data_3SEA
# 
_entry.id   3SEA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SEA         
RCSB  RCSB066097   
WWPDB D_1000066097 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1XTR . unspecified 
PDB 1XTS . unspecified 
PDB 1XTQ . unspecified 
PDB 2L0X . unspecified 
PDB 3OES . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SEA 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mazhab-Jafari, M.T.' 1 
'Marshall, C.B.'      2 
'Ishiyama, N.'        3 
'Vuk, S.'             4 
'Ikura, M.'           5 
# 
_citation.id                        primary 
_citation.title                     
'An Autoinhibited Noncanonical Mechanism of GTP Hydrolysis by Rheb Maintains mTORC1 Homeostasis.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1528 
_citation.page_last                 1539 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22819219 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.06.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mazhab-Jafari, M.T.' 1 
primary 'Marshall, C.B.'      2 
primary 'Ishiyama, N.'        3 
primary 'Ho, J.'              4 
primary 'Di Palma, V.'        5 
primary 'Stambolic, V.'       6 
primary 'Ikura, M.'           7 
# 
_cell.entry_id           3SEA 
_cell.length_a           57.247 
_cell.length_b           69.873 
_cell.length_c           79.195 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SEA 
_symmetry.space_group_name_H-M             'P 2 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GTP-binding protein Rheb'                    18757.406 2   ? Y35A G-domain ? 
2 non-polymer syn 'MAGNESIUM ION'                               24.305    2   ? ?    ?        ? 
3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                    443.201   1   ? ?    ?        ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' 522.196   1   ? ?    ?        ? 
5 non-polymer syn 'ACETATE ION'                                 59.044    1   ? ?    ?        ? 
6 water       nat water                                         18.015    252 ? ?    ?        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ras homolog enriched in brain' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSADPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYI
LVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRR
IILEAEK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSADPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYI
LVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRR
IILEAEK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   LYS n 
1 4   SER n 
1 5   ARG n 
1 6   LYS n 
1 7   ILE n 
1 8   ALA n 
1 9   ILE n 
1 10  LEU n 
1 11  GLY n 
1 12  TYR n 
1 13  ARG n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  LYS n 
1 18  SER n 
1 19  SER n 
1 20  LEU n 
1 21  THR n 
1 22  ILE n 
1 23  GLN n 
1 24  PHE n 
1 25  VAL n 
1 26  GLU n 
1 27  GLY n 
1 28  GLN n 
1 29  PHE n 
1 30  VAL n 
1 31  ASP n 
1 32  SER n 
1 33  ALA n 
1 34  ASP n 
1 35  PRO n 
1 36  THR n 
1 37  ILE n 
1 38  GLU n 
1 39  ASN n 
1 40  THR n 
1 41  PHE n 
1 42  THR n 
1 43  LYS n 
1 44  LEU n 
1 45  ILE n 
1 46  THR n 
1 47  VAL n 
1 48  ASN n 
1 49  GLY n 
1 50  GLN n 
1 51  GLU n 
1 52  TYR n 
1 53  HIS n 
1 54  LEU n 
1 55  GLN n 
1 56  LEU n 
1 57  VAL n 
1 58  ASP n 
1 59  THR n 
1 60  ALA n 
1 61  GLY n 
1 62  GLN n 
1 63  ASP n 
1 64  GLU n 
1 65  TYR n 
1 66  SER n 
1 67  ILE n 
1 68  PHE n 
1 69  PRO n 
1 70  GLN n 
1 71  THR n 
1 72  TYR n 
1 73  SER n 
1 74  ILE n 
1 75  ASP n 
1 76  ILE n 
1 77  ASN n 
1 78  GLY n 
1 79  TYR n 
1 80  ILE n 
1 81  LEU n 
1 82  VAL n 
1 83  TYR n 
1 84  SER n 
1 85  VAL n 
1 86  THR n 
1 87  SER n 
1 88  ILE n 
1 89  LYS n 
1 90  SER n 
1 91  PHE n 
1 92  GLU n 
1 93  VAL n 
1 94  ILE n 
1 95  LYS n 
1 96  VAL n 
1 97  ILE n 
1 98  HIS n 
1 99  GLY n 
1 100 LYS n 
1 101 LEU n 
1 102 LEU n 
1 103 ASP n 
1 104 MET n 
1 105 VAL n 
1 106 GLY n 
1 107 LYS n 
1 108 VAL n 
1 109 GLN n 
1 110 ILE n 
1 111 PRO n 
1 112 ILE n 
1 113 MET n 
1 114 LEU n 
1 115 VAL n 
1 116 GLY n 
1 117 ASN n 
1 118 LYS n 
1 119 LYS n 
1 120 ASP n 
1 121 LEU n 
1 122 HIS n 
1 123 MET n 
1 124 GLU n 
1 125 ARG n 
1 126 VAL n 
1 127 ILE n 
1 128 SER n 
1 129 TYR n 
1 130 GLU n 
1 131 GLU n 
1 132 GLY n 
1 133 LYS n 
1 134 ALA n 
1 135 LEU n 
1 136 ALA n 
1 137 GLU n 
1 138 SER n 
1 139 TRP n 
1 140 ASN n 
1 141 ALA n 
1 142 ALA n 
1 143 PHE n 
1 144 LEU n 
1 145 GLU n 
1 146 SER n 
1 147 SER n 
1 148 ALA n 
1 149 LYS n 
1 150 GLU n 
1 151 ASN n 
1 152 GLN n 
1 153 THR n 
1 154 ALA n 
1 155 VAL n 
1 156 ASP n 
1 157 VAL n 
1 158 PHE n 
1 159 ARG n 
1 160 ARG n 
1 161 ILE n 
1 162 ILE n 
1 163 LEU n 
1 164 GLU n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'RHEB, RHEB2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RHEB_HUMAN 
_struct_ref.pdbx_db_accession          Q15382 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYI
LVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRR
IILEAEK
;
_struct_ref.pdbx_align_begin           3 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SEA A 1 ? 167 ? Q15382 3 ? 169 ? 3 169 
2 1 3SEA B 1 ? 167 ? Q15382 3 ? 169 ? 3 169 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SEA ALA A 33 ? UNP Q15382 TYR 35 'ENGINEERED MUTATION' 35 1 
2 3SEA ALA B 33 ? UNP Q15382 TYR 35 'ENGINEERED MUTATION' 35 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                 ? 'C2 H3 O2 -1'       59.044  
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE"                    ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
GNP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' ? 'C10 H17 N6 O13 P3' 522.196 
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3SEA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_percent_sol   41.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris hydrochloride, 200 mM Sodium acetate trihydrate, 30% w/v Polyethylene glycol 4,000, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54 
# 
_reflns.entry_id                     3SEA 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   21742 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.093 
_reflns.pdbx_Rsym_value              0.093 
_reflns.pdbx_netI_over_sigmaI        20.711 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.412 
_reflns_shell.pdbx_Rsym_value        0.412 
_reflns_shell.meanI_over_sigI_obs    4.597 
_reflns_shell.pdbx_redundancy        6.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SEA 
_refine.ls_number_reflns_obs                     21742 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.919 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    98.19 
_refine.ls_R_factor_obs                          0.1665 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1618 
_refine.ls_R_factor_R_free                       0.2140 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.02 
_refine.ls_number_reflns_R_free                  1961 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            6.1797 
_refine.aniso_B[2][2]                            -0.3176 
_refine.aniso_B[3][3]                            -5.8621 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.383 
_refine.solvent_model_param_bsol                 56.249 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1XTR' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.25 
_refine.pdbx_overall_phase_error                 19.71 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2640 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               2958 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        26.919 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.007  ? ? 2904 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.141  ? ? 3963 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 16.599 ? ? 1121 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.075  ? ? 456  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.004  ? ? 495  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.0    2.0697  1876 0.1684 95.00  0.2492 . . 183 . . . . 'X-RAY DIFFRACTION' 
. 2.0697 2.1526  1907 0.1630 97.00  0.2391 . . 191 . . . . 'X-RAY DIFFRACTION' 
. 2.1526 2.2505  1947 0.1628 98.00  0.2585 . . 190 . . . . 'X-RAY DIFFRACTION' 
. 2.2505 2.3691  1932 0.1651 97.00  0.2242 . . 191 . . . . 'X-RAY DIFFRACTION' 
. 2.3691 2.5174  1965 0.1589 98.00  0.2357 . . 198 . . . . 'X-RAY DIFFRACTION' 
. 2.5174 2.7116  1966 0.1666 99.00  0.2510 . . 196 . . . . 'X-RAY DIFFRACTION' 
. 2.7116 2.9842  2007 0.1700 100.00 0.2199 . . 199 . . . . 'X-RAY DIFFRACTION' 
. 2.9842 3.4153  2007 0.1724 100.00 0.2295 . . 198 . . . . 'X-RAY DIFFRACTION' 
. 3.4153 4.3000  2040 0.1477 100.00 0.1862 . . 203 . . . . 'X-RAY DIFFRACTION' 
. 4.3000 26.9216 2134 0.1602 99.00  0.1773 . . 212 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SEA 
_struct.title                     'Structure of Rheb-Y35A mutant in GDP- and GMPPNP-bound forms' 
_struct.pdbx_descriptor           'GTP-binding protein Rheb' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SEA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'globular, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 16  ? GLY A 27  ? GLY A 18  GLY A 29  1 ? 12 
HELX_P HELX_P2  2  SER A 87  ? GLY A 106 ? SER A 89  GLY A 108 1 ? 20 
HELX_P HELX_P3  3  LEU A 121 ? ARG A 125 ? LEU A 123 ARG A 127 5 ? 5  
HELX_P HELX_P4  4  SER A 128 ? TRP A 139 ? SER A 130 TRP A 141 1 ? 12 
HELX_P HELX_P5  5  GLU A 150 ? GLU A 166 ? GLU A 152 GLU A 168 1 ? 17 
HELX_P HELX_P6  6  GLY B 16  ? GLY B 27  ? GLY B 18  GLY B 29  1 ? 12 
HELX_P HELX_P7  7  PRO B 69  ? ILE B 74  ? PRO B 71  ILE B 76  5 ? 6  
HELX_P HELX_P8  8  SER B 87  ? GLY B 106 ? SER B 89  GLY B 108 1 ? 20 
HELX_P HELX_P9  9  LEU B 121 ? ARG B 125 ? LEU B 123 ARG B 127 5 ? 5  
HELX_P HELX_P10 10 SER B 128 ? TRP B 139 ? SER B 130 TRP B 141 1 ? 12 
HELX_P HELX_P11 11 GLU B 150 ? GLU B 166 ? GLU B 152 GLU B 168 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E MG  .  MG  ? ? ? 1_555 F GNP . O2G ? ? B MG  178 B GNP 179 1_555 ? ? ? ? ? ? ? 2.072 ? 
metalc2  metalc ? ? A SER 18 OG  ? ? ? 1_555 C MG  . MG  ? ? A SER 20  A MG  202 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc3  metalc ? ? B THR 36 OG1 ? ? ? 1_555 E MG  . MG  ? ? B THR 38  B MG  178 1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc4  metalc ? ? E MG  .  MG  ? ? ? 1_555 F GNP . O2B ? ? B MG  178 B GNP 179 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc5  metalc ? ? C MG  .  MG  ? ? ? 1_555 D GDP . O3B ? ? A MG  202 A GDP 201 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc6  metalc ? ? B SER 18 OG  ? ? ? 1_555 E MG  . MG  ? ? B SER 20  B MG  178 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc7  metalc ? ? E MG  .  MG  ? ? ? 1_555 I HOH . O   ? ? B MG  178 B HOH 262 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc8  metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  202 A HOH 170 1_555 ? ? ? ? ? ? ? 2.070 ? 
metalc9  metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  202 A HOH 176 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc10 metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  202 A HOH 172 1_555 ? ? ? ? ? ? ? 2.193 ? 
metalc11 metalc ? ? E MG  .  MG  ? ? ? 1_555 I HOH . O   ? ? B MG  178 B HOH 174 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc12 metalc ? ? C MG  .  MG  ? ? ? 1_555 H HOH . O   ? ? A MG  202 A HOH 197 1_555 ? ? ? ? ? ? ? 2.431 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 39  ? VAL A 47  ? ASN A 41  VAL A 49  
A 2 GLN A 50  ? ASP A 58  ? GLN A 52  ASP A 60  
A 3 LYS A 3   ? GLY A 11  ? LYS A 5   GLY A 13  
A 4 GLY A 78  ? SER A 84  ? GLY A 80  SER A 86  
A 5 ILE A 112 ? ASN A 117 ? ILE A 114 ASN A 119 
A 6 ALA A 142 ? GLU A 145 ? ALA A 144 GLU A 147 
B 1 GLU B 38  ? VAL B 47  ? GLU B 40  VAL B 49  
B 2 GLN B 50  ? THR B 59  ? GLN B 52  THR B 61  
B 3 LYS B 3   ? GLY B 11  ? LYS B 5   GLY B 13  
B 4 GLY B 78  ? SER B 84  ? GLY B 80  SER B 86  
B 5 ILE B 112 ? ASN B 117 ? ILE B 114 ASN B 119 
B 6 ALA B 142 ? GLU B 145 ? ALA B 144 GLU B 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 45  ? N ILE A 47  O TYR A 52  ? O TYR A 54  
A 2 3 O HIS A 53  ? O HIS A 55  N LYS A 3   ? N LYS A 5   
A 3 4 N LEU A 10  ? N LEU A 12  O VAL A 82  ? O VAL A 84  
A 4 5 N TYR A 83  ? N TYR A 85  O ASN A 117 ? O ASN A 119 
A 5 6 N LEU A 114 ? N LEU A 116 O ALA A 142 ? O ALA A 144 
B 1 2 N PHE B 41  ? N PHE B 43  O LEU B 56  ? O LEU B 58  
B 2 3 O VAL B 57  ? O VAL B 59  N ILE B 7   ? N ILE B 9   
B 3 4 N LEU B 10  ? N LEU B 12  O VAL B 82  ? O VAL B 84  
B 4 5 N TYR B 83  ? N TYR B 85  O ASN B 117 ? O ASN B 119 
B 5 6 N LEU B 114 ? N LEU B 116 O ALA B 142 ? O ALA B 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 202'  
AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE GDP A 201' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG B 178'  
AC4 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE GNP B 179' 
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ACT B 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  SER A 18  ? SER A 20  . ? 1_555 ? 
2  AC1 6  HOH H .   ? HOH A 170 . ? 1_555 ? 
3  AC1 6  HOH H .   ? HOH A 172 . ? 1_555 ? 
4  AC1 6  HOH H .   ? HOH A 176 . ? 1_555 ? 
5  AC1 6  HOH H .   ? HOH A 197 . ? 1_555 ? 
6  AC1 6  GDP D .   ? GDP A 201 . ? 1_555 ? 
7  AC2 23 SER A 14  ? SER A 16  . ? 1_555 ? 
8  AC2 23 VAL A 15  ? VAL A 17  . ? 1_555 ? 
9  AC2 23 GLY A 16  ? GLY A 18  . ? 1_555 ? 
10 AC2 23 LYS A 17  ? LYS A 19  . ? 1_555 ? 
11 AC2 23 SER A 18  ? SER A 20  . ? 1_555 ? 
12 AC2 23 SER A 19  ? SER A 21  . ? 1_555 ? 
13 AC2 23 PHE A 29  ? PHE A 31  . ? 1_555 ? 
14 AC2 23 VAL A 30  ? VAL A 32  . ? 1_555 ? 
15 AC2 23 ASP A 31  ? ASP A 33  . ? 1_555 ? 
16 AC2 23 ASN A 117 ? ASN A 119 . ? 1_555 ? 
17 AC2 23 LYS A 118 ? LYS A 120 . ? 1_555 ? 
18 AC2 23 ASP A 120 ? ASP A 122 . ? 1_555 ? 
19 AC2 23 LEU A 121 ? LEU A 123 . ? 1_555 ? 
20 AC2 23 SER A 147 ? SER A 149 . ? 1_555 ? 
21 AC2 23 ALA A 148 ? ALA A 150 . ? 1_555 ? 
22 AC2 23 HOH H .   ? HOH A 172 . ? 1_555 ? 
23 AC2 23 HOH H .   ? HOH A 189 . ? 1_555 ? 
24 AC2 23 HOH H .   ? HOH A 197 . ? 1_555 ? 
25 AC2 23 MG  C .   ? MG  A 202 . ? 1_555 ? 
26 AC2 23 HOH H .   ? HOH A 235 . ? 1_555 ? 
27 AC2 23 HOH H .   ? HOH A 269 . ? 1_555 ? 
28 AC2 23 HOH H .   ? HOH A 273 . ? 1_555 ? 
29 AC2 23 HOH H .   ? HOH A 290 . ? 1_555 ? 
30 AC3 5  SER B 18  ? SER B 20  . ? 1_555 ? 
31 AC3 5  THR B 36  ? THR B 38  . ? 1_555 ? 
32 AC3 5  HOH I .   ? HOH B 174 . ? 1_555 ? 
33 AC3 5  GNP F .   ? GNP B 179 . ? 1_555 ? 
34 AC3 5  HOH I .   ? HOH B 262 . ? 1_555 ? 
35 AC4 25 ARG B 13  ? ARG B 15  . ? 1_555 ? 
36 AC4 25 SER B 14  ? SER B 16  . ? 1_555 ? 
37 AC4 25 VAL B 15  ? VAL B 17  . ? 1_555 ? 
38 AC4 25 GLY B 16  ? GLY B 18  . ? 1_555 ? 
39 AC4 25 LYS B 17  ? LYS B 19  . ? 1_555 ? 
40 AC4 25 SER B 18  ? SER B 20  . ? 1_555 ? 
41 AC4 25 SER B 19  ? SER B 21  . ? 1_555 ? 
42 AC4 25 PHE B 29  ? PHE B 31  . ? 1_555 ? 
43 AC4 25 VAL B 30  ? VAL B 32  . ? 1_555 ? 
44 AC4 25 ASP B 31  ? ASP B 33  . ? 1_555 ? 
45 AC4 25 ALA B 33  ? ALA B 35  . ? 1_555 ? 
46 AC4 25 PRO B 35  ? PRO B 37  . ? 1_555 ? 
47 AC4 25 THR B 36  ? THR B 38  . ? 1_555 ? 
48 AC4 25 GLY B 61  ? GLY B 63  . ? 1_555 ? 
49 AC4 25 ASN B 117 ? ASN B 119 . ? 1_555 ? 
50 AC4 25 LYS B 118 ? LYS B 120 . ? 1_555 ? 
51 AC4 25 ASP B 120 ? ASP B 122 . ? 1_555 ? 
52 AC4 25 LEU B 121 ? LEU B 123 . ? 1_555 ? 
53 AC4 25 SER B 147 ? SER B 149 . ? 1_555 ? 
54 AC4 25 ALA B 148 ? ALA B 150 . ? 1_555 ? 
55 AC4 25 HOH I .   ? HOH B 174 . ? 1_555 ? 
56 AC4 25 MG  E .   ? MG  B 178 . ? 1_555 ? 
57 AC4 25 HOH I .   ? HOH B 215 . ? 1_555 ? 
58 AC4 25 HOH I .   ? HOH B 262 . ? 1_555 ? 
59 AC4 25 HOH I .   ? HOH B 289 . ? 1_555 ? 
60 AC5 5  ALA B 33  ? ALA B 35  . ? 1_555 ? 
61 AC5 5  ASP B 34  ? ASP B 36  . ? 1_555 ? 
62 AC5 5  THR B 36  ? THR B 38  . ? 1_555 ? 
63 AC5 5  ASN B 39  ? ASN B 41  . ? 1_555 ? 
64 AC5 5  HOH I .   ? HOH B 267 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SEA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SEA 
_atom_sites.fract_transf_matrix[1][1]   0.017468 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014312 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLN A 1 1   ? -17.935 20.276  10.533  1.00 54.99 ? 3   GLN A N     1 
ATOM   2    C  CA    . GLN A 1 1   ? -18.873 20.005  9.450   1.00 71.74 ? 3   GLN A CA    1 
ATOM   3    C  C     . GLN A 1 1   ? -19.207 18.513  9.393   1.00 65.76 ? 3   GLN A C     1 
ATOM   4    O  O     . GLN A 1 1   ? -20.346 18.124  9.129   1.00 60.05 ? 3   GLN A O     1 
ATOM   5    C  CB    . GLN A 1 1   ? -18.291 20.483  8.117   1.00 70.99 ? 3   GLN A CB    1 
ATOM   6    C  CG    . GLN A 1 1   ? -19.220 20.324  6.921   1.00 66.30 ? 3   GLN A CG    1 
ATOM   7    C  CD    . GLN A 1 1   ? -20.517 21.099  7.072   1.00 84.57 ? 3   GLN A CD    1 
ATOM   8    O  OE1   . GLN A 1 1   ? -21.353 20.779  7.919   1.00 83.25 ? 3   GLN A OE1   1 
ATOM   9    N  NE2   . GLN A 1 1   ? -20.693 22.124  6.245   1.00 91.30 ? 3   GLN A NE2   1 
ATOM   10   N  N     . SER A 1 2   ? -18.203 17.684  9.647   1.00 53.08 ? 4   SER A N     1 
ATOM   11   C  CA    . SER A 1 2   ? -18.384 16.244  9.695   1.00 43.50 ? 4   SER A CA    1 
ATOM   12   C  C     . SER A 1 2   ? -18.871 15.832  11.088  1.00 50.33 ? 4   SER A C     1 
ATOM   13   O  O     . SER A 1 2   ? -18.406 16.372  12.096  1.00 51.59 ? 4   SER A O     1 
ATOM   14   C  CB    . SER A 1 2   ? -17.061 15.549  9.367   1.00 48.47 ? 4   SER A CB    1 
ATOM   15   O  OG    . SER A 1 2   ? -17.198 14.136  9.343   1.00 53.14 ? 4   SER A OG    1 
ATOM   16   N  N     . LYS A 1 3   ? -19.808 14.886  11.143  1.00 34.46 ? 5   LYS A N     1 
ATOM   17   C  CA    . LYS A 1 3   ? -20.319 14.374  12.419  1.00 37.13 ? 5   LYS A CA    1 
ATOM   18   C  C     . LYS A 1 3   ? -19.490 13.201  12.931  1.00 33.32 ? 5   LYS A C     1 
ATOM   19   O  O     . LYS A 1 3   ? -19.028 12.362  12.156  1.00 32.05 ? 5   LYS A O     1 
ATOM   20   C  CB    . LYS A 1 3   ? -21.775 13.945  12.292  1.00 25.27 ? 5   LYS A CB    1 
ATOM   21   C  CG    . LYS A 1 3   ? -22.726 15.045  11.835  1.00 26.31 ? 5   LYS A CG    1 
ATOM   22   C  CD    . LYS A 1 3   ? -24.146 14.482  11.682  1.00 30.46 ? 5   LYS A CD    1 
ATOM   23   C  CE    . LYS A 1 3   ? -25.125 15.486  11.088  1.00 40.52 ? 5   LYS A CE    1 
ATOM   24   N  NZ    . LYS A 1 3   ? -26.502 14.909  11.016  1.00 30.83 ? 5   LYS A NZ    1 
ATOM   25   N  N     . SER A 1 4   ? -19.319 13.146  14.247  1.00 21.30 ? 6   SER A N     1 
ATOM   26   C  CA    . SER A 1 4   ? -18.494 12.138  14.882  1.00 24.63 ? 6   SER A CA    1 
ATOM   27   C  C     . SER A 1 4   ? -19.388 11.160  15.630  1.00 28.87 ? 6   SER A C     1 
ATOM   28   O  O     . SER A 1 4   ? -20.269 11.568  16.392  1.00 30.25 ? 6   SER A O     1 
ATOM   29   C  CB    . SER A 1 4   ? -17.520 12.812  15.857  1.00 36.43 ? 6   SER A CB    1 
ATOM   30   O  OG    . SER A 1 4   ? -16.787 11.862  16.609  1.00 44.34 ? 6   SER A OG    1 
ATOM   31   N  N     . ARG A 1 5   ? -19.165 9.870   15.417  1.00 21.15 ? 7   ARG A N     1 
ATOM   32   C  CA    . ARG A 1 5   ? -19.973 8.846   16.077  1.00 16.97 ? 7   ARG A CA    1 
ATOM   33   C  C     . ARG A 1 5   ? -19.094 7.731   16.611  1.00 27.00 ? 7   ARG A C     1 
ATOM   34   O  O     . ARG A 1 5   ? -18.177 7.276   15.923  1.00 23.95 ? 7   ARG A O     1 
ATOM   35   C  CB    . ARG A 1 5   ? -20.990 8.248   15.104  1.00 27.18 ? 7   ARG A CB    1 
ATOM   36   C  CG    . ARG A 1 5   ? -22.089 9.201   14.672  1.00 27.06 ? 7   ARG A CG    1 
ATOM   37   C  CD    . ARG A 1 5   ? -22.942 9.641   15.854  1.00 25.10 ? 7   ARG A CD    1 
ATOM   38   N  NE    . ARG A 1 5   ? -24.032 10.526  15.442  1.00 32.30 ? 7   ARG A NE    1 
ATOM   39   C  CZ    . ARG A 1 5   ? -23.987 11.853  15.508  1.00 30.46 ? 7   ARG A CZ    1 
ATOM   40   N  NH1   . ARG A 1 5   ? -22.902 12.463  15.978  1.00 26.12 ? 7   ARG A NH1   1 
ATOM   41   N  NH2   . ARG A 1 5   ? -25.030 12.571  15.110  1.00 33.91 ? 7   ARG A NH2   1 
ATOM   42   N  N     . LYS A 1 6   ? -19.382 7.296   17.837  1.00 21.84 ? 8   LYS A N     1 
ATOM   43   C  CA    . LYS A 1 6   ? -18.739 6.128   18.420  1.00 18.69 ? 8   LYS A CA    1 
ATOM   44   C  C     . LYS A 1 6   ? -19.782 5.024   18.573  1.00 16.56 ? 8   LYS A C     1 
ATOM   45   O  O     . LYS A 1 6   ? -20.840 5.251   19.142  1.00 16.19 ? 8   LYS A O     1 
ATOM   46   C  CB    . LYS A 1 6   ? -18.097 6.468   19.776  1.00 20.31 ? 8   LYS A CB    1 
ATOM   47   C  CG    . LYS A 1 6   ? -17.336 5.297   20.376  1.00 23.93 ? 8   LYS A CG    1 
ATOM   48   C  CD    . LYS A 1 6   ? -16.576 5.670   21.643  1.00 29.34 ? 8   LYS A CD    1 
ATOM   49   C  CE    . LYS A 1 6   ? -15.143 6.106   21.353  1.00 33.42 ? 8   LYS A CE    1 
ATOM   50   N  NZ    . LYS A 1 6   ? -14.367 6.222   22.639  1.00 38.64 ? 8   LYS A NZ    1 
ATOM   51   N  N     . ILE A 1 7   ? -19.488 3.843   18.026  1.00 17.45 ? 9   ILE A N     1 
ATOM   52   C  CA    . ILE A 1 7   ? -20.425 2.719   17.997  1.00 14.20 ? 9   ILE A CA    1 
ATOM   53   C  C     . ILE A 1 7   ? -19.776 1.494   18.627  1.00 13.55 ? 9   ILE A C     1 
ATOM   54   O  O     . ILE A 1 7   ? -18.694 1.079   18.210  1.00 16.27 ? 9   ILE A O     1 
ATOM   55   C  CB    . ILE A 1 7   ? -20.769 2.318   16.541  1.00 18.95 ? 9   ILE A CB    1 
ATOM   56   C  CG1   . ILE A 1 7   ? -21.355 3.498   15.751  1.00 24.80 ? 9   ILE A CG1   1 
ATOM   57   C  CG2   . ILE A 1 7   ? -21.681 1.085   16.521  1.00 19.55 ? 9   ILE A CG2   1 
ATOM   58   C  CD1   . ILE A 1 7   ? -22.603 4.078   16.354  1.00 28.07 ? 9   ILE A CD1   1 
ATOM   59   N  N     . ALA A 1 8   ? -20.439 0.889   19.609  1.00 18.16 ? 10  ALA A N     1 
ATOM   60   C  CA    . ALA A 1 8   ? -19.906 -0.328  20.215  1.00 15.86 ? 10  ALA A CA    1 
ATOM   61   C  C     . ALA A 1 8   ? -20.598 -1.576  19.685  1.00 16.48 ? 10  ALA A C     1 
ATOM   62   O  O     . ALA A 1 8   ? -21.823 -1.631  19.604  1.00 17.55 ? 10  ALA A O     1 
ATOM   63   C  CB    . ALA A 1 8   ? -19.997 -0.267  21.741  1.00 11.39 ? 10  ALA A CB    1 
ATOM   64   N  N     . ILE A 1 9   ? -19.802 -2.569  19.306  1.00 15.99 ? 11  ILE A N     1 
ATOM   65   C  CA    . ILE A 1 9   ? -20.334 -3.834  18.807  1.00 14.84 ? 11  ILE A CA    1 
ATOM   66   C  C     . ILE A 1 9   ? -20.184 -4.884  19.920  1.00 15.82 ? 11  ILE A C     1 
ATOM   67   O  O     . ILE A 1 9   ? -19.068 -5.166  20.372  1.00 15.76 ? 11  ILE A O     1 
ATOM   68   C  CB    . ILE A 1 9   ? -19.623 -4.272  17.496  1.00 16.63 ? 11  ILE A CB    1 
ATOM   69   C  CG1   . ILE A 1 9   ? -19.742 -3.172  16.426  1.00 19.38 ? 11  ILE A CG1   1 
ATOM   70   C  CG2   . ILE A 1 9   ? -20.228 -5.600  16.940  1.00 11.17 ? 11  ILE A CG2   1 
ATOM   71   C  CD1   . ILE A 1 9   ? -18.490 -2.336  16.223  1.00 20.30 ? 11  ILE A CD1   1 
ATOM   72   N  N     . LEU A 1 10  ? -21.314 -5.432  20.364  1.00 12.63 ? 12  LEU A N     1 
ATOM   73   C  CA    . LEU A 1 10  ? -21.373 -6.416  21.450  1.00 13.62 ? 12  LEU A CA    1 
ATOM   74   C  C     . LEU A 1 10  ? -21.829 -7.787  20.971  1.00 19.58 ? 12  LEU A C     1 
ATOM   75   O  O     . LEU A 1 10  ? -22.431 -7.925  19.897  1.00 12.43 ? 12  LEU A O     1 
ATOM   76   C  CB    . LEU A 1 10  ? -22.380 -5.960  22.507  1.00 14.58 ? 12  LEU A CB    1 
ATOM   77   C  CG    . LEU A 1 10  ? -22.187 -4.562  23.095  1.00 19.92 ? 12  LEU A CG    1 
ATOM   78   C  CD1   . LEU A 1 10  ? -23.245 -4.288  24.120  1.00 12.58 ? 12  LEU A CD1   1 
ATOM   79   C  CD2   . LEU A 1 10  ? -20.811 -4.474  23.702  1.00 19.01 ? 12  LEU A CD2   1 
ATOM   80   N  N     . GLY A 1 11  ? -21.593 -8.806  21.792  1.00 15.94 ? 13  GLY A N     1 
ATOM   81   C  CA    . GLY A 1 11  ? -22.071 -10.133 21.450  1.00 15.24 ? 13  GLY A CA    1 
ATOM   82   C  C     . GLY A 1 11  ? -21.166 -11.250 21.926  1.00 16.41 ? 13  GLY A C     1 
ATOM   83   O  O     . GLY A 1 11  ? -20.008 -11.041 22.291  1.00 17.19 ? 13  GLY A O     1 
ATOM   84   N  N     . TYR A 1 12  ? -21.713 -12.452 21.910  1.00 15.22 ? 14  TYR A N     1 
ATOM   85   C  CA    . TYR A 1 12  ? -21.009 -13.655 22.328  1.00 10.10 ? 14  TYR A CA    1 
ATOM   86   C  C     . TYR A 1 12  ? -19.799 -13.939 21.427  1.00 17.65 ? 14  TYR A C     1 
ATOM   87   O  O     . TYR A 1 12  ? -19.726 -13.454 20.304  1.00 14.79 ? 14  TYR A O     1 
ATOM   88   C  CB    . TYR A 1 12  ? -21.995 -14.819 22.269  1.00 18.69 ? 14  TYR A CB    1 
ATOM   89   C  CG    . TYR A 1 12  ? -21.476 -16.154 22.757  1.00 24.44 ? 14  TYR A CG    1 
ATOM   90   C  CD1   . TYR A 1 12  ? -21.102 -16.332 24.088  1.00 21.11 ? 14  TYR A CD1   1 
ATOM   91   C  CD2   . TYR A 1 12  ? -21.403 -17.253 21.893  1.00 19.52 ? 14  TYR A CD2   1 
ATOM   92   C  CE1   . TYR A 1 12  ? -20.644 -17.557 24.548  1.00 27.71 ? 14  TYR A CE1   1 
ATOM   93   C  CE2   . TYR A 1 12  ? -20.949 -18.488 22.345  1.00 23.63 ? 14  TYR A CE2   1 
ATOM   94   C  CZ    . TYR A 1 12  ? -20.572 -18.631 23.672  1.00 27.61 ? 14  TYR A CZ    1 
ATOM   95   O  OH    . TYR A 1 12  ? -20.116 -19.844 24.128  1.00 26.94 ? 14  TYR A OH    1 
ATOM   96   N  N     . ARG A 1 13  ? -18.854 -14.733 21.917  1.00 20.79 ? 15  ARG A N     1 
ATOM   97   C  CA    A ARG A 1 13  ? -17.668 -15.072 21.137  0.57 23.18 ? 15  ARG A CA    1 
ATOM   98   C  CA    B ARG A 1 13  ? -17.668 -15.075 21.135  0.43 23.17 ? 15  ARG A CA    1 
ATOM   99   C  C     . ARG A 1 13  ? -18.019 -15.777 19.824  1.00 25.08 ? 15  ARG A C     1 
ATOM   100  O  O     . ARG A 1 13  ? -18.976 -16.563 19.760  1.00 20.32 ? 15  ARG A O     1 
ATOM   101  C  CB    A ARG A 1 13  ? -16.691 -15.917 21.968  0.57 24.15 ? 15  ARG A CB    1 
ATOM   102  C  CB    B ARG A 1 13  ? -16.707 -15.946 21.952  0.43 24.15 ? 15  ARG A CB    1 
ATOM   103  C  CG    A ARG A 1 13  ? -17.363 -16.934 22.882  0.57 31.47 ? 15  ARG A CG    1 
ATOM   104  C  CG    B ARG A 1 13  ? -17.178 -17.378 22.182  0.43 27.55 ? 15  ARG A CG    1 
ATOM   105  C  CD    A ARG A 1 13  ? -16.414 -17.420 23.987  0.57 31.92 ? 15  ARG A CD    1 
ATOM   106  C  CD    B ARG A 1 13  ? -16.174 -18.134 23.047  0.43 34.26 ? 15  ARG A CD    1 
ATOM   107  N  NE    A ARG A 1 13  ? -17.120 -18.153 25.041  0.57 30.89 ? 15  ARG A NE    1 
ATOM   108  N  NE    B ARG A 1 13  ? -16.551 -19.522 23.303  0.43 29.68 ? 15  ARG A NE    1 
ATOM   109  C  CZ    A ARG A 1 13  ? -17.481 -17.625 26.210  0.57 29.34 ? 15  ARG A CZ    1 
ATOM   110  C  CZ    B ARG A 1 13  ? -17.254 -19.927 24.358  0.43 40.52 ? 15  ARG A CZ    1 
ATOM   111  N  NH1   A ARG A 1 13  ? -17.197 -16.363 26.485  0.57 20.55 ? 15  ARG A NH1   1 
