.00 58.05  ? 59   LEU D CD2 1 
ATOM   5924  N  N   . GLU D  4  60  ? 17.772  -85.385  -2.706  1.00 56.69  ? 60   GLU D N   1 
ATOM   5925  C  CA  . GLU D  4  60  ? 16.810  -86.278  -3.347  1.00 56.56  ? 60   GLU D CA  1 
ATOM   5926  C  C   . GLU D  4  60  ? 15.684  -86.627  -2.387  1.00 56.43  ? 60   GLU D C   1 
ATOM   5927  O  O   . GLU D  4  60  ? 15.821  -87.506  -1.533  1.00 56.56  ? 60   GLU D O   1 
ATOM   5928  C  CB  . GLU D  4  60  ? 17.511  -87.520  -3.861  1.00 56.46  ? 60   GLU D CB  1 
ATOM   5929  C  CG  . GLU D  4  60  ? 18.669  -87.173  -4.762  1.00 57.66  ? 60   GLU D CG  1 
ATOM   5930  C  CD  . GLU D  4  60  ? 19.209  -88.360  -5.502  1.00 59.53  ? 60   GLU D CD  1 
ATOM   5931  O  OE1 . GLU D  4  60  ? 19.674  -88.180  -6.647  1.00 61.07  ? 60   GLU D OE1 1 
ATOM   5932  O  OE2 . GLU D  4  60  ? 19.170  -89.475  -4.942  1.00 61.01  ? 60   GLU D OE2 1 
ATOM   5933  N  N   . SER D  4  61  ? 14.566  -85.927  -2.544  1.00 56.13  ? 61   SER D N   1 
ATOM   5934  C  CA  . SER D  4  61  ? 13.500  -85.899  -1.539  1.00 56.02  ? 61   SER D CA  1 
ATOM   5935  C  C   . SER D  4  61  ? 12.967  -87.267  -1.116  1.00 55.62  ? 61   SER D C   1 
ATOM   5936  O  O   . SER D  4  61  ? 12.526  -87.437  0.019   1.00 55.53  ? 61   SER D O   1 
ATOM   5937  C  CB  . SER D  4  61  ? 12.335  -85.026  -2.022  1.00 56.22  ? 61   SER D CB  1 
ATOM   5938  O  OG  . SER D  4  61  ? 11.483  -85.743  -2.916  1.00 56.71  ? 61   SER D OG  1 
ATOM   5939  N  N   . ASP D  4  62  ? 12.991  -88.230  -2.031  1.00 55.19  ? 62   ASP D N   1 
ATOM   5940  C  CA  . ASP D  4  62  ? 12.423  -89.550  -1.750  1.00 54.92  ? 62   ASP D CA  1 
ATOM   5941  C  C   . ASP D  4  62  ? 13.296  -90.370  -0.800  1.00 53.58  ? 62   ASP D C   1 
ATOM   5942  O  O   . ASP D  4  62  ? 12.866  -91.408  -0.313  1.00 53.59  ? 62   ASP D O   1 
ATOM   5943  C  CB  . ASP D  4  62  ? 12.121  -90.320  -3.048  1.00 55.48  ? 62   ASP D CB  1 
ATOM   5944  C  CG  . ASP D  4  62  ? 13.275  -90.284  -4.023  1.00 57.86  ? 62   ASP D CG  1 
ATOM   5945  O  OD1 . ASP D  4  62  ? 13.011  -90.279  -5.251  1.00 60.72  ? 62   ASP D OD1 1 
ATOM   5946  O  OD2 . ASP D  4  62  ? 14.444  -90.238  -3.564  1.00 59.86  ? 62   ASP D OD2 1 
ATOM   5947  N  N   . SER D  4  63  ? 14.503  -89.883  -0.522  1.00 52.10  ? 63   SER D N   1 
ATOM   5948  C  CA  . SER D  4  63  ? 15.374  -90.513  0.457   1.00 50.68  ? 63   SER D CA  1 
ATOM   5949  C  C   . SER D  4  63  ? 15.101  -90.007  1.869   1.00 50.34  ? 63   SER D C   1 
ATOM   5950  O  O   . SER D  4  63  ? 15.888  -90.252  2.773   1.00 50.20  ? 63   SER D O   1 
ATOM   5951  C  CB  . SER D  4  63  ? 16.853  -90.320  0.084   1.00 50.59  ? 63   SER D CB  1 
ATOM   5952  O  OG  . SER D  4  63  ? 17.439  -89.173  0.679   1.00 48.67  ? 63   SER D OG  1 
ATOM   5953  N  N   . ILE D  4  64  ? 13.993  -89.293  2.060   1.00 49.90  ? 64   ILE D N   1 
ATOM   5954  C  CA  . ILE D  4  64  ? 13.654  -88.743  3.380   1.00 49.30  ? 64   ILE D CA  1 
ATOM   5955  C  C   . ILE D  4  64  ? 12.596  -89.612  4.026   1.00 49.18  ? 64   ILE D C   1 
ATOM   5956  O  O   . ILE D  4  64  ? 11.412  -89.580  3.648   1.00 48.94  ? 64   ILE D O   1 
ATOM   5957  C  CB  . ILE D  4  64  ? 13.213  -87.248  3.335   1.00 49.21  ? 64   ILE D CB  1 
ATOM   5958  C  CG1 . ILE D  4  64  ? 14.392  -86.360  2.941   1.00 48.87  ? 64   ILE D CG1 1 
ATOM   5959  C  CG2 . ILE D  4  64  ? 12.655  -86.790  4.686   1.00 48.50  ? 64   ILE D CG2 1 
ATOM   5960  C  CD1 . ILE D  4  64  ? 14.004  -84.927  2.592   1.00 49.78  ? 64   ILE D CD1 1 
ATOM   5961  N  N   . GLU D  4  65  ? 13.060  -90.387  5.005   1.00 49.12  ? 65   GLU D N   1 
ATOM   5962  C  CA  . GLU D  4  65  ? 12.270  -91.412  5.675   1.00 49.12  ? 65   GLU D CA  1 
ATOM   5963  C  C   . GLU D  4  65  ? 11.686  -90.884  6.979   1.00 48.36  ? 65   GLU D C   1 
ATOM   5964  O  O   . GLU D  4  65  ? 12.294  -91.022  8.040   1.00 48.78  ? 65   GLU D O   1 
ATOM   5965  C  CB  . GLU D  4  65  ? 13.165  -92.608  5.989   1.00 49.56  ? 65   GLU D CB  1 
ATOM   5966  C  CG  . GLU D  4  65  ? 13.149  -93.742  4.987   1.00 51.87  ? 65   GLU D CG  1 
ATOM   5967  C  CD  . GLU D  4  65  ? 13.449  -95.085  5.665   1.00 54.42  ? 65   GLU D CD  1 
ATOM   5968  O  OE1 . GLU D  4  65  ? 12.532  -95.665  6.305   1.00 53.96  ? 65   GLU D OE1 1 
ATOM   5969  O  OE2 . GLU D  4  65  ? 14.605  -95.553  5.558   1.00 56.01  ? 65   GLU D OE2 1 
ATOM   5970  N  N   . LYS D  4  66  ? 10.512  -90.284  6.924   1.00 47.51  ? 66   LYS D N   1 
ATOM   5971  C  CA  . LYS D  4  66  ? 9.935   -89.778  8.154   1.00 46.89  ? 66   LYS D CA  1 
ATOM   5972  C  C   . LYS D  4  66  ? 8.681   -90.523  8.548   1.00 46.27  ? 66   LYS D C   1 
ATOM   5973  O  O   . LYS D  4  66  ? 8.128   -90.299  9.623   1.00 46.10  ? 66   LYS D O   1 
ATOM   5974  C  CB  . LYS D  4  66  ? 9.711   -88.275  8.074   1.00 46.98  ? 66   LYS D CB  1 
ATOM   5975  C  CG  . LYS D  4  66  ? 11.009  -87.511  7.986   1.00 47.48  ? 66   LYS D CG  1 
ATOM   5976  C  CD  . LYS D  4  66  ? 10.819  -86.086  8.409   1.00 49.70  ? 66   LYS D CD  1 
ATOM   5977  C  CE  . LYS D  4  66  ? 12.136  -85.353  8.335   1.00 50.95  ? 66   LYS D CE  1 
ATOM   5978  N  NZ  . LYS D  4  66  ? 11.887  -83.897  8.237   1.00 50.72  ? 66   LYS D NZ  1 
ATOM   5979  N  N   . ILE D  4  67  ? 8.252   -91.421  7.667   1.00 45.64  ? 67   ILE D N   1 
ATOM   5980  C  CA  . ILE D  4  67  ? 7.199   -92.373  7.974   1.00 45.26  ? 67   ILE D CA  1 
ATOM   5981  C  C   . ILE D  4  67  ? 7.780   -93.773  7.805   1.00 44.70  ? 67   ILE D C   1 
ATOM   5982  O  O   . ILE D  4  67  ? 8.330   -94.096  6.744   1.00 44.70  ? 67   ILE D O   1 
ATOM   5983  C  CB  . ILE D  4  67  ? 5.968   -92.193  7.053   1.00 45.45  ? 67   ILE D CB  1 
ATOM   5984  C  CG1 . ILE D  4  67  ? 5.454   -90.748  7.122   1.00 45.60  ? 67   ILE D CG1 1 
ATOM   5985  C  CG2 . ILE D  4  67  ? 4.861   -93.196  7.434   1.00 44.98  ? 67   ILE D CG2 1 
ATOM   5986  C  CD1 . ILE D  4  67  ? 4.330   -90.406  6.130   1.00 45.63  ? 67   ILE D CD1 1 
ATOM   5987  N  N   . VAL D  4  68  ? 7.680   -94.598  8.842   1.00 43.79  ? 68   VAL D N   1 
ATOM   5988  C  CA  . VAL D  4  68  ? 8.298   -95.936  8.786   1.00 43.24  ? 68   VAL D CA  1 
ATOM   5989  C  C   . VAL D  4  68  ? 7.339   -97.055  9.155   1.00 42.73  ? 68   VAL D C   1 
ATOM   5990  O  O   . VAL D  4  68  ? 6.498   -96.893  10.053  1.00 42.26  ? 68   VAL D O   1 
ATOM   5991  C  CB  . VAL D  4  68  ? 9.572   -96.049  9.677   1.00 43.22  ? 68   VAL D CB  1 
ATOM   5992  C  CG1 . VAL D  4  68  ? 10.698  -95.178  9.143   1.00 42.49  ? 68   VAL D CG1 1 
ATOM   5993  C  CG2 . VAL D  4  68  ? 9.252   -95.688  11.119  1.00 43.80  ? 68   VAL D CG2 1 
ATOM   5994  N  N   . GLU D  4  69  ? 7.471   -98.187  8.457   1.00 42.41  ? 69   GLU D N   1 
ATOM   5995  C  CA  . GLU D  4  69  ? 6.773   -99.417  8.858   1.00 42.17  ? 69   GLU D CA  1 
ATOM   5996  C  C   . GLU D  4  69  ? 7.390   -100.034 10.125  1.00 41.55  ? 69   GLU D C   1 
ATOM   5997  O  O   . GLU D  4  69  ? 8.608   -100.195 10.219  1.00 40.79  ? 69   GLU D O   1 
ATOM   5998  C  CB  . GLU D  4  69  ? 6.744   -100.454 7.723   1.00 42.41  ? 69   GLU D CB  1 
ATOM   5999  C  CG  . GLU D  4  69  ? 5.766   -101.630 8.005   1.00 43.75  ? 69   GLU D CG  1 
ATOM   6000  C  CD  . GLU D  4  69  ? 5.753   -102.725 6.934   1.00 45.54  ? 69   GLU D CD  1 
ATOM   6001  O  OE1 . GLU D  4  69  ? 5.072   -103.756 7.159   1.00 46.14  ? 69   GLU D OE1 1 
ATOM   6002  O  OE2 . GLU D  4  69  ? 6.411   -102.565 5.876   1.00 46.37  ? 69   GLU D OE2 1 
ATOM   6003  N  N   . ILE D  4  70  ? 6.544   -100.360 11.095  1.00 41.30  ? 70   ILE D N   1 
ATOM   6004  C  CA  . ILE D  4  70  ? 7.000   -101.106 12.258  1.00 41.67  ? 70   ILE D CA  1 
ATOM   6005  C  C   . ILE D  4  70  ? 6.630   -102.592 12.163  1.00 42.13  ? 70   ILE D C   1 
ATOM   6006  O  O   . ILE D  4  70  ? 7.474   -103.456 12.373  1.00 42.79  ? 70   ILE D O   1 
ATOM   6007  C  CB  . ILE D  4  70  ? 6.544   -100.463 13.568  1.00 41.44  ? 70   ILE D CB  1 
ATOM   6008  C  CG1 . ILE D  4  70  ? 7.337   -99.179  13.798  1.00 41.12  ? 70   ILE D CG1 1 
ATOM   6009  C  CG2 . ILE D  4  70  ? 6.758   -101.415 14.743  1.00 41.21  ? 70   ILE D CG2 1 
ATOM   6010  C  CD1 . ILE D  4  70  ? 6.764   -98.282  14.863  1.00 41.25  ? 70   ILE D CD1 1 
ATOM   6011  N  N   . ASP D  4  71  ? 5.378   -102.881 11.841  1.00 42.40  ? 71   ASP D N   1 
ATOM   6012  C  CA  . ASP D  4  71  ? 4.938   -104.229 11.495  1.00 42.81  ? 71   ASP D CA  1 
ATOM   6013  C  C   . ASP D  4  71  ? 3.809   -104.053 10.473  1.00 42.73  ? 71   ASP D C   1 
ATOM   6014  O  O   . ASP D  4  71  ? 3.526   -102.922 10.091  1.00 43.09  ? 71   ASP D O   1 
ATOM   6015  C  CB  . ASP D  4  71  ? 4.465   -104.991 12.742  1.00 42.95  ? 71   ASP D CB  1 
ATOM   6016  C  CG  . ASP D  4  71  ? 4.526   -106.515 12.571  1.00 44.33  ? 71   ASP D CG  1 
ATOM   6017  O  OD1 . ASP D  4  71  ? 4.072   -107.225 13.504  1.00 46.73  ? 71   ASP D OD1 1 
ATOM   6018  O  OD2 . ASP D  4  71  ? 5.025   -107.009 11.522  1.00 43.78  ? 71   ASP D OD2 1 
ATOM   6019  N  N   . ARG D  4  72  ? 3.165   -105.136 10.030  1.00 42.40  ? 72   ARG D N   1 
ATOM   6020  C  CA  . ARG D  4  72  ? 2.089   -105.027 9.032   1.00 41.99  ? 72   ARG D CA  1 
ATOM   6021  C  C   . ARG D  4  72  ? 0.925   -104.150 9.516   1.00 40.90  ? 72   ARG D C   1 
ATOM   6022  O  O   . ARG D  4  72  ? 0.222   -103.526 8.725   1.00 40.51  ? 72   ARG D O   1 
ATOM   6023  C  CB  . ARG D  4  72  ? 1.562   -106.407 8.610   1.00 42.31  ? 72   ARG D CB  1 
ATOM   6024  C  CG  . ARG D  4  72  ? 1.314   -106.534 7.089   1.00 44.80  ? 72   ARG D CG  1 
ATOM   6025  C  CD  . ARG D  4  72  ? 0.358   -107.694 6.706   1.00 46.63  ? 72   ARG D CD  1 
ATOM   6026  N  NE  . ARG D  4  72  ? -1.064  -107.377 6.910   1.00 47.36  ? 72   ARG D NE  1 
ATOM   6027  C  CZ  . ARG D  4  72  ? -1.963  -107.216 5.932   1.00 47.97  ? 72   ARG D CZ  1 
ATOM   6028  N  NH1 . ARG D  4  72  ? -3.221  -106.948 6.245   1.00 47.13  ? 72   ARG D NH1 1 
ATOM   6029  N  NH2 . ARG D  4  72  ? -1.623  -107.327 4.645   1.00 47.69  ? 72   ARG D NH2 1 
ATOM   6030  N  N   . HIS D  4  73  ? 0.734   -104.101 10.820  1.00 39.82  ? 73   HIS D N   1 
ATOM   6031  C  CA  . HIS D  4  73  ? -0.406  -103.410 11.383  1.00 39.20  ? 73   HIS D CA  1 
ATOM   6032  C  C   . HIS D  4  73  ? 0.013   -102.154 12.148  1.00 39.02  ? 73   HIS D C   1 
ATOM   6033  O  O   . HIS D  4  73  ? -0.802  -101.543 12.817  1.00 38.78  ? 73   HIS D O   1 
ATOM   6034  C  CB  . HIS D  4  73  ? -1.198  -104.369 12.290  1.00 39.15  ? 73   HIS D CB  1 
ATOM   6035  C  CG  . HIS D  4  73  ? -0.430  -104.835 13.493  1.00 38.62  ? 73   HIS D CG  1 
ATOM   6036  N  ND1 . HIS D  4  73  ? 0.752   -105.545 13.400  1.00 37.43  ? 73   HIS D ND1 1 
ATOM   6037  C  CD2 . HIS D  4  73  ? -0.667  -104.671 14.817  1.00 38.12  ? 73   HIS D CD2 1 
ATOM   6038  C  CE1 . HIS D  4  73  ? 1.210   -105.792 14.614  1.00 37.33  ? 73   HIS D CE1 1 
ATOM   6039  N  NE2 . HIS D  4  73  ? 0.368   -105.273 15.492  1.00 37.29  ? 73   HIS D NE2 1 
ATOM   6040  N  N   . ILE D  4  74  ? 1.284   -101.775 12.065  1.00 39.01  ? 74   ILE D N   1 
ATOM   6041  C  CA  . ILE D  4  74  ? 1.766   -100.619 12.815  1.00 39.04  ? 74   ILE D CA  1 
ATOM   6042  C  C   . ILE D  4  74  ? 2.775   -99.822  12.030  1.00 39.01  ? 74   ILE D C   1 
ATOM   6043  O  O   . ILE D  4  74  ? 3.773   -100.368 11.572  1.00 39.01  ? 74   ILE D O   1 
ATOM   6044  C  CB  . ILE D  4  74  ? 2.422   -101.002 14.158  1.00 39.29  ? 74   ILE D CB  1 
ATOM   6045  C  CG1 . ILE D  4  74  ? 1.416   -101.717 15.068  1.00 38.95  ? 74   ILE D CG1 1 
ATOM   6046  C  CG2 . ILE D  4  74  ? 2.989   -99.744  14.848  1.00 38.28  ? 74   ILE D CG2 1 
ATOM   6047  C  CD1 . ILE D  4  74  ? 2.015   -102.280 16.339  1.00 38.45  ? 74   ILE D CD1 1 
ATOM   6048  N  N   . GLY D  4  75  ? 2.501   -98.526  11.891  1.00 38.93  ? 75   GLY D N   1 
ATOM   6049  C  CA  . GLY D  4  75  ? 3.432   -97.588  11.289  1.00 38.82  ? 75   GLY D CA  1 
ATOM   6050  C  C   . GLY D  4  75  ? 3.653   -96.401  12.199  1.00 39.06  ? 75   GLY D C   1 
ATOM   6051  O  O   . GLY D  4  75  ? 2.924   -96.198  13.181  1.00 38.69  ? 75   GLY D O   1 
ATOM   6052  N  N   . CYS D  4  76  ? 4.666   -95.605  11.887  1.00 39.47  ? 76   CYS D N   1 
ATOM   6053  C  CA  . CYS D  4  76  ? 4.859   -94.375  12.637  1.00 40.31  ? 76   CYS D CA  1 
ATOM   6054  C  C   . CYS D  4  76  ? 5.524   -93.238  11.860  1.00 40.19  ? 76   CYS D C   1 
ATOM   6055  O  O   . CYS D  4  76  ? 6.237   -93.451  10.871  1.00 40.00  ? 76   CYS D O   1 
ATOM   6056  C  CB  . CYS D  4  76  ? 5.600   -94.640  13.952  1.00 40.59  ? 76   CYS D CB  1 
ATOM   6057  S  SG  . CYS D  4  76  ? 7.341   -94.539  13.743  1.00 42.39  ? 76   CYS D SG  1 
ATOM   6058  N  N   . ALA D  4  77  ? 5.252   -92.026  12.332  1.00 40.66  ? 77   ALA D N   1 
ATOM   6059  C  CA  . ALA D  4  77  ? 5.813   -90.814  11.772  1.00 41.18  ? 77   ALA D CA  1 
ATOM   6060  C  C   . ALA D  4  77  ? 6.553   -90.118  12.885  1.00 41.61  ? 77   ALA D C   1 
ATOM   6061  O  O   . ALA D  4  77  ? 6.116   -90.134  14.038  1.00 41.67  ? 77   ALA D O   1 
ATOM   6062  C  CB  . ALA D  4  77  ? 4.725   -89.921  11.224  1.00 40.79  ? 77   ALA D CB  1 
ATOM   6063  N  N   . MET D  4  78  ? 7.678   -89.515  12.529  1.00 42.31  ? 78   MET D N   1 
ATOM   6064  C  CA  . MET D  4  78  ? 8.586   -88.930  13.505  1.00 43.20  ? 78   MET D CA  1 
ATOM   6065  C  C   . MET D  4  78  ? 8.735   -87.423  13.305  1.00 43.54  ? 78   MET D C   1 
ATOM   6066  O  O   . MET D  4  78  ? 8.659   -86.918  12.178  1.00 43.77  ? 78   MET D O   1 
ATOM   6067  C  CB  . MET D  4  78  ? 9.954   -89.587  13.369  1.00 43.03  ? 78   MET D CB  1 
ATOM   6068  C  CG  . MET D  4  78  ? 10.546  -89.402  11.991  1.00 44.30  ? 78   MET D CG  1 
ATOM   6069  S  SD  . MET D  4  78  ? 11.984  -90.415  11.667  1.00 47.39  ? 78   MET D SD  1 
ATOM   6070  C  CE  . MET D  4  78  ? 11.227  -91.951  11.142  1.00 45.26  ? 78   MET D CE  1 
ATOM   6071  N  N   . SER D  4  79  ? 8.976   -86.711  14.398  1.00 43.79  ? 79   SER D N   1 
ATOM   6072  C  CA  . SER D  4  79  ? 9.317   -85.302  14.308  1.00 43.99  ? 79   SER D CA  1 
ATOM   6073  C  C   . SER D  4  79  ? 10.312  -84.867  15.384  1.00 43.66  ? 79   SER D C   1 
ATOM   6074  O  O   . SER D  4  79  ? 10.083  -85.065  16.575  1.00 43.73  ? 79   SER D O   1 
ATOM   6075  C  CB  . SER D  4  79  ? 8.048   -84.446  14.361  1.00 44.25  ? 79   SER D CB  1 
ATOM   6076  O  OG  . SER D  4  79  ? 8.363   -83.089  14.125  1.00 45.49  ? 79   SER D OG  1 
ATOM   6077  N  N   . GLY D  4  80  ? 11.415  -84.272  14.947  1.00 43.68  ? 80   GLY D N   1 
ATOM   6078  C  CA  . GLY D  4  80  ? 12.387  -83.679  15.854  1.00 43.63  ? 80   GLY D CA  1 
ATOM   6079  C  C   . GLY D  4  80  ? 13.779  -83.982  15.365  1.00 44.28  ? 80   GLY D C   1 
ATOM   6080  O  O   . GLY D  4  80  ? 14.064  -83.879  14.165  1.00 44.18  ? 80   GLY D O   1 
ATOM   6081  N  N   . LEU D  4  81  ? 14.651  -84.361  16.294  1.00 44.79  ? 81   LEU D N   1 
ATOM   6082  C  CA  . LEU D  4  81  ? 15.964  -84.880  15.938  1.00 45.33  ? 81   LEU D CA  1 
ATOM   6083  C  C   . LEU D  4  81  ? 15.790  -86.309  15.440  1.00 45.53  ? 81   LEU D C   1 
ATOM   6084  O  O   . LEU D  4  81  ? 15.773  -87.263  16.227  1.00 45.76  ? 81   LEU D O   1 
ATOM   6085  C  CB  . LEU D  4  81  ? 16.915  -84.800  17.134  1.00 45.38  ? 81   LEU D CB  1 
ATOM   6086  C  CG  . LEU D  4  81  ? 17.172  -83.375  17.616  1.00 45.47  ? 81   LEU D CG  1 
ATOM   6087  C  CD1 . LEU D  4  81  ? 18.101  -83.403  18.796  1.00 45.86  ? 81   LEU D CD1 1 
ATOM   6088  C  CD2 . LEU D  4  81  ? 17.736  -82.494  16.501  1.00 45.48  ? 81   LEU D CD2 1 
ATOM   6089  N  N   . THR D  4  82  ? 15.628  -86.446  14.127  1.00 45.49  ? 82   THR D N   1 
ATOM   6090  C  CA  . THR D  4  82  ? 15.152  -87.704  13.546  1.00 45.44  ? 82   THR D CA  1 
ATOM   6091  C  C   . THR D  4  82  ? 16.199  -88.816  13.487  1.00 45.02  ? 82   THR D C   1 
ATOM   6092  O  O   . THR D  4  82  ? 15.846  -89.977  13.258  1.00 45.38  ? 82   THR D O   1 
ATOM   6093  C  CB  . THR D  4  82  ? 14.542  -87.506  12.147  1.00 45.56  ? 82   THR D CB  1 
ATOM   6094  O  OG1 . THR D  4  82  ? 15.498  -86.851  11.303  1.00 46.24  ? 82   THR D OG1 1 
ATOM   6095  C  CG2 . THR D  4  82  ? 13.255  -86.680  12.231  1.00 46.09  ? 82   THR D CG2 1 
ATOM   6096  N  N   . ALA D  4  83  ? 17.472  -88.489  13.695  1.00 44.49  ? 83   ALA D N   1 
ATOM   6097  C  CA  . ALA D  4  83  ? 18.474  -89.553  13.831  1.00 44.19  ? 83   ALA D CA  1 
ATOM   6098  C  C   . ALA D  4  83  ? 18.274  -90.315  15.140  1.00 43.87  ? 83   ALA D C   1 
ATOM   6099  O  O   . ALA D  4  83  ? 18.457  -91.527  15.179  1.00 44.13  ? 83   ALA D O   1 
ATOM   6100  C  CB  . ALA D  4  83  ? 19.897  -89.024  13.711  1.00 44.08  ? 83   ALA D CB  1 
ATOM   6101  N  N   . ASP D  4  84  ? 17.871  -89.608  16.193  1.00 43.64  ? 84   ASP D N   1 
ATOM   6102  C  CA  . ASP D  4  84  ? 17.492  -90.237  17.460  1.00 43.66  ? 84   ASP D CA  1 
ATOM   6103  C  C   . ASP D  4  84  ? 16.437  -91.323  17.262  1.00 43.65  ? 84   ASP D C   1 
ATOM   6104  O  O   . ASP D  4  84  ? 16.264  -92.184  18.121  1.00 44.18  ? 84   ASP D O   1 
ATOM   6105  C  CB  . ASP D  4  84  ? 16.950  -89.203  18.473  1.00 43.57  ? 84   ASP D CB  1 
ATOM   6106  C  CG  . ASP D  4  84  ? 18.047  -88.372  19.148  1.00 43.39  ? 84   ASP D CG  1 
ATOM   6107  O  OD1 . ASP D  4  84  ? 17.768  -87.788  20.225  1.00 42.30  ? 84   ASP D OD1 1 
ATOM   6108  O  OD2 . ASP D  4  84  ? 19.173  -88.282  18.607  1.00 43.88  ? 84   ASP D OD2 1 
ATOM   6109  N  N   . ALA D  4  85  ? 15.724  -91.290  16.142  1.00 43.60  ? 85   ALA D N   1 
ATOM   6110  C  CA  . ALA D  4  85  ? 14.583  -92.189  15.984  1.00 43.61  ? 85   ALA D CA  1 
ATOM   6111  C  C   . ALA D  4  85  ? 14.945  -93.608  15.523  1.00 43.63  ? 85   ALA D C   1 
ATOM   6112  O  O   . ALA D  4  85  ? 14.139  -94.518  15.715  1.00 43.53  ? 85   ALA D O   1 
ATOM   6113  C  CB  . ALA D  4  85  ? 13.498  -91.570  15.095  1.00 43.07  ? 85   ALA D CB  1 
ATOM   6114  N  N   . ARG D  4  86  ? 16.138  -93.799  14.941  1.00 43.63  ? 86   ARG D N   1 
ATOM   6115  C  CA  . ARG D  4  86  ? 16.560  -95.124  14.449  1.00 44.21  ? 86   ARG D CA  1 
ATOM   6116  C  C   . ARG D  4  86  ? 16.413  -96.187  15.536  1.00 43.57  ? 86   ARG D C   1 
ATOM   6117  O  O   . ARG D  4  86  ? 15.630  -97.135  15.391  1.00 43.33  ? 86   ARG D O   1 
ATOM   6118  C  CB  . ARG D  4  86  ? 18.007  -95.151  13.915  1.00 44.88  ? 86   ARG D CB  1 
ATOM   6119  C  CG  . ARG D  4  86  ? 18.319  -94.349  12.623  1.00 49.21  ? 86   ARG D CG  1 
ATOM   6120  C  CD  . ARG D  4  86  ? 17.228  -94.416  11.541  1.00 56.49  ? 86   ARG D CD  1 
ATOM   6121  N  NE  . ARG D  4  86  ? 16.987  -93.085  10.950  1.00 62.85  ? 86   ARG D NE  1 
ATOM   6122  C  CZ  . ARG D  4  86  ? 15.804  -92.637  10.512  1.00 65.51  ? 86   ARG D CZ  1 
ATOM   6123  N  NH1 . ARG D  4  86  ? 14.705  -93.398  10.579  1.00 66.15  ? 86   ARG D NH1 1 
ATOM   6124  N  NH2 . ARG D  4  86  ? 15.717  -91.411  10.005  1.00 66.84  ? 86   ARG D NH2 1 
ATOM   6125  N  N   . SER D  4  87  ? 17.143  -96.007  16.634  1.00 42.86  ? 87   SER D N   1 
ATOM   6126  C  CA  . SER D  4  87  ? 17.155  -96.996  17.707  1.00 42.09  ? 87   SER D CA  1 
ATOM   6127  C  C   . SER D  4  87  ? 15.776  -97.247  18.346  1.00 41.27  ? 87   SER D C   1 
ATOM   6128  O  O   . SER D  4  87  ? 15.556  -98.316  18.917  1.00 41.23  ? 87   SER D O   1 
ATOM   6129  C  CB  . SER D  4  87  ? 18.210  -96.652  18.762  1.00 42.03  ? 87   SER D CB  1 
ATOM   6130  O  OG  . SER D  4  87  ? 17.734  -95.684  19.677  1.00 43.30  ? 87   SER D OG  1 
ATOM   6131  N  N   . MET D  4  88  ? 14.861  -96.280  18.237  1.00 40.31  ? 88   MET D N   1 
ATOM   6132  C  CA  . MET D  4  88  ? 13.481  -96.450  18.730  1.00 39.45  ? 88   MET D CA  1 
ATOM   6133  C  C   . MET D  4  88  ? 12.654  -97.328  17.792  1.00 38.49  ? 88   MET D C   1 
ATOM   6134  O  O   . MET D  4  88  ? 11.772  -98.066  18.240  1.00 38.28  ? 88   MET D O   1 
ATOM   6135  C  CB  . MET D  4  88  ? 12.757  -95.106  18.895  1.00 39.71  ? 88   MET D CB  1 
ATOM   6136  C  CG  . MET D  4  88  ? 13.339  -94.132  19.915  1.00 40.83  ? 88   MET D CG  1 
ATOM   6137  S  SD  . MET D  4  88  ? 12.342  -92.603  20.025  1.00 41.96  ? 88   MET D SD  1 
ATOM   6138  C  CE  . MET D  4  88  ? 11.236  -92.997  21.376  1.00 41.64  ? 88   MET D CE  1 
ATOM   6139  N  N   . ILE D  4  89  ? 12.923  -97.209  16.493  1.00 37.35  ? 89   ILE D N   1 
ATOM   6140  C  CA  . ILE D  4  89  ? 12.259  -98.003  15.465  1.00 36.54  ? 89   ILE D CA  1 
ATOM   6141  C  C   . ILE D  4  89  ? 12.754  -99.465  15.541  1.00 36.22  ? 89   ILE D C   1 
ATOM   6142  O  O   . ILE D  4  89  ? 11.963  -100.416 15.530  1.00 35.63  ? 89   ILE D O   1 
ATOM   6143  C  CB  . ILE D  4  89  ? 12.512  -97.390  14.049  1.00 36.71  ? 89   ILE D CB  1 
ATOM   6144  C  CG1 . ILE D  4  89  ? 11.976  -95.944  13.954  1.00 37.16  ? 89   ILE D CG1 1 
ATOM   6145  C  CG2 . ILE D  4  89  ? 11.937  -98.259  12.930  1.00 36.12  ? 89   ILE D CG2 1 
ATOM   6146  C  CD1 . ILE D  4  89  ? 10.562  -95.732  14.515  1.00 36.34  ? 89   ILE D CD1 1 
ATOM   6147  N  N   . GLU D  4  90  ? 14.071  -99.623  15.642  1.00 35.53  ? 90   GLU D N   1 
ATOM   6148  C  CA  . GLU D  4  90  ? 14.682  -100.921 15.801  1.00 35.27  ? 90   GLU D CA  1 
ATOM   6149  C  C   . GLU D  4  90  ? 14.048  -101.656 16.993  1.00 34.56  ? 90   GLU D C   1 
ATOM   6150  O  O   . GLU D  4  90  ? 13.639  -102.811 16.880  1.00 34.64  ? 90   GLU D O   1 
ATOM   6151  C  CB  . GLU D  4  90  ? 16.201  -100.771 15.949  1.00 35.22  ? 90   GLU D CB  1 
ATOM   6152  C  CG  . GLU D  4  90  ? 16.966  -102.074 16.092  1.00 37.75  ? 90   GLU D CG  1 
ATOM   6153  C  CD  . GLU D  4  90  ? 16.725  -103.053 14.938  1.00 42.80  ? 90   GLU D CD  1 
ATOM   6154  O  OE1 . GLU D  4  90  ? 16.947  -102.686 13.748  1.00 44.09  ? 90   GLU D OE1 1 
ATOM   6155  O  OE2 . GLU D  4  90  ? 16.317  -104.204 15.233  1.00 44.05  ? 90   GLU D OE2 1 
ATOM   6156  N  N   . HIS D  4  91  ? 13.931  -100.968 18.117  1.00 33.62  ? 91   HIS D N   1 
ATOM   6157  C  CA  . HIS D  4  91  ? 13.347  -101.548 19.298  1.00 32.90  ? 91   HIS D CA  1 
ATOM   6158  C  C   . HIS D  4  91  ? 11.894  -101.909 19.072  1.00 32.80  ? 91   HIS D C   1 
ATOM   6159  O  O   . HIS D  4  91  ? 11.459  -102.976 19.479  1.00 33.01  ? 91   HIS D O   1 
ATOM   6160  C  CB  . HIS D  4  91  ? 13.451  -100.588 20.469  1.00 32.83  ? 91   HIS D CB  1 
ATOM   6161  C  CG  . HIS D  4  91  ? 12.762  -101.076 21.700  1.00 33.65  ? 91   HIS D CG  1 
ATOM   6162  N  ND1 . HIS D  4  91  ? 13.443  -101.627 22.765  1.00 34.23  ? 91   HIS D ND1 1 
ATOM   6163  C  CD2 . HIS D  4  91  ? 11.448  -101.120 22.027  1.00 35.10  ? 91   HIS D CD2 1 
ATOM   6164  C  CE1 . HIS D  4  91  ? 12.578  -101.971 23.702  1.00 36.16  ? 91   HIS D CE1 1 
ATOM   6165  N  NE2 . HIS D  4  91  ? 11.360  -101.671 23.280  1.00 36.46  ? 91   HIS D NE2 1 
ATOM   6166  N  N   . ALA D  4  92  ? 11.140  -101.017 18.436  1.00 32.67  ? 92   ALA D N   1 
ATOM   6167  C  CA  . ALA D  4  92  ? 9.726   -101.263 18.169  1.00 32.31  ? 92   ALA D CA  1 
ATOM   6168  C  C   . ALA D  4  92  ? 9.519   -102.489 17.287  1.00 32.18  ? 92   ALA D C   1 
ATOM   6169  O  O   . ALA D  4  92  ? 8.668   -103.328 17.568  1.00 32.13  ? 92   ALA D O   1 
ATOM   6170  C  CB  . ALA D  4  92  ? 9.087   -100.049 17.533  1.00 32.27  ? 92   ALA D CB  1 
ATOM   6171  N  N   . ARG D  4  93  ? 10.307  -102.577 16.221  1.00 31.91  ? 93   ARG D N   1 
ATOM   6172  C  CA  . ARG D  4  93  ? 10.240  -103.686 15.300  1.00 31.50  ? 93   ARG D CA  1 
ATOM   6173  C  C   . ARG D  4  93  ? 10.563  -104.990 16.024  1.00 31.72  ? 93   ARG D C   1 
ATOM   6174  O  O   . ARG D  4  93  ? 9.801   -105.961 15.955  1.00 31.97  ? 93   ARG D O   1 
ATOM   6175  C  CB  . ARG D  4  93  ? 11.193  -103.437 14.135  1.00 31.30  ? 93   ARG D CB  1 
ATOM   6176  C  CG  . ARG D  4  93  ? 10.703  -102.352 13.189  1.00 30.58  ? 93   ARG D CG  1 
ATOM   6177  C  CD  . ARG D  4  93  ? 11.783  -101.973 12.193  1.00 31.35  ? 93   ARG D CD  1 
ATOM   6178  N  NE  . ARG D  4  93  ? 11.244  -101.105 11.148  1.00 31.54  ? 93   ARG D NE  1 
ATOM   6179  C  CZ  . ARG D  4  93  ? 11.957  -100.496 10.208  1.00 29.72  ? 93   ARG D CZ  1 
ATOM   6180  N  NH1 . ARG D  4  93  ? 13.268  -100.640 10.146  1.00 28.94  ? 93   ARG D NH1 1 
ATOM   6181  N  NH2 . ARG D  4  93  ? 11.341  -99.731  9.325   1.00 30.38  ? 93   ARG D NH2 1 
ATOM   6182  N  N   . THR D  4  94  ? 11.669  -104.991 16.757  1.00 31.67  ? 94   THR D N   1 
ATOM   6183  C  CA  . THR D  4  94  ? 12.080  -106.159 17.516  1.00 31.76  ? 94   THR D CA  1 
ATOM   6184  C  C   . THR D  4  94  ? 10.984  -106.583 18.504  1.00 31.84  ? 94   THR D C   1 
ATOM   6185  O  O   . THR D  4  94  ? 10.691  -107.773 18.638  1.00 32.27  ? 94   THR D O   1 
ATOM   6186  C  CB  . THR D  4  94  ? 13.447  -105.921 18.209  1.00 31.98  ? 94   THR D CB  1 
ATOM   6187  O  OG1 . THR D  4  94  ? 14.428  -105.619 17.214  1.00 31.63  ? 94   THR D OG1 1 
ATOM   6188  C  CG2 . THR D  4  94  ? 13.908  -107.151 18.974  1.00 32.21  ? 94   THR D CG2 1 
ATOM   6189  N  N   . ALA D  4  95  ? 10.354  -105.618 19.160  1.00 31.56  ? 95   ALA D N   1 
ATOM   6190  C  CA  . ALA D  4  95  ? 9.307   -105.925 20.125  1.00 31.40  ? 95   ALA D CA  1 
ATOM   6191  C  C   . ALA D  4  95  ? 8.086   -106.551 19.469  1.00 31.81  ? 95   ALA D C   1 
ATOM   6192  O  O   . ALA D  4  95  ? 7.442   -107.422 20.063  1.00 32.53  ? 95   ALA D O   1 
ATOM   6193  C  CB  . ALA D  4  95  ? 8.911   -104.699 20.893  1.00 30.84  ? 95   ALA D CB  1 
ATOM   6194  N  N   . ALA D  4  96  ? 7.765   -106.127 18.250  1.00 31.53  ? 96   ALA D N   1 
ATOM   6195  C  CA  . ALA D  4  96  ? 6.577   -106.642 17.565  1.00 31.47  ? 96   ALA D CA  1 
ATOM   6196  C  C   . ALA D  4  96  ? 6.830   -108.060 17.049  1.00 31.62  ? 96   ALA D C   1 
ATOM   6197  O  O   . ALA D  4  96  ? 6.014   -108.958 17.259  1.00 31.40  ? 96   ALA D O   1 
ATOM   6198  C  CB  . ALA D  4  96  ? 6.146   -105.719 16.430  1.00 30.76  ? 96   ALA D CB  1 
ATOM   6199  N  N   . VAL D  4  97  ? 7.974   -108.237 16.387  1.00 31.70  ? 97   VAL D N   1 
ATOM   6200  C  CA  . VAL D  4  97  ? 8.385   -109.518 15.831  1.00 31.54  ? 97   VAL D CA  1 
ATOM   6201  C  C   . VAL D  4  97  ? 8.610   -110.527 16.969  1.00 31.84  ? 97   VAL D C   1 
ATOM   6202  O  O   . VAL D  4  97  ? 8.085   -111.635 16.907  1.00 32.05  ? 97   VAL D O   1 
ATOM   6203  C  CB  . VAL D  4  97  ? 9.641   -109.360 14.941  1.00 31.38  ? 97   VAL D CB  1 
ATOM   6204  C  CG1 . VAL D  4  97  ? 10.275  -110.710 14.623  1.00 31.20  ? 97   VAL D CG1 1 
ATOM   6205  C  CG2 . VAL D  4  97  ? 9.273   -108.653 13.669  1.00 31.36  ? 97   VAL D CG2 1 
ATOM   6206  N  N   . THR D  4  98  ? 9.366   -110.130 17.999  1.00 31.78  ? 98   THR D N   1 
ATOM   6207  C  CA  . THR D  4  98  ? 9.512   -110.922 19.229  1.00 31.55  ? 98   THR D CA  1 
ATOM   6208  C  C   . THR D  4  98  ? 8.141   -111.322 19.808  1.00 31.69  ? 98   THR D C   1 
ATOM   6209  O  O   . THR D  4  98  ? 7.927   -112.481 20.169  1.00 32.33  ? 98   THR D O   1 
ATOM   6210  C  CB  . THR D  4  98  ? 10.346  -110.175 20.306  1.00 31.53  ? 98   THR D CB  1 
ATOM   6211  O  OG1 . THR D  4  98  ? 11.694  -110.036 19.851  1.00 30.56  ? 98   THR D OG1 1 
ATOM   6212  C  CG2 . THR D  4  98  ? 10.345  -110.916 21.648  1.00 30.44  ? 98   THR D CG2 1 
ATOM   6213  N  N   . HIS D  4  99  ? 7.209   -110.383 19.881  1.00 31.17  ? 99   HIS D N   1 
ATOM   6214  C  CA  . HIS D  4  99  ? 5.893   -110.719 20.402  1.00 30.84  ? 99   HIS D CA  1 
ATOM   6215  C  C   . HIS D  4  99  ? 5.237   -111.818 19.573  1.00 31.38  ? 99   HIS D C   1 
ATOM   6216  O  O   . HIS D  4  99  ? 4.589   -112.717 20.120  1.00 31.01  ? 99   HIS D O   1 
ATOM   6217  C  CB  . HIS D  4  99  ? 4.964   -109.507 20.431  1.00 30.07  ? 99   HIS D CB  1 
ATOM   6218  C  CG  . HIS D  4  99  ? 3.646   -109.792 21.073  1.00 27.69  ? 99   HIS D CG  1 
ATOM   6219  N  ND1 . HIS D  4  99  ? 3.395   -109.534 22.404  1.00 26.01  ? 99   HIS D ND1 1 
ATOM   6220  C  CD2 . HIS D  4  99  ? 2.514   -110.345 20.577  1.00 25.89  ? 99   HIS D CD2 1 
ATOM   6221  C  CE1 . HIS D  4  99  ? 2.155   -109.894 22.692  1.00 24.30  ? 99   HIS D CE1 1 
ATOM   6222  N  NE2 . HIS D  4  99  ? 1.599   -110.391 21.602  1.00 23.15  ? 99   HIS D NE2 1 
ATOM   6223  N  N   . ASN D  4  100 ? 5.384   -111.721 18.254  1.00 31.79  ? 100  ASN D N   1 
ATOM   6224  C  CA  . ASN D  4  100 ? 4.737   -112.666 17.370  1.00 32.47  ? 100  ASN D CA  1 
ATOM   6225  C  C   . ASN D  4  100 ? 5.409   -114.035 17.526  1.00 32.63  ? 100  ASN D C   1 
ATOM   6226  O  O   . ASN D  4  100 ? 4.746   -115.064 17.425  1.00 32.50  ? 100  ASN D O   1 
ATOM   6227  C  CB  . ASN D  4  100 ? 4.737   -112.173 15.913  1.00 32.30  ? 100  ASN D CB  1 
ATOM   6228  C  CG  . ASN D  4  100 ? 4.136   -113.207 14.936  1.00 33.46  ? 100  ASN D CG  1 
ATOM   6229  O  OD1 . ASN D  4  100 ? 4.854   -113.822 14.150  1.00 33.41  ? 100  ASN D OD1 1 
ATOM   6230  N  ND2 . ASN D  4  100 ? 2.820   -113.405 15.004  1.00 33.15  ? 100  ASN D ND2 1 
ATOM   6231  N  N   . LEU D  4  101 ? 6.708   -114.023 17.831  1.00 32.60  ? 101  LEU D N   1 
ATOM   6232  C  CA  . LEU D  4  101 ? 7.462   -115.243 18.010  1.00 32.65  ? 101  LEU D CA  1 
ATOM   6233  C  C   . LEU D  4  101 ? 7.038   -115.939 19.288  1.00 33.51  ? 101  LEU D C   1 
ATOM   6234  O  O   . LEU D  4  101 ? 6.796   -117.142 19.277  1.00 34.17  ? 101  LEU D O   1 
ATOM   6235  C  CB  . LEU D  4  101 ? 8.978   -115.001 17.975  1.00 32.17  ? 101  LEU D CB  1 
ATOM   6236  C  CG  . LEU D  4  101 ? 9.853   -116.266 18.071  1.00 31.02  ? 101  LEU D CG  1 
ATOM   6237  C  CD1 . LEU D  4  101 ? 9.489   -117.218 16.945  1.00 29.41  ? 101  LEU D CD1 1 
ATOM   6238  C  CD2 . LEU D  4  101 ? 11.364  -115.971 18.075  1.00 26.40  ? 101  LEU D CD2 1 
ATOM   6239  N  N   . TYR D  4  102 ? 6.921   -115.185 20.374  1.00 34.19  ? 102  TYR D N   1 
ATOM   6240  C  CA  . TYR D  4  102 ? 6.525   -115.748 21.670  1.00 35.09  ? 102  TYR D CA  1 
ATOM   6241  C  C   . TYR D  4  102 ? 5.055   -116.164 21.748  1.00 34.62  ? 102  TYR D C   1 
ATOM   6242  O  O   . TYR D  4  102 ? 4.705   -117.016 22.562  1.00 34.86  ? 102  TYR D O   1 
ATOM   6243  C  CB  . TYR D  4  102 ? 6.809   -114.753 22.809  1.00 35.58  ? 102  TYR D CB  1 
ATOM   6244  C  CG  . TYR D  4  102 ? 8.268   -114.523 23.162  1.00 39.97  ? 102  TYR D CG  1 
ATOM   6245  C  CD1 . TYR D  4  102 ? 9.309   -115.168 22.467  1.00 43.43  ? 102  TYR D CD1 1 
ATOM   6246  C  CD2 . TYR D  4  102 ? 8.620   -113.612 24.175  1.00 45.12  ? 102  TYR D CD2 1 
ATOM   6247  C  CE1 . TYR D  4  102 ? 10.669  -114.940 22.792  1.00 45.28  ? 102  TYR D CE1 1 
ATOM   6248  C  CE2 . TYR D  4  102 ? 9.979   -113.374 24.512  1.00 46.94  ? 102  TYR D CE2 1 
ATOM   6249  C  CZ  . TYR D  4  102 ? 10.991  -114.045 23.814  1.00 46.89  ? 102  TYR D CZ  1 
ATOM   6250  O  OH  . TYR D  4  102 ? 12.309  -113.814 24.138  1.00 47.95  ? 102  TYR D OH  1 
ATOM   6251  N  N   . TYR D  4  103 ? 4.196   -115.566 20.920  1.00 34.40  ? 103  TYR D N   1 
ATOM   6252  C  CA  . TYR D  4  103 ? 2.744   -115.621 21.147  1.00 33.74  ? 103  TYR D CA  1 
ATOM   6253  C  C   . TYR D  4  103 ? 1.889   -115.935 19.932  1.00 33.91  ? 103  TYR D C   1 
ATOM   6254  O  O   . TYR D  4  103 ? 0.667   -116.084 20.065  1.00 33.54  ? 103  TYR D O   1 
ATOM   6255  C  CB  . TYR D  4  103 ? 2.244   -114.306 21.752  1.00 33.33  ? 103  TYR D CB  1 
ATOM   6256  C  CG  . TYR D  4  103 ? 2.642   -114.060 23.181  1.00 32.11  ? 103  TYR D CG  1 
ATOM   6257  C  CD1 . TYR D  4  103 ? 3.590   -113.093 23.502  1.00 31.71  ? 103  TYR D CD1 1 
ATOM   6258  C  CD2 . TYR D  4  103 ? 2.059   -114.787 24.219  1.00 31.58  ? 103  TYR D CD2 1 
ATOM   6259  C  CE1 . TYR D  4  103 ? 3.961   -112.863 24.843  1.00 32.79  ? 103  TYR D CE1 1 
ATOM   6260  C  CE2 . TYR D  4  103 ? 2.413   -114.573 25.550  1.00 31.30  ? 103  TYR D CE2 1 
ATOM   6261  C  CZ  . TYR D  4  103 ? 3.356   -113.610 25.854  1.00 32.99  ? 103  TYR D CZ  1 
ATOM   6262  O  OH  . TYR D  4  103 ? 3.695   -113.402 27.168  1.00 33.69  ? 103  TYR D OH  1 
ATOM   6263  N  N   . ASP D  4  104 ? 2.510   -116.004 18.756  1.00 34.41  ? 104  ASP D N   1 
ATOM   6264  C  CA  . ASP D  4  104 ? 1.783   -116.336 17.506  1.00 35.39  ? 104  ASP D CA  1 
ATOM   6265  C  C   . ASP D  4  104 ? 0.570   -115.405 17.236  1.00 35.52  ? 104  ASP D C   1 
ATOM   6266  O  O   . ASP D  4  104 ? -0.524  -115.853 16.855  1.00 35.85  ? 104  ASP D O   1 
ATOM   6267  C  CB  . ASP D  4  104 ? 1.390   -117.831 17.499  1.00 35.28  ? 104  ASP D CB  1 
ATOM   6268  C  CG  . ASP D  4  104 ? 0.785   -118.289 16.178  1.00 36.68  ? 104  ASP D CG  1 
ATOM   6269  O  OD1 . ASP D  4  104 ? -0.068  -119.212 16.222  1.00 35.74  ? 104  ASP D OD1 1 
ATOM   6270  O  OD2 . ASP D  4  104 ? 1.153   -117.727 15.107  1.00 39.16  ? 104  ASP D OD2 1 
ATOM   6271  N  N   . GLU D  4  105 ? 0.783   -114.107 17.440  1.00 35.49  ? 105  GLU D N   1 
ATOM   6272  C  CA  . GLU D  4  105 ? -0.245  -113.088 17.240  1.00 35.45  ? 105  GLU D CA  1 
ATOM   6273  C  C   . GLU D  4  105 ? 0.423   -111.754 16.958  1.00 35.92  ? 105  GLU D C   1 
ATOM   6274  O  O   . GLU D  4  105 ? 1.625   -111.610 17.161  1.00 36.32  ? 105  GLU D O   1 
ATOM   6275  C  CB  . GLU D  4  105 ? -1.120  -112.962 18.482  1.00 34.87  ? 105  GLU D CB  1 
ATOM   6276  C  CG  . GLU D  4  105 ? -0.369  -112.455 19.689  1.00 33.77  ? 105  GLU D CG  1 
ATOM   6277  C  CD  . GLU D  4  105 ? -1.231  -112.373 20.932  1.00 31.83  ? 105  GLU D CD  1 
ATOM   6278  O  OE1 . GLU D  4  105 ? -0.766  -111.803 21.936  1.00 32.64  ? 105  GLU D OE1 1 
ATOM   6279  O  OE2 . GLU D  4  105 ? -2.365  -112.872 20.920  1.00 29.89  ? 105  GLU D OE2 1 
ATOM   6280  N  N   . ASP D  4  106 ? -0.357  -110.778 16.502  1.00 36.53  ? 106  ASP D N   1 
ATOM   6281  C  CA  . ASP D  4  106 ? 0.117   -109.389 16.382  1.00 36.58  ? 106  ASP D CA  1 
ATOM   6282  C  C   . ASP D  4  106 ? 0.154   -108.741 17.757  1.00 35.89  ? 106  ASP D C   1 
ATOM   6283  O  O   . ASP D  4  106 ? -0.760  -108.950 18.554  1.00 35.32  ? 106  ASP D O   1 
ATOM   6284  C  CB  . ASP D  4  106 ? -0.812  -108.587 15.459  1.00 36.99  ? 106  ASP D CB  1 
ATOM   6285  C  CG  . ASP D  4  106 ? -0.671  -108.976 13.991  1.00 39.31  ? 106  ASP D CG  1 
ATOM   6286  O  OD1 . ASP D  4  106 ? -1.508  -108.530 13.176  1.00 42.65  ? 106  ASP D OD1 1 
ATOM   6287  O  OD2 . ASP D  4  106 ? 0.276   -109.719 13.638  1.00 42.91  ? 106  ASP D OD2 1 
ATOM   6288  N  N   . ILE D  4  107 ? 1.207   -107.975 18.048  1.00 35.76  ? 107  ILE D N   1 
ATOM   6289  C  CA  . ILE D  4  107 ? 1.214   -107.160 19.275  1.00 35.60  ? 107  ILE D CA  1 
ATOM   6290  C  C   . ILE D  4  107 ? 0.175   -106.055 19.186  1.00 36.24  ? 107  ILE D C   1 
ATOM   6291  O  O   . ILE D  4  107 ? -0.076  -105.525 18.108  1.00 36.86  ? 107  ILE D O   1 
ATOM   6292  C  CB  . ILE D  4  107 ? 2.604   -106.566 19.606  1.00 35.39  ? 107  ILE D CB  1 
ATOM   6293  C  CG1 . ILE D  4  107 ? 2.629   -106.044 21.048  1.00 34.71  ? 107  ILE D CG1 1 
ATOM   6294  C  CG2 . ILE D  4  107 ? 3.040   -105.510 18.584  1.00 34.41  ? 107  ILE D CG2 1 
ATOM   6295  C  CD1 . ILE D  4  107 ? 3.991   -105.554 21.514  1.00 33.43  ? 107  ILE D CD1 1 
ATOM   6296  N  N   . ASN D  4  108 ? -0.461  -105.750 20.306  1.00 36.84  ? 108  ASN D N   1 
ATOM   6297  C  CA  . ASN D  4  108 ? -1.374  -104.626 20.410  1.00 37.82  ? 108  ASN D CA  1 
ATOM   6298  C  C   . ASN D  4  108 ? -0.639  -103.299 20.213  1.00 38.71  ? 108  ASN D C   1 
ATOM   6299  O  O   . ASN D  4  108 ? 0.491   -103.140 20.697  1.00 39.37  ? 108  ASN D O   1 
ATOM   6300  C  CB  . ASN D  4  108 ? -2.027  -104.622 21.797  1.00 37.92  ? 108  ASN D CB  1 
ATOM   6301  C  CG  . ASN D  4  108 ? -3.144  -105.626 21.918  1.00 37.94  ? 108  ASN D CG  1 
ATOM   6302  O  OD1 . ASN D  4  108 ? -3.710  -105.800 22.995  1.00 40.66  ? 108  ASN D OD1 1 
ATOM   6303  N  ND2 . ASN D  4  108 ? -3.479  -106.285 20.820  1.00 37.48  ? 108  ASN D ND2 1 
ATOM   6304  N  N   . VAL D  4  109 ? -1.283  -102.343 19.540  1.00 39.16  ? 109  VAL D N   1 
ATOM   6305  C  CA  . VAL D  4  109 ? -0.694  -101.010 19.310  1.00 39.54  ? 109  VAL D CA  1 
ATOM   6306  C  C   . VAL D  4  109 ? -0.280  -100.345 20.634  1.00 39.99  ? 109  VAL D C   1 
ATOM   6307  O  O   . VAL D  4  109 ? 0.816   -99.791  20.738  1.00 40.29  ? 109  VAL D O   1 
ATOM   6308  C  CB  . VAL D  4  109 ? -1.655  -100.060 18.493  1.00 39.75  ? 109  VAL D CB  1 
ATOM   6309  C  CG1 . VAL D  4  109 ? -0.892  -98.859  17.901  1.00 39.12  ? 109  VAL D CG1 1 
ATOM   6310  C  CG2 . VAL D  4  109 ? -2.375  -100.815 17.364  1.00 39.28  ? 109  VAL D CG2 1 
ATOM   6311  N  N   . GLU D  4  110 ? -1.149  -100.441 21.642  1.00 40.41  ? 110  GLU D N   1 
ATOM   6312  C  CA  . GLU D  4  110 ? -0.944  -99.816  22.947  1.00 41.00  ? 110  GLU D CA  1 
ATOM   6313  C  C   . GLU D  4  110 ? 0.257   -100.410 23.689  1.00 40.64  ? 110  GLU D C   1 
ATOM   6314  O  O   . GLU D  4  110 ? 0.987   -99.694  24.397  1.00 40.74  ? 110  GLU D O   1 
ATOM   6315  C  CB  . GLU D  4  110 ? -2.227  -99.950  23.781  1.00 41.64  ? 110  GLU D CB  1 
ATOM   6316  C  CG  . GLU D  4  110 ? -2.376  -98.955  24.949  1.00 45.35  ? 110  GLU D CG  1 
ATOM   6317  C  CD  . GLU D  4  110 ? -2.129  -99.591  26.326  1.00 50.48  ? 110  GLU D CD  1 
ATOM   6318  O  OE1 . GLU D  4  110 ? -0.958  -99.948  26.624  1.00 52.53  ? 110  GLU D OE1 1 
ATOM   6319  O  OE2 . GLU D  4  110 ? -3.110  -99.729  27.112  1.00 51.64  ? 110  GLU D OE2 1 
ATOM   6320  N  N   . SER D  4  111 ? 0.456   -101.718 23.520  1.00 40.25  ? 111  SER D N   1 
ATOM   6321  C  CA  . SER D  4  111 ? 1.558   -102.442 24.159  1.00 39.48  ? 111  SER D CA  1 
ATOM   6322  C  C   . SER D  4  111 ? 2.867   -102.114 23.484  1.00 38.42  ? 111  SER D C   1 
ATOM   6323  O  O   . SER D  4  111 ? 3.880   -101.946 24.148  1.00 37.94  ? 111  SER D O   1 
ATOM   6324  C  CB  . SER D  4  111 ? 1.314   -103.946 24.085  1.00 39.84  ? 111  SER D CB  1 
ATOM   6325  O  OG  . SER D  4  111 ? 0.243   -104.302 24.939  1.00 42.30  ? 111  SER D OG  1 
ATOM   6326  N  N   . LEU D  4  112 ? 2.833   -102.035 22.157  1.00 37.56  ? 112  LEU D N   1 
ATOM   6327  C  CA  . LEU D  4  112 ? 3.976   -101.602 21.374  1.00 37.55  ? 112  LEU D CA  1 
ATOM   6328  C  C   . LEU D  4  112 ? 4.386   -100.161 21.714  1.00 37.94  ? 112  LEU D C   1 
ATOM   6329  O  O   . LEU D  4  112 ? 5.580   -99.835  21.760  1.00 38.21  ? 112  LEU D O   1 
ATOM   6330  C  CB  . LEU D  4  112 ? 3.655   -101.717 19.884  1.00 37.29  ? 112  LEU D CB  1 
ATOM   6331  C  CG  . LEU D  4  112 ? 4.753   -101.413 18.859  1.00 36.50  ? 112  LEU D CG  1 
ATOM   6332  C  CD1 . LEU D  4  112 ? 4.842   -99.917  18.615  1.00 34.93  ? 112  LEU D CD1 1 
ATOM   6333  C  CD2 . LEU D  4  112 ? 6.127   -102.026 19.238  1.00 33.75  ? 112  LEU D CD2 1 
ATOM   6334  N  N   . THR D  4  113 ? 3.398   -99.302  21.957  1.00 37.67  ? 113  THR D N   1 
ATOM   6335  C  CA  . THR D  4  113 ? 3.694   -97.926  22.302  1.00 37.63  ? 113  THR D CA  1 
ATOM   6336  C  C   . THR D  4  113 ? 4.383   -97.895  23.662  1.00 37.85  ? 113  THR D C   1 
ATOM   6337  O  O   . THR D  4  113 ? 5.465   -97.311  23.802  1.00 37.68  ? 113  THR D O   1 
ATOM   6338  C  CB  . THR D  4  113 ? 2.420   -97.024  22.255  1.00 37.71  ? 113  THR D CB  1 
ATOM   6339  O  OG1 . THR D  4  113 ? 1.760   -97.198  20.992  1.00 36.37  ? 113  THR D OG1 1 
ATOM   6340  C  CG2 . THR D  4  113 ? 2.789   -95.562  22.414  1.00 36.09  ? 113  THR D CG2 1 
ATOM   6341  N  N   . GLN D  4  114 ? 3.761   -98.554  24.639  1.00 38.08  ? 114  GLN D N   1 
ATOM   6342  C  CA  . GLN D  4  114 ? 4.286   -98.653  25.998  1.00 38.77  ? 114  GLN D CA  1 
ATOM   6343  C  C   . GLN D  4  114 ? 5.733   -99.130  26.021  1.00 39.23  ? 114  GLN D C   1 
ATOM   6344  O  O   . GLN D  4  114 ? 6.530   -98.687  26.841  1.00 39.05  ? 114  GLN D O   1 
ATOM   6345  C  CB  . GLN D  4  114 ? 3.424   -99.607  26.821  1.00 38.79  ? 114  GLN D CB  1 
ATOM   6346  C  CG  . GLN D  4  114 ? 3.864   -99.761  28.255  1.00 39.67  ? 114  GLN D CG  1 
ATOM   6347  C  CD  . GLN D  4  114 ? 3.732   -98.467  29.024  1.00 42.37  ? 114  GLN D CD  1 
ATOM   6348  O  OE1 . GLN D  4  114 ? 4.713   -97.745  29.246  1.00 42.54  ? 114  GLN D OE1 1 
ATOM   6349  N  NE2 . GLN D  4  114 ? 2.506   -98.148  29.414  1.00 43.11  ? 114  GLN D NE2 1 
ATOM   6350  N  N   . SER D  4  115 ? 6.063   -100.040 25.111  1.00 40.15  ? 115  SER D N   1 
ATOM   6351  C  CA  . SER D  4  115 ? 7.401   -100.596 25.030  1.00 40.85  ? 115  SER D CA  1 
ATOM   6352  C  C   . SER D  4  115 ? 8.382   -99.529  24.566  1.00 41.45  ? 115  SER D C   1 
ATOM   6353  O  O   . SER D  4  115 ? 9.470   -99.401  25.124  1.00 41.62  ? 115  SER D O   1 
ATOM   6354  C  CB  . SER D  4  115 ? 7.428   -101.807 24.093  1.00 40.78  ? 115  SER D CB  1 
ATOM   6355  O  OG  . SER D  4  115 ? 8.752   -102.282 23.915  1.00 40.75  ? 115  SER D OG  1 
ATOM   6356  N  N   . VAL D  4  116 ? 7.991   -98.765  23.548  1.00 42.16  ? 116  VAL D N   1 
ATOM   6357  C  CA  . VAL D  4  116 ? 8.815   -97.659  23.051  1.00 42.68  ? 116  VAL D CA  1 
ATOM   6358  C  C   . VAL D  4  116 ? 8.982   -96.600  24.136  1.00 43.26  ? 116  VAL D C   1 
ATOM   6359  O  O   . VAL D  4  116 ? 10.040  -95.991  24.252  1.00 43.17  ? 116  VAL D O   1 
ATOM   6360  C  CB  . VAL D  4  116 ? 8.231   -97.050  21.757  1.00 42.60  ? 116  VAL D CB  1 
ATOM   6361  C  CG1 . VAL D  4  116 ? 8.916   -95.762  21.396  1.00 41.77  ? 116  VAL D CG1 1 
ATOM   6362  C  CG2 . VAL D  4  116 ? 8.357   -98.038  20.611  1.00 42.51  ? 116  VAL D CG2 1 
ATOM   6363  N  N   . CYS D  4  117 ? 7.950   -96.406  24.953  1.00 44.31  ? 117  CYS D N   1 
ATOM   6364  C  CA  . CYS D  4  117 ? 8.039   -95.444  26.056  1.00 45.44  ? 117  CYS D CA  1 
ATOM   6365  C  C   . CYS D  4  117 ? 8.910   -95.922  27.219  1.00 46.01  ? 117  CYS D C   1 
ATOM   6366  O  O   . CYS D  4  117 ? 9.563   -95.116  27.893  1.00 46.16  ? 117  CYS D O   1 
ATOM   6367  C  CB  . CYS D  4  117 ? 6.654   -95.013  26.517  1.00 45.41  ? 117  CYS D CB  1 
ATOM   6368  S  SG  . CYS D  4  117 ? 5.886   -93.853  25.332  1.00 47.35  ? 117  CYS D SG  1 
ATOM   6369  N  N   . ASP D  4  118 ? 8.941   -97.241  27.429  1.00 46.81  ? 118  ASP D N   1 
ATOM   6370  C  CA  . ASP D  4  118 ? 9.861   -97.867  28.391  1.00 46.93  ? 118  ASP D CA  1 
ATOM   6371  C  C   . ASP D  4  118 ? 11.321  -97.608  28.001  1.00 46.79  ? 118  ASP D C   1 
ATOM   6372  O  O   . ASP D  4  118 ? 12.147  -97.325  28.864  1.00 46.88  ? 118  ASP D O   1 
ATOM   6373  C  CB  . ASP D  4  118 ? 9.588   -99.378  28.516  1.00 47.14  ? 118  ASP D CB  1 
ATOM   6374  C  CG  . ASP D  4  118 ? 8.319   -99.696  29.329  1.00 47.88  ? 118  ASP D CG  1 
ATOM   6375  O  OD1 . ASP D  4  118 ? 7.863   -100.867 29.296  1.00 48.29  ? 118  ASP D OD1 1 
ATOM   6376  O  OD2 . ASP D  4  118 ? 7.776   -98.787  29.996  1.00 47.95  ? 118  ASP D OD2 1 
ATOM   6377  N  N   . LEU D  4  119 ? 11.622  -97.694  26.704  1.00 46.70  ? 119  LEU D N   1 
ATOM   6378  C  CA  . LEU D  4  119 ? 12.963  -97.432  26.185  1.00 46.88  ? 119  LEU D CA  1 
ATOM   6379  C  C   . LEU D  4  119 ? 13.343  -95.980  26.445  1.00 47.39  ? 119  LEU D C   1 
ATOM   6380  O  O   . LEU D  4  119 ? 14.474  -95.681  26.821  1.00 47.56  ? 119  LEU D O   1 
ATOM   6381  C  CB  . LEU D  4  119 ? 13.021  -97.694  24.679  1.00 46.54  ? 119  LEU D CB  1 
ATOM   6382  C  CG  . LEU D  4  119 ? 14.289  -98.182  23.952  1.00 46.31  ? 119  LEU D CG  1 
ATOM   6383  C  CD1 . LEU D  4  119 ? 14.394  -97.517  22.585  1.00 45.09  ? 119  LEU D CD1 1 
ATOM   6384  C  CD2 . LEU D  4  119 ? 15.593  -97.985  24.709  1.00 46.01  ? 119  LEU D CD2 1 
ATOM   6385  N  N   . ALA D  4  120 ? 12.376  -95.086  26.251  1.00 47.99  ? 120  ALA D N   1 
ATOM   6386  C  CA  . ALA D  4  120 ? 12.581  -93.644  26.385  1.00 48.26  ? 120  ALA D CA  1 
ATOM   6387  C  C   . ALA D  4  120 ? 12.978  -93.217  27.803  1.00 48.57  ? 120  ALA D C   1 
ATOM   6388  O  O   . ALA D  4  120 ? 13.821  -92.340  27.975  1.00 48.32  ? 120  ALA D O   1 
ATOM   6389  C  CB  . ALA D  4  120 ? 11.333  -92.901  25.935  1.00 48.03  ? 120  ALA D CB  1 
ATOM   6390  N  N   . LEU D  4  121 ? 12.368  -93.849  28.805  1.00 49.23  ? 121  LEU D N   1 
ATOM   6391  C  CA  . LEU D  4  121 ? 12.626  -93.541  30.212  1.00 49.86  ? 121  LEU D CA  1 
ATOM   6392  C  C   . LEU D  4  121 ? 14.089  -93.787  30.602  1.00 50.32  ? 121  LEU D C   1 
ATOM   6393  O  O   . LEU D  4  121 ? 14.612  -93.132  31.512  1.00 50.15  ? 121  LEU D O   1 
ATOM   6394  C  CB  . LEU D  4  121 ? 11.666  -94.350  31.128  1.00 49.59  ? 121  LEU D CB  1 
ATOM   6395  N  N   . ARG D  4  122 ? 14.744  -94.708  29.891  1.00 51.08  ? 122  ARG D N   1 
ATOM   6396  C  CA  . ARG D  4  122 ? 16.048  -95.242  30.295  1.00 51.96  ? 122  ARG D CA  1 
ATOM   6397  C  C   . ARG D  4  122 ? 17.217  -94.293  30.015  1.00 52.59  ? 122  ARG D C   1 
ATOM   6398  O  O   . ARG D  4  122 ? 18.151  -94.632  29.266  1.00 52.67  ? 122  ARG D O   1 
ATOM   6399  C  CB  . ARG D  4  122 ? 16.294  -96.660  29.674  1.00 51.82  ? 122  ARG D CB  1 
ATOM   6400  N  N   . MET D  4  134 ? 22.087  -93.909  29.154  1.00 53.37  ? 128  MET D N   1 
ATOM   6401  C  CA  . MET D  4  134 ? 22.028  -93.422  27.785  1.00 51.80  ? 128  MET D CA  1 
ATOM   6402  C  C   . MET D  4  134 ? 22.075  -91.967  28.279  1.00 50.77  ? 128  MET D C   1 
ATOM   6403  O  O   . MET D  4  134 ? 21.445  -91.662  29.301  1.00 50.67  ? 128  MET D O   1 
ATOM   6404  C  CB  . MET D  4  134 ? 20.678  -93.779  27.135  1.00 51.95  ? 128  MET D CB  1 
ATOM   6405  C  CG  . MET D  4  134 ? 20.157  -92.823  26.067  1.00 50.97  ? 128  MET D CG  1 
ATOM   6406  S  SD  . MET D  4  134 ? 18.490  -93.243  25.457  1.00 51.59  ? 128  MET D SD  1 
ATOM   6407  C  CE  . MET D  4  134 ? 17.387  -92.595  26.694  1.00 50.70  ? 128  MET D CE  1 
ATOM   6408  N  N   . SER D  4  135 ? 22.847  -91.086  27.647  1.00 49.19  ? 129  SER D N   1 
ATOM   6409  C  CA  . SER D  4  135 ? 23.236  -89.844  28.344  1.00 47.65  ? 129  SER D CA  1 
ATOM   6410  C  C   . SER D  4  135 ? 22.149  -88.758  28.454  1.00 46.60  ? 129  SER D C   1 
ATOM   6411  O  O   . SER D  4  135 ? 22.183  -87.934  29.375  1.00 46.70  ? 129  SER D O   1 
ATOM   6412  C  CB  . SER D  4  135 ? 24.537  -89.273  27.776  1.00 47.65  ? 129  SER D CB  1 
ATOM   6413  O  OG  . SER D  4  135 ? 24.300  -88.496  26.614  1.00 48.64  ? 129  SER D OG  1 
ATOM   6414  N  N   . ARG D  4  136 ? 21.187  -88.774  27.530  1.00 45.00  ? 130  ARG D N   1 
ATOM   6415  C  CA  . ARG D  4  136 ? 20.195  -87.700  27.385  1.00 43.16  ? 130  ARG D CA  1 
ATOM   6416  C  C   . ARG D  4  136 ? 18.853  -88.272  26.931  1.00 42.50  ? 130  ARG D C   1 
ATOM   6417  O  O   . ARG D  4  136 ? 18.817  -89.341  26.335  1.00 42.38  ? 130  ARG D O   1 
ATOM   6418  C  CB  . ARG D  4  136 ? 20.691  -86.680  26.357  1.00 42.66  ? 130  ARG D CB  1 
ATOM   6419  C  CG  . ARG D  4  136 ? 20.915  -87.270  24.971  1.00 41.01  ? 130  ARG D CG  1 
ATOM   6420  C  CD  . ARG D  4  136 ? 21.337  -86.219  23.970  1.00 38.96  ? 130  ARG D CD  1 
ATOM   6421  N  NE  . ARG D  4  136 ? 21.716  -86.785  22.676  1.00 36.29  ? 130  ARG D NE  1 
ATOM   6422  C  CZ  . ARG D  4  136 ? 20.861  -87.144  21.717  1.00 35.19  ? 130  ARG D CZ  1 
ATOM   6423  N  NH1 . ARG D  4  136 ? 19.542  -87.016  21.886  1.00 33.34  ? 130  ARG D NH1 1 
ATOM   6424  N  NH2 . ARG D  4  136 ? 21.333  -87.643  20.580  1.00 32.79  ? 130  ARG D NH2 1 
ATOM   6425  N  N   . PRO D  4  137 ? 17.738  -87.565  27.196  1.00 41.91  ? 131  PRO D N   1 
ATOM   6426  C  CA  . PRO D  4  137 ? 16.492  -88.087  26.614  1.00 41.45  ? 131  PRO D CA  1 
ATOM   6427  C  C   . PRO D  4  137 ? 16.565  -88.052  25.087  1.00 40.94  ? 131  PRO D C   1 
ATOM   6428  O  O   . PRO D  4  137 ? 17.420  -87.361  24.536  1.00 40.97  ? 131  PRO D O   1 
ATOM   6429  C  CB  . PRO D  4  137 ? 15.414  -87.109  27.119  1.00 41.31  ? 131  PRO D CB  1 
ATOM   6430  C  CG  . PRO D  4  137 ? 16.033  -86.354  28.241  1.00 41.31  ? 131  PRO D CG  1 
ATOM   6431  C  CD  . PRO D  4  137 ? 17.517  -86.344  27.995  1.00 41.77  ? 131  PRO D CD  1 
ATOM   6432  N  N   . PHE D  4  138 ? 15.705  -88.814  24.415  1.00 40.51  ? 132  PHE D N   1 
ATOM   6433  C  CA  . PHE D  4  138 ? 15.588  -88.729  22.964  1.00 40.17  ? 132  PHE D CA  1 
ATOM   6434  C  C   . PHE D  4  138 ? 15.043  -87.355  22.585  1.00 40.14  ? 132  PHE D C   1 
ATOM   6435  O  O   . PHE D  4  138 ? 14.207  -86.791  23.306  1.00 39.96  ? 132  PHE D O   1 
ATOM   6436  C  CB  . PHE D  4  138 ? 14.616  -89.776  22.438  1.00 40.18  ? 132  PHE D CB  1 
ATOM   6437  C  CG  . PHE D  4  138 ? 15.115  -91.174  22.514  1.00 41.02  ? 132  PHE D CG  1 
ATOM   6438  C  CD1 . PHE D  4  138 ? 14.344  -92.157  23.136  1.00 41.36  ? 132  PHE D CD1 1 
ATOM   6439  C  CD2 . PHE D  4  138 ? 16.343  -91.529  21.937  1.00 41.94  ? 132  PHE D CD2 1 
ATOM   6440  C  CE1 . PHE D  4  138 ? 14.787  -93.475  23.191  1.00 42.17  ? 132  PHE D CE1 1 
ATOM   6441  C  CE2 . PHE D  4  138 ? 16.807  -92.838  21.989  1.00 42.23  ? 132  PHE D CE2 1 
ATOM   6442  C  CZ  . PHE D  4  138 ? 16.026  -93.821  22.616  1.00 42.81  ? 132  PHE D CZ  1 
ATOM   6443  N  N   . GLY D  4  139 ? 15.494  -86.825  21.453  1.00 39.63  ? 133  GLY D N   1 
ATOM   6444  C  CA  . GLY D  4  139 ? 15.022  -85.528  21.001  1.00 39.41  ? 133  GLY D CA  1 
ATOM   6445  C  C   . GLY D  4  139 ? 14.046  -85.600  19.845  1.00 39.27  ? 133  GLY D C   1 
ATOM   6446  O  O   . GLY D  4  139 ? 14.152  -84.829  18.877  1.00 39.32  ? 133  GLY D O   1 
ATOM   6447  N  N   . VAL D  4  140 ? 13.087  -86.513  19.946  1.00 38.83  ? 134  VAL D N   1 
ATOM   6448  C  CA  . VAL D  4  140 ? 12.159  -86.769  18.844  1.00 38.78  ? 134  VAL D CA  1 
ATOM   6449  C  C   . VAL D  4  140 ? 10.866  -87.345  19.399  1.00 38.85  ? 134  VAL D C   1 
ATOM   6450  O  O   . VAL D  4  140 ? 10.889  -88.079  20.389  1.00 38.96  ? 134  VAL D O   1 
ATOM   6451  C  CB  . VAL D  4  140 ? 12.788  -87.717  17.777  1.00 38.95  ? 134  VAL D CB  1 
ATOM   6452  C  CG1 . VAL D  4  140 ? 13.128  -89.091  18.376  1.00 38.16  ? 134  VAL D CG1 1 
ATOM   6453  C  CG2 . VAL D  4  140 ? 11.892  -87.855  16.538  1.00 38.65  ? 134  VAL D CG2 1 
ATOM   6454  N  N   . ALA D  4  141 ? 9.740   -86.982  18.790  1.00 38.56  ? 135  ALA D N   1 
ATOM   6455  C  CA  . ALA D  4  141 ? 8.459   -87.551  19.190  1.00 38.49  ? 135  ALA D CA  1 
ATOM   6456  C  C   . ALA D  4  141 ? 7.874   -88.394  18.071  1.00 38.53  ? 135  ALA D C   1 
ATOM   6457  O  O   . ALA D  4  141 ? 8.230   -88.225  16.895  1.00 38.36  ? 135  ALA D O   1 
ATOM   6458  C  CB  . ALA D  4  141 ? 7.492   -86.474  19.611  1.00 38.60  ? 135  ALA D CB  1 
ATOM   6459  N  N   . LEU D  4  142 ? 6.974   -89.304  18.440  1.00 38.53  ? 136  LEU D N   1 
ATOM   6460  C  CA  . LEU D  4  142 ? 6.440   -90.259  17.482  1.00 38.83  ? 136  LEU D CA  1 
ATOM   6461  C  C   . LEU D  4  142 ? 4.931   -90.267  17.445  1.00 39.02  ? 136  LEU D C   1 
ATOM   6462  O  O   . LEU D  4  142 ? 4.266   -90.179  18.481  1.00 39.55  ? 136  LEU D O   1 
ATOM   6463  C  CB  . LEU D  4  142 ? 6.953   -91.673  17.792  1.00 38.95  ? 136  LEU D CB  1 
ATOM   6464  C  CG  . LEU D  4  142 ? 8.457   -91.968  17.736  1.00 38.64  ? 136  LEU D CG  1 
ATOM   6465  C  CD1 . LEU D  4  142 ? 8.661   -93.410  18.126  1.00 39.75  ? 136  LEU D CD1 1 
ATOM   6466  C  CD2 . LEU D  4  142 ? 9.070   -91.700  16.361  1.00 36.54  ? 136  LEU D CD2 1 
ATOM   6467  N  N   . LEU D  4  143 ? 4.396   -90.363  16.240  1.00 39.29  ? 137  LEU D N   1 
ATOM   6468  C  CA  . LEU D  4  143 ? 2.999   -90.718  16.060  1.00 39.83  ? 137  LEU D CA  1 
ATOM   6469  C  C   . LEU D  4  143 ? 2.965   -92.171  15.630  1.00 39.89  ? 137  LEU D C   1 
ATOM   6470  O  O   . LEU D  4  143 ? 3.473   -92.531  14.566  1.00 39.48  ? 137  LEU D O   1 
ATOM   6471  C  CB  . LEU D  4  143 ? 2.328   -89.845  14.997  1.00 39.99  ? 137  LEU D CB  1 
ATOM   6472  C  CG  . LEU D  4  143 ? 2.225   -88.348  15.278  1.00 40.30  ? 137  LEU D CG  1 
ATOM   6473  C  CD1 . LEU D  4  143 ? 1.754   -87.627  14.024  1.00 39.03  ? 137  LEU D CD1 1 
ATOM   6474  C  CD2 . LEU D  4  143 ? 1.310   -88.073  16.474  1.00 40.38  ? 137  LEU D CD2 1 
ATOM   6475  N  N   . ILE D  4  144 ? 2.377   -92.999  16.479  1.00 40.20  ? 138  ILE D N   1 
ATOM   6476  C  CA  . ILE D  4  144 ? 2.317   -94.432  16.247  1.00 40.52  ? 138  ILE D CA  1 
ATOM   6477  C  C   . ILE D  4  144 ? 0.881   -94.794  15.948  1.00 40.77  ? 138  ILE D C   1 
ATOM   6478  O  O   . ILE D  4  144 ? -0.001  -94.595  16.788  1.00 41.18  ? 138  ILE D O   1 
ATOM   6479  C  CB  . ILE D  4  144 ? 2.805   -95.218  17.489  1.00 40.26  ? 138  ILE D CB  1 
ATOM   6480  C  CG1 . ILE D  4  144 ? 4.317   -95.069  17.650  1.00 39.23  ? 138  ILE D CG1 1 
ATOM   6481  C  CG2 . ILE D  4  144 ? 2.419   -96.693  17.375  1.00 40.34  ? 138  ILE D CG2 1 
ATOM   6482  C  CD1 . ILE D  4  144 ? 4.866   -95.633  18.931  1.00 38.16  ? 138  ILE D CD1 1 
ATOM   6483  N  N   . ALA D  4  145 ? 0.651   -95.326  14.759  1.00 41.03  ? 139  ALA D N   1 
ATOM   6484  C  CA  . ALA D  4  145 ? -0.694  -95.691  14.339  1.00 41.58  ? 139  ALA D CA  1 
ATOM   6485  C  C   . ALA D  4  145 ? -0.792  -97.156  13.921  1.00 42.18  ? 139  ALA D C   1 
ATOM   6486  O  O   . ALA D  4  145 ? 0.134   -97.708  13.306  1.00 42.17  ? 139  ALA D O   1 
ATOM   6487  C  CB  . ALA D  4  145 ? -1.132  -94.810  13.194  1.00 41.71  ? 139  ALA D CB  1 
ATOM   6488  N  N   . GLY D  4  146 ? -1.924  -97.776  14.235  1.00 42.62  ? 140  GLY D N   1 
ATOM   6489  C  CA  . GLY D  4  146 ? -2.197  -99.115  13.753  1.00 43.36  ? 140  GLY D CA  1 
ATOM   6490  C  C   . GLY D  4  146 ? -3.589  -99.618  14.036  1.00 44.10  ? 140  GLY D C   1 
ATOM   6491  O  O   . GLY D  4  146 ? -4.463  -98.871  14.482  1.00 44.09  ? 140  GLY D O   1 
ATOM   6492  N  N   . HIS D  4  147 ? -3.786  -100.903 13.771  1.00 45.16  ? 141  HIS D N   1 
ATOM   6493  C  CA  . HIS D  4  147 ? -5.043  -101.599 14.067  1.00 46.38  ? 141  HIS D CA  1 
ATOM   6494  C  C   . HIS D  4  147 ? -4.776  -102.879 14.860  1.00 46.38  ? 141  HIS D C   1 
ATOM   6495  O  O   . HIS D  4  147 ? -3.794  -103.573 14.614  1.00 46.65  ? 141  HIS D O   1 
ATOM   6496  C  CB  . HIS D  4  147 ? -5.791  -101.931 12.765  1.00 46.48  ? 141  HIS D CB  1 
ATOM   6497  C  CG  . HIS D  4  147 ? -7.079  -102.663 12.982  1.00 48.69  ? 141  HIS D CG  1 
ATOM   6498  N  ND1 . HIS D  4  147 ? -7.222  -104.011 12.729  1.00 50.01  ? 141  HIS D ND1 1 
ATOM   6499  C  CD2 . HIS D  4  147 ? -8.279  -102.238 13.446  1.00 50.41  ? 141  HIS D CD2 1 
ATOM   6500  C  CE1 . HIS D  4  147 ? -8.456  -104.383 13.021  1.00 50.36  ? 141  HIS D CE1 1 
ATOM   6501  N  NE2 . HIS D  4  147 ? -9.118  -103.326 13.459  1.00 50.95  ? 141  HIS D NE2 1 
ATOM   6502  N  N   . ASP D  4  148 ? -5.628  -103.161 15.831  1.00 46.81  ? 142  ASP D N   1 
ATOM   6503  C  CA  . ASP D  4  148 ? -5.672  -104.472 16.455  1.00 47.81  ? 142  ASP D CA  1 
ATOM   6504  C  C   . ASP D  4  148 ? -7.136  -104.849 16.746  1.00 48.93  ? 142  ASP D C   1 
ATOM   6505  O  O   . ASP D  4  148 ? -8.027  -103.999 16.644  1.00 49.37  ? 142  ASP D O   1 
ATOM   6506  C  CB  . ASP D  4  148 ? -4.757  -104.560 17.690  1.00 47.42  ? 142  ASP D CB  1 
ATOM   6507  C  CG  . ASP D  4  148 ? -5.252  -103.742 18.885  1.00 47.25  ? 142  ASP D CG  1 
ATOM   6508  O  OD1 . ASP D  4  148 ? -4.413  -103.060 19.512  1.00 46.51  ? 142  ASP D OD1 1 
ATOM   6509  O  OD2 . ASP D  4  148 ? -6.451  -103.800 19.235  1.00 47.81  ? 142  ASP D OD2 1 
ATOM   6510  N  N   . ALA D  4  149 ? -7.387  -106.112 17.086  1.00 49.73  ? 143  ALA D N   1 
ATOM   6511  C  CA  . ALA D  4  149 ? -8.758  -106.607 17.218  1.00 50.63  ? 143  ALA D CA  1 
ATOM   6512  C  C   . ALA D  4  149 ? -9.540  -106.094 18.451  1.00 51.22  ? 143  ALA D C   1 
ATOM   6513  O  O   . ALA D  4  149 ? -10.768 -106.031 18.411  1.00 51.34  ? 143  ALA D O   1 
ATOM   6514  C  CB  . ALA D  4  149 ? -8.785  -108.143 17.145  1.00 50.34  ? 143  ALA D CB  1 
ATOM   6515  N  N   . ASP D  4  150 ? -8.847  -105.723 19.526  1.00 51.77  ? 144  ASP D N   1 
ATOM   6516  C  CA  . ASP D  4  150 ? -9.532  -105.329 20.768  1.00 52.79  ? 144  ASP D CA  1 
ATOM   6517  C  C   . ASP D  4  150 ? -9.963  -103.853 20.790  1.00 52.70  ? 144  ASP D C   1 
ATOM   6518  O  O   . ASP D  4  150 ? -10.997 -103.504 21.376  1.00 52.58  ? 144  ASP D O   1 
ATOM   6519  C  CB  . ASP D  4  150 ? -8.667  -105.618 22.007  1.00 53.36  ? 144  ASP D CB  1 
ATOM   6520  C  CG  . ASP D  4  150 ? -8.299  -107.093 22.148  1.00 55.57  ? 144  ASP D CG  1 
ATOM   6521  O  OD1 . ASP D  4  150 ? -7.296  -107.532 21.516  1.00 57.67  ? 144  ASP D OD1 1 
ATOM   6522  O  OD2 . ASP D  4  150 ? -8.995  -107.803 22.913  1.00 56.34  ? 144  ASP D OD2 1 
ATOM   6523  N  N   . ASP D  4  151 A -9.156  -102.995 20.170  1.00 52.38  ? 144  ASP D N   1 
ATOM   6524  C  CA  . ASP D  4  151 A -9.379  -101.560 20.224  1.00 52.15  ? 144  ASP D CA  1 
ATOM   6525  C  C   . ASP D  4  151 A -9.448  -100.895 18.845  1.00 51.51  ? 144  ASP D C   1 
ATOM   6526  O  O   . ASP D  4  151 A -9.653  -99.691  18.742  1.00 51.62  ? 144  ASP D O   1 
ATOM   6527  C  CB  . ASP D  4  151 A -8.324  -100.895 21.113  1.00 52.54  ? 144  ASP D CB  1 
ATOM   6528  C  CG  . ASP D  4  151 A -8.575  -101.127 22.591  1.00 54.21  ? 144  ASP D CG  1 
ATOM   6529  O  OD1 . ASP D  4  151 A -7.636  -101.540 23.293  1.00 56.73  ? 144  ASP D OD1 1 
ATOM   6530  O  OD2 . ASP D  4  151 A -9.714  -100.910 23.063  1.00 56.49  ? 144  ASP D OD2 1 
ATOM   6531  N  N   . GLY D  4  152 ? -9.292  -101.682 17.788  1.00 50.80  ? 145  GLY D N   1 
ATOM   6532  C  CA  . GLY D  4  152 ? -9.446  -101.171 16.428  1.00 49.99  ? 145  GLY D CA  1 
ATOM   6533  C  C   . GLY D  4  152 ? -8.352  -100.209 16.027  1.00 49.44  ? 145  GLY D C   1 
ATOM   6534  O  O   . GLY D  4  152 ? -7.211  -100.348 16.460  1.00 50.02  ? 145  GLY D O   1 
ATOM   6535  N  N   . TYR D  4  153 ? -8.700  -99.227  15.200  1.00 48.85  ? 146  TYR D N   1 
ATOM   6536  C  CA  . TYR D  4  153 ? -7.742  -98.220  14.736  1.00 48.04  ? 146  TYR D CA  1 
ATOM   6537  C  C   . TYR D  4  153 ? -7.352  -97.238  15.834  1.00 47.68  ? 146  TYR D C   1 
ATOM   6538  O  O   . TYR D  4  153 ? -8.202  -96.742  16.560  1.00 47.43  ? 146  TYR D O   1 
ATOM   6539  C  CB  . TYR D  4  153 ? -8.306  -97.466  13.552  1.00 47.84  ? 146  TYR D CB  1 
ATOM   6540  C  CG  . TYR D  4  153 ? -8.546  -98.335  12.359  1.00 47.72  ? 146  TYR D CG  1 
ATOM   6541  C  CD1 . TYR D  4  153 ? -7.501  -98.686  11.506  1.00 47.24  ? 146  TYR D CD1 1 
ATOM   6542  C  CD2 . TYR D  4  153 ? -9.827  -98.799  12.069  1.00 47.80  ? 146  TYR D CD2 1 
ATOM   6543  C  CE1 . TYR D  4  153 ? -7.728  -99.492  10.397  1.00 47.36  ? 146  TYR D CE1 1 
ATOM   6544  C  CE2 . TYR D  4  153 ? -10.064 -99.595  10.963  1.00 47.48  ? 146  TYR D CE2 1 
ATOM   6545  C  CZ  . TYR D  4  153 ? -9.015  -99.936  10.136  1.00 47.49  ? 146  TYR D CZ  1 
ATOM   6546  O  OH  . TYR D  4  153 ? -9.269  -100.725 9.048   1.00 49.16  ? 146  TYR D OH  1 
ATOM   6547  N  N   . GLN D  4  154 ? -6.056  -96.973  15.951  1.00 47.58  ? 147  GLN D N   1 
ATOM   6548  C  CA  . GLN D  4  154 ? -5.520  -96.210  17.072  1.00 47.63  ? 147  GLN D CA  1 
ATOM   6549  C  C   . GLN D  4  154 ? -4.373  -95.285  16.672  1.00 47.56  ? 147  GLN D C   1 
ATOM   6550  O  O   . GLN D  4  154 ? -3.551  -95.613  15.802  1.00 47.67  ? 147  GLN D O   1 
ATOM   6551  C  CB  . GLN D  4  154 ? -5.032  -97.148  18.169  1.00 47.66  ? 147  GLN D CB  1 
ATOM   6552  C  CG  . GLN D  4  154 ? -6.119  -97.713  19.062  1.00 48.23  ? 147  GLN D CG  1 
ATOM   6553  C  CD  . GLN D  4  154 ? -5.739  -99.072  19.625  1.00 48.97  ? 147  GLN D CD  1 
ATOM   6554  O  OE1 . GLN D  4  154 ? -5.699  -100.067 18.896  1.00 49.18  ? 147  GLN D OE1 1 
ATOM   6555  N  NE2 . GLN D  4  154 ? -5.465  -99.124  20.925  1.00 48.68  ? 147  GLN D NE2 1 
ATOM   6556  N  N   . LEU D  4  155 ? -4.325  -94.128  17.330  1.00 47.03  ? 148  LEU D N   1 
ATOM   6557  C  CA  . LEU D  4  155 ? -3.249  -93.175  17.133  1.00 46.34  ? 148  LEU D CA  1 
ATOM   6558  C  C   . LEU D  4  155 ? -2.662  -92.824  18.487  1.00 45.77  ? 148  LEU D C   1 
ATOM   6559  O  O   . LEU D  4  155 ? -3.393  -92.512  19.419  1.00 45.32  ? 148  LEU D O   1 
ATOM   6560  C  CB  . LEU D  4  155 ? -3.765  -91.934  16.413  1.00 46.32  ? 148  LEU D CB  1 
ATOM   6561  C  CG  . LEU D  4  155 ? -2.768  -90.844  16.027  1.00 46.71  ? 148  LEU D CG  1 
ATOM   6562  C  CD1 . LEU D  4  155 ? -1.800  -91.303  14.938  1.00 45.74  ? 148  LEU D CD1 1 
ATOM   6563  C  CD2 . LEU D  4  155 ? -3.574  -89.641  15.573  1.00 46.62  ? 148  LEU D CD2 1 
ATOM   6564  N  N   . PHE D  4  156 ? -1.342  -92.917  18.600  1.00 45.43  ? 149  PHE D N   1 
ATOM   6565  C  CA  . PHE D  4  156 ? -0.677  -92.606  19.861  1.00 45.32  ? 149  PHE D CA  1 
ATOM   6566  C  C   . PHE D  4  156 ? 0.411   -91.578  19.652  1.00 45.58  ? 149  PHE D C   1 
ATOM   6567  O  O   . PHE D  4  156 ? 1.090   -91.569  18.613  1.00 45.44  ? 149  PHE D O   1 
ATOM   6568  C  CB  . PHE D  4  156 ? -0.096  -93.862  20.527  1.00 44.74  ? 149  PHE D CB  1 
ATOM   6569  C  CG  . PHE D  4  156 ? -1.129  -94.744  21.172  1.00 43.33  ? 149  PHE D CG  1 
ATOM   6570  C  CD1 . PHE D  4  156 ? -1.549  -94.509  22.477  1.00 42.90  ? 149  PHE D CD1 1 
ATOM   6571  C  CD2 . PHE D  4  156 ? -1.674  -95.820  20.484  1.00 41.78  ? 149  PHE D CD2 1 
ATOM   6572  C  CE1 . PHE D  4  156 ? -2.512  -95.328  23.088  1.00 41.92  ? 149  PHE D CE1 1 
ATOM   6573  C  CE2 . PHE D  4  156 ? -2.631  -96.638  21.084  1.00 40.91  ? 149  PHE D CE2 1 
ATOM   6574  C  CZ  . PHE D  4  156 ? -3.049  -96.389  22.388  1.00 40.69  ? 149  PHE D CZ  1 
ATOM   6575  N  N   . HIS D  4  157 ? 0.556   -90.700  20.637  1.00 46.01  ? 150  HIS D N   1 
ATOM   6576  C  CA  . HIS D  4  157 ? 1.655   -89.749  20.636  1.00 46.99  ? 150  HIS D CA  1 
ATOM   6577  C  C   . HIS D  4  157 ? 2.678   -90.210  21.657  1.00 47.44  ? 150  HIS D C   1 
ATOM   6578  O  O   . HIS D  4  157 ? 2.399   -90.227  22.859  1.00 47.46  ? 150  HIS D O   1 
ATOM   6579  C  CB  . HIS D  4  157 ? 1.152   -88.323  20.925  1.00 46.88  ? 150  HIS D CB  1 
ATOM   6580  C  CG  . HIS D  4  157 ? 2.232   -87.287  20.970  1.00 47.21  ? 150  HIS D CG  1 
ATOM   6581  N  ND1 . HIS D  4  157 ? 2.189   -86.208  21.828  1.00 48.22  ? 150  HIS D ND1 1 
ATOM   6582  C  CD2 . HIS D  4  157 ? 3.389   -87.168  20.275  1.00 48.25  ? 150  HIS D CD2 1 
ATOM   6583  C  CE1 . HIS D  4  157 ? 3.267   -85.463  21.654  1.00 48.36  ? 150  HIS D CE1 1 
ATOM   6584  N  NE2 . HIS D  4  157 ? 4.017   -86.029  20.723  1.00 49.16  ? 150  HIS D NE2 1 
ATOM   6585  N  N   . ALA D  4  158 ? 3.847   -90.609  21.168  1.00 48.02  ? 151  ALA D N   1 
ATOM   6586  C  CA  . ALA D  4  158 ? 4.935   -91.031  22.046  1.00 48.97  ? 151  ALA D CA  1 
ATOM   6587  C  C   . ALA D  4  158 ? 5.944   -89.899  22.269  1.00 49.33  ? 151  ALA D C   1 
ATOM   6588  O  O   . ALA D  4  158 ? 6.609   -89.460  21.327  1.00 49.30  ? 151  ALA D O   1 
ATOM   6589  C  CB  . ALA D  4  158 ? 5.625   -92.287  21.486  1.00 48.91  ? 151  ALA D CB  1 
ATOM   6590  N  N   . GLU D  4  159 ? 6.042   -89.436  23.516  1.00 49.92  ? 152  GLU D N   1 
ATOM   6591  C  CA  . GLU D  4  159 ? 6.928   -88.328  23.879  1.00 50.92  ? 152  GLU D CA  1 
ATOM   6592  C  C   . GLU D  4  159 ? 8.161   -88.831  24.618  1.00 51.16  ? 152  GLU D C   1 
ATOM   6593  O  O   . GLU D  4  159 ? 8.095   -89.866  25.284  1.00 51.49  ? 152  GLU D O   1 
ATOM   6594  C  CB  . GLU D  4  159 ? 6.200   -87.314  24.763  1.00 51.25  ? 152  GLU D CB  1 
ATOM   6595  C  CG  . GLU D  4  159 ? 5.200   -86.434  24.040  1.00 53.04  ? 152  GLU D CG  1 
ATOM   6596  C  CD  . GLU D  4  159 ? 4.839   -85.163  24.812  1.00 55.59  ? 152  GLU D CD  1 
ATOM   6597  O  OE1 . GLU D  4  159 ? 4.718   -84.105  24.154  1.00 57.09  ? 152  GLU D OE1 1 
ATOM   6598  O  OE2 . GLU D  4  159 ? 4.680   -85.210  26.060  1.00 56.04  ? 152  GLU D OE2 1 
ATOM   6599  N  N   . PRO D  4  160 ? 9.291   -88.096  24.518  1.00 51.29  ? 153  PRO D N   1 
ATOM   6600  C  CA  . PRO D  4  160 ? 10.529  -88.475  25.207  1.00 51.43  ? 153  PRO D CA  1 
ATOM   6601  C  C   . PRO D  4  160 ? 10.428  -88.420  26.731  1.00 51.65  ? 153  PRO D C   1 
ATOM   6602  O  O   . PRO D  4  160 ? 11.387  -88.752  27.416  1.00 51.52  ? 153  PRO D O   1 
ATOM   6603  C  CB  . PRO D  4  160 ? 11.544  -87.436  24.715  1.00 51.29  ? 153  PRO D CB  1 
ATOM   6604  C  CG  . PRO D  4  160 ? 10.983  -86.903  23.480  1.00 51.29  ? 153  PRO D CG  1 
ATOM   6605  C  CD  . PRO D  4  160 ? 9.503   -86.934  23.639  1.00 51.31  ? 153  PRO D CD  1 
ATOM   6606  N  N   . SER D  4  161 ? 9.284   -87.992  27.256  1.00 52.14  ? 154  SER D N   1 
ATOM   6607  C  CA  . SER D  4  161 ? 9.032   -88.057  28.700  1.00 52.49  ? 154  SER D CA  1 
ATOM   6608  C  C   . SER D  4  161 ? 8.633   -89.479  29.111  1.00 52.58  ? 154  SER D C   1 
ATOM   6609  O  O   . SER D  4  161 ? 8.470   -89.767  30.297  1.00 52.78  ? 154  SER D O   1 
ATOM   6610  C  CB  . SER D  4  161 ? 7.920   -87.090  29.087  1.00 52.33  ? 154  SER D CB  1 
ATOM   6611  O  OG  . SER D  4  161 ? 6.737   -87.412  28.382  1.00 52.74  ? 154  SER D OG  1 
ATOM   6612  N  N   . GLY D  4  162 ? 8.465   -90.355  28.119  1.00 52.43  ? 155  GLY D N   1 
ATOM   6613  C  CA  . GLY D  4  162 ? 7.976   -91.710  28.349  1.00 52.17  ? 155  GLY D CA  1 
ATOM   6614  C  C   . GLY D  4  162 ? 6.475   -91.752  28.558  1.00 51.89  ? 155  GLY D C   1 
ATOM   6615  O  O   . GLY D  4  162 ? 5.924   -92.779  28.958  1.00 52.19  ? 155  GLY D O   1 
ATOM   6616  N  N   . THR D  4  163 ? 5.821   -90.628  28.298  1.00 51.33  ? 156  THR D N   1 
ATOM   6617  C  CA  . THR D  4  163 ? 4.376   -90.528  28.376  1.00 50.98  ? 156  THR D CA  1 
ATOM   6618  C  C   . THR D  4  163 ? 3.792   -90.693  26.977  1.00 50.13  ? 156  THR D C   1 
ATOM   6619  O  O   . THR D  4  163 ? 4.423   -90.331  25.986  1.00 49.98  ? 156  THR D O   1 
ATOM   6620  C  CB  . THR D  4  163 ? 3.949   -89.162  28.961  1.00 51.27  ? 156  THR D CB  1 
ATOM   6621  O  OG1 . THR D  4  163 ? 4.762   -88.868  30.107  1.00 52.79  ? 156  THR D OG1 1 
ATOM   6622  C  CG2 . THR D  4  163 ? 2.471   -89.167  29.374  1.00 51.16  ? 156  THR D CG2 1 
ATOM   6623  N  N   . PHE D  4  164 ? 2.592   -91.249  26.901  1.00 49.02  ? 157  PHE D N   1 
ATOM   6624  C  CA  . PHE D  4  164 ? 1.926   -91.379  25.633  1.00 48.56  ? 157  PHE D CA  1 
ATOM   6625  C  C   . PHE D  4  164 ? 0.438   -91.144  25.797  1.00 48.60  ? 157  PHE D C   1 
ATOM   6626  O  O   . PHE D  4  164 ? -0.114  -91.308  26.887  1.00 49.06  ? 157  PHE D O   1 
ATOM   6627  C  CB  . PHE D  4  164 ? 2.251   -92.725  24.951  1.00 48.50  ? 157  PHE D CB  1 
ATOM   6628  C  CG  . PHE D  4  164 ? 1.726   -93.934  25.674  1.00 48.32  ? 157  PHE D CG  1 
ATOM   6629  C  CD1 . PHE D  4  164 ? 0.565   -94.564  25.241  1.00 48.84  ? 157  PHE D CD1 1 
ATOM   6630  C  CD2 . PHE D  4  164 ? 2.393   -94.456  26.776  1.00 48.71  ? 157  PHE D CD2 1 
ATOM   6631  C  CE1 . PHE D  4  164 ? 0.070   -95.683  25.896  1.00 48.28  ? 157  PHE D CE1 1 
ATOM   6632  C  CE2 . PHE D  4  164 ? 1.895   -95.575  27.442  1.00 48.38  ? 157  PHE D CE2 1 
ATOM   6633  C  CZ  . PHE D  4  164 ? 0.733   -96.186  26.997  1.00 47.55  ? 157  PHE D CZ  1 
ATOM   6634  N  N   . TYR D  4  165 ? -0.201  -90.744  24.709  1.00 48.22  ? 158  TYR D N   1 
ATOM   6635  C  CA  . TYR D  4  165 ? -1.593  -90.372  24.719  1.00 47.90  ? 158  TYR D CA  1 
ATOM   6636  C  C   . TYR D  4  165 ? -2.211  -90.917  23.465  1.00 47.25  ? 158  TYR D C   1 
ATOM   6637  O  O   . TYR D  4  165 ? -1.616  -90.838  22.388  1.00 46.98  ? 158  TYR D O   1 
ATOM   6638  C  CB  . TYR D  4  165 ? -1.710  -88.852  24.629  1.00 48.62  ? 158  TYR D CB  1 
ATOM   6639  C  CG  . TYR D  4  165 ? -1.824  -88.077  25.919  1.00 50.34  ? 158  TYR D CG  1 
ATOM   6640  C  CD1 . TYR D  4  165 ? -3.082  -87.726  26.422  1.00 51.89  ? 158  TYR D CD1 1 
ATOM   6641  C  CD2 . TYR D  4  165 ? -0.679  -87.641  26.610  1.00 51.84  ? 158  TYR D CD2 1 
ATOM   6642  C  CE1 . TYR D  4  165 ? -3.215  -86.986  27.598  1.00 53.36  ? 158  TYR D CE1 1 
ATOM   6643  C  CE2 . TYR D  4  165 ? -0.796  -86.895  27.795  1.00 53.49  ? 158  TYR D CE2 1 
ATOM   6644  C  CZ  . TYR D  4  165 ? -2.073  -86.574  28.281  1.00 54.26  ? 158  TYR D CZ  1 
ATOM   6645  O  OH  . TYR D  4  165 ? -2.226  -85.846  29.442  1.00 54.89  ? 158  TYR D OH  1 
ATOM   6646  N  N   . ARG D  4  166 ? -3.416  -91.445  23.580  1.00 46.72  ? 159  ARG D N   1 
ATOM   6647  C  CA  . ARG D  4  166 ? -4.195  -91.699  22.385  1.00 46.88  ? 159  ARG D CA  1 
ATOM   6648  C  C   . ARG D  4  166 ? -4.868  -90.382  21.897  1.00 46.72  ? 159  ARG D C   1 
ATOM   6649  O  O   . ARG D  4  166 ? -5.307  -89.568  22.706  1.00 46.37  ? 159  ARG D O   1 
ATOM   6650  C  CB  . ARG D  4  166 ? -5.215  -92.814  22.637  1.00 47.00  ? 159  ARG D CB  1 
ATOM   6651  C  CG  . ARG D  4  166 ? -5.767  -93.450  21.367  1.00 47.85  ? 159  ARG D CG  1 
ATOM   6652  C  CD  . ARG D  4  166 ? -6.724  -94.565  21.701  1.00 50.50  ? 159  ARG D CD  1 
ATOM   6653  N  NE  . ARG D  4  166 ? -7.635  -94.841  20.592  1.00 52.71  ? 159  ARG D NE  1 
ATOM   6654  C  CZ  . ARG D  4  166 ? -8.676  -95.669  20.665  1.00 53.71  ? 159  ARG D CZ  1 
ATOM   6655  N  NH1 . ARG D  4  166 ? -8.947  -96.322  21.792  1.00 54.00  ? 159  ARG D NH1 1 
ATOM   6656  N  NH2 . ARG D  4  166 ? -9.446  -95.851  19.604  1.00 53.95  ? 159  ARG D NH2 1 
ATOM   6657  N  N   . TYR D  4  167 ? -4.914  -90.176  20.583  1.00 46.43  ? 160  TYR D N   1 
ATOM   6658  C  CA  . TYR D  4  167 ? -5.571  -89.017  19.991  1.00 46.57  ? 160  TYR D CA  1 
ATOM   6659  C  C   . TYR D  4  167 ? -6.484  -89.474  18.855  1.00 46.57  ? 160  TYR D C   1 
ATOM   6660  O  O   . TYR D  4  167 ? -6.172  -90.452  18.167  1.00 46.80  ? 160  TYR D O   1 
ATOM   6661  C  CB  . TYR D  4  167 ? -4.531  -88.043  19.416  1.00 46.70  ? 160  TYR D CB  1 
ATOM   6662  C  CG  . TYR D  4  167 ? -3.828  -87.163  20.426  1.00 46.99  ? 160  TYR D CG  1 
ATOM   6663  C  CD1 . TYR D  4  167 ? -2.639  -87.570  21.015  1.00 46.84  ? 160  TYR D CD1 1 
ATOM   6664  C  CD2 . TYR D  4  167 ? -4.342  -85.914  20.774  1.00 47.29  ? 160  TYR D CD2 1 
ATOM   6665  C  CE1 . TYR D  4  167 ? -1.985  -86.769  21.928  1.00 48.48  ? 160  TYR D CE1 1 
ATOM   6666  C  CE2 . TYR D  4  167 ? -3.698  -85.102  21.694  1.00 47.43  ? 160  TYR D CE2 1 
ATOM   6667  C  CZ  . TYR D  4  167 ? -2.518  -85.533  22.269  1.00 49.12  ? 160  TYR D CZ  1 
ATOM   6668  O  OH  . TYR D  4  167 ? -1.850  -84.740  23.184  1.00 49.70  ? 160  TYR D OH  1 
ATOM   6669  N  N   . ASN D  4  168 ? -7.601  -88.777  18.641  1.00 46.08  ? 161  ASN D N   1 
ATOM   6670  C  CA  . ASN D  4  168 ? -8.364  -88.972  17.402  1.00 45.71  ? 161  ASN D CA  1 
ATOM   6671  C  C   . ASN D  4  168 ? -7.616  -88.329  16.229  1.00 45.29  ? 161  ASN D C   1 
ATOM   6672  O  O   . ASN D  4  168 ? -7.708  -88.774  15.076  1.00 45.31  ? 161  ASN D O   1 
ATOM   6673  C  CB  . ASN D  4  168 ? -9.784  -88.423  17.533  1.00 45.66  ? 161  ASN D CB  1 
ATOM   6674  C  CG  . ASN D  4  168 ? -10.633 -89.227  18.513  1.00 46.51  ? 161  ASN D CG  1 
ATOM   6675  O  OD1 . ASN D  4  168 ? -11.145 -88.688  19.491  1.00 46.62  ? 161  ASN D OD1 1 
ATOM   6676  N  ND2 . ASN D  4  168 ? -10.768 -90.528  18.259  1.00 46.91  ? 161  ASN D ND2 1 
ATOM   6677  N  N   . ALA D  4  169 ? -6.852  -87.292  16.552  1.00 44.80  ? 162  ALA D N   1 
ATOM   6678  C  CA  . ALA D  4  169 ? -5.971  -86.620  15.603  1.00 44.46  ? 162  ALA D CA  1 
ATOM   6679  C  C   . ALA D  4  169 ? -4.910  -85.829  16.361  1.00 44.23  ? 162  ALA D C   1 
ATOM   6680  O  O   . ALA D  4  169 ? -5.128  -85.391  17.508  1.00 44.11  ? 162  ALA D O   1 
ATOM   6681  C  CB  . ALA D  4  169 ? -6.760  -85.708  14.670  1.00 44.49  ? 162  ALA D CB  1 
ATOM   6682  N  N   . LYS D  4  170 ? -3.758  -85.659  15.723  1.00 43.86  ? 163  LYS D N   1 
ATOM   6683  C  CA  . LYS D  4  170 ? -2.632  -85.016  16.370  1.00 43.89  ? 163  LYS D CA  1 
ATOM   6684  C  C   . LYS D  4  170 ? -1.580  -84.577  15.375  1.00 44.18  ? 163  LYS D C   1 
ATOM   6685  O  O   . LYS D  4  170 ? -1.293  -85.272  14.391  1.00 44.66  ? 163  LYS D O   1 
ATOM   6686  C  CB  . LYS D  4  170 ? -2.005  -85.948  17.402  1.00 43.75  ? 163  LYS D CB  1 
ATOM   6687  C  CG  . LYS D  4  170 ? -0.785  -85.376  18.085  1.00 43.80  ? 163  LYS D CG  1 
ATOM   6688  C  CD  . LYS D  4  170 ? -1.172  -84.419  19.184  1.00 43.55  ? 163  LYS D CD  1 
ATOM   6689  C  CE  . LYS D  4  170 ? 0.055   -83.869  19.847  1.00 43.70  ? 163  LYS D CE  1 
ATOM   6690  N  NZ  . LYS D  4  170 ? -0.295  -83.282  21.145  1.00 44.01  ? 163  LYS D NZ  1 
ATOM   6691  N  N   . ALA D  4  171 ? -1.016  -83.407  15.653  1.00 44.20  ? 164  ALA D N   1 
ATOM   6692  C  CA  . ALA D  4  171 ? 0.072   -82.838  14.880  1.00 44.06  ? 164  ALA D CA  1 
ATOM   6693  C  C   . ALA D  4  171 ? 1.265   -82.594  15.796  1.00 43.90  ? 164  ALA D C   1 
ATOM   6694  O  O   . ALA D  4  171 ? 1.099   -82.338  16.998  1.00 43.41  ? 164  ALA D O   1 
ATOM   6695  C  CB  . ALA D  4  171 ? -0.373  -81.543  14.240  1.00 44.37  ? 164  ALA D CB  1 
ATOM   6696  N  N   . ILE D  4  172 ? 2.463   -82.707  15.228  1.00 44.02  ? 165  ILE D N   1 
ATOM   6697  C  CA  . ILE D  4  172 ? 3.706   -82.523  15.986  1.00 44.48  ? 165  ILE D CA  1 
ATOM   6698  C  C   . ILE D  4  172 ? 4.747   -81.814  15.123  1.00 45.15  ? 165  ILE D C   1 
ATOM   6699  O  O   . ILE D  4  172 ? 4.694   -81.897  13.894  1.00 45.13  ? 165  ILE D O   1 
ATOM   6700  C  CB  . ILE D  4  172 ? 4.288   -83.873  16.556  1.00 44.40  ? 165  ILE D CB  1 
ATOM   6701  C  CG1 . ILE D  4  172 ? 4.432   -84.935  15.459  1.00 43.96  ? 165  ILE D CG1 1 
ATOM   6702  C  CG2 . ILE D  4  172 ? 3.464   -84.388  17.745  1.00 42.80  ? 165  ILE D CG2 1 
ATOM   6703  C  CD1 . ILE D  4  172 ? 5.173   -86.203  15.913  1.00 44.02  ? 165  ILE D CD1 1 
ATOM   6704  N  N   . GLY D  4  173 ? 5.679   -81.117  15.764  1.00 46.04  ? 166  GLY D N   1 
ATOM   6705  C  CA  . GLY D  4  173 ? 6.700   -80.347  15.043  1.00 47.84  ? 166  GLY D CA  1 
ATOM   6706  C  C   . GLY D  4  173 ? 6.416   -78.853  14.946  1.00 49.06  ? 166  GLY D C   1 
ATOM   6707  O  O   . GLY D  4  173 ? 5.593   -78.316  15.702  1.00 48.97  ? 166  GLY D O   1 
ATOM   6708  N  N   . SER D  4  174 ? 7.081   -78.183  14.004  1.00 50.28  ? 167  SER D N   1 
ATOM   6709  C  CA  . SER D  4  174 ? 7.033   -76.715  13.922  1.00 51.71  ? 167  SER D CA  1 
ATOM   6710  C  C   . SER D  4  174 ? 5.649   -76.146  13.666  1.00 52.58  ? 167  SER D C   1 
ATOM   6711  O  O   . SER D  4  174 ? 5.316   -75.095  14.199  1.00 53.07  ? 167  SER D O   1 
ATOM   6712  C  CB  . SER D  4  174 ? 8.060   -76.145  12.929  1.00 51.63  ? 167  SER D CB  1 
ATOM   6713  O  OG  . SER D  4  174 ? 7.881   -76.691  11.642  1.00 51.92  ? 167  SER D OG  1 
ATOM   6714  N  N   . GLY D  4  175 ? 4.828   -76.835  12.886  1.00 53.54  ? 168  GLY D N   1 
ATOM   6715  C  CA  . GLY D  4  175 ? 3.474   -76.347  12.665  1.00 55.16  ? 168  GLY D CA  1 
ATOM   6716  C  C   . GLY D  4  175 ? 2.439   -76.700  13.727  1.00 56.51  ? 168  GLY D C   1 
ATOM   6717  O  O   . GLY D  4  175 ? 1.254   -76.432  13.536  1.00 56.75  ? 168  GLY D O   1 
ATOM   6718  N  N   . SER D  4  176 ? 2.863   -77.272  14.853  1.00 57.79  ? 169  SER D N   1 
ATOM   6719  C  CA  . SER D  4  176 ? 1.926   -78.052  15.690  1.00 59.14  ? 169  SER D CA  1 
ATOM   6720  C  C   . SER D  4  176 ? 0.816   -77.300  16.439  1.00 60.25  ? 169  SER D C   1 
ATOM   6721  O  O   . SER D  4  176 ? -0.267  -77.844  16.643  1.00 60.41  ? 169  SER D O   1 
ATOM   6722  C  CB  . SER D  4  176 ? 2.667   -79.009  16.636  1.00 58.82  ? 169  SER D CB  1 
ATOM   6723  O  OG  . SER D  4  176 ? 3.045   -78.386  17.847  1.00 58.87  ? 169  SER D OG  1 
ATOM   6724  N  N   . GLU D  4  177 ? 1.075   -76.067  16.855  1.00 61.70  ? 170  GLU D N   1 
ATOM   6725  C  CA  . GLU D  4  177 ? 0.050   -75.294  17.574  1.00 63.20  ? 170  GLU D CA  1 
ATOM   6726  C  C   . GLU D  4  177 ? -1.066  -74.861  16.613  1.00 63.15  ? 170  GLU D C   1 
ATOM   6727  O  O   . GLU D  4  177 ? -2.256  -74.905  16.961  1.00 63.14  ? 170  GLU D O   1 
ATOM   6728  C  CB  . GLU D  4  177 ? 0.662   -74.110  18.360  1.00 63.60  ? 170  GLU D CB  1 
ATOM   6729  C  CG  . GLU D  4  177 ? 1.225   -72.925  17.525  1.00 67.09  ? 170  GLU D CG  1 
ATOM   6730  C  CD  . GLU D  4  177 ? 2.275   -73.335  16.469  1.00 71.46  ? 170  GLU D CD  1 
ATOM   6731  O  OE1 . GLU D  4  177 ? 2.044   -73.055  15.257  1.00 72.98  ? 170  GLU D OE1 1 
ATOM   6732  O  OE2 . GLU D  4  177 ? 3.315   -73.943  16.846  1.00 72.14  ? 170  GLU D OE2 1 
ATOM   6733  N  N   . GLY D  4  178 ? -0.665  -74.485  15.397  1.00 63.16  ? 171  GLY D N   1 
ATOM   6734  C  CA  . GLY D  4  178 ? -1.593  -74.061  14.354  1.00 63.35  ? 171  GLY D CA  1 
ATOM   6735  C  C   . GLY D  4  178 ? -2.429  -75.228  13.879  1.00 63.31  ? 171  GLY D C   1 
ATOM   6736  O  O   . GLY D  4  178 ? -3.654  -75.215  14.014  1.00 63.64  ? 171  GLY D O   1 
ATOM   6737  N  N   . ALA D  4  179 ? -1.749  -76.241  13.347  1.00 63.02  ? 172  ALA D N   1 
ATOM   6738  C  CA  . ALA D  4  179 ? -2.377  -77.482  12.893  1.00 62.81  ? 172  ALA D CA  1 
ATOM   6739  C  C   . ALA D  4  179 ? -3.304  -78.133  13.929  1.00 62.67  ? 172  ALA D C   1 
ATOM   6740  O  O   . ALA D  4  179 ? -4.368  -78.637  13.579  1.00 62.46  ? 172  ALA D O   1 
ATOM   6741  C  CB  . ALA D  4  179 ? -1.316  -78.468  12.432  1.00 62.65  ? 172  ALA D CB  1 
ATOM   6742  N  N   . GLN D  4  180 ? -2.910  -78.115  15.196  1.00 62.80  ? 173  GLN D N   1 
ATOM   6743  C  CA  . GLN D  4  180 ? -3.733  -78.734  16.232  1.00 63.28  ? 173  GLN D CA  1 
ATOM   6744  C  C   . GLN D  4  180 ? -5.101  -78.067  16.306  1.00 63.62  ? 173  GLN D C   1 
ATOM   6745  O  O   . GLN D  4  180 ? -6.125  -78.748  16.233  1.00 63.83  ? 173  GLN D O   1 
ATOM   6746  C  CB  . GLN D  4  180 ? -3.025  -78.743  17.602  1.00 63.23  ? 173  GLN D CB  1 
ATOM   6747  C  CG  . GLN D  4  180 ? -3.654  -79.666  18.659  1.00 62.42  ? 173  GLN D CG  1 
ATOM   6748  C  CD  . GLN D  4  180 ? -3.656  -81.154  18.284  1.00 61.12  ? 173  GLN D CD  1 
ATOM   6749  O  OE1 . GLN D  4  180 ? -3.021  -81.581  17.319  1.00 59.50  ? 173  GLN D OE1 1 
ATOM   6750  N  NE2 . GLN D  4  180 ? -4.373  -81.947  19.069  1.00 61.25  ? 173  GLN D NE2 1 
ATOM   6751  N  N   . ALA D  4  181 ? -5.111  -76.741  16.422  1.00 63.96  ? 174  ALA D N   1 
ATOM   6752  C  CA  . ALA D  4  181 ? -6.361  -75.980  16.472  1.00 64.38  ? 174  ALA D CA  1 
ATOM   6753  C  C   . ALA D  4  181 ? -7.227  -76.258  15.242  1.00 64.43  ? 174  ALA D C   1 
ATOM   6754  O  O   . ALA D  4  181 ? -8.442  -76.408  15.350  1.00 64.39  ? 174  ALA D O   1 
ATOM   6755  C  CB  . ALA D  4  181 ? -6.073  -74.486  16.603  1.00 64.59  ? 174  ALA D CB  1 
ATOM   6756  N  N   . GLU D  4  182 ? -6.578  -76.334  14.084  1.00 64.44  ? 175  GLU D N   1 
ATOM   6757  C  CA  . GLU D  4  182 ? -7.222  -76.670  12.823  1.00 64.74  ? 175  GLU D CA  1 
ATOM   6758  C  C   . GLU D  4  182 ? -7.901  -78.042  12.887  1.00 64.74  ? 175  GLU D C   1 
ATOM   6759  O  O   . GLU D  4  182 ? -9.021  -78.206  12.398  1.00 64.82  ? 175  GLU D O   1 
ATOM   6760  C  CB  . GLU D  4  182 ? -6.181  -76.630  11.694  1.00 64.95  ? 175  GLU D CB  1 
ATOM   6761  C  CG  . GLU D  4  182 ? -6.738  -76.606  10.265  1.00 66.38  ? 175  GLU D CG  1 
ATOM   6762  C  CD  . GLU D  4  182 ? -7.395  -75.275  9.862   1.00 68.45  ? 175  GLU D CD  1 
ATOM   6763  O  OE1 . GLU D  4  182 ? -8.343  -75.322  9.040   1.00 69.58  ? 175  GLU D OE1 1 
ATOM   6764  O  OE2 . GLU D  4  182 ? -6.973  -74.195  10.351  1.00 68.30  ? 175  GLU D OE2 1 
ATOM   6765  N  N   . LEU D  4  183 ? -7.220  -79.017  13.496  1.00 64.77  ? 176  LEU D N   1 
ATOM   6766  C  CA  . LEU D  4  183 ? -7.774  -80.363  13.697  1.00 64.40  ? 176  LEU D CA  1 
ATOM   6767  C  C   . LEU D  4  183 ? -8.949  -80.376  14.675  1.00 64.57  ? 176  LEU D C   1 
ATOM   6768  O  O   . LEU D  4  183 ? -9.882  -81.157  14.498  1.00 64.62  ? 176  LEU D O   1 
ATOM   6769  C  CB  . LEU D  4  183 ? -6.689  -81.347  14.161  1.00 64.23  ? 176  LEU D CB  1 
ATOM   6770  C  CG  . LEU D  4  183 ? -5.640  -81.823  13.149  1.00 62.89  ? 176  LEU D CG  1 
ATOM   6771  C  CD1 . LEU D  4  183 ? -4.439  -82.407  13.862  1.00 61.07  ? 176  LEU D CD1 1 
ATOM   6772  C  CD2 . LEU D  4  183 ? -6.222  -82.823  12.168  1.00 61.82  ? 176  LEU D CD2 1 
ATOM   6773  N  N   . LEU D  4  184 ? -8.903  -79.516  15.693  1.00 64.69  ? 177  LEU D N   1 
ATOM   6774  C  CA  . LEU D  4  184 ? -9.998  -79.385  16.660  1.00 65.25  ? 177  LEU D CA  1 
ATOM   6775  C  C   . LEU D  4  184 ? -11.335 -79.119  15.941  1.00 65.56  ? 177  LEU D C   1 
ATOM   6776  O  O   . LEU D  4  184 ? -12.400 -79.499  16.431  1.00 65.59  ? 177  LEU D O   1 
ATOM   6777  C  CB  . LEU D  4  184 ? -9.701  -78.249  17.652  1.00 65.39  ? 177  LEU D CB  1 
ATOM   6778  C  CG  . LEU D  4  184 ? -10.077 -78.212  19.152  1.00 65.97  ? 177  LEU D CG  1 
ATOM   6779  C  CD1 . LEU D  4  184 ? -11.363 -78.978  19.518  1.00 66.31  ? 177  LEU D CD1 1 
ATOM   6780  C  CD2 . LEU D  4  184 ? -8.904  -78.644  20.052  1.00 66.60  ? 177  LEU D CD2 1 
ATOM   6781  N  N   . ASN D  4  185 ? -11.266 -78.474  14.775  1.00 65.79  ? 178  ASN D N   1 
ATOM   6782  C  CA  . ASN D  4  185 ? -12.462 -78.084  14.020  1.00 66.20  ? 178  ASN D CA  1 
ATOM   6783  C  C   . ASN D  4  185 ? -12.924 -79.127  13.005  1.00 66.14  ? 178  ASN D C   1 
ATOM   6784  O  O   . ASN D  4  185 ? -14.128 -79.312  12.802  1.00 66.24  ? 178  ASN D O   1 
ATOM   6785  C  CB  . ASN D  4  185 ? -12.247 -76.748  13.282  1.00 66.24  ? 178  ASN D CB  1 
ATOM   6786  C  CG  . ASN D  4  185 ? -11.993 -75.583  14.224  1.00 66.94  ? 178  ASN D CG  1 
ATOM   6787  O  OD1 . ASN D  4  185 ? -12.471 -75.558  15.367  1.00 67.97  ? 178  ASN D OD1 1 
ATOM   6788  N  ND2 . ASN D  4  185 ? -11.232 -74.603  13.744  1.00 66.86  ? 178  ASN D ND2 1 
ATOM   6789  N  N   . GLU D  4  186 ? -11.965 -79.798  12.373  1.00 65.75  ? 179  GLU D N   1 
ATOM   6790  C  CA  . GLU D  4  186 ? -12.245 -80.593  11.181  1.00 65.45  ? 179  GLU D CA  1 
ATOM   6791  C  C   . GLU D  4  186 ? -12.566 -82.063  11.437  1.00 64.75  ? 179  GLU D C   1 
ATOM   6792  O  O   . GLU D  4  186 ? -13.185 -82.712  10.594  1.00 64.75  ? 179  GLU D O   1 
ATOM   6793  C  CB  . GLU D  4  186 ? -11.082 -80.468  10.206  1.00 65.71  ? 179  GLU D CB  1 
ATOM   6794  C  CG  . GLU D  4  186 ? -10.964 -79.102  9.560   1.00 67.47  ? 179  GLU D CG  1 
ATOM   6795  C  CD  . GLU D  4  186 ? -11.650 -79.035  8.206   1.00 70.20  ? 179  GLU D CD  1 
ATOM   6796  O  OE1 . GLU D  4  186 ? -11.209 -78.214  7.363   1.00 70.70  ? 179  GLU D OE1 1 
ATOM   6797  O  OE2 . GLU D  4  186 ? -12.619 -79.804  7.978   1.00 70.86  ? 179  GLU D OE2 1 
ATOM   6798  N  N   . TRP D  4  187 ? -12.149 -82.581  12.590  1.00 63.98  ? 180  TRP D N   1 
ATOM   6799  C  CA  . TRP D  4  187 ? -12.376 -83.984  12.938  1.00 63.29  ? 180  TRP D CA  1 
ATOM   6800  C  C   . TRP D  4  187 ? -13.775 -84.242  13.508  1.00 63.08  ? 180  TRP D C   1 
ATOM   6801  O  O   . TRP D  4  187 ? -14.216 -83.571  14.449  1.00 62.76  ? 180  TRP D O   1 