ATOM   112  N  NH1   B ARG A 1 13  ? -17.680 -19.047 25.260  0.43 30.20 ? 15  ARG A NH1   1 
ATOM   113  N  NH2   A ARG A 1 13  ? -18.121 -18.362 27.105  0.57 35.66 ? 15  ARG A NH2   1 
ATOM   114  N  NH2   B ARG A 1 13  ? -17.540 -21.214 24.509  0.43 40.78 ? 15  ARG A NH2   1 
ATOM   115  N  N     . SER A 1 14  ? -17.250 -15.467 18.779  1.00 17.38 ? 16  SER A N     1 
ATOM   116  C  CA    . SER A 1 14  ? -17.384 -16.113 17.470  1.00 22.32 ? 16  SER A CA    1 
ATOM   117  C  C     . SER A 1 14  ? -18.622 -15.797 16.620  1.00 16.22 ? 16  SER A C     1 
ATOM   118  O  O     . SER A 1 14  ? -18.837 -16.450 15.604  1.00 17.89 ? 16  SER A O     1 
ATOM   119  C  CB    . SER A 1 14  ? -17.270 -17.634 17.633  1.00 26.06 ? 16  SER A CB    1 
ATOM   120  O  OG    . SER A 1 14  ? -16.004 -17.980 18.158  1.00 40.56 ? 16  SER A OG    1 
ATOM   121  N  N     . VAL A 1 15  ? -19.436 -14.826 17.013  1.00 14.49 ? 17  VAL A N     1 
ATOM   122  C  CA    . VAL A 1 15  ? -20.626 -14.508 16.231  1.00 12.32 ? 17  VAL A CA    1 
ATOM   123  C  C     . VAL A 1 15  ? -20.284 -13.701 14.971  1.00 18.40 ? 17  VAL A C     1 
ATOM   124  O  O     . VAL A 1 15  ? -21.120 -13.570 14.071  1.00 14.35 ? 17  VAL A O     1 
ATOM   125  C  CB    . VAL A 1 15  ? -21.690 -13.723 17.040  1.00 15.98 ? 17  VAL A CB    1 
ATOM   126  C  CG1   . VAL A 1 15  ? -22.129 -14.517 18.261  1.00 11.27 ? 17  VAL A CG1   1 
ATOM   127  C  CG2   . VAL A 1 15  ? -21.173 -12.316 17.426  1.00 12.81 ? 17  VAL A CG2   1 
ATOM   128  N  N     . GLY A 1 16  ? -19.075 -13.138 14.933  1.00 13.96 ? 18  GLY A N     1 
ATOM   129  C  CA    . GLY A 1 16  ? -18.640 -12.333 13.795  1.00 17.76 ? 18  GLY A CA    1 
ATOM   130  C  C     . GLY A 1 16  ? -18.557 -10.825 14.022  1.00 19.61 ? 18  GLY A C     1 
ATOM   131  O  O     . GLY A 1 16  ? -18.610 -10.044 13.060  1.00 17.91 ? 18  GLY A O     1 
ATOM   132  N  N     . LYS A 1 17  ? -18.431 -10.399 15.280  1.00 16.95 ? 19  LYS A N     1 
ATOM   133  C  CA    . LYS A 1 17  ? -18.259 -8.976  15.584  1.00 14.60 ? 19  LYS A CA    1 
ATOM   134  C  C     . LYS A 1 17  ? -17.072 -8.425  14.811  1.00 13.63 ? 19  LYS A C     1 
ATOM   135  O  O     . LYS A 1 17  ? -17.189 -7.434  14.094  1.00 15.81 ? 19  LYS A O     1 
ATOM   136  C  CB    . LYS A 1 17  ? -18.033 -8.757  17.091  1.00 12.51 ? 19  LYS A CB    1 
ATOM   137  C  CG    . LYS A 1 17  ? -19.227 -9.186  17.952  1.00 13.93 ? 19  LYS A CG    1 
ATOM   138  C  CD    . LYS A 1 17  ? -18.972 -8.960  19.464  1.00 17.26 ? 19  LYS A CD    1 
ATOM   139  C  CE    . LYS A 1 17  ? -17.732 -9.698  19.950  1.00 17.11 ? 19  LYS A CE    1 
ATOM   140  N  NZ    . LYS A 1 17  ? -17.937 -11.167 19.962  1.00 16.08 ? 19  LYS A NZ    1 
ATOM   141  N  N     . SER A 1 18  ? -15.926 -9.079  14.949  1.00 19.64 ? 20  SER A N     1 
ATOM   142  C  CA    . SER A 1 18  ? -14.720 -8.630  14.262  1.00 23.80 ? 20  SER A CA    1 
ATOM   143  C  C     . SER A 1 18  ? -14.834 -8.719  12.742  1.00 20.67 ? 20  SER A C     1 
ATOM   144  O  O     . SER A 1 18  ? -14.482 -7.768  12.033  1.00 16.46 ? 20  SER A O     1 
ATOM   145  C  CB    . SER A 1 18  ? -13.501 -9.404  14.747  1.00 13.78 ? 20  SER A CB    1 
ATOM   146  O  OG    . SER A 1 18  ? -13.206 -9.035  16.079  1.00 21.75 ? 20  SER A OG    1 
ATOM   147  N  N     . SER A 1 19  ? -15.322 -9.852  12.241  1.00 17.13 ? 21  SER A N     1 
ATOM   148  C  CA    . SER A 1 19  ? -15.391 -10.043 10.797  1.00 18.74 ? 21  SER A CA    1 
ATOM   149  C  C     . SER A 1 19  ? -16.312 -8.997  10.172  1.00 20.74 ? 21  SER A C     1 
ATOM   150  O  O     . SER A 1 19  ? -15.997 -8.421  9.132   1.00 18.06 ? 21  SER A O     1 
ATOM   151  C  CB    . SER A 1 19  ? -15.854 -11.460 10.438  1.00 15.65 ? 21  SER A CB    1 
ATOM   152  O  OG    . SER A 1 19  ? -14.934 -12.445 10.885  1.00 20.44 ? 21  SER A OG    1 
ATOM   153  N  N     . LEU A 1 20  ? -17.445 -8.736  10.819  1.00 19.85 ? 22  LEU A N     1 
ATOM   154  C  CA    . LEU A 1 20  ? -18.354 -7.692  10.348  1.00 17.98 ? 22  LEU A CA    1 
ATOM   155  C  C     . LEU A 1 20  ? -17.695 -6.325  10.321  1.00 21.77 ? 22  LEU A C     1 
ATOM   156  O  O     . LEU A 1 20  ? -17.814 -5.572  9.341   1.00 16.92 ? 22  LEU A O     1 
ATOM   157  C  CB    . LEU A 1 20  ? -19.608 -7.616  11.215  1.00 14.84 ? 22  LEU A CB    1 
ATOM   158  C  CG    . LEU A 1 20  ? -20.746 -8.530  10.792  1.00 22.01 ? 22  LEU A CG    1 
ATOM   159  C  CD1   . LEU A 1 20  ? -21.909 -8.401  11.759  1.00 20.00 ? 22  LEU A CD1   1 
ATOM   160  C  CD2   . LEU A 1 20  ? -21.168 -8.228  9.329   1.00 22.04 ? 22  LEU A CD2   1 
ATOM   161  N  N     . THR A 1 21  ? -17.008 -5.990  11.405  1.00 14.88 ? 23  THR A N     1 
ATOM   162  C  CA    . THR A 1 21  ? -16.384 -4.680  11.492  1.00 18.55 ? 23  THR A CA    1 
ATOM   163  C  C     . THR A 1 21  ? -15.273 -4.539  10.460  1.00 16.05 ? 23  THR A C     1 
ATOM   164  O  O     . THR A 1 21  ? -15.159 -3.508  9.792   1.00 20.37 ? 23  THR A O     1 
ATOM   165  C  CB    . THR A 1 21  ? -15.826 -4.402  12.890  1.00 15.71 ? 23  THR A CB    1 
ATOM   166  O  OG1   . THR A 1 21  ? -16.884 -4.535  13.844  1.00 18.28 ? 23  THR A OG1   1 
ATOM   167  C  CG2   . THR A 1 21  ? -15.246 -2.984  12.957  1.00 18.39 ? 23  THR A CG2   1 
ATOM   168  N  N     . ILE A 1 22  ? -14.456 -5.578  10.326  1.00 18.86 ? 24  ILE A N     1 
ATOM   169  C  CA    . ILE A 1 22  ? -13.362 -5.541  9.358   1.00 24.01 ? 24  ILE A CA    1 
ATOM   170  C  C     . ILE A 1 22  ? -13.876 -5.509  7.916   1.00 23.18 ? 24  ILE A C     1 
ATOM   171  O  O     . ILE A 1 22  ? -13.324 -4.800  7.077   1.00 23.17 ? 24  ILE A O     1 
ATOM   172  C  CB    . ILE A 1 22  ? -12.346 -6.662  9.606   1.00 17.59 ? 24  ILE A CB    1 
ATOM   173  C  CG1   . ILE A 1 22  ? -11.466 -6.280  10.793  1.00 20.81 ? 24  ILE A CG1   1 
ATOM   174  C  CG2   . ILE A 1 22  ? -11.479 -6.889  8.388   1.00 18.39 ? 24  ILE A CG2   1 
ATOM   175  C  CD1   . ILE A 1 22  ? -11.021 -7.442  11.612  1.00 27.06 ? 24  ILE A CD1   1 
ATOM   176  N  N     . GLN A 1 23  ? -14.954 -6.238  7.633   1.00 20.35 ? 25  GLN A N     1 
ATOM   177  C  CA    . GLN A 1 23  ? -15.587 -6.144  6.317   1.00 27.16 ? 25  GLN A CA    1 
ATOM   178  C  C     . GLN A 1 23  ? -15.977 -4.695  6.024   1.00 24.62 ? 25  GLN A C     1 
ATOM   179  O  O     . GLN A 1 23  ? -15.623 -4.143  4.990   1.00 23.81 ? 25  GLN A O     1 
ATOM   180  C  CB    . GLN A 1 23  ? -16.820 -7.047  6.227   1.00 19.81 ? 25  GLN A CB    1 
ATOM   181  C  CG    . GLN A 1 23  ? -17.545 -6.960  4.897   1.00 16.49 ? 25  GLN A CG    1 
ATOM   182  C  CD    . GLN A 1 23  ? -16.665 -7.359  3.724   1.00 23.53 ? 25  GLN A CD    1 
ATOM   183  O  OE1   . GLN A 1 23  ? -16.230 -6.508  2.939   1.00 19.78 ? 25  GLN A OE1   1 
ATOM   184  N  NE2   . GLN A 1 23  ? -16.394 -8.656  3.602   1.00 17.83 ? 25  GLN A NE2   1 
ATOM   185  N  N     . PHE A 1 24  ? -16.712 -4.088  6.948   1.00 20.29 ? 26  PHE A N     1 
ATOM   186  C  CA    . PHE A 1 24  ? -17.126 -2.691  6.832   1.00 16.80 ? 26  PHE A CA    1 
ATOM   187  C  C     . PHE A 1 24  ? -15.948 -1.730  6.689   1.00 25.28 ? 26  PHE A C     1 
ATOM   188  O  O     . PHE A 1 24  ? -15.960 -0.842  5.829   1.00 26.52 ? 26  PHE A O     1 
ATOM   189  C  CB    . PHE A 1 24  ? -17.991 -2.303  8.031   1.00 18.93 ? 26  PHE A CB    1 
ATOM   190  C  CG    . PHE A 1 24  ? -18.321 -0.842  8.102   1.00 21.32 ? 26  PHE A CG    1 
ATOM   191  C  CD1   . PHE A 1 24  ? -18.879 -0.185  7.013   1.00 23.78 ? 26  PHE A CD1   1 
ATOM   192  C  CD2   . PHE A 1 24  ? -18.099 -0.129  9.274   1.00 26.05 ? 26  PHE A CD2   1 
ATOM   193  C  CE1   . PHE A 1 24  ? -19.201 1.160   7.091   1.00 28.20 ? 26  PHE A CE1   1 
ATOM   194  C  CE2   . PHE A 1 24  ? -18.413 1.217   9.364   1.00 26.42 ? 26  PHE A CE2   1 
ATOM   195  C  CZ    . PHE A 1 24  ? -18.963 1.868   8.273   1.00 18.54 ? 26  PHE A CZ    1 
ATOM   196  N  N     . VAL A 1 25  ? -14.927 -1.907  7.518   1.00 19.23 ? 27  VAL A N     1 
ATOM   197  C  CA    . VAL A 1 25  ? -13.796 -0.989  7.510   1.00 24.69 ? 27  VAL A CA    1 
ATOM   198  C  C     . VAL A 1 25  ? -12.859 -1.156  6.312   1.00 30.27 ? 27  VAL A C     1 
ATOM   199  O  O     . VAL A 1 25  ? -12.473 -0.174  5.692   1.00 29.98 ? 27  VAL A O     1 
ATOM   200  C  CB    . VAL A 1 25  ? -12.990 -1.045  8.822   1.00 21.51 ? 27  VAL A CB    1 
ATOM   201  C  CG1   . VAL A 1 25  ? -11.759 -0.126  8.730   1.00 30.69 ? 27  VAL A CG1   1 
ATOM   202  C  CG2   . VAL A 1 25  ? -13.868 -0.626  9.991   1.00 21.39 ? 27  VAL A CG2   1 
ATOM   203  N  N     . GLU A 1 26  ? -12.514 -2.391  5.976   1.00 25.65 ? 28  GLU A N     1 
ATOM   204  C  CA    . GLU A 1 26  ? -11.478 -2.630  4.980   1.00 31.53 ? 28  GLU A CA    1 
ATOM   205  C  C     . GLU A 1 26  ? -11.948 -3.404  3.758   1.00 36.24 ? 28  GLU A C     1 
ATOM   206  O  O     . GLU A 1 26  ? -11.186 -3.631  2.816   1.00 33.61 ? 28  GLU A O     1 
ATOM   207  C  CB    . GLU A 1 26  ? -10.272 -3.304  5.634   1.00 30.03 ? 28  GLU A CB    1 
ATOM   208  C  CG    . GLU A 1 26  ? -9.480  -2.334  6.503   1.00 40.83 ? 28  GLU A CG    1 
ATOM   209  C  CD    . GLU A 1 26  ? -8.434  -3.011  7.351   1.00 53.06 ? 28  GLU A CD    1 
ATOM   210  O  OE1   . GLU A 1 26  ? -7.750  -2.303  8.124   1.00 54.30 ? 28  GLU A OE1   1 
ATOM   211  O  OE2   . GLU A 1 26  ? -8.299  -4.249  7.248   1.00 55.40 ? 28  GLU A OE2   1 
ATOM   212  N  N     . GLY A 1 27  ? -13.212 -3.793  3.767   1.00 26.29 ? 29  GLY A N     1 
ATOM   213  C  CA    . GLY A 1 27  ? -13.773 -4.514  2.645   1.00 25.97 ? 29  GLY A CA    1 
ATOM   214  C  C     . GLY A 1 27  ? -13.191 -5.903  2.417   1.00 33.51 ? 29  GLY A C     1 
ATOM   215  O  O     . GLY A 1 27  ? -13.167 -6.384  1.291   1.00 24.54 ? 29  GLY A O     1 
ATOM   216  N  N     A GLN A 1 28  ? -12.698 -6.555  3.460   0.35 29.85 ? 30  GLN A N     1 
ATOM   217  N  N     B GLN A 1 28  ? -12.745 -6.541  3.500   0.65 29.88 ? 30  GLN A N     1 
ATOM   218  C  CA    A GLN A 1 28  ? -12.317 -7.952  3.289   0.35 26.21 ? 30  GLN A CA    1 
ATOM   219  C  CA    B GLN A 1 28  ? -12.169 -7.886  3.454   0.65 25.99 ? 30  GLN A CA    1 
ATOM   220  C  C     A GLN A 1 28  ? -12.849 -8.830  4.402   0.35 26.45 ? 30  GLN A C     1 
ATOM   221  C  C     B GLN A 1 28  ? -12.886 -8.820  4.436   0.65 26.48 ? 30  GLN A C     1 
ATOM   222  O  O     A GLN A 1 28  ? -13.010 -8.400  5.547   0.35 22.59 ? 30  GLN A O     1 
ATOM   223  O  O     B GLN A 1 28  ? -13.214 -8.405  5.551   0.65 22.41 ? 30  GLN A O     1 
ATOM   224  C  CB    A GLN A 1 28  ? -10.806 -8.140  3.144   0.35 32.26 ? 30  GLN A CB    1 
ATOM   225  C  CB    B GLN A 1 28  ? -10.691 -7.825  3.838   0.65 30.10 ? 30  GLN A CB    1 
ATOM   226  C  CG    A GLN A 1 28  ? -10.039 -8.007  4.431   0.35 29.73 ? 30  GLN A CG    1 
ATOM   227  C  CG    B GLN A 1 28  ? -9.807  -7.086  2.851   0.65 39.32 ? 30  GLN A CG    1 
ATOM   228  C  CD    A GLN A 1 28  ? -9.910  -6.571  4.843   0.35 33.54 ? 30  GLN A CD    1 
ATOM   229  C  CD    B GLN A 1 28  ? -8.959  -8.028  2.015   0.65 44.79 ? 30  GLN A CD    1 
ATOM   230  O  OE1   A GLN A 1 28  ? -10.234 -5.672  4.072   0.35 38.42 ? 30  GLN A OE1   1 
ATOM   231  O  OE1   B GLN A 1 28  ? -7.784  -8.252  2.315   0.65 44.67 ? 30  GLN A OE1   1 
ATOM   232  N  NE2   A GLN A 1 28  ? -9.435  -6.338  6.059   0.35 40.99 ? 30  GLN A NE2   1 
ATOM   233  N  NE2   B GLN A 1 28  ? -9.551  -8.584  0.958   0.65 42.94 ? 30  GLN A NE2   1 
ATOM   234  N  N     . PHE A 1 29  ? -13.122 -10.072 4.038   1.00 19.98 ? 31  PHE A N     1 
ATOM   235  C  CA    . PHE A 1 29  ? -13.623 -11.061 4.971   1.00 20.44 ? 31  PHE A CA    1 
ATOM   236  C  C     . PHE A 1 29  ? -12.444 -11.813 5.582   1.00 24.43 ? 31  PHE A C     1 
ATOM   237  O  O     . PHE A 1 29  ? -11.612 -12.362 4.868   1.00 24.89 ? 31  PHE A O     1 
ATOM   238  C  CB    . PHE A 1 29  ? -14.589 -12.035 4.281   1.00 22.12 ? 31  PHE A CB    1 
ATOM   239  C  CG    . PHE A 1 29  ? -14.989 -13.184 5.152   1.00 19.20 ? 31  PHE A CG    1 
ATOM   240  C  CD1   . PHE A 1 29  ? -15.825 -12.982 6.238   1.00 18.95 ? 31  PHE A CD1   1 
ATOM   241  C  CD2   . PHE A 1 29  ? -14.497 -14.454 4.920   1.00 24.49 ? 31  PHE A CD2   1 
ATOM   242  C  CE1   . PHE A 1 29  ? -16.185 -14.028 7.053   1.00 23.66 ? 31  PHE A CE1   1 
ATOM   243  C  CE2   . PHE A 1 29  ? -14.852 -15.510 5.747   1.00 28.62 ? 31  PHE A CE2   1 
ATOM   244  C  CZ    . PHE A 1 29  ? -15.697 -15.296 6.812   1.00 27.38 ? 31  PHE A CZ    1 
ATOM   245  N  N     . VAL A 1 30  ? -12.357 -11.840 6.908   1.00 22.93 ? 32  VAL A N     1 
ATOM   246  C  CA    . VAL A 1 30  ? -11.271 -12.582 7.532   1.00 19.15 ? 32  VAL A CA    1 
ATOM   247  C  C     . VAL A 1 30  ? -11.739 -13.856 8.235   1.00 28.31 ? 32  VAL A C     1 
ATOM   248  O  O     . VAL A 1 30  ? -12.864 -13.948 8.745   1.00 27.79 ? 32  VAL A O     1 
ATOM   249  C  CB    . VAL A 1 30  ? -10.428 -11.708 8.473   1.00 23.89 ? 32  VAL A CB    1 
ATOM   250  C  CG1   . VAL A 1 30  ? -9.986  -10.454 7.741   1.00 22.58 ? 32  VAL A CG1   1 
ATOM   251  C  CG2   . VAL A 1 30  ? -11.214 -11.369 9.739   1.00 23.37 ? 32  VAL A CG2   1 
ATOM   252  N  N     . ASP A 1 31  ? -10.856 -14.843 8.245   1.00 27.40 ? 33  ASP A N     1 
ATOM   253  C  CA    . ASP A 1 31  ? -11.187 -16.163 8.764   1.00 26.39 ? 33  ASP A CA    1 
ATOM   254  C  C     . ASP A 1 31  ? -10.937 -16.281 10.263  1.00 30.18 ? 33  ASP A C     1 
ATOM   255  O  O     . ASP A 1 31  ? -11.414 -17.220 10.899  1.00 34.22 ? 33  ASP A O     1 
ATOM   256  C  CB    . ASP A 1 31  ? -10.421 -17.226 7.982   1.00 26.93 ? 33  ASP A CB    1 
ATOM   257  C  CG    . ASP A 1 31  ? -10.905 -17.339 6.551   1.00 28.93 ? 33  ASP A CG    1 
ATOM   258  O  OD1   . ASP A 1 31  ? -10.174 -16.932 5.622   1.00 29.41 ? 33  ASP A OD1   1 
ATOM   259  O  OD2   . ASP A 1 31  ? -12.041 -17.807 6.358   1.00 26.49 ? 33  ASP A OD2   1 
ATOM   260  N  N     . SER A 1 32  ? -10.207 -15.318 10.829  1.00 28.51 ? 34  SER A N     1 
ATOM   261  C  CA    . SER A 1 32  ? -10.021 -15.258 12.277  1.00 26.27 ? 34  SER A CA    1 
ATOM   262  C  C     . SER A 1 32  ? -9.489  -13.893 12.738  1.00 30.77 ? 34  SER A C     1 
ATOM   263  O  O     . SER A 1 32  ? -8.856  -13.175 11.957  1.00 32.15 ? 34  SER A O     1 
ATOM   264  C  CB    . SER A 1 32  ? -9.079  -16.375 12.738  1.00 29.40 ? 34  SER A CB    1 
ATOM   265  O  OG    . SER A 1 32  ? -7.734  -16.068 12.425  1.00 33.06 ? 34  SER A OG    1 
ATOM   266  N  N     . ALA A 1 33  ? -9.712  -13.586 14.016  1.00 35.17 ? 35  ALA A N     1 
ATOM   267  C  CA    . ALA A 1 33  ? -9.167  -12.397 14.673  1.00 30.25 ? 35  ALA A CA    1 
ATOM   268  C  C     . ALA A 1 33  ? -9.053  -12.617 16.187  1.00 39.14 ? 35  ALA A C     1 
ATOM   269  O  O     . ALA A 1 33  ? -9.910  -13.259 16.788  1.00 38.56 ? 35  ALA A O     1 
ATOM   270  C  CB    . ALA A 1 33  ? -10.031 -11.190 14.379  1.00 35.64 ? 35  ALA A CB    1 
ATOM   271  N  N     . ASP A 1 34  ? -7.993  -12.086 16.796  1.00 42.92 ? 36  ASP A N     1 
ATOM   272  C  CA    . ASP A 1 34  ? -7.775  -12.210 18.242  1.00 47.08 ? 36  ASP A CA    1 
ATOM   273  C  C     . ASP A 1 34  ? -9.095  -12.159 19.004  1.00 34.63 ? 36  ASP A C     1 
ATOM   274  O  O     . ASP A 1 34  ? -9.754  -11.126 19.035  1.00 31.07 ? 36  ASP A O     1 
ATOM   275  C  CB    . ASP A 1 34  ? -6.855  -11.093 18.745  1.00 48.02 ? 36  ASP A CB    1 
ATOM   276  C  CG    . ASP A 1 34  ? -5.414  -11.278 18.312  1.00 50.15 ? 36  ASP A CG    1 
ATOM   277  O  OD1   . ASP A 1 34  ? -4.840  -12.349 18.591  1.00 60.34 ? 36  ASP A OD1   1 
ATOM   278  O  OD2   . ASP A 1 34  ? -4.852  -10.350 17.698  1.00 30.45 ? 36  ASP A OD2   1 
ATOM   279  N  N     . PRO A 1 35  ? -9.482  -13.269 19.623  1.00 35.59 ? 37  PRO A N     1 
ATOM   280  C  CA    . PRO A 1 35  ? -10.826 -13.366 20.201  1.00 36.47 ? 37  PRO A CA    1 
ATOM   281  C  C     . PRO A 1 35  ? -10.933 -12.543 21.500  1.00 45.38 ? 37  PRO A C     1 
ATOM   282  O  O     . PRO A 1 35  ? -12.046 -12.164 21.876  1.00 38.52 ? 37  PRO A O     1 
ATOM   283  C  CB    . PRO A 1 35  ? -11.003 -14.861 20.490  1.00 51.01 ? 37  PRO A CB    1 
ATOM   284  C  CG    . PRO A 1 35  ? -9.601  -15.407 20.553  1.00 53.05 ? 37  PRO A CG    1 
ATOM   285  C  CD    . PRO A 1 35  ? -8.814  -14.604 19.558  1.00 46.67 ? 37  PRO A CD    1 
ATOM   286  N  N     . THR A 1 36  ? -9.809  -12.255 22.156  1.00 34.64 ? 38  THR A N     1 
ATOM   287  C  CA    . THR A 1 36  ? -9.851  -11.690 23.513  1.00 35.28 ? 38  THR A CA    1 
ATOM   288  C  C     . THR A 1 36  ? -9.364  -10.243 23.626  1.00 36.82 ? 38  THR A C     1 
ATOM   289  O  O     . THR A 1 36  ? -9.259  -9.708  24.731  1.00 39.22 ? 38  THR A O     1 
ATOM   290  C  CB    . THR A 1 36  ? -9.081  -12.573 24.545  1.00 37.10 ? 38  THR A CB    1 
ATOM   291  O  OG1   . THR A 1 36  ? -7.673  -12.561 24.260  1.00 27.04 ? 38  THR A OG1   1 
ATOM   292  C  CG2   . THR A 1 36  ? -9.593  -14.009 24.520  1.00 35.21 ? 38  THR A CG2   1 
ATOM   293  N  N     . ILE A 1 37  ? -9.081  -9.606  22.494  1.00 35.76 ? 39  ILE A N     1 
ATOM   294  C  CA    . ILE A 1 37  ? -8.630  -8.213  22.503  1.00 33.12 ? 39  ILE A CA    1 
ATOM   295  C  C     . ILE A 1 37  ? -9.672  -7.276  21.889  1.00 36.91 ? 39  ILE A C     1 
ATOM   296  O  O     . ILE A 1 37  ? -10.247 -7.584  20.849  1.00 37.15 ? 39  ILE A O     1 
ATOM   297  C  CB    . ILE A 1 37  ? -7.338  -8.044  21.703  1.00 38.30 ? 39  ILE A CB    1 
ATOM   298  C  CG1   . ILE A 1 37  ? -6.453  -9.290  21.835  1.00 45.44 ? 39  ILE A CG1   1 
ATOM   299  C  CG2   . ILE A 1 37  ? -6.631  -6.740  22.106  1.00 36.27 ? 39  ILE A CG2   1 
ATOM   300  C  CD1   . ILE A 1 37  ? -6.101  -9.662  23.253  1.00 43.76 ? 39  ILE A CD1   1 
ATOM   301  N  N     . GLU A 1 38  ? -9.918  -6.138  22.528  1.00 27.63 ? 40  GLU A N     1 
ATOM   302  C  CA    . GLU A 1 38  ? -10.818 -5.142  21.952  1.00 33.16 ? 40  GLU A CA    1 
ATOM   303  C  C     . GLU A 1 38  ? -10.063 -4.321  20.920  1.00 40.63 ? 40  GLU A C     1 
ATOM   304  O  O     . GLU A 1 38  ? -8.959  -3.859  21.190  1.00 32.79 ? 40  GLU A O     1 
ATOM   305  C  CB    . GLU A 1 38  ? -11.402 -4.223  23.029  1.00 28.36 ? 40  GLU A CB    1 
ATOM   306  C  CG    . GLU A 1 38  ? -12.336 -3.138  22.490  1.00 27.62 ? 40  GLU A CG    1 
ATOM   307  C  CD    . GLU A 1 38  ? -12.931 -2.263  23.584  1.00 33.80 ? 40  GLU A CD    1 
ATOM   308  O  OE1   . GLU A 1 38  ? -12.356 -1.194  23.869  1.00 29.31 ? 40  GLU A OE1   1 
ATOM   309  O  OE2   . GLU A 1 38  ? -13.980 -2.636  24.153  1.00 25.87 ? 40  GLU A OE2   1 
ATOM   310  N  N     . ASN A 1 39  ? -10.659 -4.151  19.742  1.00 30.11 ? 41  ASN A N     1 
ATOM   311  C  CA    . ASN A 1 39  ? -10.057 -3.364  18.670  1.00 30.55 ? 41  ASN A CA    1 
ATOM   312  C  C     . ASN A 1 39  ? -10.909 -2.147  18.375  1.00 26.30 ? 41  ASN A C     1 
ATOM   313  O  O     . ASN A 1 39  ? -12.121 -2.248  18.254  1.00 24.57 ? 41  ASN A O     1 
ATOM   314  C  CB    . ASN A 1 39  ? -9.963  -4.169  17.363  1.00 33.49 ? 41  ASN A CB    1 
ATOM   315  C  CG    . ASN A 1 39  ? -9.163  -5.451  17.500  1.00 39.38 ? 41  ASN A CG    1 
ATOM   316  O  OD1   . ASN A 1 39  ? -7.956  -5.420  17.749  1.00 47.09 ? 41  ASN A OD1   1 
ATOM   317  N  ND2   . ASN A 1 39  ? -9.829  -6.591  17.297  1.00 38.57 ? 41  ASN A ND2   1 
ATOM   318  N  N     . THR A 1 40  ? -10.276 -0.994  18.237  1.00 20.93 ? 42  THR A N     1 
ATOM   319  C  CA    . THR A 1 40  ? -10.994 0.192   17.801  1.00 24.35 ? 42  THR A CA    1 
ATOM   320  C  C     . THR A 1 40  ? -10.579 0.534   16.367  1.00 29.07 ? 42  THR A C     1 
ATOM   321  O  O     . THR A 1 40  ? -9.389  0.651   16.066  1.00 31.21 ? 42  THR A O     1 
ATOM   322  C  CB    . THR A 1 40  ? -10.745 1.381   18.751  1.00 33.26 ? 42  THR A CB    1 
ATOM   323  O  OG1   . THR A 1 40  ? -11.160 1.018   20.073  1.00 36.11 ? 42  THR A OG1   1 
ATOM   324  C  CG2   . THR A 1 40  ? -11.532 2.601   18.308  1.00 30.82 ? 42  THR A CG2   1 
ATOM   325  N  N     . PHE A 1 41  ? -11.556 0.646   15.475  1.00 22.87 ? 43  PHE A N     1 
ATOM   326  C  CA    . PHE A 1 41  ? -11.256 1.052   14.106  1.00 27.32 ? 43  PHE A CA    1 
ATOM   327  C  C     . PHE A 1 41  ? -11.815 2.446   13.857  1.00 27.55 ? 43  PHE A C     1 
ATOM   328  O  O     . PHE A 1 41  ? -12.725 2.898   14.548  1.00 22.28 ? 43  PHE A O     1 
ATOM   329  C  CB    . PHE A 1 41  ? -11.849 0.082   13.079  1.00 21.08 ? 43  PHE A CB    1 
ATOM   330  C  CG    . PHE A 1 41  ? -11.431 -1.351  13.262  1.00 26.22 ? 43  PHE A CG    1 
ATOM   331  C  CD1   . PHE A 1 41  ? -10.411 -1.896  12.492  1.00 27.53 ? 43  PHE A CD1   1 
ATOM   332  C  CD2   . PHE A 1 41  ? -12.086 -2.165  14.172  1.00 24.39 ? 43  PHE A CD2   1 
ATOM   333  C  CE1   . PHE A 1 41  ? -10.034 -3.213  12.649  1.00 33.55 ? 43  PHE A CE1   1 
ATOM   334  C  CE2   . PHE A 1 41  ? -11.720 -3.493  14.334  1.00 24.15 ? 43  PHE A CE2   1 
ATOM   335  C  CZ    . PHE A 1 41  ? -10.690 -4.016  13.575  1.00 29.48 ? 43  PHE A CZ    1 
ATOM   336  N  N     . THR A 1 42  ? -11.264 3.128   12.865  1.00 25.39 ? 44  THR A N     1 
ATOM   337  C  CA    . THR A 1 42  ? -11.839 4.388   12.420  1.00 28.50 ? 44  THR A CA    1 
ATOM   338  C  C     . THR A 1 42  ? -12.211 4.242   10.961  1.00 28.01 ? 44  THR A C     1 
ATOM   339  O  O     . THR A 1 42  ? -11.581 3.481   10.225  1.00 28.07 ? 44  THR A O     1 
ATOM   340  C  CB    . THR A 1 42  ? -10.869 5.568   12.599  1.00 30.46 ? 44  THR A CB    1 
ATOM   341  O  OG1   . THR A 1 42  ? -9.715  5.363   11.781  1.00 43.72 ? 44  THR A OG1   1 
ATOM   342  C  CG2   . THR A 1 42  ? -10.437 5.685   14.047  1.00 33.37 ? 44  THR A CG2   1 
ATOM   343  N  N     . LYS A 1 43  ? -13.242 4.967   10.549  1.00 24.54 ? 45  LYS A N     1 
ATOM   344  C  CA    . LYS A 1 43  ? -13.776 4.848   9.208   1.00 22.46 ? 45  LYS A CA    1 
ATOM   345  C  C     . LYS A 1 43  ? -14.573 6.099   8.883   1.00 27.52 ? 45  LYS A C     1 
ATOM   346  O  O     . LYS A 1 43  ? -15.425 6.530   9.662   1.00 24.33 ? 45  LYS A O     1 
ATOM   347  C  CB    . LYS A 1 43  ? -14.671 3.611   9.103   1.00 29.99 ? 45  LYS A CB    1 
ATOM   348  C  CG    . LYS A 1 43  ? -15.424 3.470   7.790   1.00 29.23 ? 45  LYS A CG    1 
ATOM   349  C  CD    . LYS A 1 43  ? -14.477 3.107   6.663   1.00 25.29 ? 45  LYS A CD    1 
ATOM   350  C  CE    . LYS A 1 43  ? -15.224 2.480   5.509   1.00 28.67 ? 45  LYS A CE    1 
ATOM   351  N  NZ    . LYS A 1 43  ? -14.276 1.820   4.579   1.00 34.31 ? 45  LYS A NZ    1 
ATOM   352  N  N     . LEU A 1 44  ? -14.259 6.697   7.740   1.00 17.95 ? 46  LEU A N     1 
ATOM   353  C  CA    . LEU A 1 44  ? -15.020 7.813   7.208   1.00 30.22 ? 46  LEU A CA    1 
ATOM   354  C  C     . LEU A 1 44  ? -16.050 7.288   6.231   1.00 29.89 ? 46  LEU A C     1 
ATOM   355  O  O     . LEU A 1 44  ? -15.722 6.554   5.301   1.00 36.98 ? 46  LEU A O     1 
ATOM   356  C  CB    . LEU A 1 44  ? -14.089 8.809   6.520   1.00 28.09 ? 46  LEU A CB    1 
ATOM   357  C  CG    . LEU A 1 44  ? -13.641 9.958   7.426   1.00 34.39 ? 46  LEU A CG    1 
ATOM   358  C  CD1   . LEU A 1 44  ? -12.322 10.544  6.942   1.00 54.10 ? 46  LEU A CD1   1 
ATOM   359  C  CD2   . LEU A 1 44  ? -14.733 11.023  7.478   1.00 46.28 ? 46  LEU A CD2   1 
ATOM   360  N  N     . ILE A 1 45  ? -17.301 7.653   6.457   1.00 21.42 ? 47  ILE A N     1 
ATOM   361  C  CA    . ILE A 1 45  ? -18.381 7.220   5.587   1.00 25.03 ? 47  ILE A CA    1 
ATOM   362  C  C     . ILE A 1 45  ? -19.265 8.427   5.285   1.00 35.17 ? 47  ILE A C     1 
ATOM   363  O  O     . ILE A 1 45  ? -19.331 9.375   6.069   1.00 30.49 ? 47  ILE A O     1 
ATOM   364  C  CB    . ILE A 1 45  ? -19.187 6.058   6.236   1.00 29.11 ? 47  ILE A CB    1 
ATOM   365  C  CG1   . ILE A 1 45  ? -19.935 5.250   5.177   1.00 40.35 ? 47  ILE A CG1   1 
ATOM   366  C  CG2   . ILE A 1 45  ? -20.134 6.570   7.323   1.00 30.96 ? 47  ILE A CG2   1 
ATOM   367  C  CD1   . ILE A 1 45  ? -20.740 4.101   5.751   1.00 40.27 ? 47  ILE A CD1   1 
ATOM   368  N  N     . THR A 1 46  ? -19.900 8.420   4.122   1.00 23.28 ? 48  THR A N     1 
ATOM   369  C  CA    . THR A 1 46  ? -20.873 9.448   3.785   1.00 27.27 ? 48  THR A CA    1 
ATOM   370  C  C     . THR A 1 46  ? -22.249 8.809   3.774   1.00 37.99 ? 48  THR A C     1 
ATOM   371  O  O     . THR A 1 46  ? -22.493 7.866   3.024   1.00 37.18 ? 48  THR A O     1 
ATOM   372  C  CB    . THR A 1 46  ? -20.599 10.084  2.404   1.00 27.33 ? 48  THR A CB    1 
ATOM   373  O  OG1   . THR A 1 46  ? -19.328 10.743  2.418   1.00 32.10 ? 48  THR A OG1   1 
ATOM   374  C  CG2   . THR A 1 46  ? -21.671 11.101  2.075   1.00 38.21 ? 48  THR A CG2   1 
ATOM   375  N  N     . VAL A 1 47  ? -23.139 9.297   4.633   1.00 35.76 ? 49  VAL A N     1 
ATOM   376  C  CA    . VAL A 1 47  ? -24.502 8.788   4.680   1.00 30.65 ? 49  VAL A CA    1 
ATOM   377  C  C     . VAL A 1 47  ? -25.447 9.893   4.245   1.00 38.07 ? 49  VAL A C     1 
ATOM   378  O  O     . VAL A 1 47  ? -25.503 10.946  4.880   1.00 42.41 ? 49  VAL A O     1 
ATOM   379  C  CB    . VAL A 1 47  ? -24.894 8.339   6.093   1.00 37.09 ? 49  VAL A CB    1 
ATOM   380  C  CG1   . VAL A 1 47  ? -26.341 7.843   6.114   1.00 37.31 ? 49  VAL A CG1   1 
ATOM   381  C  CG2   . VAL A 1 47  ? -23.939 7.265   6.602   1.00 38.14 ? 49  VAL A CG2   1 
ATOM   382  N  N     . ASN A 1 48  ? -26.177 9.657   3.157   1.00 38.72 ? 50  ASN A N     1 
ATOM   383  C  CA    . ASN A 1 48  ? -27.154 10.625  2.652   1.00 41.98 ? 50  ASN A CA    1 
ATOM   384  C  C     . ASN A 1 48  ? -26.568 12.018  2.492   1.00 38.70 ? 50  ASN A C     1 
ATOM   385  O  O     . ASN A 1 48  ? -27.175 13.001  2.911   1.00 43.70 ? 50  ASN A O     1 
ATOM   386  C  CB    . ASN A 1 48  ? -28.378 10.700  3.577   1.00 46.49 ? 50  ASN A CB    1 
ATOM   387  C  CG    . ASN A 1 48  ? -29.147 9.392   3.650   1.00 50.10 ? 50  ASN A CG    1 
ATOM   388  O  OD1   . ASN A 1 48  ? -28.740 8.375   3.080   1.00 62.21 ? 50  ASN A OD1   1 
ATOM   389  N  ND2   . ASN A 1 48  ? -30.266 9.411   4.361   1.00 40.85 ? 50  ASN A ND2   1 
ATOM   390  N  N     . GLY A 1 49  ? -25.385 12.101  1.897   1.00 30.22 ? 51  GLY A N     1 
ATOM   391  C  CA    . GLY A 1 49  ? -24.740 13.381  1.674   1.00 36.46 ? 51  GLY A CA    1 
ATOM   392  C  C     . GLY A 1 49  ? -23.987 13.914  2.883   1.00 37.44 ? 51  GLY A C     1 
ATOM   393  O  O     . GLY A 1 49  ? -23.258 14.896  2.775   1.00 38.58 ? 51  GLY A O     1 
ATOM   394  N  N     . GLN A 1 50  ? -24.150 13.261  4.031   1.00 35.63 ? 52  GLN A N     1 
ATOM   395  C  CA    . GLN A 1 50  ? -23.552 13.738  5.278   1.00 33.60 ? 52  GLN A CA    1 