ATOM   6802  C  CB  . TRP D  4  187 ? -11.293 -84.508  13.910  1.00 63.18  ? 180  TRP D CB  1 
ATOM   6803  C  CG  . TRP D  4  187 ? -11.393 -85.995  14.161  1.00 62.04  ? 180  TRP D CG  1 
ATOM   6804  C  CD1 . TRP D  4  187 ? -10.723 -86.986  13.499  1.00 61.02  ? 180  TRP D CD1 1 
ATOM   6805  C  CD2 . TRP D  4  187 ? -12.240 -86.652  15.115  1.00 61.48  ? 180  TRP D CD2 1 
ATOM   6806  N  NE1 . TRP D  4  187 ? -11.098 -88.218  13.984  1.00 60.92  ? 180  TRP D NE1 1 
ATOM   6807  C  CE2 . TRP D  4  187 ? -12.025 -88.043  14.976  1.00 61.53  ? 180  TRP D CE2 1 
ATOM   6808  C  CE3 . TRP D  4  187 ? -13.157 -86.201  16.075  1.00 61.54  ? 180  TRP D CE3 1 
ATOM   6809  C  CZ2 . TRP D  4  187 ? -12.693 -88.987  15.764  1.00 61.71  ? 180  TRP D CZ2 1 
ATOM   6810  C  CZ3 . TRP D  4  187 ? -13.822 -87.137  16.857  1.00 61.97  ? 180  TRP D CZ3 1 
ATOM   6811  C  CH2 . TRP D  4  187 ? -13.580 -88.516  16.700  1.00 62.20  ? 180  TRP D CH2 1 
ATOM   6812  N  N   . HIS D  4  188 C -14.450 -85.229  12.923  1.00 62.90  ? 180  HIS D N   1 
ATOM   6813  C  CA  . HIS D  4  188 C -15.718 -85.764  13.437  1.00 62.92  ? 180  HIS D CA  1 
ATOM   6814  C  C   . HIS D  4  188 C -15.703 -87.307  13.415  1.00 62.93  ? 180  HIS D C   1 
ATOM   6815  O  O   . HIS D  4  188 C -15.079 -87.929  12.540  1.00 62.54  ? 180  HIS D O   1 
ATOM   6816  C  CB  . HIS D  4  188 C -16.922 -85.203  12.656  1.00 62.67  ? 180  HIS D CB  1 
ATOM   6817  C  CG  . HIS D  4  188 C -16.913 -85.541  11.194  1.00 61.86  ? 180  HIS D CG  1 
ATOM   6818  N  ND1 . HIS D  4  188 C -17.682 -86.552  10.658  1.00 61.28  ? 180  HIS D ND1 1 
ATOM   6819  C  CD2 . HIS D  4  188 C -16.227 -85.001  10.158  1.00 61.03  ? 180  HIS D CD2 1 
ATOM   6820  C  CE1 . HIS D  4  188 C -17.470 -86.620  9.355   1.00 61.31  ? 180  HIS D CE1 1 
ATOM   6821  N  NE2 . HIS D  4  188 C -16.589 -85.691  9.026   1.00 60.66  ? 180  HIS D NE2 1 
ATOM   6822  N  N   . SER D  4  189 D -16.397 -87.913  14.376  1.00 62.95  ? 180  SER D N   1 
ATOM   6823  C  CA  . SER D  4  189 D -16.364 -89.365  14.561  1.00 62.94  ? 180  SER D CA  1 
ATOM   6824  C  C   . SER D  4  189 D -17.080 -90.121  13.451  1.00 62.80  ? 180  SER D C   1 
ATOM   6825  O  O   . SER D  4  189 D -17.968 -90.927  13.728  1.00 63.29  ? 180  SER D O   1 
ATOM   6826  C  CB  . SER D  4  189 D -16.969 -89.745  15.918  1.00 63.04  ? 180  SER D CB  1 
ATOM   6827  O  OG  . SER D  4  189 D -18.381 -89.614  15.895  1.00 62.99  ? 180  SER D OG  1 
ATOM   6828  N  N   . SER D  4  190 E -16.701 -89.854  12.203  1.00 62.39  ? 180  SER D N   1 
ATOM   6829  C  CA  . SER D  4  190 E -17.276 -90.546  11.045  1.00 62.04  ? 180  SER D CA  1 
ATOM   6830  C  C   . SER D  4  190 E -16.697 -90.108  9.702   1.00 61.50  ? 180  SER D C   1 
ATOM   6831  O  O   . SER D  4  190 E -17.364 -90.221  8.680   1.00 61.34  ? 180  SER D O   1 
ATOM   6832  C  CB  . SER D  4  190 E -18.811 -90.438  11.021  1.00 62.02  ? 180  SER D CB  1 
ATOM   6833  O  OG  . SER D  4  190 E -19.226 -89.092  11.139  1.00 62.94  ? 180  SER D OG  1 
ATOM   6834  N  N   . LEU D  4  191 ? -15.460 -89.617  9.701   1.00 61.23  ? 184  LEU D N   1 
ATOM   6835  C  CA  . LEU D  4  191 ? -14.767 -89.325  8.447   1.00 61.01  ? 184  LEU D CA  1 
ATOM   6836  C  C   . LEU D  4  191 ? -14.438 -90.602  7.700   1.00 60.89  ? 184  LEU D C   1 
ATOM   6837  O  O   . LEU D  4  191 ? -14.045 -91.601  8.301   1.00 60.76  ? 184  LEU D O   1 
ATOM   6838  C  CB  . LEU D  4  191 ? -13.459 -88.568  8.673   1.00 61.07  ? 184  LEU D CB  1 
ATOM   6839  C  CG  . LEU D  4  191 ? -13.449 -87.117  9.141   1.00 61.23  ? 184  LEU D CG  1 
ATOM   6840  C  CD1 . LEU D  4  191 ? -12.760 -87.030  10.478  1.00 60.89  ? 184  LEU D CD1 1 
ATOM   6841  C  CD2 . LEU D  4  191 ? -12.712 -86.261  8.134   1.00 61.42  ? 184  LEU D CD2 1 
ATOM   6842  N  N   . THR D  4  192 ? -14.589 -90.564  6.385   1.00 60.94  ? 185  THR D N   1 
ATOM   6843  C  CA  . THR D  4  192 ? -14.061 -91.628  5.555   1.00 61.18  ? 185  THR D CA  1 
ATOM   6844  C  C   . THR D  4  192 ? -12.529 -91.514  5.524   1.00 61.15  ? 185  THR D C   1 
ATOM   6845  O  O   . THR D  4  192 ? -11.965 -90.478  5.886   1.00 60.87  ? 185  THR D O   1 
ATOM   6846  C  CB  . THR D  4  192 ? -14.674 -91.632  4.106   1.00 61.22  ? 185  THR D CB  1 
ATOM   6847  O  OG1 . THR D  4  192 ? -14.144 -90.549  3.328   1.00 61.51  ? 185  THR D OG1 1 
ATOM   6848  C  CG2 . THR D  4  192 ? -16.196 -91.540  4.151   1.00 61.23  ? 185  THR D CG2 1 
ATOM   6849  N  N   . LEU D  4  193 ? -11.865 -92.587  5.107   1.00 61.28  ? 186  LEU D N   1 
ATOM   6850  C  CA  . LEU D  4  193 ? -10.420 -92.575  4.925   1.00 61.47  ? 186  LEU D CA  1 
ATOM   6851  C  C   . LEU D  4  193 ? -10.007 -91.550  3.861   1.00 61.79  ? 186  LEU D C   1 
ATOM   6852  O  O   . LEU D  4  193 ? -8.954  -90.912  3.977   1.00 61.59  ? 186  LEU D O   1 
ATOM   6853  C  CB  . LEU D  4  193 ? -9.916  -93.971  4.537   1.00 61.39  ? 186  LEU D CB  1 
ATOM   6854  C  CG  . LEU D  4  193 ? -8.402  -94.152  4.389   1.00 60.33  ? 186  LEU D CG  1 
ATOM   6855  C  CD1 . LEU D  4  193 ? -7.752  -94.241  5.747   1.00 59.33  ? 186  LEU D CD1 1 
ATOM   6856  C  CD2 . LEU D  4  193 ? -8.098  -95.380  3.562   1.00 60.54  ? 186  LEU D CD2 1 
ATOM   6857  N  N   . LYS D  4  194 ? -10.843 -91.407  2.832   1.00 62.13  ? 187  LYS D N   1 
ATOM   6858  C  CA  . LYS D  4  194 ? -10.630 -90.407  1.776   1.00 62.31  ? 187  LYS D CA  1 
ATOM   6859  C  C   . LYS D  4  194 ? -10.701 -88.976  2.304   1.00 61.69  ? 187  LYS D C   1 
ATOM   6860  O  O   . LYS D  4  194 ? -9.879  -88.132  1.943   1.00 61.25  ? 187  LYS D O   1 
ATOM   6861  C  CB  . LYS D  4  194 ? -11.632 -90.601  0.635   1.00 62.77  ? 187  LYS D CB  1 
ATOM   6862  C  CG  . LYS D  4  194 ? -11.253 -91.705  -0.339  1.00 64.07  ? 187  LYS D CG  1 
ATOM   6863  C  CD  . LYS D  4  194 ? -11.678 -91.339  -1.741  1.00 67.03  ? 187  LYS D CD  1 
ATOM   6864  C  CE  . LYS D  4  194 ? -10.651 -91.825  -2.748  1.00 69.12  ? 187  LYS D CE  1 
ATOM   6865  N  NZ  . LYS D  4  194 ? -10.162 -90.688  -3.582  1.00 70.06  ? 187  LYS D NZ  1 
ATOM   6866  N  N   . GLU D  4  195 ? -11.683 -88.719  3.163   1.00 61.35  ? 188  GLU D N   1 
ATOM   6867  C  CA  . GLU D  4  195 ? -11.847 -87.407  3.764   1.00 61.10  ? 188  GLU D CA  1 
ATOM   6868  C  C   . GLU D  4  195 ? -10.624 -87.101  4.597   1.00 60.70  ? 188  GLU D C   1 
ATOM   6869  O  O   . GLU D  4  195 ? -10.066 -86.007  4.494   1.00 60.99  ? 188  GLU D O   1 
ATOM   6870  C  CB  . GLU D  4  195 ? -13.126 -87.331  4.608   1.00 61.26  ? 188  GLU D CB  1 
ATOM   6871  C  CG  . GLU D  4  195 ? -14.413 -87.216  3.774   1.00 62.41  ? 188  GLU D CG  1 
ATOM   6872  C  CD  . GLU D  4  195 ? -15.698 -87.274  4.604   1.00 64.09  ? 188  GLU D CD  1 
ATOM   6873  O  OE1 . GLU D  4  195 ? -15.717 -86.791  5.758   1.00 65.20  ? 188  GLU D OE1 1 
ATOM   6874  O  OE2 . GLU D  4  195 ? -16.707 -87.795  4.085   1.00 64.92  ? 188  GLU D OE2 1 
ATOM   6875  N  N   . ALA D  4  196 ? -10.192 -88.086  5.387   1.00 60.19  ? 189  ALA D N   1 
ATOM   6876  C  CA  . ALA D  4  196 ? -9.024  -87.957  6.271   1.00 59.40  ? 189  ALA D CA  1 
ATOM   6877  C  C   . ALA D  4  196 ? -7.714  -87.639  5.536   1.00 58.95  ? 189  ALA D C   1 
ATOM   6878  O  O   . ALA D  4  196 ? -6.993  -86.727  5.935   1.00 58.65  ? 189  ALA D O   1 
ATOM   6879  C  CB  . ALA D  4  196 ? -8.871  -89.194  7.120   1.00 59.55  ? 189  ALA D CB  1 
ATOM   6880  N  N   . GLU D  4  197 ? -7.415  -88.378  4.469   1.00 58.66  ? 190  GLU D N   1 
ATOM   6881  C  CA  . GLU D  4  197 ? -6.268  -88.073  3.611   1.00 58.76  ? 190  GLU D CA  1 
ATOM   6882  C  C   . GLU D  4  197 ? -6.243  -86.579  3.257   1.00 58.56  ? 190  GLU D C   1 
ATOM   6883  O  O   . GLU D  4  197 ? -5.281  -85.872  3.577   1.00 58.50  ? 190  GLU D O   1 
ATOM   6884  C  CB  . GLU D  4  197 ? -6.306  -88.914  2.329   1.00 58.97  ? 190  GLU D CB  1 
ATOM   6885  C  CG  . GLU D  4  197 ? -6.193  -90.430  2.533   1.00 60.95  ? 190  GLU D CG  1 
ATOM   6886  C  CD  . GLU D  4  197 ? -6.693  -91.257  1.332   1.00 63.13  ? 190  GLU D CD  1 
ATOM   6887  O  OE1 . GLU D  4  197 ? -6.482  -92.491  1.317   1.00 63.58  ? 190  GLU D OE1 1 
ATOM   6888  O  OE2 . GLU D  4  197 ? -7.301  -90.684  0.401   1.00 65.58  ? 190  GLU D OE2 1 
ATOM   6889  N  N   . LEU D  4  198 ? -7.325  -86.114  2.627   1.00 58.31  ? 191  LEU D N   1 
ATOM   6890  C  CA  . LEU D  4  198 ? -7.519  -84.712  2.222   1.00 57.90  ? 191  LEU D CA  1 
ATOM   6891  C  C   . LEU D  4  198 ? -7.273  -83.685  3.334   1.00 57.68  ? 191  LEU D C   1 
ATOM   6892  O  O   . LEU D  4  198 ? -6.649  -82.646  3.090   1.00 57.46  ? 191  LEU D O   1 
ATOM   6893  C  CB  . LEU D  4  198 ? -8.926  -84.531  1.644   1.00 57.82  ? 191  LEU D CB  1 
ATOM   6894  C  CG  . LEU D  4  198 ? -9.219  -84.689  0.139   1.00 58.15  ? 191  LEU D CG  1 
ATOM   6895  C  CD1 . LEU D  4  198 ? -8.150  -85.420  -0.701  1.00 57.12  ? 191  LEU D CD1 1 
ATOM   6896  C  CD2 . LEU D  4  198 ? -10.623 -85.286  -0.074  1.00 58.30  ? 191  LEU D CD2 1 
ATOM   6897  N  N   . LEU D  4  199 ? -7.760  -83.977  4.542   1.00 57.35  ? 192  LEU D N   1 
ATOM   6898  C  CA  . LEU D  4  199 ? -7.543  -83.113  5.700   1.00 57.16  ? 192  LEU D CA  1 
ATOM   6899  C  C   . LEU D  4  199 ? -6.084  -83.005  6.099   1.00 57.08  ? 192  LEU D C   1 
ATOM   6900  O  O   . LEU D  4  199 ? -5.665  -81.972  6.627   1.00 57.32  ? 192  LEU D O   1 
ATOM   6901  C  CB  . LEU D  4  199 ? -8.328  -83.605  6.905   1.00 57.17  ? 192  LEU D CB  1 
ATOM   6902  C  CG  . LEU D  4  199 ? -9.576  -82.847  7.331   1.00 57.81  ? 192  LEU D CG  1 
ATOM   6903  C  CD1 . LEU D  4  199 ? -10.770 -83.223  6.454   1.00 58.91  ? 192  LEU D CD1 1 
ATOM   6904  C  CD2 . LEU D  4  199 ? -9.855  -83.171  8.790   1.00 57.90  ? 192  LEU D CD2 1 
ATOM   6905  N  N   . VAL D  4  200 ? -5.319  -84.072  5.879   1.00 56.62  ? 193  VAL D N   1 
ATOM   6906  C  CA  . VAL D  4  200 ? -3.908  -84.053  6.230   1.00 56.29  ? 193  VAL D CA  1 
ATOM   6907  C  C   . VAL D  4  200 ? -3.150  -83.213  5.219   1.00 56.12  ? 193  VAL D C   1 
ATOM   6908  O  O   . VAL D  4  200 ? -2.327  -82.383  5.602   1.00 55.85  ? 193  VAL D O   1 
ATOM   6909  C  CB  . VAL D  4  200 ? -3.295  -85.487  6.416   1.00 56.32  ? 193  VAL D CB  1 
ATOM   6910  C  CG1 . VAL D  4  200 ? -1.801  -85.497  6.150   1.00 55.56  ? 193  VAL D CG1 1 
ATOM   6911  C  CG2 . VAL D  4  200 ? -3.541  -85.982  7.826   1.00 55.90  ? 193  VAL D CG2 1 
ATOM   6912  N  N   . LEU D  4  201 ? -3.438  -83.427  3.937   1.00 56.17  ? 194  LEU D N   1 
ATOM   6913  C  CA  . LEU D  4  201 ? -2.887  -82.587  2.874   1.00 56.35  ? 194  LEU D CA  1 
ATOM   6914  C  C   . LEU D  4  201 ? -3.224  -81.109  3.106   1.00 56.55  ? 194  LEU D C   1 
ATOM   6915  O  O   . LEU D  4  201 ? -2.340  -80.253  3.048   1.00 56.47  ? 194  LEU D O   1 
ATOM   6916  C  CB  . LEU D  4  201 ? -3.411  -82.999  1.497   1.00 56.23  ? 194  LEU D CB  1 
ATOM   6917  C  CG  . LEU D  4  201 ? -2.798  -84.097  0.616   1.00 56.08  ? 194  LEU D CG  1 
ATOM   6918  C  CD1 . LEU D  4  201 ? -1.347  -84.406  0.966   1.00 55.43  ? 194  LEU D CD1 1 
ATOM   6919  C  CD2 . LEU D  4  201 ? -3.672  -85.340  0.644   1.00 55.43  ? 194  LEU D CD2 1 
ATOM   6920  N  N   . LYS D  4  202 ? -4.501  -80.826  3.372   1.00 56.73  ? 195  LYS D N   1 
ATOM   6921  C  CA  . LYS D  4  202 ? -4.973  -79.459  3.602   1.00 56.83  ? 195  LYS D CA  1 
ATOM   6922  C  C   . LYS D  4  202 ? -4.141  -78.771  4.677   1.00 56.54  ? 195  LYS D C   1 
ATOM   6923  O  O   . LYS D  4  202 ? -3.575  -77.693  4.447   1.00 56.28  ? 195  LYS D O   1 
ATOM   6924  C  CB  . LYS D  4  202 ? -6.457  -79.467  3.994   1.00 57.12  ? 195  LYS D CB  1 
ATOM   6925  C  CG  . LYS D  4  202 ? -7.057  -78.099  4.316   1.00 57.83  ? 195  LYS D CG  1 
ATOM   6926  C  CD  . LYS D  4  202 ? -8.558  -78.104  4.071   1.00 59.70  ? 195  LYS D CD  1 
ATOM   6927  C  CE  . LYS D  4  202 ? -9.268  -77.048  4.901   1.00 61.22  ? 195  LYS D CE  1 
ATOM   6928  N  NZ  . LYS D  4  202 ? -10.751 -77.173  4.756   1.00 61.64  ? 195  LYS D NZ  1 
ATOM   6929  N  N   . ILE D  4  203 ? -4.056  -79.424  5.834   1.00 56.12  ? 196  ILE D N   1 
ATOM   6930  C  CA  . ILE D  4  203 ? -3.396  -78.867  7.007   1.00 55.86  ? 196  ILE D CA  1 
ATOM   6931  C  C   . ILE D  4  203 ? -1.877  -78.745  6.828   1.00 55.98  ? 196  ILE D C   1 
ATOM   6932  O  O   . ILE D  4  203 ? -1.273  -77.823  7.354   1.00 56.16  ? 196  ILE D O   1 
ATOM   6933  C  CB  . ILE D  4  203 ? -3.795  -79.641  8.290   1.00 55.75  ? 196  ILE D CB  1 
ATOM   6934  C  CG1 . ILE D  4  203 ? -5.319  -79.590  8.454   1.00 55.37  ? 196  ILE D CG1 1 
ATOM   6935  C  CG2 . ILE D  4  203 ? -3.104  -79.070  9.517   1.00 55.18  ? 196  ILE D CG2 1 
ATOM   6936  C  CD1 . ILE D  4  203 ? -5.841  -80.120  9.765   1.00 55.49  ? 196  ILE D CD1 1 
ATOM   6937  N  N   . LEU D  4  204 ? -1.268  -79.643  6.063   1.00 56.26  ? 197  LEU D N   1 
ATOM   6938  C  CA  . LEU D  4  204 ? 0.146   -79.502  5.724   1.00 56.77  ? 197  LEU D CA  1 
ATOM   6939  C  C   . LEU D  4  204 ? 0.370   -78.312  4.798   1.00 57.25  ? 197  LEU D C   1 
ATOM   6940  O  O   . LEU D  4  204 ? 1.299   -77.525  5.003   1.00 57.36  ? 197  LEU D O   1 
ATOM   6941  C  CB  . LEU D  4  204 ? 0.697   -80.780  5.091   1.00 56.82  ? 197  LEU D CB  1 
ATOM   6942  C  CG  . LEU D  4  204 ? 1.046   -81.971  5.995   1.00 57.10  ? 197  LEU D CG  1 
ATOM   6943  C  CD1 . LEU D  4  204 ? 1.352   -83.210  5.155   1.00 57.28  ? 197  LEU D CD1 1 
ATOM   6944  C  CD2 . LEU D  4  204 ? 2.209   -81.649  6.926   1.00 57.06  ? 197  LEU D CD2 1 
ATOM   6945  N  N   . LYS D  4  205 ? -0.499  -78.187  3.793   1.00 58.01  ? 198  LYS D N   1 
ATOM   6946  C  CA  . LYS D  4  205 ? -0.513  -77.057  2.854   1.00 58.47  ? 198  LYS D CA  1 
ATOM   6947  C  C   . LYS D  4  205 ? -0.466  -75.720  3.593   1.00 58.21  ? 198  LYS D C   1 
ATOM   6948  O  O   . LYS D  4  205 ? 0.323   -74.848  3.240   1.00 57.98  ? 198  LYS D O   1 
ATOM   6949  C  CB  . LYS D  4  205 ? -1.769  -77.123  1.977   1.00 58.83  ? 198  LYS D CB  1 
ATOM   6950  C  CG  . LYS D  4  205 ? -1.628  -76.505  0.584   1.00 61.01  ? 198  LYS D CG  1 
ATOM   6951  C  CD  . LYS D  4  205 ? -2.942  -76.609  -0.216  1.00 64.35  ? 198  LYS D CD  1 
ATOM   6952  C  CE  . LYS D  4  205 ? -2.927  -75.696  -1.463  1.00 67.01  ? 198  LYS D CE  1 
ATOM   6953  N  NZ  . LYS D  4  205 ? -1.704  -75.882  -2.330  1.00 68.20  ? 198  LYS D NZ  1 
ATOM   6954  N  N   . GLN D  4  206 ? -1.304  -75.591  4.625   1.00 58.14  ? 199  GLN D N   1 
ATOM   6955  C  CA  . GLN D  4  206 ? -1.412  -74.380  5.440   1.00 58.12  ? 199  GLN D CA  1 
ATOM   6956  C  C   . GLN D  4  206 ? -0.129  -73.988  6.177   1.00 58.55  ? 199  GLN D C   1 
ATOM   6957  O  O   . GLN D  4  206 ? 0.211   -72.802  6.236   1.00 58.62  ? 199  GLN D O   1 
ATOM   6958  C  CB  . GLN D  4  206 ? -2.539  -74.520  6.465   1.00 57.75  ? 199  GLN D CB  1 
ATOM   6959  C  CG  . GLN D  4  206 ? -3.927  -74.469  5.887   1.00 57.80  ? 199  GLN D CG  1 
ATOM   6960  C  CD  . GLN D  4  206 ? -5.021  -74.494  6.946   1.00 58.66  ? 199  GLN D CD  1 
ATOM   6961  O  OE1 . GLN D  4  206 ? -6.179  -74.816  6.643   1.00 59.65  ? 199  GLN D OE1 1 
ATOM   6962  N  NE2 . GLN D  4  206 ? -4.671  -74.147  8.186   1.00 57.31  ? 199  GLN D NE2 1 
ATOM   6963  N  N   . VAL D  4  207 ? 0.571   -74.975  6.744   1.00 58.71  ? 200  VAL D N   1 
ATOM   6964  C  CA  . VAL D  4  207 ? 1.666   -74.701  7.680   1.00 58.74  ? 200  VAL D CA  1 
ATOM   6965  C  C   . VAL D  4  207 ? 3.076   -74.742  7.079   1.00 59.13  ? 200  VAL D C   1 
ATOM   6966  O  O   . VAL D  4  207 ? 3.999   -74.159  7.639   1.00 59.13  ? 200  VAL D O   1 
ATOM   6967  C  CB  . VAL D  4  207 ? 1.587   -75.595  8.944   1.00 58.74  ? 200  VAL D CB  1 
ATOM   6968  C  CG1 . VAL D  4  207 ? 0.277   -75.368  9.664   1.00 58.47  ? 200  VAL D CG1 1 
ATOM   6969  C  CG2 . VAL D  4  207 ? 1.767   -77.071  8.596   1.00 58.48  ? 200  VAL D CG2 1 
ATOM   6970  N  N   . MET D  4  208 ? 3.239   -75.415  5.944   1.00 59.71  ? 201  MET D N   1 
ATOM   6971  C  CA  . MET D  4  208 ? 4.528   -75.458  5.248   1.00 60.59  ? 201  MET D CA  1 
ATOM   6972  C  C   . MET D  4  208 ? 4.982   -74.089  4.720   1.00 61.05  ? 201  MET D C   1 
ATOM   6973  O  O   . MET D  4  208 ? 4.176   -73.331  4.182   1.00 61.27  ? 201  MET D O   1 
ATOM   6974  C  CB  . MET D  4  208 ? 4.454   -76.433  4.071   1.00 60.56  ? 201  MET D CB  1 
ATOM   6975  C  CG  . MET D  4  208 ? 4.510   -77.912  4.439   1.00 61.20  ? 201  MET D CG  1 
ATOM   6976  S  SD  . MET D  4  208 ? 4.249   -78.983  2.995   1.00 61.31  ? 201  MET D SD  1 
ATOM   6977  C  CE  . MET D  4  208 ? 5.674   -78.569  1.988   1.00 60.49  ? 201  MET D CE  1 
ATOM   6978  N  N   . GLU D  4  209 ? 6.270   -73.781  4.861   1.00 61.80  ? 202  GLU D N   1 
ATOM   6979  C  CA  . GLU D  4  209 ? 6.845   -72.592  4.216   1.00 62.69  ? 202  GLU D CA  1 
ATOM   6980  C  C   . GLU D  4  209 ? 6.874   -72.783  2.702   1.00 62.67  ? 202  GLU D C   1 
ATOM   6981  O  O   . GLU D  4  209 ? 6.570   -71.861  1.955   1.00 62.80  ? 202  GLU D O   1 
ATOM   6982  C  CB  . GLU D  4  209 ? 8.256   -72.245  4.739   1.00 62.92  ? 202  GLU D CB  1 
ATOM   6983  C  CG  . GLU D  4  209 ? 8.341   -71.801  6.221   1.00 65.01  ? 202  GLU D CG  1 
ATOM   6984  C  CD  . GLU D  4  209 ? 7.451   -70.597  6.572   1.00 68.02  ? 202  GLU D CD  1 
ATOM   6985  O  OE1 . GLU D  4  209 ? 7.616   -69.509  5.960   1.00 68.56  ? 202  GLU D OE1 1 
ATOM   6986  O  OE2 . GLU D  4  209 ? 6.595   -70.744  7.480   1.00 68.80  ? 202  GLU D OE2 1 
ATOM   6987  N  N   . GLU D  4  210 ? 7.230   -73.983  2.257   1.00 62.71  ? 205  GLU D N   1 
ATOM   6988  C  CA  . GLU D  4  210 ? 7.221   -74.315  0.830   1.00 62.89  ? 205  GLU D CA  1 
ATOM   6989  C  C   . GLU D  4  210 ? 5.787   -74.502  0.315   1.00 62.33  ? 205  GLU D C   1 
ATOM   6990  O  O   . GLU D  4  210 ? 4.837   -74.583  1.102   1.00 62.33  ? 205  GLU D O   1 
ATOM   6991  C  CB  . GLU D  4  210 ? 8.031   -75.597  0.567   1.00 63.36  ? 205  GLU D CB  1 
ATOM   6992  C  CG  . GLU D  4  210 ? 9.456   -75.604  1.123   1.00 65.77  ? 205  GLU D CG  1 
ATOM   6993  C  CD  . GLU D  4  210 ? 10.292  -74.427  0.625   1.00 69.48  ? 205  GLU D CD  1 
ATOM   6994  O  OE1 . GLU D  4  210 ? 10.799  -73.653  1.479   1.00 70.68  ? 205  GLU D OE1 1 
ATOM   6995  O  OE2 . GLU D  4  210 ? 10.433  -74.266  -0.617  1.00 70.72  ? 205  GLU D OE2 1 
ATOM   6996  N  N   . LYS D  4  211 ? 5.637   -74.558  -1.007  1.00 61.73  ? 206  LYS D N   1 
ATOM   6997  C  CA  . LYS D  4  211 ? 4.365   -74.932  -1.619  1.00 61.00  ? 206  LYS D CA  1 
ATOM   6998  C  C   . LYS D  4  211 ? 4.286   -76.448  -1.703  1.00 60.66  ? 206  LYS D C   1 
ATOM   6999  O  O   . LYS D  4  211 ? 5.139   -77.082  -2.329  1.00 60.41  ? 206  LYS D O   1 
ATOM   7000  C  CB  . LYS D  4  211 ? 4.228   -74.344  -3.022  1.00 60.96  ? 206  LYS D CB  1 
ATOM   7001  C  CG  . LYS D  4  211 ? 2.814   -74.430  -3.540  1.00 60.54  ? 206  LYS D CG  1 
ATOM   7002  C  CD  . LYS D  4  211 ? 2.737   -74.631  -5.042  1.00 60.28  ? 206  LYS D CD  1 
ATOM   7003  C  CE  . LYS D  4  211 ? 1.290   -74.936  -5.424  1.00 60.10  ? 206  LYS D CE  1 
ATOM   7004  N  NZ  . LYS D  4  211 ? 1.097   -75.203  -6.864  1.00 60.34  ? 206  LYS D NZ  1 
ATOM   7005  N  N   . LEU D  4  212 ? 3.253   -77.018  -1.089  1.00 60.16  ? 207  LEU D N   1 
ATOM   7006  C  CA  . LEU D  4  212 ? 3.097   -78.467  -1.005  1.00 60.11  ? 207  LEU D CA  1 
ATOM   7007  C  C   . LEU D  4  212 ? 2.950   -79.186  -2.356  1.00 60.12  ? 207  LEU D C   1 
ATOM   7008  O  O   . LEU D  4  212 ? 2.029   -78.900  -3.113  1.00 60.35  ? 207  LEU D O   1 
ATOM   7009  C  CB  . LEU D  4  212 ? 1.913   -78.795  -0.093  1.00 60.07  ? 207  LEU D CB  1 
ATOM   7010  C  CG  . LEU D  4  212 ? 1.493   -80.259  0.060   1.00 59.62  ? 207  LEU D CG  1 
ATOM   7011  C  CD1 . LEU D  4  212 ? 1.222   -80.550  1.511   1.00 59.13  ? 207  LEU D CD1 1 
ATOM   7012  C  CD2 . LEU D  4  212 ? 0.269   -80.569  -0.788  1.00 59.22  ? 207  LEU D CD2 1 
ATOM   7013  N  N   . ASP D  4  213 ? 3.862   -80.109  -2.654  1.00 59.92  ? 208  ASP D N   1 
ATOM   7014  C  CA  . ASP D  4  213 ? 3.682   -81.023  -3.787  1.00 60.01  ? 208  ASP D CA  1 
ATOM   7015  C  C   . ASP D  4  213 ? 4.027   -82.467  -3.404  1.00 59.87  ? 208  ASP D C   1 
ATOM   7016  O  O   . ASP D  4  213 ? 4.362   -82.738  -2.251  1.00 59.59  ? 208  ASP D O   1 
ATOM   7017  C  CB  . ASP D  4  213 ? 4.427   -80.548  -5.057  1.00 60.07  ? 208  ASP D CB  1 
ATOM   7018  C  CG  . ASP D  4  213 ? 5.952   -80.574  -4.920  1.00 61.11  ? 208  ASP D CG  1 
ATOM   7019  O  OD1 . ASP D  4  213 ? 6.480   -80.547  -3.788  1.00 62.74  ? 208  ASP D OD1 1 
ATOM   7020  O  OD2 . ASP D  4  213 ? 6.634   -80.600  -5.967  1.00 61.77  ? 208  ASP D OD2 1 
ATOM   7021  N  N   . GLU D  4  214 ? 3.928   -83.388  -4.363  1.00 59.85  ? 209  GLU D N   1 
ATOM   7022  C  CA  . GLU D  4  214 ? 4.211   -84.802  -4.105  1.00 59.83  ? 209  GLU D CA  1 
ATOM   7023  C  C   . GLU D  4  214 ? 5.663   -85.058  -3.688  1.00 59.43  ? 209  GLU D C   1 
ATOM   7024  O  O   . GLU D  4  214 ? 5.972   -86.127  -3.183  1.00 59.50  ? 209  GLU D O   1 
ATOM   7025  C  CB  . GLU D  4  214 ? 3.842   -85.688  -5.309  1.00 60.16  ? 209  GLU D CB  1 
ATOM   7026  C  CG  . GLU D  4  214 ? 4.688   -85.490  -6.589  1.00 61.03  ? 209  GLU D CG  1 
ATOM   7027  C  CD  . GLU D  4  214 ? 4.105   -84.434  -7.532  1.00 62.37  ? 209  GLU D CD  1 
ATOM   7028  O  OE1 . GLU D  4  214 ? 4.458   -84.432  -8.731  1.00 62.36  ? 209  GLU D OE1 1 
ATOM   7029  O  OE2 . GLU D  4  214 ? 3.289   -83.608  -7.072  1.00 62.88  ? 209  GLU D OE2 1 
ATOM   7030  N  N   . ASN D  4  215 A 6.541   -84.078  -3.893  1.00 58.84  ? 209  ASN D N   1 
ATOM   7031  C  CA  . ASN D  4  215 A 7.951   -84.226  -3.548  1.00 58.15  ? 209  ASN D CA  1 
ATOM   7032  C  C   . ASN D  4  215 A 8.388   -83.603  -2.224  1.00 57.39  ? 209  ASN D C   1 
ATOM   7033  O  O   . ASN D  4  215 A 9.563   -83.669  -1.880  1.00 57.69  ? 209  ASN D O   1 
ATOM   7034  C  CB  . ASN D  4  215 A 8.835   -83.701  -4.680  1.00 58.45  ? 209  ASN D CB  1 
ATOM   7035  C  CG  . ASN D  4  215 A 9.000   -84.704  -5.798  1.00 60.03  ? 209  ASN D CG  1 
ATOM   7036  O  OD1 . ASN D  4  215 A 8.026   -85.310  -6.266  1.00 61.78  ? 209  ASN D OD1 1 
ATOM   7037  N  ND2 . ASN D  4  215 A 10.240  -84.893  -6.235  1.00 61.38  ? 209  ASN D ND2 1 
ATOM   7038  N  N   . ASN D  4  216 B 7.478   -82.991  -1.478  1.00 56.24  ? 209  ASN D N   1 
ATOM   7039  C  CA  . ASN D  4  216 B 7.886   -82.412  -0.201  1.00 55.49  ? 209  ASN D CA  1 
ATOM   7040  C  C   . ASN D  4  216 B 6.930   -82.704  0.946   1.00 54.80  ? 209  ASN D C   1 
ATOM   7041  O  O   . ASN D  4  216 B 7.090   -82.203  2.069   1.00 54.65  ? 209  ASN D O   1 
ATOM   7042  C  CB  . ASN D  4  216 B 8.215   -80.910  -0.327  1.00 55.79  ? 209  ASN D CB  1 
ATOM   7043  C  CG  . ASN D  4  216 B 7.009   -80.048  -0.741  1.00 56.29  ? 209  ASN D CG  1 
ATOM   7044  O  OD1 . ASN D  4  216 B 5.853   -80.484  -0.740  1.00 55.20  ? 209  ASN D OD1 1 
ATOM   7045  N  ND2 . ASN D  4  216 B 7.295   -78.796  -1.079  1.00 58.00  ? 209  ASN D ND2 1 
ATOM   7046  N  N   . ALA D  4  217 ? 5.934   -83.527  0.643   1.00 53.87  ? 210  ALA D N   1 
ATOM   7047  C  CA  . ALA D  4  217 ? 5.080   -84.114  1.659   1.00 53.06  ? 210  ALA D CA  1 
ATOM   7048  C  C   . ALA D  4  217 ? 4.812   -85.573  1.303   1.00 52.60  ? 210  ALA D C   1 
ATOM   7049  O  O   . ALA D  4  217 ? 4.900   -85.975  0.126   1.00 52.16  ? 210  ALA D O   1 
ATOM   7050  C  CB  . ALA D  4  217 ? 3.791   -83.336  1.810   1.00 52.86  ? 210  ALA D CB  1 
ATOM   7051  N  N   . GLN D  4  218 ? 4.502   -86.362  2.330   1.00 52.02  ? 211  GLN D N   1 
ATOM   7052  C  CA  . GLN D  4  218 ? 4.336   -87.799  2.173   1.00 51.49  ? 211  GLN D CA  1 
ATOM   7053  C  C   . GLN D  4  218 ? 3.154   -88.297  2.977   1.00 51.40  ? 211  GLN D C   1 
ATOM   7054  O  O   . GLN D  4  218 ? 2.954   -87.905  4.136   1.00 50.97  ? 211  GLN D O   1 
ATOM   7055  C  CB  . GLN D  4  218 ? 5.611   -88.522  2.583   1.00 51.33  ? 211  GLN D CB  1 
ATOM   7056  C  CG  . GLN D  4  218 ? 5.577   -90.024  2.418   1.00 51.19  ? 211  GLN D CG  1 
ATOM   7057  C  CD  . GLN D  4  218 ? 6.943   -90.648  2.608   1.00 49.75  ? 211  GLN D CD  1 
ATOM   7058  O  OE1 . GLN D  4  218 ? 7.514   -91.185  1.667   1.00 48.35  ? 211  GLN D OE1 1 
ATOM   7059  N  NE2 . GLN D  4  218 ? 7.479   -90.565  3.823   1.00 49.89  ? 211  GLN D NE2 1 
ATOM   7060  N  N   . LEU D  4  219 ? 2.378   -89.165  2.334   1.00 51.47  ? 212  LEU D N   1 
ATOM   7061  C  CA  . LEU D  4  219 ? 1.199   -89.760  2.934   1.00 51.45  ? 212  LEU D CA  1 
ATOM   7062  C  C   . LEU D  4  219 ? 1.303   -91.273  3.066   1.00 51.49  ? 212  LEU D C   1 
ATOM   7063  O  O   . LEU D  4  219 ? 1.967   -91.955  2.280   1.00 51.04  ? 212  LEU D O   1 
ATOM   7064  C  CB  . LEU D  4  219 ? -0.052  -89.406  2.131   1.00 51.48  ? 212  LEU D CB  1 
ATOM   7065  C  CG  . LEU D  4  219 ? -0.821  -88.117  2.445   1.00 51.74  ? 212  LEU D CG  1 
ATOM   7066  C  CD1 . LEU D  4  219 ? -2.119  -88.108  1.650   1.00 51.09  ? 212  LEU D CD1 1 
ATOM   7067  C  CD2 . LEU D  4  219 ? -1.124  -87.987  3.923   1.00 52.07  ? 212  LEU D CD2 1 
ATOM   7068  N  N   . SER D  4  220 ? 0.616   -91.778  4.079   1.00 51.78  ? 213  SER D N   1 
ATOM   7069  C  CA  . SER D  4  220 ? 0.542   -93.197  4.339   1.00 52.30  ? 213  SER D CA  1 
ATOM   7070  C  C   . SER D  4  220 ? -0.741  -93.471  5.110   1.00 52.64  ? 213  SER D C   1 
ATOM   7071  O  O   . SER D  4  220 ? -1.364  -92.539  5.651   1.00 52.81  ? 213  SER D O   1 
ATOM   7072  C  CB  . SER D  4  220 ? 1.744   -93.641  5.172   1.00 52.11  ? 213  SER D CB  1 
ATOM   7073  O  OG  . SER D  4  220 ? 1.585   -93.236  6.518   1.00 52.20  ? 213  SER D OG  1 
ATOM   7074  N  N   . CYS D  4  221 ? -1.136  -94.741  5.150   1.00 52.68  ? 214  CYS D N   1 
ATOM   7075  C  CA  . CYS D  4  221 ? -2.208  -95.172  6.033   1.00 53.25  ? 214  CYS D CA  1 
ATOM   7076  C  C   . CYS D  4  221 ? -2.011  -96.607  6.478   1.00 53.07  ? 214  CYS D C   1 
ATOM   7077  O  O   . CYS D  4  221 ? -1.176  -97.342  5.935   1.00 52.92  ? 214  CYS D O   1 
ATOM   7078  C  CB  . CYS D  4  221 ? -3.561  -95.059  5.341   1.00 53.39  ? 214  CYS D CB  1 
ATOM   7079  S  SG  . CYS D  4  221 ? -3.768  -96.294  4.065   1.00 55.76  ? 214  CYS D SG  1 
ATOM   7080  N  N   . ILE D  4  222 ? -2.783  -96.998  7.480   1.00 53.01  ? 215  ILE D N   1 
ATOM   7081  C  CA  . ILE D  4  222 ? -2.928  -98.399  7.791   1.00 53.17  ? 215  ILE D CA  1 
ATOM   7082  C  C   . ILE D  4  222 ? -4.416  -98.736  7.855   1.00 53.18  ? 215  ILE D C   1 
ATOM   7083  O  O   . ILE D  4  222 ? -5.194  -98.062  8.531   1.00 52.93  ? 215  ILE D O   1 
ATOM   7084  C  CB  . ILE D  4  222 ? -2.082  -98.860  9.052   1.00 53.29  ? 215  ILE D CB  1 
ATOM   7085  C  CG1 . ILE D  4  222 ? -2.941  -99.147  10.282  1.00 53.17  ? 215  ILE D CG1 1 
ATOM   7086  C  CG2 . ILE D  4  222 ? -0.970  -97.877  9.385   1.00 53.46  ? 215  ILE D CG2 1 
ATOM   7087  C  CD1 . ILE D  4  222 ? -3.231  -100.625 10.473  1.00 52.75  ? 215  ILE D CD1 1 
ATOM   7088  N  N   . THR D  4  223 ? -4.798  -99.755  7.096   1.00 53.62  ? 216  THR D N   1 
ATOM   7089  C  CA  . THR D  4  223 ? -6.143  -100.325 7.138   1.00 54.05  ? 216  THR D CA  1 
ATOM   7090  C  C   . THR D  4  223 ? -6.008  -101.785 7.541   1.00 54.44  ? 216  THR D C   1 
ATOM   7091  O  O   . THR D  4  223 ? -5.037  -102.445 7.160   1.00 54.39  ? 216  THR D O   1 
ATOM   7092  C  CB  . THR D  4  223 ? -6.834  -100.268 5.755   1.00 54.03  ? 216  THR D CB  1 
ATOM   7093  O  OG1 . THR D  4  223 ? -5.979  -100.852 4.761   1.00 53.44  ? 216  THR D OG1 1 
ATOM   7094  C  CG2 . THR D  4  223 ? -7.155  -98.826  5.359   1.00 54.21  ? 216  THR D CG2 1 
ATOM   7095  N  N   . LYS D  4  224 ? -6.983  -102.287 8.299   1.00 55.03  ? 217  LYS D N   1 
ATOM   7096  C  CA  . LYS D  4  224 ? -7.068  -103.716 8.639   1.00 55.31  ? 217  LYS D CA  1 
ATOM   7097  C  C   . LYS D  4  224 ? -6.846  -104.634 7.430   1.00 55.52  ? 217  LYS D C   1 
ATOM   7098  O  O   . LYS D  4  224 ? -6.101  -105.598 7.530   1.00 55.49  ? 217  LYS D O   1 
ATOM   7099  C  CB  . LYS D  4  224 ? -8.406  -104.024 9.317   1.00 55.38  ? 217  LYS D CB  1 
ATOM   7100  C  CG  . LYS D  4  224 ? -8.648  -105.494 9.634   1.00 56.06  ? 217  LYS D CG  1 
ATOM   7101  C  CD  . LYS D  4  224 ? -10.038 -105.699 10.240  1.00 57.26  ? 217  LYS D CD  1 
ATOM   7102  C  CE  . LYS D  4  224 ? -10.467 -107.166 10.164  1.00 57.66  ? 217  LYS D CE  1 
ATOM   7103  N  NZ  . LYS D  4  224 ? -11.676 -107.418 10.987  1.00 56.90  ? 217  LYS D NZ  1 
ATOM   7104  N  N   . GLN D  4  225 ? -7.468  -104.316 6.293   1.00 56.07  ? 218  GLN D N   1 
ATOM   7105  C  CA  . GLN D  4  225 ? -7.400  -105.166 5.096   1.00 56.62  ? 218  GLN D CA  1 
ATOM   7106  C  C   . GLN D  4  225 ? -6.003  -105.233 4.445   1.00 56.41  ? 218  GLN D C   1 
ATOM   7107  O  O   . GLN D  4  225 ? -5.485  -106.318 4.220   1.00 56.11  ? 218  GLN D O   1 
ATOM   7108  C  CB  . GLN D  4  225 ? -8.469  -104.751 4.067   1.00 56.96  ? 218  GLN D CB  1 
ATOM   7109  C  CG  . GLN D  4  225 ? -8.757  -105.804 2.974   1.00 58.89  ? 218  GLN D CG  1 
ATOM   7110  C  CD  . GLN D  4  225 ? -9.451  -105.219 1.729   1.00 61.26  ? 218  GLN D CD  1 
ATOM   7111  O  OE1 . GLN D  4  225 ? -8.795  -104.794 0.769   1.00 61.11  ? 218  GLN D OE1 1 
ATOM   7112  N  NE2 . GLN D  4  225 ? -10.785 -105.216 1.742   1.00 61.42  ? 218  GLN D NE2 1 
ATOM   7113  N  N   . ASP D  4  226 ? -5.402  -104.079 4.151   1.00 56.60  ? 219  ASP D N   1 
ATOM   7114  C  CA  . ASP D  4  226 ? -4.121  -104.034 3.417   1.00 56.60  ? 219  ASP D CA  1 
ATOM   7115  C  C   . ASP D  4  226 ? -2.901  -103.748 4.284   1.00 56.20  ? 219  ASP D C   1 
ATOM   7116  O  O   . ASP D  4  226 ? -1.772  -103.834 3.805   1.00 56.14  ? 219  ASP D O   1 
ATOM   7117  C  CB  . ASP D  4  226 ? -4.158  -102.986 2.301   1.00 56.97  ? 219  ASP D CB  1 
ATOM   7118  C  CG  . ASP D  4  226 ? -5.273  -103.217 1.315   1.00 57.98  ? 219  ASP D CG  1 
ATOM   7119  O  OD1 . ASP D  4  226 ? -6.168  -102.341 1.227   1.00 58.55  ? 219  ASP D OD1 1 
ATOM   7120  O  OD2 . ASP D  4  226 ? -5.251  -104.267 0.635   1.00 58.62  ? 219  ASP D OD2 1 
ATOM   7121  N  N   . GLY D  4  227 ? -3.128  -103.377 5.538   1.00 55.75  ? 220  GLY D N   1 
ATOM   7122  C  CA  . GLY D  4  227 ? -2.035  -103.062 6.444   1.00 55.94  ? 220  GLY D CA  1 
ATOM   7123  C  C   . GLY D  4  227 ? -1.463  -101.665 6.255   1.00 56.06  ? 220  GLY D C   1 
ATOM   7124  O  O   . GLY D  4  227 ? -2.184  -100.745 5.875   1.00 56.26  ? 220  GLY D O   1 
ATOM   7125  N  N   . PHE D  4  228 ? -0.166  -101.516 6.525   1.00 55.96  ? 221  PHE D N   1 
ATOM   7126  C  CA  . PHE D  4  228 ? 0.514   -100.233 6.464   1.00 55.93  ? 221  PHE D CA  1 
ATOM   7127  C  C   . PHE D  4  228 ? 1.140   -100.008 5.097   1.00 56.26  ? 221  PHE D C   1 
ATOM   7128  O  O   . PHE D  4  228 ? 1.964   -100.803 4.650   1.00 55.97  ? 221  PHE D O   1 
ATOM   7129  C  CB  . PHE D  4  228 ? 1.586   -100.137 7.558   1.00 55.84  ? 221  PHE D CB  1 
ATOM   7130  C  CG  . PHE D  4  228 ? 2.411   -98.882  7.489   1.00 55.63  ? 221  PHE D CG  1 
ATOM   7131  C  CD1 . PHE D  4  228 ? 3.618   -98.864  6.787   1.00 55.59  ? 221  PHE D CD1 1 
ATOM   7132  C  CD2 . PHE D  4  228 ? 1.974   -97.709  8.107   1.00 55.62  ? 221  PHE D CD2 1 
ATOM   7133  C  CE1 . PHE D  4  228 ? 4.380   -97.698  6.706   1.00 55.49  ? 221  PHE D CE1 1 
ATOM   7134  C  CE2 . PHE D  4  228 ? 2.717   -96.540  8.034   1.00 54.99  ? 221  PHE D CE2 1 
ATOM   7135  C  CZ  . PHE D  4  228 ? 3.928   -96.533  7.333   1.00 55.36  ? 221  PHE D CZ  1 
ATOM   7136  N  N   . LYS D  4  229 ? 0.759   -98.902  4.458   1.00 56.91  ? 222  LYS D N   1 
ATOM   7137  C  CA  . LYS D  4  229 ? 1.252   -98.549  3.124   1.00 57.57  ? 222  LYS D CA  1 
ATOM   7138  C  C   . LYS D  4  229 ? 1.745   -97.103  3.064   1.00 57.64  ? 222  LYS D C   1 
ATOM   7139  O  O   . LYS D  4  229 ? 1.064   -96.194  3.525   1.00 57.56  ? 222  LYS D O   1 
ATOM   7140  C  CB  . LYS D  4  229 ? 0.148   -98.763  2.074   1.00 57.75  ? 222  LYS D CB  1 
ATOM   7141  C  CG  . LYS D  4  229 ? -0.211  -100.219 1.785   1.00 58.86  ? 222  LYS D CG  1 
ATOM   7142  C  CD  . LYS D  4  229 ? 0.817   -100.866 0.860   1.00 60.43  ? 222  LYS D CD  1 
ATOM   7143  C  CE  . LYS D  4  229 ? 0.636   -102.373 0.803   1.00 61.25  ? 222  LYS D CE  1 
ATOM   7144  N  NZ  . LYS D  4  229 ? 1.716   -103.007 -0.006  1.00 62.48  ? 222  LYS D NZ  1 
ATOM   7145  N  N   . ILE D  4  230 ? 2.933   -96.900  2.508   1.00 57.95  ? 223  ILE D N   1 
ATOM   7146  C  CA  . ILE D  4  230 ? 3.395   -95.562  2.164   1.00 58.46  ? 223  ILE D CA  1 
ATOM   7147  C  C   . ILE D  4  230 ? 3.020   -95.317  0.712   1.00 59.09  ? 223  ILE D C   1 
ATOM   7148  O  O   . ILE D  4  230 ? 3.518   -96.003  -0.194  1.00 58.78  ? 223  ILE D O   1 
ATOM   7149  C  CB  . ILE D  4  230 ? 4.929   -95.401  2.314   1.00 58.45  ? 223  ILE D CB  1 
ATOM   7150  C  CG1 . ILE D  4  230 ? 5.348   -95.434  3.781   1.00 58.30  ? 223  ILE D CG1 1 
ATOM   7151  C  CG2 . ILE D  4  230 ? 5.420   -94.098  1.657   1.00 58.21  ? 223  ILE D CG2 1 
ATOM   7152  C  CD1 . ILE D  4  230 ? 6.836   -95.725  3.971   1.00 58.39  ? 223  ILE D CD1 1 
ATOM   7153  N  N   . TYR D  4  231 ? 2.144   -94.335  0.499   1.00 59.91  ? 224  TYR D N   1 
ATOM   7154  C  CA  . TYR D  4  231 ? 1.697   -93.951  -0.835  1.00 60.54  ? 224  TYR D CA  1 
ATOM   7155  C  C   . TYR D  4  231 ? 2.885   -93.493  -1.663  1.00 61.39  ? 224  TYR D C   1 
ATOM   7156  O  O   . TYR D  4  231 ? 3.686   -92.681  -1.201  1.00 61.37  ? 224  TYR D O   1 
ATOM   7157  C  CB  . TYR D  4  231 ? 0.707   -92.796  -0.739  1.00 60.34  ? 224  TYR D CB  1 
ATOM   7158  C  CG  . TYR D  4  231 ? -0.552  -93.050  0.067   1.00 60.13  ? 224  TYR D CG  1 
ATOM   7159  C  CD1 . TYR D  4  231 ? -1.526  -92.059  0.177   1.00 59.84  ? 224  TYR D CD1 1 
ATOM   7160  C  CD2 . TYR D  4  231 ? -0.786  -94.271  0.699   1.00 60.01  ? 224  TYR D CD2 1 
ATOM   7161  C  CE1 . TYR D  4  231 ? -2.687  -92.264  0.908   1.00 59.85  ? 224  TYR D CE1 1 
ATOM   7162  C  CE2 . TYR D  4  231 ? -1.956  -94.489  1.432   1.00 60.33  ? 224  TYR D CE2 1 
ATOM   7163  C  CZ  . TYR D  4  231 ? -2.899  -93.480  1.527   1.00 59.95  ? 224  TYR D CZ  1 
ATOM   7164  O  OH  . TYR D  4  231 ? -4.052  -93.674  2.246   1.00 59.89  ? 224  TYR D OH  1 
ATOM   7165  N  N   . ASP D  4  232 ? 3.012   -94.021  -2.879  1.00 62.61  ? 225  ASP D N   1 
ATOM   7166  C  CA  . ASP D  4  232 ? 4.030   -93.526  -3.811  1.00 63.92  ? 225  ASP D CA  1 
ATOM   7167  C  C   . ASP D  4  232 ? 3.614   -92.162  -4.386  1.00 64.31  ? 225  ASP D C   1 
ATOM   7168  O  O   . ASP D  4  232 ? 2.470   -91.716  -4.207  1.00 64.09  ? 225  ASP D O   1 
ATOM   7169  C  CB  . ASP D  4  232 ? 4.345   -94.545  -4.919  1.00 64.26  ? 225  ASP D CB  1 
ATOM   7170  C  CG  . ASP D  4  232 ? 3.109   -94.975  -5.698  1.00 66.22  ? 225  ASP D CG  1 
ATOM   7171  O  OD1 . ASP D  4  232 ? 2.387   -95.887  -5.226  1.00 68.34  ? 225  ASP D OD1 1 
ATOM   7172  O  OD2 . ASP D  4  232 ? 2.871   -94.415  -6.793  1.00 67.88  ? 225  ASP D OD2 1 
ATOM   7173  N  N   . ASN D  4  233 ? 4.549   -91.509  -5.068  1.00 64.84  ? 226  ASN D N   1 
ATOM   7174  C  CA  . ASN D  4  233 ? 4.377   -90.117  -5.491  1.00 65.32  ? 226  ASN D CA  1 
ATOM   7175  C  C   . ASN D  4  233 ? 3.254   -89.838  -6.495  1.00 65.76  ? 226  ASN D C   1 
ATOM   7176  O  O   . ASN D  4  233 ? 2.607   -88.796  -6.418  1.00 65.63  ? 226  ASN D O   1 
ATOM   7177  C  CB  . ASN D  4  233 ? 5.710   -89.546  -5.971  1.00 65.20  ? 226  ASN D CB  1 
ATOM   7178  C  CG  . ASN D  4  233 ? 6.749   -89.487  -4.859  1.00 64.91  ? 226  ASN D CG  1 
ATOM   7179  O  OD1 . ASN D  4  233 ? 7.944   -89.598  -5.117  1.00 64.81  ? 226  ASN D OD1 1 
ATOM   7180  N  ND2 . ASN D  4  233 ? 6.294   -89.314  -3.612  1.00 63.71  ? 226  ASN D ND2 1 
ATOM   7181  N  N   . GLU D  4  234 ? 3.018   -90.777  -7.409  1.00 66.41  ? 227  GLU D N   1 
ATOM   7182  C  CA  . GLU D  4  234 ? 1.903   -90.688  -8.355  1.00 67.27  ? 227  GLU D CA  1 
ATOM   7183  C  C   . GLU D  4  234 ? 0.549   -90.633  -7.653  1.00 67.18  ? 227  GLU D C   1 
ATOM   7184  O  O   . GLU D  4  234 ? -0.343  -89.916  -8.089  1.00 67.16  ? 227  GLU D O   1 
ATOM   7185  C  CB  . GLU D  4  234 ? 1.928   -91.861  -9.347  1.00 67.62  ? 227  GLU D CB  1 
ATOM   7186  C  CG  . GLU D  4  234 ? 2.838   -91.668  -10.572 1.00 69.90  ? 227  GLU D CG  1 
ATOM   7187  C  CD  . GLU D  4  234 ? 4.340   -91.565  -10.239 1.00 73.23  ? 227  GLU D CD  1 
ATOM   7188  O  OE1 . GLU D  4  234 ? 5.105   -91.119  -11.127 1.00 73.96  ? 227  GLU D OE1 1 
ATOM   7189  O  OE2 . GLU D  4  234 ? 4.764   -91.930  -9.106  1.00 74.48  ? 227  GLU D OE2 1 
ATOM   7190  N  N   . LYS D  4  235 ? 0.402   -91.390  -6.571  1.00 67.48  ? 228  LYS D N   1 
ATOM   7191  C  CA  . LYS D  4  235 ? -0.873  -91.462  -5.873  1.00 68.13  ? 228  LYS D CA  1 
ATOM   7192  C  C   . LYS D  4  235 ? -1.138  -90.217  -5.036  1.00 68.37  ? 228  LYS D C   1 
ATOM   7193  O  O   . LYS D  4  235 ? -2.287  -89.794  -4.892  1.00 68.22  ? 228  LYS D O   1 
ATOM   7194  C  CB  . LYS D  4  235 ? -0.981  -92.724  -5.005  1.00 68.21  ? 228  LYS D CB  1 
ATOM   7195  C  CG  . LYS D  4  235 ? -2.393  -92.940  -4.431  1.00 69.05  ? 228  LYS D CG  1 
ATOM   7196  C  CD  . LYS D  4  235 ? -2.453  -94.064  -3.408  1.00 70.97  ? 228  LYS D CD  1 
ATOM   7197  C  CE  . LYS D  4  235 ? -3.890  -94.290  -2.916  1.00 72.12  ? 228  LYS D CE  1 
ATOM   7198  N  NZ  . LYS D  4  235 ? -3.980  -95.410  -1.922  1.00 72.05  ? 228  LYS D NZ  1 
ATOM   7199  N  N   . THR D  4  236 ? -0.079  -89.641  -4.473  1.00 68.89  ? 229  THR D N   1 
ATOM   7200  C  CA  . THR D  4  236 ? -0.221  -88.427  -3.680  1.00 69.27  ? 229  THR D CA  1 
ATOM   7201  C  C   . THR D  4  236 ? -0.523  -87.261  -4.617  1.00 69.54  ? 229  THR D C   1 
ATOM   7202  O  O   . THR D  4  236 ? -1.378  -86.423  -4.317  1.00 69.30  ? 229  THR D O   1 
ATOM   7203  C  CB  . THR D  4  236 ? 1.016   -88.156  -2.807  1.00 69.17  ? 229  THR D CB  1 
ATOM   7204  O  OG1 . THR D  4  236 ? 1.304   -89.324  -2.028  1.00 70.28  ? 229  THR D OG1 1 
ATOM   7205  C  CG2 . THR D  4  236 ? 0.762   -86.997  -1.852  1.00 68.85  ? 229  THR D CG2 1 
ATOM   7206  N  N   . ALA D  4  237 ? 0.159   -87.238  -5.761  1.00 70.07  ? 230  ALA D N   1 
ATOM   7207  C  CA  . ALA D  4  237 ? -0.110  -86.258  -6.806  1.00 70.64  ? 230  ALA D CA  1 
ATOM   7208  C  C   . ALA D  4  237 ? -1.610  -86.208  -7.107  1.00 71.20  ? 230  ALA D C   1 
ATOM   7209  O  O   . ALA D  4  237 ? -2.236  -85.158  -6.945  1.00 71.42  ? 230  ALA D O   1 
ATOM   7210  C  CB  . ALA D  4  237 ? 0.701   -86.567  -8.069  1.00 70.49  ? 230  ALA D CB  1 
ATOM   7211  N  N   . GLU D  4  238 ? -2.189  -87.347  -7.488  1.00 71.69  ? 231  GLU D N   1 
ATOM   7212  C  CA  . GLU D  4  238 ? -3.613  -87.421  -7.826  1.00 72.48  ? 231  GLU D CA  1 
ATOM   7213  C  C   . GLU D  4  238 ? -4.554  -87.029  -6.685  1.00 72.56  ? 231  GLU D C   1 
ATOM   7214  O  O   . GLU D  4  238 ? -5.742  -86.795  -6.908  1.00 72.84  ? 231  GLU D O   1 
ATOM   7215  C  CB  . GLU D  4  238 ? -3.966  -88.810  -8.345  1.00 72.57  ? 231  GLU D CB  1 
ATOM   7216  C  CG  . GLU D  4  238 ? -3.445  -89.076  -9.743  1.00 74.65  ? 231  GLU D CG  1 
ATOM   7217  C  CD  . GLU D  4  238 ? -3.623  -90.524  -10.163 1.00 77.34  ? 231  GLU D CD  1 
ATOM   7218  O  OE1 . GLU D  4  238 ? -2.599  -91.184  -10.460 1.00 78.66  ? 231  GLU D OE1 1 
ATOM   7219  O  OE2 . GLU D  4  238 ? -4.781  -91.008  -10.187 1.00 78.03  ? 231  GLU D OE2 1 
ATOM   7220  N  N   . LEU D  4  239 ? -4.023  -86.957  -5.471  1.00 72.83  ? 232  LEU D N   1 
ATOM   7221  C  CA  . LEU D  4  239 ? -4.818  -86.577  -4.311  1.00 73.24  ? 232  LEU D CA  1 
ATOM   7222  C  C   . LEU D  4  239 ? -4.710  -85.089  -4.041  1.00 73.58  ? 232  LEU D C   1 
ATOM   7223  O  O   . LEU D  4  239 ? -5.624  -84.495  -3.473  1.00 73.52  ? 232  LEU D O   1 
ATOM   7224  C  CB  . LEU D  4  239 ? -4.386  -87.364  -3.070  1.00 73.21  ? 232  LEU D CB  1 
ATOM   7225  C  CG  . LEU D  4  239 ? -4.787  -88.837  -2.939  1.00 72.91  ? 232  LEU D CG  1 
ATOM   7226  C  CD1 . LEU D  4  239 ? -3.967  -89.472  -1.835  1.00 72.91  ? 232  LEU D CD1 1 
ATOM   7227  C  CD2 . LEU D  4  239 ? -6.283  -89.012  -2.666  1.00 72.58  ? 232  LEU D CD2 1 
ATOM   7228  N  N   . ILE D  4  240 ? -3.576  -84.508  -4.434  1.00 74.23  ? 233  ILE D N   1 
ATOM   7229  C  CA  . ILE D  4  240 ? -3.322  -83.071  -4.311  1.00 74.87  ? 233  ILE D CA  1 
ATOM   7230  C  C   . ILE D  4  240 ? -4.164  -82.335  -5.349  1.00 75.53  ? 233  ILE D C   1 
ATOM   7231  O  O   . ILE D  4  240 ? -4.883  -81.383  -5.021  1.00 75.37  ? 233  ILE D O   1 
ATOM   7232  C  CB  . ILE D  4  240 ? -1.816  -82.738  -4.502  1.00 74.66  ? 233  ILE D CB  1 
ATOM   7233  C  CG1 . ILE D  4  240 ? -0.997  -83.270  -3.321  1.00 74.69  ? 233  ILE D CG1 1 
ATOM   7234  C  CG2 . ILE D  4  240 ? -1.606  -81.235  -4.656  1.00 74.40  ? 233  ILE D CG2 1 
ATOM   7235  C  CD1 . ILE D  4  240 ? 0.513   -83.378  -3.583  1.00 74.48  ? 233  ILE D CD1 1 
ATOM   7236  N  N   . LYS D  4  241 ? -4.061  -82.806  -6.594  1.00 76.35  ? 235  LYS D N   1 
ATOM   7237  C  CA  . LYS D  4  241 ? -4.897  -82.378  -7.711  1.00 77.12  ? 235  LYS D CA  1 
ATOM   7238  C  C   . LYS D  4  241 ? -6.356  -82.320  -7.281  1.00 77.67  ? 235  LYS D C   1 
ATOM   7239  O  O   . LYS D  4  241 ? -7.020  -81.309  -7.482  1.00 78.03  ? 235  LYS D O   1 
ATOM   7240  C  CB  . LYS D  4  241 ? -4.724  -83.352  -8.880  1.00 77.11  ? 235  LYS D CB  1 
ATOM   7241  C  CG  . LYS D  4  241 ? -5.255  -82.878  -10.225 1.00 77.53  ? 235  LYS D CG  1 
ATOM   7242  C  CD  . LYS D  4  241 ? -4.657  -83.717  -11.359 1.00 78.13  ? 235  LYS D CD  1 
ATOM   7243  C  CE  . LYS D  4  241 ? -5.299  -83.413  -12.709 1.00 77.95  ? 235  LYS D CE  1 
ATOM   7244  N  NZ  . LYS D  4  241 ? -6.704  -83.896  -12.772 1.00 77.79  ? 235  LYS D NZ  1 
ATOM   7245  N  N   . GLU D  4  242 ? -6.831  -83.392  -6.653  1.00 78.31  ? 236  GLU D N   1 
ATOM   7246  C  CA  . GLU D  4  242 ? -8.215  -83.492  -6.191  1.00 79.01  ? 236  GLU D CA  1 
ATOM   7247  C  C   . GLU D  4  242 ? -8.559  -82.521  -5.051  1.00 79.18  ? 236  GLU D C   1 
ATOM   7248  O  O   . GLU D  4  242 ? -9.724  -82.164  -4.861  1.00 79.25  ? 236  GLU D O   1 
ATOM   7249  C  CB  . GLU D  4  242 ? -8.512  -84.932  -5.770  1.00 79.12  ? 236  GLU D CB  1 
ATOM   7250  C  CG  . GLU D  4  242 ? -9.990  -85.270  -5.682  1.00 80.04  ? 236  GLU D CG  1 
ATOM   7251  C  CD  . GLU D  4  242 ? -10.253 -86.545  -4.905  1.00 81.39  ? 236  GLU D CD  1 
ATOM   7252  O  OE1 . GLU D  4  242 ? -9.578  -87.570  -5.174  1.00 81.78  ? 236  GLU D OE1 1 
ATOM   7253  O  OE2 . GLU D  4  242 ? -11.146 -86.517  -4.027  1.00 81.82  ? 236  GLU D OE2 1 
ATOM   7254  N  N   . LEU D  4  243 ? -7.546  -82.102  -4.302  1.00 79.58  ? 237  LEU D N   1 
ATOM   7255  C  CA  . LEU D  4  243 ? -7.739  -81.164  -3.202  1.00 80.20  ? 237  LEU D CA  1 
ATOM   7256  C  C   . LEU D  4  243 ? -7.766  -79.714  -3.712  1.00 80.94  ? 237  LEU D C   1 
ATOM   7257  O  O   . LEU D  4  243 ? -8.473  -78.866  -3.161  1.00 80.77  ? 237  LEU D O   1 
ATOM   7258  C  CB  . LEU D  4  243 ? -6.661  -81.380  -2.131  1.00 79.89  ? 237  LEU D CB  1 
ATOM   7259  C  CG  . LEU D  4  243 ? -6.619  -80.640  -0.784  1.00 79.09  ? 237  LEU D CG  1 
ATOM   7260  C  CD1 . LEU D  4  243 ? -5.690  -79.434  -0.866  1.00 79.18  ? 237  LEU D CD1 1 
ATOM   7261  C  CD2 . LEU D  4  243 ? -8.000  -80.264  -0.215  1.00 77.75  ? 237  LEU D CD2 1 
ATOM   7262  N  N   . LYS D  4  244 ? -7.001  -79.444  -4.769  1.00 82.01  ? 238  LYS D N   1 
ATOM   7263  C  CA  . LYS D  4  244 ? -7.060  -78.163  -5.476  1.00 83.28  ? 238  LYS D CA  1 
ATOM   7264  C  C   . LYS D  4  244 ? -8.516  -77.874  -5.865  1.00 84.07  ? 238  LYS D C   1 
ATOM   7265  O  O   . LYS D  4  244 ? -9.063  -76.807  -5.557  1.00 84.32  ? 238  LYS D O   1 
ATOM   7266  C  CB  . LYS D  4  244 ? -6.166  -78.199  -6.727  1.00 83.17  ? 238  LYS D CB  1 
ATOM   7267  C  CG  . LYS D  4  244 ? -6.005  -76.860  -7.447  1.00 84.04  ? 238  LYS D CG  1 
ATOM   7268  C  CD  . LYS D  4  244 ? -4.652  -76.186  -7.160  1.00 84.87  ? 238  LYS D CD  1 
ATOM   7269  C  CE  . LYS D  4  244 ? -3.639  -76.457  -8.288  1.00 84.77  ? 238  LYS D CE  1 
ATOM   7270  N  NZ  . LYS D  4  244 ? -2.240  -76.043  -7.951  1.00 84.09  ? 238  LYS D NZ  1 
ATOM   7271  N  N   . GLU D  4  245 ? -9.139  -78.858  -6.508  1.00 84.88  ? 239  GLU D N   1 
ATOM   7272  C  CA  . GLU D  4  245 ? -10.500 -78.741  -7.008  1.00 85.72  ? 239  GLU D CA  1 
ATOM   7273  C  C   . GLU D  4  245 ? -11.564 -78.642  -5.910  1.00 86.33  ? 239  GLU D C   1 
ATOM   7274  O  O   . GLU D  4  245 ? -12.539 -77.912  -6.060  1.00 86.52  ? 239  GLU D O   1 
ATOM   7275  C  CB  . GLU D  4  245 ? -10.792 -79.882  -7.988  1.00 85.62  ? 239  GLU D CB  1 
ATOM   7276  C  CG  . GLU D  4  245 ? -10.006 -79.739  -9.296  1.00 86.06  ? 239  GLU D CG  1 
ATOM   7277  C  CD  . GLU D  4  245 ? -9.700  -81.064  -9.986  1.00 86.86  ? 239  GLU D CD  1 
ATOM   7278  O  OE1 . GLU D  4  245 ? -10.459 -82.043  -9.794  1.00 86.78  ? 239  GLU D OE1 1 
ATOM   7279  O  OE2 . GLU D  4  245 ? -8.690  -81.119  -10.730 1.00 86.84  ? 239  GLU D OE2 1 
ATOM   7280  N  N   . LYS D  4  246 ? -11.376 -79.352  -4.804  1.00 87.24  ? 240  LYS D N   1 
ATOM   7281  C  CA  . LYS D  4  246 ? -12.366 -79.314  -3.727  1.00 88.30  ? 240  LYS D CA  1 
ATOM   7282  C  C   . LYS D  4  246 ? -12.394 -77.987  -2.973  1.00 88.82  ? 240  LYS D C   1 
ATOM   7283  O  O   . LYS D  4  246 ? -13.470 -77.494  -2.636  1.00 88.75  ? 240  LYS D O   1 
ATOM   7284  C  CB  . LYS D  4  246 ? -12.196 -80.486  -2.755  1.00 88.37  ? 240  LYS D CB  1 
ATOM   7285  C  CG  . LYS D  4  246 ? -12.824 -81.785  -3.255  1.00 89.25  ? 240  LYS D CG  1 
ATOM   7286  C  CD  . LYS D  4  246 ? -13.551 -82.527  -2.134  1.00 89.68  ? 240  LYS D CD  1 
ATOM   7287  C  CE  . LYS D  4  246 ? -14.334 -83.709  -2.682  1.00 89.50  ? 240  LYS D CE  1 
ATOM   7288  N  NZ  . LYS D  4  246 ? -15.372 -84.154  -1.718  1.00 89.38  ? 240  LYS D NZ  1 
ATOM   7289  N  N   . GLU D  4  247 ? -11.216 -77.416  -2.714  1.00 89.63  ? 241  GLU D N   1 
ATOM   7290  C  CA  . GLU D  4  247 ? -11.108 -76.124  -2.026  1.00 90.46  ? 241  GLU D CA  1 
ATOM   7291  C  C   . GLU D  4  247 ? -11.775 -74.991  -2.828  1.00 90.87  ? 241  GLU D C   1 
ATOM   7292  O  O   . GLU D  4  247 ? -12.492 -74.150  -2.266  1.00 90.80  ? 241  GLU D O   1 
ATOM   7293  C  CB  . GLU D  4  247 ? -9.642  -75.785  -1.724  1.00 90.51  ? 241  GLU D CB  1 
ATOM   7294  C  CG  . GLU D  4  247 ? -9.081  -76.426  -0.448  1.00 91.15  ? 241  GLU D CG  1 
ATOM   7295  C  CD  . GLU D  4  247 ? -7.752  -75.799  0.001   1.00 91.88  ? 241  GLU D CD  1 
ATOM   7296  O  OE1 . GLU D  4  247 ? -7.799  -74.841  0.804   1.00 92.54  ? 241  GLU D OE1 1 
ATOM   7297  O  OE2 . GLU D  4  247 ? -6.666  -76.245  -0.449  1.00 91.34  ? 241  GLU D OE2 1 
ATOM   7298  N  N   . ALA D  4  248 ? -11.544 -74.991  -4.141  1.00 91.31  ? 242  ALA D N   1 
ATOM   7299  C  CA  . ALA D  4  248 ? -12.208 -74.060  -5.053  1.00 91.80  ? 242  ALA D CA  1 
ATOM   7300  C  C   . ALA D  4  248 ? -13.678 -74.441  -5.307  1.00 92.13  ? 242  ALA D C   1 
ATOM   7301  O  O   . ALA D  4  248 ? -14.093 -74.595  -6.450  1.00 91.97  ? 242  ALA D O   1 
ATOM   7302  C  CB  . ALA D  4  248 ? -11.430 -73.965  -6.370  1.00 91.61  ? 242  ALA D CB  1 
ATOM   7303  N  N   . ALA D  4  249 ? -14.453 -74.607  -4.236  1.00 92.84  ? 243  ALA D N   1 
ATOM   7304  C  CA  . ALA D  4  249 ? -15.893 -74.857  -4.345  1.00 93.55  ? 243  ALA D CA  1 
ATOM   7305  C  C   . ALA D  4  249 ? -16.664 -73.717  -3.689  1.00 94.15  ? 243  ALA D C   1 
ATOM   7306  O  O   . ALA D  4  249 ? -17.597 -73.169  -4.292  1.00 94.43  ? 243  ALA D O   1 
ATOM   7307  C  CB  . ALA D  4  249 ? -16.279 -76.199  -3.731  1.00 93.44  ? 243  ALA D CB  1 
ATOM   7308  N  N   . GLU D  4  250 ? -16.271 -73.356  -2.462  1.00 94.62  ? 244  GLU D N   1 
ATOM   7309  C  CA  . GLU D  4  250 ? -16.825 -72.170  -1.788  1.00 95.00  ? 244  GLU D CA  1 
ATOM   7310  C  C   . GLU D  4  250 ? -15.777 -71.352  -1.016  1.00 94.96  ? 244  GLU D C   1 
ATOM   7311  O  O   . GLU D  4  250 ? -16.084 -70.348  -0.359  1.00 94.87  ? 244  GLU D O   1 
ATOM   7312  C  CB  . GLU D  4  250 ? -18.033 -72.534  -0.897  1.00 95.13  ? 244  GLU D CB  1 
ATOM   7313  C  CG  . GLU D  4  250 ? -19.408 -72.283  -1.559  1.00 95.51  ? 244  GLU D CG  1 
ATOM   7314  C  CD  . GLU D  4  250 ? -19.593 -70.838  -2.068  1.00 96.10  ? 244  GLU D CD  1 
ATOM   7315  O  OE1 . GLU D  4  250 ? -20.096 -70.663  -3.202  1.00 95.70  ? 244  GLU D OE1 1 
ATOM   7316  O  OE2 . GLU D  4  250 ? -19.232 -69.879  -1.343  1.00 95.95  ? 244  GLU D OE2 1 
ATOM   7317  N  N   . ASN E  5  4   ? 21.946  -72.849  45.584  1.00 63.78  ? 7    ASN E N   1 
ATOM   7318  C  CA  . ASN E  5  4   ? 23.352  -73.281  45.887  1.00 63.89  ? 7    ASN E CA  1 
ATOM   7319  C  C   . ASN E  5  4   ? 23.441  -74.659  46.582  1.00 63.68  ? 7    ASN E C   1 
ATOM   7320  O  O   . ASN E  5  4   ? 24.524  -75.258  46.670  1.00 63.61  ? 7    ASN E O   1 
ATOM   7321  C  CB  . ASN E  5  4   ? 24.079  -72.203  46.714  1.00 63.89  ? 7    ASN E CB  1 
ATOM   7322  N  N   . TYR E  5  5   ? 22.297  -75.151  47.065  1.00 63.31  ? 8    TYR E N   1 
ATOM   7323  C  CA  . TYR E  5  5   ? 22.232  -76.420  47.801  1.00 62.77  ? 8    TYR E CA  1 
ATOM   7324  C  C   . TYR E  5  5   ? 21.301  -77.455  47.158  1.00 62.38  ? 8    TYR E C   1 
ATOM   7325  O  O   . TYR E  5  5   ? 21.055  -78.522  47.731  1.00 62.48  ? 8    TYR E O   1 
ATOM   7326  C  CB  . TYR E  5  5   ? 21.811  -76.171  49.256  1.00 62.63  ? 8    TYR E CB  1 
ATOM   7327  C  CG  . TYR E  5  5   ? 22.825  -75.385  50.042  1.00 62.90  ? 8    TYR E CG  1 
ATOM   7328  C  CD1 . TYR E  5  5   ? 23.963  -76.006  50.568  1.00 62.63  ? 8    TYR E CD1 1 
ATOM   7329  C  CD2 . TYR E  5  5   ? 22.657  -74.017  50.254  1.00 62.98  ? 8    TYR E CD2 1 
ATOM   7330  C  CE1 . TYR E  5  5   ? 24.906  -75.289  51.283  1.00 62.93  ? 8    TYR E CE1 1 
ATOM   7331  C  CE2 . TYR E  5  5   ? 23.594  -73.287  50.967  1.00 63.31  ? 8    TYR E CE2 1 
ATOM   7332  C  CZ  . TYR E  5  5   ? 24.719  -73.926  51.482  1.00 63.83  ? 8    TYR E CZ  1 
ATOM   7333  O  OH  . TYR E  5  5   ? 25.653  -73.202  52.198  1.00 63.55  ? 8    TYR E OH  1 
ATOM   7334  N  N   . ASP E  5  6   ? 20.785  -77.146  45.975  1.00 61.66  ? 9    ASP E N   1 
ATOM   7335  C  CA  . ASP E  5  6   ? 19.773  -77.998  45.352  1.00 61.00  ? 9    ASP E CA  1 
ATOM   7336  C  C   . ASP E  5  6   ? 20.234  -78.655  44.044  1.00 60.27  ? 9    ASP E C   1 
ATOM   7337  O  O   . ASP E  5  6   ? 19.415  -78.974  43.186  1.00 60.20  ? 9    ASP E O   1 
ATOM   7338  C  CB  . ASP E  5  6   ? 18.450  -77.228  45.171  1.00 61.19  ? 9    ASP E CB  1 
ATOM   7339  C  CG  . ASP E  5  6   ? 18.591  -75.976  44.290  1.00 61.54  ? 9    ASP E CG  1 
ATOM   7340  O  OD1 . ASP E  5  6   ? 17.557  -75.534  43.743  1.00 60.65  ? 9    ASP E OD1 1 
ATOM   7341  O  OD2 . ASP E  5  6   ? 19.713  -75.430  44.149  1.00 61.81  ? 9    ASP E OD2 1 
ATOM   7342  N  N   . GLY E  5  7   ? 21.542  -78.869  43.918  1.00 59.61  ? 10   GLY E N   1 
ATOM   7343  C  CA  . GLY E  5  7   ? 22.129  -79.517  42.748  1.00 58.85  ? 10   GLY E CA  1 
ATOM   7344  C  C   . GLY E  5  7   ? 21.879  -81.013  42.668  1.00 58.43  ? 10   GLY E C   1 
ATOM   7345  O  O   . GLY E  5  7   ? 21.692  -81.551  41.581  1.00 58.68  ? 10   GLY E O   1 
ATOM   7346  N  N   . ASP E  5  8   ? 21.876  -81.686  43.817  1.00 57.86  ? 11   ASP E N   1 
ATOM   7347  C  CA  . ASP E  5  8   ? 21.672  -83.139  43.898  1.00 57.12  ? 11   ASP E CA  1 
ATOM   7348  C  C   . ASP E  5  8   ? 20.980  -83.550  45.209  1.00 56.53  ? 11   ASP E C   1 
ATOM   7349  O  O   . ASP E  5  8   ? 20.822  -82.730  46.122  1.00 56.24  ? 11   ASP E O   1 
ATOM   7350  C  CB  . ASP E  5  8   ? 23.004  -83.899  43.711  1.00 57.27  ? 11   ASP E CB  1 
ATOM   7351  C  CG  . ASP E  5  8   ? 24.182  -83.255  44.469  1.00 57.99  ? 11   ASP E CG  1 
ATOM   7352  O  OD1 . ASP E  5  8   ? 24.017  -82.847  45.641  1.00 58.65  ? 11   ASP E OD1 1 
ATOM   7353  O  OD2 . ASP E  5  8   ? 25.289  -83.164  43.894  1.00 58.63  ? 11   ASP E OD2 1 
ATOM   7354  N  N   . THR E  5  9   ? 20.573  -84.819  45.295  1.00 55.89  ? 12   THR E N   1 
ATOM   7355  C  CA  . THR E  5  9   ? 19.918  -85.345  46.500  1.00 55.23  ? 12   THR E CA  1 
ATOM   7356  C  C   . THR E  5  9   ? 20.928  -85.732  47.543  1.00 54.18  ? 12   THR E C   1 
ATOM   7357  O  O   . THR E  5  9   ? 20.576  -86.274  48.589  1.00 54.43  ? 12   THR E O   1 
ATOM   7358  C  CB  . THR E  5  9   ? 19.097  -86.623  46.250  1.00 55.44  ? 12   THR E CB  1 
ATOM   7359  O  OG1 . THR E  5  9   ? 18.847  -86.798  44.851  1.00 56.42  ? 12   THR E OG1 1 
ATOM   7360  C  CG2 . THR E  5  9   ? 17.785  -86.531  47.011  1.00 55.73  ? 12   THR E CG2 1 
ATOM   7361  N  N   . VAL E  5  10  ? 22.187  -85.457  47.256  1.00 52.83  ? 13   VAL E N   1 
ATOM   7362  C  CA  . VAL E  5  10  ? 23.261  -85.960  48.073  1.00 51.73  ? 13   VAL E CA  1 
ATOM   7363  C  C   . VAL E  5  10  ? 23.805  -84.828  48.978  1.00 51.02  ? 13   VAL E C   1 
ATOM   7364  O  O   . VAL E  5  10  ? 24.902  -84.912  49.550  1.00 50.84  ? 13   VAL E O   1 
ATOM   7365  C  CB  . VAL E  5  10  ? 24.287  -86.690  47.147  1.00 51.69  ? 13   VAL E CB  1 
ATOM   7366  C  CG1 . VAL E  5  10  ? 25.542  -85.847  46.844  1.00 52.00  ? 13   VAL E CG1 1 
ATOM   7367  C  CG2 . VAL E  5  10  ? 24.626  -88.033  47.707  1.00 51.54  ? 13   VAL E CG2 1 
ATOM   7368  N  N   . THR E  5  11  ? 22.983  -83.788  49.130  1.00 50.06  ? 14   THR E N   1 
ATOM   7369  C  CA  . THR E  5  11  ? 23.383  -82.545  49.795  1.00 48.94  ? 14   THR E CA  1 
ATOM   7370  C  C   . THR E  5  11  ? 22.298  -81.978  50.711  1.00 47.91  ? 14   THR E C   1 
ATOM   7371  O  O   . THR E  5  11  ? 21.141  -81.835  50.314  1.00 47.71  ? 14   THR E O   1 
ATOM   7372  C  CB  . THR E  5  11  ? 23.811  -81.486  48.757  1.00 48.98  ? 14   THR E CB  1 
ATOM   7373  O  OG1 . THR E  5  11  ? 24.975  -81.955  48.073  1.00 48.74  ? 14   THR E OG1 1 
ATOM   7374  C  CG2 . THR E  5  11  ? 24.148  -80.159  49.424  1.00 49.20  ? 14   THR E CG2 1 
ATOM   7375  N  N   . PHE E  5  12  ? 22.689  -81.670  51.942  1.00 46.71  ? 15   PHE E N   1 
ATOM   7376  C  CA  . PHE E  5  12  ? 21.800  -81.018  52.893  1.00 45.66  ? 15   PHE E CA  1 
ATOM   7377  C  C   . PHE E  5  12  ? 21.893  -79.494  52.794  1.00 45.23  ? 15   PHE E C   1 
ATOM   7378  O  O   . PHE E  5  12  ? 22.963  -78.952  52.548  1.00 44.38  ? 15   PHE E O   1 
ATOM   7379  C  CB  . PHE E  5  12  ? 22.146  -81.442  54.312  1.00 45.30  ? 15   PHE E CB  1 
ATOM   7380  C  CG  . PHE E  5  12  ? 21.424  -82.666  54.776  1.00 44.18  ? 15   PHE E CG  1 
ATOM   7381  C  CD1 . PHE E  5  12  ? 20.075  -82.610  55.097  1.00 43.12  ? 15   PHE E CD1 1 
ATOM   7382  C  CD2 . PHE E  5  12  ? 22.106  -83.869  54.934  1.00 42.89  ? 15   PHE E CD2 1 
ATOM   7383  C  CE1 . PHE E  5  12  ? 19.404  -83.739  55.541  1.00 43.15  ? 15   PHE E CE1 1 
ATOM   7384  C  CE2 . PHE E  5  12  ? 21.454  -84.998  55.379  1.00 43.20  ? 15   PHE E CE2 1 
ATOM   7385  C  CZ  . PHE E  5  12  ? 20.097  -84.944  55.681  1.00 43.44  ? 15   PHE E CZ  1 
ATOM   7386  N  N   . SER E  5  13  ? 20.758  -78.818  52.973  1.00 45.08  ? 16   SER E N   1 
ATOM   7387  C  CA  . SER E  5  13  ? 20.734  -77.368  53.109  1.00 45.04  ? 16   SER E CA  1 
ATOM   7388  C  C   . SER E  5  13  ? 21.112  -77.025  54.540  1.00 45.08  ? 16   SER E C   1 
ATOM   7389  O  O   . SER E  5  13  ? 20.962  -77.864  55.436  1.00 45.06  ? 16   SER E O   1 
ATOM   7390  C  CB  . SER E  5  13  ? 19.344  -76.820  52.816  1.00 45.05  ? 16   SER E CB  1 
ATOM   7391  O  OG  . SER E  5  13  ? 18.524  -76.846  53.978  1.00 45.65  ? 16   SER E OG  1 
ATOM   7392  N  N   . PRO E  5  14  ? 21.588  -75.791  54.773  1.00 45.06  ? 17   PRO E N   1 
ATOM   7393  C  CA  . PRO E  5  14  ? 21.968  -75.403  56.135  1.00 45.08  ? 17   PRO E CA  1 
ATOM   7394  C  C   . PRO E  5  14  ? 20.842  -75.485  57.171  1.00 45.18  ? 17   PRO E C   1 
ATOM   7395  O  O   . PRO E  5  14  ? 21.133  -75.408  58.353  1.00 45.54  ? 17   PRO E O   1 
ATOM   7396  C  CB  . PRO E  5  14  ? 22.454  -73.960  55.971  1.00 44.92  ? 17   PRO E CB  1 
ATOM   7397  C  CG  . PRO E  5  14  ? 22.874  -73.869  54.555  1.00 45.06  ? 17   PRO E CG  1 
ATOM   7398  C  CD  . PRO E  5  14  ? 21.936  -74.752  53.791  1.00 44.96  ? 17   PRO E CD  1 
ATOM   7399  N  N   . THR E  5  15  ? 19.587  -75.648  56.749  1.00 45.54  ? 18   THR E N   1 
ATOM   7400  C  CA  . THR E  5  15  ? 18.475  -75.887  57.695  1.00 45.85  ? 18   THR E CA  1 
ATOM   7401  C  C   . THR E  5  15  ? 18.098  -77.359  57.760  1.00 46.29  ? 18   THR E C   1 
ATOM   7402  O  O   . THR E  5  15  ? 17.070  -77.713  58.358  1.00 46.29  ? 18   THR E O   1 
ATOM   7403  C  CB  . THR E  5  15  ? 17.190  -75.096  57.348  1.00 45.75  ? 18   THR E CB  1 
ATOM   7404  O  OG1 . THR E  5  15  ? 16.880  -75.264  55.960  1.00 45.61  ? 18   THR E OG1 1 
ATOM   7405  C  CG2 . THR E  5  15  ? 17.360  -73.615  57.662  1.00 45.78  ? 18   THR E CG2 1 
ATOM   7406  N  N   . GLY E  5  16  ? 18.920  -78.203  57.127  1.00 46.49  ? 19   GLY E N   1 
ATOM   7407  C  CA  . GLY E  5  16  ? 18.713  -79.654  57.101  1.00 46.55  ? 19   GLY E CA  1 
ATOM   7408  C  C   . GLY E  5  16  ? 17.698  -80.167  56.092  1.00 46.60  ? 19   GLY E C   1 
ATOM   7409  O  O   . GLY E  5  16  ? 17.067  -81.205  56.301  1.00 46.73  ? 19   GLY E O   1 
ATOM   7410  N  N   . ARG E  5  17  ? 17.551  -79.457  54.984  1.00 46.68  ? 20   ARG E N   1 
ATOM   7411  C  CA  . ARG E  5  17  ? 16.564  -79.836  53.993  1.00 46.80  ? 20   ARG E CA  1 
ATOM   7412  C  C   . ARG E  5  17  ? 17.188  -80.462  52.767  1.00 46.06  ? 20   ARG E C   1 
ATOM   7413  O  O   . ARG E  5  17  ? 18.340  -80.189  52.419  1.00 46.07  ? 20   ARG E O   1 
ATOM   7414  C  CB  . ARG E  5  17  ? 15.724  -78.626  53.587  1.00 47.56  ? 20   ARG E CB  1 
ATOM   7415  C  CG  . ARG E  5  17  ? 14.845  -78.080  54.702  1.00 49.79  ? 20   ARG E CG  1 
ATOM   7416  C  CD  . ARG E  5  17  ? 14.448  -76.644  54.387  1.00 54.48  ? 20   ARG E CD  1 
ATOM   7417  N  NE  . ARG E  5  17  ? 13.276  -76.562  53.516  1.00 58.09  ? 20   ARG E NE  1 
ATOM   7418  C  CZ  . ARG E  5  17  ? 12.960  -75.496  52.780  1.00 60.71  ? 20   ARG E CZ  1 
ATOM   7419  N  NH1 . ARG E  5  17  ? 13.736  -74.410  52.788  1.00 61.27  ? 20   ARG E NH1 1 
ATOM   7420  N  NH2 . ARG E  5  17  ? 11.866  -75.516  52.023  1.00 60.73  ? 20   ARG E NH2 1 
ATOM   7421  N  N   . LEU E  5  18  ? 16.405  -81.303  52.109  1.00 45.42  ? 21   LEU E N   1 
ATOM   7422  C  CA  . LEU E  5  18  ? 16.807  -81.902  50.862  1.00 44.79  ? 21   LEU E CA  1 
ATOM   7423  C  C   . LEU E  5  18  ? 15.888  -81.319  49.804  1.00 45.11  ? 21   LEU E C   1 
ATOM   7424  O  O   . LEU E  5  18  ? 14.698  -81.666  49.727  1.00 45.32  ? 21   LEU E O   1 
ATOM   7425  C  CB  . LEU E  5  18  ? 16.695  -83.425  50.950  1.00 44.49  ? 21   LEU E CB  1 
ATOM   7426  C  CG  . LEU E  5  18  ? 17.593  -84.061  52.020  1.00 43.36  ? 21   LEU E CG  1 
ATOM   7427  C  CD1 . LEU E  5  18  ? 17.139  -85.470  52.352  1.00 42.47  ? 21   LEU E CD1 1 
ATOM   7428  C  CD2 . LEU E  5  18  ? 19.056  -84.036  51.610  1.00 41.05  ? 21   LEU E CD2 1 
ATOM   7429  N  N   . PHE E  5  19  ? 16.429  -80.394  49.014  1.00 45.09  ? 22   PHE E N   1 
ATOM   7430  C  CA  . PHE E  5  19  ? 15.594  -79.623  48.100  1.00 44.97  ? 22   PHE E CA  1 
ATOM   7431  C  C   . PHE E  5  19  ? 15.134  -80.445  46.919  1.00 44.76  ? 22   PHE E C   1 
ATOM   7432  O  O   . PHE E  5  19  ? 13.980  -80.338  46.497  1.00 44.79  ? 22   PHE E O   1 
ATOM   7433  C  CB  . PHE E  5  19  ? 16.280  -78.337  47.650  1.00 45.05  ? 22   PHE E CB  1 
ATOM   7434  C  CG  . PHE E  5  19  ? 16.199  -77.234  48.658  1.00 46.20  ? 22   PHE E CG  1 
ATOM   7435  C  CD1 . PHE E  5  19  ? 14.988  -76.595  48.911  1.00 47.22  ? 22   PHE E CD1 1 
ATOM   7436  C  CD2 . PHE E  5  19  ? 17.333  -76.830  49.360  1.00 47.75  ? 22   PHE E CD2 1 
ATOM   7437  C  CE1 . PHE E  5  19  ? 14.895  -75.571  49.857  1.00 48.13  ? 22   PHE E CE1 1 
ATOM   7438  C  CE2 . PHE E  5  19  ? 17.259  -75.797  50.303  1.00 48.86  ? 22   PHE E CE2 1 
ATOM   7439  C  CZ  . PHE E  5  19  ? 16.034  -75.170  50.557  1.00 49.08  ? 22   PHE E CZ  1 
ATOM   7440  N  N   . GLN E  5  20  ? 16.028  -81.273  46.391  1.00 44.54  ? 23   GLN E N   1 
ATOM   7441  C  CA  . GLN E  5  20  ? 15.661  -82.146  45.290  1.00 44.46  ? 23   GLN E CA  1 
ATOM   7442  C  C   . GLN E  5  20  ? 14.435  -82.990  45.650  1.00 44.38  ? 23   GLN E C   1 
ATOM   7443  O  O   . GLN E  5  20  ? 13.527  -83.169  44.831  1.00 44.20  ? 23   GLN E O   1 
ATOM   7444  C  CB  . GLN E  5  20  ? 16.849  -82.989  44.843  1.00 44.26  ? 23   GLN E CB  1 
ATOM   7445  C  CG  . GLN E  5  20  ? 17.754  -82.250  43.873  1.00 44.68  ? 23   GLN E CG  1 
ATOM   7446  C  CD  . GLN E  5  20  ? 17.057  -81.935  42.553  1.00 46.70  ? 23   GLN E CD  1 
ATOM   7447  O  OE1 . GLN E  5  20  ? 16.349  -82.783  41.987  1.00 47.60  ? 23   GLN E OE1 1 
ATOM   7448  N  NE2 . GLN E  5  20  ? 17.248  -80.714  42.059  1.00 45.60  ? 23   GLN E NE2 1 
ATOM   7449  N  N   . VAL E  5  21  ? 14.388  -83.453  46.893  1.00 44.37  ? 24   VAL E N   1 
ATOM   7450  C  CA  . VAL E  5  21  ? 13.241  -84.205  47.364  1.00 44.56  ? 24   VAL E CA  1 
ATOM   7451  C  C   . VAL E  5  21  ? 12.037  -83.292  47.434  1.00 45.02  ? 24   VAL E C   1 
ATOM   7452  O  O   . VAL E  5  21  ? 10.979  -83.648  46.934  1.00 45.02  ? 24   VAL E O   1 
ATOM   7453  C  CB  . VAL E  5  21  ? 13.507  -84.892  48.724  1.00 44.55  ? 24   VAL E CB  1 
ATOM   7454  C  CG1 . VAL E  5  21  ? 12.232  -85.547  49.280  1.00 43.48  ? 24   VAL E CG1 1 
ATOM   7455  C  CG2 . VAL E  5  21  ? 14.606  -85.915  48.566  1.00 43.96  ? 24   VAL E CG2 1 
ATOM   7456  N  N   . GLU E  5  22  ? 12.214  -82.113  48.035  1.00 45.98  ? 25   GLU E N   1 
ATOM   7457  C  CA  . GLU E  5  22  ? 11.146  -81.105  48.160  1.00 46.64  ? 25   GLU E CA  1 
ATOM   7458  C  C   . GLU E  5  22  ? 10.604  -80.615  46.823  1.00 46.61  ? 25   GLU E C   1 
ATOM   7459  O  O   . GLU E  5  22  ? 9.418   -80.313  46.712  1.00 46.47  ? 25   GLU E O   1 
ATOM   7460  C  CB  . GLU E  5  22  ? 11.616  -79.924  49.005  1.00 47.14  ? 25   GLU E CB  1 
ATOM   7461  C  CG  . GLU E  5  22  ? 11.526  -80.202  50.511  1.00 50.05  ? 25   GLU E CG  1 
ATOM   7462  C  CD  . GLU E  5  22  ? 11.855  -78.990  51.370  1.00 52.50  ? 25   GLU E CD  1 
ATOM   7463  O  OE1 . GLU E  5  22  ? 11.646  -77.851  50.898  1.00 52.88  ? 25   GLU E OE1 1 
ATOM   7464  O  OE2 . GLU E  5  22  ? 12.319  -79.184  52.520  1.00 54.13  ? 25   GLU E OE2 1 
ATOM   7465  N  N   . TYR E  5  23  ? 11.469  -80.555  45.811  1.00 47.03  ? 26   TYR E N   1 
ATOM   7466  C  CA  . TYR E  5  23  ? 11.037  -80.241  44.453  1.00 47.61  ? 26   TYR E CA  1 
ATOM   7467  C  C   . TYR E  5  23  ? 10.284  -81.404  43.808  1.00 48.10  ? 26   TYR E C   1 
ATOM   7468  O  O   . TYR E  5  23  ? 9.300   -81.198  43.105  1.00 48.14  ? 26   TYR E O   1 
ATOM   7469  C  CB  . TYR E  5  23  ? 12.213  -79.858  43.564  1.00 47.41  ? 26   TYR E CB  1 
ATOM   7470  C  CG  . TYR E  5  23  ? 13.003  -78.630  43.966  1.00 47.60  ? 26   TYR E CG  1 
ATOM   7471  C  CD1 . TYR E  5  23  ? 12.547  -77.738  44.946  1.00 46.99  ? 26   TYR E CD1 1 
ATOM   7472  C  CD2 . TYR E  5  23  ? 14.210  -78.346  43.327  1.00 47.89  ? 26   TYR E CD2 1 
ATOM   7473  C  CE1 . TYR E  5  23  ? 13.296  -76.620  45.295  1.00 46.73  ? 26   TYR E CE1 1 
ATOM   7474  C  CE2 . TYR E  5  23  ? 14.953  -77.239  43.657  1.00 47.73  ? 26   TYR E CE2 1 
ATOM   7475  C  CZ  . TYR E  5  23  ? 14.498  -76.379  44.634  1.00 48.21  ? 26   TYR E CZ  1 
ATOM   7476  O  OH  . TYR E  5  23  ? 15.273  -75.285  44.928  1.00 49.34  ? 26   TYR E OH  1 
ATOM   7477  N  N   . ALA E  5  24  ? 10.755  -82.625  44.030  1.00 48.81  ? 27   ALA E N   1 
ATOM   7478  C  CA  . ALA E  5  24  ? 10.018  -83.799  43.585  1.00 49.59  ? 27   ALA E CA  1 
ATOM   7479  C  C   . ALA E  5  24  ? 8.586   -83.789  44.134  1.00 50.28  ? 27   ALA E C   1 
ATOM   7480  O  O   . ALA E  5  24  ? 7.651   -84.094  43.402  1.00 50.32  ? 27   ALA E O   1 
ATOM   7481  C  CB  . ALA E  5  24  ? 10.749  -85.073  43.976  1.00 49.45  ? 27   ALA E CB  1 
ATOM   7482  N  N   . LEU E  5  25  ? 8.414   -83.410  45.403  1.00 51.30  ? 28   LEU E N   1 
ATOM   7483  C  CA  . LEU E  5  25  ? 7.071   -83.273  45.993  1.00 52.70  ? 28   LEU E CA  1 
ATOM   7484  C  C   . LEU E  5  25  ? 6.173   -82.246  45.279  1.00 53.40  ? 28   LEU E C   1 
ATOM   7485  O  O   . LEU E  5  25  ? 4.939   -82.337  45.341  1.00 53.05  ? 28   LEU E O   1 
ATOM   7486  C  CB  . LEU E  5  25  ? 7.139   -82.946  47.488  1.00 52.78  ? 28   LEU E CB  1 
ATOM   7487  C  CG  . LEU E  5  25  ? 7.494   -84.085  48.445  1.00 54.17  ? 28   LEU E CG  1 
ATOM   7488  C  CD1 . LEU E  5  25  ? 8.862   -83.849  49.021  1.00 54.62  ? 28   LEU E CD1 1 
ATOM   7489  C  CD2 . LEU E  5  25  ? 6.489   -84.206  49.583  1.00 55.98  ? 28   LEU E CD2 1 
ATOM   7490  N  N   . GLU E  5  26  ? 6.801   -81.277  44.613  1.00 54.41  ? 29   GLU E N   1 
ATOM   7491  C  CA  . GLU E  5  26  ? 6.077   -80.240  43.878  1.00 55.51  ? 29   GLU E CA  1 
ATOM   7492  C  C   . GLU E  5  26  ? 5.411   -80.778  42.609  1.00 55.73  ? 29   GLU E C   1 
ATOM   7493  O  O   . GLU E  5  26  ? 4.393   -80.244  42.173  1.00 55.93  ? 29   GLU E O   1 
ATOM   7494  C  CB  . GLU E  5  26  ? 7.001   -79.056  43.557  1.00 55.72  ? 29   GLU E CB  1 
ATOM   7495  C  CG  . GLU E  5  26  ? 6.334   -77.683  43.655  1.00 57.76  ? 29   GLU E CG  1 
ATOM   7496  C  CD  . GLU E  5  26  ? 5.741   -77.386  45.046  1.00 60.03  ? 29   GLU E CD  1 
ATOM   7497  O  OE1 . GLU E  5  26  ? 4.550   -76.993  45.099  1.00 61.36  ? 29   GLU E OE1 1 
ATOM   7498  O  OE2 . GLU E  5  26  ? 6.453   -77.549  46.070  1.00 58.79  ? 29   GLU E OE2 1 
ATOM   7499  N  N   . ALA E  5  27  ? 5.974   -81.838  42.029  1.00 56.18  ? 30   ALA E N   1 
ATOM   7500  C  CA  . ALA E  5  27  ? 5.367   -82.499  40.865  1.00 56.90  ? 30   ALA E CA  1 
ATOM   7501  C  C   . ALA E  5  27  ? 4.013   -83.138  41.182  1.00 57.44  ? 30   ALA E C   1 
ATOM   7502  O  O   . ALA E  5  27  ? 3.161   -83.265  40.304  1.00 57.48  ? 30   ALA E O   1 
ATOM   7503  C  CB  . ALA E  5  27  ? 6.303   -83.529  40.277  1.00 56.52  ? 30   ALA E CB  1 
ATOM   7504  N  N   . ILE E  5  28  ? 3.834   -83.547  42.435  1.00 58.26  ? 31   ILE E N   1 
ATOM   7505  C  CA  . ILE E  5  28  ? 2.573   -84.110  42.912  1.00 59.09  ? 31   ILE E CA  1 
ATOM   7506  C  C   . ILE E  5  28  ? 1.466   -83.062  42.874  1.00 60.17  ? 31   ILE E C   1 
ATOM   7507  O  O   . ILE E  5  28  ? 0.384   -83.330  42.342  1.00 60.43  ? 31   ILE E O   1 
ATOM   7508  C  CB  . ILE E  5  28  ? 2.721   -84.687  44.335  1.00 58.87  ? 31   ILE E CB  1 
ATOM   7509  C  CG1 . ILE E  5  28  ? 3.588   -85.942  44.297  1.00 58.31  ? 31   ILE E CG1 1 
ATOM   7510  C  CG2 . ILE E  5  28  ? 1.365   -84.970  44.973  1.00 58.48  ? 31   ILE E CG2 1 
ATOM   7511  C  CD1 . ILE E  5  28  ? 4.084   -86.353  45.635  1.00 57.44  ? 31   ILE E CD1 1 
ATOM   7512  N  N   . LYS E  5  29  ? 1.751   -81.876  43.429  1.00 61.26  ? 32   LYS E N   1 
ATOM   7513  C  CA  . LYS E  5  29  ? 0.823   -80.730  43.422  1.00 62.17  ? 32   LYS E CA  1 
ATOM   7514  C  C   . LYS E  5  29  ? 0.403   -80.325  42.012  1.00 62.33  ? 32   LYS E C   1 
ATOM   7515  O  O   . LYS E  5  29  ? -0.718  -79.887  41.798  1.00 62.77  ? 32   LYS E O   1 
ATOM   7516  C  CB  . LYS E  5  29  ? 1.434   -79.520  44.139  1.00 62.44  ? 32   LYS E CB  1 
ATOM   7517  C  CG  . LYS E  5  29  ? 1.215   -79.464  45.660  1.00 63.47  ? 32   LYS E CG  1 
ATOM   7518  C  CD  . LYS E  5  29  ? 2.207   -80.354  46.416  1.00 65.47  ? 32   LYS E CD  1 
ATOM   7519  C  CE  . LYS E  5  29  ? 3.074   -79.559  47.417  1.00 65.66  ? 32   LYS E CE  1 
ATOM   7520  N  NZ  . LYS E  5  29  ? 2.351   -79.148  48.651  1.00 64.98  ? 32   LYS E NZ  1 
ATOM   7521  N  N   . GLN E  5  30  ? 1.307   -80.483  41.055  1.00 62.53  ? 33   GLN E N   1 
ATOM   7522  C  CA  . GLN E  5  30  ? 1.014   -80.218  39.651  1.00 62.81  ? 33   GLN E CA  1 
ATOM   7523  C  C   . GLN E  5  30  ? 0.185   -81.362  39.022  1.00 62.07  ? 33   GLN E C   1 
ATOM   7524  O  O   . GLN E  5  30  ? -0.092  -81.360  37.812  1.00 62.29  ? 33   GLN E O   1 
ATOM   7525  C  CB  . GLN E  5  30  ? 2.341   -80.022  38.900  1.00 63.50  ? 33   GLN E CB  1 
ATOM   7526  C  CG  . GLN E  5  30  ? 2.269   -79.199  37.609  1.00 66.04  ? 33   GLN E CG  1 
ATOM   7527  C  CD  . GLN E  5  30  ? 3.234   -79.714  36.542  1.00 68.95  ? 33   GLN E CD  1 
ATOM   7528  O  OE1 . GLN E  5  30  ? 2.819   -80.056  35.423  1.00 69.91  ? 33   GLN E OE1 1 
ATOM   7529  N  NE2 . GLN E  5  30  ? 4.526   -79.789  36.890  1.00 68.96  ? 33   GLN E NE2 1 
ATOM   7530  N  N   . GLY E  5  31  ? -0.209  -82.333  39.845  1.00 60.95  ? 34   GLY E N   1 
ATOM   7531  C  CA  . GLY E  5  31  ? -0.929  -83.510  39.361  1.00 59.53  ? 34   GLY E CA  1 
ATOM   7532  C  C   . GLY E  5  31  ? -2.433  -83.417  39.533  1.00 58.53  ? 34   GLY E C   1 
ATOM   7533  O  O   . GLY E  5  31  ? -2.927  -82.751  40.452  1.00 58.71  ? 34   GLY E O   1 
ATOM   7534  N  N   . SER E  5  32  ? -3.161  -84.087  38.645  1.00 57.23  ? 35   SER E N   1 
ATOM   7535  C  CA  . SER E  5  32  ? -4.615  -84.131  38.711  1.00 56.09  ? 35   SER E CA  1 
ATOM   7536  C  C   . SER E  5  32  ? -5.071  -84.873  39.957  1.00 55.50  ? 35   SER E C   1 
ATOM   7537  O  O   . SER E  5  32  ? -4.468  -85.875  40.344  1.00 55.51  ? 35   SER E O   1 
ATOM   7538  C  CB  . SER E  5  32  ? -5.176  -84.792  37.462  1.00 56.11  ? 35   SER E CB  1 
ATOM   7539  O  OG  . SER E  5  32  ? -6.585  -84.780  37.491  1.00 56.43  ? 35   SER E OG  1 
ATOM   7540  N  N   . VAL E  5  33  ? -6.136  -84.383  40.583  1.00 54.74  ? 36   VAL E N   1 
ATOM   7541  C  CA  . VAL E  5  33  ? -6.546  -84.887  41.901  1.00 53.96  ? 36   VAL E CA  1 
ATOM   7542  C  C   . VAL E  5  33  ? -7.008  -86.341  41.885  1.00 53.31  ? 36   VAL E C   1 
ATOM   7543  O  O   . VAL E  5  33  ? -7.615  -86.814  40.924  1.00 53.27  ? 36   VAL E O   1 
ATOM   7544  C  CB  . VAL E  5  33  ? -7.626  -83.983  42.564  1.00 53.95  ? 36   VAL E CB  1 
ATOM   7545  C  CG1 . VAL E  5  33  ? -8.911  -83.982  41.748  1.00 54.61  ? 36   VAL E CG1 1 
ATOM   7546  C  CG2 . VAL E  5  33  ? -7.907  -84.406  44.010  1.00 53.46  ? 36   VAL E CG2 1 
ATOM   7547  N  N   . THR E  5  34  ? -6.684  -87.043  42.958  1.00 52.77  ? 37   THR E N   1 
ATOM   7548  C  CA  . THR E  5  34  ? -7.185  -88.379  43.193  1.00 52.44  ? 37   THR E CA  1 
ATOM   7549  C  C   . THR E  5  34  ? -7.478  -88.573  44.674  1.00 52.01  ? 37   THR E C   1 
ATOM   7550  O  O   . THR E  5  34  ? -6.805  -87.999  45.527  1.00 51.88  ? 37   THR E O   1 
ATOM   7551  C  CB  . THR E  5  34  ? -6.236  -89.476  42.638  1.00 52.58  ? 37   THR E CB  1 
ATOM   7552  O  OG1 . THR E  5  34  ? -6.783  -90.769  42.930  1.00 52.80  ? 37   THR E OG1 1 
ATOM   7553  C  CG2 . THR E  5  34  ? -4.830  -89.359  43.227  1.00 52.40  ? 37   THR E CG2 1 
ATOM   7554  N  N   . VAL E  5  35  ? -8.503  -89.368  44.961  1.00 51.88  ? 38   VAL E N   1 
ATOM   7555  C  CA  . VAL E  5  35  ? -8.983  -89.581  46.323  1.00 52.00  ? 38   VAL E CA  1 
ATOM   7556  C  C   . VAL E  5  35  ? -8.958  -91.077  46.630  1.00 52.03  ? 38   VAL E C   1 
ATOM   7557  O  O   . VAL E  5  35  ? -9.154  -91.907  45.732  1.00 51.87  ? 38   VAL E O   1 
ATOM   7558  C  CB  . VAL E  5  35  ? -10.451 -89.060  46.512  1.00 52.00  ? 38   VAL E CB  1 
ATOM   7559  C  CG1 . VAL E  5  35  ? -10.976 -89.370  47.905  1.00 51.53  ? 38   VAL E CG1 1 
ATOM   7560  C  CG2 . VAL E  5  35  ? -10.546 -87.567  46.249  1.00 52.24  ? 38   VAL E CG2 1 
ATOM   7561  N  N   . GLY E  5  36  ? -8.718  -91.399  47.897  1.00 51.80  ? 39   GLY E N   1 
ATOM   7562  C  CA  . GLY E  5  36  ? -8.874  -92.749  48.398  1.00 51.92  ? 39   GLY E CA  1 
ATOM   7563  C  C   . GLY E  5  36  ? -9.570  -92.727  49.738  1.00 52.25  ? 39   GLY E C   1 
ATOM   7564  O  O   . GLY E  5  36  ? -9.328  -91.825  50.555  1.00 52.32  ? 39   GLY E O   1 
ATOM   7565  N  N   . LEU E  5  37  ? -10.441 -93.711  49.961  1.00 52.46  ? 40   LEU E N   1 
ATOM   7566  C  CA  . LEU E  5  37  ? -11.103 -93.904  51.261  1.00 52.73  ? 40   LEU E CA  1 
ATOM   7567  C  C   . LEU E  5  37  ? -11.538 -95.360  51.433  1.00 52.93  ? 40   LEU E C   1 
ATOM   7568  O  O   . LEU E  5  37  ? -11.619 -96.105  50.455  1.00 52.77  ? 40   LEU E O   1 
ATOM   7569  C  CB  . LEU E  5  37  ? -12.315 -92.972  51.413  1.00 52.53  ? 40   LEU E CB  1 
ATOM   7570  C  CG  . LEU E  5  37  ? -13.616 -93.396  50.721  1.00 52.21  ? 40   LEU E CG  1 
ATOM   7571  C  CD1 . LEU E  5  37  ? -14.800 -92.632  51.287  1.00 51.76  ? 40   LEU E CD1 1 
ATOM   7572  C  CD2 . LEU E  5  37  ? -13.531 -93.253  49.198  1.00 51.67  ? 40   LEU E CD2 1 
ATOM   7573  N  N   . ARG E  5  38  ? -11.841 -95.742  52.673  1.00 53.45  ? 41   ARG E N   1 
ATOM   7574  C  CA  . ARG E  5  38  ? -12.191 -97.127  53.004  1.00 54.05  ? 41   ARG E CA  1 
ATOM   7575  C  C   . ARG E  5  38  ? -13.180 -97.232  54.166  1.00 54.59  ? 41   ARG E C   1 
ATOM   7576  O  O   . ARG E  5  38  ? -13.171 -96.398  55.073  1.00 54.52  ? 41   ARG E O   1 
ATOM   7577  C  CB  . ARG E  5  38  ? -10.927 -97.928  53.358  1.00 53.87  ? 41   ARG E CB  1 
ATOM   7578  C  CG  . ARG E  5  38  ? -10.325 -97.592  54.725  1.00 53.54  ? 41   ARG E CG  1 
ATOM   7579  C  CD  . ARG E  5  38  ? -9.569  -98.764  55.299  1.00 53.23  ? 41   ARG E CD  1 
ATOM   7580  N  NE  . ARG E  5  38  ? -9.220  -98.579  56.707  1.00 53.46  ? 41   ARG E NE  1 
ATOM   7581  C  CZ  . ARG E  5  38  ? -9.881  -99.125  57.728  1.00 54.35  ? 41   ARG E CZ  1 
ATOM   7582  N  NH1 . ARG E  5  38  ? -10.946 -99.898  57.523  1.00 54.17  ? 41   ARG E NH1 1 
ATOM   7583  N  NH2 . ARG E  5  38  ? -9.474  -98.901  58.969  1.00 54.34  ? 41   ARG E NH2 1 
ATOM   7584  N  N   . SER E  5  39  ? -14.018 -98.267  54.135  1.00 55.19  ? 42   SER E N   1 
ATOM   7585  C  CA  . SER E  5  39  ? -14.781 -98.670  55.311  1.00 55.99  ? 42   SER E CA  1 
ATOM   7586  C  C   . SER E  5  39  ? -14.082 -99.889  55.922  1.00 56.62  ? 42   SER E C   1 
ATOM   7587  O  O   . SER E  5  39  ? -12.890 -100.090 55.692  1.00 56.99  ? 42   SER E O   1 
ATOM   7588  C  CB  . SER E  5  39  ? -16.228 -98.982  54.943  1.00 55.90  ? 42   SER E CB  1 
ATOM   7589  O  OG  . SER E  5  39  ? -16.342 -100.248 54.315  1.00 56.62  ? 42   SER E OG  1 
ATOM   7590  N  N   . ASN E  5  40  ? -14.804 -100.687 56.706  1.00 57.22  ? 43   ASN E N   1 
ATOM   7591  C  CA  . ASN E  5  40  ? -14.261 -101.942 57.228  1.00 57.74  ? 43   ASN E CA  1 
ATOM   7592  C  C   . ASN E  5  40  ? -14.268 -103.079 56.203  1.00 57.48  ? 43   ASN E C   1 
ATOM   7593  O  O   . ASN E  5  40  ? -13.553 -104.064 56.378  1.00 57.82  ? 43   ASN E O   1 
ATOM   7594  C  CB  . ASN E  5  40  ? -15.002 -102.381 58.497  1.00 58.21  ? 43   ASN E CB  1 
ATOM   7595  C  CG  . ASN E  5  40  ? -14.283 -101.963 59.767  1.00 60.21  ? 43   ASN E CG  1 
ATOM   7596  O  OD1 . ASN E  5  40  ? -13.270 -102.555 60.138  1.00 63.02  ? 43   ASN E OD1 1 
ATOM   7597  N  ND2 . ASN E  5  40  ? -14.811 -100.946 60.448  1.00 62.07  ? 43   ASN E ND2 1 
ATOM   7598  N  N   . THR E  5  41  ? -15.064 -102.945 55.143  1.00 56.89  ? 44   THR E N   1 
ATOM   7599  C  CA  . THR E  5  41  ? -15.231 -104.033 54.176  1.00 56.48  ? 44   THR E CA  1 
ATOM   7600  C  C   . THR E  5  41  ? -14.666 -103.742 52.777  1.00 56.12  ? 44   THR E C   1 
ATOM   7601  O  O   . THR E  5  41  ? -14.346 -104.676 52.030  1.00 56.29  ? 44   THR E O   1 
ATOM   7602  C  CB  . THR E  5  41  ? -16.726 -104.489 54.040  1.00 56.59  ? 44   THR E CB  1 
ATOM   7603  O  OG1 . THR E  5  41  ? -17.526 -103.413 53.530  1.00 56.30  ? 44   THR E OG1 1 
ATOM   7604  C  CG2 . THR E  5  41  ? -17.288 -104.959 55.382  1.00 56.82  ? 44   THR E CG2 1 
ATOM   7605  N  N   . HIS E  5  42  ? -14.571 -102.465 52.409  1.00 55.21  ? 45   HIS E N   1 
ATOM   7606  C  CA  . HIS E  5  42  ? -14.076 -102.095 51.082  1.00 54.62  ? 45   HIS E CA  1 
ATOM   7607  C  C   . HIS E  5  42  ? -13.137 -100.897 51.115  1.00 54.27  ? 45   HIS E C   1 
ATOM   7608  O  O   . HIS E  5  42  ? -13.092 -100.147 52.091  1.00 54.30  ? 45   HIS E O   1 
ATOM   7609  C  CB  . HIS E  5  42  ? -15.233 -101.782 50.131  1.00 54.68  ? 45   HIS E CB  1 
ATOM   7610  C  CG  . HIS E  5  42  ? -16.153 -102.934 49.876  1.00 54.87  ? 45   HIS E CG  1 
ATOM   7611  N  ND1 . HIS E  5  42  ? -17.023 -103.418 50.831  1.00 54.62  ? 45   HIS E ND1 1 
ATOM   7612  C  CD2 . HIS E  5  42  ? -16.365 -103.676 48.762  1.00 55.14  ? 45   HIS E CD2 1 
ATOM   7613  C  CE1 . HIS E  5  42  ? -17.720 -104.419 50.320  1.00 55.19  ? 45   HIS E CE1 1 
ATOM   7614  N  NE2 . HIS E  5  42  ? -17.343 -104.593 49.065  1.00 55.10  ? 45   HIS E NE2 1 
ATOM   7615  N  N   . ALA E  5  43  ? -12.396 -100.716 50.030  1.00 53.80  ? 46   ALA E N   1 
ATOM   7616  C  CA  . ALA E  5  43  ? -11.532 -99.559  49.872  1.00 53.44  ? 46   ALA E CA  1 
ATOM   7617  C  C   . ALA E  5  43  ? -11.665 -99.072  48.445  1.00 53.46  ? 46   ALA E C   1 
ATOM   7618  O  O   . ALA E  5  43  ? -11.704 -99.880  47.505  1.00 53.49  ? 46   ALA E O   1 
ATOM   7619  C  CB  . ALA E  5  43  ? -10.107 -99.911  50.192  1.00 53.38  ? 46   ALA E CB  1 
ATOM   7620  N  N   . VAL E  5  44  ? -11.765 -97.755  48.287  1.00 53.30  ? 47   VAL E N   1 
ATOM   7621  C  CA  . VAL E  5  44  ? -12.132 -97.169  47.006  1.00 53.17  ? 47   VAL E CA  1 
ATOM   7622  C  C   . VAL E  5  44  ? -11.138 -96.104  46.601  1.00 53.40  ? 47   VAL E C   1 
ATOM   7623  O  O   . VAL E  5  44  ? -10.713 -95.301  47.426  1.00 53.42  ? 47   VAL E O   1 
ATOM   7624  C  CB  . VAL E  5  44  ? -13.575 -96.582  47.034  1.00 53.22  ? 47   VAL E CB  1 
ATOM   7625  C  CG1 . VAL E  5  44  ? -13.887 -95.810  45.748  1.00 53.18  ? 47   VAL E CG1 1 
ATOM   7626  C  CG2 . VAL E  5  44  ? -14.614 -97.684  47.238  1.00 52.49  ? 47   VAL E CG2 1 
ATOM   7627  N  N   . LEU E  5  45  ? -10.759 -96.130  45.328  1.00 53.76  ? 48   LEU E N   1 
ATOM   7628  C  CA  . LEU E  5  45  ? -9.952  -95.095  44.722  1.00 54.41  ? 48   LEU E CA  1 
ATOM   7629  C  C   . LEU E  5  45  ? -10.789 -94.359  43.691  1.00 55.40  ? 48   LEU E C   1 
ATOM   7630  O  O   . LEU E  5  45  ? -11.441 -94.991  42.849  1.00 55.58  ? 48   LEU E O   1 
ATOM   7631  C  CB  . LEU E  5  45  ? -8.739  -95.697  44.019  1.00 53.99  ? 48   LEU E CB  1 
ATOM   7632  C  CG  . LEU E  5  45  ? -7.532  -96.195  44.805  1.00 53.39  ? 48   LEU E CG  1 
ATOM   7633  C  CD1 . LEU E  5  45  ? -6.548  -96.792  43.827  1.00 52.20  ? 48   LEU E CD1 1 
ATOM   7634  C  CD2 . LEU E  5  45  ? -6.879  -95.087  45.601  1.00 52.28  ? 48   LEU E CD2 1 
ATOM   7635  N  N   . VAL E  5  46  ? -10.778 -93.027  43.769  1.00 56.41  ? 49   VAL E N   1 
ATOM   7636  C  CA  . VAL E  5  46  ? -11.423 -92.169  42.771  1.00 57.48  ? 49   VAL E CA  1 
ATOM   7637  C  C   . VAL E  5  46  ? -10.379 -91.208  42.227  1.00 58.28  ? 49   VAL E C   1 
ATOM   7638  O  O   . VAL E  5  46  ? -9.694  -90.526  42.996  1.00 58.50  ? 49   VAL E O   1 
ATOM   7639  C  CB  . VAL E  5  46  ? -12.585 -91.305  43.362  1.00 57.49  ? 49   VAL E CB  1 
ATOM   7640  C  CG1 . VAL E  5  46  ? -13.370 -90.642  42.241  1.00 57.53  ? 49   VAL E CG1 1 
ATOM   7641  C  CG2 . VAL E  5  46  ? -13.517 -92.120  44.248  1.00 57.08  ? 49   VAL E CG2 1 
ATOM   7642  N  N   . ALA E  5  47  ? -10.259 -91.142  40.910  1.00 59.09  ? 50   ALA E N   1 
ATOM   7643  C  CA  . ALA E  5  47  ? -9.293  -90.240  40.309  1.00 60.22  ? 50   ALA E CA  1 
ATOM   7644  C  C   . ALA E  5  47  ? -9.924  -89.438  39.184  1.00 61.07  ? 50   ALA E C   1 
ATOM   7645  O  O   . ALA E  5  47  ? -10.769 -89.955  38.445  1.00 61.36  ? 50   ALA E O   1 
ATOM   7646  C  CB  . ALA E  5  47  ? -8.094  -91.014  39.796  1.00 60.28  ? 50   ALA E CB  1 
ATOM   7647  N  N   . LEU E  5  48  ? -9.513  -88.175  39.068  1.00 61.92  ? 51   LEU E N   1 
ATOM   7648  C  CA  . LEU E  5  48  ? -9.895  -87.330  37.939  1.00 62.74  ? 51   LEU E CA  1 
ATOM   7649  C  C   . LEU E  5  48  ? -8.845  -87.435  36.831  1.00 63.27  ? 51   LEU E C   1 
ATOM   7650  O  O   . LEU E  5  48  ? -7.739  -86.903  36.956  1.00 63.48  ? 51   LEU E O   1 
ATOM   7651  C  CB  . LEU E  5  48  ? -10.061 -85.874  38.393  1.00 62.77  ? 51   LEU E CB  1 
ATOM   7652  C  CG  . LEU E  5  48  ? -10.377 -84.797  37.344  1.00 63.01  ? 51   LEU E CG  1 
ATOM   7653  C  CD1 . LEU E  5  48  ? -11.850 -84.812  36.959  1.00 63.12  ? 51   LEU E CD1 1 
ATOM   7654  C  CD2 . LEU E  5  48  ? -9.963  -83.406  37.838  1.00 63.58  ? 51   LEU E CD2 1 
ATOM   7655  N  N   . LYS E  5  49  ? -9.182  -88.136  35.754  1.00 63.82  ? 52   LYS E N   1 
ATOM   7656  C  CA  . LYS E  5  49  ? -8.266  -88.268  34.622  1.00 64.58  ? 52   LYS E CA  1 
ATOM   7657  C  C   . LYS E  5  49  ? -8.144  -86.931  33.867  1.00 65.19  ? 52   LYS E C   1 
ATOM   7658  O  O   . LYS E  5  49  ? -9.065  -86.108  33.899  1.00 65.32  ? 52   LYS E O   1 
ATOM   7659  C  CB  . LYS E  5  49  ? -8.723  -89.393  33.694  1.00 64.43  ? 52   LYS E CB  1 
ATOM   7660  C  CG  . LYS E  5  49  ? -8.823  -90.755  34.366  1.00 64.46  ? 52   LYS E CG  1 
ATOM   7661  C  CD  . LYS E  5  49  ? -9.194  -91.861  33.376  1.00 64.54  ? 52   LYS E CD  1 
ATOM   7662  C  CE  . LYS E  5  49  ? -10.704 -92.013  33.218  1.00 63.59  ? 52   LYS E CE  1 
ATOM   7663  N  NZ  . LYS E  5  49  ? -11.043 -93.082  32.240  1.00 62.36  ? 52   LYS E NZ  1 
ATOM   7664  N  N   . ARG E  5  50  ? -7.010  -86.713  33.204  1.00 65.72  ? 53   ARG E N   1 
ATOM   7665  C  CA  . ARG E  5  50  ? -6.736  -85.431  32.562  1.00 66.23  ? 53   ARG E CA  1 
ATOM   7666  C  C   . ARG E  5  50  ? -6.269  -85.617  31.119  1.00 66.58  ? 53   ARG E C   1 
ATOM   7667  O  O   . ARG E  5  50  ? -5.440  -86.477  30.834  1.00 66.70  ? 53   ARG E O   1 
ATOM   7668  C  CB  . ARG E  5  50  ? -5.702  -84.650  33.377  1.00 66.22  ? 53   ARG E CB  1 
ATOM   7669  C  CG  . ARG E  5  50  ? -5.509  -83.207  32.952  1.00 67.09  ? 53   ARG E CG  1 
ATOM   7670  C  CD  . ARG E  5  50  ? -4.365  -82.564  33.722  1.00 68.32  ? 53   ARG E CD  1 
ATOM   7671  N  NE  . ARG E  5  50  ? -4.803  -81.994  34.997  1.00 68.71  ? 53   ARG E NE  1 
ATOM   7672  C  CZ  . ARG E  5  50  ? -3.979  -81.576  35.959  1.00 69.10  ? 53   ARG E CZ  1 
ATOM   7673  N  NH1 . ARG E  5  50  ? -2.660  -81.679  35.806  1.00 68.41  ? 53   ARG E NH1 1 
ATOM   7674  N  NH2 . ARG E  5  50  ? -4.474  -81.062  37.085  1.00 68.41  ? 53   ARG E NH2 1 
ATOM   7675  N  N   . ASN E  5  51  ? -6.816  -84.804  30.220  1.00 67.00  ? 54   ASN E N   1 
ATOM   7676  C  CA  . ASN E  5  51  ? -6.494  -84.864  28.796  1.00 67.54  ? 54   ASN E CA  1 
ATOM   7677  C  C   . ASN E  5  51  ? -5.546  -83.747  28.355  1.00 67.96  ? 54   ASN E C   1 
ATOM   7678  O  O   . ASN E  5  51  ? -5.389  -82.742  29.057  1.00 68.31  ? 54   ASN E O   1 
ATOM   7679  C  CB  . ASN E  5  51  ? -7.782  -84.870  27.949  1.00 67.52  ? 54   ASN E CB  1 
ATOM   7680  C  CG  . ASN E  5  51  ? -8.668  -83.637  28.178  1.00 67.63  ? 54   ASN E CG  1 