ATOM   396  C  C     . GLN A 1 50  ? -22.296 12.953  5.661   1.00 26.83 ? 52  GLN A C     1 
ATOM   397  O  O     . GLN A 1 50  ? -22.326 11.723  5.759   1.00 28.26 ? 52  GLN A O     1 
ATOM   398  C  CB    . GLN A 1 50  ? -24.581 13.653  6.411   1.00 40.21 ? 52  GLN A CB    1 
ATOM   399  C  CG    . GLN A 1 50  ? -24.037 14.032  7.779   1.00 35.94 ? 52  GLN A CG    1 
ATOM   400  C  CD    . GLN A 1 50  ? -23.717 15.508  7.883   1.00 34.80 ? 52  GLN A CD    1 
ATOM   401  O  OE1   . GLN A 1 50  ? -22.559 15.896  8.062   1.00 40.32 ? 52  GLN A OE1   1 
ATOM   402  N  NE2   . GLN A 1 50  ? -24.744 16.342  7.773   1.00 49.86 ? 52  GLN A NE2   1 
ATOM   403  N  N     . GLU A 1 51  ? -21.200 13.665  5.898   1.00 23.61 ? 53  GLU A N     1 
ATOM   404  C  CA    . GLU A 1 51  ? -19.940 13.025  6.272   1.00 36.73 ? 53  GLU A CA    1 
ATOM   405  C  C     . GLU A 1 51  ? -19.867 12.637  7.764   1.00 28.11 ? 53  GLU A C     1 
ATOM   406  O  O     . GLU A 1 51  ? -20.095 13.470  8.641   1.00 27.69 ? 53  GLU A O     1 
ATOM   407  C  CB    . GLU A 1 51  ? -18.772 13.933  5.903   1.00 36.64 ? 53  GLU A CB    1 
ATOM   408  C  CG    . GLU A 1 51  ? -17.407 13.293  6.037   1.00 52.10 ? 53  GLU A CG    1 
ATOM   409  C  CD    . GLU A 1 51  ? -16.310 14.166  5.449   1.00 72.02 ? 53  GLU A CD    1 
ATOM   410  O  OE1   . GLU A 1 51  ? -16.648 15.195  4.824   1.00 67.62 ? 53  GLU A OE1   1 
ATOM   411  O  OE2   . GLU A 1 51  ? -15.115 13.827  5.610   1.00 70.87 ? 53  GLU A OE2   1 
ATOM   412  N  N     . TYR A 1 52  ? -19.546 11.373  8.037   1.00 18.73 ? 54  TYR A N     1 
ATOM   413  C  CA    . TYR A 1 52  ? -19.432 10.868  9.417   1.00 27.79 ? 54  TYR A CA    1 
ATOM   414  C  C     . TYR A 1 52  ? -18.053 10.309  9.704   1.00 32.18 ? 54  TYR A C     1 
ATOM   415  O  O     . TYR A 1 52  ? -17.549 9.497   8.924   1.00 27.98 ? 54  TYR A O     1 
ATOM   416  C  CB    . TYR A 1 52  ? -20.423 9.726   9.648   1.00 29.91 ? 54  TYR A CB    1 
ATOM   417  C  CG    . TYR A 1 52  ? -21.848 10.158  9.810   1.00 26.03 ? 54  TYR A CG    1 
ATOM   418  C  CD1   . TYR A 1 52  ? -22.374 10.412  11.070  1.00 25.79 ? 54  TYR A CD1   1 
ATOM   419  C  CD2   . TYR A 1 52  ? -22.672 10.321  8.711   1.00 28.35 ? 54  TYR A CD2   1 
ATOM   420  C  CE1   . TYR A 1 52  ? -23.687 10.814  11.226  1.00 26.68 ? 54  TYR A CE1   1 
ATOM   421  C  CE2   . TYR A 1 52  ? -23.981 10.731  8.860   1.00 26.99 ? 54  TYR A CE2   1 
ATOM   422  C  CZ    . TYR A 1 52  ? -24.483 10.970  10.118  1.00 26.57 ? 54  TYR A CZ    1 
ATOM   423  O  OH    . TYR A 1 52  ? -25.789 11.367  10.267  1.00 39.93 ? 54  TYR A OH    1 
ATOM   424  N  N     . HIS A 1 53  ? -17.434 10.740  10.802  1.00 21.42 ? 55  HIS A N     1 
ATOM   425  C  CA    A HIS A 1 53  ? -16.206 10.096  11.258  0.54 27.56 ? 55  HIS A CA    1 
ATOM   426  C  CA    B HIS A 1 53  ? -16.200 10.126  11.277  0.46 27.61 ? 55  HIS A CA    1 
ATOM   427  C  C     . HIS A 1 53  ? -16.555 9.084   12.341  1.00 29.03 ? 55  HIS A C     1 
ATOM   428  O  O     . HIS A 1 53  ? -17.053 9.439   13.405  1.00 29.02 ? 55  HIS A O     1 
ATOM   429  C  CB    A HIS A 1 53  ? -15.170 11.100  11.777  0.54 33.14 ? 55  HIS A CB    1 
ATOM   430  C  CB    B HIS A 1 53  ? -15.254 11.181  11.867  0.46 33.23 ? 55  HIS A CB    1 
ATOM   431  C  CG    A HIS A 1 53  ? -13.922 10.456  12.300  0.54 34.73 ? 55  HIS A CG    1 
ATOM   432  C  CG    B HIS A 1 53  ? -14.599 12.060  10.844  0.46 35.63 ? 55  HIS A CG    1 
ATOM   433  N  ND1   A HIS A 1 53  ? -12.737 10.434  11.594  0.54 39.19 ? 55  HIS A ND1   1 
ATOM   434  N  ND1   B HIS A 1 53  ? -15.285 13.017  10.132  0.46 39.19 ? 55  HIS A ND1   1 
ATOM   435  C  CD2   A HIS A 1 53  ? -13.678 9.784   13.454  0.54 38.78 ? 55  HIS A CD2   1 
ATOM   436  C  CD2   B HIS A 1 53  ? -13.311 12.130  10.424  0.46 37.96 ? 55  HIS A CD2   1 
ATOM   437  C  CE1   A HIS A 1 53  ? -11.818 9.790   12.293  0.54 38.17 ? 55  HIS A CE1   1 
ATOM   438  C  CE1   B HIS A 1 53  ? -14.454 13.637  9.311   0.46 37.61 ? 55  HIS A CE1   1 
ATOM   439  N  NE2   A HIS A 1 53  ? -12.367 9.384   13.425  0.54 33.59 ? 55  HIS A NE2   1 
ATOM   440  N  NE2   B HIS A 1 53  ? -13.251 13.118  9.469   0.46 38.94 ? 55  HIS A NE2   1 
ATOM   441  N  N     . LEU A 1 54  ? -16.301 7.814   12.046  1.00 24.61 ? 56  LEU A N     1 
ATOM   442  C  CA    . LEU A 1 54  ? -16.679 6.710   12.923  1.00 22.58 ? 56  LEU A CA    1 
ATOM   443  C  C     . LEU A 1 54  ? -15.524 6.160   13.756  1.00 28.67 ? 56  LEU A C     1 
ATOM   444  O  O     . LEU A 1 54  ? -14.391 6.034   13.279  1.00 27.20 ? 56  LEU A O     1 
ATOM   445  C  CB    . LEU A 1 54  ? -17.280 5.573   12.085  1.00 24.10 ? 56  LEU A CB    1 
ATOM   446  C  CG    . LEU A 1 54  ? -18.775 5.544   11.768  1.00 33.02 ? 56  LEU A CG    1 
ATOM   447  C  CD1   . LEU A 1 54  ? -19.448 6.901   11.939  1.00 23.66 ? 56  LEU A CD1   1 
ATOM   448  C  CD2   . LEU A 1 54  ? -19.039 4.951   10.375  1.00 30.06 ? 56  LEU A CD2   1 
ATOM   449  N  N     . GLN A 1 55  ? -15.821 5.850   15.013  1.00 26.30 ? 57  GLN A N     1 
ATOM   450  C  CA    . GLN A 1 55  ? -14.948 5.023   15.824  1.00 24.43 ? 57  GLN A CA    1 
ATOM   451  C  C     . GLN A 1 55  ? -15.754 3.783   16.128  1.00 20.08 ? 57  GLN A C     1 
ATOM   452  O  O     . GLN A 1 55  ? -16.812 3.867   16.748  1.00 16.65 ? 57  GLN A O     1 
ATOM   453  C  CB    . GLN A 1 55  ? -14.589 5.703   17.145  1.00 29.28 ? 57  GLN A CB    1 
ATOM   454  C  CG    . GLN A 1 55  ? -13.586 6.827   17.044  1.00 39.15 ? 57  GLN A CG    1 
ATOM   455  C  CD    . GLN A 1 55  ? -13.473 7.591   18.353  1.00 58.12 ? 57  GLN A CD    1 
ATOM   456  O  OE1   . GLN A 1 55  ? -14.278 8.488   18.632  1.00 46.40 ? 57  GLN A OE1   1 
ATOM   457  N  NE2   . GLN A 1 55  ? -12.483 7.228   19.173  1.00 42.33 ? 57  GLN A NE2   1 
ATOM   458  N  N     . LEU A 1 56  ? -15.252 2.636   15.698  1.00 16.73 ? 58  LEU A N     1 
ATOM   459  C  CA    . LEU A 1 56  ? -15.984 1.394   15.865  1.00 20.69 ? 58  LEU A CA    1 
ATOM   460  C  C     . LEU A 1 56  ? -15.273 0.594   16.927  1.00 20.41 ? 58  LEU A C     1 
ATOM   461  O  O     . LEU A 1 56  ? -14.096 0.250   16.779  1.00 18.01 ? 58  LEU A O     1 
ATOM   462  C  CB    . LEU A 1 56  ? -16.067 0.652   14.520  1.00 20.87 ? 58  LEU A CB    1 
ATOM   463  C  CG    . LEU A 1 56  ? -16.646 1.609   13.469  1.00 24.45 ? 58  LEU A CG    1 
ATOM   464  C  CD1   . LEU A 1 56  ? -16.577 1.034   12.076  1.00 28.31 ? 58  LEU A CD1   1 
ATOM   465  C  CD2   . LEU A 1 56  ? -18.082 2.048   13.824  1.00 21.63 ? 58  LEU A CD2   1 
ATOM   466  N  N     . VAL A 1 57  ? -15.972 0.356   18.033  1.00 18.55 ? 59  VAL A N     1 
ATOM   467  C  CA    . VAL A 1 57  ? -15.385 -0.354  19.150  1.00 20.74 ? 59  VAL A CA    1 
ATOM   468  C  C     . VAL A 1 57  ? -15.798 -1.817  19.090  1.00 16.30 ? 59  VAL A C     1 
ATOM   469  O  O     . VAL A 1 57  ? -16.895 -2.184  19.505  1.00 18.18 ? 59  VAL A O     1 
ATOM   470  C  CB    . VAL A 1 57  ? -15.808 0.258   20.509  1.00 15.33 ? 59  VAL A CB    1 
ATOM   471  C  CG1   . VAL A 1 57  ? -15.031 -0.397  21.627  1.00 23.37 ? 59  VAL A CG1   1 
ATOM   472  C  CG2   . VAL A 1 57  ? -15.591 1.770   20.496  1.00 17.76 ? 59  VAL A CG2   1 
ATOM   473  N  N     . ASP A 1 58  ? -14.901 -2.638  18.555  1.00 18.76 ? 60  ASP A N     1 
ATOM   474  C  CA    . ASP A 1 58  ? -15.116 -4.061  18.390  1.00 20.86 ? 60  ASP A CA    1 
ATOM   475  C  C     . ASP A 1 58  ? -14.717 -4.766  19.686  1.00 17.76 ? 60  ASP A C     1 
ATOM   476  O  O     . ASP A 1 58  ? -13.562 -5.139  19.862  1.00 19.15 ? 60  ASP A O     1 
ATOM   477  C  CB    . ASP A 1 58  ? -14.249 -4.557  17.233  1.00 21.11 ? 60  ASP A CB    1 
ATOM   478  C  CG    . ASP A 1 58  ? -14.294 -6.064  17.067  1.00 24.13 ? 60  ASP A CG    1 
ATOM   479  O  OD1   . ASP A 1 58  ? -15.337 -6.673  17.387  1.00 17.83 ? 60  ASP A OD1   1 
ATOM   480  O  OD2   . ASP A 1 58  ? -13.281 -6.641  16.625  1.00 19.64 ? 60  ASP A OD2   1 
ATOM   481  N  N     . THR A 1 59  ? -15.670 -4.932  20.597  1.00 17.93 ? 61  THR A N     1 
ATOM   482  C  CA    . THR A 1 59  ? -15.351 -5.491  21.908  1.00 21.57 ? 61  THR A CA    1 
ATOM   483  C  C     . THR A 1 59  ? -14.951 -6.951  21.783  1.00 25.77 ? 61  THR A C     1 
ATOM   484  O  O     . THR A 1 59  ? -15.336 -7.621  20.831  1.00 20.50 ? 61  THR A O     1 
ATOM   485  C  CB    . THR A 1 59  ? -16.535 -5.338  22.896  1.00 20.19 ? 61  THR A CB    1 
ATOM   486  O  OG1   . THR A 1 59  ? -17.603 -6.227  22.532  1.00 16.36 ? 61  THR A OG1   1 
ATOM   487  C  CG2   . THR A 1 59  ? -17.044 -3.908  22.872  1.00 18.79 ? 61  THR A CG2   1 
ATOM   488  N  N     . ALA A 1 60  ? -14.137 -7.435  22.716  1.00 24.80 ? 62  ALA A N     1 
ATOM   489  C  CA    . ALA A 1 60  ? -13.988 -8.862  22.865  1.00 31.99 ? 62  ALA A CA    1 
ATOM   490  C  C     . ALA A 1 60  ? -15.353 -9.234  23.416  1.00 22.28 ? 62  ALA A C     1 
ATOM   491  O  O     . ALA A 1 60  ? -15.989 -8.425  24.084  1.00 43.63 ? 62  ALA A O     1 
ATOM   492  C  CB    . ALA A 1 60  ? -12.887 -9.188  23.855  1.00 32.10 ? 62  ALA A CB    1 
ATOM   493  N  N     . GLY A 1 61  ? -15.832 -10.424 23.134  1.00 31.97 ? 63  GLY A N     1 
ATOM   494  C  CA    . GLY A 1 61  ? -17.229 -10.691 23.420  1.00 28.03 ? 63  GLY A CA    1 
ATOM   495  C  C     . GLY A 1 61  ? -17.655 -10.642 24.875  1.00 33.18 ? 63  GLY A C     1 
ATOM   496  O  O     . GLY A 1 61  ? -16.863 -10.395 25.795  1.00 21.85 ? 63  GLY A O     1 
ATOM   497  N  N     . GLN A 1 62  ? -18.944 -10.859 25.084  1.00 19.12 ? 64  GLN A N     1 
ATOM   498  C  CA    . GLN A 1 62  ? -19.409 -11.126 26.414  1.00 18.77 ? 64  GLN A CA    1 
ATOM   499  C  C     . GLN A 1 62  ? -20.350 -12.335 26.448  1.00 24.77 ? 64  GLN A C     1 
ATOM   500  O  O     . GLN A 1 62  ? -20.945 -12.711 25.438  1.00 23.07 ? 64  GLN A O     1 
ATOM   501  C  CB    . GLN A 1 62  ? -19.938 -9.861  27.116  1.00 27.70 ? 64  GLN A CB    1 
ATOM   502  C  CG    . GLN A 1 62  ? -20.750 -8.865  26.329  1.00 34.41 ? 64  GLN A CG    1 
ATOM   503  C  CD    . GLN A 1 62  ? -20.013 -8.151  25.189  1.00 23.20 ? 64  GLN A CD    1 
ATOM   504  O  OE1   . GLN A 1 62  ? -18.909 -7.611  25.323  1.00 28.67 ? 64  GLN A OE1   1 
ATOM   505  N  NE2   . GLN A 1 62  ? -20.663 -8.119  24.069  1.00 16.57 ? 64  GLN A NE2   1 
ATOM   506  N  N     . ASP A 1 63  ? -20.422 -12.991 27.594  1.00 18.66 ? 65  ASP A N     1 
ATOM   507  C  CA    . ASP A 1 63  ? -21.349 -14.100 27.746  1.00 17.92 ? 65  ASP A CA    1 
ATOM   508  C  C     . ASP A 1 63  ? -22.254 -13.779 28.922  1.00 19.45 ? 65  ASP A C     1 
ATOM   509  O  O     . ASP A 1 63  ? -22.277 -12.631 29.380  1.00 20.15 ? 65  ASP A O     1 
ATOM   510  C  CB    . ASP A 1 63  ? -20.599 -15.425 27.913  1.00 17.24 ? 65  ASP A CB    1 
ATOM   511  C  CG    . ASP A 1 63  ? -19.638 -15.409 29.083  1.00 19.08 ? 65  ASP A CG    1 
ATOM   512  O  OD1   . ASP A 1 63  ? -19.871 -14.632 30.033  1.00 17.19 ? 65  ASP A OD1   1 
ATOM   513  O  OD2   . ASP A 1 63  ? -18.650 -16.174 29.054  1.00 27.10 ? 65  ASP A OD2   1 
ATOM   514  N  N     . GLU A 1 64  ? -23.006 -14.766 29.404  1.00 18.13 ? 66  GLU A N     1 
ATOM   515  C  CA    . GLU A 1 64  ? -23.992 -14.506 30.440  1.00 18.16 ? 66  GLU A CA    1 
ATOM   516  C  C     . GLU A 1 64  ? -23.315 -14.082 31.740  1.00 19.05 ? 66  GLU A C     1 
ATOM   517  O  O     . GLU A 1 64  ? -23.971 -13.564 32.624  1.00 19.11 ? 66  GLU A O     1 
ATOM   518  C  CB    . GLU A 1 64  ? -24.864 -15.740 30.751  1.00 22.08 ? 66  GLU A CB    1 
ATOM   519  C  CG    . GLU A 1 64  ? -25.122 -16.667 29.597  1.00 43.31 ? 66  GLU A CG    1 
ATOM   520  C  CD    . GLU A 1 64  ? -24.034 -17.701 29.464  1.00 34.92 ? 66  GLU A CD    1 
ATOM   521  O  OE1   . GLU A 1 64  ? -24.190 -18.818 30.021  1.00 35.02 ? 66  GLU A OE1   1 
ATOM   522  O  OE2   . GLU A 1 64  ? -23.019 -17.386 28.812  1.00 21.45 ? 66  GLU A OE2   1 
ATOM   523  N  N     . TYR A 1 65  ? -22.018 -14.326 31.866  1.00 21.00 ? 67  TYR A N     1 
ATOM   524  C  CA    . TYR A 1 65  ? -21.350 -14.077 33.143  1.00 18.40 ? 67  TYR A CA    1 
ATOM   525  C  C     . TYR A 1 65  ? -20.554 -12.796 33.112  1.00 26.66 ? 67  TYR A C     1 
ATOM   526  O  O     . TYR A 1 65  ? -20.011 -12.385 34.129  1.00 21.80 ? 67  TYR A O     1 
ATOM   527  C  CB    . TYR A 1 65  ? -20.469 -15.270 33.531  1.00 17.97 ? 67  TYR A CB    1 
ATOM   528  C  CG    . TYR A 1 65  ? -21.251 -16.550 33.499  1.00 24.32 ? 67  TYR A CG    1 
ATOM   529  C  CD1   . TYR A 1 65  ? -21.103 -17.457 32.452  1.00 21.52 ? 67  TYR A CD1   1 
ATOM   530  C  CD2   . TYR A 1 65  ? -22.175 -16.836 34.490  1.00 16.55 ? 67  TYR A CD2   1 
ATOM   531  C  CE1   . TYR A 1 65  ? -21.849 -18.616 32.402  1.00 21.30 ? 67  TYR A CE1   1 
ATOM   532  C  CE2   . TYR A 1 65  ? -22.919 -17.999 34.459  1.00 26.22 ? 67  TYR A CE2   1 
ATOM   533  C  CZ    . TYR A 1 65  ? -22.754 -18.884 33.408  1.00 27.64 ? 67  TYR A CZ    1 
ATOM   534  O  OH    . TYR A 1 65  ? -23.489 -20.038 33.366  1.00 40.21 ? 67  TYR A OH    1 
ATOM   535  N  N     . SER A 1 66  ? -20.504 -12.149 31.945  1.00 21.88 ? 68  SER A N     1 
ATOM   536  C  CA    . SER A 1 66  ? -19.724 -10.933 31.814  1.00 19.70 ? 68  SER A CA    1 
ATOM   537  C  C     . SER A 1 66  ? -20.328 -9.777  32.609  1.00 27.09 ? 68  SER A C     1 
ATOM   538  O  O     . SER A 1 66  ? -21.547 -9.652  32.740  1.00 23.95 ? 68  SER A O     1 
ATOM   539  C  CB    . SER A 1 66  ? -19.559 -10.538 30.343  1.00 20.04 ? 68  SER A CB    1 
ATOM   540  O  OG    . SER A 1 66  ? -18.749 -11.482 29.676  1.00 21.35 ? 68  SER A OG    1 
ATOM   541  N  N     . ILE A 1 67  ? -19.455 -8.932  33.138  1.00 19.10 ? 69  ILE A N     1 
ATOM   542  C  CA    . ILE A 1 67  ? -19.878 -7.758  33.875  1.00 20.32 ? 69  ILE A CA    1 
ATOM   543  C  C     . ILE A 1 67  ? -20.127 -6.551  32.974  1.00 22.32 ? 69  ILE A C     1 
ATOM   544  O  O     . ILE A 1 67  ? -19.333 -6.229  32.094  1.00 22.68 ? 69  ILE A O     1 
ATOM   545  C  CB    . ILE A 1 67  ? -18.836 -7.395  34.930  1.00 22.87 ? 69  ILE A CB    1 
ATOM   546  C  CG1   . ILE A 1 67  ? -18.872 -8.445  36.041  1.00 26.65 ? 69  ILE A CG1   1 
ATOM   547  C  CG2   . ILE A 1 67  ? -19.091 -5.986  35.483  1.00 17.62 ? 69  ILE A CG2   1 
ATOM   548  C  CD1   . ILE A 1 67  ? -17.723 -8.339  36.960  1.00 38.13 ? 69  ILE A CD1   1 
ATOM   549  N  N     . PHE A 1 68  ? -21.242 -5.880  33.213  1.00 24.37 ? 70  PHE A N     1 
ATOM   550  C  CA    . PHE A 1 68  ? -21.517 -4.610  32.556  1.00 25.22 ? 70  PHE A CA    1 
ATOM   551  C  C     . PHE A 1 68  ? -21.381 -3.457  33.548  1.00 32.39 ? 70  PHE A C     1 
ATOM   552  O  O     . PHE A 1 68  ? -21.881 -3.540  34.662  1.00 34.06 ? 70  PHE A O     1 
ATOM   553  C  CB    . PHE A 1 68  ? -22.922 -4.621  31.970  1.00 23.70 ? 70  PHE A CB    1 
ATOM   554  C  CG    . PHE A 1 68  ? -23.012 -5.344  30.677  1.00 20.63 ? 70  PHE A CG    1 
ATOM   555  C  CD1   . PHE A 1 68  ? -23.247 -4.651  29.502  1.00 28.01 ? 70  PHE A CD1   1 
ATOM   556  C  CD2   . PHE A 1 68  ? -22.811 -6.714  30.620  1.00 26.00 ? 70  PHE A CD2   1 
ATOM   557  C  CE1   . PHE A 1 68  ? -23.311 -5.313  28.292  1.00 28.32 ? 70  PHE A CE1   1 
ATOM   558  C  CE2   . PHE A 1 68  ? -22.880 -7.386  29.417  1.00 25.69 ? 70  PHE A CE2   1 
ATOM   559  C  CZ    . PHE A 1 68  ? -23.122 -6.683  28.248  1.00 25.46 ? 70  PHE A CZ    1 
ATOM   560  N  N     . PRO A 1 69  ? -20.700 -2.375  33.143  1.00 39.12 ? 71  PRO A N     1 
ATOM   561  C  CA    . PRO A 1 69  ? -20.655 -1.182  33.996  1.00 28.60 ? 71  PRO A CA    1 
ATOM   562  C  C     . PRO A 1 69  ? -22.065 -0.812  34.430  1.00 30.48 ? 71  PRO A C     1 
ATOM   563  O  O     . PRO A 1 69  ? -23.017 -1.134  33.726  1.00 33.97 ? 71  PRO A O     1 
ATOM   564  C  CB    . PRO A 1 69  ? -20.050 -0.102  33.076  1.00 32.20 ? 71  PRO A CB    1 
ATOM   565  C  CG    . PRO A 1 69  ? -19.993 -0.702  31.704  1.00 31.74 ? 71  PRO A CG    1 
ATOM   566  C  CD    . PRO A 1 69  ? -19.986 -2.187  31.870  1.00 30.42 ? 71  PRO A CD    1 
ATOM   567  N  N     . GLN A 1 70  ? -22.214 -0.156  35.577  1.00 34.43 ? 72  GLN A N     1 
ATOM   568  C  CA    A GLN A 1 70  ? -23.536 0.194   36.088  0.44 39.87 ? 72  GLN A CA    1 
ATOM   569  C  CA    B GLN A 1 70  ? -23.549 0.189   36.066  0.56 39.92 ? 72  GLN A CA    1 
ATOM   570  C  C     . GLN A 1 70  ? -24.037 1.537   35.544  1.00 38.45 ? 72  GLN A C     1 
ATOM   571  O  O     . GLN A 1 70  ? -25.183 1.936   35.791  1.00 41.02 ? 72  GLN A O     1 
ATOM   572  C  CB    A GLN A 1 70  ? -23.545 0.183   37.620  0.44 43.73 ? 72  GLN A CB    1 
ATOM   573  C  CB    B GLN A 1 70  ? -23.611 0.160   37.589  0.56 43.77 ? 72  GLN A CB    1 
ATOM   574  C  CG    A GLN A 1 70  ? -22.525 1.116   38.275  0.44 37.65 ? 72  GLN A CG    1 
ATOM   575  C  CG    B GLN A 1 70  ? -24.997 0.423   38.133  0.56 43.80 ? 72  GLN A CG    1 
ATOM   576  C  CD    A GLN A 1 70  ? -21.189 1.126   37.552  0.44 33.82 ? 72  GLN A CD    1 
ATOM   577  C  CD    B GLN A 1 70  ? -26.018 -0.568  37.612  0.56 46.42 ? 72  GLN A CD    1 
ATOM   578  O  OE1   A GLN A 1 70  ? -20.463 0.132   37.532  0.44 21.96 ? 72  GLN A OE1   1 
ATOM   579  O  OE1   B GLN A 1 70  ? -26.580 -0.388  36.533  0.56 49.84 ? 72  GLN A OE1   1 
ATOM   580  N  NE2   A GLN A 1 70  ? -20.865 2.258   36.939  0.44 39.02 ? 72  GLN A NE2   1 
ATOM   581  N  NE2   B GLN A 1 70  ? -26.269 -1.619  38.382  0.56 51.91 ? 72  GLN A NE2   1 
ATOM   582  N  N     . THR A 1 71  ? -23.186 2.229   34.795  1.00 30.62 ? 73  THR A N     1 
ATOM   583  C  CA    . THR A 1 71  ? -23.601 3.487   34.172  1.00 27.07 ? 73  THR A CA    1 
ATOM   584  C  C     . THR A 1 71  ? -23.006 3.696   32.767  1.00 26.76 ? 73  THR A C     1 
ATOM   585  O  O     . THR A 1 71  ? -21.976 3.124   32.414  1.00 19.89 ? 73  THR A O     1 
ATOM   586  C  CB    . THR A 1 71  ? -23.325 4.698   35.112  1.00 39.52 ? 73  THR A CB    1 
ATOM   587  O  OG1   . THR A 1 71  ? -23.991 5.865   34.611  1.00 38.56 ? 73  THR A OG1   1 
ATOM   588  C  CG2   . THR A 1 71  ? -21.828 4.957   35.257  1.00 28.93 ? 73  THR A CG2   1 
ATOM   589  N  N     . TYR A 1 72  ? -23.663 4.525   31.964  1.00 27.45 ? 74  TYR A N     1 
ATOM   590  C  CA    . TYR A 1 72  ? -23.335 4.604   30.542  1.00 25.97 ? 74  TYR A CA    1 
ATOM   591  C  C     . TYR A 1 72  ? -22.233 5.610   30.207  1.00 22.24 ? 74  TYR A C     1 
ATOM   592  O  O     . TYR A 1 72  ? -21.867 6.464   31.019  1.00 25.14 ? 74  TYR A O     1 
ATOM   593  C  CB    . TYR A 1 72  ? -24.598 4.880   29.709  1.00 31.32 ? 74  TYR A CB    1 
ATOM   594  C  CG    . TYR A 1 72  ? -25.202 6.237   29.947  1.00 29.96 ? 74  TYR A CG    1 
ATOM   595  C  CD1   . TYR A 1 72  ? -25.055 7.255   29.012  1.00 20.69 ? 74  TYR A CD1   1 
ATOM   596  C  CD2   . TYR A 1 72  ? -25.899 6.516   31.121  1.00 27.12 ? 74  TYR A CD2   1 
ATOM   597  C  CE1   . TYR A 1 72  ? -25.597 8.508   29.235  1.00 27.22 ? 74  TYR A CE1   1 
ATOM   598  C  CE2   . TYR A 1 72  ? -26.445 7.776   31.354  1.00 30.59 ? 74  TYR A CE2   1 
ATOM   599  C  CZ    . TYR A 1 72  ? -26.293 8.766   30.405  1.00 33.67 ? 74  TYR A CZ    1 
ATOM   600  O  OH    . TYR A 1 72  ? -26.835 10.017  30.620  1.00 29.88 ? 74  TYR A OH    1 
ATOM   601  N  N     . SER A 1 73  ? -21.687 5.467   29.009  1.00 19.73 ? 75  SER A N     1 
ATOM   602  C  CA    . SER A 1 73  ? -20.713 6.395   28.473  1.00 25.16 ? 75  SER A CA    1 
ATOM   603  C  C     . SER A 1 73  ? -21.430 7.338   27.514  1.00 29.32 ? 75  SER A C     1 
ATOM   604  O  O     . SER A 1 73  ? -21.959 6.917   26.483  1.00 22.48 ? 75  SER A O     1 
ATOM   605  C  CB    . SER A 1 73  ? -19.615 5.653   27.709  1.00 31.04 ? 75  SER A CB    1 
ATOM   606  O  OG    . SER A 1 73  ? -19.196 4.483   28.380  1.00 33.42 ? 75  SER A OG    1 
ATOM   607  N  N     . ILE A 1 74  ? -21.437 8.613   27.875  1.00 16.25 ? 76  ILE A N     1 
ATOM   608  C  CA    . ILE A 1 74  ? -22.065 9.668   27.102  1.00 21.21 ? 76  ILE A CA    1 
ATOM   609  C  C     . ILE A 1 74  ? -21.480 9.730   25.688  1.00 18.64 ? 76  ILE A C     1 
ATOM   610  O  O     . ILE A 1 74  ? -22.147 10.157  24.752  1.00 28.97 ? 76  ILE A O     1 
ATOM   611  C  CB    . ILE A 1 74  ? -21.829 11.018  27.821  1.00 29.36 ? 76  ILE A CB    1 
ATOM   612  C  CG1   . ILE A 1 74  ? -23.067 11.903  27.787  1.00 37.71 ? 76  ILE A CG1   1 
ATOM   613  C  CG2   . ILE A 1 74  ? -20.620 11.736  27.255  1.00 27.67 ? 76  ILE A CG2   1 
ATOM   614  C  CD1   . ILE A 1 74  ? -22.909 13.145  28.647  1.00 28.63 ? 76  ILE A CD1   1 
ATOM   615  N  N     . ASP A 1 75  ? -20.237 9.291   25.537  1.00 18.57 ? 77  ASP A N     1 
ATOM   616  C  CA    . ASP A 1 75  ? -19.561 9.361   24.250  1.00 29.98 ? 77  ASP A CA    1 
ATOM   617  C  C     . ASP A 1 75  ? -19.862 8.184   23.313  1.00 23.02 ? 77  ASP A C     1 
ATOM   618  O  O     . ASP A 1 75  ? -19.348 8.141   22.204  1.00 21.11 ? 77  ASP A O     1 
ATOM   619  C  CB    . ASP A 1 75  ? -18.050 9.544   24.436  1.00 29.34 ? 77  ASP A CB    1 
ATOM   620  C  CG    . ASP A 1 75  ? -17.342 8.259   24.838  1.00 31.11 ? 77  ASP A CG    1 
ATOM   621  O  OD1   . ASP A 1 75  ? -17.998 7.360   25.412  1.00 27.75 ? 77  ASP A OD1   1 
ATOM   622  O  OD2   . ASP A 1 75  ? -16.124 8.152   24.567  1.00 29.53 ? 77  ASP A OD2   1 
ATOM   623  N  N     . ILE A 1 76  ? -20.679 7.231   23.757  1.00 20.76 ? 78  ILE A N     1 
ATOM   624  C  CA    A ILE A 1 76  ? -21.118 6.124   22.900  0.49 22.47 ? 78  ILE A CA    1 
ATOM   625  C  CA    B ILE A 1 76  ? -21.100 6.153   22.869  0.51 22.48 ? 78  ILE A CA    1 
ATOM   626  C  C     . ILE A 1 76  ? -22.476 6.438   22.280  1.00 20.08 ? 78  ILE A C     1 
ATOM   627  O  O     . ILE A 1 76  ? -23.454 6.642   22.999  1.00 19.02 ? 78  ILE A O     1 
ATOM   628  C  CB    A ILE A 1 76  ? -21.236 4.794   23.679  0.49 23.67 ? 78  ILE A CB    1 
ATOM   629  C  CB    B ILE A 1 76  ? -21.050 4.777   23.551  0.51 23.73 ? 78  ILE A CB    1 
ATOM   630  C  CG1   A ILE A 1 76  ? -19.884 4.374   24.258  0.49 22.08 ? 78  ILE A CG1   1 
ATOM   631  C  CG1   B ILE A 1 76  ? -19.594 4.392   23.811  0.51 20.60 ? 78  ILE A CG1   1 
ATOM   632  C  CG2   A ILE A 1 76  ? -21.785 3.691   22.770  0.49 19.98 ? 78  ILE A CG2   1 
ATOM   633  C  CG2   B ILE A 1 76  ? -21.718 3.721   22.670  0.51 19.97 ? 78  ILE A CG2   1 
ATOM   634  C  CD1   A ILE A 1 76  ? -18.888 3.918   23.228  0.49 19.01 ? 78  ILE A CD1   1 
ATOM   635  C  CD1   B ILE A 1 76  ? -19.429 3.108   24.556  0.51 17.96 ? 78  ILE A CD1   1 
ATOM   636  N  N     . ASN A 1 77  ? -22.533 6.452   20.954  1.00 15.69 ? 79  ASN A N     1 
ATOM   637  C  CA    . ASN A 1 77  ? -23.729 6.878   20.245  1.00 23.87 ? 79  ASN A CA    1 
ATOM   638  C  C     . ASN A 1 77  ? -24.665 5.762   19.802  1.00 19.57 ? 79  ASN A C     1 
ATOM   639  O  O     . ASN A 1 77  ? -25.752 6.032   19.292  1.00 22.61 ? 79  ASN A O     1 
ATOM   640  C  CB    . ASN A 1 77  ? -23.325 7.719   19.034  1.00 14.82 ? 79  ASN A CB    1 
ATOM   641  C  CG    . ASN A 1 77  ? -22.443 8.888   19.417  1.00 20.40 ? 79  ASN A CG    1 
ATOM   642  O  OD1   . ASN A 1 77  ? -22.873 9.778   20.148  1.00 26.66 ? 79  ASN A OD1   1 
ATOM   643  N  ND2   . ASN A 1 77  ? -21.206 8.882   18.950  1.00 13.73 ? 79  ASN A ND2   1 
ATOM   644  N  N     . GLY A 1 78  ? -24.246 4.514   19.973  1.00 20.47 ? 80  GLY A N     1 
ATOM   645  C  CA    . GLY A 1 78  ? -25.085 3.407   19.570  1.00 20.71 ? 80  GLY A CA    1 
ATOM   646  C  C     . GLY A 1 78  ? -24.448 2.067   19.840  1.00 19.39 ? 80  GLY A C     1 
ATOM   647  O  O     . GLY A 1 78  ? -23.230 1.951   19.927  1.00 17.35 ? 80  GLY A O     1 
ATOM   648  N  N     . TYR A 1 79  ? -25.292 1.057   19.999  1.00 18.86 ? 81  TYR A N     1 
ATOM   649  C  CA    . TYR A 1 79  ? -24.840 -0.297  20.276  1.00 21.08 ? 81  TYR A CA    1 
ATOM   650  C  C     . TYR A 1 79  ? -25.383 -1.229  19.201  1.00 16.20 ? 81  TYR A C     1 
ATOM   651  O  O     . TYR A 1 79  ? -26.587 -1.226  18.904  1.00 17.05 ? 81  TYR A O     1 
ATOM   652  C  CB    . TYR A 1 79  ? -25.315 -0.765  21.652  1.00 19.68 ? 81  TYR A CB    1 
ATOM   653  C  CG    . TYR A 1 79  ? -24.671 -0.037  22.818  1.00 16.20 ? 81  TYR A CG    1 
ATOM   654  C  CD1   . TYR A 1 79  ? -25.282 1.070   23.399  1.00 19.93 ? 81  TYR A CD1   1 
ATOM   655  C  CD2   . TYR A 1 79  ? -23.451 -0.454  23.329  1.00 23.07 ? 81  TYR A CD2   1 
ATOM   656  C  CE1   . TYR A 1 79  ? -24.693 1.737   24.471  1.00 15.40 ? 81  TYR A CE1   1 
ATOM   657  C  CE2   . TYR A 1 79  ? -22.854 0.211   24.393  1.00 23.74 ? 81  TYR A CE2   1 
ATOM   658  C  CZ    . TYR A 1 79  ? -23.481 1.301   24.954  1.00 19.65 ? 81  TYR A CZ    1 
ATOM   659  O  OH    . TYR A 1 79  ? -22.880 1.959   26.003  1.00 25.38 ? 81  TYR A OH    1 
ATOM   660  N  N     . ILE A 1 80  ? -24.484 -2.014  18.620  1.00 15.81 ? 82  ILE A N     1 
ATOM   661  C  CA    . ILE A 1 80  ? -24.880 -3.077  17.722  1.00 17.06 ? 82  ILE A CA    1 
ATOM   662  C  C     . ILE A 1 80  ? -24.743 -4.406  18.469  1.00 15.41 ? 82  ILE A C     1 
ATOM   663  O  O     . ILE A 1 80  ? -23.644 -4.766  18.891  1.00 13.59 ? 82  ILE A O     1 
ATOM   664  C  CB    . ILE A 1 80  ? -23.982 -3.098  16.480  1.00 13.58 ? 82  ILE A CB    1 
ATOM   665  C  CG1   . ILE A 1 80  ? -24.137 -1.793  15.680  1.00 16.65 ? 82  ILE A CG1   1 
ATOM   666  C  CG2   . ILE A 1 80  ? -24.313 -4.290  15.652  1.00 11.95 ? 82  ILE A CG2   1 
ATOM   667  C  CD1   . ILE A 1 80  ? -23.116 -1.647  14.537  1.00 13.76 ? 82  ILE A CD1   1 
ATOM   668  N  N     . LEU A 1 81  ? -25.850 -5.120  18.659  1.00 11.97 ? 83  LEU A N     1 
ATOM   669  C  CA    A LEU A 1 81  ? -25.797 -6.414  19.342  0.66 13.21 ? 83  LEU A CA    1 
ATOM   670  C  CA    B LEU A 1 81  ? -25.822 -6.414  19.341  0.34 13.23 ? 83  LEU A CA    1 
ATOM   671  C  C     . LEU A 1 81  ? -25.833 -7.556  18.327  1.00 18.03 ? 83  LEU A C     1 
ATOM   672  O  O     . LEU A 1 81  ? -26.818 -7.754  17.621  1.00 15.51 ? 83  LEU A O     1 
ATOM   673  C  CB    A LEU A 1 81  ? -26.922 -6.556  20.382  0.66 11.90 ? 83  LEU A CB    1 
ATOM   674  C  CB    B LEU A 1 81  ? -27.020 -6.553  20.288  0.34 11.99 ? 83  LEU A CB    1 
ATOM   675  C  CG    A LEU A 1 81  ? -26.628 -5.914  21.748  0.66 15.02 ? 83  LEU A CG    1 
ATOM   676  C  CG    B LEU A 1 81  ? -27.191 -5.435  21.317  0.34 14.03 ? 83  LEU A CG    1 
ATOM   677  C  CD1   A LEU A 1 81  ? -26.329 -4.427  21.606  0.66 13.21 ? 83  LEU A CD1   1 
ATOM   678  C  CD1   B LEU A 1 81  ? -28.257 -5.794  22.335  0.34 14.71 ? 83  LEU A CD1   1 
ATOM   679  C  CD2   A LEU A 1 81  ? -27.760 -6.129  22.742  0.66 13.78 ? 83  LEU A CD2   1 