ATOM   7681  O  OD1 . ASN E  5  51  ? -8.740  -83.092  29.282  1.00 68.14  ? 54   ASN E OD1 1 
ATOM   7682  N  ND2 . ASN E  5  51  ? -9.365  -83.213  27.128  1.00 66.95  ? 54   ASN E ND2 1 
ATOM   7683  N  N   . ALA E  5  52  ? -4.900  -83.929  27.206  1.00 68.29  ? 55   ALA E N   1 
ATOM   7684  C  CA  . ALA E  5  52  ? -4.026  -82.894  26.654  1.00 68.72  ? 55   ALA E CA  1 
ATOM   7685  C  C   . ALA E  5  52  ? -4.825  -81.914  25.793  1.00 69.09  ? 55   ALA E C   1 
ATOM   7686  O  O   . ALA E  5  52  ? -4.762  -80.698  25.993  1.00 69.22  ? 55   ALA E O   1 
ATOM   7687  C  CB  . ALA E  5  52  ? -2.897  -83.517  25.856  1.00 68.76  ? 55   ALA E CB  1 
ATOM   7688  N  N   . ASP E  5  53  ? -5.563  -82.467  24.834  1.00 69.34  ? 56   ASP E N   1 
ATOM   7689  C  CA  . ASP E  5  53  ? -6.477  -81.732  23.975  1.00 69.44  ? 56   ASP E CA  1 
ATOM   7690  C  C   . ASP E  5  53  ? -7.863  -82.251  24.250  1.00 69.57  ? 56   ASP E C   1 
ATOM   7691  O  O   . ASP E  5  53  ? -8.051  -83.126  25.094  1.00 69.44  ? 56   ASP E O   1 
ATOM   7692  C  CB  . ASP E  5  53  ? -6.163  -82.025  22.510  1.00 69.50  ? 56   ASP E CB  1 
ATOM   7693  C  CG  . ASP E  5  53  ? -5.090  -81.141  21.962  1.00 70.12  ? 56   ASP E CG  1 
ATOM   7694  O  OD1 . ASP E  5  53  ? -3.901  -81.535  22.013  1.00 70.99  ? 56   ASP E OD1 1 
ATOM   7695  O  OD2 . ASP E  5  53  ? -5.438  -80.042  21.488  1.00 71.28  ? 56   ASP E OD2 1 
ATOM   7696  N  N   . GLU E  5  54  ? -8.834  -81.725  23.513  1.00 69.79  ? 57   GLU E N   1 
ATOM   7697  C  CA  . GLU E  5  54  ? -10.161 -82.327  23.475  1.00 70.01  ? 57   GLU E CA  1 
ATOM   7698  C  C   . GLU E  5  54  ? -10.186 -83.471  22.438  1.00 69.64  ? 57   GLU E C   1 
ATOM   7699  O  O   . GLU E  5  54  ? -11.183 -84.183  22.296  1.00 69.74  ? 57   GLU E O   1 
ATOM   7700  C  CB  . GLU E  5  54  ? -11.247 -81.260  23.221  1.00 70.29  ? 57   GLU E CB  1 
ATOM   7701  C  CG  . GLU E  5  54  ? -12.528 -81.407  24.092  1.00 71.06  ? 57   GLU E CG  1 
ATOM   7702  C  CD  . GLU E  5  54  ? -12.265 -81.356  25.612  1.00 72.16  ? 57   GLU E CD  1 
ATOM   7703  O  OE1 . GLU E  5  54  ? -12.841 -82.192  26.339  1.00 72.58  ? 57   GLU E OE1 1 
ATOM   7704  O  OE2 . GLU E  5  54  ? -11.487 -80.492  26.083  1.00 72.47  ? 57   GLU E OE2 1 
ATOM   7705  N  N   . LEU E  5  55  ? -9.067  -83.652  21.740  1.00 69.14  ? 58   LEU E N   1 
ATOM   7706  C  CA  . LEU E  5  55  ? -8.884  -84.765  20.815  1.00 68.68  ? 58   LEU E CA  1 
ATOM   7707  C  C   . LEU E  5  55  ? -8.177  -85.972  21.451  1.00 68.39  ? 58   LEU E C   1 
ATOM   7708  O  O   . LEU E  5  55  ? -8.160  -87.071  20.880  1.00 68.24  ? 58   LEU E O   1 
ATOM   7709  C  CB  . LEU E  5  55  ? -8.103  -84.292  19.590  1.00 68.71  ? 58   LEU E CB  1 
ATOM   7710  C  CG  . LEU E  5  55  ? -8.876  -84.104  18.285  1.00 68.66  ? 58   LEU E CG  1 
ATOM   7711  C  CD1 . LEU E  5  55  ? -10.271 -83.549  18.513  1.00 69.14  ? 58   LEU E CD1 1 
ATOM   7712  C  CD2 . LEU E  5  55  ? -8.086  -83.230  17.319  1.00 68.74  ? 58   LEU E CD2 1 
ATOM   7713  N  N   . SER E  5  56  ? -7.603  -85.758  22.634  1.00 68.01  ? 59   SER E N   1 
ATOM   7714  C  CA  . SER E  5  56  ? -6.778  -86.761  23.299  1.00 67.45  ? 59   SER E CA  1 
ATOM   7715  C  C   . SER E  5  56  ? -7.568  -87.739  24.167  1.00 67.42  ? 59   SER E C   1 
ATOM   7716  O  O   . SER E  5  56  ? -8.719  -87.487  24.526  1.00 67.31  ? 59   SER E O   1 
ATOM   7717  C  CB  . SER E  5  56  ? -5.694  -86.083  24.143  1.00 67.22  ? 59   SER E CB  1 
ATOM   7718  O  OG  . SER E  5  56  ? -6.143  -85.820  25.460  1.00 66.70  ? 59   SER E OG  1 
ATOM   7719  N  N   . SER E  5  57  ? -6.915  -88.802  24.588  1.00 67.52  ? 60   SER E N   1 
ATOM   7720  C  CA  . SER E  5  57  ? -7.467  -89.678  25.591  1.00 67.54  ? 60   SER E CA  1 
ATOM   7721  C  C   . SER E  5  57  ? -7.235  -89.071  26.942  1.00 67.27  ? 60   SER E C   1 
ATOM   7722  O  O   . SER E  5  57  ? -6.328  -88.285  27.112  1.00 67.06  ? 60   SER E O   1 
ATOM   7723  C  CB  . SER E  5  57  ? -6.742  -91.000  25.544  1.00 67.72  ? 60   SER E CB  1 
ATOM   7724  O  OG  . SER E  5  57  ? -5.357  -90.795  25.694  1.00 68.02  ? 60   SER E OG  1 
ATOM   7725  N  N   . TYR E  5  58  ? -8.051  -89.440  27.912  1.00 63.83  ? 63   TYR E N   1 
ATOM   7726  C  CA  . TYR E  5  58  ? -7.819  -89.006  29.268  1.00 63.92  ? 63   TYR E CA  1 
ATOM   7727  C  C   . TYR E  5  58  ? -7.001  -90.080  29.881  1.00 63.56  ? 63   TYR E C   1 
ATOM   7728  O  O   . TYR E  5  58  ? -7.413  -91.205  29.939  1.00 63.70  ? 63   TYR E O   1 
ATOM   7729  C  CB  . TYR E  5  58  ? -9.101  -88.887  30.064  1.00 64.25  ? 63   TYR E CB  1 
ATOM   7730  C  CG  . TYR E  5  58  ? -9.939  -87.678  29.802  1.00 65.11  ? 63   TYR E CG  1 
ATOM   7731  C  CD1 . TYR E  5  58  ? -10.622 -87.542  28.631  1.00 66.20  ? 63   TYR E CD1 1 
ATOM   7732  C  CD2 . TYR E  5  58  ? -10.086 -86.707  30.745  1.00 66.34  ? 63   TYR E CD2 1 
ATOM   7733  C  CE1 . TYR E  5  58  ? -11.389 -86.471  28.398  1.00 67.38  ? 63   TYR E CE1 1 
ATOM   7734  C  CE2 . TYR E  5  58  ? -10.847 -85.625  30.515  1.00 67.19  ? 63   TYR E CE2 1 
ATOM   7735  C  CZ  . TYR E  5  58  ? -11.501 -85.509  29.339  1.00 67.84  ? 63   TYR E CZ  1 
ATOM   7736  O  OH  . TYR E  5  58  ? -12.282 -84.424  29.088  1.00 68.26  ? 63   TYR E OH  1 
ATOM   7737  N  N   . GLN E  5  59  ? -5.841  -89.700  30.358  1.00 63.06  ? 64   GLN E N   1 
ATOM   7738  C  CA  . GLN E  5  59  ? -4.765  -90.604  30.801  1.00 62.53  ? 64   GLN E CA  1 
ATOM   7739  C  C   . GLN E  5  59  ? -5.094  -91.375  32.089  1.00 61.64  ? 64   GLN E C   1 
ATOM   7740  O  O   . GLN E  5  59  ? -5.651  -90.802  33.035  1.00 61.50  ? 64   GLN E O   1 
ATOM   7741  C  CB  . GLN E  5  59  ? -3.472  -89.808  30.987  1.00 62.90  ? 64   GLN E CB  1 
ATOM   7742  C  CG  . GLN E  5  59  ? -2.189  -90.640  30.966  1.00 64.22  ? 64   GLN E CG  1 
ATOM   7743  C  CD  . GLN E  5  59  ? -1.105  -90.038  31.854  1.00 66.09  ? 64   GLN E CD  1 
ATOM   7744  O  OE1 . GLN E  5  59  ? -0.028  -89.674  31.376  1.00 67.26  ? 64   GLN E OE1 1 
ATOM   7745  N  NE2 . GLN E  5  59  ? -1.394  -89.917  33.154  1.00 66.01  ? 64   GLN E NE2 1 
ATOM   7746  N  N   . LYS E  5  60  ? -4.731  -92.663  32.123  1.00 60.53  ? 65   LYS E N   1 
ATOM   7747  C  CA  . LYS E  5  60  ? -5.059  -93.530  33.266  1.00 59.63  ? 65   LYS E CA  1 
ATOM   7748  C  C   . LYS E  5  60  ? -4.300  -93.154  34.544  1.00 58.33  ? 65   LYS E C   1 
ATOM   7749  O  O   . LYS E  5  60  ? -3.120  -92.820  34.494  1.00 58.27  ? 65   LYS E O   1 
ATOM   7750  C  CB  . LYS E  5  60  ? -4.889  -95.019  32.923  1.00 59.84  ? 65   LYS E CB  1 
ATOM   7751  C  CG  . LYS E  5  60  ? -3.461  -95.483  32.639  1.00 61.65  ? 65   LYS E CG  1 
ATOM   7752  C  CD  . LYS E  5  60  ? -3.377  -97.029  32.614  1.00 64.20  ? 65   LYS E CD  1 
ATOM   7753  C  CE  . LYS E  5  60  ? -1.950  -97.554  32.876  1.00 64.78  ? 65   LYS E CE  1 
ATOM   7754  N  NZ  . LYS E  5  60  ? -1.072  -97.467  31.669  1.00 65.42  ? 65   LYS E NZ  1 
ATOM   7755  N  N   . LYS E  5  61  ? -4.999  -93.177  35.674  1.00 56.76  ? 66   LYS E N   1 
ATOM   7756  C  CA  . LYS E  5  61  ? -4.408  -92.825  36.963  1.00 55.36  ? 66   LYS E CA  1 
ATOM   7757  C  C   . LYS E  5  61  ? -4.404  -94.029  37.916  1.00 54.21  ? 66   LYS E C   1 
ATOM   7758  O  O   . LYS E  5  61  ? -3.824  -93.976  39.000  1.00 53.98  ? 66   LYS E O   1 
ATOM   7759  C  CB  . LYS E  5  61  ? -5.168  -91.657  37.608  1.00 55.64  ? 66   LYS E CB  1 
ATOM   7760  C  CG  . LYS E  5  61  ? -5.404  -90.423  36.718  1.00 56.19  ? 66   LYS E CG  1 
ATOM   7761  C  CD  . LYS E  5  61  ? -4.380  -89.309  36.964  1.00 57.05  ? 66   LYS E CD  1 
ATOM   7762  C  CE  . LYS E  5  61  ? -4.707  -88.475  38.216  1.00 56.35  ? 66   LYS E CE  1 
ATOM   7763  N  NZ  . LYS E  5  61  ? -3.536  -87.621  38.604  1.00 55.69  ? 66   LYS E NZ  1 
ATOM   7764  N  N   . ILE E  5  62  ? -5.051  -95.111  37.504  1.00 52.81  ? 67   ILE E N   1 
ATOM   7765  C  CA  . ILE E  5  62  ? -5.233  -96.270  38.365  1.00 51.84  ? 67   ILE E CA  1 
ATOM   7766  C  C   . ILE E  5  62  ? -4.566  -97.527  37.791  1.00 51.55  ? 67   ILE E C   1 
ATOM   7767  O  O   . ILE E  5  62  ? -4.774  -97.886  36.626  1.00 51.30  ? 67   ILE E O   1 
ATOM   7768  C  CB  . ILE E  5  62  ? -6.729  -96.505  38.674  1.00 51.64  ? 67   ILE E CB  1 
ATOM   7769  C  CG1 . ILE E  5  62  ? -7.244  -95.379  39.563  1.00 50.71  ? 67   ILE E CG1 1 
ATOM   7770  C  CG2 . ILE E  5  62  ? -6.944  -97.837  39.366  1.00 51.12  ? 67   ILE E CG2 1 
ATOM   7771  C  CD1 . ILE E  5  62  ? -8.700  -95.477  39.905  1.00 50.06  ? 67   ILE E CD1 1 
ATOM   7772  N  N   . ILE E  5  63  ? -3.752  -98.179  38.621  1.00 50.96  ? 68   ILE E N   1 
ATOM   7773  C  CA  . ILE E  5  63  ? -3.026  -99.370  38.207  1.00 50.64  ? 68   ILE E CA  1 
ATOM   7774  C  C   . ILE E  5  63  ? -3.301  -100.503 39.183  1.00 50.66  ? 68   ILE E C   1 
ATOM   7775  O  O   . ILE E  5  63  ? -3.256  -100.313 40.400  1.00 50.53  ? 68   ILE E O   1 
ATOM   7776  C  CB  . ILE E  5  63  ? -1.497  -99.102  38.058  1.00 50.52  ? 68   ILE E CB  1 
ATOM   7777  C  CG1 . ILE E  5  63  ? -1.255  -97.996  37.026  1.00 50.36  ? 68   ILE E CG1 1 
ATOM   7778  C  CG2 . ILE E  5  63  ? -0.745  -100.370 37.648  1.00 49.61  ? 68   ILE E CG2 1 
ATOM   7779  C  CD1 . ILE E  5  63  ? 0.015   -97.214  37.229  1.00 50.22  ? 68   ILE E CD1 1 
ATOM   7780  N  N   . LYS E  5  64  ? -3.621  -101.670 38.626  1.00 50.71  ? 69   LYS E N   1 
ATOM   7781  C  CA  . LYS E  5  64  ? -3.790  -102.892 39.399  1.00 50.78  ? 69   LYS E CA  1 
ATOM   7782  C  C   . LYS E  5  64  ? -2.426  -103.508 39.703  1.00 50.78  ? 69   LYS E C   1 
ATOM   7783  O  O   . LYS E  5  64  ? -1.561  -103.592 38.815  1.00 50.96  ? 69   LYS E O   1 
ATOM   7784  C  CB  . LYS E  5  64  ? -4.654  -103.879 38.619  1.00 50.93  ? 69   LYS E CB  1 
ATOM   7785  C  CG  . LYS E  5  64  ? -4.914  -105.195 39.331  1.00 51.22  ? 69   LYS E CG  1 
ATOM   7786  C  CD  . LYS E  5  64  ? -5.831  -106.061 38.495  1.00 52.26  ? 69   LYS E CD  1 
ATOM   7787  C  CE  . LYS E  5  64  ? -5.827  -107.487 38.981  1.00 53.01  ? 69   LYS E CE  1 
ATOM   7788  N  NZ  . LYS E  5  64  ? -6.568  -108.372 38.048  1.00 53.21  ? 69   LYS E NZ  1 
ATOM   7789  N  N   . CYS E  5  65  ? -2.239  -103.941 40.949  1.00 50.45  ? 70   CYS E N   1 
ATOM   7790  C  CA  . CYS E  5  65  ? -0.960  -104.508 41.393  1.00 50.33  ? 70   CYS E CA  1 
ATOM   7791  C  C   . CYS E  5  65  ? -1.014  -106.014 41.629  1.00 50.28  ? 70   CYS E C   1 
ATOM   7792  O  O   . CYS E  5  65  ? -0.057  -106.728 41.327  1.00 50.39  ? 70   CYS E O   1 
ATOM   7793  C  CB  . CYS E  5  65  ? -0.465  -103.775 42.638  1.00 50.40  ? 70   CYS E CB  1 
ATOM   7794  S  SG  . CYS E  5  65  ? 0.073   -102.093 42.230  1.00 50.47  ? 70   CYS E SG  1 
ATOM   7795  N  N   . ASP E  5  66  ? -2.141  -106.467 42.178  1.00 50.18  ? 71   ASP E N   1 
ATOM   7796  C  CA  . ASP E  5  66  ? -2.488  -107.875 42.343  1.00 49.93  ? 71   ASP E CA  1 
ATOM   7797  C  C   . ASP E  5  66  ? -4.023  -107.957 42.426  1.00 49.71  ? 71   ASP E C   1 
ATOM   7798  O  O   . ASP E  5  66  ? -4.722  -106.959 42.202  1.00 49.69  ? 71   ASP E O   1 
ATOM   7799  C  CB  . ASP E  5  66  ? -1.833  -108.451 43.608  1.00 50.34  ? 71   ASP E CB  1 
ATOM   7800  C  CG  . ASP E  5  66  ? -1.671  -109.981 43.564  1.00 51.02  ? 71   ASP E CG  1 
ATOM   7801  O  OD1 . ASP E  5  66  ? -1.138  -110.548 44.544  1.00 51.23  ? 71   ASP E OD1 1 
ATOM   7802  O  OD2 . ASP E  5  66  ? -2.065  -110.619 42.562  1.00 52.31  ? 71   ASP E OD2 1 
ATOM   7803  N  N   . GLU E  5  67  ? -4.550  -109.136 42.740  1.00 49.03  ? 72   GLU E N   1 
ATOM   7804  C  CA  . GLU E  5  67  ? -5.994  -109.324 42.818  1.00 48.56  ? 72   GLU E CA  1 
ATOM   7805  C  C   . GLU E  5  67  ? -6.592  -108.590 44.010  1.00 47.65  ? 72   GLU E C   1 
ATOM   7806  O  O   . GLU E  5  67  ? -7.785  -108.307 44.035  1.00 47.39  ? 72   GLU E O   1 
ATOM   7807  C  CB  . GLU E  5  67  ? -6.336  -110.814 42.902  1.00 49.06  ? 72   GLU E CB  1 
ATOM   7808  C  CG  . GLU E  5  67  ? -6.000  -111.607 41.646  1.00 50.64  ? 72   GLU E CG  1 
ATOM   7809  C  CD  . GLU E  5  67  ? -6.843  -111.200 40.455  1.00 53.74  ? 72   GLU E CD  1 
ATOM   7810  O  OE1 . GLU E  5  67  ? -8.062  -110.946 40.623  1.00 55.08  ? 72   GLU E OE1 1 
ATOM   7811  O  OE2 . GLU E  5  67  ? -6.281  -111.137 39.339  1.00 56.15  ? 72   GLU E OE2 1 
ATOM   7812  N  N   . HIS E  5  68  ? -5.749  -108.281 44.989  1.00 46.54  ? 73   HIS E N   1 
ATOM   7813  C  CA  . HIS E  5  68  ? -6.195  -107.722 46.253  1.00 45.58  ? 73   HIS E CA  1 
ATOM   7814  C  C   . HIS E  5  68  ? -5.565  -106.342 46.513  1.00 45.06  ? 73   HIS E C   1 
ATOM   7815  O  O   . HIS E  5  68  ? -5.616  -105.831 47.632  1.00 44.79  ? 73   HIS E O   1 
ATOM   7816  C  CB  . HIS E  5  68  ? -5.808  -108.676 47.380  1.00 45.30  ? 73   HIS E CB  1 
ATOM   7817  C  CG  . HIS E  5  68  ? -4.332  -108.731 47.626  1.00 45.38  ? 73   HIS E CG  1 
ATOM   7818  N  ND1 . HIS E  5  68  ? -3.760  -108.345 48.820  1.00 45.52  ? 73   HIS E ND1 1 
ATOM   7819  C  CD2 . HIS E  5  68  ? -3.306  -109.073 46.810  1.00 45.12  ? 73   HIS E CD2 1 
ATOM   7820  C  CE1 . HIS E  5  68  ? -2.447  -108.467 48.736  1.00 45.30  ? 73   HIS E CE1 1 
ATOM   7821  N  NE2 . HIS E  5  68  ? -2.146  -108.902 47.525  1.00 45.60  ? 73   HIS E NE2 1 
ATOM   7822  N  N   . MET E  5  69  ? -4.960  -105.747 45.490  1.00 44.41  ? 74   MET E N   1 
ATOM   7823  C  CA  . MET E  5  69  ? -4.186  -104.525 45.699  1.00 43.86  ? 74   MET E CA  1 
ATOM   7824  C  C   . MET E  5  69  ? -4.006  -103.714 44.425  1.00 43.85  ? 74   MET E C   1 
ATOM   7825  O  O   . MET E  5  69  ? -3.797  -104.265 43.350  1.00 43.87  ? 74   MET E O   1 
ATOM   7826  C  CB  . MET E  5  69  ? -2.817  -104.867 46.296  1.00 43.54  ? 74   MET E CB  1 
ATOM   7827  C  CG  . MET E  5  69  ? -2.087  -103.692 46.929  1.00 42.66  ? 74   MET E CG  1 
ATOM   7828  S  SD  . MET E  5  69  ? -0.388  -104.054 47.409  1.00 40.02  ? 74   MET E SD  1 
ATOM   7829  C  CE  . MET E  5  69  ? -0.640  -105.100 48.833  1.00 39.84  ? 74   MET E CE  1 
ATOM   7830  N  N   . GLY E  5  70  ? -4.084  -102.396 44.561  1.00 44.10  ? 75   GLY E N   1 
ATOM   7831  C  CA  . GLY E  5  70  ? -3.823  -101.481 43.455  1.00 44.13  ? 75   GLY E CA  1 
ATOM   7832  C  C   . GLY E  5  70  ? -3.617  -100.072 43.959  1.00 44.48  ? 75   GLY E C   1 
ATOM   7833  O  O   . GLY E  5  70  ? -3.807  -99.779  45.148  1.00 44.59  ? 75   GLY E O   1 
ATOM   7834  N  N   . LEU E  5  71  ? -3.224  -99.188  43.055  1.00 44.79  ? 76   LEU E N   1 
ATOM   7835  C  CA  . LEU E  5  71  ? -2.890  -97.833  43.443  1.00 45.19  ? 76   LEU E CA  1 
ATOM   7836  C  C   . LEU E  5  71  ? -3.397  -96.810  42.433  1.00 45.75  ? 76   LEU E C   1 
ATOM   7837  O  O   . LEU E  5  71  ? -3.696  -97.157  41.277  1.00 45.71  ? 76   LEU E O   1 
ATOM   7838  C  CB  . LEU E  5  71  ? -1.370  -97.704  43.667  1.00 45.20  ? 76   LEU E CB  1 
ATOM   7839  C  CG  . LEU E  5  71  ? -0.325  -97.554  42.549  1.00 44.76  ? 76   LEU E CG  1 
ATOM   7840  C  CD1 . LEU E  5  71  ? 1.011   -98.020  43.063  1.00 45.55  ? 76   LEU E CD1 1 
ATOM   7841  C  CD2 . LEU E  5  71  ? -0.646  -98.347  41.332  1.00 45.61  ? 76   LEU E CD2 1 
ATOM   7842  N  N   . SER E  5  72  ? -3.512  -95.561  42.886  1.00 46.17  ? 77   SER E N   1 
ATOM   7843  C  CA  . SER E  5  72  ? -3.737  -94.426  41.992  1.00 46.92  ? 77   SER E CA  1 
ATOM   7844  C  C   . SER E  5  72  ? -2.540  -93.474  42.071  1.00 46.99  ? 77   SER E C   1 
ATOM   7845  O  O   . SER E  5  72  ? -1.840  -93.432  43.085  1.00 47.07  ? 77   SER E O   1 
ATOM   7846  C  CB  . SER E  5  72  ? -5.045  -93.691  42.317  1.00 46.89  ? 77   SER E CB  1 
ATOM   7847  O  OG  . SER E  5  72  ? -4.947  -93.001  43.550  1.00 48.00  ? 77   SER E OG  1 
ATOM   7848  N  N   . LEU E  5  73  ? -2.323  -92.714  41.003  1.00 46.94  ? 78   LEU E N   1 
ATOM   7849  C  CA  . LEU E  5  73  ? -1.122  -91.908  40.866  1.00 46.98  ? 78   LEU E CA  1 
ATOM   7850  C  C   . LEU E  5  73  ? -1.400  -90.408  40.721  1.00 47.19  ? 78   LEU E C   1 
ATOM   7851  O  O   . LEU E  5  73  ? -2.415  -89.996  40.152  1.00 47.37  ? 78   LEU E O   1 
ATOM   7852  C  CB  . LEU E  5  73  ? -0.304  -92.423  39.679  1.00 46.96  ? 78   LEU E CB  1 
ATOM   7853  C  CG  . LEU E  5  73  ? -0.856  -92.247  38.262  1.00 47.34  ? 78   LEU E CG  1 
ATOM   7854  C  CD1 . LEU E  5  73  ? -0.079  -91.149  37.529  1.00 48.03  ? 78   LEU E CD1 1 
ATOM   7855  C  CD2 . LEU E  5  73  ? -0.789  -93.547  37.487  1.00 46.49  ? 78   LEU E CD2 1 
ATOM   7856  N  N   . ALA E  5  74  ? -0.479  -89.599  41.241  1.00 47.16  ? 79   ALA E N   1 
ATOM   7857  C  CA  . ALA E  5  74  ? -0.513  -88.145  41.081  1.00 46.76  ? 79   ALA E CA  1 
ATOM   7858  C  C   . ALA E  5  74  ? 0.918   -87.629  40.962  1.00 46.65  ? 79   ALA E C   1 
ATOM   7859  O  O   . ALA E  5  74  ? 1.675   -87.653  41.942  1.00 46.78  ? 79   ALA E O   1 
ATOM   7860  C  CB  . ALA E  5  74  ? -1.218  -87.504  42.265  1.00 46.57  ? 79   ALA E CB  1 
ATOM   7861  N  N   . GLY E  5  75  ? 1.295   -87.178  39.768  1.00 46.51  ? 80   GLY E N   1 
ATOM   7862  C  CA  . GLY E  5  75  ? 2.656   -86.692  39.521  1.00 46.52  ? 80   GLY E CA  1 
ATOM   7863  C  C   . GLY E  5  75  ? 3.181   -87.214  38.202  1.00 46.90  ? 80   GLY E C   1 
ATOM   7864  O  O   . GLY E  5  75  ? 2.425   -87.334  37.245  1.00 47.03  ? 80   GLY E O   1 
ATOM   7865  N  N   . LEU E  5  76  ? 4.473   -87.526  38.139  1.00 47.27  ? 81   LEU E N   1 
ATOM   7866  C  CA  . LEU E  5  76  ? 5.052   -88.144  36.939  1.00 47.64  ? 81   LEU E CA  1 
ATOM   7867  C  C   . LEU E  5  76  ? 4.503   -89.557  36.718  1.00 47.75  ? 81   LEU E C   1 
ATOM   7868  O  O   . LEU E  5  76  ? 4.705   -90.450  37.542  1.00 48.02  ? 81   LEU E O   1 
ATOM   7869  C  CB  . LEU E  5  76  ? 6.577   -88.186  37.025  1.00 47.66  ? 81   LEU E CB  1 
ATOM   7870  C  CG  . LEU E  5  76  ? 7.384   -86.927  36.729  1.00 48.40  ? 81   LEU E CG  1 
ATOM   7871  C  CD1 . LEU E  5  76  ? 8.834   -87.206  37.053  1.00 49.78  ? 81   LEU E CD1 1 
ATOM   7872  C  CD2 . LEU E  5  76  ? 7.242   -86.485  35.275  1.00 49.53  ? 81   LEU E CD2 1 
ATOM   7873  N  N   . ALA E  5  77  ? 3.801   -89.750  35.604  1.00 47.82  ? 82   ALA E N   1 
ATOM   7874  C  CA  . ALA E  5  77  ? 3.205   -91.047  35.271  1.00 47.38  ? 82   ALA E CA  1 
ATOM   7875  C  C   . ALA E  5  77  ? 4.231   -92.181  35.046  1.00 47.10  ? 82   ALA E C   1 
ATOM   7876  O  O   . ALA E  5  77  ? 4.014   -93.287  35.542  1.00 47.07  ? 82   ALA E O   1 
ATOM   7877  C  CB  . ALA E  5  77  ? 2.273   -90.912  34.073  1.00 47.53  ? 82   ALA E CB  1 
ATOM   7878  N  N   . PRO E  5  78  ? 5.342   -91.921  34.303  1.00 46.53  ? 83   PRO E N   1 
ATOM   7879  C  CA  . PRO E  5  78  ? 6.317   -93.005  34.120  1.00 46.09  ? 83   PRO E CA  1 
ATOM   7880  C  C   . PRO E  5  78  ? 6.950   -93.481  35.427  1.00 45.91  ? 83   PRO E C   1 
ATOM   7881  O  O   . PRO E  5  78  ? 7.375   -94.631  35.508  1.00 46.31  ? 83   PRO E O   1 
ATOM   7882  C  CB  . PRO E  5  78  ? 7.383   -92.381  33.214  1.00 46.06  ? 83   PRO E CB  1 
ATOM   7883  C  CG  . PRO E  5  78  ? 6.677   -91.285  32.510  1.00 46.41  ? 83   PRO E CG  1 
ATOM   7884  C  CD  . PRO E  5  78  ? 5.716   -90.731  33.517  1.00 46.35  ? 83   PRO E CD  1 
ATOM   7885  N  N   . ASP E  5  79  ? 7.012   -92.618  36.438  1.00 45.25  ? 84   ASP E N   1 
ATOM   7886  C  CA  . ASP E  5  79  ? 7.521   -93.030  37.741  1.00 44.88  ? 84   ASP E CA  1 
ATOM   7887  C  C   . ASP E  5  79  ? 6.523   -93.934  38.471  1.00 44.59  ? 84   ASP E C   1 
ATOM   7888  O  O   . ASP E  5  79  ? 6.906   -94.759  39.311  1.00 44.22  ? 84   ASP E O   1 
ATOM   7889  C  CB  . ASP E  5  79  ? 7.879   -91.814  38.597  1.00 44.90  ? 84   ASP E CB  1 
ATOM   7890  C  CG  . ASP E  5  79  ? 9.263   -91.241  38.269  1.00 45.98  ? 84   ASP E CG  1 
ATOM   7891  O  OD1 . ASP E  5  79  ? 9.786   -90.459  39.100  1.00 46.84  ? 84   ASP E OD1 1 
ATOM   7892  O  OD2 . ASP E  5  79  ? 9.830   -91.564  37.193  1.00 46.59  ? 84   ASP E OD2 1 
ATOM   7893  N  N   . ALA E  5  80  ? 5.245   -93.773  38.138  1.00 44.13  ? 85   ALA E N   1 
ATOM   7894  C  CA  . ALA E  5  80  ? 4.195   -94.597  38.708  1.00 43.82  ? 85   ALA E CA  1 
ATOM   7895  C  C   . ALA E  5  80  ? 4.311   -95.986  38.112  1.00 43.58  ? 85   ALA E C   1 
ATOM   7896  O  O   . ALA E  5  80  ? 4.034   -96.986  38.780  1.00 43.61  ? 85   ALA E O   1 
ATOM   7897  C  CB  . ALA E  5  80  ? 2.818   -94.002  38.419  1.00 43.77  ? 85   ALA E CB  1 
ATOM   7898  N  N   . ARG E  5  81  ? 4.736   -96.038  36.855  1.00 42.99  ? 86   ARG E N   1 
ATOM   7899  C  CA  . ARG E  5  81  ? 4.864   -97.300  36.162  1.00 42.79  ? 86   ARG E CA  1 
ATOM   7900  C  C   . ARG E  5  81  ? 6.040   -98.085  36.756  1.00 42.33  ? 86   ARG E C   1 
ATOM   7901  O  O   . ARG E  5  81  ? 5.899   -99.264  37.076  1.00 42.29  ? 86   ARG E O   1 
ATOM   7902  C  CB  . ARG E  5  81  ? 5.021   -97.082  34.660  1.00 42.79  ? 86   ARG E CB  1 
ATOM   7903  C  CG  . ARG E  5  81  ? 5.403   -98.329  33.917  1.00 43.37  ? 86   ARG E CG  1 
ATOM   7904  C  CD  . ARG E  5  81  ? 5.075   -98.207  32.460  1.00 44.85  ? 86   ARG E CD  1 
ATOM   7905  N  NE  . ARG E  5  81  ? 5.597   -99.336  31.695  1.00 45.79  ? 86   ARG E NE  1 
ATOM   7906  C  CZ  . ARG E  5  81  ? 5.021   -100.534 31.630  1.00 45.12  ? 86   ARG E CZ  1 
ATOM   7907  N  NH1 . ARG E  5  81  ? 3.898   -100.780 32.303  1.00 43.87  ? 86   ARG E NH1 1 
ATOM   7908  N  NH2 . ARG E  5  81  ? 5.577   -101.481 30.892  1.00 43.44  ? 86   ARG E NH2 1 
ATOM   7909  N  N   . VAL E  5  82  ? 7.175   -97.419  36.934  1.00 41.61  ? 87   VAL E N   1 
ATOM   7910  C  CA  . VAL E  5  82  ? 8.324   -98.030  37.582  1.00 40.96  ? 87   VAL E CA  1 
ATOM   7911  C  C   . VAL E  5  82  ? 7.961   -98.605  38.952  1.00 41.13  ? 87   VAL E C   1 
ATOM   7912  O  O   . VAL E  5  82  ? 8.321   -99.735  39.267  1.00 41.19  ? 87   VAL E O   1 
ATOM   7913  C  CB  . VAL E  5  82  ? 9.491   -97.048  37.719  1.00 40.62  ? 87   VAL E CB  1 
ATOM   7914  C  CG1 . VAL E  5  82  ? 10.594  -97.642  38.577  1.00 39.98  ? 87   VAL E CG1 1 
ATOM   7915  C  CG2 . VAL E  5  82  ? 10.036  -96.680  36.349  1.00 40.51  ? 87   VAL E CG2 1 
ATOM   7916  N  N   . LEU E  5  83  ? 7.235   -97.842  39.756  1.00 41.37  ? 88   LEU E N   1 
ATOM   7917  C  CA  . LEU E  5  83  ? 6.927   -98.285  41.119  1.00 41.73  ? 88   LEU E CA  1 
ATOM   7918  C  C   . LEU E  5  83  ? 5.797   -99.320  41.180  1.00 42.13  ? 88   LEU E C   1 
ATOM   7919  O  O   . LEU E  5  83  ? 5.860   -100.268 41.965  1.00 42.10  ? 88   LEU E O   1 
ATOM   7920  C  CB  . LEU E  5  83  ? 6.616   -97.093  42.026  1.00 41.43  ? 88   LEU E CB  1 
ATOM   7921  C  CG  . LEU E  5  83  ? 7.744   -96.120  42.366  1.00 41.38  ? 88   LEU E CG  1 
ATOM   7922  C  CD1 . LEU E  5  83  ? 7.156   -94.830  42.877  1.00 41.67  ? 88   LEU E CD1 1 
ATOM   7923  C  CD2 . LEU E  5  83  ? 8.708   -96.692  43.394  1.00 41.32  ? 88   LEU E CD2 1 
ATOM   7924  N  N   . SER E  5  84  ? 4.766   -99.149  40.357  1.00 42.68  ? 89   SER E N   1 
ATOM   7925  C  CA  . SER E  5  84  ? 3.685   -100.140 40.301  1.00 43.28  ? 89   SER E CA  1 
ATOM   7926  C  C   . SER E  5  84  ? 4.241   -101.468 39.786  1.00 43.50  ? 89   SER E C   1 
ATOM   7927  O  O   . SER E  5  84  ? 3.800   -102.542 40.182  1.00 43.53  ? 89   SER E O   1 
ATOM   7928  C  CB  . SER E  5  84  ? 2.532   -99.660  39.418  1.00 43.06  ? 89   SER E CB  1 
ATOM   7929  O  OG  . SER E  5  84  ? 2.978   -99.458  38.085  1.00 43.55  ? 89   SER E OG  1 
ATOM   7930  N  N   . ASN E  5  85  ? 5.228   -101.373 38.909  1.00 43.94  ? 90   ASN E N   1 
ATOM   7931  C  CA  . ASN E  5  85  ? 5.887   -102.528 38.360  1.00 44.50  ? 90   ASN E CA  1 
ATOM   7932  C  C   . ASN E  5  85  ? 6.576   -103.319 39.455  1.00 44.21  ? 90   ASN E C   1 
ATOM   7933  O  O   . ASN E  5  85  ? 6.399   -104.535 39.564  1.00 44.46  ? 90   ASN E O   1 
ATOM   7934  C  CB  . ASN E  5  85  ? 6.922   -102.063 37.358  1.00 45.41  ? 90   ASN E CB  1 
ATOM   7935  C  CG  . ASN E  5  85  ? 6.864   -102.834 36.085  1.00 48.40  ? 90   ASN E CG  1 
ATOM   7936  O  OD1 . ASN E  5  85  ? 7.628   -103.802 35.895  1.00 52.32  ? 90   ASN E OD1 1 
ATOM   7937  N  ND2 . ASN E  5  85  ? 5.940   -102.441 35.197  1.00 48.05  ? 90   ASN E ND2 1 
ATOM   7938  N  N   . TYR E  5  86  ? 7.353   -102.613 40.275  1.00 43.67  ? 91   TYR E N   1 
ATOM   7939  C  CA  . TYR E  5  86  ? 8.093   -103.211 41.378  1.00 43.01  ? 91   TYR E CA  1 
ATOM   7940  C  C   . TYR E  5  86  ? 7.125   -103.865 42.356  1.00 42.79  ? 91   TYR E C   1 
ATOM   7941  O  O   . TYR E  5  86  ? 7.365   -104.966 42.845  1.00 42.97  ? 91   TYR E O   1 
ATOM   7942  C  CB  . TYR E  5  86  ? 8.943   -102.137 42.071  1.00 43.05  ? 91   TYR E CB  1 
ATOM   7943  C  CG  . TYR E  5  86  ? 9.601   -102.558 43.368  1.00 43.12  ? 91   TYR E CG  1 
ATOM   7944  C  CD1 . TYR E  5  86  ? 9.074   -102.153 44.601  1.00 43.08  ? 91   TYR E CD1 1 
ATOM   7945  C  CD2 . TYR E  5  86  ? 10.750  -103.355 43.368  1.00 43.82  ? 91   TYR E CD2 1 
ATOM   7946  C  CE1 . TYR E  5  86  ? 9.665   -102.536 45.799  1.00 43.62  ? 91   TYR E CE1 1 
ATOM   7947  C  CE2 . TYR E  5  86  ? 11.351  -103.752 44.565  1.00 44.36  ? 91   TYR E CE2 1 
ATOM   7948  C  CZ  . TYR E  5  86  ? 10.805  -103.334 45.774  1.00 44.86  ? 91   TYR E CZ  1 
ATOM   7949  O  OH  . TYR E  5  86  ? 11.397  -103.711 46.961  1.00 45.73  ? 91   TYR E OH  1 
ATOM   7950  N  N   . LEU E  5  87  ? 6.024   -103.178 42.619  1.00 42.45  ? 92   LEU E N   1 
ATOM   7951  C  CA  . LEU E  5  87  ? 5.007   -103.639 43.541  1.00 42.23  ? 92   LEU E CA  1 
ATOM   7952  C  C   . LEU E  5  87  ? 4.314   -104.908 43.034  1.00 41.86  ? 92   LEU E C   1 
ATOM   7953  O  O   . LEU E  5  87  ? 4.007   -105.816 43.806  1.00 41.92  ? 92   LEU E O   1 
ATOM   7954  C  CB  . LEU E  5  87  ? 3.988   -102.524 43.739  1.00 42.47  ? 92   LEU E CB  1 
ATOM   7955  C  CG  . LEU E  5  87  ? 3.234   -102.500 45.056  1.00 43.20  ? 92   LEU E CG  1 
ATOM   7956  C  CD1 . LEU E  5  87  ? 4.221   -102.514 46.205  1.00 43.74  ? 92   LEU E CD1 1 
ATOM   7957  C  CD2 . LEU E  5  87  ? 2.339   -101.256 45.108  1.00 43.73  ? 92   LEU E CD2 1 
ATOM   7958  N  N   . ARG E  5  88  ? 4.068   -104.958 41.729  1.00 41.20  ? 93   ARG E N   1 
ATOM   7959  C  CA  . ARG E  5  88  ? 3.561   -106.159 41.081  1.00 40.40  ? 93   ARG E CA  1 
ATOM   7960  C  C   . ARG E  5  88  ? 4.490   -107.352 41.298  1.00 40.45  ? 93   ARG E C   1 
ATOM   7961  O  O   . ARG E  5  88  ? 4.033   -108.456 41.586  1.00 40.48  ? 93   ARG E O   1 
ATOM   7962  C  CB  . ARG E  5  88  ? 3.373   -105.918 39.587  1.00 40.12  ? 93   ARG E CB  1 
ATOM   7963  C  CG  . ARG E  5  88  ? 2.162   -105.097 39.235  1.00 37.77  ? 93   ARG E CG  1 
ATOM   7964  C  CD  . ARG E  5  88  ? 2.107   -104.819 37.745  1.00 35.16  ? 93   ARG E CD  1 
ATOM   7965  N  NE  . ARG E  5  88  ? 0.764   -104.386 37.390  1.00 34.80  ? 93   ARG E NE  1 
ATOM   7966  C  CZ  . ARG E  5  88  ? 0.386   -103.923 36.204  1.00 32.98  ? 93   ARG E CZ  1 
ATOM   7967  N  NH1 . ARG E  5  88  ? 1.245   -103.821 35.198  1.00 32.26  ? 93   ARG E NH1 1 
ATOM   7968  N  NH2 . ARG E  5  88  ? -0.875  -103.574 36.035  1.00 31.59  ? 93   ARG E NH2 1 
ATOM   7969  N  N   . GLN E  5  89  ? 5.791   -107.118 41.164  1.00 40.35  ? 94   GLN E N   1 
ATOM   7970  C  CA  . GLN E  5  89  ? 6.794   -108.154 41.388  1.00 40.19  ? 94   GLN E CA  1 
ATOM   7971  C  C   . GLN E  5  89  ? 6.833   -108.627 42.833  1.00 39.57  ? 94   GLN E C   1 
ATOM   7972  O  O   . GLN E  5  89  ? 6.920   -109.827 43.087  1.00 39.79  ? 94   GLN E O   1 
ATOM   7973  C  CB  . GLN E  5  89  ? 8.172   -107.674 40.936  1.00 40.31  ? 94   GLN E CB  1 
ATOM   7974  C  CG  . GLN E  5  89  ? 8.346   -107.735 39.426  1.00 42.51  ? 94   GLN E CG  1 
ATOM   7975  C  CD  . GLN E  5  89  ? 9.603   -107.041 38.940  1.00 46.41  ? 94   GLN E CD  1 
ATOM   7976  O  OE1 . GLN E  5  89  ? 10.237  -106.274 39.679  1.00 48.67  ? 94   GLN E OE1 1 
ATOM   7977  N  NE2 . GLN E  5  89  ? 9.976   -107.304 37.680  1.00 47.50  ? 94   GLN E NE2 1 
ATOM   7978  N  N   . GLN E  5  90  ? 6.757   -107.692 43.774  1.00 38.90  ? 95   GLN E N   1 
ATOM   7979  C  CA  . GLN E  5  90  ? 6.786   -108.041 45.192  1.00 38.56  ? 95   GLN E CA  1 
ATOM   7980  C  C   . GLN E  5  90  ? 5.545   -108.816 45.601  1.00 38.41  ? 95   GLN E C   1 
ATOM   7981  O  O   . GLN E  5  90  ? 5.616   -109.679 46.464  1.00 38.38  ? 95   GLN E O   1 
ATOM   7982  C  CB  . GLN E  5  90  ? 6.942   -106.804 46.079  1.00 38.27  ? 95   GLN E CB  1 
ATOM   7983  C  CG  . GLN E  5  90  ? 8.261   -106.089 45.928  1.00 39.02  ? 95   GLN E CG  1 
ATOM   7984  C  CD  . GLN E  5  90  ? 9.451   -107.013 46.066  1.00 40.84  ? 95   GLN E CD  1 
ATOM   7985  O  OE1 . GLN E  5  90  ? 9.612   -107.698 47.084  1.00 41.43  ? 95   GLN E OE1 1 
ATOM   7986  N  NE2 . GLN E  5  90  ? 10.304  -107.034 45.040  1.00 41.25  ? 95   GLN E NE2 1 
ATOM   7987  N  N   . CYS E  5  91  ? 4.412   -108.489 44.990  1.00 38.27  ? 96   CYS E N   1 
ATOM   7988  C  CA  . CYS E  5  91  ? 3.174   -109.208 45.220  1.00 38.60  ? 96   CYS E CA  1 
ATOM   7989  C  C   . CYS E  5  91  ? 3.286   -110.621 44.683  1.00 38.55  ? 96   CYS E C   1 
ATOM   7990  O  O   . CYS E  5  91  ? 2.850   -111.571 45.322  1.00 38.69  ? 96   CYS E O   1 
ATOM   7991  C  CB  . CYS E  5  91  ? 2.016   -108.491 44.530  1.00 38.62  ? 96   CYS E CB  1 
ATOM   7992  S  SG  . CYS E  5  91  ? 1.302   -107.175 45.520  1.00 40.35  ? 96   CYS E SG  1 
ATOM   7993  N  N   . ASN E  5  92  ? 3.875   -110.727 43.496  1.00 38.59  ? 97   ASN E N   1 
ATOM   7994  C  CA  . ASN E  5  92  ? 4.097   -111.974 42.794  1.00 38.48  ? 97   ASN E CA  1 
ATOM   7995  C  C   . ASN E  5  92  ? 5.036   -112.892 43.572  1.00 38.79  ? 97   ASN E C   1 
ATOM   7996  O  O   . ASN E  5  92  ? 4.720   -114.068 43.813  1.00 38.84  ? 97   ASN E O   1 
ATOM   7997  C  CB  . ASN E  5  92  ? 4.708   -111.654 41.439  1.00 38.47  ? 97   ASN E CB  1 
ATOM   7998  C  CG  . ASN E  5  92  ? 4.387   -112.678 40.393  1.00 38.81  ? 97   ASN E CG  1 
ATOM   7999  O  OD1 . ASN E  5  92  ? 5.201   -112.949 39.517  1.00 39.51  ? 97   ASN E OD1 1 
ATOM   8000  N  ND2 . ASN E  5  92  ? 3.194   -113.246 40.460  1.00 39.48  ? 97   ASN E ND2 1 
ATOM   8001  N  N   . TYR E  5  93  ? 6.187   -112.346 43.972  1.00 38.59  ? 98   TYR E N   1 
ATOM   8002  C  CA  . TYR E  5  93  ? 7.176   -113.112 44.700  1.00 38.32  ? 98   TYR E CA  1 
ATOM   8003  C  C   . TYR E  5  93  ? 6.526   -113.717 45.940  1.00 38.15  ? 98   TYR E C   1 
ATOM   8004  O  O   . TYR E  5  93  ? 6.684   -114.910 46.206  1.00 38.52  ? 98   TYR E O   1 
ATOM   8005  C  CB  . TYR E  5  93  ? 8.379   -112.244 45.042  1.00 38.25  ? 98   TYR E CB  1 
ATOM   8006  C  CG  . TYR E  5  93  ? 9.495   -112.937 45.811  1.00 39.48  ? 98   TYR E CG  1 
ATOM   8007  C  CD1 . TYR E  5  93  ? 10.609  -113.487 45.151  1.00 39.91  ? 98   TYR E CD1 1 
ATOM   8008  C  CD2 . TYR E  5  93  ? 9.459   -113.007 47.206  1.00 40.79  ? 98   TYR E CD2 1 
ATOM   8009  C  CE1 . TYR E  5  93  ? 11.645  -114.103 45.871  1.00 40.22  ? 98   TYR E CE1 1 
ATOM   8010  C  CE2 . TYR E  5  93  ? 10.477  -113.620 47.929  1.00 41.44  ? 98   TYR E CE2 1 
ATOM   8011  C  CZ  . TYR E  5  93  ? 11.562  -114.165 47.262  1.00 42.05  ? 98   TYR E CZ  1 
ATOM   8012  O  OH  . TYR E  5  93  ? 12.554  -114.754 48.023  1.00 44.19  ? 98   TYR E OH  1 
ATOM   8013  N  N   . SER E  5  94  ? 5.753   -112.911 46.656  1.00 37.67  ? 99   SER E N   1 
ATOM   8014  C  CA  . SER E  5  94  ? 5.086   -113.353 47.878  1.00 37.48  ? 99   SER E CA  1 
ATOM   8015  C  C   . SER E  5  94  ? 4.147   -114.559 47.655  1.00 37.82  ? 99   SER E C   1 
ATOM   8016  O  O   . SER E  5  94  ? 4.163   -115.516 48.425  1.00 37.46  ? 99   SER E O   1 
ATOM   8017  C  CB  . SER E  5  94  ? 4.338   -112.185 48.506  1.00 36.73  ? 99   SER E CB  1 
ATOM   8018  O  OG  . SER E  5  94  ? 3.691   -112.578 49.693  1.00 36.95  ? 99   SER E OG  1 
ATOM   8019  N  N   . SER E  5  95  ? 3.345   -114.502 46.596  1.00 38.37  ? 100  SER E N   1 
ATOM   8020  C  CA  . SER E  5  95  ? 2.494   -115.616 46.204  1.00 38.93  ? 100  SER E CA  1 
ATOM   8021  C  C   . SER E  5  95  ? 3.293   -116.848 45.818  1.00 39.27  ? 100  SER E C   1 
ATOM   8022  O  O   . SER E  5  95  ? 3.046   -117.922 46.345  1.00 39.52  ? 100  SER E O   1 
ATOM   8023  C  CB  . SER E  5  95  ? 1.612   -115.217 45.028  1.00 38.59  ? 100  SER E CB  1 
ATOM   8024  O  OG  . SER E  5  95  ? 0.463   -114.578 45.514  1.00 39.91  ? 100  SER E OG  1 
ATOM   8025  N  N   . LEU E  5  96  ? 4.240   -116.682 44.891  1.00 39.39  ? 101  LEU E N   1 
ATOM   8026  C  CA  . LEU E  5  96  ? 4.986   -117.792 44.331  1.00 39.27  ? 101  LEU E CA  1 
ATOM   8027  C  C   . LEU E  5  96  ? 5.776   -118.544 45.381  1.00 39.08  ? 101  LEU E C   1 
ATOM   8028  O  O   . LEU E  5  96  ? 5.736   -119.778 45.409  1.00 39.32  ? 101  LEU E O   1 
ATOM   8029  C  CB  . LEU E  5  96  ? 5.934   -117.313 43.233  1.00 39.59  ? 101  LEU E CB  1 
ATOM   8030  C  CG  . LEU E  5  96  ? 5.314   -116.795 41.928  1.00 41.08  ? 101  LEU E CG  1 
ATOM   8031  C  CD1 . LEU E  5  96  ? 6.427   -116.381 40.903  1.00 41.55  ? 101  LEU E CD1 1 
ATOM   8032  C  CD2 . LEU E  5  96  ? 4.314   -117.801 41.319  1.00 39.42  ? 101  LEU E CD2 1 
ATOM   8033  N  N   . VAL E  5  97  ? 6.476   -117.803 46.244  1.00 38.44  ? 102  VAL E N   1 
ATOM   8034  C  CA  . VAL E  5  97  ? 7.416   -118.403 47.200  1.00 37.82  ? 102  VAL E CA  1 
ATOM   8035  C  C   . VAL E  5  97  ? 6.755   -118.835 48.512  1.00 37.84  ? 102  VAL E C   1 
ATOM   8036  O  O   . VAL E  5  97  ? 7.109   -119.868 49.077  1.00 38.01  ? 102  VAL E O   1 
ATOM   8037  C  CB  . VAL E  5  97  ? 8.630   -117.484 47.486  1.00 37.48  ? 102  VAL E CB  1 
ATOM   8038  C  CG1 . VAL E  5  97  ? 9.520   -118.071 48.572  1.00 36.81  ? 102  VAL E CG1 1 
ATOM   8039  C  CG2 . VAL E  5  97  ? 9.449   -117.262 46.221  1.00 37.34  ? 102  VAL E CG2 1 
ATOM   8040  N  N   . PHE E  5  98  ? 5.793   -118.054 48.984  1.00 37.62  ? 103  PHE E N   1 
ATOM   8041  C  CA  . PHE E  5  98  ? 5.193   -118.292 50.281  1.00 37.41  ? 103  PHE E CA  1 
ATOM   8042  C  C   . PHE E  5  98  ? 3.723   -118.608 50.168  1.00 37.92  ? 103  PHE E C   1 
ATOM   8043  O  O   . PHE E  5  98  ? 3.077   -118.874 51.173  1.00 38.32  ? 103  PHE E O   1 
ATOM   8044  C  CB  . PHE E  5  98  ? 5.369   -117.073 51.185  1.00 37.38  ? 103  PHE E CB  1 
ATOM   8045  C  CG  . PHE E  5  98  ? 6.796   -116.785 51.556  1.00 36.84  ? 103  PHE E CG  1 
ATOM   8046  C  CD1 . PHE E  5  98  ? 7.545   -115.861 50.831  1.00 36.60  ? 103  PHE E CD1 1 
ATOM   8047  C  CD2 . PHE E  5  98  ? 7.391   -117.423 52.638  1.00 36.49  ? 103  PHE E CD2 1 
ATOM   8048  C  CE1 . PHE E  5  98  ? 8.874   -115.582 51.171  1.00 36.24  ? 103  PHE E CE1 1 
ATOM   8049  C  CE2 . PHE E  5  98  ? 8.724   -117.156 52.982  1.00 37.03  ? 103  PHE E CE2 1 
ATOM   8050  C  CZ  . PHE E  5  98  ? 9.465   -116.228 52.241  1.00 36.39  ? 103  PHE E CZ  1 
ATOM   8051  N  N   . ASN E  5  99  ? 3.193   -118.581 48.949  1.00 38.56  ? 104  ASN E N   1 
ATOM   8052  C  CA  . ASN E  5  99  ? 1.762   -118.764 48.704  1.00 39.22  ? 104  ASN E CA  1 
ATOM   8053  C  C   . ASN E  5  99  ? 0.924   -117.810 49.559  1.00 39.18  ? 104  ASN E C   1 
ATOM   8054  O  O   . ASN E  5  99  ? -0.159  -118.134 50.029  1.00 39.22  ? 104  ASN E O   1 
ATOM   8055  C  CB  . ASN E  5  99  ? 1.354   -120.231 48.889  1.00 39.49  ? 104  ASN E CB  1 
ATOM   8056  C  CG  . ASN E  5  99  ? 0.011   -120.560 48.223  1.00 41.77  ? 104  ASN E CG  1 
ATOM   8057  O  OD1 . ASN E  5  99  ? -0.826  -121.235 48.818  1.00 44.70  ? 104  ASN E OD1 1 
ATOM   8058  N  ND2 . ASN E  5  99  ? -0.199  -120.075 46.993  1.00 41.85  ? 104  ASN E ND2 1 
ATOM   8059  N  N   . ARG E  5  100 ? 1.451   -116.611 49.734  1.00 39.51  ? 105  ARG E N   1 
ATOM   8060  C  CA  . ARG E  5  100 ? 0.900   -115.633 50.659  1.00 39.68  ? 105  ARG E CA  1 
ATOM   8061  C  C   . ARG E  5  100 ? 0.597   -114.350 49.903  1.00 40.08  ? 105  ARG E C   1 
ATOM   8062  O  O   . ARG E  5  100 ? 1.417   -113.881 49.085  1.00 39.84  ? 105  ARG E O   1 
ATOM   8063  C  CB  . ARG E  5  100 ? 1.933   -115.356 51.743  1.00 39.54  ? 105  ARG E CB  1 
ATOM   8064  C  CG  . ARG E  5  100 ? 1.472   -114.552 52.907  1.00 38.51  ? 105  ARG E CG  1 
ATOM   8065  C  CD  . ARG E  5  100 ? 2.693   -114.171 53.716  1.00 36.87  ? 105  ARG E CD  1 
ATOM   8066  N  NE  . ARG E  5  100 ? 2.345   -113.677 55.045  1.00 35.41  ? 105  ARG E NE  1 
ATOM   8067  C  CZ  . ARG E  5  100 ? 3.200   -113.611 56.057  1.00 34.62  ? 105  ARG E CZ  1 
ATOM   8068  N  NH1 . ARG E  5  100 ? 4.450   -114.007 55.896  1.00 36.53  ? 105  ARG E NH1 1 
ATOM   8069  N  NH2 . ARG E  5  100 ? 2.802   -113.167 57.231  1.00 34.89  ? 105  ARG E NH2 1 
ATOM   8070  N  N   . LYS E  5  101 ? -0.589  -113.800 50.156  1.00 40.37  ? 106  LYS E N   1 
ATOM   8071  C  CA  . LYS E  5  101 ? -0.924  -112.465 49.653  1.00 41.03  ? 106  LYS E CA  1 
ATOM   8072  C  C   . LYS E  5  101 ? -0.169  -111.421 50.477  1.00 40.21  ? 106  LYS E C   1 
ATOM   8073  O  O   . LYS E  5  101 ? -0.239  -111.436 51.708  1.00 39.89  ? 106  LYS E O   1 
ATOM   8074  C  CB  . LYS E  5  101 ? -2.430  -112.232 49.705  1.00 41.39  ? 106  LYS E CB  1 
ATOM   8075  C  CG  . LYS E  5  101 ? -3.199  -113.023 48.670  1.00 44.10  ? 106  LYS E CG  1 
ATOM   8076  C  CD  . LYS E  5  101 ? -4.637  -113.210 49.110  1.00 49.33  ? 106  LYS E CD  1 
ATOM   8077  C  CE  . LYS E  5  101 ? -5.539  -113.488 47.914  1.00 52.75  ? 106  LYS E CE  1 
ATOM   8078  N  NZ  . LYS E  5  101 ? -6.803  -114.117 48.393  1.00 55.48  ? 106  LYS E NZ  1 
ATOM   8079  N  N   . LEU E  5  102 ? 0.586   -110.558 49.794  1.00 39.88  ? 107  LEU E N   1 
ATOM   8080  C  CA  . LEU E  5  102 ? 1.381   -109.517 50.451  1.00 39.63  ? 107  LEU E CA  1 
ATOM   8081  C  C   . LEU E  5  102 ? 0.472   -108.580 51.245  1.00 39.94  ? 107  LEU E C   1 
ATOM   8082  O  O   . LEU E  5  102 ? -0.522  -108.080 50.722  1.00 39.83  ? 107  LEU E O   1 
ATOM   8083  C  CB  . LEU E  5  102 ? 2.199   -108.721 49.431  1.00 39.11  ? 107  LEU E CB  1 
ATOM   8084  C  CG  . LEU E  5  102 ? 3.264   -107.747 49.965  1.00 38.83  ? 107  LEU E CG  1 
ATOM   8085  C  CD1 . LEU E  5  102 ? 4.394   -108.477 50.666  1.00 36.81  ? 107  LEU E CD1 1 
ATOM   8086  C  CD2 . LEU E  5  102 ? 3.831   -106.877 48.846  1.00 37.63  ? 107  LEU E CD2 1 
ATOM   8087  N  N   . ALA E  5  103 ? 0.802   -108.375 52.518  1.00 40.34  ? 108  ALA E N   1 
ATOM   8088  C  CA  . ALA E  5  103 ? 0.102   -107.395 53.355  1.00 40.63  ? 108  ALA E CA  1 
ATOM   8089  C  C   . ALA E  5  103 ? 0.280   -105.998 52.761  1.00 40.73  ? 108  ALA E C   1 
ATOM   8090  O  O   . ALA E  5  103 ? 1.363   -105.660 52.273  1.00 40.68  ? 108  ALA E O   1 
ATOM   8091  C  CB  . ALA E  5  103 ? 0.628   -107.443 54.797  1.00 40.24  ? 108  ALA E CB  1 
ATOM   8092  N  N   . VAL E  5  104 ? -0.785  -105.201 52.780  1.00 41.24  ? 109  VAL E N   1 
ATOM   8093  C  CA  . VAL E  5  104 ? -0.729  -103.837 52.256  1.00 41.81  ? 109  VAL E CA  1 
ATOM   8094  C  C   . VAL E  5  104 ? 0.285   -103.013 53.030  1.00 42.26  ? 109  VAL E C   1 
ATOM   8095  O  O   . VAL E  5  104 ? 1.087   -102.302 52.428  1.00 42.24  ? 109  VAL E O   1 
ATOM   8096  C  CB  . VAL E  5  104 ? -2.087  -103.150 52.278  1.00 41.92  ? 109  VAL E CB  1 
ATOM   8097  C  CG1 . VAL E  5  104 ? -2.001  -101.826 51.534  1.00 42.56  ? 109  VAL E CG1 1 
ATOM   8098  C  CG2 . VAL E  5  104 ? -3.132  -104.042 51.624  1.00 41.55  ? 109  VAL E CG2 1 
ATOM   8099  N  N   . GLU E  5  105 ? 0.280   -103.144 54.354  1.00 42.75  ? 110  GLU E N   1 
ATOM   8100  C  CA  . GLU E  5  105 ? 1.320   -102.537 55.169  1.00 43.67  ? 110  GLU E CA  1 
ATOM   8101  C  C   . GLU E  5  105 ? 2.721   -102.848 54.636  1.00 43.60  ? 110  GLU E C   1 
ATOM   8102  O  O   . GLU E  5  105 ? 3.544   -101.948 54.455  1.00 44.17  ? 110  GLU E O   1 
ATOM   8103  C  CB  . GLU E  5  105 ? 1.212   -102.991 56.621  1.00 44.09  ? 110  GLU E CB  1 
ATOM   8104  C  CG  . GLU E  5  105 ? 2.201   -102.274 57.530  1.00 46.74  ? 110  GLU E CG  1 
ATOM   8105  C  CD  . GLU E  5  105 ? 1.902   -102.432 59.010  1.00 51.36  ? 110  GLU E CD  1 
ATOM   8106  O  OE1 . GLU E  5  105 ? 2.856   -102.316 59.812  1.00 54.13  ? 110  GLU E OE1 1 
ATOM   8107  O  OE2 . GLU E  5  105 ? 0.726   -102.662 59.384  1.00 53.09  ? 110  GLU E OE2 1 
ATOM   8108  N  N   . ARG E  5  106 ? 2.980   -104.126 54.391  1.00 43.29  ? 111  ARG E N   1 
ATOM   8109  C  CA  . ARG E  5  106 ? 4.278   -104.590 53.944  1.00 43.03  ? 111  ARG E CA  1 
ATOM   8110  C  C   . ARG E  5  106 ? 4.635   -103.981 52.588  1.00 42.27  ? 111  ARG E C   1 
ATOM   8111  O  O   . ARG E  5  106 ? 5.795   -103.656 52.333  1.00 42.13  ? 111  ARG E O   1 
ATOM   8112  C  CB  . ARG E  5  106 ? 4.277   -106.119 53.893  1.00 43.62  ? 111  ARG E CB  1 
ATOM   8113  C  CG  . ARG E  5  106 ? 5.606   -106.722 53.571  1.00 45.96  ? 111  ARG E CG  1 
ATOM   8114  C  CD  . ARG E  5  106 ? 6.167   -107.627 54.663  1.00 50.03  ? 111  ARG E CD  1 
ATOM   8115  N  NE  . ARG E  5  106 ? 7.593   -107.887 54.401  1.00 53.40  ? 111  ARG E NE  1 
ATOM   8116  C  CZ  . ARG E  5  106 ? 8.089   -108.413 53.271  1.00 53.92  ? 111  ARG E CZ  1 
ATOM   8117  N  NH1 . ARG E  5  106 ? 7.295   -108.760 52.259  1.00 53.61  ? 111  ARG E NH1 1 
ATOM   8118  N  NH2 . ARG E  5  106 ? 9.396   -108.593 53.147  1.00 53.64  ? 111  ARG E NH2 1 
ATOM   8119  N  N   . ALA E  5  107 ? 3.634   -103.809 51.728  1.00 41.71  ? 112  ALA E N   1 
ATOM   8120  C  CA  . ALA E  5  107 ? 3.830   -103.125 50.439  1.00 41.10  ? 112  ALA E CA  1 
ATOM   8121  C  C   . ALA E  5  107 ? 4.182   -101.656 50.640  1.00 40.84  ? 112  ALA E C   1 
ATOM   8122  O  O   . ALA E  5  107 ? 4.933   -101.080 49.864  1.00 40.72  ? 112  ALA E O   1 
ATOM   8123  C  CB  . ALA E  5  107 ? 2.611   -103.248 49.584  1.00 40.83  ? 112  ALA E CB  1 
ATOM   8124  N  N   . GLY E  5  108 ? 3.634   -101.058 51.690  1.00 40.79  ? 113  GLY E N   1 
ATOM   8125  C  CA  . GLY E  5  108 ? 3.992   -99.703  52.069  1.00 40.95  ? 113  GLY E CA  1 
ATOM   8126  C  C   . GLY E  5  108 ? 5.475   -99.634  52.343  1.00 41.15  ? 113  GLY E C   1 
ATOM   8127  O  O   . GLY E  5  108 ? 6.202   -98.830  51.725  1.00 40.84  ? 113  GLY E O   1 
ATOM   8128  N  N   . HIS E  5  109 ? 5.926   -100.505 53.247  1.00 41.25  ? 114  HIS E N   1 
ATOM   8129  C  CA  . HIS E  5  109 ? 7.317   -100.512 53.686  1.00 41.88  ? 114  HIS E CA  1 
ATOM   8130  C  C   . HIS E  5  109 ? 8.271   -100.674 52.516  1.00 42.12  ? 114  HIS E C   1 
ATOM   8131  O  O   . HIS E  5  109 ? 9.333   -100.047 52.491  1.00 42.32  ? 114  HIS E O   1 
ATOM   8132  C  CB  . HIS E  5  109 ? 7.570   -101.616 54.711  1.00 42.05  ? 114  HIS E CB  1 
ATOM   8133  C  CG  . HIS E  5  109 ? 6.779   -101.466 55.974  1.00 43.82  ? 114  HIS E CG  1 
ATOM   8134  N  ND1 . HIS E  5  109 ? 6.576   -100.246 56.592  1.00 44.78  ? 114  HIS E ND1 1 
ATOM   8135  C  CD2 . HIS E  5  109 ? 6.154   -102.386 56.747  1.00 44.23  ? 114  HIS E CD2 1 
ATOM   8136  C  CE1 . HIS E  5  109 ? 5.852   -100.422 57.683  1.00 44.40  ? 114  HIS E CE1 1 
ATOM   8137  N  NE2 . HIS E  5  109 ? 5.584   -101.711 57.799  1.00 45.23  ? 114  HIS E NE2 1 
ATOM   8138  N  N   . LEU E  5  110 ? 7.888   -101.507 51.547  1.00 42.04  ? 115  LEU E N   1 
ATOM   8139  C  CA  . LEU E  5  110 ? 8.744   -101.800 50.406  1.00 41.79  ? 115  LEU E CA  1 
ATOM   8140  C  C   . LEU E  5  110 ? 8.910   -100.594 49.489  1.00 41.74  ? 115  LEU E C   1 
ATOM   8141  O  O   . LEU E  5  110 ? 10.019  -100.312 49.037  1.00 41.89  ? 115  LEU E O   1 
ATOM   8142  C  CB  . LEU E  5  110 ? 8.226   -103.017 49.637  1.00 42.01  ? 115  LEU E CB  1 
ATOM   8143  C  CG  . LEU E  5  110 ? 8.334   -104.394 50.312  1.00 41.63  ? 115  LEU E CG  1 
ATOM   8144  C  CD1 . LEU E  5  110 ? 7.275   -105.342 49.750  1.00 40.12  ? 115  LEU E CD1 1 
ATOM   8145  C  CD2 . LEU E  5  110 ? 9.737   -104.978 50.171  1.00 39.95  ? 115  LEU E CD2 1 
ATOM   8146  N  N   . LEU E  5  111 ? 7.811   -99.888  49.221  1.00 41.83  ? 116  LEU E N   1 
ATOM   8147  C  CA  . LEU E  5  111 ? 7.852   -98.641  48.447  1.00 41.59  ? 116  LEU E CA  1 
ATOM   8148  C  C   . LEU E  5  111 ? 8.635   -97.557  49.181  1.00 41.57  ? 116  LEU E C   1 
ATOM   8149  O  O   . LEU E  5  111 ? 9.409   -96.821  48.570  1.00 41.77  ? 116  LEU E O   1 
ATOM   8150  C  CB  . LEU E  5  111 ? 6.447   -98.132  48.123  1.00 41.37  ? 116  LEU E CB  1 
ATOM   8151  C  CG  . LEU E  5  111 ? 5.625   -98.864  47.060  1.00 41.63  ? 116  LEU E CG  1 
ATOM   8152  C  CD1 . LEU E  5  111 ? 4.160   -98.497  47.211  1.00 41.52  ? 116  LEU E CD1 1 
ATOM   8153  C  CD2 . LEU E  5  111 ? 6.103   -98.587  45.633  1.00 40.33  ? 116  LEU E CD2 1 
ATOM   8154  N  N   . CYS E  5  112 ? 8.442   -97.456  50.487  1.00 41.52  ? 117  CYS E N   1 
ATOM   8155  C  CA  . CYS E  5  112 ? 9.219   -96.503  51.262  1.00 42.16  ? 117  CYS E CA  1 
ATOM   8156  C  C   . CYS E  5  112 ? 10.726  -96.705  51.057  1.00 41.64  ? 117  CYS E C   1 
ATOM   8157  O  O   . CYS E  5  112 ? 11.436  -95.758  50.720  1.00 41.55  ? 117  CYS E O   1 
ATOM   8158  C  CB  . CYS E  5  112 ? 8.859   -96.566  52.749  1.00 42.25  ? 117  CYS E CB  1 
ATOM   8159  S  SG  . CYS E  5  112 ? 10.140  -95.814  53.807  1.00 46.45  ? 117  CYS E SG  1 
ATOM   8160  N  N   . ASP E  5  113 ? 11.194  -97.941  51.246  1.00 41.45  ? 118  ASP E N   1 
ATOM   8161  C  CA  . ASP E  5  113 ? 12.615  -98.271  51.167  1.00 41.22  ? 118  ASP E CA  1 
ATOM   8162  C  C   . ASP E  5  113 ? 13.152  -98.019  49.763  1.00 41.10  ? 118  ASP E C   1 
ATOM   8163  O  O   . ASP E  5  113 ? 14.309  -97.617  49.591  1.00 41.00  ? 118  ASP E O   1 
ATOM   8164  C  CB  . ASP E  5  113 ? 12.878  -99.724  51.600  1.00 41.22  ? 118  ASP E CB  1 
ATOM   8165  C  CG  . ASP E  5  113 ? 12.584  -99.981  53.101  1.00 42.18  ? 118  ASP E CG  1 
ATOM   8166  O  OD1 . ASP E  5  113 ? 12.474  -99.014  53.902  1.00 42.47  ? 118  ASP E OD1 1 
ATOM   8167  O  OD2 . ASP E  5  113 ? 12.466  -101.171 53.483  1.00 41.63  ? 118  ASP E OD2 1 
ATOM   8168  N  N   . LYS E  5  114 ? 12.308  -98.234  48.760  1.00 41.13  ? 119  LYS E N   1 
ATOM   8169  C  CA  . LYS E  5  114 ? 12.749  -98.074  47.386  1.00 41.34  ? 119  LYS E CA  1 
ATOM   8170  C  C   . LYS E  5  114 ? 12.970  -96.600  47.070  1.00 41.77  ? 119  LYS E C   1 
ATOM   8171  O  O   . LYS E  5  114 ? 13.994  -96.232  46.488  1.00 41.93  ? 119  LYS E O   1 
ATOM   8172  C  CB  . LYS E  5  114 ? 11.767  -98.703  46.405  1.00 41.13  ? 119  LYS E CB  1 
ATOM   8173  C  CG  . LYS E  5  114 ? 12.422  -99.041  45.088  1.00 40.55  ? 119  LYS E CG  1 
ATOM   8174  C  CD  . LYS E  5  114 ? 11.423  -99.179  43.964  1.00 40.14  ? 119  LYS E CD  1 
ATOM   8175  C  CE  . LYS E  5  114 ? 12.035  -99.895  42.754  1.00 41.00  ? 119  LYS E CE  1 
ATOM   8176  N  NZ  . LYS E  5  114 ? 13.389  -99.399  42.357  1.00 40.72  ? 119  LYS E NZ  1 
ATOM   8177  N  N   . ALA E  5  115 ? 12.016  -95.764  47.476  1.00 41.98  ? 120  ALA E N   1 
ATOM   8178  C  CA  . ALA E  5  115 ? 12.122  -94.314  47.310  1.00 42.11  ? 120  ALA E CA  1 
ATOM   8179  C  C   . ALA E  5  115 ? 13.336  -93.755  48.040  1.00 42.39  ? 120  ALA E C   1 
ATOM   8180  O  O   . ALA E  5  115 ? 14.024  -92.870  47.523  1.00 42.30  ? 120  ALA E O   1 
ATOM   8181  C  CB  . ALA E  5  115 ? 10.866  -93.638  47.789  1.00 41.75  ? 120  ALA E CB  1 
ATOM   8182  N  N   . GLN E  5  116 ? 13.599  -94.294  49.229  1.00 43.00  ? 121  GLN E N   1 
ATOM   8183  C  CA  . GLN E  5  116 ? 14.678  -93.817  50.090  1.00 43.71  ? 121  GLN E CA  1 
ATOM   8184  C  C   . GLN E  5  116 ? 16.060  -93.884  49.426  1.00 44.45  ? 121  GLN E C   1 
ATOM   8185  O  O   . GLN E  5  116 ? 16.846  -92.952  49.542  1.00 44.50  ? 121  GLN E O   1 
ATOM   8186  C  CB  . GLN E  5  116 ? 14.672  -94.584  51.410  1.00 43.52  ? 121  GLN E CB  1 
ATOM   8187  C  CG  . GLN E  5  116 ? 15.527  -93.975  52.523  1.00 43.41  ? 121  GLN E CG  1 
ATOM   8188  C  CD  . GLN E  5  116 ? 17.021  -94.167  52.316  1.00 43.93  ? 121  GLN E CD  1 
ATOM   8189  O  OE1 . GLN E  5  116 ? 17.824  -93.353  52.773  1.00 45.16  ? 121  GLN E OE1 1 
ATOM   8190  N  NE2 . GLN E  5  116 ? 17.403  -95.238  51.618  1.00 43.19  ? 121  GLN E NE2 1 
ATOM   8191  N  N   . LYS E  5  117 ? 16.355  -94.983  48.737  1.00 45.65  ? 122  LYS E N   1 
ATOM   8192  C  CA  . LYS E  5  117 ? 17.651  -95.160  48.074  1.00 46.80  ? 122  LYS E CA  1 
ATOM   8193  C  C   . LYS E  5  117 ? 17.906  -94.069  47.043  1.00 47.17  ? 122  LYS E C   1 
ATOM   8194  O  O   . LYS E  5  117 ? 19.052  -93.702  46.767  1.00 47.55  ? 122  LYS E O   1 
ATOM   8195  C  CB  . LYS E  5  117 ? 17.752  -96.547  47.427  1.00 47.06  ? 122  LYS E CB  1 
ATOM   8196  C  CG  . LYS E  5  117 ? 18.107  -97.669  48.425  1.00 49.36  ? 122  LYS E CG  1 
ATOM   8197  C  CD  . LYS E  5  117 ? 17.756  -99.070  47.909  1.00 51.42  ? 122  LYS E CD  1 
ATOM   8198  C  CE  . LYS E  5  117 ? 17.665  -100.043 49.079  1.00 53.20  ? 122  LYS E CE  1 
ATOM   8199  N  NZ  . LYS E  5  117 ? 16.474  -100.954 48.984  1.00 54.59  ? 122  LYS E NZ  1 
ATOM   8200  N  N   . ASN E  5  118 ? 16.820  -93.547  46.489  1.00 47.54  ? 123  ASN E N   1 
ATOM   8201  C  CA  . ASN E  5  118 ? 16.887  -92.482  45.513  1.00 47.76  ? 123  ASN E CA  1 
ATOM   8202  C  C   . ASN E  5  118 ? 17.021  -91.085  46.133  1.00 48.01  ? 123  ASN E C   1 
ATOM   8203  O  O   . ASN E  5  118 ? 17.242  -90.112  45.421  1.00 48.16  ? 123  ASN E O   1 
ATOM   8204  C  CB  . ASN E  5  118 ? 15.684  -92.581  44.587  1.00 47.75  ? 123  ASN E CB  1 
ATOM   8205  C  CG  . ASN E  5  118 ? 15.826  -93.705  43.598  1.00 48.42  ? 123  ASN E CG  1 
ATOM   8206  O  OD1 . ASN E  5  118 ? 16.277  -93.502  42.481  1.00 48.84  ? 123  ASN E OD1 1 
ATOM   8207  N  ND2 . ASN E  5  118 ? 15.479  -94.912  44.017  1.00 50.66  ? 123  ASN E ND2 1 
ATOM   8208  N  N   . THR E  5  119 ? 16.902  -90.998  47.460  1.00 48.17  ? 124  THR E N   1 
ATOM   8209  C  CA  . THR E  5  119 ? 17.080  -89.739  48.185  1.00 47.99  ? 124  THR E CA  1 
ATOM   8210  C  C   . THR E  5  119 ? 18.462  -89.640  48.821  1.00 48.63  ? 124  THR E C   1 
ATOM   8211  O  O   . THR E  5  119 ? 18.663  -88.855  49.752  1.00 48.76  ? 124  THR E O   1 
ATOM   8212  C  CB  . THR E  5  119 ? 15.997  -89.518  49.296  1.00 47.84  ? 124  THR E CB  1 
ATOM   8213  O  OG1 . THR E  5  119 ? 16.262  -90.353  50.436  1.00 47.12  ? 124  THR E OG1 1 
ATOM   8214  C  CG2 . THR E  5  119 ? 14.590  -89.770  48.769  1.00 46.99  ? 124  THR E CG2 1 
ATOM   8215  N  N   . GLN E  5  120 ? 19.413  -90.430  48.322  1.00 49.41  ? 125  GLN E N   1 
ATOM   8216  C  CA  . GLN E  5  120 ? 20.722  -90.554  48.970  1.00 49.85  ? 125  GLN E CA  1 
ATOM   8217  C  C   . GLN E  5  120 ? 21.842  -91.039  48.053  1.00 50.10  ? 125  GLN E C   1 
ATOM   8218  O  O   . GLN E  5  120 ? 22.990  -91.111  48.482  1.00 50.62  ? 125  GLN E O   1 
ATOM   8219  C  CB  . GLN E  5  120 ? 20.606  -91.468  50.191  1.00 49.94  ? 125  GLN E CB  1 
ATOM   8220  C  CG  . GLN E  5  120 ? 21.778  -91.403  51.157  1.00 50.65  ? 125  GLN E CG  1 
ATOM   8221  C  CD  . GLN E  5  120 ? 21.659  -92.416  52.278  1.00 51.87  ? 125  GLN E CD  1 
ATOM   8222  O  OE1 . GLN E  5  120 ? 22.023  -92.133  53.424  1.00 52.29  ? 125  GLN E OE1 1 
ATOM   8223  N  NE2 . GLN E  5  120 ? 21.147  -93.608  51.955  1.00 51.30  ? 125  GLN E NE2 1 
ATOM   8224  N  N   . SER E  5  121 ? 21.515  -91.362  46.805  1.00 50.68  ? 126  SER E N   1 
ATOM   8225  C  CA  . SER E  5  121 ? 22.518  -91.735  45.791  1.00 51.29  ? 126  SER E CA  1 
ATOM   8226  C  C   . SER E  5  121 ? 22.769  -90.591  44.820  1.00 51.35  ? 126  SER E C   1 
ATOM   8227  O  O   . SER E  5  121 ? 21.809  -90.038  44.266  1.00 51.57  ? 126  SER E O   1 
ATOM   8228  C  CB  . SER E  5  121 ? 22.056  -92.955  44.980  1.00 51.36  ? 126  SER E CB  1 
ATOM   8229  O  OG  . SER E  5  121 ? 22.225  -94.148  45.722  1.00 52.41  ? 126  SER E OG  1 
ATOM   8230  N  N   . ALA E  5  122 ? 24.046  -90.250  44.606  1.00 51.32  ? 127  ALA E N   1 
ATOM   8231  C  CA  . ALA E  5  122 ? 24.432  -89.282  43.567  1.00 51.27  ? 127  ALA E CA  1 
ATOM   8232  C  C   . ALA E  5  122 ? 24.101  -89.856  42.200  1.00 51.33  ? 127  ALA E C   1 
ATOM   8233  O  O   . ALA E  5  122 ? 24.175  -91.072  41.997  1.00 51.41  ? 127  ALA E O   1 
ATOM   8234  C  CB  . ALA E  5  122 ? 25.924  -88.922  43.648  1.00 50.95  ? 127  ALA E CB  1 
ATOM   8235  N  N   . GLY E  5  123 ? 23.724  -88.986  41.267  1.00 51.33  ? 128  GLY E N   1 
ATOM   8236  C  CA  . GLY E  5  123 ? 23.402  -89.428  39.913  1.00 51.32  ? 128  GLY E CA  1 
ATOM   8237  C  C   . GLY E  5  123 ? 21.968  -89.924  39.770  1.00 51.03  ? 128  GLY E C   1 
ATOM   8238  O  O   . GLY E  5  123 ? 21.423  -89.937  38.667  1.00 51.43  ? 128  GLY E O   1 
ATOM   8239  N  N   . GLY E  5  124 ? 21.359  -90.346  40.876  1.00 50.26  ? 129  GLY E N   1 
ATOM   8240  C  CA  . GLY E  5  124 ? 19.940  -90.674  40.878  1.00 49.34  ? 129  GLY E CA  1 
ATOM   8241  C  C   . GLY E  5  124 ? 19.094  -89.419  41.048  1.00 48.48  ? 129  GLY E C   1 
ATOM   8242  O  O   . GLY E  5  124 ? 19.619  -88.314  41.196  1.00 48.67  ? 129  GLY E O   1 
ATOM   8243  N  N   . ARG E  5  125 ? 17.781  -89.589  41.011  1.00 47.10  ? 130  ARG E N   1 
ATOM   8244  C  CA  . ARG E  5  125 ? 16.867  -88.536  41.392  1.00 45.50  ? 130  ARG E CA  1 
ATOM   8245  C  C   . ARG E  5  125 ? 15.736  -89.173  42.179  1.00 44.58  ? 130  ARG E C   1 
ATOM   8246  O  O   . ARG E  5  125 ? 15.479  -90.362  42.019  1.00 44.72  ? 130  ARG E O   1 
ATOM   8247  C  CB  . ARG E  5  125 ? 16.318  -87.833  40.159  1.00 45.66  ? 130  ARG E CB  1 
ATOM   8248  C  CG  . ARG E  5  125 ? 15.339  -88.646  39.331  1.00 45.46  ? 130  ARG E CG  1 
ATOM   8249  C  CD  . ARG E  5  125 ? 14.455  -87.710  38.521  1.00 46.41  ? 130  ARG E CD  1 
ATOM   8250  N  NE  . ARG E  5  125 ? 13.740  -88.404  37.454  1.00 45.41  ? 130  ARG E NE  1 
ATOM   8251  C  CZ  . ARG E  5  125 ? 12.590  -89.049  37.621  1.00 44.86  ? 130  ARG E CZ  1 
ATOM   8252  N  NH1 . ARG E  5  125 ? 12.008  -89.085  38.813  1.00 45.34  ? 130  ARG E NH1 1 
ATOM   8253  N  NH2 . ARG E  5  125 ? 12.024  -89.664  36.595  1.00 44.28  ? 130  ARG E NH2 1 
ATOM   8254  N  N   . PRO E  5  126 ? 15.055  -88.393  43.032  1.00 43.59  ? 131  PRO E N   1 
ATOM   8255  C  CA  . PRO E  5  126 ? 13.915  -88.912  43.763  1.00 42.83  ? 131  PRO E CA  1 
ATOM   8256  C  C   . PRO E  5  126 ? 12.794  -89.258  42.810  1.00 42.44  ? 131  PRO E C   1 
ATOM   8257  O  O   . PRO E  5  126 ? 12.800  -88.819  41.663  1.00 42.56  ? 131  PRO E O   1 
ATOM   8258  C  CB  . PRO E  5  126 ? 13.493  -87.726  44.617  1.00 42.97  ? 131  PRO E CB  1 
ATOM   8259  C  CG  . PRO E  5  126 ? 14.703  -86.897  44.736  1.00 43.28  ? 131  PRO E CG  1 
ATOM   8260  C  CD  . PRO E  5  126 ? 15.368  -87.011  43.428  1.00 43.43  ? 131  PRO E CD  1 
ATOM   8261  N  N   . TYR E  5  127 ? 11.839  -90.058  43.255  1.00 42.01  ? 132  TYR E N   1 
ATOM   8262  C  CA  . TYR E  5  127 ? 10.676  -90.304  42.423  1.00 41.54  ? 132  TYR E CA  1 
ATOM   8263  C  C   . TYR E  5  127 ? 9.842   -89.036  42.443  1.00 41.35  ? 132  TYR E C   1 
ATOM   8264  O  O   . TYR E  5  127 ? 9.909   -88.269  43.397  1.00 41.10  ? 132  TYR E O   1 
ATOM   8265  C  CB  . TYR E  5  127 ? 9.903   -91.543  42.894  1.00 41.37  ? 132  TYR E CB  1 
ATOM   8266  C  CG  . TYR E  5  127 ? 10.667  -92.816  42.608  1.00 41.45  ? 132  TYR E CG  1 
ATOM   8267  C  CD1 . TYR E  5  127 ? 11.431  -93.427  43.590  1.00 42.26  ? 132  TYR E CD1 1 
ATOM   8268  C  CD2 . TYR E  5  127 ? 10.663  -93.383  41.340  1.00 41.39  ? 132  TYR E CD2 1 
ATOM   8269  C  CE1 . TYR E  5  127 ? 12.154  -94.583  43.322  1.00 42.10  ? 132  TYR E CE1 1 
ATOM   8270  C  CE2 . TYR E  5  127 ? 11.387  -94.534  41.059  1.00 41.52  ? 132  TYR E CE2 1 
ATOM   8271  C  CZ  . TYR E  5  127 ? 12.132  -95.133  42.052  1.00 41.57  ? 132  TYR E CZ  1 
ATOM   8272  O  OH  . TYR E  5  127 ? 12.855  -96.282  41.783  1.00 41.15  ? 132  TYR E OH  1 
ATOM   8273  N  N   . GLY E  5  128 ? 9.096   -88.784  41.377  1.00 40.98  ? 133  GLY E N   1 
ATOM   8274  C  CA  . GLY E  5  128 ? 8.305   -87.568  41.316  1.00 40.61  ? 133  GLY E CA  1 
ATOM   8275  C  C   . GLY E  5  128 ? 6.845   -87.896  41.160  1.00 40.46  ? 133  GLY E C   1 
ATOM   8276  O  O   . GLY E  5  128 ? 6.171   -87.355  40.282  1.00 40.83  ? 133  GLY E O   1 
ATOM   8277  N  N   . VAL E  5  129 ? 6.357   -88.796  42.002  1.00 39.86  ? 134  VAL E N   1 
ATOM   8278  C  CA  . VAL E  5  129 ? 4.979   -89.237  41.906  1.00 39.60  ? 134  VAL E CA  1 
ATOM   8279  C  C   . VAL E  5  129 ? 4.465   -89.547  43.302  1.00 39.77  ? 134  VAL E C   1 
ATOM   8280  O  O   . VAL E  5  129 ? 5.233   -89.917  44.186  1.00 39.41  ? 134  VAL E O   1 
ATOM   8281  C  CB  . VAL E  5  129 ? 4.814   -90.447  40.933  1.00 39.58  ? 134  VAL E CB  1 
ATOM   8282  C  CG1 . VAL E  5  129 ? 5.400   -91.729  41.523  1.00 39.36  ? 134  VAL E CG1 1 
ATOM   8283  C  CG2 . VAL E  5  129 ? 3.354   -90.651  40.553  1.00 39.42  ? 134  VAL E CG2 1 
ATOM   8284  N  N   . GLY E  5  130 ? 3.171   -89.340  43.503  1.00 40.01  ? 135  GLY E N   1 
ATOM   8285  C  CA  . GLY E  5  130 ? 2.524   -89.678  44.757  1.00 40.58  ? 135  GLY E CA  1 
ATOM   8286  C  C   . GLY E  5  130 ? 1.521   -90.764  44.451  1.00 41.19  ? 135  GLY E C   1 
ATOM   8287  O  O   . GLY E  5  130 ? 0.886   -90.756  43.387  1.00 41.38  ? 135  GLY E O   1 
ATOM   8288  N  N   . LEU E  5  131 ? 1.380   -91.708  45.370  1.00 41.40  ? 136  LEU E N   1 
ATOM   8289  C  CA  . LEU E  5  131 ? 0.514   -92.839  45.132  1.00 41.58  ? 136  LEU E CA  1 
ATOM   8290  C  C   . LEU E  5  131 ? -0.430  -93.029  46.300  1.00 42.04  ? 136  LEU E C   1 
ATOM   8291  O  O   . LEU E  5  131 ? -0.061  -92.780  47.449  1.00 41.84  ? 136  LEU E O   1 
ATOM   8292  C  CB  . LEU E  5  131 ? 1.356   -94.104  44.911  1.00 41.77  ? 136  LEU E CB  1 
ATOM   8293  C  CG  . LEU E  5  131 ? 2.508   -94.082  43.887  1.00 41.34  ? 136  LEU E CG  1 
ATOM   8294  C  CD1 . LEU E  5  131 ? 3.509   -95.187  44.208  1.00 41.04  ? 136  LEU E CD1 1 
ATOM   8295  C  CD2 . LEU E  5  131 ? 2.035   -94.175  42.422  1.00 39.28  ? 136  LEU E CD2 1 
ATOM   8296  N  N   . LEU E  5  132 ? -1.655  -93.445  45.989  1.00 42.82  ? 137  LEU E N   1 
ATOM   8297  C  CA  . LEU E  5  132 ? -2.604  -93.927  46.993  1.00 43.54  ? 137  LEU E CA  1 
ATOM   8298  C  C   . LEU E  5  132 ? -2.863  -95.407  46.744  1.00 44.31  ? 137  LEU E C   1 
ATOM   8299  O  O   . LEU E  5  132 ? -3.281  -95.798  45.648  1.00 44.89  ? 137  LEU E O   1 
ATOM   8300  C  CB  . LEU E  5  132 ? -3.927  -93.165  46.920  1.00 43.46  ? 137  LEU E CB  1 
ATOM   8301  C  CG  . LEU E  5  132 ? -3.876  -91.648  47.024  1.00 43.13  ? 137  LEU E CG  1 
ATOM   8302  C  CD1 . LEU E  5  132 ? -5.288  -91.105  47.069  1.00 43.05  ? 137  LEU E CD1 1 
ATOM   8303  C  CD2 . LEU E  5  132 ? -3.091  -91.249  48.254  1.00 42.18  ? 137  LEU E CD2 1 
ATOM   8304  N  N   . ILE E  5  133 ? -2.618  -96.228  47.757  1.00 44.87  ? 138  ILE E N   1 
ATOM   8305  C  CA  . ILE E  5  133 ? -2.704  -97.675  47.606  1.00 45.32  ? 138  ILE E CA  1 
ATOM   8306  C  C   . ILE E  5  133 ? -3.841  -98.232  48.450  1.00 45.51  ? 138  ILE E C   1 
ATOM   8307  O  O   . ILE E  5  133 ? -3.972  -97.907  49.640  1.00 45.35  ? 138  ILE E O   1 
ATOM   8308  C  CB  . ILE E  5  133 ? -1.372  -98.365  48.007  1.00 45.57  ? 138  ILE E CB  1 
ATOM   8309  C  CG1 . ILE E  5  133 ? -0.178  -97.630  47.397  1.00 45.12  ? 138  ILE E CG1 1 
ATOM   8310  C  CG2 . ILE E  5  133 ? -1.365  -99.817  47.562  1.00 45.96  ? 138  ILE E CG2 1 
ATOM   8311  C  CD1 . ILE E  5  133 ? 0.938   -97.419  48.373  1.00 45.75  ? 138  ILE E CD1 1 
ATOM   8312  N  N   . ILE E  5  134 ? -4.656  -99.074  47.820  1.00 45.73  ? 139  ILE E N   1 
ATOM   8313  C  CA  . ILE E  5  134 ? -5.765  -99.750  48.494  1.00 45.80  ? 139  ILE E CA  1 
ATOM   8314  C  C   . ILE E  5  134 ? -5.619  -101.262 48.362  1.00 46.20  ? 139  ILE E C   1 
ATOM   8315  O  O   . ILE E  5  134 ? -5.119  -101.763 47.346  1.00 46.03  ? 139  ILE E O   1 
ATOM   8316  C  CB  . ILE E  5  134 ? -7.158  -99.330  47.929  1.00 45.59  ? 139  ILE E CB  1 
ATOM   8317  C  CG1 . ILE E  5  134 ? -7.233  -99.552  46.413  1.00 45.30  ? 139  ILE E CG1 1 
ATOM   8318  C  CG2 . ILE E  5  134 ? -7.472  -97.890  48.280  1.00 45.44  ? 139  ILE E CG2 1 
ATOM   8319  C  CD1 . ILE E  5  134 ? -8.639  -99.758  45.886  1.00 45.23  ? 139  ILE E CD1 1 
ATOM   8320  N  N   . GLY E  5  135 ? -6.078  -101.983 49.380  1.00 46.44  ? 140  GLY E N   1 
ATOM   8321  C  CA  . GLY E  5  135 ? -6.096  -103.432 49.333  1.00 47.01  ? 140  GLY E CA  1 
ATOM   8322  C  C   . GLY E  5  135 ? -6.964  -104.076 50.392  1.00 47.76  ? 140  GLY E C   1 
ATOM   8323  O  O   . GLY E  5  135 ? -7.298  -103.459 51.404  1.00 47.86  ? 140  GLY E O   1 
ATOM   8324  N  N   . TYR E  5  136 ? -7.349  -105.322 50.144  1.00 48.44  ? 141  TYR E N   1 
ATOM   8325  C  CA  . TYR E  5  136 ? -8.005  -106.119 51.158  1.00 49.07  ? 141  TYR E CA  1 
ATOM   8326  C  C   . TYR E  5  136 ? -7.090  -107.288 51.435  1.00 49.37  ? 141  TYR E C   1 
ATOM   8327  O  O   . TYR E  5  136 ? -6.890  -108.143 50.573  1.00 49.80  ? 141  TYR E O   1 
ATOM   8328  C  CB  . TYR E  5  136 ? -9.384  -106.605 50.696  1.00 49.15  ? 141  TYR E CB  1 
ATOM   8329  C  CG  . TYR E  5  136 ? -10.250 -107.061 51.851  1.00 49.60  ? 141  TYR E CG  1 
ATOM   8330  C  CD1 . TYR E  5  136 ? -10.934 -106.135 52.637  1.00 50.32  ? 141  TYR E CD1 1 
ATOM   8331  C  CD2 . TYR E  5  136 ? -10.370 -108.416 52.175  1.00 50.00  ? 141  TYR E CD2 1 
ATOM   8332  C  CE1 . TYR E  5  136 ? -11.721 -106.542 53.717  1.00 50.95  ? 141  TYR E CE1 1 
ATOM   8333  C  CE2 . TYR E  5  136 ? -11.156 -108.836 53.255  1.00 50.19  ? 141  TYR E CE2 1 
ATOM   8334  C  CZ  . TYR E  5  136 ? -11.826 -107.891 54.019  1.00 50.76  ? 141  TYR E CZ  1 
ATOM   8335  O  OH  . TYR E  5  136 ? -12.604 -108.275 55.081  1.00 50.45  ? 141  TYR E OH  1 
ATOM   8336  N  N   . ASP E  5  137 ? -6.501  -107.306 52.623  1.00 49.62  ? 142  ASP E N   1 
ATOM   8337  C  CA  . ASP E  5  137 ? -5.629  -108.402 53.007  1.00 49.91  ? 142  ASP E CA  1 
ATOM   8338  C  C   . ASP E  5  137 ? -6.202  -109.133 54.232  1.00 50.43  ? 142  ASP E C   1 
ATOM   8339  O  O   . ASP E  5  137 ? -7.383  -108.979 54.545  1.00 50.67  ? 142  ASP E O   1 
ATOM   8340  C  CB  . ASP E  5  137 ? -4.175  -107.919 53.189  1.00 49.74  ? 142  ASP E CB  1 
ATOM   8341  C  CG  . ASP E  5  137 ? -3.997  -106.941 54.357  1.00 48.98  ? 142  ASP E CG  1 
ATOM   8342  O  OD1 . ASP E  5  137 ? -3.011  -106.169 54.345  1.00 47.77  ? 142  ASP E OD1 1 
ATOM   8343  O  OD2 . ASP E  5  137 ? -4.810  -106.958 55.305  1.00 48.94  ? 142  ASP E OD2 1 
ATOM   8344  N  N   . LYS E  5  138 ? -5.378  -109.915 54.923  1.00 50.86  ? 143  LYS E N   1 
ATOM   8345  C  CA  . LYS E  5  138 ? -5.854  -110.755 56.021  1.00 51.32  ? 143  LYS E CA  1 
ATOM   8346  C  C   . LYS E  5  138 ? -6.332  -110.011 57.272  1.00 51.13  ? 143  LYS E C   1 
ATOM   8347  O  O   . LYS E  5  138 ? -6.823  -110.638 58.216  1.00 51.26  ? 143  LYS E O   1 
ATOM   8348  C  CB  . LYS E  5  138 ? -4.801  -111.820 56.383  1.00 51.92  ? 143  LYS E CB  1 
ATOM   8349  C  CG  . LYS E  5  138 ? -4.937  -113.119 55.580  1.00 52.66  ? 143  LYS E CG  1 
ATOM   8350  C  CD  . LYS E  5  138 ? -3.785  -114.083 55.837  1.00 54.61  ? 143  LYS E CD  1 
ATOM   8351  C  CE  . LYS E  5  138 ? -4.240  -115.546 55.687  1.00 55.70  ? 143  LYS E CE  1 
ATOM   8352  N  NZ  . LYS E  5  138 ? -4.247  -116.317 56.986  1.00 55.62  ? 143  LYS E NZ  1 
ATOM   8353  N  N   . SER E  5  139 ? -6.192  -108.683 57.273  1.00 50.87  ? 144  SER E N   1 
ATOM   8354  C  CA  . SER E  5  139 ? -6.640  -107.841 58.391  1.00 50.40  ? 144  SER E CA  1 
ATOM   8355  C  C   . SER E  5  139 ? -7.592  -106.734 57.931  1.00 49.99  ? 144  SER E C   1 
ATOM   8356  O  O   . SER E  5  139 ? -7.756  -105.720 58.614  1.00 50.05  ? 144  SER E O   1 
ATOM   8357  C  CB  . SER E  5  139 ? -5.451  -107.231 59.126  1.00 50.50  ? 144  SER E CB  1 
ATOM   8358  O  OG  . SER E  5  139 ? -4.679  -106.420 58.251  1.00 51.51  ? 144  SER E OG  1 
ATOM   8359  N  N   . GLY E  5  140 ? -8.207  -106.931 56.770  1.00 49.24  ? 145  GLY E N   1 
ATOM   8360  C  CA  . GLY E  5  140 ? -9.268  -106.052 56.313  1.00 48.66  ? 145  GLY E CA  1 
ATOM   8361  C  C   . GLY E  5  140 ? -8.894  -105.085 55.209  1.00 48.20  ? 145  GLY E C   1 
ATOM   8362  O  O   . GLY E  5  140 ? -7.934  -105.307 54.459  1.00 48.18  ? 145  GLY E O   1 
ATOM   8363  N  N   . ALA E  5  141 ? -9.682  -104.018 55.097  1.00 47.54  ? 146  ALA E N   1 
ATOM   8364  C  CA  . ALA E  5  141 ? -9.452  -102.987 54.082  1.00 46.65  ? 146  ALA E CA  1 
ATOM   8365  C  C   . ALA E  5  141 ? -8.348  -102.068 54.547  1.00 45.75  ? 146  ALA E C   1 
ATOM   8366  O  O   . ALA E  5  141 ? -8.197  -101.854 55.747  1.00 45.35  ? 146  ALA E O   1 
ATOM   8367  C  CB  . ALA E  5  141 ? -10.723 -102.194 53.806  1.00 46.65  ? 146  ALA E CB  1 
ATOM   8368  N  N   . HIS E  5  142 ? -7.578  -101.549 53.587  1.00 44.96  ? 147  HIS E N   1 
ATOM   8369  C  CA  . HIS E  5  142 ? -6.460  -100.653 53.862  1.00 44.37  ? 147  HIS E CA  1 
ATOM   8370  C  C   . HIS E  5  142 ? -6.337  -99.563  52.817  1.00 44.37  ? 147  HIS E C   1 
ATOM   8371  O  O   . HIS E  5  142 ? -6.651  -99.770  51.642  1.00 44.33  ? 147  HIS E O   1 
ATOM   8372  C  CB  . HIS E  5  142 ? -5.144  -101.420 53.913  1.00 44.18  ? 147  HIS E CB  1 
ATOM   8373  C  CG  . HIS E  5  142 ? -5.091  -102.456 54.985  1.00 43.40  ? 147  HIS E CG  1 
ATOM   8374  N  ND1 . HIS E  5  142 ? -4.770  -102.157 56.290  1.00 43.13  ? 147  HIS E ND1 1 
ATOM   8375  C  CD2 . HIS E  5  142 ? -5.321  -103.789 54.947  1.00 42.44  ? 147  HIS E CD2 1 
ATOM   8376  C  CE1 . HIS E  5  142 ? -4.798  -103.266 57.011  1.00 43.58  ? 147  HIS E CE1 1 
ATOM   8377  N  NE2 . HIS E  5  142 ? -5.135  -104.269 56.220  1.00 42.69  ? 147  HIS E NE2 1 
ATOM   8378  N  N   . LEU E  5  143 ? -5.880  -98.398  53.266  1.00 44.40  ? 148  LEU E N   1 
ATOM   8379  C  CA  . LEU E  5  143 ? -5.501  -97.308  52.378  1.00 44.20  ? 148  LEU E CA  1 
ATOM   8380  C  C   . LEU E  5  143 ? -4.161  -96.731  52.807  1.00 44.12  ? 148  LEU E C   1 
ATOM   8381  O  O   . LEU E  5  143 ? -3.924  -96.486  53.988  1.00 44.13  ? 148  LEU E O   1 
ATOM   8382  C  CB  . LEU E  5  143 ? -6.565  -96.210  52.365  1.00 44.10  ? 148  LEU E CB  1 
ATOM   8383  C  CG  . LEU E  5  143 ? -6.189  -94.882  51.695  1.00 44.54  ? 148  LEU E CG  1 
ATOM   8384  C  CD1 . LEU E  5  143 ? -5.991  -95.007  50.185  1.00 44.62  ? 148  LEU E CD1 1 
ATOM   8385  C  CD2 . LEU E  5  143 ? -7.227  -93.842  51.998  1.00 44.67  ? 148  LEU E CD2 1 
ATOM   8386  N  N   . LEU E  5  144 ? -3.291  -96.514  51.833  1.00 44.16  ? 149  LEU E N   1 
ATOM   8387  C  CA  . LEU E  5  144 ? -1.979  -95.948  52.083  1.00 44.07  ? 149  LEU E CA  1 
ATOM   8388  C  C   . LEU E  5  144 ? -1.758  -94.696  51.247  1.00 44.04  ? 149  LEU E C   1 
ATOM   8389  O  O   . LEU E  5  144 ? -2.338  -94.555  50.179  1.00 43.99  ? 149  LEU E O   1 
ATOM   8390  C  CB  . LEU E  5  144 ? -0.914  -96.993  51.754  1.00 44.07  ? 149  LEU E CB  1 
ATOM   8391  C  CG  . LEU E  5  144 ? -0.210  -97.787  52.864  1.00 43.67  ? 149  LEU E CG  1 
ATOM   8392  C  CD1 . LEU E  5  144 ? -1.023  -98.031  54.138  1.00 42.75  ? 149  LEU E CD1 1 
ATOM   8393  C  CD2 . LEU E  5  144 ? 0.239   -99.085  52.264  1.00 43.26  ? 149  LEU E CD2 1 
ATOM   8394  N  N   . GLU E  5  145 ? -0.935  -93.780  51.745  1.00 44.19  ? 150  GLU E N   1 
ATOM   8395  C  CA  . GLU E  5  145 ? -0.505  -92.633  50.954  1.00 44.59  ? 150  GLU E CA  1 
ATOM   8396  C  C   . GLU E  5  145 ? 1.021   -92.653  50.889  1.00 44.24  ? 150  GLU E C   1 
ATOM   8397  O  O   . GLU E  5  145 ? 1.696   -92.725  51.917  1.00 44.33  ? 150  GLU E O   1 
ATOM   8398  C  CB  . GLU E  5  145 ? -1.033  -91.304  51.540  1.00 44.83  ? 150  GLU E CB  1 
ATOM   8399  C  CG  . GLU E  5  145 ? -0.614  -90.026  50.762  1.00 47.33  ? 150  GLU E CG  1 
ATOM   8400  C  CD  . GLU E  5  145 ? -0.935  -88.696  51.498  1.00 51.73  ? 150  GLU E CD  1 
ATOM   8401  O  OE1 . GLU E  5  145 ? -2.095  -88.500  51.955  1.00 52.87  ? 150  GLU E OE1 1 
ATOM   8402  O  OE2 . GLU E  5  145 ? -0.021  -87.832  51.601  1.00 52.74  ? 150  GLU E OE2 1 
ATOM   8403  N  N   . PHE E  5  146 ? 1.551   -92.601  49.674  1.00 43.94  ? 151  PHE E N   1 
ATOM   8404  C  CA  . PHE E  5  146 ? 2.983   -92.612  49.452  1.00 43.88  ? 151  PHE E CA  1 
ATOM   8405  C  C   . PHE E  5  146 ? 3.474   -91.284  48.889  1.00 44.41  ? 151  PHE E C   1 
ATOM   8406  O  O   . PHE E  5  146 ? 2.918   -90.761  47.918  1.00 44.50  ? 151  PHE E O   1 
ATOM   8407  C  CB  . PHE E  5  146 ? 3.353   -93.742  48.491  1.00 43.57  ? 151  PHE E CB  1 
ATOM   8408  C  CG  . PHE E  5  146 ? 4.703   -93.590  47.861  1.00 42.38  ? 151  PHE E CG  1 
ATOM   8409  C  CD1 . PHE E  5  146 ? 5.810   -94.213  48.414  1.00 42.06  ? 151  PHE E CD1 1 
ATOM   8410  C  CD2 . PHE E  5  146 ? 4.864   -92.831  46.703  1.00 41.62  ? 151  PHE E CD2 1 
ATOM   8411  C  CE1 . PHE E  5  146 ? 7.066   -94.072  47.827  1.00 42.29  ? 151  PHE E CE1 1 
ATOM   8412  C  CE2 . PHE E  5  146 ? 6.098   -92.685  46.112  1.00 40.52  ? 151  PHE E CE2 1 
ATOM   8413  C  CZ  . PHE E  5  146 ? 7.204   -93.308  46.670  1.00 41.91  ? 151  PHE E CZ  1 
ATOM   8414  N  N   . GLN E  5  147 ? 4.538   -90.771  49.493  1.00 44.61  ? 152  GLN E N   1 
ATOM   8415  C  CA  . GLN E  5  147 ? 5.204   -89.564  49.038  1.00 44.89  ? 152  GLN E CA  1 
ATOM   8416  C  C   . GLN E  5  147 ? 6.629   -89.934  48.615  1.00 44.72  ? 152  GLN E C   1 
ATOM   8417  O  O   . GLN E  5  147 ? 7.264   -90.769  49.265  1.00 45.01  ? 152  GLN E O   1 
ATOM   8418  C  CB  . GLN E  5  147 ? 5.229   -88.538  50.172  1.00 45.11  ? 152  GLN E CB  1 
ATOM   8419  C  CG  . GLN E  5  147 ? 3.858   -88.054  50.604  1.00 47.09  ? 152  GLN E CG  1 
ATOM   8420  C  CD  . GLN E  5  147 ? 3.148   -87.272  49.502  1.00 50.76  ? 152  GLN E CD  1 
ATOM   8421  O  OE1 . GLN E  5  147 ? 3.781   -86.542  48.733  1.00 51.31  ? 152  GLN E OE1 1 
ATOM   8422  N  NE2 . GLN E  5  147 ? 1.822   -87.421  49.421  1.00 52.68  ? 152  GLN E NE2 1 
ATOM   8423  N  N   . PRO E  5  148 ? 7.141   -89.320  47.534  1.00 44.32  ? 153  PRO E N   1 
ATOM   8424  C  CA  . PRO E  5  148 ? 8.465   -89.620  46.987  1.00 44.18  ? 153  PRO E CA  1 
ATOM   8425  C  C   . PRO E  5  148 ? 9.607   -89.416  47.984  1.00 44.29  ? 153  PRO E C   1 
ATOM   8426  O  O   . PRO E  5  148 ? 10.740  -89.813  47.703  1.00 43.94  ? 153  PRO E O   1 
ATOM   8427  C  CB  . PRO E  5  148 ? 8.622   -88.604  45.853  1.00 44.29  ? 153  PRO E CB  1 
ATOM   8428  C  CG  . PRO E  5  148 ? 7.309   -88.130  45.545  1.00 44.47  ? 153  PRO E CG  1 
ATOM   8429  C  CD  . PRO E  5  148 ? 6.482   -88.242  46.789  1.00 44.41  ? 153  PRO E CD  1 
ATOM   8430  N  N   . SER E  5  149 ? 9.317   -88.778  49.115  1.00 44.24  ? 154  SER E N   1 
ATOM   8431  C  CA  . SER E  5  149 ? 10.279  -88.679  50.198  1.00 44.93  ? 154  SER E CA  1 
ATOM   8432  C  C   . SER E  5  149 ? 10.550  -90.050  50.834  1.00 45.27  ? 154  SER E C   1 
ATOM   8433  O  O   . SER E  5  149 ? 11.617  -90.277  51.405  1.00 45.29  ? 154  SER E O   1 
ATOM   8434  C  CB  . SER E  5  149 ? 9.779   -87.703  51.253  1.00 44.86  ? 154  SER E CB  1 
ATOM   8435  O  OG  . SER E  5  149 ? 8.443   -88.001  51.609  1.00 45.58  ? 154  SER E OG  1 
ATOM   8436  N  N   . GLY E  5  150 ? 9.575   -90.953  50.709  1.00 45.61  ? 155  GLY E N   1 
ATOM   8437  C  CA  . GLY E  5  150 ? 9.611   -92.276  51.317  1.00 45.82  ? 155  GLY E CA  1 
ATOM   8438  C  C   . GLY E  5  150 ? 8.623   -92.429  52.468  1.00 46.46  ? 155  GLY E C   1 
ATOM   8439  O  O   . GLY E  5  150 ? 8.628   -93.441  53.181  1.00 46.62  ? 155  GLY E O   1 
ATOM   8440  N  N   . ASN E  5  151 ? 7.773   -91.429  52.664  1.00 46.53  ? 156  ASN E N   1 
ATOM   8441  C  CA  . ASN E  5  151 ? 6.889   -91.426  53.812  1.00 46.68  ? 156  ASN E CA  1 
ATOM   8442  C  C   . ASN E  5  151 ? 5.561   -92.036  53.415  1.00 47.09  ? 156  ASN E C   1 
ATOM   8443  O  O   . ASN E  5  151 ? 4.901   -91.585  52.470  1.00 47.32  ? 156  ASN E O   1 
ATOM   8444  C  CB  . ASN E  5  151 ? 6.720   -90.011  54.374  1.00 46.73  ? 156  ASN E CB  1 
ATOM   8445  C  CG  . ASN E  5  151 ? 7.998   -89.474  55.012  1.00 46.93  ? 156  ASN E CG  1 
ATOM   8446  O  OD1 . ASN E  5  151 ? 8.299   -89.767  56.164  1.00 47.95  ? 156  ASN E OD1 1 
ATOM   8447  N  ND2 . ASN E  5  151 ? 8.748   -88.681  54.263  1.00 46.77  ? 156  ASN E ND2 1 
ATOM   8448  N  N   . VAL E  5  152 ? 5.188   -93.089  54.129  1.00 47.20  ? 157  VAL E N   1 
ATOM   8449  C  CA  . VAL E  5  152 ? 3.955   -93.800  53.856  1.00 47.39  ? 157  VAL E CA  1 
ATOM   8450  C  C   . VAL E  5  152 ? 3.086   -93.801  55.104  1.00 47.64  ? 157  VAL E C   1 
ATOM   8451  O  O   . VAL E  5  152 ? 3.567   -94.065  56.201  1.00 47.48  ? 157  VAL E O   1 
ATOM   8452  C  CB  . VAL E  5  152 ? 4.231   -95.231  53.348  1.00 47.37  ? 157  VAL E CB  1 
ATOM   8453  C  CG1 . VAL E  5  152 ? 2.941   -96.007  53.203  1.00 47.68  ? 157  VAL E CG1 1 
ATOM   8454  C  CG2 . VAL E  5  152 ? 4.950   -95.176  52.004  1.00 47.12  ? 157  VAL E CG2 1 
ATOM   8455  N  N   . THR E  5  153 ? 1.805   -93.487  54.923  1.00 48.15  ? 158  THR E N   1 
ATOM   8456  C  CA  . THR E  5  153 ? 0.879   -93.333  56.040  1.00 48.55  ? 158  THR E CA  1 
ATOM   8457  C  C   . THR E  5  153 ? -0.383  -94.154  55.805  1.00 48.55  ? 158  THR E C   1 
ATOM   8458  O  O   . THR E  5  153 ? -0.941  -94.132  54.698  1.00 48.38  ? 158  THR E O   1 
ATOM   8459  C  CB  . THR E  5  153 ? 0.482   -91.844  56.209  1.00 48.71  ? 158  THR E CB  1 
ATOM   8460  O  OG1 . THR E  5  153 ? 1.596   -91.007  55.880  1.00 49.12  ? 158  THR E OG1 1 
ATOM   8461  C  CG2 . THR E  5  153 ? 0.043   -91.555  57.635  1.00 49.27  ? 158  THR E CG2 1 
ATOM   8462  N  N   . GLU E  5  154 ? -0.829  -94.875  56.831  1.00 48.87  ? 159  GLU E N   1 
ATOM   8463  C  CA  . GLU E  5  154 ? -2.130  -95.545  56.754  1.00 49.71  ? 159  GLU E CA  1 
ATOM   8464  C  C   . GLU E  5  154 ? -3.210  -94.593  57.233  1.00 49.65  ? 159  GLU E C   1 
ATOM   8465  O  O   . GLU E  5  154 ? -3.085  -93.965  58.292  1.00 49.83  ? 159  GLU E O   1 
ATOM   8466  C  CB  . GLU E  5  154 ? -2.187  -96.885  57.520  1.00 49.92  ? 159  GLU E CB  1 
ATOM   8467  C  CG  . GLU E  5  154 ? -3.420  -97.756  57.117  1.00 52.09  ? 159  GLU E CG  1 
ATOM   8468  C  CD  . GLU E  5  154 ? -3.400  -99.222  57.610  1.00 54.24  ? 159  GLU E CD  1 
ATOM   8469  O  OE1 . GLU E  5  154 ? -4.500  -99.798  57.785  1.00 54.43  ? 159  GLU E OE1 1 
ATOM   8470  O  OE2 . GLU E  5  154 ? -2.308  -99.807  57.807  1.00 56.15  ? 159  GLU E OE2 1 
ATOM   8471  N  N   . LEU E  5  155 ? -4.265  -94.495  56.434  1.00 49.60  ? 160  LEU E N   1 
ATOM   8472  C  CA  . LEU E  5  155 ? -5.323  -93.510  56.631  1.00 49.77  ? 160  LEU E CA  1 
ATOM   8473  C  C   . LEU E  5  155 ? -6.681  -94.148  56.373  1.00 49.59  ? 160  LEU E C   1 
ATOM   8474  O  O   . LEU E  5  155 ? -6.777  -95.118  55.609  1.00 49.70  ? 160  LEU E O   1 
ATOM   8475  C  CB  . LEU E  5  155 ? -5.128  -92.316  55.675  1.00 49.66  ? 160  LEU E CB  1 
ATOM   8476  C  CG  . LEU E  5  155 ? -3.811  -91.542  55.788  1.00 50.00  ? 160  LEU E CG  1 
ATOM   8477  C  CD1 . LEU E  5  155 ? -3.421  -90.924  54.474  1.00 50.91  ? 160  LEU E CD1 1 
ATOM   8478  C  CD2 . LEU E  5  155 ? -3.866  -90.493  56.875  1.00 50.20  ? 160  LEU E CD2 1 
ATOM   8479  N  N   . TYR E  5  156 ? -7.726  -93.610  57.002  1.00 49.30  ? 161  TYR E N   1 
ATOM   8480  C  CA  . TYR E  5  156 ? -9.086  -94.007  56.658  1.00 49.24  ? 161  TYR E CA  1 
ATOM   8481  C  C   . TYR E  5  156 ? -9.445  -93.403  55.298  1.00 48.91  ? 161  TYR E C   1 
ATOM   8482  O  O   . TYR E  5  156 ? -10.201 -94.002  54.518  1.00 48.65  ? 161  TYR E O   1 
ATOM   8483  C  CB  . TYR E  5  156 ? -10.083 -93.544  57.704  1.00 49.42  ? 161  TYR E CB  1 
ATOM   8484  C  CG  . TYR E  5  156 ? -9.935  -94.147  59.087  1.00 50.83  ? 161  TYR E CG  1 
ATOM   8485  C  CD1 . TYR E  5  156 ? -10.311 -95.469  59.343  1.00 51.70  ? 161  TYR E CD1 1 
ATOM   8486  C  CD2 . TYR E  5  156 ? -9.460  -93.379  60.155  1.00 51.85  ? 161  TYR E CD2 1 
ATOM   8487  C  CE1 . TYR E  5  156 ? -10.204 -96.022  60.626  1.00 51.94  ? 161  TYR E CE1 1 
ATOM   8488  C  CE2 . TYR E  5  156 ? -9.347  -93.923  61.440  1.00 52.73  ? 161  TYR E CE2 1 
ATOM   8489  C  CZ  . TYR E  5  156 ? -9.722  -95.242  61.664  1.00 52.92  ? 161  TYR E CZ  1 
ATOM   8490  O  OH  . TYR E  5  156 ? -9.611  -95.772  62.930  1.00 54.48  ? 161  TYR E OH  1 
ATOM   8491  N  N   . GLY E  5  157 ? -8.877  -92.229  55.014  1.00 48.41  ? 162  GLY E N   1 
ATOM   8492  C  CA  . GLY E  5  157 ? -9.116  -91.542  53.752  1.00 48.28  ? 162  GLY E CA  1 
ATOM   8493  C  C   . GLY E  5  157 ? -8.122  -90.438  53.471  1.00 48.25  ? 162  GLY E C   1 
ATOM   8494  O  O   . GLY E  5  157 ? -7.506  -89.902  54.397  1.00 48.02  ? 162  GLY E O   1 
ATOM   8495  N  N   . THR E  5  158 ? -7.956  -90.109  52.190  1.00 48.25  ? 163  THR E N   1 
ATOM   8496  C  CA  . THR E  5  158 ? -7.106  -88.987  51.791  1.00 48.86  ? 163  THR E CA  1 
ATOM   8497  C  C   . THR E  5  158 ? -7.178  -88.664  50.307  1.00 49.00  ? 163  THR E C   1 
ATOM   8498  O  O   . THR E  5  158 ? -7.773  -89.404  49.524  1.00 49.26  ? 163  THR E O   1 
ATOM   8499  C  CB  . THR E  5  158 ? -5.620  -89.180  52.191  1.00 49.10  ? 163  THR E CB  1 
ATOM   8500  O  OG1 . THR E  5  158 ? -4.914  -87.943  52.015  1.00 49.83  ? 163  THR E OG1 1 
ATOM   8501  C  CG2 . THR E  5  158 ? -4.958  -90.268  51.345  1.00 49.38  ? 163  THR E CG2 1 
ATOM   8502  N  N   . ALA E  5  159 ? -6.554  -87.549  49.941  1.00 49.21  ? 164  ALA E N   1 
ATOM   8503  C  CA  . ALA E  5  159 ? -6.510  -87.087  48.566  1.00 49.69  ? 164  ALA E CA  1 
ATOM   8504  C  C   . ALA E  5  159 ? -5.167  -86.423  48.292  1.00 50.18  ? 164  ALA E C   1 
ATOM   8505  O  O   . ALA E  5  159 ? -4.559  -85.841  49.194  1.00 49.83  ? 164  ALA E O   1 
ATOM   8506  C  CB  . ALA E  5  159 ? -7.647  -86.119  48.299  1.00 49.41  ? 164  ALA E CB  1 
ATOM   8507  N  N   . ILE E  5  160 ? -4.703  -86.533  47.051  1.00 50.98  ? 165  ILE E N   1 
ATOM   8508  C  CA  . ILE E  5  160 ? -3.449  -85.905  46.636  1.00 52.00  ? 165  ILE E CA  1 
ATOM   8509  C  C   . ILE E  5  160 ? -3.586  -85.310  45.230  1.00 53.10  ? 165  ILE E C   1 
ATOM   8510  O  O   . ILE E  5  160 ? -4.485  -85.687  44.473  1.00 52.99  ? 165  ILE E O   1 
ATOM   8511  C  CB  . ILE E  5  160 ? -2.229  -86.879  46.718  1.00 51.78  ? 165  ILE E CB  1 
ATOM   8512  C  CG1 . ILE E  5  160 ? -2.520  -88.202  45.991  1.00 51.52  ? 165  ILE E CG1 1 
ATOM   8513  C  CG2 . ILE E  5  160 ? -1.829  -87.124  48.168  1.00 51.46  ? 165  ILE E CG2 1 
ATOM   8514  C  CD1 . ILE E  5  160 ? -1.294  -89.066  45.738  1.00 49.94  ? 165  ILE E CD1 1 
ATOM   8515  N  N   . GLY E  5  161 ? -2.693  -84.381  44.892  1.00 54.49  ? 166  GLY E N   1 
ATOM   8516  C  CA  . GLY E  5  161 ? -2.778  -83.633  43.630  1.00 56.18  ? 166  GLY E CA  1 
ATOM   8517  C  C   . GLY E  5  161 ? -3.247  -82.197  43.826  1.00 57.39  ? 166  GLY E C   1 
ATOM   8518  O  O   . GLY E  5  161 ? -3.424  -81.742  44.959  1.00 57.09  ? 166  GLY E O   1 
ATOM   8519  N  N   . ALA E  5  162 ? -3.458  -81.487  42.720  1.00 58.75  ? 167  ALA E N   1 
ATOM   8520  C  CA  . ALA E  5  162 ? -3.888  -80.083  42.765  1.00 60.04  ? 167  ALA E CA  1 
ATOM   8521  C  C   . ALA E  5  162 ? -5.251  -79.901  43.434  1.00 60.99  ? 167  ALA E C   1 
ATOM   8522  O  O   . ALA E  5  162 ? -6.175  -80.690  43.219  1.00 61.12  ? 167  ALA E O   1 
ATOM   8523  C  CB  . ALA E  5  162 ? -3.904  -79.488  41.363  1.00 60.07  ? 167  ALA E CB  1 
ATOM   8524  N  N   . ARG E  5  163 ? -5.357  -78.861  44.258  1.00 62.31  ? 168  ARG E N   1 
ATOM   8525  C  CA  . ARG E  5  163 ? -6.617  -78.483  44.912  1.00 63.71  ? 168  ARG E CA  1 
ATOM   8526  C  C   . ARG E  5  163 ? -7.143  -79.602  45.803  1.00 64.02  ? 168  ARG E C   1 
ATOM   8527  O  O   . ARG E  5  163 ? -8.285  -79.558  46.265  1.00 64.23  ? 168  ARG E O   1 
ATOM   8528  C  CB  . ARG E  5  163 ? -7.678  -78.061  43.877  1.00 63.92  ? 168  ARG E CB  1 
ATOM   8529  C  CG  . ARG E  5  163 ? -7.201  -76.987  42.895  1.00 66.22  ? 168  ARG E CG  1 
ATOM   8530  C  CD  . ARG E  5  163 ? -7.900  -77.094  41.542  1.00 69.79  ? 168  ARG E CD  1 
ATOM   8531  N  NE  . ARG E  5  163 ? -6.922  -77.199  40.453  1.00 72.72  ? 168  ARG E NE  1 
ATOM   8532  C  CZ  . ARG E  5  163 ? -7.208  -77.514  39.186  1.00 73.88  ? 168  ARG E CZ  1 
ATOM   8533  N  NH1 . ARG E  5  163 ? -8.465  -77.747  38.807  1.00 74.67  ? 168  ARG E NH1 1 
ATOM   8534  N  NH2 . ARG E  5  163 ? -6.226  -77.591  38.291  1.00 73.51  ? 168  ARG E NH2 1 
ATOM   8535  N  N   . SER E  5  164 ? -6.290  -80.591  46.053  1.00 64.58  ? 169  SER E N   1 
ATOM   8536  C  CA  . SER E  5  164 ? -6.643  -81.751  46.864  1.00 65.09  ? 169  SER E CA  1 
ATOM   8537  C  C   . SER E  5  164 ? -7.128  -81.392  48.268  1.00 65.61  ? 169  SER E C   1 
ATOM   8538  O  O   . SER E  5  164 ? -7.893  -82.151  48.873  1.00 65.81  ? 169  SER E O   1 
ATOM   8539  C  CB  . SER E  5  164 ? -5.455  -82.711  46.968  1.00 64.94  ? 169  SER E CB  1 
ATOM   8540  O  OG  . SER E  5  164 ? -4.389  -82.136  47.700  1.00 64.13  ? 169  SER E OG  1 
ATOM   8541  N  N   . GLN E  5  165 ? -6.689  -80.237  48.772  1.00 66.09  ? 170  GLN E N   1 
ATOM   8542  C  CA  . GLN E  5  165 ? -6.961  -79.827  50.155  1.00 66.68  ? 170  GLN E CA  1 
ATOM   8543  C  C   . GLN E  5  165 ? -8.462  -79.779  50.492  1.00 66.88  ? 170  GLN E C   1 
ATOM   8544  O  O   . GLN E  5  165 ? -8.850  -79.986  51.645  1.00 66.74  ? 170  GLN E O   1 
ATOM   8545  C  CB  . GLN E  5  165 ? -6.239  -78.504  50.479  1.00 66.74  ? 170  GLN E CB  1 
ATOM   8546  C  CG  . GLN E  5  165 ? -6.329  -78.007  51.944  1.00 67.61  ? 170  GLN E CG  1 
ATOM   8547  C  CD  . GLN E  5  165 ? -6.087  -79.096  52.996  1.00 68.83  ? 170  GLN E CD  1 
ATOM   8548  O  OE1 . GLN E  5  165 ? -6.953  -79.366  53.828  1.00 69.78  ? 170  GLN E OE1 1 
ATOM   8549  N  NE2 . GLN E  5  165 ? -4.915  -79.721  52.959  1.00 69.10  ? 170  GLN E NE2 1 
ATOM   8550  N  N   . GLY E  5  166 ? -9.297  -79.549  49.478  1.00 67.24  ? 171  GLY E N   1 
ATOM   8551  C  CA  . GLY E  5  166 ? -10.749 -79.555  49.646  1.00 67.88  ? 171  GLY E CA  1 
ATOM   8552  C  C   . GLY E  5  166 ? -11.306 -80.897  50.096  1.00 68.35  ? 171  GLY E C   1 
ATOM   8553  O  O   . GLY E  5  166 ? -11.982 -80.990  51.130  1.00 68.44  ? 171  GLY E O   1 
ATOM   8554  N  N   . ALA E  5  167 ? -11.010 -81.937  49.315  1.00 68.79  ? 172  ALA E N   1 
ATOM   8555  C  CA  . ALA E  5  167 ? -11.488 -83.303  49.569  1.00 69.03  ? 172  ALA E CA  1 
ATOM   8556  C  C   . ALA E  5  167 ? -11.012 -83.842  50.911  1.00 69.29  ? 172  ALA E C   1 
ATOM   8557  O  O   . ALA E  5  167 ? -11.745 -84.541  51.610  1.00 68.99  ? 172  ALA E O   1 
ATOM   8558  C  CB  . ALA E  5  167 ? -11.045 -84.222  48.450  1.00 68.93  ? 172  ALA E CB  1 