ATOM   680  C  CD2   B LEU A 1 81  ? -25.869 -5.171  22.009  0.34 13.85 ? 83  LEU A CD2   1 
ATOM   681  N  N     . VAL A 1 82  ? -24.745 -8.312  18.258  1.00 15.00 ? 84  VAL A N     1 
ATOM   682  C  CA    . VAL A 1 82  ? -24.642 -9.361  17.249  1.00 15.80 ? 84  VAL A CA    1 
ATOM   683  C  C     . VAL A 1 82  ? -24.789 -10.756 17.830  1.00 12.78 ? 84  VAL A C     1 
ATOM   684  O  O     . VAL A 1 82  ? -24.228 -11.063 18.881  1.00 16.51 ? 84  VAL A O     1 
ATOM   685  C  CB    . VAL A 1 82  ? -23.284 -9.316  16.527  1.00 11.12 ? 84  VAL A CB    1 
ATOM   686  C  CG1   . VAL A 1 82  ? -23.280 -10.294 15.333  1.00 10.48 ? 84  VAL A CG1   1 
ATOM   687  C  CG2   . VAL A 1 82  ? -22.957 -7.894  16.066  1.00 15.24 ? 84  VAL A CG2   1 
ATOM   688  N  N     . TYR A 1 83  ? -25.556 -11.593 17.141  1.00 19.60 ? 85  TYR A N     1 
ATOM   689  C  CA    . TYR A 1 83  ? -25.523 -13.032 17.371  1.00 13.51 ? 85  TYR A CA    1 
ATOM   690  C  C     . TYR A 1 83  ? -25.312 -13.696 16.016  1.00 16.74 ? 85  TYR A C     1 
ATOM   691  O  O     . TYR A 1 83  ? -25.375 -13.034 14.967  1.00 12.79 ? 85  TYR A O     1 
ATOM   692  C  CB    . TYR A 1 83  ? -26.808 -13.554 18.049  1.00 13.93 ? 85  TYR A CB    1 
ATOM   693  C  CG    . TYR A 1 83  ? -28.042 -13.422 17.180  1.00 15.30 ? 85  TYR A CG    1 
ATOM   694  C  CD1   . TYR A 1 83  ? -28.495 -14.494 16.408  1.00 14.44 ? 85  TYR A CD1   1 
ATOM   695  C  CD2   . TYR A 1 83  ? -28.750 -12.228 17.124  1.00 14.05 ? 85  TYR A CD2   1 
ATOM   696  C  CE1   . TYR A 1 83  ? -29.611 -14.374 15.602  1.00 9.29  ? 85  TYR A CE1   1 
ATOM   697  C  CE2   . TYR A 1 83  ? -29.875 -12.093 16.311  1.00 15.23 ? 85  TYR A CE2   1 
ATOM   698  C  CZ    . TYR A 1 83  ? -30.296 -13.174 15.552  1.00 15.09 ? 85  TYR A CZ    1 
ATOM   699  O  OH    . TYR A 1 83  ? -31.410 -13.050 14.756  1.00 14.58 ? 85  TYR A OH    1 
ATOM   700  N  N     . SER A 1 84  ? -25.044 -14.995 16.038  1.00 16.33 ? 86  SER A N     1 
ATOM   701  C  CA    . SER A 1 84  ? -24.938 -15.753 14.796  1.00 17.51 ? 86  SER A CA    1 
ATOM   702  C  C     . SER A 1 84  ? -26.196 -16.585 14.616  1.00 17.06 ? 86  SER A C     1 
ATOM   703  O  O     . SER A 1 84  ? -26.687 -17.182 15.576  1.00 15.89 ? 86  SER A O     1 
ATOM   704  C  CB    . SER A 1 84  ? -23.721 -16.664 14.804  1.00 14.04 ? 86  SER A CB    1 
ATOM   705  O  OG    . SER A 1 84  ? -23.886 -17.710 13.862  1.00 15.19 ? 86  SER A OG    1 
ATOM   706  N  N     . VAL A 1 85  ? -26.718 -16.616 13.393  1.00 14.52 ? 87  VAL A N     1 
ATOM   707  C  CA    . VAL A 1 85  ? -27.917 -17.402 13.110  1.00 15.83 ? 87  VAL A CA    1 
ATOM   708  C  C     . VAL A 1 85  ? -27.619 -18.904 13.238  1.00 14.93 ? 87  VAL A C     1 
ATOM   709  O  O     . VAL A 1 85  ? -28.535 -19.731 13.272  1.00 16.26 ? 87  VAL A O     1 
ATOM   710  C  CB    . VAL A 1 85  ? -28.538 -17.069 11.732  1.00 17.64 ? 87  VAL A CB    1 
ATOM   711  C  CG1   . VAL A 1 85  ? -28.887 -15.553 11.628  1.00 14.50 ? 87  VAL A CG1   1 
ATOM   712  C  CG2   . VAL A 1 85  ? -27.602 -17.492 10.599  1.00 11.26 ? 87  VAL A CG2   1 
ATOM   713  N  N     . THR A 1 86  ? -26.334 -19.244 13.341  1.00 15.10 ? 88  THR A N     1 
ATOM   714  C  CA    . THR A 1 86  ? -25.924 -20.638 13.464  1.00 18.91 ? 88  THR A CA    1 
ATOM   715  C  C     . THR A 1 86  ? -25.767 -21.098 14.914  1.00 21.38 ? 88  THR A C     1 
ATOM   716  O  O     . THR A 1 86  ? -25.480 -22.263 15.156  1.00 17.74 ? 88  THR A O     1 
ATOM   717  C  CB    . THR A 1 86  ? -24.604 -20.933 12.720  1.00 20.19 ? 88  THR A CB    1 
ATOM   718  O  OG1   . THR A 1 86  ? -23.504 -20.319 13.409  1.00 18.76 ? 88  THR A OG1   1 
ATOM   719  C  CG2   . THR A 1 86  ? -24.667 -20.422 11.272  1.00 16.89 ? 88  THR A CG2   1 
ATOM   720  N  N     . SER A 1 87  ? -25.953 -20.196 15.875  1.00 15.95 ? 89  SER A N     1 
ATOM   721  C  CA    . SER A 1 87  ? -25.697 -20.549 17.280  1.00 15.72 ? 89  SER A CA    1 
ATOM   722  C  C     . SER A 1 87  ? -26.812 -20.158 18.219  1.00 14.77 ? 89  SER A C     1 
ATOM   723  O  O     . SER A 1 87  ? -26.996 -18.981 18.502  1.00 13.34 ? 89  SER A O     1 
ATOM   724  C  CB    . SER A 1 87  ? -24.391 -19.912 17.770  1.00 15.61 ? 89  SER A CB    1 
ATOM   725  O  OG    . SER A 1 87  ? -24.249 -20.016 19.182  1.00 17.98 ? 89  SER A OG    1 
ATOM   726  N  N     . ILE A 1 88  ? -27.543 -21.141 18.735  1.00 16.58 ? 90  ILE A N     1 
ATOM   727  C  CA    . ILE A 1 88  ? -28.596 -20.816 19.698  1.00 16.85 ? 90  ILE A CA    1 
ATOM   728  C  C     . ILE A 1 88  ? -28.009 -20.197 20.983  1.00 14.58 ? 90  ILE A C     1 
ATOM   729  O  O     . ILE A 1 88  ? -28.590 -19.272 21.560  1.00 21.74 ? 90  ILE A O     1 
ATOM   730  C  CB    . ILE A 1 88  ? -29.502 -22.018 20.009  1.00 26.03 ? 90  ILE A CB    1 
ATOM   731  C  CG1   . ILE A 1 88  ? -30.750 -21.547 20.768  1.00 37.09 ? 90  ILE A CG1   1 
ATOM   732  C  CG2   . ILE A 1 88  ? -28.743 -23.046 20.809  1.00 28.09 ? 90  ILE A CG2   1 
ATOM   733  C  CD1   . ILE A 1 88  ? -31.923 -22.511 20.712  1.00 38.64 ? 90  ILE A CD1   1 
ATOM   734  N  N     . LYS A 1 89  ? -26.856 -20.681 21.430  1.00 16.58 ? 91  LYS A N     1 
ATOM   735  C  CA    A LYS A 1 89  ? -26.211 -20.090 22.593  0.51 18.83 ? 91  LYS A CA    1 
ATOM   736  C  CA    B LYS A 1 89  ? -26.197 -20.092 22.589  0.49 18.84 ? 91  LYS A CA    1 
ATOM   737  C  C     . LYS A 1 89  ? -26.036 -18.591 22.372  1.00 18.03 ? 91  LYS A C     1 
ATOM   738  O  O     . LYS A 1 89  ? -26.343 -17.779 23.264  1.00 16.14 ? 91  LYS A O     1 
ATOM   739  C  CB    A LYS A 1 89  ? -24.855 -20.745 22.858  0.51 21.61 ? 91  LYS A CB    1 
ATOM   740  C  CB    B LYS A 1 89  ? -24.828 -20.739 22.817  0.49 21.61 ? 91  LYS A CB    1 
ATOM   741  C  CG    A LYS A 1 89  ? -24.079 -20.116 24.007  0.51 21.21 ? 91  LYS A CG    1 
ATOM   742  C  CG    B LYS A 1 89  ? -23.975 -20.057 23.881  0.49 21.02 ? 91  LYS A CG    1 
ATOM   743  C  CD    A LYS A 1 89  ? -24.832 -20.249 25.327  0.51 27.27 ? 91  LYS A CD    1 
ATOM   744  C  CD    B LYS A 1 89  ? -24.442 -20.407 25.289  0.49 28.34 ? 91  LYS A CD    1 
ATOM   745  C  CE    A LYS A 1 89  ? -23.923 -19.953 26.517  0.51 26.09 ? 91  LYS A CE    1 
ATOM   746  C  CE    B LYS A 1 89  ? -23.463 -19.901 26.346  0.49 26.66 ? 91  LYS A CE    1 
ATOM   747  N  NZ    A LYS A 1 89  ? -24.614 -20.161 27.821  0.51 25.34 ? 91  LYS A NZ    1 
ATOM   748  N  NZ    B LYS A 1 89  ? -22.081 -20.422 26.133  0.49 27.69 ? 91  LYS A NZ    1 
ATOM   749  N  N     . SER A 1 90  ? -25.564 -18.223 21.178  1.00 15.78 ? 92  SER A N     1 
ATOM   750  C  CA    . SER A 1 90  ? -25.325 -16.812 20.848  1.00 16.40 ? 92  SER A CA    1 
ATOM   751  C  C     . SER A 1 90  ? -26.584 -15.984 20.986  1.00 12.90 ? 92  SER A C     1 
ATOM   752  O  O     . SER A 1 90  ? -26.548 -14.836 21.462  1.00 13.70 ? 92  SER A O     1 
ATOM   753  C  CB    . SER A 1 90  ? -24.705 -16.646 19.441  1.00 14.23 ? 92  SER A CB    1 
ATOM   754  O  OG    . SER A 1 90  ? -25.678 -16.628 18.416  1.00 13.62 ? 92  SER A OG    1 
ATOM   755  N  N     . PHE A 1 91  ? -27.698 -16.573 20.571  1.00 13.71 ? 93  PHE A N     1 
ATOM   756  C  CA    . PHE A 1 91  ? -28.988 -15.887 20.577  1.00 14.20 ? 93  PHE A CA    1 
ATOM   757  C  C     . PHE A 1 91  ? -29.508 -15.725 22.010  1.00 15.84 ? 93  PHE A C     1 
ATOM   758  O  O     . PHE A 1 91  ? -29.966 -14.648 22.398  1.00 14.68 ? 93  PHE A O     1 
ATOM   759  C  CB    . PHE A 1 91  ? -29.988 -16.658 19.701  1.00 13.11 ? 93  PHE A CB    1 
ATOM   760  C  CG    . PHE A 1 91  ? -31.297 -15.948 19.483  1.00 18.72 ? 93  PHE A CG    1 
ATOM   761  C  CD1   . PHE A 1 91  ? -31.351 -14.753 18.772  1.00 21.26 ? 93  PHE A CD1   1 
ATOM   762  C  CD2   . PHE A 1 91  ? -32.482 -16.496 19.955  1.00 15.66 ? 93  PHE A CD2   1 
ATOM   763  C  CE1   . PHE A 1 91  ? -32.569 -14.108 18.552  1.00 16.10 ? 93  PHE A CE1   1 
ATOM   764  C  CE2   . PHE A 1 91  ? -33.702 -15.861 19.741  1.00 17.24 ? 93  PHE A CE2   1 
ATOM   765  C  CZ    . PHE A 1 91  ? -33.749 -14.668 19.037  1.00 15.55 ? 93  PHE A CZ    1 
ATOM   766  N  N     . GLU A 1 92  ? -29.411 -16.784 22.801  1.00 15.57 ? 94  GLU A N     1 
ATOM   767  C  CA    . GLU A 1 92  ? -29.754 -16.699 24.214  1.00 17.77 ? 94  GLU A CA    1 
ATOM   768  C  C     . GLU A 1 92  ? -28.870 -15.670 24.910  1.00 16.48 ? 94  GLU A C     1 
ATOM   769  O  O     . GLU A 1 92  ? -29.355 -14.848 25.673  1.00 17.07 ? 94  GLU A O     1 
ATOM   770  C  CB    . GLU A 1 92  ? -29.607 -18.064 24.897  1.00 16.55 ? 94  GLU A CB    1 
ATOM   771  C  CG    . GLU A 1 92  ? -30.454 -19.162 24.266  1.00 22.73 ? 94  GLU A CG    1 
ATOM   772  C  CD    . GLU A 1 92  ? -31.946 -18.918 24.390  1.00 27.61 ? 94  GLU A CD    1 
ATOM   773  O  OE1   . GLU A 1 92  ? -32.349 -17.944 25.066  1.00 28.53 ? 94  GLU A OE1   1 
ATOM   774  O  OE2   . GLU A 1 92  ? -32.720 -19.705 23.804  1.00 33.66 ? 94  GLU A OE2   1 
ATOM   775  N  N     . VAL A 1 93  ? -27.571 -15.704 24.629  1.00 13.43 ? 95  VAL A N     1 
ATOM   776  C  CA    . VAL A 1 93  ? -26.654 -14.746 25.239  1.00 20.66 ? 95  VAL A CA    1 
ATOM   777  C  C     . VAL A 1 93  ? -27.012 -13.298 24.882  1.00 21.39 ? 95  VAL A C     1 
ATOM   778  O  O     . VAL A 1 93  ? -27.037 -12.413 25.750  1.00 18.30 ? 95  VAL A O     1 
ATOM   779  C  CB    . VAL A 1 93  ? -25.196 -15.059 24.887  1.00 18.19 ? 95  VAL A CB    1 
ATOM   780  C  CG1   . VAL A 1 93  ? -24.311 -13.834 25.098  1.00 17.83 ? 95  VAL A CG1   1 
ATOM   781  C  CG2   . VAL A 1 93  ? -24.701 -16.240 25.721  1.00 22.74 ? 95  VAL A CG2   1 
ATOM   782  N  N     . ILE A 1 94  ? -27.324 -13.049 23.613  1.00 17.27 ? 96  ILE A N     1 
ATOM   783  C  CA    . ILE A 1 94  ? -27.631 -11.679 23.200  1.00 11.87 ? 96  ILE A CA    1 
ATOM   784  C  C     . ILE A 1 94  ? -28.831 -11.100 23.975  1.00 14.71 ? 96  ILE A C     1 
ATOM   785  O  O     . ILE A 1 94  ? -28.907 -9.886  24.205  1.00 14.56 ? 96  ILE A O     1 
ATOM   786  C  CB    . ILE A 1 94  ? -27.776 -11.543 21.640  1.00 14.92 ? 96  ILE A CB    1 
ATOM   787  C  CG1   . ILE A 1 94  ? -27.383 -10.136 21.187  1.00 15.47 ? 96  ILE A CG1   1 
ATOM   788  C  CG2   . ILE A 1 94  ? -29.170 -11.943 21.175  1.00 13.43 ? 96  ILE A CG2   1 
ATOM   789  C  CD1   . ILE A 1 94  ? -26.036 -9.677  21.783  1.00 11.84 ? 96  ILE A CD1   1 
ATOM   790  N  N     . LYS A 1 95  ? -29.765 -11.955 24.382  1.00 16.44 ? 97  LYS A N     1 
ATOM   791  C  CA    . LYS A 1 95  ? -30.885 -11.502 25.211  1.00 15.43 ? 97  LYS A CA    1 
ATOM   792  C  C     . LYS A 1 95  ? -30.400 -11.064 26.602  1.00 14.44 ? 97  LYS A C     1 
ATOM   793  O  O     . LYS A 1 95  ? -30.849 -10.059 27.147  1.00 15.63 ? 97  LYS A O     1 
ATOM   794  C  CB    . LYS A 1 95  ? -31.930 -12.613 25.362  1.00 20.54 ? 97  LYS A CB    1 
ATOM   795  C  CG    . LYS A 1 95  ? -32.588 -13.049 24.058  1.00 17.60 ? 97  LYS A CG    1 
ATOM   796  C  CD    . LYS A 1 95  ? -33.463 -14.288 24.252  1.00 23.15 ? 97  LYS A CD    1 
ATOM   797  C  CE    . LYS A 1 95  ? -34.149 -14.671 22.939  1.00 25.54 ? 97  LYS A CE    1 
ATOM   798  N  NZ    . LYS A 1 95  ? -34.880 -15.964 23.061  1.00 28.33 ? 97  LYS A NZ    1 
ATOM   799  N  N     . VAL A 1 96  ? -29.476 -11.820 27.174  1.00 15.48 ? 98  VAL A N     1 
ATOM   800  C  CA    . VAL A 1 96  ? -28.922 -11.465 28.479  1.00 15.26 ? 98  VAL A CA    1 
ATOM   801  C  C     . VAL A 1 96  ? -28.095 -10.169 28.404  1.00 16.06 ? 98  VAL A C     1 
ATOM   802  O  O     . VAL A 1 96  ? -28.182 -9.287  29.271  1.00 14.70 ? 98  VAL A O     1 
ATOM   803  C  CB    . VAL A 1 96  ? -28.067 -12.601 29.010  1.00 14.27 ? 98  VAL A CB    1 
ATOM   804  C  CG1   . VAL A 1 96  ? -27.402 -12.196 30.324  1.00 15.20 ? 98  VAL A CG1   1 
ATOM   805  C  CG2   . VAL A 1 96  ? -28.925 -13.849 29.198  1.00 16.21 ? 98  VAL A CG2   1 
ATOM   806  N  N     . ILE A 1 97  ? -27.285 -10.068 27.356  1.00 11.69 ? 99  ILE A N     1 
ATOM   807  C  CA    . ILE A 1 97  ? -26.536 -8.855  27.052  1.00 14.15 ? 99  ILE A CA    1 
ATOM   808  C  C     . ILE A 1 97  ? -27.478 -7.662  26.933  1.00 12.26 ? 99  ILE A C     1 
ATOM   809  O  O     . ILE A 1 97  ? -27.215 -6.609  27.495  1.00 19.10 ? 99  ILE A O     1 
ATOM   810  C  CB    . ILE A 1 97  ? -25.711 -9.023  25.750  1.00 12.21 ? 99  ILE A CB    1 
ATOM   811  C  CG1   . ILE A 1 97  ? -24.541 -9.977  25.988  1.00 16.79 ? 99  ILE A CG1   1 
ATOM   812  C  CG2   . ILE A 1 97  ? -25.209 -7.667  25.216  1.00 14.47 ? 99  ILE A CG2   1 
ATOM   813  C  CD1   . ILE A 1 97  ? -23.715 -10.267 24.700  1.00 17.75 ? 99  ILE A CD1   1 
ATOM   814  N  N     . HIS A 1 98  ? -28.584 -7.828  26.210  1.00 13.48 ? 100 HIS A N     1 
ATOM   815  C  CA    . HIS A 1 98  ? -29.514 -6.717  26.051  1.00 15.82 ? 100 HIS A CA    1 
ATOM   816  C  C     . HIS A 1 98  ? -30.056 -6.313  27.431  1.00 16.40 ? 100 HIS A C     1 
ATOM   817  O  O     . HIS A 1 98  ? -30.147 -5.128  27.748  1.00 16.14 ? 100 HIS A O     1 
ATOM   818  C  CB    . HIS A 1 98  ? -30.654 -7.065  25.077  1.00 16.61 ? 100 HIS A CB    1 
ATOM   819  C  CG    . HIS A 1 98  ? -31.697 -6.000  24.973  1.00 19.74 ? 100 HIS A CG    1 
ATOM   820  N  ND1   . HIS A 1 98  ? -32.881 -6.045  25.681  1.00 16.34 ? 100 HIS A ND1   1 
ATOM   821  C  CD2   . HIS A 1 98  ? -31.731 -4.843  24.267  1.00 15.13 ? 100 HIS A CD2   1 
ATOM   822  C  CE1   . HIS A 1 98  ? -33.594 -4.963  25.419  1.00 14.07 ? 100 HIS A CE1   1 
ATOM   823  N  NE2   . HIS A 1 98  ? -32.916 -4.222  24.559  1.00 19.64 ? 100 HIS A NE2   1 
ATOM   824  N  N     . GLY A 1 99  ? -30.391 -7.302  28.257  1.00 15.76 ? 101 GLY A N     1 
ATOM   825  C  CA    . GLY A 1 99  ? -30.893 -7.016  29.587  1.00 17.92 ? 101 GLY A CA    1 
ATOM   826  C  C     . GLY A 1 99  ? -29.930 -6.196  30.423  1.00 19.20 ? 101 GLY A C     1 
ATOM   827  O  O     . GLY A 1 99  ? -30.324 -5.211  31.066  1.00 15.99 ? 101 GLY A O     1 
ATOM   828  N  N     . LYS A 1 100 ? -28.665 -6.601  30.436  1.00 13.29 ? 102 LYS A N     1 
ATOM   829  C  CA    . LYS A 1 100 ? -27.675 -5.904  31.250  1.00 18.66 ? 102 LYS A CA    1 
ATOM   830  C  C     . LYS A 1 100 ? -27.349 -4.550  30.632  1.00 21.31 ? 102 LYS A C     1 
ATOM   831  O  O     . LYS A 1 100 ? -27.036 -3.582  31.327  1.00 14.83 ? 102 LYS A O     1 
ATOM   832  C  CB    . LYS A 1 100 ? -26.423 -6.755  31.420  1.00 18.91 ? 102 LYS A CB    1 
ATOM   833  C  CG    . LYS A 1 100 ? -26.694 -8.011  32.233  1.00 17.81 ? 102 LYS A CG    1 
ATOM   834  C  CD    . LYS A 1 100 ? -25.488 -8.902  32.403  1.00 21.34 ? 102 LYS A CD    1 
ATOM   835  C  CE    . LYS A 1 100 ? -25.868 -10.048 33.313  1.00 27.02 ? 102 LYS A CE    1 
ATOM   836  N  NZ    . LYS A 1 100 ? -24.952 -11.192 33.218  1.00 35.56 ? 102 LYS A NZ    1 
ATOM   837  N  N     . LEU A 1 101 ? -27.449 -4.474  29.313  1.00 22.08 ? 103 LEU A N     1 
ATOM   838  C  CA    . LEU A 1 101 ? -27.218 -3.203  28.648  1.00 18.00 ? 103 LEU A CA    1 
ATOM   839  C  C     . LEU A 1 101 ? -28.290 -2.200  29.055  1.00 17.96 ? 103 LEU A C     1 
ATOM   840  O  O     . LEU A 1 101 ? -27.986 -1.060  29.416  1.00 19.34 ? 103 LEU A O     1 
ATOM   841  C  CB    . LEU A 1 101 ? -27.181 -3.382  27.133  1.00 16.35 ? 103 LEU A CB    1 
ATOM   842  C  CG    . LEU A 1 101 ? -27.013 -2.070  26.374  1.00 20.51 ? 103 LEU A CG    1 
ATOM   843  C  CD1   . LEU A 1 101 ? -25.707 -1.402  26.768  1.00 18.90 ? 103 LEU A CD1   1 
ATOM   844  C  CD2   . LEU A 1 101 ? -27.031 -2.335  24.860  1.00 22.19 ? 103 LEU A CD2   1 
ATOM   845  N  N     . LEU A 1 102 ? -29.548 -2.626  29.002  1.00 15.54 ? 104 LEU A N     1 
ATOM   846  C  CA    . LEU A 1 102 ? -30.659 -1.747  29.354  1.00 21.12 ? 104 LEU A CA    1 
ATOM   847  C  C     . LEU A 1 102 ? -30.581 -1.298  30.823  1.00 26.00 ? 104 LEU A C     1 
ATOM   848  O  O     . LEU A 1 102 ? -30.986 -0.193  31.178  1.00 25.93 ? 104 LEU A O     1 
ATOM   849  C  CB    . LEU A 1 102 ? -31.999 -2.432  29.065  1.00 19.11 ? 104 LEU A CB    1 
ATOM   850  C  CG    . LEU A 1 102 ? -32.777 -2.048  27.805  1.00 29.78 ? 104 LEU A CG    1 
ATOM   851  C  CD1   . LEU A 1 102 ? -34.157 -2.716  27.824  1.00 33.44 ? 104 LEU A CD1   1 
ATOM   852  C  CD2   . LEU A 1 102 ? -32.922 -0.535  27.688  1.00 29.81 ? 104 LEU A CD2   1 
ATOM   853  N  N     . ASP A 1 103 ? -30.050 -2.154  31.682  1.00 25.94 ? 105 ASP A N     1 
ATOM   854  C  CA    . ASP A 1 103 ? -29.847 -1.771  33.071  1.00 25.52 ? 105 ASP A CA    1 
ATOM   855  C  C     . ASP A 1 103 ? -28.757 -0.727  33.229  1.00 22.73 ? 105 ASP A C     1 
ATOM   856  O  O     . ASP A 1 103 ? -28.820 0.121   34.111  1.00 33.43 ? 105 ASP A O     1 
ATOM   857  C  CB    . ASP A 1 103 ? -29.515 -2.985  33.921  1.00 28.62 ? 105 ASP A CB    1 
ATOM   858  C  CG    . ASP A 1 103 ? -30.737 -3.604  34.519  1.00 43.32 ? 105 ASP A CG    1 
ATOM   859  O  OD1   . ASP A 1 103 ? -31.136 -4.686  34.044  1.00 45.41 ? 105 ASP A OD1   1 
ATOM   860  O  OD2   . ASP A 1 103 ? -31.309 -2.994  35.456  1.00 56.70 ? 105 ASP A OD2   1 
ATOM   861  N  N     . MET A 1 104 ? -27.748 -0.793  32.377  1.00 22.82 ? 106 MET A N     1 
ATOM   862  C  CA    . MET A 1 104 ? -26.684 0.200   32.406  1.00 27.65 ? 106 MET A CA    1 
ATOM   863  C  C     . MET A 1 104 ? -27.126 1.539   31.829  1.00 30.45 ? 106 MET A C     1 
ATOM   864  O  O     . MET A 1 104 ? -26.780 2.592   32.363  1.00 27.81 ? 106 MET A O     1 
ATOM   865  C  CB    . MET A 1 104 ? -25.468 -0.299  31.638  1.00 22.38 ? 106 MET A CB    1 
ATOM   866  C  CG    . MET A 1 104 ? -24.553 0.819   31.129  1.00 21.17 ? 106 MET A CG    1 
ATOM   867  S  SD    . MET A 1 104 ? -23.135 0.091   30.291  1.00 41.74 ? 106 MET A SD    1 
ATOM   868  C  CE    . MET A 1 104 ? -23.502 0.432   28.575  1.00 33.74 ? 106 MET A CE    1 
ATOM   869  N  N     . VAL A 1 105 ? -27.873 1.507   30.730  1.00 24.96 ? 107 VAL A N     1 
ATOM   870  C  CA    . VAL A 1 105 ? -28.214 2.755   30.036  1.00 25.10 ? 107 VAL A CA    1 
ATOM   871  C  C     . VAL A 1 105 ? -29.561 3.350   30.450  1.00 27.31 ? 107 VAL A C     1 
ATOM   872  O  O     . VAL A 1 105 ? -29.821 4.535   30.224  1.00 26.28 ? 107 VAL A O     1 
ATOM   873  C  CB    . VAL A 1 105 ? -28.174 2.601   28.504  1.00 19.42 ? 107 VAL A CB    1 
ATOM   874  C  CG1   . VAL A 1 105 ? -26.864 1.937   28.073  1.00 22.47 ? 107 VAL A CG1   1 
ATOM   875  C  CG2   . VAL A 1 105 ? -29.395 1.818   28.006  1.00 21.23 ? 107 VAL A CG2   1 
ATOM   876  N  N     . GLY A 1 106 ? -30.420 2.533   31.053  1.00 29.66 ? 108 GLY A N     1 
ATOM   877  C  CA    . GLY A 1 106 ? -31.732 3.006   31.452  1.00 26.96 ? 108 GLY A CA    1 
ATOM   878  C  C     . GLY A 1 106 ? -32.539 3.587   30.296  1.00 30.08 ? 108 GLY A C     1 
ATOM   879  O  O     . GLY A 1 106 ? -32.690 2.964   29.238  1.00 20.62 ? 108 GLY A O     1 
ATOM   880  N  N     . LYS A 1 107 ? -33.061 4.791   30.503  1.00 34.73 ? 109 LYS A N     1 
ATOM   881  C  CA    . LYS A 1 107 ? -33.966 5.424   29.550  1.00 31.22 ? 109 LYS A CA    1 
ATOM   882  C  C     . LYS A 1 107 ? -33.248 6.326   28.561  1.00 31.66 ? 109 LYS A C     1 
ATOM   883  O  O     . LYS A 1 107 ? -33.889 7.028   27.775  1.00 29.44 ? 109 LYS A O     1 
ATOM   884  C  CB    . LYS A 1 107 ? -34.993 6.276   30.302  1.00 42.73 ? 109 LYS A CB    1 
ATOM   885  C  CG    . LYS A 1 107 ? -36.241 5.546   30.746  1.00 57.22 ? 109 LYS A CG    1 
ATOM   886  C  CD    . LYS A 1 107 ? -37.112 6.460   31.608  1.00 57.82 ? 109 LYS A CD    1 
ATOM   887  C  CE    . LYS A 1 107 ? -37.423 7.782   30.908  1.00 64.46 ? 109 LYS A CE    1 
ATOM   888  N  NZ    . LYS A 1 107 ? -38.253 7.618   29.676  1.00 69.25 ? 109 LYS A NZ    1 
ATOM   889  N  N     . VAL A 1 108 ? -31.923 6.339   28.603  1.00 30.26 ? 110 VAL A N     1 
ATOM   890  C  CA    . VAL A 1 108 ? -31.190 7.244   27.723  1.00 26.83 ? 110 VAL A CA    1 
ATOM   891  C  C     . VAL A 1 108 ? -31.523 6.946   26.260  1.00 28.34 ? 110 VAL A C     1 
ATOM   892  O  O     . VAL A 1 108 ? -31.683 5.787   25.874  1.00 27.74 ? 110 VAL A O     1 
ATOM   893  C  CB    . VAL A 1 108 ? -29.684 7.157   27.953  1.00 22.66 ? 110 VAL A CB    1 
ATOM   894  C  CG1   . VAL A 1 108 ? -29.134 5.850   27.399  1.00 25.71 ? 110 VAL A CG1   1 
ATOM   895  C  CG2   . VAL A 1 108 ? -28.991 8.345   27.329  1.00 27.48 ? 110 VAL A CG2   1 
ATOM   896  N  N     . GLN A 1 109 ? -31.660 7.993   25.450  1.00 29.96 ? 111 GLN A N     1 
ATOM   897  C  CA    A GLN A 1 109 ? -31.941 7.844   24.023  0.43 28.05 ? 111 GLN A CA    1 
ATOM   898  C  CA    B GLN A 1 109 ? -31.954 7.779   24.040  0.57 28.06 ? 111 GLN A CA    1 
ATOM   899  C  C     . GLN A 1 109 ? -30.676 7.508   23.244  1.00 29.13 ? 111 GLN A C     1 
ATOM   900  O  O     . GLN A 1 109 ? -30.215 8.333   22.446  1.00 24.69 ? 111 GLN A O     1 
ATOM   901  C  CB    A GLN A 1 109 ? -32.512 9.140   23.441  0.43 25.22 ? 111 GLN A CB    1 
ATOM   902  C  CB    B GLN A 1 109 ? -32.788 8.923   23.463  0.57 25.09 ? 111 GLN A CB    1 
ATOM   903  C  CG    A GLN A 1 109 ? -33.818 9.623   24.030  0.43 29.88 ? 111 GLN A CG    1 
ATOM   904  C  CG    B GLN A 1 109 ? -34.254 8.852   23.889  0.57 31.60 ? 111 GLN A CG    1 
ATOM   905  C  CD    A GLN A 1 109 ? -34.186 11.016  23.533  0.43 29.47 ? 111 GLN A CD    1 
ATOM   906  C  CD    B GLN A 1 109 ? -34.930 7.570   23.422  0.57 35.43 ? 111 GLN A CD    1 
ATOM   907  O  OE1   A GLN A 1 109 ? -34.391 11.932  24.325  0.43 28.50 ? 111 GLN A OE1   1 
ATOM   908  O  OE1   B GLN A 1 109 ? -35.144 7.368   22.225  0.57 39.22 ? 111 GLN A OE1   1 
ATOM   909  N  NE2   A GLN A 1 109 ? -34.265 11.180  22.215  0.43 24.23 ? 111 GLN A NE2   1 
ATOM   910  N  NE2   B GLN A 1 109 ? -35.254 6.692   24.366  0.57 33.58 ? 111 GLN A NE2   1 
ATOM   911  N  N     . ILE A 1 110 ? -30.107 6.329   23.499  1.00 27.93 ? 112 ILE A N     1 
ATOM   912  C  CA    . ILE A 1 110 ? -28.994 5.779   22.721  1.00 26.11 ? 112 ILE A CA    1 
ATOM   913  C  C     . ILE A 1 110 ? -29.503 4.486   22.084  1.00 21.58 ? 112 ILE A C     1 
ATOM   914  O  O     . ILE A 1 110 ? -29.912 3.560   22.789  1.00 22.51 ? 112 ILE A O     1 
ATOM   915  C  CB    . ILE A 1 110 ? -27.765 5.436   23.596  1.00 26.52 ? 112 ILE A CB    1 
ATOM   916  C  CG1   . ILE A 1 110 ? -27.163 6.699   24.221  1.00 27.15 ? 112 ILE A CG1   1 
ATOM   917  C  CG2   . ILE A 1 110 ? -26.708 4.722   22.771  1.00 20.38 ? 112 ILE A CG2   1 
ATOM   918  C  CD1   . ILE A 1 110 ? -26.052 6.405   25.232  1.00 27.97 ? 112 ILE A CD1   1 
ATOM   919  N  N     . PRO A 1 111 ? -29.464 4.416   20.753  1.00 19.18 ? 113 PRO A N     1 
ATOM   920  C  CA    . PRO A 1 111 ? -30.075 3.330   19.983  1.00 21.72 ? 113 PRO A CA    1 
ATOM   921  C  C     . PRO A 1 111 ? -29.351 2.017   20.171  1.00 25.46 ? 113 PRO A C     1 
ATOM   922  O  O     . PRO A 1 111 ? -28.133 1.983   20.376  1.00 19.10 ? 113 PRO A O     1 
ATOM   923  C  CB    . PRO A 1 111 ? -29.916 3.781   18.527  1.00 19.14 ? 113 PRO A CB    1 
ATOM   924  C  CG    . PRO A 1 111 ? -29.289 5.128   18.567  1.00 32.19 ? 113 PRO A CG    1 
ATOM   925  C  CD    . PRO A 1 111 ? -28.674 5.316   19.905  1.00 26.18 ? 113 PRO A CD    1 
ATOM   926  N  N     . ILE A 1 112 ? -30.123 0.941   20.093  1.00 18.03 ? 114 ILE A N     1 
ATOM   927  C  CA    . ILE A 1 112 ? -29.621 -0.410  20.217  1.00 15.38 ? 114 ILE A CA    1 
ATOM   928  C  C     . ILE A 1 112 ? -30.253 -1.186  19.076  1.00 27.73 ? 114 ILE A C     1 
ATOM   929  O  O     . ILE A 1 112 ? -31.476 -1.184  18.931  1.00 26.50 ? 114 ILE A O     1 
ATOM   930  C  CB    . ILE A 1 112 ? -30.058 -1.031  21.551  1.00 24.49 ? 114 ILE A CB    1 
ATOM   931  C  CG1   . ILE A 1 112 ? -29.361 -0.320  22.714  1.00 25.28 ? 114 ILE A CG1   1 
ATOM   932  C  CG2   . ILE A 1 112 ? -29.776 -2.525  21.566  1.00 27.50 ? 114 ILE A CG2   1 
ATOM   933  C  CD1   . ILE A 1 112 ? -29.895 -0.716  24.074  1.00 30.67 ? 114 ILE A CD1   1 
ATOM   934  N  N     . MET A 1 113 ? -29.437 -1.817  18.242  1.00 17.07 ? 115 MET A N     1 
ATOM   935  C  CA    . MET A 1 113 ? -29.997 -2.679  17.208  1.00 20.10 ? 115 MET A CA    1 
ATOM   936  C  C     . MET A 1 113 ? -29.537 -4.125  17.349  1.00 23.93 ? 115 MET A C     1 
ATOM   937  O  O     . MET A 1 113 ? -28.555 -4.416  18.032  1.00 22.38 ? 115 MET A O     1 
ATOM   938  C  CB    . MET A 1 113 ? -29.670 -2.158  15.810  1.00 17.39 ? 115 MET A CB    1 
ATOM   939  C  CG    . MET A 1 113 ? -28.237 -2.385  15.366  1.00 21.79 ? 115 MET A CG    1 
ATOM   940  S  SD    . MET A 1 113 ? -28.003 -1.846  13.653  1.00 30.05 ? 115 MET A SD    1 
ATOM   941  C  CE    . MET A 1 113 ? -29.086 -2.962  12.772  1.00 20.38 ? 115 MET A CE    1 
ATOM   942  N  N     . LEU A 1 114 ? -30.255 -5.022  16.685  1.00 17.06 ? 116 LEU A N     1 
ATOM   943  C  CA    . LEU A 1 114 ? -29.974 -6.444  16.761  1.00 16.49 ? 116 LEU A CA    1 
ATOM   944  C  C     . LEU A 1 114 ? -29.585 -6.918  15.376  1.00 16.09 ? 116 LEU A C     1 
ATOM   945  O  O     . LEU A 1 114 ? -30.233 -6.552  14.384  1.00 18.08 ? 116 LEU A O     1 
ATOM   946  C  CB    . LEU A 1 114 ? -31.227 -7.187  17.214  1.00 14.71 ? 116 LEU A CB    1 
ATOM   947  C  CG    . LEU A 1 114 ? -31.128 -8.701  17.384  1.00 12.60 ? 116 LEU A CG    1 
ATOM   948  C  CD1   . LEU A 1 114 ? -30.060 -9.011  18.449  1.00 11.40 ? 116 LEU A CD1   1 
ATOM   949  C  CD2   . LEU A 1 114 ? -32.482 -9.298  17.771  1.00 12.62 ? 116 LEU A CD2   1 
ATOM   950  N  N     . VAL A 1 115 ? -28.534 -7.724  15.306  1.00 9.87  ? 117 VAL A N     1 
ATOM   951  C  CA    . VAL A 1 115 ? -28.041 -8.224  14.031  1.00 18.33 ? 117 VAL A CA    1 
ATOM   952  C  C     . VAL A 1 115 ? -27.847 -9.736  14.082  1.00 19.75 ? 117 VAL A C     1 
ATOM   953  O  O     . VAL A 1 115 ? -27.086 -10.242 14.915  1.00 14.86 ? 117 VAL A O     1 
ATOM   954  C  CB    . VAL A 1 115 ? -26.694 -7.579  13.668  1.00 11.68 ? 117 VAL A CB    1 
ATOM   955  C  CG1   . VAL A 1 115 ? -26.101 -8.242  12.425  1.00 17.52 ? 117 VAL A CG1   1 
ATOM   956  C  CG2   . VAL A 1 115 ? -26.870 -6.083  13.471  1.00 14.31 ? 117 VAL A CG2   1 
ATOM   957  N  N     . GLY A 1 116 ? -28.535 -10.450 13.196  1.00 13.45 ? 118 GLY A N     1 
ATOM   958  C  CA    . GLY A 1 116 ? -28.322 -11.887 13.050  1.00 15.00 ? 118 GLY A CA    1 
ATOM   959  C  C     . GLY A 1 116 ? -27.278 -12.123 11.968  1.00 17.36 ? 118 GLY A C     1 
ATOM   960  O  O     . GLY A 1 116 ? -27.567 -11.950 10.788  1.00 14.49 ? 118 GLY A O     1 
ATOM   961  N  N     . ASN A 1 117 ? -26.061 -12.486 12.365  1.00 14.00 ? 119 ASN A N     1 
ATOM   962  C  CA    . ASN A 1 117 ? -24.958 -12.623 11.419  1.00 12.12 ? 119 ASN A CA    1 
ATOM   963  C  C     . ASN A 1 117 ? -24.795 -14.054 10.906  1.00 15.66 ? 119 ASN A C     1 