ATOM   8559  N  N   . LYS E  5  168 ? -9.778  -83.503  51.264  1.00 69.97  ? 173  LYS E N   1 
ATOM   8560  C  CA  . LYS E  5  168 ? -9.203  -83.918  52.528  1.00 70.92  ? 173  LYS E CA  1 
ATOM   8561  C  C   . LYS E  5  168 ? -10.018 -83.369  53.708  1.00 71.21  ? 173  LYS E C   1 
ATOM   8562  O  O   . LYS E  5  168 ? -10.206 -84.066  54.710  1.00 71.15  ? 173  LYS E O   1 
ATOM   8563  C  CB  . LYS E  5  168 ? -7.721  -83.514  52.607  1.00 71.12  ? 173  LYS E CB  1 
ATOM   8564  C  CG  . LYS E  5  168 ? -6.907  -84.332  53.609  1.00 72.45  ? 173  LYS E CG  1 
ATOM   8565  C  CD  . LYS E  5  168 ? -5.395  -84.201  53.404  1.00 74.50  ? 173  LYS E CD  1 
ATOM   8566  C  CE  . LYS E  5  168 ? -4.658  -84.900  54.549  1.00 76.13  ? 173  LYS E CE  1 
ATOM   8567  N  NZ  . LYS E  5  168 ? -3.224  -85.161  54.265  1.00 76.66  ? 173  LYS E NZ  1 
ATOM   8568  N  N   . THR E  5  169 ? -10.518 -82.135  53.574  1.00 71.73  ? 174  THR E N   1 
ATOM   8569  C  CA  . THR E  5  169 ? -11.357 -81.516  54.612  1.00 72.08  ? 174  THR E CA  1 
ATOM   8570  C  C   . THR E  5  169 ? -12.731 -82.167  54.650  1.00 72.05  ? 174  THR E C   1 
ATOM   8571  O  O   . THR E  5  169 ? -13.256 -82.446  55.730  1.00 72.08  ? 174  THR E O   1 
ATOM   8572  C  CB  . THR E  5  169 ? -11.516 -79.982  54.434  1.00 72.37  ? 174  THR E CB  1 
ATOM   8573  O  OG1 . THR E  5  169 ? -10.268 -79.402  54.028  1.00 72.84  ? 174  THR E OG1 1 
ATOM   8574  C  CG2 . THR E  5  169 ? -11.977 -79.329  55.752  1.00 72.35  ? 174  THR E CG2 1 
ATOM   8575  N  N   . TYR E  5  170 ? -13.304 -82.412  53.474  1.00 72.12  ? 175  TYR E N   1 
ATOM   8576  C  CA  . TYR E  5  170 ? -14.560 -83.141  53.381  1.00 72.55  ? 175  TYR E CA  1 
ATOM   8577  C  C   . TYR E  5  170 ? -14.442 -84.481  54.098  1.00 72.63  ? 175  TYR E C   1 
ATOM   8578  O  O   . TYR E  5  170 ? -15.264 -84.808  54.947  1.00 72.76  ? 175  TYR E O   1 
ATOM   8579  C  CB  . TYR E  5  170 ? -14.967 -83.350  51.923  1.00 72.66  ? 175  TYR E CB  1 
ATOM   8580  C  CG  . TYR E  5  170 ? -16.173 -84.256  51.742  1.00 74.00  ? 175  TYR E CG  1 
ATOM   8581  C  CD1 . TYR E  5  170 ? -17.470 -83.734  51.706  1.00 75.16  ? 175  TYR E CD1 1 
ATOM   8582  C  CD2 . TYR E  5  170 ? -16.017 -85.635  51.603  1.00 75.12  ? 175  TYR E CD2 1 
ATOM   8583  C  CE1 . TYR E  5  170 ? -18.581 -84.566  51.535  1.00 75.88  ? 175  TYR E CE1 1 
ATOM   8584  C  CE2 . TYR E  5  170 ? -17.117 -86.476  51.429  1.00 76.22  ? 175  TYR E CE2 1 
ATOM   8585  C  CZ  . TYR E  5  170 ? -18.395 -85.937  51.399  1.00 76.65  ? 175  TYR E CZ  1 
ATOM   8586  O  OH  . TYR E  5  170 ? -19.478 -86.773  51.234  1.00 77.31  ? 175  TYR E OH  1 
ATOM   8587  N  N   . LEU E  5  171 ? -13.405 -85.244  53.760  1.00 72.84  ? 176  LEU E N   1 
ATOM   8588  C  CA  . LEU E  5  171 ? -13.201 -86.572  54.330  1.00 72.93  ? 176  LEU E CA  1 
ATOM   8589  C  C   . LEU E  5  171 ? -12.989 -86.517  55.839  1.00 73.47  ? 176  LEU E C   1 
ATOM   8590  O  O   . LEU E  5  171 ? -13.497 -87.363  56.574  1.00 73.34  ? 176  LEU E O   1 
ATOM   8591  C  CB  . LEU E  5  171 ? -12.034 -87.281  53.638  1.00 72.66  ? 176  LEU E CB  1 
ATOM   8592  C  CG  . LEU E  5  171 ? -12.253 -87.734  52.195  1.00 71.30  ? 176  LEU E CG  1 
ATOM   8593  C  CD1 . LEU E  5  171 ? -10.929 -88.070  51.550  1.00 70.08  ? 176  LEU E CD1 1 
ATOM   8594  C  CD2 . LEU E  5  171 ? -13.203 -88.914  52.133  1.00 70.39  ? 176  LEU E CD2 1 
ATOM   8595  N  N   . GLU E  5  172 ? -12.252 -85.503  56.286  1.00 74.27  ? 177  GLU E N   1 
ATOM   8596  C  CA  . GLU E  5  172 ? -12.022 -85.246  57.707  1.00 75.31  ? 177  GLU E CA  1 
ATOM   8597  C  C   . GLU E  5  172 ? -13.345 -84.977  58.439  1.00 75.73  ? 177  GLU E C   1 
ATOM   8598  O  O   . GLU E  5  172 ? -13.516 -85.354  59.605  1.00 75.68  ? 177  GLU E O   1 
ATOM   8599  C  CB  . GLU E  5  172 ? -11.073 -84.056  57.856  1.00 75.49  ? 177  GLU E CB  1 
ATOM   8600  C  CG  . GLU E  5  172 ? -10.182 -84.080  59.094  1.00 76.74  ? 177  GLU E CG  1 
ATOM   8601  C  CD  . GLU E  5  172 ? -8.928  -83.198  58.952  1.00 78.33  ? 177  GLU E CD  1 
ATOM   8602  O  OE1 . GLU E  5  172 ? -8.222  -83.019  59.973  1.00 78.95  ? 177  GLU E OE1 1 
ATOM   8603  O  OE2 . GLU E  5  172 ? -8.642  -82.699  57.831  1.00 78.06  ? 177  GLU E OE2 1 
ATOM   8604  N  N   . ARG E  5  173 ? -14.270 -84.332  57.732  1.00 76.30  ? 178  ARG E N   1 
ATOM   8605  C  CA  . ARG E  5  173 ? -15.595 -84.017  58.247  1.00 77.04  ? 178  ARG E CA  1 
ATOM   8606  C  C   . ARG E  5  173 ? -16.486 -85.266  58.240  1.00 76.95  ? 178  ARG E C   1 
ATOM   8607  O  O   . ARG E  5  173 ? -17.172 -85.554  59.222  1.00 76.86  ? 178  ARG E O   1 
ATOM   8608  C  CB  . ARG E  5  173 ? -16.218 -82.903  57.390  1.00 77.47  ? 178  ARG E CB  1 
ATOM   8609  C  CG  . ARG E  5  173 ? -17.180 -81.947  58.113  1.00 79.33  ? 178  ARG E CG  1 
ATOM   8610  C  CD  . ARG E  5  173 ? -18.607 -82.492  58.187  1.00 81.75  ? 178  ARG E CD  1 
ATOM   8611  N  NE  . ARG E  5  173 ? -19.571 -81.466  58.588  1.00 83.65  ? 178  ARG E NE  1 
ATOM   8612  C  CZ  . ARG E  5  173 ? -20.808 -81.716  59.019  1.00 84.65  ? 178  ARG E CZ  1 
ATOM   8613  N  NH1 . ARG E  5  173 ? -21.249 -82.970  59.122  1.00 84.59  ? 178  ARG E NH1 1 
ATOM   8614  N  NH2 . ARG E  5  173 ? -21.607 -80.708  59.355  1.00 84.46  ? 178  ARG E NH2 1 
ATOM   8615  N  N   . THR E  5  174 ? -16.447 -86.006  57.132  1.00 76.97  ? 179  THR E N   1 
ATOM   8616  C  CA  . THR E  5  174 ? -17.316 -87.162  56.905  1.00 77.02  ? 179  THR E CA  1 
ATOM   8617  C  C   . THR E  5  174 ? -16.920 -88.404  57.713  1.00 76.98  ? 179  THR E C   1 
ATOM   8618  O  O   . THR E  5  174 ? -17.736 -89.309  57.886  1.00 76.99  ? 179  THR E O   1 
ATOM   8619  C  CB  . THR E  5  174 ? -17.357 -87.536  55.400  1.00 77.01  ? 179  THR E CB  1 
ATOM   8620  O  OG1 . THR E  5  174 ? -17.408 -86.345  54.611  1.00 77.17  ? 179  THR E OG1 1 
ATOM   8621  C  CG2 . THR E  5  174 ? -18.579 -88.401  55.066  1.00 77.56  ? 179  THR E CG2 1 
ATOM   8622  N  N   . LEU E  5  175 ? -15.687 -88.436  58.217  1.00 77.04  ? 180  LEU E N   1 
ATOM   8623  C  CA  . LEU E  5  175 ? -15.099 -89.648  58.820  1.00 77.11  ? 180  LEU E CA  1 
ATOM   8624  C  C   . LEU E  5  175 ? -16.096 -90.655  59.414  1.00 77.10  ? 180  LEU E C   1 
ATOM   8625  O  O   . LEU E  5  175 ? -16.226 -91.768  58.900  1.00 77.13  ? 180  LEU E O   1 
ATOM   8626  C  CB  . LEU E  5  175 ? -14.004 -89.301  59.848  1.00 77.22  ? 180  LEU E CB  1 
ATOM   8627  C  CG  . LEU E  5  175 ? -13.302 -90.481  60.547  1.00 77.21  ? 180  LEU E CG  1 
ATOM   8628  C  CD1 . LEU E  5  175 ? -12.677 -91.434  59.534  1.00 77.16  ? 180  LEU E CD1 1 
ATOM   8629  C  CD2 . LEU E  5  175 ? -12.260 -90.022  61.568  1.00 76.91  ? 180  LEU E CD2 1 
ATOM   8630  N  N   . ASP E  5  176 A -16.795 -90.253  60.474  1.00 76.98  ? 180  ASP E N   1 
ATOM   8631  C  CA  . ASP E  5  176 A -17.685 -91.147  61.220  1.00 76.97  ? 180  ASP E CA  1 
ATOM   8632  C  C   . ASP E  5  176 A -18.797 -91.792  60.390  1.00 76.73  ? 180  ASP E C   1 
ATOM   8633  O  O   . ASP E  5  176 A -19.292 -92.867  60.742  1.00 76.83  ? 180  ASP E O   1 
ATOM   8634  C  CB  . ASP E  5  176 A -18.280 -90.415  62.423  1.00 77.18  ? 180  ASP E CB  1 
ATOM   8635  C  CG  . ASP E  5  176 A -17.232 -90.054  63.459  1.00 78.11  ? 180  ASP E CG  1 
ATOM   8636  O  OD1 . ASP E  5  176 A -17.304 -88.943  64.032  1.00 79.06  ? 180  ASP E OD1 1 
ATOM   8637  O  OD2 . ASP E  5  176 A -16.330 -90.883  63.701  1.00 79.11  ? 180  ASP E OD2 1 
ATOM   8638  N  N   . THR E  5  177 B -19.181 -91.142  59.295  1.00 76.37  ? 180  THR E N   1 
ATOM   8639  C  CA  . THR E  5  177 B -20.208 -91.675  58.406  1.00 76.06  ? 180  THR E CA  1 
ATOM   8640  C  C   . THR E  5  177 B -19.648 -92.794  57.524  1.00 75.71  ? 180  THR E C   1 
ATOM   8641  O  O   . THR E  5  177 B -20.081 -93.941  57.649  1.00 75.64  ? 180  THR E O   1 
ATOM   8642  C  CB  . THR E  5  177 B -20.876 -90.563  57.539  1.00 76.27  ? 180  THR E CB  1 
ATOM   8643  O  OG1 . THR E  5  177 B -21.240 -89.455  58.373  1.00 76.26  ? 180  THR E OG1 1 
ATOM   8644  C  CG2 . THR E  5  177 B -22.124 -91.091  56.815  1.00 75.87  ? 180  THR E CG2 1 
ATOM   8645  N  N   . PHE E  5  178 C -18.686 -92.470  56.654  1.00 75.29  ? 180  PHE E N   1 
ATOM   8646  C  CA  . PHE E  5  178 C -18.234 -93.428  55.627  1.00 74.93  ? 180  PHE E CA  1 
ATOM   8647  C  C   . PHE E  5  178 C -17.498 -94.646  56.175  1.00 74.74  ? 180  PHE E C   1 
ATOM   8648  O  O   . PHE E  5  178 C -17.608 -95.733  55.610  1.00 74.55  ? 180  PHE E O   1 
ATOM   8649  C  CB  . PHE E  5  178 C -17.457 -92.757  54.469  1.00 74.83  ? 180  PHE E CB  1 
ATOM   8650  C  CG  . PHE E  5  178 C -16.046 -92.338  54.811  1.00 74.32  ? 180  PHE E CG  1 
ATOM   8651  C  CD1 . PHE E  5  178 C -15.025 -93.276  54.928  1.00 74.00  ? 180  PHE E CD1 1 
ATOM   8652  C  CD2 . PHE E  5  178 C -15.729 -90.996  54.965  1.00 74.09  ? 180  PHE E CD2 1 
ATOM   8653  C  CE1 . PHE E  5  178 C -13.723 -92.883  55.231  1.00 73.48  ? 180  PHE E CE1 1 
ATOM   8654  C  CE2 . PHE E  5  178 C -14.429 -90.595  55.265  1.00 73.80  ? 180  PHE E CE2 1 
ATOM   8655  C  CZ  . PHE E  5  178 C -13.425 -91.542  55.399  1.00 73.47  ? 180  PHE E CZ  1 
ATOM   8656  N  N   . ILE E  5  179 D -16.776 -94.460  57.281  1.00 74.57  ? 180  ILE E N   1 
ATOM   8657  C  CA  . ILE E  5  179 D -16.059 -95.550  57.947  1.00 74.42  ? 180  ILE E CA  1 
ATOM   8658  C  C   . ILE E  5  179 D -16.983 -96.735  58.244  1.00 74.39  ? 180  ILE E C   1 
ATOM   8659  O  O   . ILE E  5  179 D -16.520 -97.858  58.469  1.00 74.50  ? 180  ILE E O   1 
ATOM   8660  C  CB  . ILE E  5  179 D -15.346 -95.069  59.253  1.00 74.41  ? 180  ILE E CB  1 
ATOM   8661  C  CG1 . ILE E  5  179 D -14.321 -96.096  59.738  1.00 74.64  ? 180  ILE E CG1 1 
ATOM   8662  C  CG2 . ILE E  5  179 D -16.344 -94.807  60.372  1.00 74.48  ? 180  ILE E CG2 1 
ATOM   8663  C  CD1 . ILE E  5  179 D -13.387 -96.608  58.660  1.00 75.45  ? 180  ILE E CD1 1 
ATOM   8664  N  N   . LYS E  5  180 E -18.288 -96.472  58.219  1.00 74.23  ? 180  LYS E N   1 
ATOM   8665  C  CA  . LYS E  5  180 E -19.295 -97.453  58.606  1.00 73.95  ? 180  LYS E CA  1 
ATOM   8666  C  C   . LYS E  5  180 E -20.075 -98.007  57.420  1.00 73.50  ? 180  LYS E C   1 
ATOM   8667  O  O   . LYS E  5  180 E -20.928 -98.879  57.600  1.00 73.34  ? 180  LYS E O   1 
ATOM   8668  C  CB  . LYS E  5  180 E -20.263 -96.851  59.632  1.00 74.16  ? 180  LYS E CB  1 
ATOM   8669  C  CG  . LYS E  5  180 E -19.668 -96.615  61.014  1.00 74.94  ? 180  LYS E CG  1 
ATOM   8670  C  CD  . LYS E  5  180 E -20.768 -96.412  62.051  1.00 76.80  ? 180  LYS E CD  1 
ATOM   8671  C  CE  . LYS E  5  180 E -21.399 -97.751  62.463  1.00 77.50  ? 180  LYS E CE  1 
ATOM   8672  N  NZ  . LYS E  5  180 E -22.860 -97.605  62.743  1.00 77.49  ? 180  LYS E NZ  1 
ATOM   8673  N  N   . ILE E  5  181 F -19.789 -97.506  56.218  1.00 73.13  ? 180  ILE E N   1 
ATOM   8674  C  CA  . ILE E  5  181 F -20.408 -98.035  54.996  1.00 72.84  ? 180  ILE E CA  1 
ATOM   8675  C  C   . ILE E  5  181 F -19.880 -99.449  54.708  1.00 72.96  ? 180  ILE E C   1 
ATOM   8676  O  O   . ILE E  5  181 F -18.992 -99.660  53.874  1.00 72.77  ? 180  ILE E O   1 
ATOM   8677  C  CB  . ILE E  5  181 F -20.229 -97.094  53.773  1.00 72.76  ? 180  ILE E CB  1 
ATOM   8678  C  CG1 . ILE E  5  181 F -20.766 -95.694  54.089  1.00 72.34  ? 180  ILE E CG1 1 
ATOM   8679  C  CG2 . ILE E  5  181 F -20.924 -97.678  52.535  1.00 72.49  ? 180  ILE E CG2 1 
ATOM   8680  C  CD1 . ILE E  5  181 F -20.488 -94.662  53.017  1.00 71.88  ? 180  ILE E CD1 1 
ATOM   8681  N  N   . ASP E  5  182 ? -20.444 -100.411 55.433  1.00 73.13  ? 183  ASP E N   1 
ATOM   8682  C  CA  . ASP E  5  182 ? -20.067 -101.811 55.312  1.00 73.22  ? 183  ASP E CA  1 
ATOM   8683  C  C   . ASP E  5  182 ? -21.094 -102.575 54.495  1.00 73.21  ? 183  ASP E C   1 
ATOM   8684  O  O   . ASP E  5  182 ? -22.298 -102.452 54.713  1.00 73.22  ? 183  ASP E O   1 
ATOM   8685  C  CB  . ASP E  5  182 ? -19.908 -102.443 56.698  1.00 73.14  ? 183  ASP E CB  1 
ATOM   8686  C  CG  . ASP E  5  182 ? -18.699 -101.908 57.449  1.00 73.41  ? 183  ASP E CG  1 
ATOM   8687  O  OD1 . ASP E  5  182 ? -17.830 -101.280 56.812  1.00 74.16  ? 183  ASP E OD1 1 
ATOM   8688  O  OD2 . ASP E  5  182 ? -18.609 -102.119 58.676  1.00 73.39  ? 183  ASP E OD2 1 
ATOM   8689  N  N   . GLY E  5  183 ? -20.604 -103.354 53.542  1.00 73.29  ? 184  GLY E N   1 
ATOM   8690  C  CA  . GLY E  5  183 ? -21.461 -104.215 52.745  1.00 73.45  ? 184  GLY E CA  1 
ATOM   8691  C  C   . GLY E  5  183 ? -22.222 -103.463 51.678  1.00 73.52  ? 184  GLY E C   1 
ATOM   8692  O  O   . GLY E  5  183 ? -23.153 -104.005 51.083  1.00 73.44  ? 184  GLY E O   1 
ATOM   8693  N  N   . ASN E  5  184 ? -21.827 -102.215 51.429  1.00 73.65  ? 185  ASN E N   1 
ATOM   8694  C  CA  . ASN E  5  184 ? -22.479 -101.409 50.395  1.00 73.71  ? 185  ASN E CA  1 
ATOM   8695  C  C   . ASN E  5  184 ? -21.496 -100.709 49.460  1.00 73.64  ? 185  ASN E C   1 
ATOM   8696  O  O   . ASN E  5  184 ? -21.282 -99.499  49.576  1.00 73.70  ? 185  ASN E O   1 
ATOM   8697  C  CB  . ASN E  5  184 ? -23.460 -100.402 51.016  1.00 73.68  ? 185  ASN E CB  1 
ATOM   8698  C  CG  . ASN E  5  184 ? -24.623 -100.061 50.091  1.00 73.67  ? 185  ASN E CG  1 
ATOM   8699  O  OD1 . ASN E  5  184 ? -25.550 -99.369  50.494  1.00 73.83  ? 185  ASN E OD1 1 
ATOM   8700  N  ND2 . ASN E  5  184 ? -24.581 -100.553 48.851  1.00 73.93  ? 185  ASN E ND2 1 
ATOM   8701  N  N   . PRO E  5  185 ? -20.898 -101.470 48.524  1.00 73.61  ? 186  PRO E N   1 
ATOM   8702  C  CA  . PRO E  5  185 ? -19.964 -100.899 47.558  1.00 73.68  ? 186  PRO E CA  1 
ATOM   8703  C  C   . PRO E  5  185 ? -20.440 -99.575  46.950  1.00 73.73  ? 186  PRO E C   1 
ATOM   8704  O  O   . PRO E  5  185 ? -19.677 -98.607  46.929  1.00 73.64  ? 186  PRO E O   1 
ATOM   8705  C  CB  . PRO E  5  185 ? -19.862 -101.980 46.467  1.00 73.51  ? 186  PRO E CB  1 
ATOM   8706  C  CG  . PRO E  5  185 ? -20.580 -103.187 46.992  1.00 73.66  ? 186  PRO E CG  1 
ATOM   8707  C  CD  . PRO E  5  185 ? -20.944 -102.937 48.421  1.00 73.64  ? 186  PRO E CD  1 
ATOM   8708  N  N   . ASP E  5  186 ? -21.686 -99.534  46.479  1.00 73.81  ? 187  ASP E N   1 
ATOM   8709  C  CA  . ASP E  5  186 ? -22.187 -98.378  45.732  1.00 73.98  ? 187  ASP E CA  1 
ATOM   8710  C  C   . ASP E  5  186 ? -22.245 -97.091  46.568  1.00 73.83  ? 187  ASP E C   1 
ATOM   8711  O  O   . ASP E  5  186 ? -22.002 -95.993  46.049  1.00 73.77  ? 187  ASP E O   1 
ATOM   8712  C  CB  . ASP E  5  186 ? -23.544 -98.686  45.083  1.00 74.15  ? 187  ASP E CB  1 
ATOM   8713  C  CG  . ASP E  5  186 ? -23.443 -99.735  43.970  1.00 75.03  ? 187  ASP E CG  1 
ATOM   8714  O  OD1 . ASP E  5  186 ? -22.451 -99.740  43.211  1.00 75.38  ? 187  ASP E OD1 1 
ATOM   8715  O  OD2 . ASP E  5  186 ? -24.372 -100.559 43.844  1.00 76.36  ? 187  ASP E OD2 1 
ATOM   8716  N  N   . GLU E  5  187 ? -22.540 -97.227  47.857  1.00 73.53  ? 188  GLU E N   1 
ATOM   8717  C  CA  . GLU E  5  187 ? -22.613 -96.061  48.733  1.00 73.46  ? 188  GLU E CA  1 
ATOM   8718  C  C   . GLU E  5  187 ? -21.235 -95.491  49.069  1.00 73.11  ? 188  GLU E C   1 
ATOM   8719  O  O   . GLU E  5  187 ? -21.082 -94.278  49.242  1.00 73.03  ? 188  GLU E O   1 
ATOM   8720  C  CB  . GLU E  5  187 ? -23.418 -96.376  50.002  1.00 73.73  ? 188  GLU E CB  1 
ATOM   8721  C  CG  . GLU E  5  187 ? -24.940 -96.223  49.832  1.00 74.56  ? 188  GLU E CG  1 
ATOM   8722  C  CD  . GLU E  5  187 ? -25.370 -94.772  49.682  1.00 75.73  ? 188  GLU E CD  1 
ATOM   8723  O  OE1 . GLU E  5  187 ? -25.694 -94.362  48.544  1.00 76.12  ? 188  GLU E OE1 1 
ATOM   8724  O  OE2 . GLU E  5  187 ? -25.359 -94.036  50.698  1.00 76.55  ? 188  GLU E OE2 1 
ATOM   8725  N  N   . LEU E  5  188 ? -20.239 -96.376  49.142  1.00 72.83  ? 189  LEU E N   1 
ATOM   8726  C  CA  . LEU E  5  188 ? -18.848 -95.993  49.406  1.00 72.22  ? 189  LEU E CA  1 
ATOM   8727  C  C   . LEU E  5  188 ? -18.224 -95.277  48.211  1.00 72.05  ? 189  LEU E C   1 
ATOM   8728  O  O   . LEU E  5  188 ? -17.431 -94.352  48.379  1.00 71.87  ? 189  LEU E O   1 
ATOM   8729  C  CB  . LEU E  5  188 ? -18.006 -97.223  49.755  1.00 72.00  ? 189  LEU E CB  1 
ATOM   8730  C  CG  . LEU E  5  188 ? -17.027 -97.199  50.936  1.00 71.25  ? 189  LEU E CG  1 
ATOM   8731  C  CD1 . LEU E  5  188 ? -15.900 -98.176  50.666  1.00 70.55  ? 189  LEU E CD1 1 
ATOM   8732  C  CD2 . LEU E  5  188 ? -16.463 -95.825  51.242  1.00 70.55  ? 189  LEU E CD2 1 
ATOM   8733  N  N   . ILE E  5  189 ? -18.565 -95.720  47.007  1.00 72.03  ? 190  ILE E N   1 
ATOM   8734  C  CA  . ILE E  5  189 ? -18.107 -95.039  45.807  1.00 72.25  ? 190  ILE E CA  1 
ATOM   8735  C  C   . ILE E  5  189 ? -18.713 -93.636  45.757  1.00 72.80  ? 190  ILE E C   1 
ATOM   8736  O  O   . ILE E  5  189 ? -17.988 -92.668  45.538  1.00 72.87  ? 190  ILE E O   1 
ATOM   8737  C  CB  . ILE E  5  189 ? -18.412 -95.840  44.526  1.00 72.00  ? 190  ILE E CB  1 
ATOM   8738  C  CG1 . ILE E  5  189 ? -17.642 -97.165  44.545  1.00 71.67  ? 190  ILE E CG1 1 
ATOM   8739  C  CG2 . ILE E  5  189 ? -18.051 -95.024  43.300  1.00 71.44  ? 190  ILE E CG2 1 
ATOM   8740  C  CD1 . ILE E  5  189 ? -18.046 -98.161  43.468  1.00 71.45  ? 190  ILE E CD1 1 
ATOM   8741  N  N   . LYS E  5  190 ? -20.028 -93.540  45.991  1.00 73.56  ? 191  LYS E N   1 
ATOM   8742  C  CA  . LYS E  5  190 ? -20.746 -92.253  46.073  1.00 74.17  ? 191  LYS E CA  1 
ATOM   8743  C  C   . LYS E  5  190 ? -20.040 -91.241  46.965  1.00 73.90  ? 191  LYS E C   1 
ATOM   8744  O  O   . LYS E  5  190 ? -19.831 -90.096  46.551  1.00 74.00  ? 191  LYS E O   1 
ATOM   8745  C  CB  . LYS E  5  190 ? -22.184 -92.438  46.575  1.00 74.58  ? 191  LYS E CB  1 
ATOM   8746  C  CG  . LYS E  5  190 ? -23.269 -92.325  45.501  1.00 76.66  ? 191  LYS E CG  1 
ATOM   8747  C  CD  . LYS E  5  190 ? -24.581 -91.802  46.124  1.00 80.09  ? 191  LYS E CD  1 
ATOM   8748  C  CE  . LYS E  5  190 ? -25.743 -91.789  45.123  1.00 81.47  ? 191  LYS E CE  1 
ATOM   8749  N  NZ  . LYS E  5  190 ? -26.309 -93.161  44.922  1.00 82.55  ? 191  LYS E NZ  1 
ATOM   8750  N  N   . ALA E  5  191 ? -19.677 -91.668  48.178  1.00 73.62  ? 192  ALA E N   1 
ATOM   8751  C  CA  . ALA E  5  191 ? -18.951 -90.817  49.134  1.00 73.57  ? 192  ALA E CA  1 
ATOM   8752  C  C   . ALA E  5  191 ? -17.558 -90.426  48.634  1.00 73.58  ? 192  ALA E C   1 
ATOM   8753  O  O   . ALA E  5  191 ? -17.032 -89.374  49.003  1.00 73.61  ? 192  ALA E O   1 
ATOM   8754  C  CB  . ALA E  5  191 ? -18.862 -91.487  50.503  1.00 73.41  ? 192  ALA E CB  1 
ATOM   8755  N  N   . GLY E  5  192 ? -16.968 -91.279  47.798  1.00 73.54  ? 193  GLY E N   1 
ATOM   8756  C  CA  . GLY E  5  192 ? -15.694 -90.980  47.168  1.00 73.51  ? 193  GLY E CA  1 
ATOM   8757  C  C   . GLY E  5  192 ? -15.876 -89.954  46.072  1.00 73.66  ? 193  GLY E C   1 
ATOM   8758  O  O   . GLY E  5  192 ? -15.134 -88.971  45.996  1.00 73.50  ? 193  GLY E O   1 
ATOM   8759  N  N   . VAL E  5  193 ? -16.876 -90.185  45.225  1.00 73.87  ? 194  VAL E N   1 
ATOM   8760  C  CA  . VAL E  5  193 ? -17.219 -89.264  44.147  1.00 74.20  ? 194  VAL E CA  1 
ATOM   8761  C  C   . VAL E  5  193 ? -17.635 -87.893  44.698  1.00 74.55  ? 194  VAL E C   1 
ATOM   8762  O  O   . VAL E  5  193 ? -17.295 -86.863  44.124  1.00 74.52  ? 194  VAL E O   1 
ATOM   8763  C  CB  . VAL E  5  193 ? -18.311 -89.858  43.232  1.00 74.11  ? 194  VAL E CB  1 
ATOM   8764  C  CG1 . VAL E  5  193 ? -18.704 -88.874  42.140  1.00 74.25  ? 194  VAL E CG1 1 
ATOM   8765  C  CG2 . VAL E  5  193 ? -17.823 -91.158  42.611  1.00 73.80  ? 194  VAL E CG2 1 
ATOM   8766  N  N   . GLU E  5  194 ? -18.348 -87.886  45.820  1.00 75.18  ? 195  GLU E N   1 
ATOM   8767  C  CA  . GLU E  5  194 ? -18.699 -86.634  46.487  1.00 75.98  ? 195  GLU E CA  1 
ATOM   8768  C  C   . GLU E  5  194 ? -17.456 -85.927  47.020  1.00 76.14  ? 195  GLU E C   1 
ATOM   8769  O  O   . GLU E  5  194 ? -17.325 -84.714  46.886  1.00 76.23  ? 195  GLU E O   1 
ATOM   8770  C  CB  . GLU E  5  194 ? -19.706 -86.864  47.619  1.00 76.12  ? 195  GLU E CB  1 
ATOM   8771  C  CG  . GLU E  5  194 ? -20.419 -85.586  48.065  1.00 77.38  ? 195  GLU E CG  1 
ATOM   8772  C  CD  . GLU E  5  194 ? -21.588 -85.845  49.010  1.00 79.80  ? 195  GLU E CD  1 
ATOM   8773  O  OE1 . GLU E  5  194 ? -21.760 -85.051  49.964  1.00 80.56  ? 195  GLU E OE1 1 
ATOM   8774  O  OE2 . GLU E  5  194 ? -22.334 -86.836  48.808  1.00 80.34  ? 195  GLU E OE2 1 
ATOM   8775  N  N   . ALA E  5  195 ? -16.549 -86.692  47.621  1.00 76.54  ? 196  ALA E N   1 
ATOM   8776  C  CA  . ALA E  5  195 ? -15.304 -86.146  48.158  1.00 76.79  ? 196  ALA E CA  1 
ATOM   8777  C  C   . ALA E  5  195 ? -14.428 -85.505  47.088  1.00 76.94  ? 196  ALA E C   1 
ATOM   8778  O  O   . ALA E  5  195 ? -13.864 -84.439  47.320  1.00 76.94  ? 196  ALA E O   1 
ATOM   8779  C  CB  . ALA E  5  195 ? -14.524 -87.216  48.907  1.00 76.94  ? 196  ALA E CB  1 
ATOM   8780  N  N   . ILE E  5  196 ? -14.324 -86.141  45.920  1.00 77.19  ? 197  ILE E N   1 
ATOM   8781  C  CA  . ILE E  5  196 ? -13.498 -85.602  44.836  1.00 77.50  ? 197  ILE E CA  1 
ATOM   8782  C  C   . ILE E  5  196 ? -14.043 -84.288  44.244  1.00 77.98  ? 197  ILE E C   1 
ATOM   8783  O  O   . ILE E  5  196 ? -13.283 -83.498  43.680  1.00 78.03  ? 197  ILE E O   1 
ATOM   8784  C  CB  . ILE E  5  196 ? -13.197 -86.650  43.723  1.00 77.35  ? 197  ILE E CB  1 
ATOM   8785  C  CG1 . ILE E  5  196 ? -11.935 -86.243  42.942  1.00 77.28  ? 197  ILE E CG1 1 
ATOM   8786  C  CG2 . ILE E  5  196 ? -14.410 -86.863  42.812  1.00 77.13  ? 197  ILE E CG2 1 
ATOM   8787  C  CD1 . ILE E  5  196 ? -11.358 -87.302  42.014  1.00 77.22  ? 197  ILE E CD1 1 
ATOM   8788  N  N   . SER E  5  197 ? -15.346 -84.049  44.385  1.00 78.60  ? 198  SER E N   1 
ATOM   8789  C  CA  . SER E  5  197 ? -15.948 -82.828  43.841  1.00 79.25  ? 198  SER E CA  1 
ATOM   8790  C  C   . SER E  5  197 ? -15.621 -81.566  44.636  1.00 79.68  ? 198  SER E C   1 
ATOM   8791  O  O   . SER E  5  197 ? -15.637 -80.474  44.081  1.00 79.81  ? 198  SER E O   1 
ATOM   8792  C  CB  . SER E  5  197 ? -17.451 -82.987  43.597  1.00 79.11  ? 198  SER E CB  1 
ATOM   8793  O  OG  . SER E  5  197 ? -17.902 -84.265  43.995  1.00 79.34  ? 198  SER E OG  1 
ATOM   8794  N  N   . GLN E  5  198 ? -15.289 -81.720  45.915  1.00 80.32  ? 199  GLN E N   1 
ATOM   8795  C  CA  . GLN E  5  198 ? -14.778 -80.606  46.719  1.00 81.20  ? 199  GLN E CA  1 
ATOM   8796  C  C   . GLN E  5  198 ? -13.389 -80.129  46.280  1.00 81.83  ? 199  GLN E C   1 
ATOM   8797  O  O   . GLN E  5  198 ? -12.750 -79.339  46.980  1.00 81.90  ? 199  GLN E O   1 
ATOM   8798  C  CB  . GLN E  5  198 ? -14.738 -80.985  48.204  1.00 81.20  ? 199  GLN E CB  1 
ATOM   8799  C  CG  . GLN E  5  198 ? -15.900 -80.448  49.025  1.00 81.82  ? 199  GLN E CG  1 
ATOM   8800  C  CD  . GLN E  5  198 ? -17.227 -81.082  48.657  1.00 82.35  ? 199  GLN E CD  1 
ATOM   8801  O  OE1 . GLN E  5  198 ? -18.235 -80.392  48.515  1.00 82.42  ? 199  GLN E OE1 1 
ATOM   8802  N  NE2 . GLN E  5  198 ? -17.235 -82.402  48.501  1.00 82.81  ? 199  GLN E NE2 1 
ATOM   8803  N  N   . SER E  5  199 ? -12.922 -80.615  45.131  1.00 82.66  ? 200  SER E N   1 
ATOM   8804  C  CA  . SER E  5  199 ? -11.601 -80.259  44.607  1.00 83.49  ? 200  SER E CA  1 
ATOM   8805  C  C   . SER E  5  199 ? -11.690 -79.854  43.141  1.00 84.15  ? 200  SER E C   1 
ATOM   8806  O  O   . SER E  5  199 ? -10.675 -79.679  42.457  1.00 83.98  ? 200  SER E O   1 
ATOM   8807  C  CB  . SER E  5  199 ? -10.611 -81.416  44.793  1.00 83.43  ? 200  SER E CB  1 
ATOM   8808  O  OG  . SER E  5  199 ? -10.130 -81.476  46.127  1.00 83.50  ? 200  SER E OG  1 
ATOM   8809  N  N   . LEU E  5  200 ? -12.926 -79.704  42.673  1.00 85.24  ? 201  LEU E N   1 
ATOM   8810  C  CA  . LEU E  5  200 ? -13.193 -79.253  41.315  1.00 86.35  ? 201  LEU E CA  1 
ATOM   8811  C  C   . LEU E  5  200 ? -13.276 -77.731  41.227  1.00 87.31  ? 201  LEU E C   1 
ATOM   8812  O  O   . LEU E  5  200 ? -13.777 -77.057  42.135  1.00 87.45  ? 201  LEU E O   1 
ATOM   8813  C  CB  . LEU E  5  200 ? -14.472 -79.892  40.779  1.00 86.16  ? 201  LEU E CB  1 
ATOM   8814  C  CG  . LEU E  5  200 ? -14.432 -81.407  40.572  1.00 85.97  ? 201  LEU E CG  1 
ATOM   8815  C  CD1 . LEU E  5  200 ? -15.831 -81.934  40.305  1.00 85.71  ? 201  LEU E CD1 1 
ATOM   8816  C  CD2 . LEU E  5  200 ? -13.472 -81.792  39.442  1.00 85.49  ? 201  LEU E CD2 1 
ATOM   8817  N  N   . ARG E  5  201 ? -12.768 -77.209  40.118  1.00 88.42  ? 202  ARG E N   1 
ATOM   8818  C  CA  . ARG E  5  201 ? -12.718 -75.783  39.847  1.00 89.49  ? 202  ARG E CA  1 
ATOM   8819  C  C   . ARG E  5  201 ? -12.766 -75.718  38.334  1.00 89.96  ? 202  ARG E C   1 
ATOM   8820  O  O   . ARG E  5  201 ? -13.570 -74.982  37.749  1.00 89.98  ? 202  ARG E O   1 
ATOM   8821  C  CB  . ARG E  5  201 ? -11.400 -75.209  40.363  1.00 89.65  ? 202  ARG E CB  1 
ATOM   8822  C  CG  . ARG E  5  201 ? -11.355 -73.703  40.471  1.00 90.63  ? 202  ARG E CG  1 
ATOM   8823  C  CD  . ARG E  5  201 ? -9.946  -73.263  40.801  1.00 92.66  ? 202  ARG E CD  1 
ATOM   8824  N  NE  . ARG E  5  201 ? -9.924  -72.311  41.910  1.00 94.41  ? 202  ARG E NE  1 
ATOM   8825  C  CZ  . ARG E  5  201 ? -8.977  -72.268  42.847  1.00 95.39  ? 202  ARG E CZ  1 
ATOM   8826  N  NH1 . ARG E  5  201 ? -7.964  -73.132  42.824  1.00 95.61  ? 202  ARG E NH1 1 
ATOM   8827  N  NH2 . ARG E  5  201 ? -9.046  -71.364  43.819  1.00 95.29  ? 202  ARG E NH2 1 
ATOM   8828  N  N   . ASP E  5  202 ? -11.876 -76.512  37.730  1.00 90.60  ? 203  ASP E N   1 
ATOM   8829  C  CA  . ASP E  5  202 ? -11.917 -76.920  36.322  1.00 91.09  ? 203  ASP E CA  1 
ATOM   8830  C  C   . ASP E  5  202 ? -13.363 -76.901  35.789  1.00 90.98  ? 203  ASP E C   1 
ATOM   8831  O  O   . ASP E  5  202 ? -13.768 -75.948  35.107  1.00 90.96  ? 203  ASP E O   1 
ATOM   8832  C  CB  . ASP E  5  202 ? -11.285 -78.331  36.193  1.00 91.29  ? 203  ASP E CB  1 
ATOM   8833  C  CG  . ASP E  5  202 ? -10.694 -78.606  34.806  1.00 92.03  ? 203  ASP E CG  1 
ATOM   8834  O  OD1 . ASP E  5  202 ? -9.482  -78.346  34.608  1.00 92.36  ? 203  ASP E OD1 1 
ATOM   8835  O  OD2 . ASP E  5  202 ? -11.435 -79.096  33.921  1.00 92.52  ? 203  ASP E OD2 1 
ATOM   8836  N  N   . GLU E  5  203 ? -14.139 -77.929  36.141  1.00 90.74  ? 204  GLU E N   1 
ATOM   8837  C  CA  . GLU E  5  203 ? -15.530 -78.056  35.704  1.00 90.48  ? 204  GLU E CA  1 
ATOM   8838  C  C   . GLU E  5  203 ? -16.271 -79.163  36.458  1.00 89.77  ? 204  GLU E C   1 
ATOM   8839  O  O   . GLU E  5  203 ? -15.941 -79.492  37.599  1.00 89.57  ? 204  GLU E O   1 
ATOM   8840  C  CB  . GLU E  5  203 ? -15.610 -78.297  34.181  1.00 90.83  ? 204  GLU E CB  1 
ATOM   8841  C  CG  . GLU E  5  203 ? -14.854 -79.535  33.667  1.00 92.08  ? 204  GLU E CG  1 
ATOM   8842  C  CD  . GLU E  5  203 ? -14.742 -79.566  32.147  1.00 94.00  ? 204  GLU E CD  1 
ATOM   8843  O  OE1 . GLU E  5  203 ? -15.771 -79.360  31.457  1.00 94.65  ? 204  GLU E OE1 1 
ATOM   8844  O  OE2 . GLU E  5  203 ? -13.618 -79.799  31.645  1.00 94.19  ? 204  GLU E OE2 1 
ATOM   8845  N  N   . SER E  5  204 ? -17.283 -79.712  35.793  1.00 88.96  ? 206  SER E N   1 
ATOM   8846  C  CA  . SER E  5  204 ? -18.054 -80.845  36.273  1.00 88.04  ? 206  SER E CA  1 
ATOM   8847  C  C   . SER E  5  204 ? -17.419 -82.178  35.816  1.00 87.15  ? 206  SER E C   1 
ATOM   8848  O  O   . SER E  5  204 ? -16.773 -82.250  34.760  1.00 87.01  ? 206  SER E O   1 
ATOM   8849  C  CB  . SER E  5  204 ? -19.489 -80.712  35.757  1.00 88.14  ? 206  SER E CB  1 
ATOM   8850  O  OG  . SER E  5  204 ? -20.298 -81.781  36.200  1.00 88.94  ? 206  SER E OG  1 
ATOM   8851  N  N   . LEU E  5  205 ? -17.604 -83.222  36.624  1.00 85.92  ? 207  LEU E N   1 
ATOM   8852  C  CA  . LEU E  5  205 ? -17.016 -84.538  36.361  1.00 84.72  ? 207  LEU E CA  1 
ATOM   8853  C  C   . LEU E  5  205 ? -17.841 -85.353  35.366  1.00 83.68  ? 207  LEU E C   1 
ATOM   8854  O  O   . LEU E  5  205 ? -19.000 -85.676  35.617  1.00 83.66  ? 207  LEU E O   1 
ATOM   8855  C  CB  . LEU E  5  205 ? -16.745 -85.308  37.672  1.00 84.74  ? 207  LEU E CB  1 
ATOM   8856  C  CG  . LEU E  5  205 ? -17.746 -85.528  38.823  1.00 85.22  ? 207  LEU E CG  1 
ATOM   8857  C  CD1 . LEU E  5  205 ? -16.991 -86.039  40.049  1.00 85.27  ? 207  LEU E CD1 1 
ATOM   8858  C  CD2 . LEU E  5  205 ? -18.591 -84.297  39.219  1.00 85.72  ? 207  LEU E CD2 1 
ATOM   8859  N  N   . THR E  5  206 B -17.228 -85.660  34.227  1.00 82.41  ? 207  THR E N   1 
ATOM   8860  C  CA  . THR E  5  206 B -17.917 -86.309  33.109  1.00 81.16  ? 207  THR E CA  1 
ATOM   8861  C  C   . THR E  5  206 B -17.638 -87.806  33.067  1.00 80.23  ? 207  THR E C   1 
ATOM   8862  O  O   . THR E  5  206 B -16.926 -88.335  33.916  1.00 80.17  ? 207  THR E O   1 
ATOM   8863  C  CB  . THR E  5  206 B -17.533 -85.674  31.740  1.00 81.26  ? 207  THR E CB  1 
ATOM   8864  O  OG1 . THR E  5  206 B -16.148 -85.916  31.455  1.00 81.00  ? 207  THR E OG1 1 
ATOM   8865  C  CG2 . THR E  5  206 B -17.805 -84.167  31.730  1.00 81.35  ? 207  THR E CG2 1 
ATOM   8866  N  N   . VAL E  5  207 C -18.201 -88.476  32.065  1.00 79.12  ? 208  VAL E N   1 
ATOM   8867  C  CA  . VAL E  5  207 C -18.045 -89.922  31.887  1.00 77.97  ? 208  VAL E CA  1 
ATOM   8868  C  C   . VAL E  5  207 C -16.639 -90.277  31.349  1.00 77.16  ? 208  VAL E C   1 
ATOM   8869  O  O   . VAL E  5  207 C -16.235 -91.440  31.354  1.00 76.93  ? 208  VAL E O   1 
ATOM   8870  C  CB  . VAL E  5  207 C -19.220 -90.508  31.022  1.00 77.93  ? 208  VAL E CB  1 
ATOM   8871  C  CG1 . VAL E  5  207 C -18.933 -90.430  29.523  1.00 78.05  ? 208  VAL E CG1 1 
ATOM   8872  C  CG2 . VAL E  5  207 C -19.550 -91.921  31.435  1.00 77.77  ? 208  VAL E CG2 1 
ATOM   8873  N  N   . ASP E  5  208 D -15.901 -89.257  30.914  1.00 76.22  ? 209  ASP E N   1 
ATOM   8874  C  CA  . ASP E  5  208 D -14.507 -89.399  30.484  1.00 75.31  ? 209  ASP E CA  1 
ATOM   8875  C  C   . ASP E  5  208 D -13.545 -89.057  31.617  1.00 74.47  ? 209  ASP E C   1 
ATOM   8876  O  O   . ASP E  5  208 D -12.552 -89.754  31.817  1.00 74.44  ? 209  ASP E O   1 
ATOM   8877  C  CB  . ASP E  5  208 D -14.217 -88.487  29.291  1.00 75.48  ? 209  ASP E CB  1 
ATOM   8878  C  CG  . ASP E  5  208 D -15.228 -88.639  28.179  1.00 75.77  ? 209  ASP E CG  1 
ATOM   8879  O  OD1 . ASP E  5  208 D -16.443 -88.576  28.463  1.00 76.18  ? 209  ASP E OD1 1 
ATOM   8880  O  OD2 . ASP E  5  208 D -14.808 -88.818  27.018  1.00 76.41  ? 209  ASP E OD2 1 
ATOM   8881  N  N   . ASN E  5  209 E -13.854 -87.968  32.329  1.00 73.39  ? 209  ASN E N   1 
ATOM   8882  C  CA  . ASN E  5  209 E -13.139 -87.490  33.525  1.00 72.29  ? 209  ASN E CA  1 
ATOM   8883  C  C   . ASN E  5  209 E -12.821 -88.554  34.575  1.00 71.09  ? 209  ASN E C   1 
ATOM   8884  O  O   . ASN E  5  209 E -11.729 -88.570  35.150  1.00 70.98  ? 209  ASN E O   1 
ATOM   8885  C  CB  . ASN E  5  209 E -13.992 -86.422  34.239  1.00 72.72  ? 209  ASN E CB  1 
ATOM   8886  C  CG  . ASN E  5  209 E -13.699 -85.009  33.775  1.00 73.86  ? 209  ASN E CG  1 
ATOM   8887  O  OD1 . ASN E  5  209 E -12.736 -84.767  33.051  1.00 76.54  ? 209  ASN E OD1 1 
ATOM   8888  N  ND2 . ASN E  5  209 E -14.530 -84.059  34.205  1.00 74.15  ? 209  ASN E ND2 1 
ATOM   8889  N  N   . LEU E  5  210 ? -13.800 -89.417  34.835  1.00 69.38  ? 210  LEU E N   1 
ATOM   8890  C  CA  . LEU E  5  210 ? -13.831 -90.213  36.050  1.00 67.71  ? 210  LEU E CA  1 
ATOM   8891  C  C   . LEU E  5  210 ? -13.242 -91.610  35.920  1.00 66.63  ? 210  LEU E C   1 
ATOM   8892  O  O   . LEU E  5  210 ? -13.531 -92.349  34.968  1.00 66.27  ? 210  LEU E O   1 
ATOM   8893  C  CB  . LEU E  5  210 ? -15.264 -90.297  36.573  1.00 67.80  ? 210  LEU E CB  1 
ATOM   8894  C  CG  . LEU E  5  210 ? -15.475 -90.731  38.022  1.00 67.83  ? 210  LEU E CG  1 
ATOM   8895  C  CD1 . LEU E  5  210 ? -14.711 -89.831  38.988  1.00 67.39  ? 210  LEU E CD1 1 
ATOM   8896  C  CD2 . LEU E  5  210 ? -16.962 -90.734  38.344  1.00 68.11  ? 210  LEU E CD2 1 
ATOM   8897  N  N   . SER E  5  211 ? -12.414 -91.941  36.909  1.00 65.19  ? 211  SER E N   1 
ATOM   8898  C  CA  . SER E  5  211 ? -11.838 -93.265  37.077  1.00 63.81  ? 211  SER E CA  1 
ATOM   8899  C  C   . SER E  5  211 ? -12.065 -93.707  38.516  1.00 62.71  ? 211  SER E C   1 
ATOM   8900  O  O   . SER E  5  211 ? -11.639 -93.030  39.456  1.00 62.38  ? 211  SER E O   1 
ATOM   8901  C  CB  . SER E  5  211 ? -10.344 -93.226  36.777  1.00 63.96  ? 211  SER E CB  1 
ATOM   8902  O  OG  . SER E  5  211 ? -9.878  -94.484  36.334  1.00 64.07  ? 211  SER E OG  1 
ATOM   8903  N  N   . ILE E  5  212 ? -12.760 -94.828  38.684  1.00 61.54  ? 212  ILE E N   1 
ATOM   8904  C  CA  . ILE E  5  212 ? -12.994 -95.396  40.011  1.00 60.66  ? 212  ILE E CA  1 
ATOM   8905  C  C   . ILE E  5  212 ? -12.421 -96.810  40.118  1.00 60.05  ? 212  ILE E C   1 
ATOM   8906  O  O   . ILE E  5  212 ? -12.420 -97.560  39.138  1.00 60.07  ? 212  ILE E O   1 
ATOM   8907  C  CB  . ILE E  5  212 ? -14.496 -95.411  40.370  1.00 60.72  ? 212  ILE E CB  1 
ATOM   8908  C  CG1 . ILE E  5  212 ? -15.115 -94.033  40.115  1.00 60.94  ? 212  ILE E CG1 1 
ATOM   8909  C  CG2 . ILE E  5  212 ? -14.702 -95.824  41.836  1.00 60.32  ? 212  ILE E CG2 1 
ATOM   8910  C  CD1 . ILE E  5  212 ? -16.640 -94.006  40.139  1.00 61.20  ? 212  ILE E CD1 1 
ATOM   8911  N  N   . ALA E  5  213 ? -11.924 -97.165  41.301  1.00 59.11  ? 213  ALA E N   1 
ATOM   8912  C  CA  . ALA E  5  213 ? -11.472 -98.531  41.560  1.00 58.49  ? 213  ALA E CA  1 
ATOM   8913  C  C   . ALA E  5  213 ? -11.906 -98.996  42.933  1.00 58.17  ? 213  ALA E C   1 
ATOM   8914  O  O   . ALA E  5  213 ? -11.980 -98.207  43.870  1.00 57.81  ? 213  ALA E O   1 
ATOM   8915  C  CB  . ALA E  5  213 ? -9.970  -98.639  41.416  1.00 58.31  ? 213  ALA E CB  1 
ATOM   8916  N  N   . ILE E  5  214 ? -12.192 -100.286 43.047  1.00 58.19  ? 214  ILE E N   1 
ATOM   8917  C  CA  . ILE E  5  214 ? -12.625 -100.861 44.322  1.00 58.29  ? 214  ILE E CA  1 
ATOM   8918  C  C   . ILE E  5  214 ? -11.967 -102.216 44.598  1.00 58.32  ? 214  ILE E C   1 
ATOM   8919  O  O   . ILE E  5  214 ? -11.511 -102.895 43.672  1.00 58.25  ? 214  ILE E O   1 
ATOM   8920  C  CB  . ILE E  5  214 ? -14.178 -100.961 44.406  1.00 58.06  ? 214  ILE E CB  1 
ATOM   8921  C  CG1 . ILE E  5  214 ? -14.619 -101.426 45.797  1.00 58.26  ? 214  ILE E CG1 1 
ATOM   8922  C  CG2 . ILE E  5  214 ? -14.729 -101.865 43.315  1.00 58.21  ? 214  ILE E CG2 1 
ATOM   8923  C  CD1 . ILE E  5  214 ? -16.108 -101.292 46.065  1.00 58.78  ? 214  ILE E CD1 1 
ATOM   8924  N  N   . VAL E  5  215 ? -11.917 -102.576 45.881  1.00 58.40  ? 215  VAL E N   1 
ATOM   8925  C  CA  . VAL E  5  215 ? -11.419 -103.867 46.355  1.00 58.56  ? 215  VAL E CA  1 
ATOM   8926  C  C   . VAL E  5  215 ? -12.045 -104.141 47.730  1.00 58.97  ? 215  VAL E C   1 
ATOM   8927  O  O   . VAL E  5  215 ? -12.312 -103.199 48.481  1.00 58.88  ? 215  VAL E O   1 
ATOM   8928  C  CB  . VAL E  5  215 ? -9.852  -103.887 46.426  1.00 58.47  ? 215  VAL E CB  1 
ATOM   8929  C  CG1 . VAL E  5  215 ? -9.335  -103.083 47.612  1.00 57.86  ? 215  VAL E CG1 1 
ATOM   8930  C  CG2 . VAL E  5  215 ? -9.314  -105.313 46.465  1.00 58.16  ? 215  VAL E CG2 1 
ATOM   8931  N  N   . GLY E  5  216 ? -12.296 -105.411 48.053  1.00 59.40  ? 216  GLY E N   1 
ATOM   8932  C  CA  . GLY E  5  216 ? -12.838 -105.756 49.368  1.00 60.27  ? 216  GLY E CA  1 
ATOM   8933  C  C   . GLY E  5  216 ? -13.208 -107.204 49.622  1.00 60.93  ? 216  GLY E C   1 
ATOM   8934  O  O   . GLY E  5  216 ? -12.975 -108.068 48.785  1.00 60.73  ? 216  GLY E O   1 
ATOM   8935  N  N   . LYS E  5  217 ? -13.804 -107.438 50.794  1.00 61.82  ? 217  LYS E N   1 
ATOM   8936  C  CA  . LYS E  5  217 ? -14.201 -108.763 51.299  1.00 62.71  ? 217  LYS E CA  1 
ATOM   8937  C  C   . LYS E  5  217 ? -14.343 -109.855 50.241  1.00 62.99  ? 217  LYS E C   1 
ATOM   8938  O  O   . LYS E  5  217 ? -13.593 -110.827 50.246  1.00 63.27  ? 217  LYS E O   1 
ATOM   8939  C  CB  . LYS E  5  217 ? -15.498 -108.657 52.110  1.00 62.97  ? 217  LYS E CB  1 
ATOM   8940  C  CG  . LYS E  5  217 ? -15.790 -109.867 53.002  1.00 64.25  ? 217  LYS E CG  1 
ATOM   8941  C  CD  . LYS E  5  217 ? -16.924 -109.569 53.978  1.00 65.33  ? 217  LYS E CD  1 
ATOM   8942  C  CE  . LYS E  5  217 ? -16.615 -110.129 55.363  1.00 66.14  ? 217  LYS E CE  1 
ATOM   8943  N  NZ  . LYS E  5  217 ? -17.166 -109.244 56.438  1.00 67.16  ? 217  LYS E NZ  1 
ATOM   8944  N  N   . ASP E  5  218 ? -15.307 -109.711 49.344  1.00 63.24  ? 218  ASP E N   1 
ATOM   8945  C  CA  . ASP E  5  218 ? -15.478 -110.718 48.308  1.00 63.82  ? 218  ASP E CA  1 
ATOM   8946  C  C   . ASP E  5  218 ? -15.406 -110.083 46.920  1.00 63.61  ? 218  ASP E C   1 
ATOM   8947  O  O   . ASP E  5  218 ? -16.075 -110.524 45.986  1.00 63.80  ? 218  ASP E O   1 
ATOM   8948  C  CB  . ASP E  5  218 ? -16.777 -111.523 48.528  1.00 64.30  ? 218  ASP E CB  1 
ATOM   8949  C  CG  . ASP E  5  218 ? -16.717 -112.435 49.775  1.00 65.39  ? 218  ASP E CG  1 
ATOM   8950  O  OD1 . ASP E  5  218 ? -17.619 -112.326 50.647  1.00 65.93  ? 218  ASP E OD1 1 
ATOM   8951  O  OD2 . ASP E  5  218 ? -15.770 -113.258 49.883  1.00 65.45  ? 218  ASP E OD2 1 
ATOM   8952  N  N   . THR E  5  219 ? -14.570 -109.051 46.801  1.00 63.20  ? 219  THR E N   1 
ATOM   8953  C  CA  . THR E  5  219 ? -14.414 -108.310 45.552  1.00 62.75  ? 219  THR E CA  1 
ATOM   8954  C  C   . THR E  5  219 ? -12.939 -108.070 45.217  1.00 62.26  ? 219  THR E C   1 
ATOM   8955  O  O   . THR E  5  219 ? -12.250 -107.347 45.939  1.00 61.97  ? 219  THR E O   1 
ATOM   8956  C  CB  . THR E  5  219 ? -15.123 -106.941 45.621  1.00 62.85  ? 219  THR E CB  1 
ATOM   8957  O  OG1 . THR E  5  219 ? -16.100 -106.952 46.668  1.00 62.80  ? 219  THR E OG1 1 
ATOM   8958  C  CG2 . THR E  5  219 ? -15.780 -106.598 44.276  1.00 62.94  ? 219  THR E CG2 1 
ATOM   8959  N  N   . PRO E  5  220 ? -12.449 -108.677 44.118  1.00 61.89  ? 220  PRO E N   1 
ATOM   8960  C  CA  . PRO E  5  220 ? -11.082 -108.403 43.681  1.00 61.56  ? 220  PRO E CA  1 
ATOM   8961  C  C   . PRO E  5  220 ? -10.954 -106.972 43.169  1.00 61.36  ? 220  PRO E C   1 
ATOM   8962  O  O   . PRO E  5  220 ? -11.967 -106.347 42.851  1.00 61.77  ? 220  PRO E O   1 
ATOM   8963  C  CB  . PRO E  5  220 ? -10.861 -109.413 42.549  1.00 61.42  ? 220  PRO E CB  1 
ATOM   8964  C  CG  . PRO E  5  220 ? -12.208 -109.771 42.074  1.00 61.60  ? 220  PRO E CG  1 
ATOM   8965  C  CD  . PRO E  5  220 ? -13.099 -109.702 43.280  1.00 61.91  ? 220  PRO E CD  1 
ATOM   8966  N  N   . PHE E  5  221 ? -9.724  -106.464 43.103  1.00 61.04  ? 221  PHE E N   1 
ATOM   8967  C  CA  . PHE E  5  221 ? -9.451  -105.094 42.675  1.00 60.57  ? 221  PHE E CA  1 
ATOM   8968  C  C   . PHE E  5  221 ? -9.844  -104.929 41.224  1.00 61.02  ? 221  PHE E C   1 
ATOM   8969  O  O   . PHE E  5  221 ? -9.294  -105.600 40.357  1.00 61.16  ? 221  PHE E O   1 
ATOM   8970  C  CB  . PHE E  5  221 ? -7.966  -104.763 42.870  1.00 60.07  ? 221  PHE E CB  1 
ATOM   8971  C  CG  . PHE E  5  221 ? -7.573  -103.368 42.436  1.00 58.32  ? 221  PHE E CG  1 
ATOM   8972  C  CD1 . PHE E  5  221 ? -7.289  -103.087 41.099  1.00 57.22  ? 221  PHE E CD1 1 
ATOM   8973  C  CD2 . PHE E  5  221 ? -7.455  -102.345 43.365  1.00 56.32  ? 221  PHE E CD2 1 
ATOM   8974  C  CE1 . PHE E  5  221 ? -6.919  -101.801 40.695  1.00 56.03  ? 221  PHE E CE1 1 
ATOM   8975  C  CE2 . PHE E  5  221 ? -7.088  -101.061 42.970  1.00 55.64  ? 221  PHE E CE2 1 
ATOM   8976  C  CZ  . PHE E  5  221 ? -6.813  -100.792 41.635  1.00 55.61  ? 221  PHE E CZ  1 
ATOM   8977  N  N   . THR E  5  222 ? -10.799 -104.039 40.967  1.00 61.60  ? 222  THR E N   1 
ATOM   8978  C  CA  . THR E  5  222 ? -11.267 -103.773 39.601  1.00 62.42  ? 222  THR E CA  1 
ATOM   8979  C  C   . THR E  5  222 ? -11.365 -102.276 39.262  1.00 62.56  ? 222  THR E C   1 
ATOM   8980  O  O   . THR E  5  222 ? -11.675 -101.439 40.118  1.00 62.32  ? 222  THR E O   1 
ATOM   8981  C  CB  . THR E  5  222 ? -12.607 -104.500 39.298  1.00 62.53  ? 222  THR E CB  1 
ATOM   8982  O  OG1 . THR E  5  222 ? -13.395 -104.569 40.495  1.00 63.07  ? 222  THR E OG1 1 
ATOM   8983  C  CG2 . THR E  5  222 ? -12.353 -105.937 38.797  1.00 63.21  ? 222  THR E CG2 1 
ATOM   8984  N  N   . ILE E  5  223 ? -11.080 -101.961 38.002  1.00 63.16  ? 223  ILE E N   1 
ATOM   8985  C  CA  . ILE E  5  223 ? -11.060 -100.584 37.512  1.00 63.76  ? 223  ILE E CA  1 
ATOM   8986  C  C   . ILE E  5  223 ? -12.297 -100.284 36.667  1.00 64.08  ? 223  ILE E C   1 
ATOM   8987  O  O   . ILE E  5  223 ? -12.617 -101.020 35.737  1.00 63.95  ? 223  ILE E O   1 
ATOM   8988  C  CB  . ILE E  5  223 ? -9.791  -100.298 36.665  1.00 63.65  ? 223  ILE E CB  1 
ATOM   8989  C  CG1 . ILE E  5  223 ? -8.526  -100.677 37.434  1.00 63.62  ? 223  ILE E CG1 1 
ATOM   8990  C  CG2 . ILE E  5  223 ? -9.724  -98.828  36.276  1.00 64.02  ? 223  ILE E CG2 1 
ATOM   8991  C  CD1 . ILE E  5  223 ? -7.308  -100.863 36.551  1.00 64.11  ? 223  ILE E CD1 1 
ATOM   8992  N  N   . TYR E  5  224 ? -12.979 -99.195  36.998  1.00 64.86  ? 224  TYR E N   1 
ATOM   8993  C  CA  . TYR E  5  224 ? -14.118 -98.721  36.213  1.00 65.81  ? 224  TYR E CA  1 
ATOM   8994  C  C   . TYR E  5  224 ? -13.795 -97.430  35.470  1.00 66.31  ? 224  TYR E C   1 
ATOM   8995  O  O   . TYR E  5  224 ? -13.333 -96.453  36.066  1.00 66.29  ? 224  TYR E O   1 
ATOM   8996  C  CB  . TYR E  5  224 ? -15.356 -98.518  37.098  1.00 65.65  ? 224  TYR E CB  1 
ATOM   8997  C  CG  . TYR E  5  224 ? -15.864 -99.776  37.760  1.00 66.08  ? 224  TYR E CG  1 
ATOM   8998  C  CD1 . TYR E  5  224 ? -15.960 -100.976 37.050  1.00 66.68  ? 224  TYR E CD1 1 