ATOM   964  O  O     . ASN A 1 117 ? -25.422 -14.982 11.420  1.00 14.14 ? 119 ASN A O     1 
ATOM   965  C  CB    . ASN A 1 117 ? -23.640 -12.119 12.046  1.00 13.49 ? 119 ASN A CB    1 
ATOM   966  C  CG    . ASN A 1 117 ? -22.504 -12.030 11.035  1.00 14.00 ? 119 ASN A CG    1 
ATOM   967  O  OD1   . ASN A 1 117 ? -22.681 -11.520 9.921   1.00 15.77 ? 119 ASN A OD1   1 
ATOM   968  N  ND2   . ASN A 1 117 ? -21.334 -12.549 11.409  1.00 13.03 ? 119 ASN A ND2   1 
ATOM   969  N  N     . LYS A 1 118 ? -23.938 -14.214 9.895   1.00 15.05 ? 120 LYS A N     1 
ATOM   970  C  CA    . LYS A 1 118 ? -23.676 -15.507 9.248   1.00 15.40 ? 120 LYS A CA    1 
ATOM   971  C  C     . LYS A 1 118 ? -24.850 -16.028 8.435   1.00 13.52 ? 120 LYS A C     1 
ATOM   972  O  O     . LYS A 1 118 ? -24.998 -17.232 8.270   1.00 16.30 ? 120 LYS A O     1 
ATOM   973  C  CB    . LYS A 1 118 ? -23.210 -16.568 10.266  1.00 10.06 ? 120 LYS A CB    1 
ATOM   974  C  CG    . LYS A 1 118 ? -22.000 -16.123 11.082  1.00 15.55 ? 120 LYS A CG    1 
ATOM   975  C  CD    . LYS A 1 118 ? -21.340 -17.287 11.823  1.00 16.05 ? 120 LYS A CD    1 
ATOM   976  C  CE    . LYS A 1 118 ? -20.189 -16.813 12.720  1.00 18.16 ? 120 LYS A CE    1 
ATOM   977  N  NZ    . LYS A 1 118 ? -19.502 -17.970 13.397  1.00 15.67 ? 120 LYS A NZ    1 
ATOM   978  N  N     . LYS A 1 119 ? -25.660 -15.128 7.882   1.00 16.09 ? 121 LYS A N     1 
ATOM   979  C  CA    . LYS A 1 119 ? -26.809 -15.579 7.095   1.00 15.32 ? 121 LYS A CA    1 
ATOM   980  C  C     . LYS A 1 119 ? -26.422 -16.399 5.847   1.00 15.47 ? 121 LYS A C     1 
ATOM   981  O  O     . LYS A 1 119 ? -27.258 -17.093 5.288   1.00 15.76 ? 121 LYS A O     1 
ATOM   982  C  CB    . LYS A 1 119 ? -27.715 -14.414 6.699   1.00 18.10 ? 121 LYS A CB    1 
ATOM   983  C  CG    . LYS A 1 119 ? -27.178 -13.559 5.555   1.00 17.08 ? 121 LYS A CG    1 
ATOM   984  C  CD    . LYS A 1 119 ? -28.105 -12.393 5.283   1.00 23.93 ? 121 LYS A CD    1 
ATOM   985  C  CE    . LYS A 1 119 ? -27.707 -11.652 4.009   1.00 29.22 ? 121 LYS A CE    1 
ATOM   986  N  NZ    . LYS A 1 119 ? -27.952 -12.479 2.783   1.00 49.09 ? 121 LYS A NZ    1 
ATOM   987  N  N     . ASP A 1 120 ? -25.171 -16.308 5.419   1.00 12.49 ? 122 ASP A N     1 
ATOM   988  C  CA    . ASP A 1 120 ? -24.692 -17.095 4.280   1.00 20.76 ? 122 ASP A CA    1 
ATOM   989  C  C     . ASP A 1 120 ? -24.587 -18.587 4.598   1.00 22.76 ? 122 ASP A C     1 
ATOM   990  O  O     . ASP A 1 120 ? -24.529 -19.419 3.685   1.00 19.90 ? 122 ASP A O     1 
ATOM   991  C  CB    . ASP A 1 120 ? -23.327 -16.603 3.829   1.00 19.81 ? 122 ASP A CB    1 
ATOM   992  C  CG    . ASP A 1 120 ? -22.313 -16.671 4.932   1.00 23.77 ? 122 ASP A CG    1 
ATOM   993  O  OD1   . ASP A 1 120 ? -22.424 -15.850 5.866   1.00 17.00 ? 122 ASP A OD1   1 
ATOM   994  O  OD2   . ASP A 1 120 ? -21.419 -17.541 4.880   1.00 17.91 ? 122 ASP A OD2   1 
ATOM   995  N  N     . LEU A 1 121 ? -24.546 -18.932 5.882   1.00 14.33 ? 123 LEU A N     1 
ATOM   996  C  CA    . LEU A 1 121 ? -24.418 -20.336 6.261   1.00 16.41 ? 123 LEU A CA    1 
ATOM   997  C  C     . LEU A 1 121 ? -25.795 -20.959 6.395   1.00 17.12 ? 123 LEU A C     1 
ATOM   998  O  O     . LEU A 1 121 ? -26.199 -21.402 7.478   1.00 22.06 ? 123 LEU A O     1 
ATOM   999  C  CB    . LEU A 1 121 ? -23.636 -20.478 7.560   1.00 14.22 ? 123 LEU A CB    1 
ATOM   1000 C  CG    . LEU A 1 121 ? -22.192 -20.004 7.490   1.00 17.60 ? 123 LEU A CG    1 
ATOM   1001 C  CD1   . LEU A 1 121 ? -21.504 -20.192 8.852   1.00 22.29 ? 123 LEU A CD1   1 
ATOM   1002 C  CD2   . LEU A 1 121 ? -21.441 -20.752 6.362   1.00 17.52 ? 123 LEU A CD2   1 
ATOM   1003 N  N     . HIS A 1 122 ? -26.516 -20.971 5.281   1.00 19.22 ? 124 HIS A N     1 
ATOM   1004 C  CA    . HIS A 1 122 ? -27.936 -21.284 5.285   1.00 23.19 ? 124 HIS A CA    1 
ATOM   1005 C  C     . HIS A 1 122 ? -28.187 -22.721 5.703   1.00 25.72 ? 124 HIS A C     1 
ATOM   1006 O  O     . HIS A 1 122 ? -29.241 -23.039 6.253   1.00 23.58 ? 124 HIS A O     1 
ATOM   1007 C  CB    . HIS A 1 122 ? -28.564 -20.980 3.922   1.00 23.92 ? 124 HIS A CB    1 
ATOM   1008 C  CG    . HIS A 1 122 ? -27.937 -21.726 2.785   1.00 26.98 ? 124 HIS A CG    1 
ATOM   1009 N  ND1   . HIS A 1 122 ? -28.331 -22.993 2.423   1.00 30.75 ? 124 HIS A ND1   1 
ATOM   1010 C  CD2   . HIS A 1 122 ? -26.947 -21.376 1.932   1.00 27.86 ? 124 HIS A CD2   1 
ATOM   1011 C  CE1   . HIS A 1 122 ? -27.608 -23.397 1.392   1.00 33.03 ? 124 HIS A CE1   1 
ATOM   1012 N  NE2   . HIS A 1 122 ? -26.756 -22.437 1.077   1.00 33.78 ? 124 HIS A NE2   1 
ATOM   1013 N  N     . MET A 1 123 ? -27.213 -23.589 5.468   1.00 22.20 ? 125 MET A N     1 
ATOM   1014 C  CA    . MET A 1 123 ? -27.362 -24.969 5.913   1.00 26.73 ? 125 MET A CA    1 
ATOM   1015 C  C     . MET A 1 123 ? -27.078 -25.159 7.401   1.00 25.46 ? 125 MET A C     1 
ATOM   1016 O  O     . MET A 1 123 ? -27.259 -26.253 7.915   1.00 25.01 ? 125 MET A O     1 
ATOM   1017 C  CB    . MET A 1 123 ? -26.488 -25.910 5.087   1.00 25.70 ? 125 MET A CB    1 
ATOM   1018 C  CG    . MET A 1 123 ? -26.952 -26.026 3.640   1.00 37.56 ? 125 MET A CG    1 
ATOM   1019 S  SD    . MET A 1 123 ? -26.163 -27.372 2.735   1.00 56.22 ? 125 MET A SD    1 
ATOM   1020 C  CE    . MET A 1 123 ? -27.015 -28.788 3.437   1.00 45.67 ? 125 MET A CE    1 
ATOM   1021 N  N     . GLU A 1 124 ? -26.634 -24.103 8.085   1.00 20.03 ? 126 GLU A N     1 
ATOM   1022 C  CA    . GLU A 1 124 ? -26.280 -24.205 9.500   1.00 22.81 ? 126 GLU A CA    1 
ATOM   1023 C  C     . GLU A 1 124 ? -27.158 -23.324 10.382  1.00 23.16 ? 126 GLU A C     1 
ATOM   1024 O  O     . GLU A 1 124 ? -26.912 -23.190 11.575  1.00 19.10 ? 126 GLU A O     1 
ATOM   1025 C  CB    . GLU A 1 124 ? -24.809 -23.849 9.718   1.00 19.65 ? 126 GLU A CB    1 
ATOM   1026 C  CG    . GLU A 1 124 ? -23.840 -24.720 8.927   1.00 33.57 ? 126 GLU A CG    1 
ATOM   1027 C  CD    . GLU A 1 124 ? -22.388 -24.274 9.065   1.00 42.42 ? 126 GLU A CD    1 
ATOM   1028 O  OE1   . GLU A 1 124 ? -22.004 -23.758 10.143  1.00 33.07 ? 126 GLU A OE1   1 
ATOM   1029 O  OE2   . GLU A 1 124 ? -21.625 -24.441 8.091   1.00 50.75 ? 126 GLU A OE2   1 
ATOM   1030 N  N     . ARG A 1 125 ? -28.190 -22.728 9.798   1.00 17.03 ? 127 ARG A N     1 
ATOM   1031 C  CA    . ARG A 1 125 ? -29.065 -21.835 10.554  1.00 19.17 ? 127 ARG A CA    1 
ATOM   1032 C  C     . ARG A 1 125 ? -29.875 -22.559 11.626  1.00 19.35 ? 127 ARG A C     1 
ATOM   1033 O  O     . ARG A 1 125 ? -30.489 -23.587 11.362  1.00 15.17 ? 127 ARG A O     1 
ATOM   1034 C  CB    . ARG A 1 125 ? -30.029 -21.118 9.608   1.00 17.15 ? 127 ARG A CB    1 
ATOM   1035 C  CG    . ARG A 1 125 ? -31.007 -20.194 10.322  1.00 13.33 ? 127 ARG A CG    1 
ATOM   1036 C  CD    . ARG A 1 125 ? -32.064 -19.680 9.331   1.00 17.77 ? 127 ARG A CD    1 
ATOM   1037 N  NE    . ARG A 1 125 ? -31.541 -18.680 8.402   1.00 18.29 ? 127 ARG A NE    1 
ATOM   1038 C  CZ    . ARG A 1 125 ? -31.534 -17.370 8.649   1.00 20.79 ? 127 ARG A CZ    1 
ATOM   1039 N  NH1   . ARG A 1 125 ? -32.015 -16.917 9.802   1.00 14.56 ? 127 ARG A NH1   1 
ATOM   1040 N  NH2   . ARG A 1 125 ? -31.047 -16.515 7.752   1.00 17.86 ? 127 ARG A NH2   1 
ATOM   1041 N  N     . VAL A 1 126 ? -29.911 -21.995 12.828  1.00 15.16 ? 128 VAL A N     1 
ATOM   1042 C  CA    . VAL A 1 126 ? -30.778 -22.525 13.868  1.00 19.58 ? 128 VAL A CA    1 
ATOM   1043 C  C     . VAL A 1 126 ? -31.723 -21.452 14.408  1.00 17.87 ? 128 VAL A C     1 
ATOM   1044 O  O     . VAL A 1 126 ? -32.661 -21.761 15.133  1.00 17.97 ? 128 VAL A O     1 
ATOM   1045 C  CB    . VAL A 1 126 ? -29.973 -23.166 15.021  1.00 21.40 ? 128 VAL A CB    1 
ATOM   1046 C  CG1   . VAL A 1 126 ? -29.301 -24.452 14.540  1.00 18.89 ? 128 VAL A CG1   1 
ATOM   1047 C  CG2   . VAL A 1 126 ? -28.955 -22.173 15.588  1.00 14.29 ? 128 VAL A CG2   1 
ATOM   1048 N  N     . ILE A 1 127 ? -31.480 -20.192 14.044  1.00 14.62 ? 129 ILE A N     1 
ATOM   1049 C  CA    . ILE A 1 127 ? -32.357 -19.102 14.458  1.00 13.81 ? 129 ILE A CA    1 
ATOM   1050 C  C     . ILE A 1 127 ? -33.102 -18.600 13.222  1.00 15.85 ? 129 ILE A C     1 
ATOM   1051 O  O     . ILE A 1 127 ? -32.482 -18.256 12.217  1.00 15.63 ? 129 ILE A O     1 
ATOM   1052 C  CB    . ILE A 1 127 ? -31.565 -17.925 15.059  1.00 18.58 ? 129 ILE A CB    1 
ATOM   1053 C  CG1   . ILE A 1 127 ? -30.568 -18.407 16.124  1.00 20.53 ? 129 ILE A CG1   1 
ATOM   1054 C  CG2   . ILE A 1 127 ? -32.525 -16.872 15.620  1.00 18.45 ? 129 ILE A CG2   1 
ATOM   1055 C  CD1   . ILE A 1 127 ? -31.191 -19.087 17.344  1.00 19.18 ? 129 ILE A CD1   1 
ATOM   1056 N  N     . SER A 1 128 ? -34.426 -18.556 13.279  1.00 16.41 ? 130 SER A N     1 
ATOM   1057 C  CA    . SER A 1 128 ? -35.183 -18.097 12.106  1.00 16.45 ? 130 SER A CA    1 
ATOM   1058 C  C     . SER A 1 128 ? -35.084 -16.585 12.000  1.00 16.74 ? 130 SER A C     1 
ATOM   1059 O  O     . SER A 1 128 ? -34.798 -15.901 12.993  1.00 14.35 ? 130 SER A O     1 
ATOM   1060 C  CB    . SER A 1 128 ? -36.649 -18.517 12.199  1.00 18.17 ? 130 SER A CB    1 
ATOM   1061 O  OG    . SER A 1 128 ? -37.316 -17.810 13.233  1.00 18.90 ? 130 SER A OG    1 
ATOM   1062 N  N     . TYR A 1 129 ? -35.301 -16.056 10.802  1.00 14.54 ? 131 TYR A N     1 
ATOM   1063 C  CA    . TYR A 1 129 ? -35.380 -14.608 10.630  1.00 17.65 ? 131 TYR A CA    1 
ATOM   1064 C  C     . TYR A 1 129 ? -36.446 -14.036 11.573  1.00 16.09 ? 131 TYR A C     1 
ATOM   1065 O  O     . TYR A 1 129 ? -36.243 -13.015 12.244  1.00 11.34 ? 131 TYR A O     1 
ATOM   1066 C  CB    . TYR A 1 129 ? -35.727 -14.250 9.169   1.00 17.04 ? 131 TYR A CB    1 
ATOM   1067 C  CG    . TYR A 1 129 ? -35.537 -12.774 8.839   1.00 20.81 ? 131 TYR A CG    1 
ATOM   1068 C  CD1   . TYR A 1 129 ? -34.339 -12.313 8.289   1.00 23.83 ? 131 TYR A CD1   1 
ATOM   1069 C  CD2   . TYR A 1 129 ? -36.547 -11.852 9.069   1.00 17.01 ? 131 TYR A CD2   1 
ATOM   1070 C  CE1   . TYR A 1 129 ? -34.153 -10.984 7.991   1.00 23.75 ? 131 TYR A CE1   1 
ATOM   1071 C  CE2   . TYR A 1 129 ? -36.369 -10.503 8.769   1.00 27.66 ? 131 TYR A CE2   1 
ATOM   1072 C  CZ    . TYR A 1 129 ? -35.166 -10.082 8.232   1.00 17.38 ? 131 TYR A CZ    1 
ATOM   1073 O  OH    . TYR A 1 129 ? -34.967 -8.760  7.936   1.00 32.66 ? 131 TYR A OH    1 
ATOM   1074 N  N     . GLU A 1 130 ? -37.590 -14.703 11.611  1.00 16.48 ? 132 GLU A N     1 
ATOM   1075 C  CA    . GLU A 1 130 ? -38.729 -14.241 12.408  1.00 16.60 ? 132 GLU A CA    1 
ATOM   1076 C  C     . GLU A 1 130 ? -38.377 -14.100 13.898  1.00 17.08 ? 132 GLU A C     1 
ATOM   1077 O  O     . GLU A 1 130 ? -38.802 -13.137 14.572  1.00 12.13 ? 132 GLU A O     1 
ATOM   1078 C  CB    . GLU A 1 130 ? -39.924 -15.194 12.206  1.00 14.62 ? 132 GLU A CB    1 
ATOM   1079 C  CG    . GLU A 1 130 ? -41.137 -14.947 13.133  1.00 15.43 ? 132 GLU A CG    1 
ATOM   1080 C  CD    . GLU A 1 130 ? -41.829 -13.603 12.884  1.00 17.36 ? 132 GLU A CD    1 
ATOM   1081 O  OE1   . GLU A 1 130 ? -41.766 -13.087 11.754  1.00 16.22 ? 132 GLU A OE1   1 
ATOM   1082 O  OE2   . GLU A 1 130 ? -42.455 -13.057 13.816  1.00 16.30 ? 132 GLU A OE2   1 
ATOM   1083 N  N     . GLU A 1 131 ? -37.618 -15.063 14.422  1.00 18.88 ? 133 GLU A N     1 
ATOM   1084 C  CA    . GLU A 1 131 ? -37.259 -15.048 15.837  1.00 23.90 ? 133 GLU A CA    1 
ATOM   1085 C  C     . GLU A 1 131 ? -36.466 -13.798 16.161  1.00 15.94 ? 133 GLU A C     1 
ATOM   1086 O  O     . GLU A 1 131 ? -36.745 -13.111 17.147  1.00 15.76 ? 133 GLU A O     1 
ATOM   1087 C  CB    . GLU A 1 131 ? -36.415 -16.270 16.213  1.00 15.78 ? 133 GLU A CB    1 
ATOM   1088 C  CG    . GLU A 1 131 ? -37.162 -17.565 16.317  1.00 30.72 ? 133 GLU A CG    1 
ATOM   1089 C  CD    . GLU A 1 131 ? -36.235 -18.717 16.644  1.00 38.16 ? 133 GLU A CD    1 
ATOM   1090 O  OE1   . GLU A 1 131 ? -36.025 -18.957 17.849  1.00 30.92 ? 133 GLU A OE1   1 
ATOM   1091 O  OE2   . GLU A 1 131 ? -35.712 -19.369 15.705  1.00 25.40 ? 133 GLU A OE2   1 
ATOM   1092 N  N     . GLY A 1 132 ? -35.467 -13.522 15.325  1.00 15.09 ? 134 GLY A N     1 
ATOM   1093 C  CA    . GLY A 1 132 ? -34.621 -12.353 15.496  1.00 12.70 ? 134 GLY A CA    1 
ATOM   1094 C  C     . GLY A 1 132 ? -35.409 -11.060 15.357  1.00 18.44 ? 134 GLY A C     1 
ATOM   1095 O  O     . GLY A 1 132 ? -35.298 -10.159 16.186  1.00 16.88 ? 134 GLY A O     1 
ATOM   1096 N  N     . LYS A 1 133 ? -36.217 -10.972 14.303  1.00 19.37 ? 135 LYS A N     1 
ATOM   1097 C  CA    . LYS A 1 133 ? -37.006 -9.778  14.030  1.00 15.97 ? 135 LYS A CA    1 
ATOM   1098 C  C     . LYS A 1 133 ? -37.973 -9.475  15.173  1.00 16.99 ? 135 LYS A C     1 
ATOM   1099 O  O     . LYS A 1 133 ? -38.079 -8.335  15.626  1.00 15.40 ? 135 LYS A O     1 
ATOM   1100 C  CB    . LYS A 1 133 ? -37.786 -9.952  12.722  1.00 19.80 ? 135 LYS A CB    1 
ATOM   1101 C  CG    . LYS A 1 133 ? -38.700 -8.797  12.395  1.00 19.71 ? 135 LYS A CG    1 
ATOM   1102 C  CD    . LYS A 1 133 ? -37.905 -7.609  11.883  1.00 25.71 ? 135 LYS A CD    1 
ATOM   1103 C  CE    . LYS A 1 133 ? -38.811 -6.582  11.215  1.00 28.14 ? 135 LYS A CE    1 
ATOM   1104 N  NZ    . LYS A 1 133 ? -38.088 -5.316  10.916  1.00 42.27 ? 135 LYS A NZ    1 
ATOM   1105 N  N     . ALA A 1 134 ? -38.679 -10.500 15.636  1.00 17.88 ? 136 ALA A N     1 
ATOM   1106 C  CA    . ALA A 1 134 ? -39.636 -10.332 16.731  1.00 13.18 ? 136 ALA A CA    1 
ATOM   1107 C  C     . ALA A 1 134 ? -38.970 -9.908  18.041  1.00 19.95 ? 136 ALA A C     1 
ATOM   1108 O  O     . ALA A 1 134 ? -39.520 -9.104  18.791  1.00 18.87 ? 136 ALA A O     1 
ATOM   1109 C  CB    . ALA A 1 134 ? -40.428 -11.598 16.942  1.00 14.88 ? 136 ALA A CB    1 
ATOM   1110 N  N     . LEU A 1 135 ? -37.805 -10.472 18.329  1.00 18.56 ? 137 LEU A N     1 
ATOM   1111 C  CA    . LEU A 1 135 ? -37.053 -10.065 19.510  1.00 16.15 ? 137 LEU A CA    1 
ATOM   1112 C  C     . LEU A 1 135 ? -36.729 -8.576  19.396  1.00 15.92 ? 137 LEU A C     1 
ATOM   1113 O  O     . LEU A 1 135 ? -37.018 -7.793  20.305  1.00 19.66 ? 137 LEU A O     1 
ATOM   1114 C  CB    . LEU A 1 135 ? -35.758 -10.863 19.621  1.00 17.17 ? 137 LEU A CB    1 
ATOM   1115 C  CG    . LEU A 1 135 ? -34.902 -10.580 20.862  1.00 17.91 ? 137 LEU A CG    1 
ATOM   1116 C  CD1   . LEU A 1 135 ? -35.662 -10.927 22.140  1.00 16.01 ? 137 LEU A CD1   1 
ATOM   1117 C  CD2   . LEU A 1 135 ? -33.616 -11.390 20.774  1.00 18.70 ? 137 LEU A CD2   1 
ATOM   1118 N  N     . ALA A 1 136 ? -36.128 -8.188  18.275  1.00 15.06 ? 138 ALA A N     1 
ATOM   1119 C  CA    . ALA A 1 136 ? -35.808 -6.784  18.053  1.00 17.01 ? 138 ALA A CA    1 
ATOM   1120 C  C     . ALA A 1 136 ? -37.060 -5.937  18.216  1.00 23.51 ? 138 ALA A C     1 
ATOM   1121 O  O     . ALA A 1 136 ? -37.033 -4.889  18.854  1.00 22.47 ? 138 ALA A O     1 
ATOM   1122 C  CB    . ALA A 1 136 ? -35.201 -6.578  16.693  1.00 19.30 ? 138 ALA A CB    1 
ATOM   1123 N  N     . GLU A 1 137 ? -38.164 -6.390  17.640  1.00 19.76 ? 139 GLU A N     1 
ATOM   1124 C  CA    . GLU A 1 137 ? -39.431 -5.671  17.796  1.00 17.19 ? 139 GLU A CA    1 
ATOM   1125 C  C     . GLU A 1 137 ? -39.870 -5.526  19.254  1.00 19.28 ? 139 GLU A C     1 
ATOM   1126 O  O     . GLU A 1 137 ? -40.392 -4.482  19.641  1.00 19.64 ? 139 GLU A O     1 
ATOM   1127 C  CB    . GLU A 1 137 ? -40.529 -6.332  16.968  1.00 12.75 ? 139 GLU A CB    1 
ATOM   1128 C  CG    . GLU A 1 137 ? -40.499 -5.884  15.504  1.00 17.92 ? 139 GLU A CG    1 
ATOM   1129 C  CD    . GLU A 1 137 ? -41.136 -6.880  14.543  1.00 21.92 ? 139 GLU A CD    1 
ATOM   1130 O  OE1   . GLU A 1 137 ? -41.194 -6.568  13.325  1.00 18.66 ? 139 GLU A OE1   1 
ATOM   1131 O  OE2   . GLU A 1 137 ? -41.573 -7.964  14.993  1.00 16.70 ? 139 GLU A OE2   1 
ATOM   1132 N  N     . SER A 1 138 ? -39.662 -6.570  20.055  1.00 18.99 ? 140 SER A N     1 
ATOM   1133 C  CA    . SER A 1 138 ? -40.012 -6.530  21.480  1.00 17.48 ? 140 SER A CA    1 
ATOM   1134 C  C     . SER A 1 138 ? -39.102 -5.570  22.253  1.00 23.91 ? 140 SER A C     1 
ATOM   1135 O  O     . SER A 1 138 ? -39.415 -5.165  23.372  1.00 23.34 ? 140 SER A O     1 
ATOM   1136 C  CB    . SER A 1 138 ? -39.925 -7.930  22.096  1.00 16.30 ? 140 SER A CB    1 
ATOM   1137 O  OG    . SER A 1 138 ? -38.582 -8.245  22.464  1.00 17.01 ? 140 SER A OG    1 
ATOM   1138 N  N     . TRP A 1 139 ? -37.975 -5.216  21.650  1.00 15.17 ? 141 TRP A N     1 
ATOM   1139 C  CA    . TRP A 1 139 ? -37.023 -4.292  22.255  1.00 20.75 ? 141 TRP A CA    1 
ATOM   1140 C  C     . TRP A 1 139 ? -37.204 -2.891  21.697  1.00 24.13 ? 141 TRP A C     1 
ATOM   1141 O  O     . TRP A 1 139 ? -36.496 -1.965  22.097  1.00 21.65 ? 141 TRP A O     1 
ATOM   1142 C  CB    . TRP A 1 139 ? -35.607 -4.686  21.885  1.00 18.02 ? 141 TRP A CB    1 
ATOM   1143 C  CG    . TRP A 1 139 ? -35.085 -5.959  22.460  1.00 18.41 ? 141 TRP A CG    1 
ATOM   1144 C  CD1   . TRP A 1 139 ? -35.676 -6.780  23.373  1.00 14.75 ? 141 TRP A CD1   1 
ATOM   1145 C  CD2   . TRP A 1 139 ? -33.840 -6.541  22.136  1.00 16.75 ? 141 TRP A CD2   1 
ATOM   1146 N  NE1   . TRP A 1 139 ? -34.858 -7.865  23.631  1.00 18.38 ? 141 TRP A NE1   1 
ATOM   1147 C  CE2   . TRP A 1 139 ? -33.710 -7.727  22.878  1.00 19.35 ? 141 TRP A CE2   1 
ATOM   1148 C  CE3   . TRP A 1 139 ? -32.795 -6.166  21.280  1.00 18.64 ? 141 TRP A CE3   1 
ATOM   1149 C  CZ2   . TRP A 1 139 ? -32.596 -8.546  22.789  1.00 22.50 ? 141 TRP A CZ2   1 
ATOM   1150 C  CZ3   . TRP A 1 139 ? -31.684 -6.968  21.195  1.00 21.21 ? 141 TRP A CZ3   1 
ATOM   1151 C  CH2   . TRP A 1 139 ? -31.591 -8.145  21.931  1.00 16.61 ? 141 TRP A CH2   1 
ATOM   1152 N  N     . ASN A 1 140 ? -38.120 -2.752  20.746  1.00 15.13 ? 142 ASN A N     1 
ATOM   1153 C  CA    . ASN A 1 140 ? -38.260 -1.513  19.989  1.00 21.28 ? 142 ASN A CA    1 
ATOM   1154 C  C     . ASN A 1 140 ? -36.942 -1.167  19.312  1.00 25.29 ? 142 ASN A C     1 
ATOM   1155 O  O     . ASN A 1 140 ? -36.522 -0.009  19.288  1.00 24.48 ? 142 ASN A O     1 
ATOM   1156 C  CB    . ASN A 1 140 ? -38.730 -0.364  20.898  1.00 21.16 ? 142 ASN A CB    1 
ATOM   1157 C  CG    . ASN A 1 140 ? -39.270 0.821   20.115  1.00 44.47 ? 142 ASN A CG    1 
ATOM   1158 O  OD1   . ASN A 1 140 ? -38.937 1.976   20.401  1.00 59.83 ? 142 ASN A OD1   1 
ATOM   1159 N  ND2   . ASN A 1 140 ? -40.107 0.541   19.116  1.00 48.82 ? 142 ASN A ND2   1 
ATOM   1160 N  N     . ALA A 1 141 ? -36.291 -2.187  18.760  1.00 21.51 ? 143 ALA A N     1 
ATOM   1161 C  CA    . ALA A 1 141 ? -34.987 -2.029  18.125  1.00 23.86 ? 143 ALA A CA    1 
ATOM   1162 C  C     . ALA A 1 141 ? -35.049 -2.357  16.642  1.00 23.51 ? 143 ALA A C     1 
ATOM   1163 O  O     . ALA A 1 141 ? -35.866 -3.158  16.201  1.00 21.11 ? 143 ALA A O     1 
ATOM   1164 C  CB    . ALA A 1 141 ? -33.949 -2.934  18.800  1.00 22.78 ? 143 ALA A CB    1 
ATOM   1165 N  N     . ALA A 1 142 ? -34.152 -1.759  15.879  1.00 17.07 ? 144 ALA A N     1 
ATOM   1166 C  CA    . ALA A 1 142 ? -33.967 -2.172  14.502  1.00 20.44 ? 144 ALA A CA    1 
ATOM   1167 C  C     . ALA A 1 142 ? -33.378 -3.587  14.435  1.00 21.22 ? 144 ALA A C     1 
ATOM   1168 O  O     . ALA A 1 142 ? -32.601 -4.001  15.309  1.00 16.87 ? 144 ALA A O     1 
ATOM   1169 C  CB    . ALA A 1 142 ? -33.055 -1.205  13.800  1.00 20.33 ? 144 ALA A CB    1 
ATOM   1170 N  N     . PHE A 1 143 ? -33.746 -4.316  13.388  1.00 16.19 ? 145 PHE A N     1 
ATOM   1171 C  CA    . PHE A 1 143 ? -33.190 -5.634  13.108  1.00 14.62 ? 145 PHE A CA    1 
ATOM   1172 C  C     . PHE A 1 143 ? -32.645 -5.723  11.690  1.00 18.96 ? 145 PHE A C     1 
ATOM   1173 O  O     . PHE A 1 143 ? -33.260 -5.223  10.754  1.00 17.12 ? 145 PHE A O     1 
ATOM   1174 C  CB    . PHE A 1 143 ? -34.260 -6.702  13.262  1.00 14.71 ? 145 PHE A CB    1 
ATOM   1175 C  CG    . PHE A 1 143 ? -33.763 -8.102  13.008  1.00 15.84 ? 145 PHE A CG    1 
ATOM   1176 C  CD1   . PHE A 1 143 ? -32.863 -8.700  13.878  1.00 13.24 ? 145 PHE A CD1   1 
ATOM   1177 C  CD2   . PHE A 1 143 ? -34.219 -8.830  11.912  1.00 15.92 ? 145 PHE A CD2   1 
ATOM   1178 C  CE1   . PHE A 1 143 ? -32.406 -9.999  13.669  1.00 12.51 ? 145 PHE A CE1   1 
ATOM   1179 C  CE2   . PHE A 1 143 ? -33.772 -10.129 11.687  1.00 22.91 ? 145 PHE A CE2   1 
ATOM   1180 C  CZ    . PHE A 1 143 ? -32.864 -10.720 12.579  1.00 13.87 ? 145 PHE A CZ    1 
ATOM   1181 N  N     . LEU A 1 144 ? -31.509 -6.394  11.538  1.00 15.83 ? 146 LEU A N     1 
ATOM   1182 C  CA    . LEU A 1 144 ? -31.006 -6.801  10.227  1.00 14.69 ? 146 LEU A CA    1 
ATOM   1183 C  C     . LEU A 1 144 ? -30.345 -8.168  10.347  1.00 19.24 ? 146 LEU A C     1 
ATOM   1184 O  O     . LEU A 1 144 ? -29.828 -8.500  11.409  1.00 15.97 ? 146 LEU A O     1 
ATOM   1185 C  CB    . LEU A 1 144 ? -29.951 -5.805  9.759   1.00 16.38 ? 146 LEU A CB    1 
ATOM   1186 C  CG    . LEU A 1 144 ? -30.182 -4.799  8.632   1.00 35.64 ? 146 LEU A CG    1 
ATOM   1187 C  CD1   . LEU A 1 144 ? -31.644 -4.484  8.345   1.00 29.08 ? 146 LEU A CD1   1 
ATOM   1188 C  CD2   . LEU A 1 144 ? -29.370 -3.539  8.930   1.00 21.01 ? 146 LEU A CD2   1 
ATOM   1189 N  N     . GLU A 1 145 ? -30.358 -8.963  9.274   1.00 13.51 ? 147 GLU A N     1 
ATOM   1190 C  CA    . GLU A 1 145 ? -29.421 -10.075 9.179   1.00 13.74 ? 147 GLU A CA    1 
ATOM   1191 C  C     . GLU A 1 145 ? -28.248 -9.642  8.310   1.00 19.13 ? 147 GLU A C     1 
ATOM   1192 O  O     . GLU A 1 145 ? -28.375 -8.731  7.497   1.00 17.28 ? 147 GLU A O     1 
ATOM   1193 C  CB    . GLU A 1 145 ? -30.089 -11.340 8.632   1.00 15.11 ? 147 GLU A CB    1 
ATOM   1194 C  CG    . GLU A 1 145 ? -31.043 -11.991 9.632   1.00 18.33 ? 147 GLU A CG    1 
ATOM   1195 C  CD    . GLU A 1 145 ? -31.388 -13.444 9.276   1.00 14.88 ? 147 GLU A CD    1 
ATOM   1196 O  OE1   . GLU A 1 145 ? -31.872 -14.176 10.160  1.00 16.08 ? 147 GLU A OE1   1 
ATOM   1197 O  OE2   . GLU A 1 145 ? -31.192 -13.846 8.120   1.00 17.04 ? 147 GLU A OE2   1 
ATOM   1198 N  N     . SER A 1 146 ? -27.102 -10.284 8.491   1.00 15.92 ? 148 SER A N     1 
ATOM   1199 C  CA    . SER A 1 146 ? -25.908 -9.897  7.773   1.00 18.15 ? 148 SER A CA    1 
ATOM   1200 C  C     . SER A 1 146 ? -25.041 -11.102 7.485   1.00 18.09 ? 148 SER A C     1 
ATOM   1201 O  O     . SER A 1 146 ? -25.240 -12.185 8.048   1.00 15.65 ? 148 SER A O     1 
ATOM   1202 C  CB    . SER A 1 146 ? -25.077 -8.898  8.603   1.00 10.47 ? 148 SER A CB    1 
ATOM   1203 O  OG    . SER A 1 146 ? -24.612 -9.518  9.809   1.00 15.96 ? 148 SER A OG    1 
ATOM   1204 N  N     . SER A 1 147 ? -24.057 -10.879 6.621   1.00 16.48 ? 149 SER A N     1 
ATOM   1205 C  CA    . SER A 1 147 ? -22.950 -11.801 6.435   1.00 15.73 ? 149 SER A CA    1 
ATOM   1206 C  C     . SER A 1 147 ? -21.683 -11.000 6.264   1.00 18.40 ? 149 SER A C     1 
ATOM   1207 O  O     . SER A 1 147 ? -21.604 -10.115 5.395   1.00 19.49 ? 149 SER A O     1 
ATOM   1208 C  CB    . SER A 1 147 ? -23.142 -12.660 5.184   1.00 19.38 ? 149 SER A CB    1 
ATOM   1209 O  OG    . SER A 1 147 ? -21.933 -13.323 4.872   1.00 20.08 ? 149 SER A OG    1 
ATOM   1210 N  N     . ALA A 1 148 ? -20.677 -11.333 7.058   1.00 16.72 ? 150 ALA A N     1 
ATOM   1211 C  CA    . ALA A 1 148 ? -19.397 -10.627 6.974   1.00 19.15 ? 150 ALA A CA    1 
ATOM   1212 C  C     . ALA A 1 148 ? -18.683 -10.896 5.646   1.00 17.51 ? 150 ALA A C     1 
ATOM   1213 O  O     . ALA A 1 148 ? -17.693 -10.235 5.331   1.00 18.42 ? 150 ALA A O     1 
ATOM   1214 C  CB    . ALA A 1 148 ? -18.511 -10.999 8.142   1.00 13.62 ? 150 ALA A CB    1 
ATOM   1215 N  N     . LYS A 1 149 ? -19.184 -11.863 4.869   1.00 16.79 ? 151 LYS A N     1 
ATOM   1216 C  CA    . LYS A 1 149 ? -18.628 -12.130 3.533   1.00 20.68 ? 151 LYS A CA    1 
ATOM   1217 C  C     . LYS A 1 149 ? -19.189 -11.162 2.499   1.00 22.61 ? 151 LYS A C     1 
ATOM   1218 O  O     . LYS A 1 149 ? -18.707 -11.091 1.369   1.00 27.84 ? 151 LYS A O     1 
ATOM   1219 C  CB    . LYS A 1 149 ? -18.950 -13.556 3.077   1.00 18.56 ? 151 LYS A CB    1 
ATOM   1220 C  CG    . LYS A 1 149 ? -18.203 -14.635 3.813   1.00 24.65 ? 151 LYS A CG    1 
ATOM   1221 C  CD    . LYS A 1 149 ? -18.419 -15.985 3.141   1.00 18.68 ? 151 LYS A CD    1 
ATOM   1222 C  CE    . LYS A 1 149 ? -17.539 -17.050 3.767   1.00 36.21 ? 151 LYS A CE    1 
ATOM   1223 N  NZ    . LYS A 1 149 ? -17.820 -18.403 3.196   1.00 36.47 ? 151 LYS A NZ    1 
ATOM   1224 N  N     . GLU A 1 150 ? -20.234 -10.443 2.883   1.00 18.31 ? 152 GLU A N     1 
ATOM   1225 C  CA    . GLU A 1 150 ? -20.955 -9.572  1.961   1.00 19.75 ? 152 GLU A CA    1 
ATOM   1226 C  C     . GLU A 1 150 ? -20.881 -8.112  2.401   1.00 15.55 ? 152 GLU A C     1 
ATOM   1227 O  O     . GLU A 1 150 ? -21.629 -7.684  3.272   1.00 17.91 ? 152 GLU A O     1 
ATOM   1228 C  CB    . GLU A 1 150 ? -22.411 -10.034 1.842   1.00 20.82 ? 152 GLU A CB    1 
ATOM   1229 C  CG    . GLU A 1 150 ? -22.598 -11.268 0.941   1.00 41.18 ? 152 GLU A CG    1 
ATOM   1230 C  CD    . GLU A 1 150 ? -23.548 -12.335 1.500   1.00 38.24 ? 152 GLU A CD    1 
ATOM   1231 O  OE1   . GLU A 1 150 ? -24.758 -12.056 1.701   1.00 28.97 ? 152 GLU A OE1   1 
ATOM   1232 O  OE2   . GLU A 1 150 ? -23.077 -13.472 1.719   1.00 35.90 ? 152 GLU A OE2   1 
ATOM   1233 N  N     . ASN A 1 151 ? -19.996 -7.347  1.768   1.00 22.21 ? 153 ASN A N     1 
ATOM   1234 C  CA    . ASN A 1 151 ? -19.753 -5.958  2.147   1.00 18.88 ? 153 ASN A CA    1 
ATOM   1235 C  C     . ASN A 1 151 ? -21.006 -5.118  2.363   1.00 15.96 ? 153 ASN A C     1 
ATOM   1236 O  O     . ASN A 1 151 ? -21.098 -4.386  3.345   1.00 17.04 ? 153 ASN A O     1 
ATOM   1237 C  CB    . ASN A 1 151 ? -18.813 -5.265  1.148   1.00 17.02 ? 153 ASN A CB    1 
ATOM   1238 C  CG    . ASN A 1 151 ? -18.371 -3.884  1.623   1.00 19.50 ? 153 ASN A CG    1 
ATOM   1239 O  OD1   . ASN A 1 151 ? -18.934 -2.875  1.220   1.00 21.53 ? 153 ASN A OD1   1 
ATOM   1240 N  ND2   . ASN A 1 151 ? -17.362 -3.842  2.482   1.00 23.65 ? 153 ASN A ND2   1 
ATOM   1241 N  N     . GLN A 1 152 ? -21.970 -5.209  1.455   1.00 14.21 ? 154 GLN A N     1 
ATOM   1242 C  CA    . GLN A 1 152 ? -23.141 -4.348  1.559   1.00 17.72 ? 154 GLN A CA    1 
ATOM   1243 C  C     . GLN A 1 152 ? -23.921 -4.628  2.845   1.00 19.07 ? 154 GLN A C     1 
ATOM   1244 O  O     . GLN A 1 152 ? -24.507 -3.719  3.432   1.00 21.38 ? 154 GLN A O     1 
ATOM   1245 C  CB    . GLN A 1 152 ? -24.059 -4.481  0.333   1.00 17.09 ? 154 GLN A CB    1 
ATOM   1246 C  CG    . GLN A 1 152 ? -25.213 -3.486  0.350   1.00 25.13 ? 154 GLN A CG    1 
ATOM   1247 C  CD    . GLN A 1 152 ? -24.736 -2.048  0.224   1.00 22.86 ? 154 GLN A CD    1 
ATOM   1248 O  OE1   . GLN A 1 152 ? -23.964 -1.729  -0.669  1.00 32.99 ? 154 GLN A OE1   1 
ATOM   1249 N  NE2   . GLN A 1 152 ? -25.188 -1.178  1.128   1.00 23.75 ? 154 GLN A NE2   1 
ATOM   1250 N  N     . THR A 1 153 ? -23.918 -5.878  3.301   1.00 18.29 ? 155 THR A N     1 
ATOM   1251 C  CA    . THR A 1 153 ? -24.699 -6.203  4.487   1.00 17.49 ? 155 THR A CA    1 
ATOM   1252 C  C     . THR A 1 153 ? -24.035 -5.602  5.728   1.00 18.30 ? 155 THR A C     1 
ATOM   1253 O  O     . THR A 1 153 ? -24.712 -5.176  6.672   1.00 17.64 ? 155 THR A O     1 
ATOM   1254 C  CB    . THR A 1 153 ? -24.945 -7.741  4.663   1.00 17.28 ? 155 THR A CB    1 
ATOM   1255 O  OG1   . THR A 1 153 ? -23.757 -8.386  5.132   1.00 12.69 ? 155 THR A OG1   1 
ATOM   1256 C  CG2   . THR A 1 153 ? -25.427 -8.395  3.346   1.00 22.73 ? 155 THR A CG2   1 
ATOM   1257 N  N     . ALA A 1 154 ? -22.709 -5.551  5.723   1.00 19.69 ? 156 ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 154 ? -21.994 -4.946  6.842   1.00 14.20 ? 156 ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 154 ? -22.200 -3.427  6.829   1.00 23.14 ? 156 ALA A C     1 
ATOM   1260 O  O     . ALA A 1 154 ? -22.474 -2.813  7.858   1.00 20.15 ? 156 ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 154 ? -20.505 -5.303  6.791   1.00 14.46 ? 156 ALA A CB    1 
ATOM   1262 N  N     . VAL A 1 155 ? -22.083 -2.827  5.649   1.00 18.98 ? 157 VAL A N     1 
ATOM   1263 C  CA    . VAL A 1 155 ? -22.339 -1.403  5.488   1.00 20.56 ? 157 VAL A CA    1 
ATOM   1264 C  C     . VAL A 1 155 ? -23.744 -1.075  5.971   1.00 17.75 ? 157 VAL A C     1 
ATOM   1265 O  O     . VAL A 1 155 ? -23.947 -0.091  6.684   1.00 21.10 ? 157 VAL A O     1 
ATOM   1266 C  CB    . VAL A 1 155 ? -22.170 -0.962  4.009   1.00 15.82 ? 157 VAL A CB    1 
ATOM   1267 C  CG1   . VAL A 1 155 ? -22.706 0.459   3.793   1.00 20.85 ? 157 VAL A CG1   1 
ATOM   1268 C  CG2   . VAL A 1 155 ? -20.707 -1.089  3.573   1.00 18.35 ? 157 VAL A CG2   1 
ATOM   1269 N  N     . ASP A 1 156 ? -24.712 -1.905  5.592   1.00 16.70 ? 158 ASP A N     1 
ATOM   1270 C  CA    . ASP A 1 156 ? -26.099 -1.667  5.968   1.00 18.56 ? 158 ASP A CA    1 
ATOM   1271 C  C     . ASP A 1 156 ? -26.263 -1.667  7.483   1.00 16.98 ? 158 ASP A C     1 
ATOM   1272 O  O     . ASP A 1 156 ? -27.062 -0.907  8.039   1.00 16.34 ? 158 ASP A O     1 
ATOM   1273 C  CB    . ASP A 1 156 ? -27.020 -2.732  5.381   1.00 15.74 ? 158 ASP A CB    1 
ATOM   1274 C  CG    . ASP A 1 156 ? -27.252 -2.553  3.889   1.00 29.64 ? 158 ASP A CG    1 
ATOM   1275 O  OD1   . ASP A 1 156 ? -26.843 -1.512  3.320   1.00 20.50 ? 158 ASP A OD1   1 
ATOM   1276 O  OD2   . ASP A 1 156 ? -27.873 -3.455  3.299   1.00 22.58 ? 158 ASP A OD2   1 
ATOM   1277 N  N     . VAL A 1 157 ? -25.528 -2.548  8.146   1.00 19.59 ? 159 VAL A N     1 
ATOM   1278 C  CA    . VAL A 1 157 ? -25.594 -2.616  9.594   1.00 18.89 ? 159 VAL A CA    1 
ATOM   1279 C  C     . VAL A 1 157 ? -25.145 -1.295  10.219  1.00 18.84 ? 159 VAL A C     1 
ATOM   1280 O  O     . VAL A 1 157 ? -25.868 -0.689  11.004  1.00 16.68 ? 159 VAL A O     1 
ATOM   1281 C  CB    . VAL A 1 157 ? -24.761 -3.777  10.128  1.00 16.74 ? 159 VAL A CB    1 
ATOM   1282 C  CG1   . VAL A 1 157 ? -24.506 -3.598  11.623  1.00 16.86 ? 159 VAL A CG1   1 
ATOM   1283 C  CG2   . VAL A 1 157 ? -25.478 -5.118  9.842   1.00 15.40 ? 159 VAL A CG2   1 
ATOM   1284 N  N     . PHE A 1 158 ? -23.956 -0.839  9.856   1.00 16.02 ? 160 PHE A N     1 
ATOM   1285 C  CA    . PHE A 1 158 ? -23.405 0.362   10.479  1.00 19.89 ? 160 PHE A CA    1 
ATOM   1286 C  C     . PHE A 1 158 ? -24.163 1.629   10.088  1.00 23.61 ? 160 PHE A C     1 
ATOM   1287 O  O     . PHE A 1 158 ? -24.350 2.549   10.908  1.00 22.65 ? 160 PHE A O     1 
ATOM   1288 C  CB    . PHE A 1 158 ? -21.909 0.466   10.198  1.00 15.27 ? 160 PHE A CB    1 
ATOM   1289 C  CG    . PHE A 1 158 ? -21.095 -0.557  10.943  1.00 20.07 ? 160 PHE A CG    1 
ATOM   1290 C  CD1   . PHE A 1 158 ? -20.682 -0.315  12.246  1.00 18.45 ? 160 PHE A CD1   1 
ATOM   1291 C  CD2   . PHE A 1 158 ? -20.772 -1.776  10.355  1.00 20.76 ? 160 PHE A CD2   1 
ATOM   1292 C  CE1   . PHE A 1 158 ? -19.952 -1.257  12.947  1.00 19.67 ? 160 PHE A CE1   1 
ATOM   1293 C  CE2   . PHE A 1 158 ? -20.037 -2.723  11.041  1.00 21.33 ? 160 PHE A CE2   1 
ATOM   1294 C  CZ    . PHE A 1 158 ? -19.623 -2.471  12.344  1.00 20.87 ? 160 PHE A CZ    1 
ATOM   1295 N  N     . ARG A 1 159 ? -24.634 1.677   8.850   1.00 21.08 ? 161 ARG A N     1 
ATOM   1296 C  CA    A ARG A 1 159 ? -25.440 2.808   8.405   0.56 21.96 ? 161 ARG A CA    1 
ATOM   1297 C  CA    B ARG A 1 159 ? -25.434 2.813   8.415   0.44 21.99 ? 161 ARG A CA    1 
ATOM   1298 C  C     . ARG A 1 159 ? -26.729 2.901   9.216   1.00 24.03 ? 161 ARG A C     1 
ATOM   1299 O  O     . ARG A 1 159 ? -27.178 3.986   9.573   1.00 20.90 ? 161 ARG A O     1 
ATOM   1300 C  CB    A ARG A 1 159 ? -25.768 2.695   6.914   0.56 26.56 ? 161 ARG A CB    1 
ATOM   1301 C  CB    B ARG A 1 159 ? -25.741 2.729   6.920   0.44 26.61 ? 161 ARG A CB    1 
ATOM   1302 C  CG    A ARG A 1 159 ? -26.727 3.771   6.415   0.56 36.60 ? 161 ARG A CG    1 
ATOM   1303 C  CG    B ARG A 1 159 ? -26.493 3.940   6.384   0.44 36.87 ? 161 ARG A CG    1 
ATOM   1304 C  CD    A ARG A 1 159 ? -26.920 3.717   4.899   0.56 46.76 ? 161 ARG A CD    1 
ATOM   1305 C  CD    B ARG A 1 159 ? -26.788 3.809   4.898   0.44 46.54 ? 161 ARG A CD    1 
ATOM   1306 N  NE    A ARG A 1 159 ? -27.585 2.488   4.471   0.56 54.83 ? 161 ARG A NE    1 
ATOM   1307 N  NE    B ARG A 1 159 ? -27.699 2.701   4.622   0.44 53.83 ? 161 ARG A NE    1 
ATOM   1308 C  CZ    A ARG A 1 159 ? -27.937 2.220   3.217   0.56 56.06 ? 161 ARG A CZ    1 
ATOM   1309 C  CZ    B ARG A 1 159 ? -29.022 2.820   4.561   0.44 54.37 ? 161 ARG A CZ    1 
ATOM   1310 N  NH1   A ARG A 1 159 ? -27.693 3.097   2.251   0.56 46.17 ? 161 ARG A NH1   1 
ATOM   1311 N  NH1   B ARG A 1 159 ? -29.591 4.002   4.753   0.44 53.65 ? 161 ARG A NH1   1 
ATOM   1312 N  NH2   A ARG A 1 159 ? -28.538 1.074   2.929   0.56 49.30 ? 161 ARG A NH2   1 
ATOM   1313 N  NH2   B ARG A 1 159 ? -29.778 1.759   4.305   0.44 47.13 ? 161 ARG A NH2   1 
ATOM   1314 N  N     . ARG A 1 160 ? -27.331 1.756   9.508   1.00 16.71 ? 162 ARG A N     1 
ATOM   1315 C  CA    A ARG A 1 160 ? -28.618 1.722   10.196  0.55 20.53 ? 162 ARG A CA    1 
ATOM   1316 C  CA    B ARG A 1 160 ? -28.621 1.787   10.175  0.45 20.52 ? 162 ARG A CA    1 
ATOM   1317 C  C     . ARG A 1 160 ? -28.505 2.197   11.643  1.00 15.31 ? 162 ARG A C     1 
ATOM   1318 O  O     . ARG A 1 160 ? -29.412 2.834   12.175  1.00 20.25 ? 162 ARG A O     1 
ATOM   1319 C  CB    A ARG A 1 160 ? -29.210 0.308   10.139  0.55 22.92 ? 162 ARG A CB    1 
ATOM   1320 C  CB    B ARG A 1 160 ? -29.367 0.462   10.012  0.45 22.95 ? 162 ARG A CB    1 
ATOM   1321 C  CG    A ARG A 1 160 ? -30.432 0.092   11.018  0.55 20.02 ? 162 ARG A CG    1 
ATOM   1322 C  CG    B ARG A 1 160 ? -30.877 0.640   9.944   0.45 25.25 ? 162 ARG A CG    1 
ATOM   1323 C  CD    A ARG A 1 160 ? -31.490 1.180   10.809  0.55 21.83 ? 162 ARG A CD    1 
ATOM   1324 C  CD    B ARG A 1 160 ? -31.553 -0.030  11.120  0.45 25.14 ? 162 ARG A CD    1 
ATOM   1325 N  NE    A ARG A 1 160 ? -31.990 1.240   9.438   0.55 23.17 ? 162 ARG A NE    1 
ATOM   1326 N  NE    B ARG A 1 160 ? -32.974 0.305   11.237  0.45 26.77 ? 162 ARG A NE    1 
ATOM   1327 C  CZ    A ARG A 1 160 ? -32.961 2.056   9.034   0.55 33.43 ? 162 ARG A CZ    1 
ATOM   1328 C  CZ    B ARG A 1 160 ? -33.964 -0.415  10.715  0.45 25.38 ? 162 ARG A CZ    1 
ATOM   1329 N  NH1   A ARG A 1 160 ? -33.540 2.880   9.901   0.55 32.05 ? 162 ARG A NH1   1 
ATOM   1330 N  NH1   B ARG A 1 160 ? -33.698 -1.513  10.014  0.45 21.39 ? 162 ARG A NH1   1 
ATOM   1331 N  NH2   A ARG A 1 160 ? -33.355 2.050   7.765   0.55 35.25 ? 162 ARG A NH2   1 
ATOM   1332 N  NH2   B ARG A 1 160 ? -35.220 -0.034  10.893  0.45 20.29 ? 162 ARG A NH2   1 
ATOM   1333 N  N     . ILE A 1 161 ? -27.388 1.871   12.293  1.00 17.30 ? 163 ILE A N     1 
ATOM   1334 C  CA    . ILE A 1 161 ? -27.237 2.293   13.681  1.00 20.43 ? 163 ILE A CA    1 
ATOM   1335 C  C     . ILE A 1 161 ? -27.035 3.796   13.706  1.00 16.62 ? 163 ILE A C     1 
ATOM   1336 O  O     . ILE A 1 161 ? -27.559 4.484   14.582  1.00 19.69 ? 163 ILE A O     1 
ATOM   1337 C  CB    . ILE A 1 161 ? -26.116 1.541   14.451  1.00 17.15 ? 163 ILE A CB    1 
ATOM   1338 C  CG1   . ILE A 1 161 ? -26.247 1.795   15.963  1.00 28.43 ? 163 ILE A CG1   1 
ATOM   1339 C  CG2   . ILE A 1 161 ? -24.747 1.964   13.972  1.00 21.25 ? 163 ILE A CG2   1 
ATOM   1340 C  CD1   . ILE A 1 161 ? -27.568 1.326   16.579  1.00 20.47 ? 163 ILE A CD1   1 
ATOM   1341 N  N     . ILE A 1 162 ? -26.319 4.307   12.709  1.00 23.44 ? 164 ILE A N     1 
ATOM   1342 C  CA    . ILE A 1 162 ? -26.134 5.749   12.536  1.00 22.44 ? 164 ILE A CA    1 
ATOM   1343 C  C     . ILE A 1 162 ? -27.450 6.471   12.290  1.00 25.48 ? 164 ILE A C     1 
ATOM   1344 O  O     . ILE A 1 162 ? -27.730 7.476   12.935  1.00 25.11 ? 164 ILE A O     1 
ATOM   1345 C  CB    . ILE A 1 162 ? -25.189 6.070   11.375  1.00 21.09 ? 164 ILE A CB    1 
ATOM   1346 C  CG1   . ILE A 1 162 ? -23.762 5.659   11.717  1.00 25.18 ? 164 ILE A CG1   1 
ATOM   1347 C  CG2   . ILE A 1 162 ? -25.256 7.569   11.019  1.00 24.14 ? 164 ILE A CG2   1 
ATOM   1348 C  CD1   . ILE A 1 162 ? -22.864 5.537   10.502  1.00 26.93 ? 164 ILE A CD1   1 
ATOM   1349 N  N     . LEU A 1 163 ? -28.249 5.970   11.351  1.00 20.72 ? 165 LEU A N     1 
ATOM   1350 C  CA    . LEU A 1 163 ? -29.587 6.521   11.112  1.00 23.48 ? 165 LEU A CA    1 
ATOM   1351 C  C     . LEU A 1 163 ? -30.462 6.482   12.367  1.00 29.68 ? 165 LEU A C     1 
ATOM   1352 O  O     . LEU A 1 163 ? -31.191 7.438   12.650  1.00 26.87 ? 165 LEU A O     1 
ATOM   1353 C  CB    . LEU A 1 163 ? -30.291 5.783   9.973   1.00 23.82 ? 165 LEU A CB    1 
ATOM   1354 C  CG    . LEU A 1 163 ? -29.688 5.937   8.576   1.00 29.36 ? 165 LEU A CG    1 
ATOM   1355 C  CD1   . LEU A 1 163 ? -30.377 5.010   7.592   1.00 34.83 ? 165 LEU A CD1   1 
ATOM   1356 C  CD2   . LEU A 1 163 ? -29.770 7.377   8.117   1.00 30.64 ? 165 LEU A CD2   1 
ATOM   1357 N  N     . GLU A 1 164 ? -30.387 5.383   13.118  1.00 22.33 ? 166 GLU A N     1 
ATOM   1358 C  CA    . GLU A 1 164 ? -31.206 5.230   14.317  1.00 20.69 ? 166 GLU A CA    1 
ATOM   1359 C  C     . GLU A 1 164 ? -30.828 6.270   15.369  1.00 33.99 ? 166 GLU A C     1 
ATOM   1360 O  O     . GLU A 1 164 ? -31.672 6.720   16.138  1.00 33.29 ? 166 GLU A O     1 
ATOM   1361 C  CB    . GLU A 1 164 ? -31.083 3.826   14.920  1.00 20.87 ? 166 GLU A CB    1 
ATOM   1362 C  CG    . GLU A 1 164 ? -31.744 2.707   14.116  1.00 22.49 ? 166 GLU A CG    1 
ATOM   1363 C  CD    . GLU A 1 164 ? -33.251 2.874   13.975  1.00 27.18 ? 166 GLU A CD    1 
ATOM   1364 O  OE1   . GLU A 1 164 ? -33.769 2.740   12.846  1.00 33.78 ? 166 GLU A OE1   1 
ATOM   1365 O  OE2   . GLU A 1 164 ? -33.926 3.124   14.988  1.00 31.78 ? 166 GLU A OE2   1 
ATOM   1366 N  N     . ALA A 1 165 ? -29.555 6.640   15.406  1.00 28.01 ? 167 ALA A N     1 
ATOM   1367 C  CA    . ALA A 1 165 ? -29.067 7.576   16.417  1.00 31.96 ? 167 ALA A CA    1 
ATOM   1368 C  C     . ALA A 1 165 ? -29.741 8.932   16.277  1.00 43.10 ? 167 ALA A C     1 
ATOM   1369 O  O     . ALA A 1 165 ? -29.959 9.635   17.270  1.00 47.03 ? 167 ALA A O     1 
ATOM   1370 C  CB    . ALA A 1 165 ? -27.553 7.719   16.335  1.00 28.21 ? 167 ALA A CB    1 
ATOM   1371 N  N     . GLU A 1 166 ? -30.087 9.290   15.043  1.00 40.98 ? 168 GLU A N     1 
ATOM   1372 C  CA    . GLU A 1 166 ? -30.634 10.612  14.771  1.00 34.69 ? 168 GLU A CA    1 
ATOM   1373 C  C     . GLU A 1 166 ? -32.106 10.571  14.413  1.00 46.82 ? 168 GLU A C     1 
ATOM   1374 O  O     . GLU A 1 166 ? -32.546 11.233  13.468  1.00 50.93 ? 168 GLU A O     1 
ATOM   1375 C  CB    . GLU A 1 166 ? -29.840 11.298  13.660  1.00 45.97 ? 168 GLU A CB    1 
ATOM   1376 C  CG    . GLU A 1 166 ? -28.419 11.648  14.059  1.00 47.97 ? 168 GLU A CG    1 
ATOM   1377 C  CD    . GLU A 1 166 ? -27.742 12.522  13.031  1.00 51.19 ? 168 GLU A CD    1 
ATOM   1378 O  OE1   . GLU A 1 166 ? -28.459 13.284  12.349  1.00 49.22 ? 168 GLU A OE1   1 
ATOM   1379 O  OE2   . GLU A 1 166 ? -26.501 12.442  12.900  1.00 51.99 ? 168 GLU A OE2   1 
ATOM   1380 N  N     . LYS A 1 167 ? -32.866 9.790   15.170  1.00 47.01 ? 169 LYS A N     1 
ATOM   1381 C  CA    . LYS A 1 167 ? -34.315 9.784   15.033  0.96 44.74 ? 169 LYS A CA    1 
ATOM   1382 C  C     . LYS A 1 167 ? -34.945 10.498  16.222  1.00 50.06 ? 169 LYS A C     1 
ATOM   1383 O  O     . LYS A 1 167 ? -34.234 11.046  17.070  1.00 50.30 ? 169 LYS A O     1 
ATOM   1384 C  CB    . LYS A 1 167 ? -34.843 8.353   14.894  1.00 41.76 ? 169 LYS A CB    1 
ATOM   1385 C  CG    . LYS A 1 167 ? -34.727 7.812   13.478  1.00 43.48 ? 169 LYS A CG    1 
ATOM   1386 C  CD    . LYS A 1 167 ? -35.415 6.464   13.307  1.00 47.11 ? 169 LYS A CD    1 
ATOM   1387 C  CE    . LYS A 1 167 ? -35.251 5.961   11.875  0.79 53.61 ? 169 LYS A CE    1 
ATOM   1388 N  NZ    . LYS A 1 167 ? -35.893 4.635   11.647  0.79 63.02 ? 169 LYS A NZ    1 
ATOM   1389 N  N     . GLN B 1 1   ? -60.774 4.260   16.202  1.00 66.83 ? 3   GLN B N     1 
ATOM   1390 C  CA    . GLN B 1 1   ? -59.686 3.817   17.073  1.00 73.37 ? 3   GLN B CA    1 
ATOM   1391 C  C     . GLN B 1 1   ? -59.256 2.386   16.758  1.00 75.40 ? 3   GLN B C     1 
ATOM   1392 O  O     . GLN B 1 1   ? -58.675 1.700   17.603  1.00 69.45 ? 3   GLN B O     1 
ATOM   1393 C  CB    . GLN B 1 1   ? -60.094 3.936   18.543  1.00 71.95 ? 3   GLN B CB    1 
ATOM   1394 C  CG    . GLN B 1 1   ? -60.253 5.379   19.013  1.00 81.67 ? 3   GLN B CG    1 
ATOM   1395 C  CD    . GLN B 1 1   ? -60.950 5.499   20.357  1.00 47.75 ? 3   GLN B CD    1 
ATOM   1396 O  OE1   . GLN B 1 1   ? -61.169 4.504   21.049  1.00 55.20 ? 3   GLN B OE1   1 
ATOM   1397 N  NE2   . GLN B 1 1   ? -61.308 6.726   20.729  1.00 36.69 ? 3   GLN B NE2   1 
ATOM   1398 N  N     . SER B 1 2   ? -59.541 1.946   15.536  1.00 70.55 ? 4   SER B N     1 
ATOM   1399 C  CA    . SER B 1 2   ? -59.232 0.584   15.115  1.00 67.67 ? 4   SER B CA    1 
ATOM   1400 C  C     . SER B 1 2   ? -59.081 0.520   13.600  1.00 51.62 ? 4   SER B C     1 
ATOM   1401 O  O     . SER B 1 2   ? -60.026 0.807   12.867  1.00 62.11 ? 4   SER B O     1 
ATOM   1402 C  CB    . SER B 1 2   ? -60.334 -0.373  15.576  1.00 63.57 ? 4   SER B CB    1 
ATOM   1403 O  OG    . SER B 1 2   ? -59.994 -1.723  15.309  1.00 61.51 ? 4   SER B OG    1 
ATOM   1404 N  N     . LYS B 1 3   ? -57.895 0.139   13.135  1.00 42.98 ? 5   LYS B N     1 
ATOM   1405 C  CA    . LYS B 1 3   ? -57.602 0.129   11.701  1.00 44.37 ? 5   LYS B CA    1 
ATOM   1406 C  C     . LYS B 1 3   ? -57.988 -1.190  11.052  1.00 46.46 ? 5   LYS B C     1 
ATOM   1407 O  O     . LYS B 1 3   ? -57.501 -2.254  11.444  1.00 41.77 ? 5   LYS B O     1 
ATOM   1408 C  CB    . LYS B 1 3   ? -56.125 0.430   11.453  1.00 41.48 ? 5   LYS B CB    1 
ATOM   1409 C  CG    . LYS B 1 3   ? -55.672 1.728   12.098  1.00 45.46 ? 5   LYS B CG    1 
ATOM   1410 C  CD    . LYS B 1 3   ? -54.232 2.061   11.753  1.00 50.30 ? 5   LYS B CD    1 
ATOM   1411 C  CE    . LYS B 1 3   ? -53.813 3.362   12.410  1.00 51.41 ? 5   LYS B CE    1 
ATOM   1412 N  NZ    . LYS B 1 3   ? -54.801 4.443   12.135  1.00 42.16 ? 5   LYS B NZ    1 
ATOM   1413 N  N     . SER B 1 4   ? -58.871 -1.116  10.060  1.00 36.86 ? 6   SER B N     1 
ATOM   1414 C  CA    . SER B 1 4   ? -59.385 -2.314  9.404   1.00 41.50 ? 6   SER B CA    1 
ATOM   1415 C  C     . SER B 1 4   ? -58.445 -2.769  8.286   1.00 44.85 ? 6   SER B C     1 
ATOM   1416 O  O     . SER B 1 4   ? -58.104 -1.988  7.400   1.00 41.89 ? 6   SER B O     1 
ATOM   1417 C  CB    . SER B 1 4   ? -60.788 -2.055  8.849   1.00 42.56 ? 6   SER B CB    1 
ATOM   1418 O  OG    . SER B 1 4   ? -61.438 -3.268  8.499   1.00 57.40 ? 6   SER B OG    1 
ATOM   1419 N  N     . ARG B 1 5   ? -58.019 -4.029  8.337   1.00 36.73 ? 7   ARG B N     1 
ATOM   1420 C  CA    . ARG B 1 5   ? -57.188 -4.591  7.277   1.00 28.30 ? 7   ARG B CA    1 
ATOM   1421 C  C     . ARG B 1 5   ? -57.836 -5.850  6.706   1.00 36.20 ? 7   ARG B C     1 
ATOM   1422 O  O     . ARG B 1 5   ? -58.341 -6.699  7.453   1.00 32.37 ? 7   ARG B O     1 
ATOM   1423 C  CB    . ARG B 1 5   ? -55.785 -4.904  7.792   1.00 32.00 ? 7   ARG B CB    1 
ATOM   1424 C  CG    . ARG B 1 5   ? -55.006 -3.691  8.297   1.00 43.65 ? 7   ARG B CG    1 
ATOM   1425 C  CD    . ARG B 1 5   ? -54.666 -2.731  7.164   1.00 42.65 ? 7   ARG B CD    1 
ATOM   1426 N  NE    . ARG B 1 5   ? -53.942 -1.552  7.639   1.00 59.18 ? 7   ARG B NE    1 
ATOM   1427 C  CZ    . ARG B 1 5   ? -54.509 -0.374  7.899   1.00 54.59 ? 7   ARG B CZ    1 
ATOM   1428 N  NH1   . ARG B 1 5   ? -55.814 -0.208  7.730   1.00 54.78 ? 7   ARG B NH1   1 
ATOM   1429 N  NH2   . ARG B 1 5   ? -53.772 0.644   8.328   1.00 48.05 ? 7   ARG B NH2   1 
ATOM   1430 N  N     . LYS B 1 6   ? -57.832 -5.964  5.382   1.00 22.12 ? 8   LYS B N     1 
ATOM   1431 C  CA    . LYS B 1 6   ? -58.402 -7.130  4.730   1.00 24.29 ? 8   LYS B CA    1 
ATOM   1432 C  C     . LYS B 1 6   ? -57.274 -7.947  4.117   1.00 21.28 ? 8   LYS B C     1 
ATOM   1433 O  O     . LYS B 1 6   ? -56.464 -7.435  3.345   1.00 24.78 ? 8   LYS B O     1 
ATOM   1434 C  CB    . LYS B 1 6   ? -59.432 -6.716  3.678   1.00 29.38 ? 8   LYS B CB    1 
ATOM   1435 C  CG    . LYS B 1 6   ? -60.291 -7.865  3.164   1.00 35.66 ? 8   LYS B CG    1 
ATOM   1436 C  CD    . LYS B 1 6   ? -61.252 -7.391  2.071   1.00 36.91 ? 8   LYS B CD    1 
ATOM   1437 C  CE    . LYS B 1 6   ? -62.023 -8.556  1.457   1.00 49.27 ? 8   LYS B CE    1 
ATOM   1438 N  NZ    . LYS B 1 6   ? -62.716 -8.191  0.179   1.00 45.82 ? 8   LYS B NZ    1 
ATOM   1439 N  N     . ILE B 1 7   ? -57.210 -9.217  4.490   1.00 24.78 ? 9   ILE B N     1 
ATOM   1440 C  CA    . ILE B 1 7   ? -56.088 -10.062 4.103   1.00 21.66 ? 9   ILE B CA    1 
ATOM   1441 C  C     . ILE B 1 7   ? -56.610 -11.292 3.384   1.00 16.55 ? 9   ILE B C     1 
ATOM   1442 O  O     . ILE B 1 7   ? -57.548 -11.938 3.855   1.00 20.10 ? 9   ILE B O     1 
ATOM   1443 C  CB    . ILE B 1 7   ? -55.295 -10.548 5.344   1.00 22.83 ? 9   ILE B CB    1 
ATOM   1444 C  CG1   . ILE B 1 7   ? -54.902 -9.377  6.263   1.00 17.83 ? 9   ILE B CG1   1 
ATOM   1445 C  CG2   . ILE B 1 7   ? -54.092 -11.424 4.923   1.00 19.81 ? 9   ILE B CG2   1 
ATOM   1446 C  CD1   . ILE B 1 7   ? -53.793 -8.513  5.745   1.00 21.96 ? 9   ILE B CD1   1 
ATOM   1447 N  N     . ALA B 1 8   ? -55.986 -11.637 2.263   1.00 21.59 ? 10  ALA B N     1 
ATOM   1448 C  CA    . ALA B 1 8   ? -56.348 -12.857 1.554   1.00 17.52 ? 10  ALA B CA    1 
ATOM   1449 C  C     . ALA B 1 8   ? -55.306 -13.946 1.825   1.00 27.44 ? 10  ALA B C     1 
ATOM   1450 O  O     . ALA B 1 8   ? -54.096 -13.692 1.730   1.00 20.83 ? 10  ALA B O     1 
ATOM   1451 C  CB    . ALA B 1 8   ? -56.470 -12.585 0.066   1.00 25.10 ? 10  ALA B CB    1 
ATOM   1452 N  N     . ILE B 1 9   ? -55.781 -15.138 2.194   1.00 17.82 ? 11  ILE B N     1 
ATOM   1453 C  CA    . ILE B 1 9   ? -54.923 -16.296 2.417   1.00 17.78 ? 11  ILE B CA    1 
ATOM   1454 C  C     . ILE B 1 9   ? -55.029 -17.228 1.208   1.00 21.91 ? 11  ILE B C     1 
ATOM   1455 O  O     . ILE B 1 9   ? -56.095 -17.771 0.919   1.00 19.86 ? 11  ILE B O     1 
ATOM   1456 C  CB    . ILE B 1 9   ? -55.314 -17.061 3.713   1.00 17.51 ? 11  ILE B CB    1 
ATOM   1457 C  CG1   . ILE B 1 9   ? -55.293 -16.117 4.928   1.00 19.39 ? 11  ILE B CG1   1 
ATOM   1458 C  CG2   . ILE B 1 9   ? -54.360 -18.231 3.959   1.00 10.78 ? 11  ILE B CG2   1 
ATOM   1459 C  CD1   . ILE B 1 9   ? -56.680 -15.641 5.396   1.00 19.06 ? 11  ILE B CD1   1 
ATOM   1460 N  N     . LEU B 1 10  ? -53.925 -17.391 0.488   1.00 20.02 ? 12  LEU B N     1 
ATOM   1461 C  CA    . LEU B 1 10  ? -53.922 -18.149 -0.757  1.00 17.92 ? 12  LEU B CA    1 
ATOM   1462 C  C     . LEU B 1 10  ? -52.971 -19.329 -0.713  1.00 20.19 ? 12  LEU B C     1 
ATOM   1463 O  O     . LEU B 1 10  ? -52.008 -19.338 0.059   1.00 15.10 ? 12  LEU B O     1 
ATOM   1464 C  CB    . LEU B 1 10  ? -53.504 -17.236 -1.904  1.00 17.33 ? 12  LEU B CB    1 
ATOM   1465 C  CG    . LEU B 1 10  ? -54.394 -16.013 -2.055  1.00 19.46 ? 12  LEU B CG    1 
ATOM   1466 C  CD1   . LEU B 1 10  ? -53.646 -14.917 -2.790  1.00 25.63 ? 12  LEU B CD1   1 
ATOM   1467 C  CD2   . LEU B 1 10  ? -55.656 -16.426 -2.789  1.00 21.54 ? 12  LEU B CD2   1 
ATOM   1468 N  N     . GLY B 1 11  ? -53.220 -20.311 -1.570  1.00 18.12 ? 13  GLY B N     1 
ATOM   1469 C  CA    . GLY B 1 11  ? -52.339 -21.458 -1.628  1.00 16.28 ? 13  GLY B CA    1 
ATOM   1470 C  C     . GLY B 1 11  ? -52.975 -22.704 -2.200  1.00 18.44 ? 13  GLY B C     1 
ATOM   1471 O  O     . GLY B 1 11  ? -54.172 -22.752 -2.478  1.00 16.49 ? 13  GLY B O     1 
ATOM   1472 N  N     . TYR B 1 12  ? -52.140 -23.714 -2.384  1.00 15.28 ? 14  TYR B N     1 
ATOM   1473 C  CA    . TYR B 1 12  ? -52.558 -24.998 -2.934  1.00 22.18 ? 14  TYR B CA    1 
ATOM   1474 C  C     . TYR B 1 12  ? -53.558 -25.661 -1.987  1.00 21.25 ? 14  TYR B C     1 
ATOM   1475 O  O     . TYR B 1 12  ? -53.674 -25.275 -0.824  1.00 14.75 ? 14  TYR B O     1 
ATOM   1476 C  CB    . TYR B 1 12  ? -51.305 -25.858 -3.143  1.00 19.32 ? 14  TYR B CB    1 
ATOM   1477 C  CG    . TYR B 1 12  ? -51.518 -27.233 -3.740  1.00 18.27 ? 14  TYR B CG    1 
ATOM   1478 C  CD1   . TYR B 1 12  ? -52.070 -27.390 -5.008  1.00 21.69 ? 14  TYR B CD1   1 
ATOM   1479 C  CD2   . TYR B 1 12  ? -51.131 -28.375 -3.041  1.00 22.47 ? 14  TYR B CD2   1 
ATOM   1480 C  CE1   . TYR B 1 12  ? -52.245 -28.651 -5.565  1.00 21.81 ? 14  TYR B CE1   1 
ATOM   1481 C  CE2   . TYR B 1 12  ? -51.303 -29.639 -3.581  1.00 26.12 ? 14  TYR B CE2   1 
ATOM   1482 C  CZ    . TYR B 1 12  ? -51.854 -29.771 -4.852  1.00 31.47 ? 14  TYR B CZ    1 
ATOM   1483 O  OH    . TYR B 1 12  ? -52.029 -31.025 -5.400  1.00 25.95 ? 14  TYR B OH    1 
ATOM   1484 N  N     A ARG B 1 13  ? -54.298 -26.641 -2.504  0.59 18.98 ? 15  ARG B N     1 
ATOM   1485 N  N     B ARG B 1 13  ? -54.293 -26.646 -2.496  0.41 19.02 ? 15  ARG B N     1 
ATOM   1486 C  CA    A ARG B 1 13  ? -55.254 -27.400 -1.707  0.59 19.59 ? 15  ARG B CA    1 
ATOM   1487 C  CA    B ARG B 1 13  ? -55.272 -27.362 -1.690  0.41 19.58 ? 15  ARG B CA    1 
ATOM   1488 C  C     A ARG B 1 13  ? -54.573 -28.078 -0.523  0.59 18.13 ? 15  ARG B C     1 
ATOM   1489 C  C     B ARG B 1 13  ? -54.600 -28.100 -0.536  0.41 18.16 ? 15  ARG B C     1 
ATOM   1490 O  O     A ARG B 1 13  ? -53.465 -28.594 -0.655  0.59 15.88 ? 15  ARG B O     1 
ATOM   1491 O  O     B ARG B 1 13  ? -53.523 -28.669 -0.699  0.41 15.95 ? 15  ARG B O     1 
ATOM   1492 C  CB    A ARG B 1 13  ? -55.923 -28.481 -2.569  0.59 21.60 ? 15  ARG B CB    1 
ATOM   1493 C  CB    B ARG B 1 13  ? -56.054 -28.359 -2.554  0.41 21.67 ? 15  ARG B CB    1 
ATOM   1494 C  CG    A ARG B 1 13  ? -57.051 -27.992 -3.463  0.59 27.57 ? 15  ARG B CG    1 
ATOM   1495 C  CG    B ARG B 1 13  ? -56.851 -27.717 -3.678  0.41 27.50 ? 15  ARG B CG    1 
ATOM   1496 C  CD    A ARG B 1 13  ? -57.618 -29.137 -4.316  0.59 29.66 ? 15  ARG B CD    1 
ATOM   1497 C  CD    B ARG B 1 13  ? -57.623 -28.749 -4.496  0.41 29.79 ? 15  ARG B CD    1 
ATOM   1498 N  NE    A ARG B 1 13  ? -56.601 -29.742 -5.176  0.59 25.46 ? 15  ARG B NE    1 
ATOM   1499 N  NE    B ARG B 1 13  ? -58.215 -28.148 -5.690  0.41 33.36 ? 15  ARG B NE    1 
ATOM   1500 C  CZ    A ARG B 1 13  ? -56.346 -29.353 -6.423  0.59 29.73 ? 15  ARG B CZ    1 
ATOM   1501 C  CZ    B ARG B 1 13  ? -57.630 -28.127 -6.884  0.41 31.57 ? 15  ARG B CZ    1 
ATOM   1502 N  NH1   A ARG B 1 13  ? -57.037 -28.358 -6.961  0.59 31.20 ? 15  ARG B NH1   1 
ATOM   1503 N  NH1   B ARG B 1 13  ? -56.436 -28.684 -7.053  0.41 28.93 ? 15  ARG B NH1   1 
ATOM   1504 N  NH2   A ARG B 1 13  ? -55.397 -29.953 -7.132  0.59 27.11 ? 15  ARG B NH2   1 
ATOM   1505 N  NH2   B ARG B 1 13  ? -58.240 -27.552 -7.912  0.41 36.14 ? 15  ARG B NH2   1 
ATOM   1506 N  N     . SER B 1 14  ? -55.242 -28.079 0.629   1.00 20.34 ? 16  SER B N     1 
ATOM   1507 C  CA    . SER B 1 14  ? -54.786 -28.859 1.798   1.00 19.22 ? 16  SER B CA    1 
ATOM   1508 C  C     . SER B 1 14  ? -53.482 -28.468 2.519   1.00 21.87 ? 16  SER B C     1 
ATOM   1509 O  O     . SER B 1 14  ? -52.994 -29.233 3.377   1.00 17.78 ? 16  SER B O     1 
ATOM   1510 C  CB    . SER B 1 14  ? -54.721 -30.351 1.441   1.00 20.52 ? 16  SER B CB    1 
ATOM   1511 O  OG    . SER B 1 14  ? -56.013 -30.853 1.171   1.00 27.69 ? 16  SER B OG    1 
ATOM   1512 N  N     . VAL B 1 15  ? -52.921 -27.304 2.197   1.00 15.93 ? 17  VAL B N     1 
ATOM   1513 C  CA    . VAL B 1 15  ? -51.675 -26.873 2.836   1.00 18.50 ? 17  VAL B CA    1 
ATOM   1514 C  C     . VAL B 1 15  ? -51.906 -26.375 4.256   1.00 19.66 ? 17  VAL B C     1 
ATOM   1515 O  O     . VAL B 1 15  ? -50.955 -26.258 5.039   1.00 14.56 ? 17  VAL B O     1 
ATOM   1516 C  CB    . VAL B 1 15  ? -50.951 -25.777 2.042   1.00 17.22 ? 17  VAL B CB    1 
ATOM   1517 C  CG1   . VAL B 1 15  ? -50.605 -26.298 0.644   1.00 18.58 ? 17  VAL B CG1   1 
ATOM   1518 C  CG2   . VAL B 1 15  ? -51.794 -24.493 1.970   1.00 14.47 ? 17  VAL B CG2   1 
ATOM   1519 N  N     . GLY B 1 16  ? -53.167 -26.075 4.571   1.00 19.64 ? 18  GLY B N     1 
ATOM   1520 C  CA    . GLY B 1 16  ? -53.570 -25.694 5.917   1.00 16.99 ? 18  GLY B CA    1 
ATOM   1521 C  C     . GLY B 1 16  ? -53.994 -24.238 6.049   1.00 21.78 ? 18  GLY B C     1 
ATOM   1522 O  O     . GLY B 1 16  ? -53.890 -23.648 7.133   1.00 20.14 ? 18  GLY B O     1 
ATOM   1523 N  N     . LYS B 1 17  ? -54.462 -23.647 4.953   1.00 14.36 ? 19  LYS B N     1 
ATOM   1524 C  CA    . LYS B 1 17  ? -54.966 -22.278 4.993   1.00 17.44 ? 19  LYS B CA    1 
ATOM   1525 C  C     . LYS B 1 17  ? -56.057 -22.122 6.050   1.00 18.40 ? 19  LYS B C     1 
ATOM   1526 O  O     . LYS B 1 17  ? -55.961 -21.272 6.933   1.00 16.31 ? 19  LYS B O     1 
ATOM   1527 C  CB    . LYS B 1 17  ? -55.495 -21.846 3.621   1.00 14.91 ? 19  LYS B CB    1 
ATOM   1528 C  CG    . LYS B 1 17  ? -54.430 -21.737 2.548   1.00 14.30 ? 19  LYS B CG    1 
ATOM   1529 C  CD    . LYS B 1 17  ? -55.052 -21.384 1.196   1.00 18.48 ? 19  LYS B CD    1 
ATOM   1530 C  CE    . LYS B 1 17  ? -56.096 -22.424 0.769   1.00 20.03 ? 19  LYS B CE    1 
ATOM   1531 N  NZ    . LYS B 1 17  ? -55.533 -23.793 0.578   1.00 20.21 ? 19  LYS B NZ    1 