ATOM   8999  C  CD2 . TYR E  5  224 ? -16.270 -99.766  39.094  1.00 66.93  ? 224  TYR E CD2 1 
ATOM   9000  C  CE1 . TYR E  5  224 ? -16.434 -102.134 37.657  1.00 67.31  ? 224  TYR E CE1 1 
ATOM   9001  C  CE2 . TYR E  5  224 ? -16.749 -100.921 39.715  1.00 67.28  ? 224  TYR E CE2 1 
ATOM   9002  C  CZ  . TYR E  5  224 ? -16.827 -102.097 38.989  1.00 67.63  ? 224  TYR E CZ  1 
ATOM   9003  O  OH  . TYR E  5  224 ? -17.297 -103.239 39.593  1.00 68.81  ? 224  TYR E OH  1 
ATOM   9004  N  N   . ASP E  5  225 ? -14.042 -97.445  34.163  1.00 67.28  ? 225  ASP E N   1 
ATOM   9005  C  CA  . ASP E  5  225 ? -13.901 -96.267  33.306  1.00 68.21  ? 225  ASP E CA  1 
ATOM   9006  C  C   . ASP E  5  225 ? -15.090 -96.174  32.352  1.00 68.74  ? 225  ASP E C   1 
ATOM   9007  O  O   . ASP E  5  225 ? -15.762 -97.178  32.086  1.00 68.76  ? 225  ASP E O   1 
ATOM   9008  C  CB  . ASP E  5  225 ? -12.588 -96.321  32.505  1.00 68.25  ? 225  ASP E CB  1 
ATOM   9009  C  CG  . ASP E  5  225 ? -11.352 -96.107  33.374  1.00 68.77  ? 225  ASP E CG  1 
ATOM   9010  O  OD1 . ASP E  5  225 ? -11.358 -95.201  34.241  1.00 68.50  ? 225  ASP E OD1 1 
ATOM   9011  O  OD2 . ASP E  5  225 ? -10.360 -96.843  33.175  1.00 69.77  ? 225  ASP E OD2 1 
ATOM   9012  N  N   . GLY E  5  226 ? -15.338 -94.964  31.849  1.00 69.39  ? 226  GLY E N   1 
ATOM   9013  C  CA  . GLY E  5  226 ? -16.402 -94.700  30.880  1.00 70.18  ? 226  GLY E CA  1 
ATOM   9014  C  C   . GLY E  5  226 ? -17.821 -94.997  31.350  1.00 70.85  ? 226  GLY E C   1 
ATOM   9015  O  O   . GLY E  5  226 ? -18.178 -94.773  32.515  1.00 70.59  ? 226  GLY E O   1 
ATOM   9016  N  N   . GLU E  5  227 ? -18.620 -95.506  30.415  1.00 71.51  ? 227  GLU E N   1 
ATOM   9017  C  CA  . GLU E  5  227 ? -20.020 -95.890  30.629  1.00 72.40  ? 227  GLU E CA  1 
ATOM   9018  C  C   . GLU E  5  227 ? -20.206 -96.551  31.986  1.00 72.39  ? 227  GLU E C   1 
ATOM   9019  O  O   . GLU E  5  227 ? -21.206 -96.330  32.671  1.00 72.37  ? 227  GLU E O   1 
ATOM   9020  C  CB  . GLU E  5  227 ? -20.484 -96.865  29.530  1.00 72.65  ? 227  GLU E CB  1 
ATOM   9021  C  CG  . GLU E  5  227 ? -19.794 -96.702  28.143  1.00 74.67  ? 227  GLU E CG  1 
ATOM   9022  C  CD  . GLU E  5  227 ? -18.286 -97.072  28.130  1.00 76.44  ? 227  GLU E CD  1 
ATOM   9023  O  OE1 . GLU E  5  227 ? -17.843 -97.919  28.945  1.00 77.32  ? 227  GLU E OE1 1 
ATOM   9024  O  OE2 . GLU E  5  227 ? -17.542 -96.505  27.296  1.00 76.61  ? 227  GLU E OE2 1 
ATOM   9025  N  N   . ALA E  5  228 ? -19.215 -97.353  32.365  1.00 72.55  ? 228  ALA E N   1 
ATOM   9026  C  CA  . ALA E  5  228 ? -19.261 -98.128  33.588  1.00 72.77  ? 228  ALA E CA  1 
ATOM   9027  C  C   . ALA E  5  228 ? -19.252 -97.273  34.859  1.00 72.99  ? 228  ALA E C   1 
ATOM   9028  O  O   . ALA E  5  228 ? -19.517 -97.792  35.946  1.00 72.95  ? 228  ALA E O   1 
ATOM   9029  C  CB  . ALA E  5  228 ? -18.132 -99.147  33.601  1.00 72.66  ? 228  ALA E CB  1 
ATOM   9030  N  N   . VAL E  5  229 ? -18.968 -95.973  34.724  1.00 73.23  ? 229  VAL E N   1 
ATOM   9031  C  CA  . VAL E  5  229 ? -19.012 -95.056  35.878  1.00 73.76  ? 229  VAL E CA  1 
ATOM   9032  C  C   . VAL E  5  229 ? -20.208 -94.096  35.882  1.00 74.05  ? 229  VAL E C   1 
ATOM   9033  O  O   . VAL E  5  229 ? -20.438 -93.391  36.872  1.00 74.14  ? 229  VAL E O   1 
ATOM   9034  C  CB  . VAL E  5  229 ? -17.686 -94.244  36.084  1.00 73.72  ? 229  VAL E CB  1 
ATOM   9035  C  CG1 . VAL E  5  229 ? -16.485 -95.155  36.042  1.00 73.87  ? 229  VAL E CG1 1 
ATOM   9036  C  CG2 . VAL E  5  229 ? -17.546 -93.107  35.074  1.00 73.48  ? 229  VAL E CG2 1 
ATOM   9037  N  N   . ALA E  5  230 ? -20.965 -94.085  34.788  1.00 74.48  ? 230  ALA E N   1 
ATOM   9038  C  CA  . ALA E  5  230 ? -22.075 -93.143  34.602  1.00 74.85  ? 230  ALA E CA  1 
ATOM   9039  C  C   . ALA E  5  230 ? -23.027 -93.058  35.794  1.00 75.14  ? 230  ALA E C   1 
ATOM   9040  O  O   . ALA E  5  230 ? -23.497 -91.971  36.135  1.00 75.14  ? 230  ALA E O   1 
ATOM   9041  C  CB  . ALA E  5  230 ? -22.845 -93.472  33.330  1.00 74.80  ? 230  ALA E CB  1 
ATOM   9042  N  N   . LYS E  5  231 ? -23.289 -94.194  36.436  1.00 75.55  ? 231  LYS E N   1 
ATOM   9043  C  CA  . LYS E  5  231 ? -24.276 -94.244  37.515  1.00 76.19  ? 231  LYS E CA  1 
ATOM   9044  C  C   . LYS E  5  231 ? -23.872 -93.522  38.815  1.00 76.46  ? 231  LYS E C   1 
ATOM   9045  O  O   . LYS E  5  231 ? -24.642 -93.499  39.773  1.00 76.60  ? 231  LYS E O   1 
ATOM   9046  C  CB  . LYS E  5  231 ? -24.738 -95.693  37.789  1.00 76.30  ? 231  LYS E CB  1 
ATOM   9047  C  CG  . LYS E  5  231 ? -23.747 -96.588  38.538  1.00 76.73  ? 231  LYS E CG  1 
ATOM   9048  C  CD  . LYS E  5  231 ? -22.890 -97.421  37.587  1.00 77.28  ? 231  LYS E CD  1 
ATOM   9049  C  CE  . LYS E  5  231 ? -23.294 -98.891  37.587  1.00 77.71  ? 231  LYS E CE  1 
ATOM   9050  N  NZ  . LYS E  5  231 ? -22.567 -99.651  36.527  1.00 77.08  ? 231  LYS E NZ  1 
ATOM   9051  N  N   . TYR E  5  232 ? -22.690 -92.914  38.843  1.00 76.92  ? 232  TYR E N   1 
ATOM   9052  C  CA  . TYR E  5  232 ? -22.235 -92.199  40.046  1.00 77.36  ? 232  TYR E CA  1 
ATOM   9053  C  C   . TYR E  5  232 ? -22.128 -90.694  39.842  1.00 77.69  ? 232  TYR E C   1 
ATOM   9054  O  O   . TYR E  5  232 ? -21.935 -89.943  40.804  1.00 77.54  ? 232  TYR E O   1 
ATOM   9055  C  CB  . TYR E  5  232 ? -20.899 -92.755  40.543  1.00 77.31  ? 232  TYR E CB  1 
ATOM   9056  C  CG  . TYR E  5  232 ? -20.866 -94.259  40.650  1.00 77.55  ? 232  TYR E CG  1 
ATOM   9057  C  CD1 . TYR E  5  232 ? -20.314 -95.032  39.630  1.00 77.43  ? 232  TYR E CD1 1 
ATOM   9058  C  CD2 . TYR E  5  232 ? -21.394 -94.910  41.769  1.00 77.95  ? 232  TYR E CD2 1 
ATOM   9059  C  CE1 . TYR E  5  232 ? -20.280 -96.414  39.720  1.00 78.22  ? 232  TYR E CE1 1 
ATOM   9060  C  CE2 . TYR E  5  232 ? -21.366 -96.299  41.870  1.00 78.21  ? 232  TYR E CE2 1 
ATOM   9061  C  CZ  . TYR E  5  232 ? -20.810 -97.043  40.841  1.00 78.54  ? 232  TYR E CZ  1 
ATOM   9062  O  OH  . TYR E  5  232 ? -20.777 -98.419  40.922  1.00 79.52  ? 232  TYR E OH  1 
ATOM   9063  N  N   . ILE E  5  233 ? -22.250 -90.264  38.587  1.00 78.27  ? 233  ILE E N   1 
ATOM   9064  C  CA  . ILE E  5  233 ? -22.249 -88.845  38.233  1.00 78.77  ? 233  ILE E CA  1 
ATOM   9065  C  C   . ILE E  5  233 ? -23.419 -88.105  38.901  1.00 79.04  ? 233  ILE E C   1 
ATOM   9066  O  O   . ILE E  5  233 ? -24.578 -88.528  38.817  1.00 79.08  ? 233  ILE E O   1 
ATOM   9067  C  CB  . ILE E  5  233 ? -22.257 -88.652  36.691  1.00 78.85  ? 233  ILE E CB  1 
ATOM   9068  C  CG1 . ILE E  5  233 ? -20.854 -88.917  36.131  1.00 78.66  ? 233  ILE E CG1 1 
ATOM   9069  C  CG2 . ILE E  5  233 ? -22.774 -87.245  36.298  1.00 78.83  ? 233  ILE E CG2 1 
ATOM   9070  C  CD1 . ILE E  5  233 ? -20.790 -89.055  34.613  1.00 78.96  ? 233  ILE E CD1 1 
ATOM   9071  O  OXT . ILE E  5  233 ? -23.216 -87.074  39.558  1.00 79.20  ? 233  ILE E OXT 1 
ATOM   9072  N  N   . GLY F  6  1   ? 32.542  -71.746  50.058  1.00 107.61 ? 7    GLY F N   1 
ATOM   9073  C  CA  . GLY F  6  1   ? 31.427  -72.743  50.010  1.00 107.66 ? 7    GLY F CA  1 
ATOM   9074  C  C   . GLY F  6  1   ? 31.877  -74.131  50.437  1.00 107.68 ? 7    GLY F C   1 
ATOM   9075  O  O   . GLY F  6  1   ? 31.722  -75.100  49.677  1.00 107.75 ? 7    GLY F O   1 
ATOM   9076  N  N   . TYR F  6  2   ? 32.413  -74.220  51.663  1.00 107.54 ? 8    TYR F N   1 
ATOM   9077  C  CA  . TYR F  6  2   ? 32.958  -75.472  52.249  1.00 107.29 ? 8    TYR F CA  1 
ATOM   9078  C  C   . TYR F  6  2   ? 31.901  -76.546  52.582  1.00 106.67 ? 8    TYR F C   1 
ATOM   9079  O  O   . TYR F  6  2   ? 32.241  -77.630  53.076  1.00 106.72 ? 8    TYR F O   1 
ATOM   9080  C  CB  . TYR F  6  2   ? 33.780  -75.166  53.516  1.00 107.51 ? 8    TYR F CB  1 
ATOM   9081  C  CG  . TYR F  6  2   ? 34.983  -74.264  53.304  1.00 108.63 ? 8    TYR F CG  1 
ATOM   9082  C  CD1 . TYR F  6  2   ? 36.185  -74.776  52.795  1.00 109.13 ? 8    TYR F CD1 1 
ATOM   9083  C  CD2 . TYR F  6  2   ? 34.928  -72.897  53.631  1.00 109.28 ? 8    TYR F CD2 1 
ATOM   9084  C  CE1 . TYR F  6  2   ? 37.300  -73.949  52.605  1.00 109.61 ? 8    TYR F CE1 1 
ATOM   9085  C  CE2 . TYR F  6  2   ? 36.039  -72.059  53.445  1.00 109.60 ? 8    TYR F CE2 1 
ATOM   9086  C  CZ  . TYR F  6  2   ? 37.221  -72.595  52.931  1.00 109.99 ? 8    TYR F CZ  1 
ATOM   9087  O  OH  . TYR F  6  2   ? 38.324  -71.786  52.742  1.00 110.31 ? 8    TYR F OH  1 
ATOM   9088  N  N   . ASP F  6  3   ? 30.631  -76.236  52.305  1.00 105.80 ? 9    ASP F N   1 
ATOM   9089  C  CA  . ASP F  6  3   ? 29.486  -77.101  52.650  1.00 104.66 ? 9    ASP F CA  1 
ATOM   9090  C  C   . ASP F  6  3   ? 28.678  -77.648  51.440  1.00 103.65 ? 9    ASP F C   1 
ATOM   9091  O  O   . ASP F  6  3   ? 27.479  -77.940  51.565  1.00 103.64 ? 9    ASP F O   1 
ATOM   9092  C  CB  . ASP F  6  3   ? 28.564  -76.405  53.684  1.00 104.80 ? 9    ASP F CB  1 
ATOM   9093  C  CG  . ASP F  6  3   ? 28.430  -74.883  53.463  1.00 105.02 ? 9    ASP F CG  1 
ATOM   9094  O  OD1 . ASP F  6  3   ? 29.455  -74.179  53.274  1.00 105.25 ? 9    ASP F OD1 1 
ATOM   9095  O  OD2 . ASP F  6  3   ? 27.284  -74.385  53.514  1.00 104.97 ? 9    ASP F OD2 1 
ATOM   9096  N  N   . LEU F  6  4   ? 29.348  -77.798  50.289  1.00 102.16 ? 10   LEU F N   1 
ATOM   9097  C  CA  . LEU F  6  4   ? 28.738  -78.352  49.059  1.00 100.42 ? 10   LEU F CA  1 
ATOM   9098  C  C   . LEU F  6  4   ? 28.902  -79.889  48.938  1.00 98.84  ? 10   LEU F C   1 
ATOM   9099  O  O   . LEU F  6  4   ? 28.015  -80.568  48.404  1.00 98.81  ? 10   LEU F O   1 
ATOM   9100  C  CB  . LEU F  6  4   ? 29.279  -77.638  47.798  1.00 100.71 ? 10   LEU F CB  1 
ATOM   9101  C  CG  . LEU F  6  4   ? 29.210  -76.101  47.689  1.00 100.94 ? 10   LEU F CG  1 
ATOM   9102  C  CD1 . LEU F  6  4   ? 30.100  -75.588  46.551  1.00 100.75 ? 10   LEU F CD1 1 
ATOM   9103  C  CD2 . LEU F  6  4   ? 27.771  -75.582  47.540  1.00 100.98 ? 10   LEU F CD2 1 
ATOM   9104  N  N   . SER F  6  5   ? 30.031  -80.419  49.435  1.00 96.59  ? 11   SER F N   1 
ATOM   9105  C  CA  . SER F  6  5   ? 30.311  -81.877  49.472  1.00 94.16  ? 11   SER F CA  1 
ATOM   9106  C  C   . SER F  6  5   ? 30.475  -82.399  50.923  1.00 92.19  ? 11   SER F C   1 
ATOM   9107  O  O   . SER F  6  5   ? 30.860  -81.640  51.822  1.00 92.11  ? 11   SER F O   1 
ATOM   9108  C  CB  . SER F  6  5   ? 31.560  -82.228  48.636  1.00 94.35  ? 11   SER F CB  1 
ATOM   9109  O  OG  . SER F  6  5   ? 31.698  -81.409  47.480  1.00 94.24  ? 11   SER F OG  1 
ATOM   9110  N  N   . ASN F  6  6   ? 30.194  -83.688  51.140  1.00 89.48  ? 12   ASN F N   1 
ATOM   9111  C  CA  . ASN F  6  6   ? 30.197  -84.285  52.495  1.00 86.85  ? 12   ASN F CA  1 
ATOM   9112  C  C   . ASN F  6  6   ? 31.592  -84.545  53.107  1.00 84.54  ? 12   ASN F C   1 
ATOM   9113  O  O   . ASN F  6  6   ? 31.913  -84.044  54.196  1.00 84.53  ? 12   ASN F O   1 
ATOM   9114  C  CB  . ASN F  6  6   ? 29.315  -85.556  52.530  1.00 87.15  ? 12   ASN F CB  1 
ATOM   9115  C  CG  . ASN F  6  6   ? 29.729  -86.564  53.634  1.00 87.81  ? 12   ASN F CG  1 
ATOM   9116  O  OD1 . ASN F  6  6   ? 30.262  -86.192  54.695  1.00 87.09  ? 12   ASN F OD1 1 
ATOM   9117  N  ND2 . ASN F  6  6   ? 29.472  -87.854  53.371  1.00 87.70  ? 12   ASN F ND2 1 
ATOM   9118  N  N   . SER F  6  7   ? 32.399  -85.337  52.406  1.00 81.09  ? 13   SER F N   1 
ATOM   9119  C  CA  . SER F  6  7   ? 33.756  -85.649  52.815  1.00 77.60  ? 13   SER F CA  1 
ATOM   9120  C  C   . SER F  6  7   ? 34.684  -84.422  52.906  1.00 74.98  ? 13   SER F C   1 
ATOM   9121  O  O   . SER F  6  7   ? 35.908  -84.564  52.887  1.00 75.11  ? 13   SER F O   1 
ATOM   9122  C  CB  . SER F  6  7   ? 34.337  -86.653  51.823  1.00 77.97  ? 13   SER F CB  1 
ATOM   9123  O  OG  . SER F  6  7   ? 34.306  -86.130  50.503  1.00 78.28  ? 13   SER F OG  1 
ATOM   9124  N  N   . VAL F  6  8   ? 34.111  -83.224  52.999  1.00 71.28  ? 14   VAL F N   1 
ATOM   9125  C  CA  . VAL F  6  8   ? 34.904  -82.005  53.107  1.00 67.65  ? 14   VAL F CA  1 
ATOM   9126  C  C   . VAL F  6  8   ? 35.031  -81.574  54.568  1.00 65.15  ? 14   VAL F C   1 
ATOM   9127  O  O   . VAL F  6  8   ? 34.035  -81.409  55.271  1.00 64.42  ? 14   VAL F O   1 
ATOM   9128  C  CB  . VAL F  6  8   ? 34.312  -80.844  52.238  1.00 67.82  ? 14   VAL F CB  1 
ATOM   9129  C  CG1 . VAL F  6  8   ? 35.164  -79.583  52.329  1.00 67.33  ? 14   VAL F CG1 1 
ATOM   9130  C  CG2 . VAL F  6  8   ? 34.191  -81.262  50.789  1.00 67.69  ? 14   VAL F CG2 1 
ATOM   9131  N  N   . PHE F  6  9   ? 36.272  -81.418  55.014  1.00 62.33  ? 15   PHE F N   1 
ATOM   9132  C  CA  . PHE F  6  9   ? 36.568  -80.742  56.271  1.00 59.65  ? 15   PHE F CA  1 
ATOM   9133  C  C   . PHE F  6  9   ? 36.559  -79.232  56.045  1.00 58.42  ? 15   PHE F C   1 
ATOM   9134  O  O   . PHE F  6  9   ? 37.127  -78.753  55.061  1.00 58.09  ? 15   PHE F O   1 
ATOM   9135  C  CB  . PHE F  6  9   ? 37.961  -81.120  56.765  1.00 59.10  ? 15   PHE F CB  1 
ATOM   9136  C  CG  . PHE F  6  9   ? 38.044  -82.449  57.439  1.00 57.07  ? 15   PHE F CG  1 
ATOM   9137  C  CD1 . PHE F  6  9   ? 37.380  -82.683  58.639  1.00 55.43  ? 15   PHE F CD1 1 
ATOM   9138  C  CD2 . PHE F  6  9   ? 38.832  -83.463  56.898  1.00 55.09  ? 15   PHE F CD2 1 
ATOM   9139  C  CE1 . PHE F  6  9   ? 37.479  -83.920  59.278  1.00 54.07  ? 15   PHE F CE1 1 
ATOM   9140  C  CE2 . PHE F  6  9   ? 38.936  -84.692  57.528  1.00 53.57  ? 15   PHE F CE2 1 
ATOM   9141  C  CZ  . PHE F  6  9   ? 38.260  -84.922  58.719  1.00 53.14  ? 15   PHE F CZ  1 
ATOM   9142  N  N   . SER F  6  10  ? 35.937  -78.489  56.957  1.00 56.79  ? 16   SER F N   1 
ATOM   9143  C  CA  . SER F  6  10  ? 36.047  -77.029  56.975  1.00 55.72  ? 16   SER F CA  1 
ATOM   9144  C  C   . SER F  6  10  ? 37.430  -76.635  57.493  1.00 55.16  ? 16   SER F C   1 
ATOM   9145  O  O   . SER F  6  10  ? 38.106  -77.458  58.089  1.00 54.88  ? 16   SER F O   1 
ATOM   9146  C  CB  . SER F  6  10  ? 34.959  -76.428  57.861  1.00 55.59  ? 16   SER F CB  1 
ATOM   9147  O  OG  . SER F  6  10  ? 35.289  -76.516  59.240  1.00 55.03  ? 16   SER F OG  1 
ATOM   9148  N  N   . PRO F  6  11  ? 37.859  -75.373  57.285  1.00 54.93  ? 17   PRO F N   1 
ATOM   9149  C  CA  . PRO F  6  11  ? 39.179  -74.981  57.802  1.00 54.70  ? 17   PRO F CA  1 
ATOM   9150  C  C   . PRO F  6  11  ? 39.390  -75.210  59.290  1.00 54.44  ? 17   PRO F C   1 
ATOM   9151  O  O   . PRO F  6  11  ? 40.526  -75.347  59.719  1.00 54.18  ? 17   PRO F O   1 
ATOM   9152  C  CB  . PRO F  6  11  ? 39.248  -73.495  57.471  1.00 54.51  ? 17   PRO F CB  1 
ATOM   9153  C  CG  . PRO F  6  11  ? 38.479  -73.394  56.218  1.00 54.24  ? 17   PRO F CG  1 
ATOM   9154  C  CD  . PRO F  6  11  ? 37.301  -74.316  56.424  1.00 54.81  ? 17   PRO F CD  1 
ATOM   9155  N  N   . ASP F  6  12  ? 38.309  -75.280  60.058  1.00 54.79  ? 18   ASP F N   1 
ATOM   9156  C  CA  . ASP F  6  12  ? 38.406  -75.538  61.505  1.00 55.52  ? 18   ASP F CA  1 
ATOM   9157  C  C   . ASP F  6  12  ? 38.281  -77.022  61.892  1.00 54.86  ? 18   ASP F C   1 
ATOM   9158  O  O   . ASP F  6  12  ? 38.287  -77.372  63.075  1.00 54.95  ? 18   ASP F O   1 
ATOM   9159  C  CB  . ASP F  6  12  ? 37.464  -74.623  62.340  1.00 56.22  ? 18   ASP F CB  1 
ATOM   9160  C  CG  . ASP F  6  12  ? 36.159  -74.212  61.592  1.00 59.96  ? 18   ASP F CG  1 
ATOM   9161  O  OD1 . ASP F  6  12  ? 35.158  -73.905  62.294  1.00 61.92  ? 18   ASP F OD1 1 
ATOM   9162  O  OD2 . ASP F  6  12  ? 36.123  -74.172  60.324  1.00 63.25  ? 18   ASP F OD2 1 
ATOM   9163  N  N   . GLY F  6  13  ? 38.194  -77.892  60.884  1.00 54.04  ? 19   GLY F N   1 
ATOM   9164  C  CA  . GLY F  6  13  ? 38.163  -79.337  61.092  1.00 52.51  ? 19   GLY F CA  1 
ATOM   9165  C  C   . GLY F  6  13  ? 36.769  -79.889  61.306  1.00 51.87  ? 19   GLY F C   1 
ATOM   9166  O  O   . GLY F  6  13  ? 36.596  -80.960  61.897  1.00 52.17  ? 19   GLY F O   1 
ATOM   9167  N  N   . ARG F  6  14  ? 35.767  -79.161  60.833  1.00 50.88  ? 20   ARG F N   1 
ATOM   9168  C  CA  . ARG F  6  14  ? 34.385  -79.578  61.004  1.00 50.03  ? 20   ARG F CA  1 
ATOM   9169  C  C   . ARG F  6  14  ? 33.835  -80.130  59.707  1.00 49.29  ? 20   ARG F C   1 
ATOM   9170  O  O   . ARG F  6  14  ? 34.451  -79.993  58.650  1.00 49.41  ? 20   ARG F O   1 
ATOM   9171  C  CB  . ARG F  6  14  ? 33.521  -78.411  61.483  1.00 50.30  ? 20   ARG F CB  1 
ATOM   9172  C  CG  . ARG F  6  14  ? 33.832  -77.951  62.904  1.00 50.80  ? 20   ARG F CG  1 
ATOM   9173  C  CD  . ARG F  6  14  ? 33.492  -76.490  63.100  1.00 50.60  ? 20   ARG F CD  1 
ATOM   9174  N  NE  . ARG F  6  14  ? 32.052  -76.280  63.117  1.00 51.84  ? 20   ARG F NE  1 
ATOM   9175  C  CZ  . ARG F  6  14  ? 31.466  -75.096  62.983  1.00 52.52  ? 20   ARG F CZ  1 
ATOM   9176  N  NH1 . ARG F  6  14  ? 32.196  -74.004  62.808  1.00 53.60  ? 20   ARG F NH1 1 
ATOM   9177  N  NH2 . ARG F  6  14  ? 30.145  -75.007  63.010  1.00 52.08  ? 20   ARG F NH2 1 
ATOM   9178  N  N   . ASN F  6  15  ? 32.678  -80.768  59.804  1.00 48.24  ? 21   ASN F N   1 
ATOM   9179  C  CA  . ASN F  6  15  ? 31.994  -81.305  58.657  1.00 47.29  ? 21   ASN F CA  1 
ATOM   9180  C  C   . ASN F  6  15  ? 30.616  -80.682  58.657  1.00 46.58  ? 21   ASN F C   1 
ATOM   9181  O  O   . ASN F  6  15  ? 29.747  -81.067  59.441  1.00 46.27  ? 21   ASN F O   1 
ATOM   9182  C  CB  . ASN F  6  15  ? 31.923  -82.836  58.737  1.00 47.32  ? 21   ASN F CB  1 
ATOM   9183  C  CG  . ASN F  6  15  ? 31.411  -83.464  57.454  1.00 48.31  ? 21   ASN F CG  1 
ATOM   9184  O  OD1 . ASN F  6  15  ? 30.329  -83.120  56.965  1.00 49.70  ? 21   ASN F OD1 1 
ATOM   9185  N  ND2 . ASN F  6  15  ? 32.193  -84.383  56.890  1.00 49.32  ? 21   ASN F ND2 1 
ATOM   9186  N  N   . PHE F  6  16  ? 30.429  -79.698  57.787  1.00 45.96  ? 22   PHE F N   1 
ATOM   9187  C  CA  . PHE F  6  16  ? 29.201  -78.907  57.786  1.00 45.37  ? 22   PHE F CA  1 
ATOM   9188  C  C   . PHE F  6  16  ? 27.996  -79.722  57.366  1.00 44.23  ? 22   PHE F C   1 
ATOM   9189  O  O   . PHE F  6  16  ? 26.893  -79.517  57.882  1.00 43.82  ? 22   PHE F O   1 
ATOM   9190  C  CB  . PHE F  6  16  ? 29.337  -77.659  56.907  1.00 45.91  ? 22   PHE F CB  1 
ATOM   9191  C  CG  . PHE F  6  16  ? 29.940  -76.475  57.614  1.00 47.98  ? 22   PHE F CG  1 
ATOM   9192  C  CD1 . PHE F  6  16  ? 29.146  -75.637  58.399  1.00 50.81  ? 22   PHE F CD1 1 
ATOM   9193  C  CD2 . PHE F  6  16  ? 31.295  -76.183  57.484  1.00 49.76  ? 22   PHE F CD2 1 
ATOM   9194  C  CE1 . PHE F  6  16  ? 29.704  -74.535  59.052  1.00 52.41  ? 22   PHE F CE1 1 
ATOM   9195  C  CE2 . PHE F  6  16  ? 31.860  -75.089  58.128  1.00 49.96  ? 22   PHE F CE2 1 
ATOM   9196  C  CZ  . PHE F  6  16  ? 31.074  -74.267  58.908  1.00 51.94  ? 22   PHE F CZ  1 
ATOM   9197  N  N   . GLN F  6  17  ? 28.213  -80.655  56.445  1.00 43.35  ? 23   GLN F N   1 
ATOM   9198  C  CA  . GLN F  6  17  ? 27.142  -81.530  55.982  1.00 42.73  ? 23   GLN F CA  1 
ATOM   9199  C  C   . GLN F  6  17  ? 26.549  -82.376  57.114  1.00 42.11  ? 23   GLN F C   1 
ATOM   9200  O  O   . GLN F  6  17  ? 25.337  -82.562  57.194  1.00 42.25  ? 23   GLN F O   1 
ATOM   9201  C  CB  . GLN F  6  17  ? 27.620  -82.403  54.822  1.00 42.89  ? 23   GLN F CB  1 
ATOM   9202  C  CG  . GLN F  6  17  ? 27.457  -81.749  53.458  1.00 43.03  ? 23   GLN F CG  1 
ATOM   9203  C  CD  . GLN F  6  17  ? 25.995  -81.502  53.108  1.00 45.59  ? 23   GLN F CD  1 
ATOM   9204  O  OE1 . GLN F  6  17  ? 25.603  -80.376  52.767  1.00 46.08  ? 23   GLN F OE1 1 
ATOM   9205  N  NE2 . GLN F  6  17  ? 25.176  -82.548  53.206  1.00 45.09  ? 23   GLN F NE2 1 
ATOM   9206  N  N   . VAL F  6  18  ? 27.399  -82.860  58.006  1.00 41.51  ? 24   VAL F N   1 
ATOM   9207  C  CA  . VAL F  6  18  ? 26.925  -83.622  59.151  1.00 41.17  ? 24   VAL F CA  1 
ATOM   9208  C  C   . VAL F  6  18  ? 26.157  -82.710  60.108  1.00 41.36  ? 24   VAL F C   1 
ATOM   9209  O  O   . VAL F  6  18  ? 25.084  -83.067  60.617  1.00 41.09  ? 24   VAL F O   1 
ATOM   9210  C  CB  . VAL F  6  18  ? 28.085  -84.340  59.862  1.00 40.94  ? 24   VAL F CB  1 
ATOM   9211  C  CG1 . VAL F  6  18  ? 27.603  -84.988  61.137  1.00 40.78  ? 24   VAL F CG1 1 
ATOM   9212  C  CG2 . VAL F  6  18  ? 28.689  -85.379  58.944  1.00 40.08  ? 24   VAL F CG2 1 
ATOM   9213  N  N   . GLU F  6  19  ? 26.707  -81.516  60.322  1.00 41.50  ? 25   GLU F N   1 
ATOM   9214  C  CA  . GLU F  6  19  ? 26.079  -80.516  61.164  1.00 41.46  ? 25   GLU F CA  1 
ATOM   9215  C  C   . GLU F  6  19  ? 24.707  -80.149  60.632  1.00 41.22  ? 25   GLU F C   1 
ATOM   9216  O  O   . GLU F  6  19  ? 23.797  -79.884  61.419  1.00 41.56  ? 25   GLU F O   1 
ATOM   9217  C  CB  . GLU F  6  19  ? 26.958  -79.279  61.286  1.00 41.41  ? 25   GLU F CB  1 
ATOM   9218  C  CG  . GLU F  6  19  ? 28.164  -79.471  62.185  1.00 42.98  ? 25   GLU F CG  1 
ATOM   9219  C  CD  . GLU F  6  19  ? 29.021  -78.214  62.294  1.00 45.37  ? 25   GLU F CD  1 
ATOM   9220  O  OE1 . GLU F  6  19  ? 28.482  -77.115  62.026  1.00 47.10  ? 25   GLU F OE1 1 
ATOM   9221  O  OE2 . GLU F  6  19  ? 30.227  -78.320  62.647  1.00 45.20  ? 25   GLU F OE2 1 
ATOM   9222  N  N   . TYR F  6  20  ? 24.556  -80.142  59.310  1.00 40.69  ? 26   TYR F N   1 
ATOM   9223  C  CA  . TYR F  6  20  ? 23.248  -79.867  58.703  1.00 40.66  ? 26   TYR F CA  1 
ATOM   9224  C  C   . TYR F  6  20  ? 22.323  -81.062  58.819  1.00 40.32  ? 26   TYR F C   1 
ATOM   9225  O  O   . TYR F  6  20  ? 21.117  -80.904  58.971  1.00 40.29  ? 26   TYR F O   1 
ATOM   9226  C  CB  . TYR F  6  20  ? 23.361  -79.443  57.232  1.00 40.70  ? 26   TYR F CB  1 
ATOM   9227  C  CG  . TYR F  6  20  ? 24.206  -78.209  56.970  1.00 40.95  ? 26   TYR F CG  1 
ATOM   9228  C  CD1 . TYR F  6  20  ? 24.471  -77.274  57.983  1.00 41.21  ? 26   TYR F CD1 1 
ATOM   9229  C  CD2 . TYR F  6  20  ? 24.731  -77.964  55.700  1.00 40.24  ? 26   TYR F CD2 1 
ATOM   9230  C  CE1 . TYR F  6  20  ? 25.254  -76.149  57.733  1.00 40.50  ? 26   TYR F CE1 1 
ATOM   9231  C  CE2 . TYR F  6  20  ? 25.497  -76.842  55.443  1.00 39.45  ? 26   TYR F CE2 1 
ATOM   9232  C  CZ  . TYR F  6  20  ? 25.759  -75.942  56.460  1.00 40.29  ? 26   TYR F CZ  1 
ATOM   9233  O  OH  . TYR F  6  20  ? 26.525  -74.827  56.203  1.00 40.72  ? 26   TYR F OH  1 
ATOM   9234  N  N   . ALA F  6  21  ? 22.891  -82.262  58.745  1.00 40.43  ? 27   ALA F N   1 
ATOM   9235  C  CA  . ALA F  6  21  ? 22.124  -83.489  58.975  1.00 40.03  ? 27   ALA F CA  1 
ATOM   9236  C  C   . ALA F  6  21  ? 21.458  -83.475  60.360  1.00 39.77  ? 27   ALA F C   1 
ATOM   9237  O  O   . ALA F  6  21  ? 20.314  -83.892  60.505  1.00 39.67  ? 27   ALA F O   1 
ATOM   9238  C  CB  . ALA F  6  21  ? 23.013  -84.697  58.799  1.00 39.83  ? 27   ALA F CB  1 
ATOM   9239  N  N   . VAL F  6  22  ? 22.169  -82.950  61.359  1.00 39.81  ? 28   VAL F N   1 
ATOM   9240  C  CA  . VAL F  6  22  ? 21.651  -82.828  62.727  1.00 39.94  ? 28   VAL F CA  1 
ATOM   9241  C  C   . VAL F  6  22  ? 20.406  -81.947  62.811  1.00 40.58  ? 28   VAL F C   1 
ATOM   9242  O  O   . VAL F  6  22  ? 19.494  -82.212  63.598  1.00 40.22  ? 28   VAL F O   1 
ATOM   9243  C  CB  . VAL F  6  22  ? 22.730  -82.283  63.671  1.00 39.74  ? 28   VAL F CB  1 
ATOM   9244  C  CG1 . VAL F  6  22  ? 22.189  -82.115  65.083  1.00 38.92  ? 28   VAL F CG1 1 
ATOM   9245  C  CG2 . VAL F  6  22  ? 23.931  -83.210  63.670  1.00 39.52  ? 28   VAL F CG2 1 
ATOM   9246  N  N   . LYS F  6  23  ? 20.375  -80.903  61.987  1.00 41.48  ? 29   LYS F N   1 
ATOM   9247  C  CA  . LYS F  6  23  ? 19.228  -80.010  61.928  1.00 42.55  ? 29   LYS F CA  1 
ATOM   9248  C  C   . LYS F  6  23  ? 17.974  -80.762  61.524  1.00 42.88  ? 29   LYS F C   1 
ATOM   9249  O  O   . LYS F  6  23  ? 16.888  -80.472  62.034  1.00 43.19  ? 29   LYS F O   1 
ATOM   9250  C  CB  . LYS F  6  23  ? 19.483  -78.838  60.975  1.00 42.88  ? 29   LYS F CB  1 
ATOM   9251  C  CG  . LYS F  6  23  ? 20.596  -77.897  61.431  1.00 44.22  ? 29   LYS F CG  1 
ATOM   9252  C  CD  . LYS F  6  23  ? 20.209  -77.204  62.729  1.00 48.01  ? 29   LYS F CD  1 
ATOM   9253  C  CE  . LYS F  6  23  ? 21.243  -76.187  63.154  1.00 50.15  ? 29   LYS F CE  1 
ATOM   9254  N  NZ  . LYS F  6  23  ? 20.669  -75.277  64.182  1.00 50.97  ? 29   LYS F NZ  1 
ATOM   9255  N  N   . ALA F  6  24  ? 18.120  -81.736  60.626  1.00 43.34  ? 30   ALA F N   1 
ATOM   9256  C  CA  . ALA F  6  24  ? 16.978  -82.564  60.216  1.00 43.68  ? 30   ALA F CA  1 
ATOM   9257  C  C   . ALA F  6  24  ? 16.454  -83.352  61.410  1.00 44.07  ? 30   ALA F C   1 
ATOM   9258  O  O   . ALA F  6  24  ? 15.246  -83.522  61.564  1.00 43.97  ? 30   ALA F O   1 
ATOM   9259  C  CB  . ALA F  6  24  ? 17.350  -83.492  59.074  1.00 43.25  ? 30   ALA F CB  1 
ATOM   9260  N  N   . VAL F  6  25  ? 17.374  -83.805  62.261  1.00 44.55  ? 31   VAL F N   1 
ATOM   9261  C  CA  . VAL F  6  25  ? 17.022  -84.567  63.459  1.00 45.18  ? 31   VAL F CA  1 
ATOM   9262  C  C   . VAL F  6  25  ? 16.290  -83.697  64.475  1.00 46.00  ? 31   VAL F C   1 
ATOM   9263  O  O   . VAL F  6  25  ? 15.193  -84.045  64.923  1.00 46.27  ? 31   VAL F O   1 
ATOM   9264  C  CB  . VAL F  6  25  ? 18.267  -85.192  64.125  1.00 44.95  ? 31   VAL F CB  1 
ATOM   9265  C  CG1 . VAL F  6  25  ? 17.878  -86.046  65.309  1.00 44.27  ? 31   VAL F CG1 1 
ATOM   9266  C  CG2 . VAL F  6  25  ? 19.048  -86.009  63.124  1.00 45.10  ? 31   VAL F CG2 1 
ATOM   9267  N  N   . GLU F  6  26  ? 16.905  -82.568  64.830  1.00 46.95  ? 32   GLU F N   1 
ATOM   9268  C  CA  . GLU F  6  26  ? 16.309  -81.584  65.744  1.00 47.56  ? 32   GLU F CA  1 
ATOM   9269  C  C   . GLU F  6  26  ? 14.910  -81.201  65.293  1.00 47.74  ? 32   GLU F C   1 
ATOM   9270  O  O   . GLU F  6  26  ? 14.013  -80.976  66.121  1.00 48.10  ? 32   GLU F O   1 
ATOM   9271  C  CB  . GLU F  6  26  ? 17.185  -80.342  65.819  1.00 47.55  ? 32   GLU F CB  1 
ATOM   9272  C  CG  . GLU F  6  26  ? 18.538  -80.578  66.494  1.00 49.37  ? 32   GLU F CG  1 
ATOM   9273  C  CD  . GLU F  6  26  ? 19.494  -79.389  66.357  1.00 52.28  ? 32   GLU F CD  1 
ATOM   9274  O  OE1 . GLU F  6  26  ? 19.115  -78.361  65.734  1.00 53.51  ? 32   GLU F OE1 1 
ATOM   9275  O  OE2 . GLU F  6  26  ? 20.633  -79.488  66.874  1.00 52.71  ? 32   GLU F OE2 1 
ATOM   9276  N  N   . ASN F  6  27  ? 14.727  -81.172  63.977  1.00 47.81  ? 33   ASN F N   1 
ATOM   9277  C  CA  . ASN F  6  27  ? 13.446  -80.869  63.358  1.00 48.37  ? 33   ASN F CA  1 
ATOM   9278  C  C   . ASN F  6  27  ? 12.403  -81.984  63.548  1.00 47.96  ? 33   ASN F C   1 
ATOM   9279  O  O   . ASN F  6  27  ? 11.205  -81.796  63.280  1.00 48.00  ? 33   ASN F O   1 
ATOM   9280  C  CB  . ASN F  6  27  ? 13.668  -80.580  61.867  1.00 48.91  ? 33   ASN F CB  1 
ATOM   9281  C  CG  . ASN F  6  27  ? 12.446  -79.977  61.193  1.00 51.20  ? 33   ASN F CG  1 
ATOM   9282  O  OD1 . ASN F  6  27  ? 11.852  -80.584  60.290  1.00 52.70  ? 33   ASN F OD1 1 
ATOM   9283  N  ND2 . ASN F  6  27  ? 12.061  -78.777  61.630  1.00 53.37  ? 33   ASN F ND2 1 
ATOM   9284  N  N   . GLY F  6  28  ? 12.863  -83.140  64.014  1.00 47.38  ? 34   GLY F N   1 
ATOM   9285  C  CA  . GLY F  6  28  ? 12.022  -84.319  64.074  1.00 46.69  ? 34   GLY F CA  1 
ATOM   9286  C  C   . GLY F  6  28  ? 11.209  -84.418  65.340  1.00 46.44  ? 34   GLY F C   1 
ATOM   9287  O  O   . GLY F  6  28  ? 11.343  -83.611  66.261  1.00 46.34  ? 34   GLY F O   1 
ATOM   9288  N  N   . THR F  6  29  ? 10.352  -85.425  65.364  1.00 46.21  ? 35   THR F N   1 
ATOM   9289  C  CA  . THR F  6  29  ? 9.573   -85.785  66.534  1.00 46.10  ? 35   THR F CA  1 
ATOM   9290  C  C   . THR F  6  29  ? 10.507  -86.220  67.662  1.00 46.15  ? 35   THR F C   1 
ATOM   9291  O  O   . THR F  6  29  ? 11.679  -86.542  67.428  1.00 46.40  ? 35   THR F O   1 
ATOM   9292  C  CB  . THR F  6  29  ? 8.584   -86.897  66.156  1.00 46.16  ? 35   THR F CB  1 
ATOM   9293  O  OG1 . THR F  6  29  ? 7.372   -86.298  65.684  1.00 46.69  ? 35   THR F OG1 1 
ATOM   9294  C  CG2 . THR F  6  29  ? 8.284   -87.797  67.321  1.00 46.22  ? 35   THR F CG2 1 
ATOM   9295  N  N   . THR F  6  30  ? 10.004  -86.216  68.889  1.00 45.81  ? 36   THR F N   1 
ATOM   9296  C  CA  . THR F  6  30  ? 10.853  -86.543  70.027  1.00 45.61  ? 36   THR F CA  1 
ATOM   9297  C  C   . THR F  6  30  ? 10.773  -88.027  70.392  1.00 45.19  ? 36   THR F C   1 
ATOM   9298  O  O   . THR F  6  30  ? 9.693   -88.621  70.424  1.00 44.92  ? 36   THR F O   1 
ATOM   9299  C  CB  . THR F  6  30  ? 10.618  -85.576  71.249  1.00 45.64  ? 36   THR F CB  1 
ATOM   9300  O  OG1 . THR F  6  30  ? 11.253  -86.092  72.425  1.00 45.51  ? 36   THR F OG1 1 
ATOM   9301  C  CG2 . THR F  6  30  ? 9.146   -85.383  71.535  1.00 46.48  ? 36   THR F CG2 1 
ATOM   9302  N  N   . SER F  6  31  ? 11.933  -88.624  70.630  1.00 44.75  ? 37   SER F N   1 
ATOM   9303  C  CA  . SER F  6  31  ? 11.990  -90.003  71.086  1.00 44.90  ? 37   SER F CA  1 
ATOM   9304  C  C   . SER F  6  31  ? 12.994  -90.199  72.220  1.00 44.57  ? 37   SER F C   1 
ATOM   9305  O  O   . SER F  6  31  ? 13.939  -89.417  72.369  1.00 44.56  ? 37   SER F O   1 
ATOM   9306  C  CB  . SER F  6  31  ? 12.246  -90.972  69.922  1.00 45.25  ? 37   SER F CB  1 
ATOM   9307  O  OG  . SER F  6  31  ? 13.313  -90.555  69.092  1.00 46.17  ? 37   SER F OG  1 
ATOM   9308  N  N   . ILE F  6  32  ? 12.763  -91.228  73.035  1.00 44.16  ? 38   ILE F N   1 
ATOM   9309  C  CA  . ILE F  6  32  ? 13.569  -91.458  74.232  1.00 43.98  ? 38   ILE F CA  1 
ATOM   9310  C  C   . ILE F  6  32  ? 13.781  -92.931  74.506  1.00 43.92  ? 38   ILE F C   1 
ATOM   9311  O  O   . ILE F  6  32  ? 13.042  -93.783  74.019  1.00 43.94  ? 38   ILE F O   1 
ATOM   9312  C  CB  . ILE F  6  32  ? 12.926  -90.843  75.509  1.00 44.02  ? 38   ILE F CB  1 
ATOM   9313  C  CG1 . ILE F  6  32  ? 11.473  -91.314  75.670  1.00 43.61  ? 38   ILE F CG1 1 
ATOM   9314  C  CG2 . ILE F  6  32  ? 12.998  -89.325  75.485  1.00 44.29  ? 38   ILE F CG2 1 
ATOM   9315  C  CD1 . ILE F  6  32  ? 11.021  -91.407  77.102  1.00 42.58  ? 38   ILE F CD1 1 
ATOM   9316  N  N   . GLY F  6  33  ? 14.781  -93.214  75.322  1.00 43.92  ? 39   GLY F N   1 
ATOM   9317  C  CA  . GLY F  6  33  ? 15.032  -94.548  75.794  1.00 44.18  ? 39   GLY F CA  1 
ATOM   9318  C  C   . GLY F  6  33  ? 15.480  -94.434  77.219  1.00 44.77  ? 39   GLY F C   1 
ATOM   9319  O  O   . GLY F  6  33  ? 16.173  -93.478  77.580  1.00 44.71  ? 39   GLY F O   1 
ATOM   9320  N  N   . ILE F  6  34  ? 15.070  -95.405  78.030  1.00 45.48  ? 40   ILE F N   1 
ATOM   9321  C  CA  . ILE F  6  34  ? 15.399  -95.439  79.451  1.00 46.12  ? 40   ILE F CA  1 
ATOM   9322  C  C   . ILE F  6  34  ? 15.937  -96.812  79.828  1.00 46.50  ? 40   ILE F C   1 
ATOM   9323  O  O   . ILE F  6  34  ? 15.279  -97.817  79.605  1.00 46.13  ? 40   ILE F O   1 
ATOM   9324  C  CB  . ILE F  6  34  ? 14.158  -95.142  80.321  1.00 46.02  ? 40   ILE F CB  1 
ATOM   9325  C  CG1 . ILE F  6  34  ? 13.386  -93.939  79.771  1.00 46.68  ? 40   ILE F CG1 1 
ATOM   9326  C  CG2 . ILE F  6  34  ? 14.559  -94.935  81.780  1.00 46.18  ? 40   ILE F CG2 1 
ATOM   9327  C  CD1 . ILE F  6  34  ? 12.099  -93.619  80.523  1.00 48.50  ? 40   ILE F CD1 1 
ATOM   9328  N  N   . LYS F  6  35  ? 17.128  -96.843  80.410  1.00 47.47  ? 41   LYS F N   1 
ATOM   9329  C  CA  . LYS F  6  35  ? 17.723  -98.093  80.863  1.00 48.68  ? 41   LYS F CA  1 
ATOM   9330  C  C   . LYS F  6  35  ? 17.282  -98.385  82.288  1.00 49.78  ? 41   LYS F C   1 
ATOM   9331  O  O   . LYS F  6  35  ? 17.571  -97.616  83.198  1.00 50.51  ? 41   LYS F O   1 
ATOM   9332  C  CB  . LYS F  6  35  ? 19.248  -98.018  80.766  1.00 48.27  ? 41   LYS F CB  1 
ATOM   9333  C  CG  . LYS F  6  35  ? 20.004  -99.198  81.321  1.00 47.90  ? 41   LYS F CG  1 
ATOM   9334  C  CD  . LYS F  6  35  ? 21.484  -99.047  81.015  1.00 48.70  ? 41   LYS F CD  1 
ATOM   9335  C  CE  . LYS F  6  35  ? 22.351  -99.679  82.082  1.00 49.76  ? 41   LYS F CE  1 
ATOM   9336  N  NZ  . LYS F  6  35  ? 23.709  -99.064  82.071  1.00 50.24  ? 41   LYS F NZ  1 
ATOM   9337  N  N   . CYS F  6  36  ? 16.577  -99.492  82.483  1.00 50.81  ? 42   CYS F N   1 
ATOM   9338  C  CA  . CYS F  6  36  ? 16.150  -99.878  83.819  1.00 52.17  ? 42   CYS F CA  1 
ATOM   9339  C  C   . CYS F  6  36  ? 17.030  -100.972 84.439  1.00 52.43  ? 42   CYS F C   1 
ATOM   9340  O  O   . CYS F  6  36  ? 18.050  -101.359 83.865  1.00 52.66  ? 42   CYS F O   1 
ATOM   9341  C  CB  . CYS F  6  36  ? 14.675  -100.271 83.814  1.00 52.44  ? 42   CYS F CB  1 
ATOM   9342  S  SG  . CYS F  6  36  ? 14.273  -101.685 82.785  1.00 55.55  ? 42   CYS F SG  1 
ATOM   9343  N  N   . ASN F  6  37  ? 16.641  -101.461 85.614  1.00 52.78  ? 43   ASN F N   1 
ATOM   9344  C  CA  . ASN F  6  37  ? 17.490  -102.384 86.383  1.00 53.44  ? 43   ASN F CA  1 
ATOM   9345  C  C   . ASN F  6  37  ? 17.914  -103.651 85.619  1.00 52.95  ? 43   ASN F C   1 
ATOM   9346  O  O   . ASN F  6  37  ? 19.011  -104.171 85.837  1.00 53.07  ? 43   ASN F O   1 
ATOM   9347  C  CB  . ASN F  6  37  ? 16.851  -102.730 87.748  1.00 53.84  ? 43   ASN F CB  1 
ATOM   9348  C  CG  . ASN F  6  37  ? 15.464  -103.417 87.621  1.00 56.53  ? 43   ASN F CG  1 
ATOM   9349  O  OD1 . ASN F  6  37  ? 14.958  -103.984 88.600  1.00 59.25  ? 43   ASN F OD1 1 
ATOM   9350  N  ND2 . ASN F  6  37  ? 14.849  -103.362 86.424  1.00 57.90  ? 43   ASN F ND2 1 
ATOM   9351  N  N   . ASP F  6  38  ? 17.050  -104.111 84.710  1.00 52.30  ? 44   ASP F N   1 
ATOM   9352  C  CA  . ASP F  6  38  ? 17.226  -105.380 83.998  1.00 51.47  ? 44   ASP F CA  1 
ATOM   9353  C  C   . ASP F  6  38  ? 16.704  -105.316 82.549  1.00 50.77  ? 44   ASP F C   1 
ATOM   9354  O  O   . ASP F  6  38  ? 16.369  -106.339 81.947  1.00 50.57  ? 44   ASP F O   1 
ATOM   9355  C  CB  . ASP F  6  38  ? 16.517  -106.501 84.773  1.00 51.55  ? 44   ASP F CB  1 
ATOM   9356  C  CG  . ASP F  6  38  ? 14.994  -106.517 84.554  1.00 52.24  ? 44   ASP F CG  1 
ATOM   9357  O  OD1 . ASP F  6  38  ? 14.408  -107.625 84.573  1.00 52.87  ? 44   ASP F OD1 1 
ATOM   9358  O  OD2 . ASP F  6  38  ? 14.378  -105.439 84.360  1.00 53.17  ? 44   ASP F OD2 1 
ATOM   9359  N  N   . GLY F  6  39  ? 16.620  -104.111 81.996  1.00 50.15  ? 45   GLY F N   1 
ATOM   9360  C  CA  . GLY F  6  39  ? 16.084  -103.939 80.647  1.00 49.26  ? 45   GLY F CA  1 
ATOM   9361  C  C   . GLY F  6  39  ? 16.170  -102.531 80.093  1.00 48.61  ? 45   GLY F C   1 
ATOM   9362  O  O   . GLY F  6  39  ? 16.936  -101.701 80.584  1.00 48.61  ? 45   GLY F O   1 
ATOM   9363  N  N   . VAL F  6  40  ? 15.373  -102.268 79.063  1.00 47.81  ? 46   VAL F N   1 
ATOM   9364  C  CA  . VAL F  6  40  ? 15.351  -100.971 78.399  1.00 46.98  ? 46   VAL F CA  1 
ATOM   9365  C  C   . VAL F  6  40  ? 13.944  -100.636 77.922  1.00 46.56  ? 46   VAL F C   1 
ATOM   9366  O  O   . VAL F  6  40  ? 13.167  -101.527 77.565  1.00 46.70  ? 46   VAL F O   1 
ATOM   9367  C  CB  . VAL F  6  40  ? 16.317  -100.909 77.185  1.00 47.03  ? 46   VAL F CB  1 
ATOM   9368  C  CG1 . VAL F  6  40  ? 17.770  -100.922 77.634  1.00 46.97  ? 46   VAL F CG1 1 
ATOM   9369  C  CG2 . VAL F  6  40  ? 16.029  -102.034 76.185  1.00 46.85  ? 46   VAL F CG2 1 
ATOM   9370  N  N   . VAL F  6  41  ? 13.628  -99.346  77.912  1.00 45.98  ? 47   VAL F N   1 
ATOM   9371  C  CA  . VAL F  6  41  ? 12.320  -98.872  77.492  1.00 45.60  ? 47   VAL F CA  1 
ATOM   9372  C  C   . VAL F  6  41  ? 12.477  -97.816  76.406  1.00 45.36  ? 47   VAL F C   1 
ATOM   9373  O  O   . VAL F  6  41  ? 13.301  -96.916  76.515  1.00 44.98  ? 47   VAL F O   1 
ATOM   9374  C  CB  . VAL F  6  41  ? 11.534  -98.271  78.684  1.00 45.69  ? 47   VAL F CB  1 
ATOM   9375  C  CG1 . VAL F  6  41  ? 10.105  -97.941  78.275  1.00 45.92  ? 47   VAL F CG1 1 
ATOM   9376  C  CG2 . VAL F  6  41  ? 11.536  -99.220  79.871  1.00 44.87  ? 47   VAL F CG2 1 
ATOM   9377  N  N   . PHE F  6  42  ? 11.682  -97.941  75.353  1.00 45.42  ? 48   PHE F N   1 
ATOM   9378  C  CA  . PHE F  6  42  ? 11.697  -96.982  74.256  1.00 45.41  ? 48   PHE F CA  1 
ATOM   9379  C  C   . PHE F  6  42  ? 10.324  -96.352  74.108  1.00 45.96  ? 48   PHE F C   1 
ATOM   9380  O  O   . PHE F  6  42  ? 9.301   -97.045  74.137  1.00 45.86  ? 48   PHE F O   1 
ATOM   9381  C  CB  . PHE F  6  42  ? 12.091  -97.654  72.942  1.00 44.88  ? 48   PHE F CB  1 
ATOM   9382  C  CG  . PHE F  6  42  ? 13.357  -98.431  73.021  1.00 44.15  ? 48   PHE F CG  1 
ATOM   9383  C  CD1 . PHE F  6  42  ? 13.328  -99.814  73.095  1.00 43.42  ? 48   PHE F CD1 1 
ATOM   9384  C  CD2 . PHE F  6  42  ? 14.590  -97.784  73.023  1.00 43.91  ? 48   PHE F CD2 1 
ATOM   9385  C  CE1 . PHE F  6  42  ? 14.515  -100.543 73.171  1.00 43.34  ? 48   PHE F CE1 1 
ATOM   9386  C  CE2 . PHE F  6  42  ? 15.779  -98.507  73.096  1.00 43.39  ? 48   PHE F CE2 1 
ATOM   9387  C  CZ  . PHE F  6  42  ? 15.739  -99.885  73.170  1.00 43.02  ? 48   PHE F CZ  1 
ATOM   9388  N  N   . ALA F  6  43  ? 10.309  -95.033  73.947  1.00 46.56  ? 49   ALA F N   1 
ATOM   9389  C  CA  . ALA F  6  43  ? 9.068   -94.307  73.782  1.00 47.06  ? 49   ALA F CA  1 
ATOM   9390  C  C   . ALA F  6  43  ? 9.264   -93.222  72.757  1.00 47.69  ? 49   ALA F C   1 
ATOM   9391  O  O   . ALA F  6  43  ? 10.368  -92.683  72.603  1.00 47.66  ? 49   ALA F O   1 
ATOM   9392  C  CB  . ALA F  6  43  ? 8.609   -93.725  75.101  1.00 46.91  ? 49   ALA F CB  1 
ATOM   9393  N  N   . VAL F  6  44  ? 8.181   -92.908  72.059  1.00 48.49  ? 50   VAL F N   1 
ATOM   9394  C  CA  . VAL F  6  44  ? 8.222   -91.966  70.963  1.00 49.74  ? 50   VAL F CA  1 
ATOM   9395  C  C   . VAL F  6  44  ? 6.877   -91.239  70.841  1.00 50.73  ? 50   VAL F C   1 
ATOM   9396  O  O   . VAL F  6  44  ? 5.841   -91.739  71.296  1.00 50.64  ? 50   VAL F O   1 
ATOM   9397  C  CB  . VAL F  6  44  ? 8.648   -92.671  69.617  1.00 49.72  ? 50   VAL F CB  1 
ATOM   9398  C  CG1 . VAL F  6  44  ? 7.598   -93.686  69.153  1.00 49.55  ? 50   VAL F CG1 1 
ATOM   9399  C  CG2 . VAL F  6  44  ? 8.953   -91.651  68.507  1.00 49.56  ? 50   VAL F CG2 1 
ATOM   9400  N  N   . GLU F  6  45  ? 6.930   -90.056  70.228  1.00 51.98  ? 51   GLU F N   1 
ATOM   9401  C  CA  . GLU F  6  45  ? 5.784   -89.188  69.989  1.00 53.31  ? 51   GLU F CA  1 
ATOM   9402  C  C   . GLU F  6  45  ? 5.319   -89.316  68.525  1.00 53.68  ? 51   GLU F C   1 
ATOM   9403  O  O   . GLU F  6  45  ? 6.097   -89.097  67.598  1.00 53.81  ? 51   GLU F O   1 
ATOM   9404  C  CB  . GLU F  6  45  ? 6.197   -87.741  70.339  1.00 53.53  ? 51   GLU F CB  1 
ATOM   9405  C  CG  . GLU F  6  45  ? 5.320   -86.600  69.801  1.00 55.61  ? 51   GLU F CG  1 
ATOM   9406  C  CD  . GLU F  6  45  ? 5.968   -85.207  69.949  1.00 59.31  ? 51   GLU F CD  1 
ATOM   9407  O  OE1 . GLU F  6  45  ? 5.266   -84.260  70.372  1.00 61.26  ? 51   GLU F OE1 1 
ATOM   9408  O  OE2 . GLU F  6  45  ? 7.172   -85.046  69.636  1.00 59.88  ? 51   GLU F OE2 1 
ATOM   9409  N  N   . LYS F  6  46  ? 4.060   -89.679  68.314  1.00 54.25  ? 52   LYS F N   1 
ATOM   9410  C  CA  . LYS F  6  46  ? 3.507   -89.729  66.959  1.00 55.00  ? 52   LYS F CA  1 
ATOM   9411  C  C   . LYS F  6  46  ? 2.543   -88.565  66.749  1.00 55.30  ? 52   LYS F C   1 
ATOM   9412  O  O   . LYS F  6  46  ? 1.442   -88.572  67.289  1.00 55.11  ? 52   LYS F O   1 
ATOM   9413  C  CB  . LYS F  6  46  ? 2.774   -91.059  66.708  1.00 55.22  ? 52   LYS F CB  1 
ATOM   9414  C  CG  . LYS F  6  46  ? 3.634   -92.327  66.771  1.00 55.44  ? 52   LYS F CG  1 
ATOM   9415  C  CD  . LYS F  6  46  ? 2.792   -93.620  66.944  1.00 56.43  ? 52   LYS F CD  1 
ATOM   9416  C  CE  . LYS F  6  46  ? 1.764   -93.831  65.818  1.00 56.89  ? 52   LYS F CE  1 
ATOM   9417  N  NZ  . LYS F  6  46  ? 1.315   -95.249  65.704  1.00 57.14  ? 52   LYS F NZ  1 
ATOM   9418  N  N   . LEU F  6  47  ? 2.961   -87.570  65.968  1.00 56.08  ? 53   LEU F N   1 
ATOM   9419  C  CA  . LEU F  6  47  ? 2.111   -86.422  65.639  1.00 56.81  ? 53   LEU F CA  1 
ATOM   9420  C  C   . LEU F  6  47  ? 0.883   -86.820  64.836  1.00 57.51  ? 53   LEU F C   1 
ATOM   9421  O  O   . LEU F  6  47  ? 0.999   -87.322  63.716  1.00 57.41  ? 53   LEU F O   1 
ATOM   9422  C  CB  . LEU F  6  47  ? 2.887   -85.354  64.863  1.00 56.56  ? 53   LEU F CB  1 
ATOM   9423  C  CG  . LEU F  6  47  ? 3.894   -84.483  65.626  1.00 57.23  ? 53   LEU F CG  1 
ATOM   9424  C  CD1 . LEU F  6  47  ? 4.420   -83.335  64.739  1.00 56.78  ? 53   LEU F CD1 1 
ATOM   9425  C  CD2 . LEU F  6  47  ? 3.316   -83.942  66.941  1.00 56.39  ? 53   LEU F CD2 1 
ATOM   9426  N  N   . ILE F  6  48  ? -0.295  -86.591  65.407  1.00 58.48  ? 54   ILE F N   1 
ATOM   9427  C  CA  . ILE F  6  48  ? -1.530  -86.827  64.676  1.00 59.67  ? 54   ILE F CA  1 
ATOM   9428  C  C   . ILE F  6  48  ? -1.826  -85.624  63.785  1.00 60.41  ? 54   ILE F C   1 
ATOM   9429  O  O   . ILE F  6  48  ? -2.385  -84.618  64.228  1.00 60.97  ? 54   ILE F O   1 
ATOM   9430  C  CB  . ILE F  6  48  ? -2.713  -87.172  65.609  1.00 59.74  ? 54   ILE F CB  1 
ATOM   9431  C  CG1 . ILE F  6  48  ? -2.451  -88.511  66.314  1.00 59.96  ? 54   ILE F CG1 1 
ATOM   9432  C  CG2 . ILE F  6  48  ? -4.026  -87.223  64.820  1.00 60.12  ? 54   ILE F CG2 1 
ATOM   9433  C  CD1 . ILE F  6  48  ? -3.453  -88.866  67.402  1.00 60.71  ? 54   ILE F CD1 1 
ATOM   9434  N  N   . THR F  6  49  ? -1.415  -85.741  62.528  1.00 61.14  ? 55   THR F N   1 
ATOM   9435  C  CA  . THR F  6  49  ? -1.583  -84.699  61.521  1.00 61.74  ? 55   THR F CA  1 
ATOM   9436  C  C   . THR F  6  49  ? -3.064  -84.488  61.166  1.00 62.33  ? 55   THR F C   1 
ATOM   9437  O  O   . THR F  6  49  ? -3.463  -83.393  60.787  1.00 62.66  ? 55   THR F O