ATOM   1532 N  N     . SER B 1 18  ? -57.093 -22.948 5.971   1.00 18.94 ? 20  SER B N     1 
ATOM   1533 C  CA    . SER B 1 18  ? -58.167 -22.867 6.959   1.00 21.15 ? 20  SER B CA    1 
ATOM   1534 C  C     . SER B 1 18  ? -57.729 -23.218 8.380   1.00 18.92 ? 20  SER B C     1 
ATOM   1535 O  O     . SER B 1 18  ? -58.120 -22.556 9.333   1.00 17.73 ? 20  SER B O     1 
ATOM   1536 C  CB    . SER B 1 18  ? -59.326 -23.762 6.545   1.00 18.71 ? 20  SER B CB    1 
ATOM   1537 O  OG    . SER B 1 18  ? -59.885 -23.283 5.337   1.00 19.63 ? 20  SER B OG    1 
ATOM   1538 N  N     . SER B 1 19  ? -56.961 -24.293 8.526   1.00 17.00 ? 21  SER B N     1 
ATOM   1539 C  CA    . SER B 1 19  ? -56.518 -24.718 9.850   1.00 20.47 ? 21  SER B CA    1 
ATOM   1540 C  C     . SER B 1 19  ? -55.706 -23.627 10.546  1.00 18.98 ? 21  SER B C     1 
ATOM   1541 O  O     . SER B 1 19  ? -55.888 -23.370 11.732  1.00 18.48 ? 21  SER B O     1 
ATOM   1542 C  CB    . SER B 1 19  ? -55.709 -26.013 9.755   1.00 16.80 ? 21  SER B CB    1 
ATOM   1543 O  OG    . SER B 1 19  ? -56.533 -27.092 9.328   1.00 20.39 ? 21  SER B OG    1 
ATOM   1544 N  N     . LEU B 1 20  ? -54.810 -22.984 9.801   1.00 19.64 ? 22  LEU B N     1 
ATOM   1545 C  CA    . LEU B 1 20  ? -53.982 -21.908 10.340  1.00 20.34 ? 22  LEU B CA    1 
ATOM   1546 C  C     . LEU B 1 20  ? -54.852 -20.731 10.735  1.00 23.04 ? 22  LEU B C     1 
ATOM   1547 O  O     . LEU B 1 20  ? -54.723 -20.181 11.832  1.00 18.49 ? 22  LEU B O     1 
ATOM   1548 C  CB    . LEU B 1 20  ? -52.969 -21.435 9.298   1.00 23.53 ? 22  LEU B CB    1 
ATOM   1549 C  CG    . LEU B 1 20  ? -51.472 -21.544 9.580   1.00 32.97 ? 22  LEU B CG    1 
ATOM   1550 C  CD1   . LEU B 1 20  ? -50.716 -20.638 8.604   1.00 29.43 ? 22  LEU B CD1   1 
ATOM   1551 C  CD2   . LEU B 1 20  ? -51.137 -21.179 11.018  1.00 20.97 ? 22  LEU B CD2   1 
ATOM   1552 N  N     . THR B 1 21  ? -55.748 -20.350 9.831   1.00 19.40 ? 23  THR B N     1 
ATOM   1553 C  CA    . THR B 1 21  ? -56.621 -19.214 10.068  1.00 17.42 ? 23  THR B CA    1 
ATOM   1554 C  C     . THR B 1 21  ? -57.500 -19.448 11.293  1.00 20.22 ? 23  THR B C     1 
ATOM   1555 O  O     . THR B 1 21  ? -57.615 -18.572 12.163  1.00 22.87 ? 23  THR B O     1 
ATOM   1556 C  CB    . THR B 1 21  ? -57.488 -18.893 8.836   1.00 18.23 ? 23  THR B CB    1 
ATOM   1557 O  OG1   . THR B 1 21  ? -56.637 -18.649 7.710   1.00 16.14 ? 23  THR B OG1   1 
ATOM   1558 C  CG2   . THR B 1 21  ? -58.300 -17.641 9.081   1.00 18.30 ? 23  THR B CG2   1 
ATOM   1559 N  N     . ILE B 1 22  ? -58.097 -20.636 11.371  1.00 20.45 ? 24  ILE B N     1 
ATOM   1560 C  CA    . ILE B 1 22  ? -58.994 -20.962 12.485  1.00 21.10 ? 24  ILE B CA    1 
ATOM   1561 C  C     . ILE B 1 22  ? -58.238 -21.035 13.811  1.00 23.77 ? 24  ILE B C     1 
ATOM   1562 O  O     . ILE B 1 22  ? -58.772 -20.651 14.859  1.00 19.45 ? 24  ILE B O     1 
ATOM   1563 C  CB    . ILE B 1 22  ? -59.777 -22.262 12.237  1.00 21.94 ? 24  ILE B CB    1 
ATOM   1564 C  CG1   . ILE B 1 22  ? -60.796 -22.036 11.130  1.00 22.89 ? 24  ILE B CG1   1 
ATOM   1565 C  CG2   . ILE B 1 22  ? -60.503 -22.722 13.508  1.00 26.17 ? 24  ILE B CG2   1 
ATOM   1566 C  CD1   . ILE B 1 22  ? -61.248 -23.312 10.488  1.00 24.15 ? 24  ILE B CD1   1 
ATOM   1567 N  N     . GLN B 1 23  ? -56.992 -21.498 13.761  1.00 20.26 ? 25  GLN B N     1 
ATOM   1568 C  CA    . GLN B 1 23  ? -56.161 -21.531 14.963  1.00 24.58 ? 25  GLN B CA    1 
ATOM   1569 C  C     . GLN B 1 23  ? -55.996 -20.110 15.491  1.00 24.92 ? 25  GLN B C     1 
ATOM   1570 O  O     . GLN B 1 23  ? -56.174 -19.855 16.676  1.00 19.31 ? 25  GLN B O     1 
ATOM   1571 C  CB    . GLN B 1 23  ? -54.803 -22.187 14.687  1.00 18.57 ? 25  GLN B CB    1 
ATOM   1572 C  CG    . GLN B 1 23  ? -53.824 -22.185 15.894  1.00 22.32 ? 25  GLN B CG    1 
ATOM   1573 C  CD    . GLN B 1 23  ? -54.333 -22.941 17.130  1.00 22.79 ? 25  GLN B CD    1 
ATOM   1574 O  OE1   . GLN B 1 23  ? -54.743 -22.325 18.118  1.00 22.85 ? 25  GLN B OE1   1 
ATOM   1575 N  NE2   . GLN B 1 23  ? -54.274 -24.271 17.090  1.00 17.51 ? 25  GLN B NE2   1 
ATOM   1576 N  N     . PHE B 1 24  ? -55.688 -19.178 14.598  1.00 18.24 ? 26  PHE B N     1 
ATOM   1577 C  CA    . PHE B 1 24  ? -55.534 -17.782 14.981  1.00 20.34 ? 26  PHE B CA    1 
ATOM   1578 C  C     . PHE B 1 24  ? -56.849 -17.216 15.497  1.00 23.64 ? 26  PHE B C     1 
ATOM   1579 O  O     . PHE B 1 24  ? -56.896 -16.599 16.561  1.00 28.26 ? 26  PHE B O     1 
ATOM   1580 C  CB    . PHE B 1 24  ? -55.032 -16.946 13.788  1.00 16.34 ? 26  PHE B CB    1 
ATOM   1581 C  CG    . PHE B 1 24  ? -55.054 -15.463 14.032  1.00 24.82 ? 26  PHE B CG    1 
ATOM   1582 C  CD1   . PHE B 1 24  ? -54.399 -14.913 15.131  1.00 21.99 ? 26  PHE B CD1   1 
ATOM   1583 C  CD2   . PHE B 1 24  ? -55.721 -14.615 13.158  1.00 22.88 ? 26  PHE B CD2   1 
ATOM   1584 C  CE1   . PHE B 1 24  ? -54.411 -13.545 15.362  1.00 20.53 ? 26  PHE B CE1   1 
ATOM   1585 C  CE2   . PHE B 1 24  ? -55.736 -13.239 13.370  1.00 20.50 ? 26  PHE B CE2   1 
ATOM   1586 C  CZ    . PHE B 1 24  ? -55.087 -12.701 14.474  1.00 26.41 ? 26  PHE B CZ    1 
ATOM   1587 N  N     . VAL B 1 25  ? -57.917 -17.429 14.738  1.00 21.67 ? 27  VAL B N     1 
ATOM   1588 C  CA    . VAL B 1 25  ? -59.195 -16.790 15.034  1.00 21.17 ? 27  VAL B CA    1 
ATOM   1589 C  C     . VAL B 1 25  ? -59.900 -17.402 16.247  1.00 31.26 ? 27  VAL B C     1 
ATOM   1590 O  O     . VAL B 1 25  ? -60.376 -16.677 17.123  1.00 33.42 ? 27  VAL B O     1 
ATOM   1591 C  CB    . VAL B 1 25  ? -60.124 -16.807 13.798  1.00 23.57 ? 27  VAL B CB    1 
ATOM   1592 C  CG1   . VAL B 1 25  ? -61.529 -16.386 14.177  1.00 27.30 ? 27  VAL B CG1   1 
ATOM   1593 C  CG2   . VAL B 1 25  ? -59.563 -15.885 12.726  1.00 24.11 ? 27  VAL B CG2   1 
ATOM   1594 N  N     . GLU B 1 26  ? -59.937 -18.733 16.299  1.00 28.11 ? 28  GLU B N     1 
ATOM   1595 C  CA    . GLU B 1 26  ? -60.668 -19.467 17.333  1.00 32.02 ? 28  GLU B CA    1 
ATOM   1596 C  C     . GLU B 1 26  ? -59.787 -20.129 18.394  1.00 33.82 ? 28  GLU B C     1 
ATOM   1597 O  O     . GLU B 1 26  ? -60.284 -20.566 19.432  1.00 28.47 ? 28  GLU B O     1 
ATOM   1598 C  CB    . GLU B 1 26  ? -61.569 -20.523 16.687  1.00 34.99 ? 28  GLU B CB    1 
ATOM   1599 C  CG    . GLU B 1 26  ? -62.707 -19.942 15.851  1.00 35.24 ? 28  GLU B CG    1 
ATOM   1600 C  CD    . GLU B 1 26  ? -63.618 -21.017 15.279  1.00 61.56 ? 28  GLU B CD    1 
ATOM   1601 O  OE1   . GLU B 1 26  ? -64.583 -20.665 14.564  1.00 67.33 ? 28  GLU B OE1   1 
ATOM   1602 O  OE2   . GLU B 1 26  ? -63.371 -22.217 15.542  1.00 62.76 ? 28  GLU B OE2   1 
ATOM   1603 N  N     . GLY B 1 27  ? -58.488 -20.221 18.132  1.00 27.99 ? 29  GLY B N     1 
ATOM   1604 C  CA    . GLY B 1 27  ? -57.559 -20.788 19.094  1.00 25.32 ? 29  GLY B CA    1 
ATOM   1605 C  C     . GLY B 1 27  ? -57.585 -22.304 19.214  1.00 34.44 ? 29  GLY B C     1 
ATOM   1606 O  O     . GLY B 1 27  ? -57.102 -22.858 20.196  1.00 31.27 ? 29  GLY B O     1 
ATOM   1607 N  N     . GLN B 1 28  ? -58.139 -22.990 18.223  1.00 29.48 ? 30  GLN B N     1 
ATOM   1608 C  CA    . GLN B 1 28  ? -58.158 -24.442 18.278  1.00 29.49 ? 30  GLN B CA    1 
ATOM   1609 C  C     . GLN B 1 28  ? -57.751 -25.036 16.939  1.00 31.21 ? 30  GLN B C     1 
ATOM   1610 O  O     . GLN B 1 28  ? -57.842 -24.376 15.910  1.00 23.65 ? 30  GLN B O     1 
ATOM   1611 C  CB    . GLN B 1 28  ? -59.541 -24.940 18.664  1.00 33.01 ? 30  GLN B CB    1 
ATOM   1612 C  CG    . GLN B 1 28  ? -60.640 -24.364 17.811  1.00 38.38 ? 30  GLN B CG    1 
ATOM   1613 C  CD    . GLN B 1 28  ? -61.918 -25.170 17.898  1.00 56.97 ? 30  GLN B CD    1 
ATOM   1614 O  OE1   . GLN B 1 28  ? -62.117 -25.943 18.837  1.00 59.36 ? 30  GLN B OE1   1 
ATOM   1615 N  NE2   . GLN B 1 28  ? -62.792 -25.002 16.909  1.00 66.09 ? 30  GLN B NE2   1 
ATOM   1616 N  N     . PHE B 1 29  ? -57.297 -26.280 16.962  1.00 24.31 ? 31  PHE B N     1 
ATOM   1617 C  CA    . PHE B 1 29  ? -56.886 -26.956 15.743  1.00 25.95 ? 31  PHE B CA    1 
ATOM   1618 C  C     . PHE B 1 29  ? -58.003 -27.853 15.264  1.00 31.00 ? 31  PHE B C     1 
ATOM   1619 O  O     . PHE B 1 29  ? -58.378 -28.803 15.941  1.00 33.05 ? 31  PHE B O     1 
ATOM   1620 C  CB    . PHE B 1 29  ? -55.626 -27.776 15.983  1.00 26.01 ? 31  PHE B CB    1 
ATOM   1621 C  CG    . PHE B 1 29  ? -55.208 -28.607 14.801  1.00 31.02 ? 31  PHE B CG    1 
ATOM   1622 C  CD1   . PHE B 1 29  ? -54.837 -28.003 13.610  1.00 27.35 ? 31  PHE B CD1   1 
ATOM   1623 C  CD2   . PHE B 1 29  ? -55.180 -29.991 14.885  1.00 30.03 ? 31  PHE B CD2   1 
ATOM   1624 C  CE1   . PHE B 1 29  ? -54.447 -28.767 12.519  1.00 23.72 ? 31  PHE B CE1   1 
ATOM   1625 C  CE2   . PHE B 1 29  ? -54.787 -30.766 13.798  1.00 30.17 ? 31  PHE B CE2   1 
ATOM   1626 C  CZ    . PHE B 1 29  ? -54.422 -30.153 12.614  1.00 34.35 ? 31  PHE B CZ    1 
ATOM   1627 N  N     . VAL B 1 30  ? -58.548 -27.523 14.100  1.00 41.94 ? 32  VAL B N     1 
ATOM   1628 C  CA    . VAL B 1 30  ? -59.576 -28.339 13.476  1.00 45.00 ? 32  VAL B CA    1 
ATOM   1629 C  C     . VAL B 1 30  ? -58.922 -29.385 12.578  1.00 49.03 ? 32  VAL B C     1 
ATOM   1630 O  O     . VAL B 1 30  ? -58.425 -29.069 11.486  1.00 62.55 ? 32  VAL B O     1 
ATOM   1631 C  CB    . VAL B 1 30  ? -60.577 -27.472 12.678  1.00 51.63 ? 32  VAL B CB    1 
ATOM   1632 C  CG1   . VAL B 1 30  ? -61.317 -26.541 13.624  1.00 40.61 ? 32  VAL B CG1   1 
ATOM   1633 C  CG2   . VAL B 1 30  ? -59.866 -26.672 11.586  1.00 46.98 ? 32  VAL B CG2   1 
ATOM   1634 N  N     . ASP B 1 31  ? -58.905 -30.629 13.049  1.00 52.67 ? 33  ASP B N     1 
ATOM   1635 C  CA    . ASP B 1 31  ? -58.213 -31.699 12.333  1.00 62.90 ? 33  ASP B CA    1 
ATOM   1636 C  C     . ASP B 1 31  ? -59.053 -32.256 11.195  1.00 65.21 ? 33  ASP B C     1 
ATOM   1637 O  O     . ASP B 1 31  ? -58.570 -33.044 10.378  1.00 61.50 ? 33  ASP B O     1 
ATOM   1638 C  CB    . ASP B 1 31  ? -57.782 -32.820 13.284  1.00 68.26 ? 33  ASP B CB    1 
ATOM   1639 C  CG    . ASP B 1 31  ? -58.945 -33.424 14.046  1.00 88.98 ? 33  ASP B CG    1 
ATOM   1640 O  OD1   . ASP B 1 31  ? -59.883 -32.676 14.408  1.00 84.30 ? 33  ASP B OD1   1 
ATOM   1641 O  OD2   . ASP B 1 31  ? -58.915 -34.652 14.284  1.00 86.29 ? 33  ASP B OD2   1 
ATOM   1642 N  N     . SER B 1 32  ? -60.311 -31.832 11.145  1.00 68.64 ? 34  SER B N     1 
ATOM   1643 C  CA    . SER B 1 32  ? -61.212 -32.236 10.075  1.00 81.65 ? 34  SER B CA    1 
ATOM   1644 C  C     . SER B 1 32  ? -61.909 -31.022 9.464   1.00 76.20 ? 34  SER B C     1 
ATOM   1645 O  O     . SER B 1 32  ? -63.019 -30.657 9.860   1.00 80.44 ? 34  SER B O     1 
ATOM   1646 C  CB    . SER B 1 32  ? -62.241 -33.244 10.593  1.00 78.31 ? 34  SER B CB    1 
ATOM   1647 O  OG    . SER B 1 32  ? -63.076 -33.705 9.545   1.00 84.23 ? 34  SER B OG    1 
ATOM   1648 N  N     . ALA B 1 33  ? -61.247 -30.391 8.502   1.00 64.75 ? 35  ALA B N     1 
ATOM   1649 C  CA    . ALA B 1 33  ? -61.826 -29.239 7.824   1.00 57.30 ? 35  ALA B CA    1 
ATOM   1650 C  C     . ALA B 1 33  ? -62.325 -29.631 6.438   1.00 58.50 ? 35  ALA B C     1 
ATOM   1651 O  O     . ALA B 1 33  ? -61.769 -30.521 5.786   1.00 56.46 ? 35  ALA B O     1 
ATOM   1652 C  CB    . ALA B 1 33  ? -60.806 -28.101 7.736   1.00 51.07 ? 35  ALA B CB    1 
ATOM   1653 N  N     . ASP B 1 34  ? -63.386 -28.975 5.992   1.00 51.66 ? 36  ASP B N     1 
ATOM   1654 C  CA    . ASP B 1 34  ? -63.894 -29.213 4.649   1.00 56.49 ? 36  ASP B CA    1 
ATOM   1655 C  C     . ASP B 1 34  ? -63.125 -28.365 3.651   1.00 42.99 ? 36  ASP B C     1 
ATOM   1656 O  O     . ASP B 1 34  ? -62.645 -27.285 3.995   1.00 37.50 ? 36  ASP B O     1 
ATOM   1657 C  CB    . ASP B 1 34  ? -65.387 -28.895 4.583   1.00 48.05 ? 36  ASP B CB    1 
ATOM   1658 C  CG    . ASP B 1 34  ? -66.202 -29.801 5.474   1.00 62.11 ? 36  ASP B CG    1 
ATOM   1659 O  OD1   . ASP B 1 34  ? -65.911 -31.016 5.484   1.00 53.78 ? 36  ASP B OD1   1 
ATOM   1660 O  OD2   . ASP B 1 34  ? -67.112 -29.302 6.173   1.00 62.62 ? 36  ASP B OD2   1 
ATOM   1661 N  N     . PRO B 1 35  ? -62.994 -28.858 2.411   1.00 35.56 ? 37  PRO B N     1 
ATOM   1662 C  CA    . PRO B 1 35  ? -62.355 -28.059 1.366   1.00 32.06 ? 37  PRO B CA    1 
ATOM   1663 C  C     . PRO B 1 35  ? -63.083 -26.732 1.304   1.00 33.09 ? 37  PRO B C     1 
ATOM   1664 O  O     . PRO B 1 35  ? -64.314 -26.726 1.267   1.00 31.69 ? 37  PRO B O     1 
ATOM   1665 C  CB    . PRO B 1 35  ? -62.632 -28.855 0.095   1.00 38.99 ? 37  PRO B CB    1 
ATOM   1666 C  CG    . PRO B 1 35  ? -62.875 -30.241 0.560   1.00 38.23 ? 37  PRO B CG    1 
ATOM   1667 C  CD    . PRO B 1 35  ? -63.535 -30.123 1.894   1.00 42.87 ? 37  PRO B CD    1 
ATOM   1668 N  N     . THR B 1 36  ? -62.348 -25.627 1.320   1.00 25.43 ? 38  THR B N     1 
ATOM   1669 C  CA    . THR B 1 36  ? -62.989 -24.315 1.338   1.00 28.06 ? 38  THR B CA    1 
ATOM   1670 C  C     . THR B 1 36  ? -63.553 -23.918 -0.022  1.00 32.83 ? 38  THR B C     1 
ATOM   1671 O  O     . THR B 1 36  ? -62.995 -24.264 -1.065  1.00 29.63 ? 38  THR B O     1 
ATOM   1672 C  CB    . THR B 1 36  ? -62.013 -23.211 1.813   1.00 24.93 ? 38  THR B CB    1 
ATOM   1673 O  OG1   . THR B 1 36  ? -61.586 -23.508 3.145   1.00 26.76 ? 38  THR B OG1   1 
ATOM   1674 C  CG2   . THR B 1 36  ? -62.695 -21.848 1.805   1.00 22.62 ? 38  THR B CG2   1 
ATOM   1675 N  N     . ILE B 1 37  ? -64.669 -23.196 -0.001  1.00 28.38 ? 39  ILE B N     1 
ATOM   1676 C  CA    . ILE B 1 37  ? -65.133 -22.485 -1.186  1.00 29.69 ? 39  ILE B CA    1 
ATOM   1677 C  C     . ILE B 1 37  ? -64.636 -21.060 -0.990  1.00 32.54 ? 39  ILE B C     1 
ATOM   1678 O  O     . ILE B 1 37  ? -63.835 -20.547 -1.772  1.00 28.72 ? 39  ILE B O     1 
ATOM   1679 C  CB    . ILE B 1 37  ? -66.676 -22.500 -1.289  1.00 32.61 ? 39  ILE B CB    1 
ATOM   1680 C  CG1   . ILE B 1 37  ? -67.204 -23.940 -1.263  1.00 37.59 ? 39  ILE B CG1   1 
ATOM   1681 C  CG2   . ILE B 1 37  ? -67.147 -21.762 -2.531  1.00 25.02 ? 39  ILE B CG2   1 
ATOM   1682 C  CD1   . ILE B 1 37  ? -66.454 -24.881 -2.184  1.00 45.74 ? 39  ILE B CD1   1 
ATOM   1683 N  N     . GLU B 1 38  ? -65.115 -20.443 0.087   1.00 22.79 ? 40  GLU B N     1 
ATOM   1684 C  CA    . GLU B 1 38  ? -64.601 -19.172 0.571   1.00 23.82 ? 40  GLU B CA    1 
ATOM   1685 C  C     . GLU B 1 38  ? -65.284 -18.828 1.881   1.00 27.59 ? 40  GLU B C     1 
ATOM   1686 O  O     . GLU B 1 38  ? -66.510 -18.933 2.010   1.00 24.51 ? 40  GLU B O     1 
ATOM   1687 C  CB    . GLU B 1 38  ? -64.839 -18.044 -0.425  1.00 25.51 ? 40  GLU B CB    1 
ATOM   1688 C  CG    . GLU B 1 38  ? -64.111 -16.762 -0.060  1.00 20.47 ? 40  GLU B CG    1 
ATOM   1689 C  CD    . GLU B 1 38  ? -64.610 -15.559 -0.832  1.00 28.87 ? 40  GLU B CD    1 
ATOM   1690 O  OE1   . GLU B 1 38  ? -65.652 -14.984 -0.442  1.00 26.42 ? 40  GLU B OE1   1 
ATOM   1691 O  OE2   . GLU B 1 38  ? -63.960 -15.185 -1.826  1.00 25.19 ? 40  GLU B OE2   1 
ATOM   1692 N  N     . ASN B 1 39  ? -64.477 -18.431 2.854   1.00 23.07 ? 41  ASN B N     1 
ATOM   1693 C  CA    . ASN B 1 39  ? -64.980 -17.943 4.112   1.00 20.65 ? 41  ASN B CA    1 
ATOM   1694 C  C     . ASN B 1 39  ? -64.220 -16.688 4.486   1.00 20.47 ? 41  ASN B C     1 
ATOM   1695 O  O     . ASN B 1 39  ? -63.064 -16.514 4.099   1.00 25.40 ? 41  ASN B O     1 
ATOM   1696 C  CB    . ASN B 1 39  ? -64.827 -19.002 5.205   1.00 25.94 ? 41  ASN B CB    1 
ATOM   1697 C  CG    . ASN B 1 39  ? -65.741 -20.196 4.989   1.00 35.22 ? 41  ASN B CG    1 
ATOM   1698 O  OD1   . ASN B 1 39  ? -66.966 -20.096 5.122   1.00 36.75 ? 41  ASN B OD1   1 
ATOM   1699 N  ND2   . ASN B 1 39  ? -65.153 -21.331 4.660   1.00 28.48 ? 41  ASN B ND2   1 
ATOM   1700 N  N     . THR B 1 40  ? -64.885 -15.803 5.210   1.00 18.47 ? 42  THR B N     1 
ATOM   1701 C  CA    . THR B 1 40  ? -64.253 -14.598 5.728   1.00 25.25 ? 42  THR B CA    1 
ATOM   1702 C  C     . THR B 1 40  ? -64.416 -14.527 7.252   1.00 20.46 ? 42  THR B C     1 
ATOM   1703 O  O     . THR B 1 40  ? -65.539 -14.572 7.770   1.00 21.41 ? 42  THR B O     1 
ATOM   1704 C  CB    . THR B 1 40  ? -64.840 -13.327 5.087   1.00 24.83 ? 42  THR B CB    1 
ATOM   1705 O  OG1   . THR B 1 40  ? -64.582 -13.333 3.679   1.00 28.47 ? 42  THR B OG1   1 
ATOM   1706 C  CG2   . THR B 1 40  ? -64.193 -12.102 5.695   1.00 25.95 ? 42  THR B CG2   1 
ATOM   1707 N  N     . PHE B 1 41  ? -63.296 -14.446 7.963   1.00 21.00 ? 43  PHE B N     1 
ATOM   1708 C  CA    . PHE B 1 41  ? -63.317 -14.371 9.428   1.00 24.96 ? 43  PHE B CA    1 
ATOM   1709 C  C     . PHE B 1 41  ? -62.837 -12.997 9.877   1.00 24.01 ? 43  PHE B C     1 
ATOM   1710 O  O     . PHE B 1 41  ? -62.001 -12.392 9.217   1.00 28.77 ? 43  PHE B O     1 
ATOM   1711 C  CB    . PHE B 1 41  ? -62.389 -15.418 10.036  1.00 22.61 ? 43  PHE B CB    1 
ATOM   1712 C  CG    . PHE B 1 41  ? -62.671 -16.827 9.591   1.00 21.13 ? 43  PHE B CG    1 
ATOM   1713 C  CD1   . PHE B 1 41  ? -63.555 -17.628 10.295  1.00 28.24 ? 43  PHE B CD1   1 
ATOM   1714 C  CD2   . PHE B 1 41  ? -62.017 -17.365 8.490   1.00 28.28 ? 43  PHE B CD2   1 
ATOM   1715 C  CE1   . PHE B 1 41  ? -63.800 -18.938 9.904   1.00 37.60 ? 43  PHE B CE1   1 
ATOM   1716 C  CE2   . PHE B 1 41  ? -62.254 -18.674 8.094   1.00 23.82 ? 43  PHE B CE2   1 
ATOM   1717 C  CZ    . PHE B 1 41  ? -63.151 -19.459 8.796   1.00 32.42 ? 43  PHE B CZ    1 
ATOM   1718 N  N     . THR B 1 42  ? -63.347 -12.503 11.000  1.00 20.48 ? 44  THR B N     1 
ATOM   1719 C  CA    . THR B 1 42  ? -62.826 -11.244 11.548  1.00 22.84 ? 44  THR B CA    1 
ATOM   1720 C  C     . THR B 1 42  ? -62.173 -11.503 12.897  1.00 23.69 ? 44  THR B C     1 
ATOM   1721 O  O     . THR B 1 42  ? -62.601 -12.380 13.643  1.00 27.39 ? 44  THR B O     1 
ATOM   1722 C  CB    . THR B 1 42  ? -63.906 -10.144 11.682  1.00 24.85 ? 44  THR B CB    1 
ATOM   1723 O  OG1   . THR B 1 42  ? -64.700 -10.397 12.846  1.00 29.90 ? 44  THR B OG1   1 
ATOM   1724 C  CG2   . THR B 1 42  ? -64.809 -10.117 10.446  1.00 22.70 ? 44  THR B CG2   1 
ATOM   1725 N  N     . LYS B 1 43  ? -61.131 -10.746 13.200  1.00 21.04 ? 45  LYS B N     1 
ATOM   1726 C  CA    A LYS B 1 43  ? -60.375 -10.938 14.433  0.68 24.36 ? 45  LYS B CA    1 
ATOM   1727 C  CA    B LYS B 1 43  ? -60.407 -10.920 14.449  0.32 24.45 ? 45  LYS B CA    1 
ATOM   1728 C  C     . LYS B 1 43  ? -59.705 -9.629  14.833  1.00 30.33 ? 45  LYS B C     1 
ATOM   1729 O  O     . LYS B 1 43  ? -59.080 -8.967  13.994  1.00 21.04 ? 45  LYS B O     1 
ATOM   1730 C  CB    A LYS B 1 43  ? -59.316 -12.021 14.220  0.68 28.49 ? 45  LYS B CB    1 
ATOM   1731 C  CB    B LYS B 1 43  ? -59.392 -12.058 14.330  0.32 28.37 ? 45  LYS B CB    1 
ATOM   1732 C  CG    A LYS B 1 43  ? -58.431 -12.299 15.424  0.68 27.61 ? 45  LYS B CG    1 
ATOM   1733 C  CG    B LYS B 1 43  ? -58.568 -12.291 15.586  0.32 27.34 ? 45  LYS B CG    1 
ATOM   1734 C  CD    A LYS B 1 43  ? -59.132 -13.158 16.447  0.68 26.20 ? 45  LYS B CD    1 
ATOM   1735 C  CD    B LYS B 1 43  ? -59.447 -12.637 16.773  0.32 26.55 ? 45  LYS B CD    1 
ATOM   1736 C  CE    A LYS B 1 43  ? -58.180 -13.539 17.578  0.68 24.21 ? 45  LYS B CE    1 
ATOM   1737 C  CE    B LYS B 1 43  ? -58.612 -12.838 18.030  0.32 26.70 ? 45  LYS B CE    1 
ATOM   1738 N  NZ    A LYS B 1 43  ? -58.897 -14.240 18.671  0.68 19.81 ? 45  LYS B NZ    1 
ATOM   1739 N  NZ    B LYS B 1 43  ? -57.506 -13.807 17.810  0.32 23.04 ? 45  LYS B NZ    1 
ATOM   1740 N  N     . LEU B 1 44  ? -59.837 -9.257  16.102  1.00 24.02 ? 46  LEU B N     1 
ATOM   1741 C  CA    . LEU B 1 44  ? -59.136 -8.099  16.630  1.00 31.04 ? 46  LEU B CA    1 
ATOM   1742 C  C     . LEU B 1 44  ? -57.797 -8.578  17.126  1.00 33.32 ? 46  LEU B C     1 
ATOM   1743 O  O     . LEU B 1 44  ? -57.689 -9.663  17.689  1.00 28.25 ? 46  LEU B O     1 
ATOM   1744 C  CB    . LEU B 1 44  ? -59.891 -7.467  17.799  1.00 23.89 ? 46  LEU B CB    1 
ATOM   1745 C  CG    . LEU B 1 44  ? -61.241 -6.836  17.461  1.00 38.53 ? 46  LEU B CG    1 
ATOM   1746 C  CD1   . LEU B 1 44  ? -62.032 -6.523  18.732  1.00 45.85 ? 46  LEU B CD1   1 
ATOM   1747 C  CD2   . LEU B 1 44  ? -61.053 -5.583  16.601  1.00 38.53 ? 46  LEU B CD2   1 
ATOM   1748 N  N     . ILE B 1 45  ? -56.775 -7.765  16.901  1.00 30.30 ? 47  ILE B N     1 
ATOM   1749 C  CA    . ILE B 1 45  ? -55.442 -8.062  17.386  1.00 30.27 ? 47  ILE B CA    1 
ATOM   1750 C  C     . ILE B 1 45  ? -54.734 -6.743  17.666  1.00 24.22 ? 47  ILE B C     1 
ATOM   1751 O  O     . ILE B 1 45  ? -54.902 -5.763  16.936  1.00 27.93 ? 47  ILE B O     1 
ATOM   1752 C  CB    . ILE B 1 45  ? -54.630 -8.937  16.386  1.00 21.12 ? 47  ILE B CB    1 
ATOM   1753 C  CG1   . ILE B 1 45  ? -53.261 -9.288  16.983  1.00 26.88 ? 47  ILE B CG1   1 
ATOM   1754 C  CG2   . ILE B 1 45  ? -54.515 -8.256  15.026  1.00 26.80 ? 47  ILE B CG2   1 
ATOM   1755 C  CD1   . ILE B 1 45  ? -52.322 -9.969  16.027  1.00 35.72 ? 47  ILE B CD1   1 
ATOM   1756 N  N     . THR B 1 46  ? -53.982 -6.708  18.752  1.00 25.57 ? 48  THR B N     1 
ATOM   1757 C  CA    . THR B 1 46  ? -53.208 -5.525  19.068  1.00 30.97 ? 48  THR B CA    1 
ATOM   1758 C  C     . THR B 1 46  ? -51.748 -5.795  18.756  1.00 31.14 ? 48  THR B C     1 
ATOM   1759 O  O     . THR B 1 46  ? -51.171 -6.781  19.213  1.00 26.89 ? 48  THR B O     1 
ATOM   1760 C  CB    . THR B 1 46  ? -53.376 -5.102  20.530  1.00 38.21 ? 48  THR B CB    1 
ATOM   1761 O  OG1   . THR B 1 46  ? -54.754 -4.778  20.770  1.00 34.11 ? 48  THR B OG1   1 
ATOM   1762 C  CG2   . THR B 1 46  ? -52.516 -3.880  20.825  1.00 31.18 ? 48  THR B CG2   1 
ATOM   1763 N  N     . VAL B 1 47  ? -51.168 -4.922  17.947  1.00 30.18 ? 49  VAL B N     1 
ATOM   1764 C  CA    . VAL B 1 47  ? -49.771 -5.034  17.574  1.00 35.22 ? 49  VAL B CA    1 
ATOM   1765 C  C     . VAL B 1 47  ? -49.094 -3.696  17.812  1.00 36.93 ? 49  VAL B C     1 
ATOM   1766 O  O     . VAL B 1 47  ? -49.462 -2.696  17.199  1.00 33.65 ? 49  VAL B O     1 
ATOM   1767 C  CB    . VAL B 1 47  ? -49.636 -5.413  16.107  1.00 26.15 ? 49  VAL B CB    1 
ATOM   1768 C  CG1   . VAL B 1 47  ? -48.163 -5.502  15.720  1.00 33.53 ? 49  VAL B CG1   1 
ATOM   1769 C  CG2   . VAL B 1 47  ? -50.356 -6.729  15.850  1.00 23.31 ? 49  VAL B CG2   1 
ATOM   1770 N  N     . ASN B 1 48  ? -48.111 -3.685  18.705  1.00 37.46 ? 50  ASN B N     1 
ATOM   1771 C  CA    A ASN B 1 48  ? -47.426 -2.454  19.085  0.71 45.05 ? 50  ASN B CA    1 
ATOM   1772 C  CA    B ASN B 1 48  ? -47.433 -2.445  19.077  0.29 44.84 ? 50  ASN B CA    1 
ATOM   1773 C  C     . ASN B 1 48  ? -48.404 -1.379  19.558  1.00 47.11 ? 50  ASN B C     1 
ATOM   1774 O  O     . ASN B 1 48  ? -48.418 -0.263  19.034  1.00 44.37 ? 50  ASN B O     1 
ATOM   1775 C  CB    A ASN B 1 48  ? -46.571 -1.929  17.928  0.71 39.73 ? 50  ASN B CB    1 
ATOM   1776 C  CB    B ASN B 1 48  ? -46.630 -1.891  17.903  0.29 39.75 ? 50  ASN B CB    1 
ATOM   1777 C  CG    A ASN B 1 48  ? -45.103 -1.810  18.299  0.71 41.87 ? 50  ASN B CG    1 
ATOM   1778 C  CG    B ASN B 1 48  ? -45.628 -2.879  17.376  0.29 39.88 ? 50  ASN B CG    1 
ATOM   1779 O  OD1   A ASN B 1 48  ? -44.548 -2.682  18.971  0.71 47.41 ? 50  ASN B OD1   1 
ATOM   1780 O  OD1   B ASN B 1 48  ? -44.665 -3.229  18.061  0.29 40.30 ? 50  ASN B OD1   1 
ATOM   1781 N  ND2   A ASN B 1 48  ? -44.471 -0.725  17.873  0.71 44.20 ? 50  ASN B ND2   1 
ATOM   1782 N  ND2   B ASN B 1 48  ? -45.842 -3.337  16.151  0.29 35.72 ? 50  ASN B ND2   1 
ATOM   1783 N  N     . GLY B 1 49  ? -49.224 -1.729  20.543  1.00 34.79 ? 51  GLY B N     1 
ATOM   1784 C  CA    . GLY B 1 49  ? -50.192 -0.803  21.109  1.00 39.01 ? 51  GLY B CA    1 
ATOM   1785 C  C     . GLY B 1 49  ? -51.274 -0.305  20.171  1.00 44.28 ? 51  GLY B C     1 
ATOM   1786 O  O     . GLY B 1 49  ? -52.086 0.539   20.544  1.00 42.51 ? 51  GLY B O     1 
ATOM   1787 N  N     . GLN B 1 50  ? -51.298 -0.814  18.946  1.00 40.26 ? 52  GLN B N     1 
ATOM   1788 C  CA    . GLN B 1 50  ? -52.331 -0.408  18.008  1.00 30.65 ? 52  GLN B CA    1 
ATOM   1789 C  C     . GLN B 1 50  ? -53.275 -1.577  17.763  1.00 42.64 ? 52  GLN B C     1 
ATOM   1790 O  O     . GLN B 1 50  ? -52.831 -2.699  17.495  1.00 37.33 ? 52  GLN B O     1 
ATOM   1791 C  CB    . GLN B 1 50  ? -51.714 0.078   16.692  1.00 32.65 ? 52  GLN B CB    1 
ATOM   1792 C  CG    . GLN B 1 50  ? -52.734 0.416   15.608  1.00 42.44 ? 52  GLN B CG    1 
ATOM   1793 C  CD    . GLN B 1 50  ? -53.653 1.566   15.992  1.00 52.96 ? 52  GLN B CD    1 
ATOM   1794 O  OE1   . GLN B 1 50  ? -53.205 2.575   16.539  1.00 66.43 ? 52  GLN B OE1   1 
ATOM   1795 N  NE2   . GLN B 1 50  ? -54.947 1.417   15.710  1.00 53.40 ? 52  GLN B NE2   1 
ATOM   1796 N  N     . GLU B 1 51  ? -54.576 -1.317  17.861  1.00 37.89 ? 53  GLU B N     1 
ATOM   1797 C  CA    . GLU B 1 51  ? -55.572 -2.351  17.611  1.00 42.90 ? 53  GLU B CA    1 
ATOM   1798 C  C     . GLU B 1 51  ? -55.993 -2.409  16.145  1.00 30.74 ? 53  GLU B C     1 
ATOM   1799 O  O     . GLU B 1 51  ? -56.355 -1.394  15.556  1.00 34.09 ? 53  GLU B O     1 
ATOM   1800 C  CB    . GLU B 1 51  ? -56.802 -2.158  18.494  1.00 44.42 ? 53  GLU B CB    1 
ATOM   1801 C  CG    . GLU B 1 51  ? -57.858 -3.229  18.269  1.00 48.71 ? 53  GLU B CG    1 
ATOM   1802 C  CD    . GLU B 1 51  ? -59.013 -3.123  19.240  1.00 60.20 ? 53  GLU B CD    1 
ATOM   1803 O  OE1   . GLU B 1 51  ? -59.705 -2.078  19.236  1.00 57.34 ? 53  GLU B OE1   1 
ATOM   1804 O  OE2   . GLU B 1 51  ? -59.221 -4.087  20.008  1.00 49.17 ? 53  GLU B OE2   1 
ATOM   1805 N  N     . TYR B 1 52  ? -55.943 -3.613  15.577  1.00 30.32 ? 54  TYR B N     1 
ATOM   1806 C  CA    . TYR B 1 52  ? -56.352 -3.850  14.198  1.00 28.69 ? 54  TYR B CA    1 
ATOM   1807 C  C     . TYR B 1 52  ? -57.570 -4.765  14.134  1.00 31.41 ? 54  TYR B C     1 
ATOM   1808 O  O     . TYR B 1 52  ? -57.647 -5.778  14.841  1.00 29.53 ? 54  TYR B O     1 
ATOM   1809 C  CB    . TYR B 1 52  ? -55.201 -4.464  13.391  1.00 28.57 ? 54  TYR B CB    1 
ATOM   1810 C  CG    . TYR B 1 52  ? -54.000 -3.555  13.275  1.00 28.22 ? 54  TYR B CG    1 
ATOM   1811 C  CD1   . TYR B 1 52  ? -53.828 -2.721  12.172  1.00 34.12 ? 54  TYR B CD1   1 
ATOM   1812 C  CD2   . TYR B 1 52  ? -53.042 -3.528  14.273  1.00 22.57 ? 54  TYR B CD2   1 
ATOM   1813 C  CE1   . TYR B 1 52  ? -52.728 -1.876  12.082  1.00 29.24 ? 54  TYR B CE1   1 
ATOM   1814 C  CE2   . TYR B 1 52  ? -51.947 -2.702  14.195  1.00 28.97 ? 54  TYR B CE2   1 
ATOM   1815 C  CZ    . TYR B 1 52  ? -51.789 -1.879  13.101  1.00 36.87 ? 54  TYR B CZ    1 
ATOM   1816 O  OH    . TYR B 1 52  ? -50.680 -1.066  13.053  1.00 35.59 ? 54  TYR B OH    1 
ATOM   1817 N  N     . HIS B 1 53  ? -58.528 -4.387  13.295  1.00 26.96 ? 55  HIS B N     1 
ATOM   1818 C  CA    . HIS B 1 53  ? -59.677 -5.229  13.025  1.00 28.55 ? 55  HIS B CA    1 
ATOM   1819 C  C     . HIS B 1 53  ? -59.459 -5.954  11.704  1.00 31.37 ? 55  HIS B C     1 
ATOM   1820 O  O     . HIS B 1 53  ? -59.629 -5.385  10.618  1.00 27.42 ? 55  HIS B O     1 
ATOM   1821 C  CB    . HIS B 1 53  ? -60.962 -4.407  12.979  1.00 34.29 ? 55  HIS B CB    1 
ATOM   1822 C  CG    . HIS B 1 53  ? -62.188 -5.228  12.759  1.00 43.31 ? 55  HIS B CG    1 
ATOM   1823 N  ND1   . HIS B 1 53  ? -62.711 -6.075  13.723  1.00 44.59 ? 55  HIS B ND1   1 
ATOM   1824 C  CD2   . HIS B 1 53  ? -63.006 -5.356  11.683  1.00 47.73 ? 55  HIS B CD2   1 
ATOM   1825 C  CE1   . HIS B 1 53  ? -63.780 -6.668  13.258  1.00 43.47 ? 55  HIS B CE1   1 
ATOM   1826 N  NE2   . HIS B 1 53  ? -63.991 -6.251  12.013  1.00 44.47 ? 55  HIS B NE2   1 
ATOM   1827 N  N     . LEU B 1 54  ? -59.066 -7.215  11.806  1.00 25.51 ? 56  LEU B N     1 
ATOM   1828 C  CA    . LEU B 1 54  ? -58.699 -7.999  10.631  1.00 24.92 ? 56  LEU B CA    1 
ATOM   1829 C  C     . LEU B 1 54  ? -59.884 -8.686  9.989   1.00 26.21 ? 56  LEU B C     1 
ATOM   1830 O  O     . LEU B 1 54  ? -60.715 -9.287  10.667  1.00 22.15 ? 56  LEU B O     1 
ATOM   1831 C  CB    . LEU B 1 54  ? -57.677 -9.067  11.016  1.00 28.56 ? 56  LEU B CB    1 
ATOM   1832 C  CG    . LEU B 1 54  ? -56.218 -8.786  10.680  1.00 32.98 ? 56  LEU B CG    1 
ATOM   1833 C  CD1   . LEU B 1 54  ? -55.907 -7.307  10.790  1.00 38.12 ? 56  LEU B CD1   1 
ATOM   1834 C  CD2   . LEU B 1 54  ? -55.329 -9.618  11.583  1.00 24.05 ? 56  LEU B CD2   1 
ATOM   1835 N  N     . GLN B 1 55  ? -59.966 -8.580  8.673   1.00 25.04 ? 57  GLN B N     1 
ATOM   1836 C  CA    A GLN B 1 55  ? -60.910 -9.368  7.895   0.49 24.78 ? 57  GLN B CA    1 
ATOM   1837 C  CA    B GLN B 1 55  ? -60.903 -9.388  7.912   0.51 24.77 ? 57  GLN B CA    1 
ATOM   1838 C  C     . GLN B 1 55  ? -60.076 -10.371 7.113   1.00 23.01 ? 57  GLN B C     1 
ATOM   1839 O  O     . GLN B 1 55  ? -59.271 -9.987  6.274   1.00 20.54 ? 57  GLN B O     1 
ATOM   1840 C  CB    A GLN B 1 55  ? -61.718 -8.470  6.953   0.49 25.73 ? 57  GLN B CB    1 
ATOM   1841 C  CB    B GLN B 1 55  ? -61.755 -8.522  6.994   0.51 25.71 ? 57  GLN B CB    1 
ATOM   1842 C  CG    A GLN B 1 55  ? -62.802 -9.189  6.163   0.49 28.88 ? 57  GLN B CG    1 
ATOM   1843 C  CG    B GLN B 1 55  ? -62.664 -7.560  7.734   0.51 28.00 ? 57  GLN B CG    1 
ATOM   1844 C  CD    A GLN B 1 55  ? -63.665 -8.246  5.325   0.49 34.92 ? 57  GLN B CD    1 
ATOM   1845 C  CD    B GLN B 1 55  ? -63.169 -6.454  6.838   0.51 39.55 ? 57  GLN B CD    1 
ATOM   1846 O  OE1   A GLN B 1 55  ? -63.839 -7.077  5.662   0.49 39.60 ? 57  GLN B OE1   1 
ATOM   1847 O  OE1   B GLN B 1 55  ? -62.463 -5.478  6.582   0.51 39.37 ? 57  GLN B OE1   1 
ATOM   1848 N  NE2   A GLN B 1 55  ? -64.213 -8.762  4.231   0.49 34.60 ? 57  GLN B NE2   1 
ATOM   1849 N  NE2   B GLN B 1 55  ? -64.394 -6.605  6.340   0.51 43.12 ? 57  GLN B NE2   1 
ATOM   1850 N  N     . LEU B 1 56  ? -60.253 -11.650 7.403   1.00 19.04 ? 58  LEU B N     1 
ATOM   1851 C  CA    . LEU B 1 56  ? -59.408 -12.671 6.810   1.00 22.08 ? 58  LEU B CA    1 
ATOM   1852 C  C     . LEU B 1 56  ? -60.175 -13.498 5.792   1.00 23.66 ? 58  LEU B C     1 
ATOM   1853 O  O     . LEU B 1 56  ? -61.083 -14.250 6.152   1.00 25.28 ? 58  LEU B O     1 
ATOM   1854 C  CB    . LEU B 1 56  ? -58.848 -13.578 7.903   1.00 19.17 ? 58  LEU B CB    1 
ATOM   1855 C  CG    . LEU B 1 56  ? -58.238 -12.864 9.116   1.00 22.33 ? 58  LEU B CG    1 
ATOM   1856 C  CD1   . LEU B 1 56  ? -57.808 -13.880 10.166  1.00 25.10 ? 58  LEU B CD1   1 
ATOM   1857 C  CD2   . LEU B 1 56  ? -57.064 -11.986 8.712   1.00 19.87 ? 58  LEU B CD2   1 
ATOM   1858 N  N     . VAL B 1 57  ? -59.805 -13.343 4.525   1.00 16.29 ? 59  VAL B N     1 
ATOM   1859 C  CA    . VAL B 1 57  ? -60.426 -14.092 3.423   1.00 19.96 ? 59  VAL B CA    1 
ATOM   1860 C  C     . VAL B 1 57  ? -59.702 -15.415 3.182   1.00 21.51 ? 59  VAL B C     1 
ATOM   1861 O  O     . VAL B 1 57  ? -58.618 -15.435 2.600   1.00 22.22 ? 59  VAL B O     1 
ATOM   1862 C  CB    . VAL B 1 57  ? -60.405 -13.279 2.111   1.00 21.81 ? 59  VAL B CB    1 
ATOM   1863 C  CG1   . VAL B 1 57  ? -61.119 -14.035 1.012   1.00 21.44 ? 59  VAL B CG1   1 
ATOM   1864 C  CG2   . VAL B 1 57  ? -61.059 -11.911 2.328   1.00 21.70 ? 59  VAL B CG2   1 
ATOM   1865 N  N     . ASP B 1 58  ? -60.310 -16.499 3.655   1.00 17.01 ? 60  ASP B N     1 
ATOM   1866 C  CA    . ASP B 1 58  ? -59.809 -17.864 3.524   1.00 18.85 ? 60  ASP B CA    1 
ATOM   1867 C  C     . ASP B 1 58  ? -60.335 -18.471 2.215   1.00 24.03 ? 60  ASP B C     1 
ATOM   1868 O  O     . ASP B 1 58  ? -61.519 -18.779 2.084   1.00 24.33 ? 60  ASP B O     1 
ATOM   1869 C  CB    . ASP B 1 58  ? -60.273 -18.668 4.747   1.00 21.50 ? 60  ASP B CB    1 
ATOM   1870 C  CG    . ASP B 1 58  ? -59.732 -20.082 4.781   1.00 26.63 ? 60  ASP B CG    1 
ATOM   1871 O  OD1   . ASP B 1 58  ? -58.652 -20.353 4.215   1.00 20.50 ? 60  ASP B OD1   1 
ATOM   1872 O  OD2   . ASP B 1 58  ? -60.403 -20.933 5.401   1.00 21.27 ? 60  ASP B OD2   1 
ATOM   1873 N  N     . THR B 1 59  ? -59.447 -18.622 1.239   1.00 20.48 ? 61  THR B N     1 
ATOM   1874 C  CA    . THR B 1 59  ? -59.862 -18.981 -0.108  1.00 21.68 ? 61  THR B CA    1 
ATOM   1875 C  C     . THR B 1 59  ? -59.778 -20.481 -0.400  1.00 24.51 ? 61  THR B C     1 
ATOM   1876 O  O     . THR B 1 59  ? -59.209 -21.250 0.377   1.00 21.50 ? 61  THR B O     1 
ATOM   1877 C  CB    . THR B 1 59  ? -59.035 -18.210 -1.144  1.00 21.02 ? 61  THR B CB    1 
ATOM   1878 O  OG1   . THR B 1 59  ? -57.683 -18.671 -1.107  1.00 22.26 ? 61  THR B OG1   1 
ATOM   1879 C  CG2   . THR B 1 59  ? -59.063 -16.721 -0.835  1.00 18.99 ? 61  THR B CG2   1 
ATOM   1880 N  N     . ALA B 1 60  ? -60.373 -20.883 -1.522  1.00 24.11 ? 62  ALA B N     1 
ATOM   1881 C  CA    . ALA B 1 60  ? -60.291 -22.248 -2.025  1.00 27.69 ? 62  ALA B CA    1 
ATOM   1882 C  C     . ALA B 1 60  ? -58.870 -22.519 -2.501  1.00 18.64 ? 62  ALA B C     1 
ATOM   1883 O  O     . ALA B 1 60  ? -58.206 -21.628 -3.032  1.00 18.89 ? 62  ALA B O     1 
ATOM   1884 C  CB    . ALA B 1 60  ? -61.289 -22.455 -3.195  1.00 28.11 ? 62  ALA B CB    1 
ATOM   1885 N  N     . GLY B 1 61  ? -58.396 -23.739 -2.288  1.00 22.12 ? 63  GLY B N     1 
ATOM   1886 C  CA    . GLY B 1 61  ? -57.109 -24.139 -2.831  1.00 24.24 ? 63  GLY B CA    1 
ATOM   1887 C  C     . GLY B 1 61  ? -57.077 -23.970 -4.347  1.00 26.75 ? 63  GLY B C     1 
ATOM   1888 O  O     . GLY B 1 61  ? -58.066 -24.254 -5.038  1.00 22.14 ? 63  GLY B O     1 
ATOM   1889 N  N     . GLN B 1 62  ? -55.938 -23.504 -4.849  1.00 20.85 ? 64  GLN B N     1 
ATOM   1890 C  CA    . GLN B 1 62  ? -55.716 -23.341 -6.279  1.00 28.73 ? 64  GLN B CA    1 
ATOM   1891 C  C     . GLN B 1 62  ? -54.619 -24.289 -6.750  1.00 24.74 ? 64  GLN B C     1 
ATOM   1892 O  O     . GLN B 1 62  ? -53.759 -24.689 -5.971  1.00 22.95 ? 64  GLN B O     1 
ATOM   1893 C  CB    . GLN B 1 62  ? -55.320 -21.900 -6.600  1.00 24.57 ? 64  GLN B CB    1 
ATOM   1894 C  CG    . GLN B 1 62  ? -56.326 -20.857 -6.158  1.00 28.29 ? 64  GLN B CG    1 
ATOM   1895 C  CD    . GLN B 1 62  ? -55.960 -19.462 -6.623  1.00 31.55 ? 64  GLN B CD    1 
ATOM   1896 O  OE1   . GLN B 1 62  ? -56.352 -18.472 -6.012  1.00 34.65 ? 64  GLN B OE1   1 
ATOM   1897 N  NE2   . GLN B 1 62  ? -55.206 -19.378 -7.710  1.00 29.88 ? 64  GLN B NE2   1 
ATOM   1898 N  N     . ASP B 1 63  ? -54.658 -24.643 -8.030  1.00 26.26 ? 65  ASP B N     1 
ATOM   1899 C  CA    A ASP B 1 63  ? -53.470 -25.300 -8.646  0.30 23.58 ? 65  ASP B CA    1 
ATOM   1900 C  CA    B ASP B 1 63  ? -53.425 -25.200 -8.581  0.70 23.52 ? 65  ASP B CA    1 
ATOM   1901 C  C     . ASP B 1 63  ? -53.052 -24.579 -9.919  1.00 21.97 ? 65  ASP B C     1 
ATOM   1902 O  O     . ASP B 1 63  ? -53.559 -23.486 -10.171 1.00 22.42 ? 65  ASP B O     1 
ATOM   1903 C  CB    A ASP B 1 63  ? -53.948 -26.699 -9.025  0.30 28.70 ? 65  ASP B CB    1 
ATOM   1904 C  CB    B ASP B 1 63  ? -53.534 -26.722 -8.695  0.70 29.07 ? 65  ASP B CB    1 
ATOM   1905 C  CG    A ASP B 1 63  ? -55.331 -26.689 -9.649  0.30 26.65 ? 65  ASP B CG    1 
ATOM   1906 C  CG    B ASP B 1 63  ? -54.476 -27.158 -9.799  0.70 26.45 ? 65  ASP B CG    1 
ATOM   1907 O  OD1   A ASP B 1 63  ? -55.686 -25.680 -10.291 0.30 27.00 ? 65  ASP B OD1   1 
ATOM   1908 O  OD1   B ASP B 1 63  ? -54.728 -26.353 -10.720 0.70 23.48 ? 65  ASP B OD1   1 
ATOM   1909 O  OD2   A ASP B 1 63  ? -56.068 -27.684 -9.491  0.30 28.96 ? 65  ASP B OD2   1 
ATOM   1910 O  OD2   B ASP B 1 63  ? -54.965 -28.306 -9.746  0.70 28.53 ? 65  ASP B OD2   1 
ATOM   1911 N  N     . GLU B 1 64  ? -52.099 -25.125 -10.669 1.00 21.19 ? 66  GLU B N     1 
ATOM   1912 C  CA    . GLU B 1 64  ? -51.634 -24.487 -11.910 1.00 20.64 ? 66  GLU B CA    1 
ATOM   1913 C  C     . GLU B 1 64  ? -52.774 -24.073 -12.832 1.00 23.09 ? 66  GLU B C     1 
ATOM   1914 O  O     . GLU B 1 64  ? -52.677 -23.072 -13.538 1.00 30.25 ? 66  GLU B O     1 
ATOM   1915 C  CB    . GLU B 1 64  ? -50.703 -25.400 -12.720 1.00 24.60 ? 66  GLU B CB    1 
ATOM   1916 C  CG    . GLU B 1 64  ? -49.774 -26.259 -11.928 1.00 44.12 ? 66  GLU B CG    1 
ATOM   1917 C  CD    . GLU B 1 64  ? -50.368 -27.612 -11.647 1.00 32.60 ? 66  GLU B CD    1 
ATOM   1918 O  OE1   . GLU B 1 64  ? -50.082 -28.562 -12.410 1.00 28.61 ? 66  GLU B OE1   1 
ATOM   1919 O  OE2   . GLU B 1 64  ? -51.130 -27.716 -10.671 1.00 25.27 ? 66  GLU B OE2   1 
ATOM   1920 N  N     . TYR B 1 65  ? -53.847 -24.854 -12.839 1.00 24.41 ? 67  TYR B N     1 
ATOM   1921 C  CA    . TYR B 1 65  ? -54.962 -24.602 -13.755 1.00 31.54 ? 67  TYR B CA    1 
ATOM   1922 C  C     . TYR B 1 65  ? -55.897 -23.473 -13.306 1.00 37.20 ? 67  TYR B C     1 
ATOM   1923 O  O     . TYR B 1 65  ? -56.605 -22.885 -14.127 1.00 38.56 ? 67  TYR B O     1 
ATOM   1924 C  CB    . TYR B 1 65  ? -55.766 -25.889 -13.977 1.00 29.42 ? 67  TYR B CB    1 
ATOM   1925 C  CG    . TYR B 1 65  ? -54.914 -27.053 -14.420 1.00 36.47 ? 67  TYR B CG    1 
ATOM   1926 C  CD1   . TYR B 1 65  ? -54.358 -27.924 -13.490 1.00 33.75 ? 67  TYR B CD1   1 
ATOM   1927 C  CD2   . TYR B 1 65  ? -54.656 -27.278 -15.771 1.00 39.47 ? 67  TYR B CD2   1 
ATOM   1928 C  CE1   . TYR B 1 65  ? -53.566 -28.991 -13.893 1.00 40.79 ? 67  TYR B CE1   1 
ATOM   1929 C  CE2   . TYR B 1 65  ? -53.870 -28.338 -16.181 1.00 36.13 ? 67  TYR B CE2   1 
ATOM   1930 C  CZ    . TYR B 1 65  ? -53.324 -29.191 -15.238 1.00 43.66 ? 67  TYR B CZ    1 
ATOM   1931 O  OH    . TYR B 1 65  ? -52.540 -30.250 -15.643 1.00 46.15 ? 67  TYR B OH    1 
ATOM   1932 N  N     . SER B 1 66  ? -55.885 -23.150 -12.015 1.00 31.57 ? 68  SER B N     1 
ATOM   1933 C  CA    A SER B 1 66  ? -56.842 -22.194 -11.465 0.22 28.64 ? 68  SER B CA    1 
ATOM   1934 C  CA    B SER B 1 66  ? -56.837 -22.189 -11.464 0.78 28.50 ? 68  SER B CA    1 
ATOM   1935 C  C     . SER B 1 66  ? -56.755 -20.813 -12.111 1.00 30.57 ? 68  SER B C     1 
ATOM   1936 O  O     . SER B 1 66  ? -55.671 -20.290 -12.348 1.00 33.84 ? 68  SER B O     1 
ATOM   1937 C  CB    A SER B 1 66  ? -56.671 -22.064 -9.948  0.22 30.32 ? 68  SER B CB    1 
ATOM   1938 C  CB    B SER B 1 66  ? -56.657 -22.065 -9.947  0.78 30.36 ? 68  SER B CB    1 
ATOM   1939 O  OG    A SER B 1 66  ? -55.539 -21.275 -9.630  0.22 29.17 ? 68  SER B OG    1 
ATOM   1940 O  OG    B SER B 1 66  ? -56.917 -23.304 -9.319  0.78 23.74 ? 68  SER B OG    1 
ATOM   1941 N  N     . ILE B 1 67  ? -57.912 -20.233 -12.395 1.00 31.81 ? 69  ILE B N     1 
ATOM   1942 C  CA    . ILE B 1 67  ? -57.975 -18.849 -12.835 1.00 41.32 ? 69  ILE B CA    1 
ATOM   1943 C  C     . ILE B 1 67  ? -57.928 -18.017 -11.567 1.00 40.99 ? 69  ILE B C     1 
ATOM   1944 O  O     . ILE B 1 67  ? -58.731 -18.226 -10.653 1.00 41.79 ? 69  ILE B O     1 
ATOM   1945 C  CB    . ILE B 1 67  ? -59.289 -18.534 -13.576 1.00 43.19 ? 69  ILE B CB    1 
ATOM   1946 C  CG1   . ILE B 1 67  ? -59.458 -19.447 -14.790 1.00 42.42 ? 69  ILE B CG1   1 
ATOM   1947 C  CG2   . ILE B 1 67  ? -59.323 -17.070 -14.000 1.00 41.41 ? 69  ILE B CG2   1 
ATOM   1948 C  CD1   . ILE B 1 67  ? -60.814 -19.337 -15.446 1.00 54.08 ? 69  ILE B CD1   1 
ATOM   1949 N  N     . PHE B 1 68  ? -56.980 -17.090 -11.490 1.00 37.25 ? 70  PHE B N     1 
ATOM   1950 C  CA    . PHE B 1 68  ? -56.841 -16.303 -10.277 1.00 45.44 ? 70  PHE B CA    1 
ATOM   1951 C  C     . PHE B 1 68  ? -58.016 -15.346 -10.135 1.00 33.65 ? 70  PHE B C     1 
ATOM   1952 O  O     . PHE B 1 68  ? -58.152 -14.404 -10.911 1.00 42.26 ? 70  PHE B O     1 
ATOM   1953 C  CB    . PHE B 1 68  ? -55.512 -15.543 -10.239 1.00 39.89 ? 70  PHE B CB    1 
ATOM   1954 C  CG    . PHE B 1 68  ? -55.228 -14.914 -8.909  1.00 36.04 ? 70  PHE B CG    1 
ATOM   1955 C  CD1   . PHE B 1 68  ? -55.665 -13.627 -8.628  1.00 38.23 ? 70  PHE B CD1   1 
ATOM   1956 C  CD2   . PHE B 1 68  ? -54.541 -15.615 -7.927  1.00 30.10 ? 70  PHE B CD2   1 
ATOM   1957 C  CE1   . PHE B 1 68  ? -55.413 -13.046 -7.391  1.00 33.02 ? 70  PHE B CE1   1 
ATOM   1958 C  CE2   . PHE B 1 68  ? -54.288 -15.040 -6.691  1.00 29.04 ? 70  PHE B CE2   1 
ATOM   1959 C  CZ    . PHE B 1 68  ? -54.725 -13.757 -6.423  1.00 33.64 ? 70  PHE B CZ    1 
ATOM   1960 N  N     . PRO B 1 69  ? -58.866 -15.588 -9.130  1.00 36.57 ? 71  PRO B N     1 
ATOM   1961 C  CA    . PRO B 1 69  ? -60.107 -14.828 -8.996  1.00 39.44 ? 71  PRO B CA    1 
ATOM   1962 C  C     . PRO B 1 69  ? -59.843 -13.326 -8.987  1.00 39.26 ? 71  PRO B C     1 
ATOM   1963 O  O     . PRO B 1 69  ? -59.094 -12.819 -8.154  1.00 35.04 ? 71  PRO B O     1 
ATOM   1964 C  CB    . PRO B 1 69  ? -60.655 -15.291 -7.641  1.00 40.92 ? 71  PRO B CB    1 
ATOM   1965 C  CG    . PRO B 1 69  ? -60.000 -16.625 -7.398  1.00 29.78 ? 71  PRO B CG    1 
ATOM   1966 C  CD    . PRO B 1 69  ? -58.632 -16.468 -7.974  1.00 34.59 ? 71  PRO B CD    1 
ATOM   1967 N  N     . GLN B 1 70  ? -60.446 -12.639 -9.947  1.00 37.65 ? 72  GLN B N     1 
ATOM   1968 C  CA    . GLN B 1 70  ? -60.418 -11.192 -10.020 1.00 43.15 ? 72  GLN B CA    1 
ATOM   1969 C  C     . GLN B 1 70  ? -60.578 -10.518 -8.655  1.00 38.74 ? 72  GLN B C     1 
ATOM   1970 O  O     . GLN B 1 70  ? -59.842 -9.590  -8.331  1.00 39.21 ? 72  GLN B O     1 
ATOM   1971 C  CB    . GLN B 1 70  ? -61.526 -10.714 -10.954 1.00 48.12 ? 72  GLN B CB    1 
ATOM   1972 C  CG    . GLN B 1 70  ? -61.762 -9.225  -10.897 1.00 61.97 ? 72  GLN B CG    1 
ATOM   1973 C  CD    . GLN B 1 70  ? -60.567 -8.447  -11.393 1.00 73.42 ? 72  GLN B CD    1 
ATOM   1974 O  OE1   . GLN B 1 70  ? -59.693 -8.999  -12.064 1.00 71.60 ? 72  GLN B OE1   1 
ATOM   1975 N  NE2   . GLN B 1 70  ? -60.516 -7.159  -11.064 1.00 70.65 ? 72  GLN B NE2   1 
ATOM   1976 N  N     . THR B 1 71  ? -61.546 -10.967 -7.861  1.00 36.57 ? 73  THR B N     1 
ATOM   1977 C  CA    . THR B 1 71  ? -61.823 -10.307 -6.582  1.00 42.99 ? 73  THR B CA    1 
ATOM   1978 C  C     . THR B 1 71  ? -60.575 -10.145 -5.723  1.00 45.30 ? 73  THR B C     1 
ATOM   1979 O  O     . THR B 1 71  ? -60.351 -9.088  -5.137  1.00 52.64 ? 73  THR B O     1 
ATOM   1980 C  CB    . THR B 1 71  ? -62.898 -11.033 -5.737  1.00 44.60 ? 73  THR B CB    1 
ATOM   1981 O  OG1   . THR B 1 71  ? -62.838 -12.447 -5.971  1.00 46.85 ? 73  THR B OG1   1 
ATOM   1982 C  CG2   . THR B 1 71  ? -64.284 -10.509 -6.073  1.00 51.98 ? 73  THR B CG2   1 
ATOM   1983 N  N     . TYR B 1 72  ? -59.760 -11.192 -5.661  1.00 35.81 ? 74  TYR B N     1 
ATOM   1984 C  CA    . TYR B 1 72  ? -58.626 -11.210 -4.748  1.00 30.14 ? 74  TYR B CA    1 
ATOM   1985 C  C     . TYR B 1 72  ? -57.507 -10.257 -5.156  1.00 36.44 ? 74  TYR B C     1 
ATOM   1986 O  O     . TYR B 1 72  ? -56.461 -10.212 -4.510  1.00 39.41 ? 74  TYR B O     1 
ATOM   1987 C  CB    . TYR B 1 72  ? -58.095 -12.632 -4.588  1.00 38.10 ? 74  TYR B CB    1 
ATOM   1988 C  CG    . TYR B 1 72  ? -59.142 -13.608 -4.115  1.00 31.45 ? 74  TYR B CG    1 
ATOM   1989 C  CD1   . TYR B 1 72  ? -60.220 -13.181 -3.350  1.00 25.84 ? 74  TYR B CD1   1 
ATOM   1990 C  CD2   . TYR B 1 72  ? -59.058 -14.954 -4.444  1.00 30.54 ? 74  TYR B CD2   1 
ATOM   1991 C  CE1   . TYR B 1 72  ? -61.188 -14.074 -2.921  1.00 37.79 ? 74  TYR B CE1   1 
ATOM   1992 C  CE2   . TYR B 1 72  ? -60.015 -15.855 -4.023  1.00 29.60 ? 74  TYR B CE2   1 
ATOM   1993 C  CZ    . TYR B 1 72  ? -61.079 -15.414 -3.258  1.00 36.02 ? 74  TYR B CZ    1 
ATOM   1994 O  OH    . TYR B 1 72  ? -62.032 -16.317 -2.837  1.00 31.88 ? 74  TYR B OH    1 
ATOM   1995 N  N     . SER B 1 73  ? -57.727 -9.483  -6.216  1.00 39.71 ? 75  SER B N     1 
ATOM   1996 C  CA    . SER B 1 73  ? -56.712 -8.544  -6.687  1.00 35.44 ? 75  SER B CA    1 
ATOM   1997 C  C     . SER B 1 73  ? -57.108 -7.109  -6.367  1.00 40.42 ? 75  SER B C     1 
ATOM   1998 O  O     . SER B 1 73  ? -56.394 -6.167  -6.716  1.00 43.03 ? 75  SER B O     1 
ATOM   1999 C  CB    . SER B 1 73  ? -56.499 -8.684  -8.193  1.00 40.27 ? 75  SER B CB    1 
ATOM   2000 O  OG    . SER B 1 73  ? -57.556 -8.064  -8.903  1.00 42.90 ? 75  SER B OG    1 
ATOM   2001 N  N     . ILE B 1 74  ? -58.249 -6.942  -5.707  1.00 39.03 ? 76  ILE B N     1 
ATOM   2002 C  CA    . ILE B 1 74  ? -58.732 -5.601  -5.393  1.00 44.29 ? 76  ILE B CA    1 
ATOM   2003 C  C     . ILE B 1 74  ? -59.125 -5.424  -3.921  1.00 40.72 ? 76  ILE B C     1 
ATOM   2004 O  O     . ILE B 1 74  ? -59.734 -6.307  -3.306  1.00 43.43 ? 76  ILE B O     1 
ATOM   2005 C  CB    . ILE B 1 74  ? -59.888 -5.166  -6.343  1.00 52.26 ? 76  ILE B CB    1 
ATOM   2006 C  CG1   . ILE B 1 74  ? -61.254 -5.524  -5.759  1.00 50.69 ? 76  ILE B CG1   1 
ATOM   2007 C  CG2   . ILE B 1 74  ? -59.708 -5.771  -7.737  1.00 38.60 ? 76  ILE B CG2   1 
ATOM   2008 C  CD1   . ILE B 1 74  ? -62.022 -4.321  -5.254  1.00 56.28 ? 76  ILE B CD1   1 
ATOM   2009 N  N     . ASP B 1 75  ? -58.741 -4.276  -3.373  1.00 42.85 ? 77  ASP B N     1 
ATOM   2010 C  CA    A ASP B 1 75  ? -59.038 -3.911  -1.984  0.41 37.14 ? 77  ASP B CA    1 
ATOM   2011 C  CA    B ASP B 1 75  ? -59.043 -3.911  -1.990  0.59 37.09 ? 77  ASP B CA    1 
ATOM   2012 C  C     . ASP B 1 75  ? -58.494 -4.892  -0.941  1.00 35.04 ? 77  ASP B C     1 
ATOM   2013 O  O     . ASP B 1 75  ? -59.016 -4.988  0.165   1.00 32.20 ? 77  ASP B O     1 
ATOM   2014 C  CB    A ASP B 1 75  ? -60.540 -3.651  -1.769  0.41 38.66 ? 77  ASP B CB    1 
ATOM   2015 C  CB    B ASP B 1 75  ? -60.549 -3.674  -1.808  0.59 38.61 ? 77  ASP B CB    1 
ATOM   2016 C  CG    A ASP B 1 75  ? -61.354 -4.926  -1.654  0.41 42.33 ? 77  ASP B CG    1 
ATOM   2017 C  CG    B ASP B 1 75  ? -61.033 -2.405  -2.513  0.59 46.77 ? 77  ASP B CG    1 
ATOM   2018 O  OD1   A ASP B 1 75  ? -61.342 -5.554  -0.576  0.41 42.20 ? 77  ASP B OD1   1 
ATOM   2019 O  OD1   B ASP B 1 75  ? -60.210 -1.491  -2.740  0.59 42.42 ? 77  ASP B OD1   1 
ATOM   2020 O  OD2   A ASP B 1 75  ? -62.030 -5.291  -2.637  0.41 48.99 ? 77  ASP B OD2   1 
ATOM   2021 O  OD2   B ASP B 1 75  ? -62.237 -2.316  -2.833  0.59 44.23 ? 77  ASP B OD2   1 
ATOM   2022 N  N     . ILE B 1 76  ? -57.430 -5.607  -1.287  1.00 33.16 ? 78  ILE B N     1 
ATOM   2023 C  CA    . ILE B 1 76  ? -56.777 -6.484  -0.326  1.00 32.00 ? 78  ILE B CA    1 
ATOM   2024 C  C     . ILE B 1 76  ? -55.607 -5.721  0.270   1.00 30.96 ? 78  ILE B C     1 
ATOM   2025 O  O     . ILE B 1 76  ? -54.778 -5.173  -0.456  1.00 33.06 ? 78  ILE B O     1 
ATOM   2026 C  CB    . ILE B 1 76  ? -56.288 -7.806  -0.982  1.00 36.00 ? 78  ILE B CB    1 
ATOM   2027 C  CG1   . ILE B 1 76  ? -57.478 -8.663  -1.401  1.00 24.64 ? 78  ILE B CG1   1 
ATOM   2028 C  CG2   . ILE B 1 76  ? -55.407 -8.593  -0.029  1.00 25.84 ? 78  ILE B CG2   1 
ATOM   2029 C  CD1   . ILE B 1 76  ? -58.475 -8.859  -0.289  1.00 38.76 ? 78  ILE B CD1   1 
ATOM   2030 N  N     . ASN B 1 77  ? -55.546 -5.655  1.594   1.00 29.73 ? 79  ASN B N     1 
ATOM   2031 C  CA    . ASN B 1 77  ? -54.450 -4.961  2.245   1.00 22.80 ? 79  ASN B CA    1 
ATOM   2032 C  C     . ASN B 1 77  ? -53.180 -5.775  2.387   1.00 32.48 ? 79  ASN B C     1 
ATOM   2033 O  O     . ASN B 1 77  ? -52.116 -5.218  2.628   1.00 35.06 ? 79  ASN B O     1 
ATOM   2034 C  CB    . ASN B 1 77  ? -54.877 -4.460  3.615   1.00 31.04 ? 79  ASN B CB    1 
ATOM   2035 C  CG    . ASN B 1 77  ? -55.950 -3.429  3.520   1.00 31.28 ? 79  ASN B CG    1 
ATOM   2036 O  OD1   . ASN B 1 77  ? -55.720 -2.342  2.999   1.00 33.64 ? 79  ASN B OD1   1 
ATOM   2037 N  ND2   . ASN B 1 77  ? -57.137 -3.762  3.991   1.00 26.98 ? 79  ASN B ND2   1 
ATOM   2038 N  N     . GLY B 1 78  ? -53.289 -7.091  2.260   1.00 29.55 ? 80  GLY B N     1 
ATOM   2039 C  CA    . GLY B 1 78  ? -52.133 -7.945  2.444   1.00 25.69 ? 80  GLY B CA    1 
ATOM   2040 C  C     . GLY B 1 78  ? -52.405 -9.355  1.971   1.00 22.70 ? 80  GLY B C     1 
ATOM   2041 O  O     . GLY B 1 78  ? -53.553 -9.794  1.955   1.00 19.31 ? 80  GLY B O     1 
ATOM   2042 N  N     . TYR B 1 79  ? -51.348 -10.060 1.581   1.00 17.96 ? 81  TYR B N     1 
ATOM   2043 C  CA    . TYR B 1 79  ? -51.482 -11.436 1.112   1.00 17.44 ? 81  TYR B CA    1 
ATOM   2044 C  C     . TYR B 1 79  ? -50.602 -12.373 1.925   1.00 22.10 ? 81  TYR B C     1 
ATOM   2045 O  O     . TYR B 1 79  ? -49.418 -12.099 2.151   1.00 19.93 ? 81  TYR B O     1 
ATOM   2046 C  CB    . TYR B 1 79  ? -51.105 -11.555 -0.364  1.00 20.32 ? 81  TYR B CB    1 
ATOM   2047 C  CG    . TYR B 1 79  ? -52.020 -10.791 -1.289  1.00 28.40 ? 81  TYR B CG    1 
ATOM   2048 C  CD1   . TYR B 1 79  ? -51.779 -9.453  -1.590  1.00 28.53 ? 81  TYR B CD1   1 
ATOM   2049 C  CD2   . TYR B 1 79  ? -53.130 -11.407 -1.864  1.00 22.96 ? 81  TYR B CD2   1 
ATOM   2050 C  CE1   . TYR B 1 79  ? -52.619 -8.748  -2.434  1.00 25.53 ? 81  TYR B CE1   1 
ATOM   2051 C  CE2   . TYR B 1 79  ? -53.980 -10.707 -2.705  1.00 25.72 ? 81  TYR B CE2   1 
ATOM   2052 C  CZ    . TYR B 1 79  ? -53.715 -9.378  -2.986  1.00 31.09 ? 81  TYR B CZ    1 
ATOM   2053 O  OH    . TYR B 1 79  ? -54.549 -8.676  -3.819  1.00 28.94 ? 81  TYR B OH    1 
ATOM   2054 N  N     . ILE B 1 80  ? -51.196 -13.479 2.361   1.00 19.52 ? 82  ILE B N     1 
ATOM   2055 C  CA    . ILE B 1 80  ? -50.467 -14.564 2.987   1.00 11.99 ? 82  ILE B CA    1 
ATOM   2056 C  C     . ILE B 1 80  ? -50.537 -15.729 1.985   1.00 10.45 ? 82  ILE B C     1 
ATOM   2057 O  O     . ILE B 1 80  ? -51.614 -16.203 1.657   1.00 16.05 ? 82  ILE B O     1 
ATOM   2058 C  CB    . ILE B 1 80  ? -51.096 -14.940 4.342   1.00 13.08 ? 82  ILE B CB    1 
ATOM   2059 C  CG1   . ILE B 1 80  ? -51.170 -13.708 5.266   1.00 13.83 ? 82  ILE B CG1   1 
ATOM   2060 C  CG2   . ILE B 1 80  ? -50.325 -16.094 5.025   1.00 15.30 ? 82  ILE B CG2   1 
ATOM   2061 C  CD1   . ILE B 1 80  ? -51.930 -13.976 6.567   1.00 17.57 ? 82  ILE B CD1   1 
ATOM   2062 N  N     . LEU B 1 81  ? -49.391 -16.106 1.436   1.00 15.96 ? 83  LEU B N     1 
ATOM   2063 C  CA    A LEU B 1 81  ? -49.316 -17.226 0.505   0.66 14.81 ? 83  LEU B CA    1 
ATOM   2064 C  CA    B LEU B 1 81  ? -49.306 -17.219 0.502   0.34 14.81 ? 83  LEU B CA    1 
ATOM   2065 C  C     . LEU B 1 81  ? -48.730 -18.427 1.227   1.00 16.86 ? 83  LEU B C     1 
ATOM   2066 O  O     . LEU B 1 81  ? -47.591 -18.390 1.695   1.00 14.86 ? 83  LEU B O     1 
ATOM   2067 C  CB    A LEU B 1 81  ? -48.473 -16.874 -0.730  0.66 13.45 ? 83  LEU B CB    1 
ATOM   2068 C  CB    B LEU B 1 81  ? -48.416 -16.839 -0.683  0.34 13.53 ? 83  LEU B CB    1 
ATOM   2069 C  CG    A LEU B 1 81  ? -49.247 -16.233 -1.888  0.66 17.17 ? 83  LEU B CG    1 
ATOM   2070 C  CG    B LEU B 1 81  ? -48.735 -15.468 -1.282  0.34 16.33 ? 83  LEU B CG    1 
ATOM   2071 C  CD1   A LEU B 1 81  ? -49.779 -14.863 -1.484  0.66 16.30 ? 83  LEU B CD1   1 
ATOM   2072 C  CD1   B LEU B 1 81  ? -47.758 -15.128 -2.389  0.34 19.76 ? 83  LEU B CD1   1 
ATOM   2073 C  CD2   A LEU B 1 81  ? -48.383 -16.122 -3.132  0.66 14.09 ? 83  LEU B CD2   1 
ATOM   2074 C  CD2   B LEU B 1 81  ? -50.172 -15.424 -1.788  0.34 15.61 ? 83  LEU B CD2   1 
ATOM   2075 N  N     . VAL B 1 82  ? -49.518 -19.492 1.320   1.00 15.55 ? 84  VAL B N     1 
ATOM   2076 C  CA    . VAL B 1 82  ? -49.142 -20.635 2.134   1.00 12.38 ? 84  VAL B CA    1 
ATOM   2077 C  C     . VAL B 1 82  ? -48.765 -21.842 1.287   1.00 15.66 ? 84  VAL B C     1 
ATOM   2078 O  O     . VAL B 1 82  ? -49.439 -22.165 0.302   1.00 14.23 ? 84  VAL B O     1 
ATOM   2079 C  CB    . VAL B 1 82  ? -50.306 -21.042 3.090   1.00 16.56 ? 84  VAL B CB    1 
ATOM   2080 C  CG1   . VAL B 1 82  ? -49.874 -22.143 4.034   1.00 15.19 ? 84  VAL B CG1   1 
ATOM   2081 C  CG2   . VAL B 1 82  ? -50.810 -19.827 3.879   1.00 16.73 ? 84  VAL B CG2   1 
ATOM   2082 N  N     . TYR B 1 83  ? -47.673 -22.498 1.666   1.00 16.71 ? 85  TYR B N     1 
ATOM   2083 C  CA    . TYR B 1 83  ? -47.415 -23.850 1.170   1.00 17.46 ? 85  TYR B CA    1 
ATOM   2084 C  C     . TYR B 1 83  ? -47.247 -24.758 2.373   1.00 18.62 ? 85  TYR B C     1 
ATOM   2085 O  O     . TYR B 1 83  ? -47.368 -24.309 3.530   1.00 13.58 ? 85  TYR B O     1 
ATOM   2086 C  CB    . TYR B 1 83  ? -46.182 -23.916 0.269   1.00 9.87  ? 85  TYR B CB    1 
ATOM   2087 C  CG    . TYR B 1 83  ? -44.867 -23.609 0.964   1.00 12.27 ? 85  TYR B CG    1 
ATOM   2088 C  CD1   . TYR B 1 83  ? -44.036 -24.629 1.436   1.00 12.32 ? 85  TYR B CD1   1 
ATOM   2089 C  CD2   . TYR B 1 83  ? -44.450 -22.293 1.130   1.00 9.80  ? 85  TYR B CD2   1 
ATOM   2090 C  CE1   . TYR B 1 83  ? -42.817 -24.332 2.068   1.00 15.74 ? 85  TYR B CE1   1 
ATOM   2091 C  CE2   . TYR B 1 83  ? -43.254 -21.988 1.766   1.00 13.88 ? 85  TYR B CE2   1 
ATOM   2092 C  CZ    . TYR B 1 83  ? -42.441 -23.003 2.226   1.00 11.84 ? 85  TYR B CZ    1 
ATOM   2093 O  OH    . TYR B 1 83  ? -41.250 -22.664 2.825   1.00 14.15 ? 85  TYR B OH    1 
ATOM   2094 N  N     . SER B 1 84  ? -46.980 -26.031 2.101   1.00 14.95 ? 86  SER B N     1 
ATOM   2095 C  CA    . SER B 1 84  ? -46.724 -27.013 3.155   1.00 13.84 ? 86  SER B CA    1 
ATOM   2096 C  C     . SER B 1 84  ? -45.322 -27.553 2.999   1.00 15.52 ? 86  SER B C     1 
ATOM   2097 O  O     . SER B 1 84  ? -44.919 -27.933 1.899   1.00 14.92 ? 86  SER B O     1 
ATOM   2098 C  CB    . SER B 1 84  ? -47.717 -28.173 3.064   1.00 18.52 ? 86  SER B CB    1 
ATOM   2099 O  OG    . SER B 1 84  ? -47.273 -29.291 3.821   1.00 18.09 ? 86  SER B OG    1 
ATOM   2100 N  N     . VAL B 1 85  ? -44.583 -27.604 4.101   1.00 17.82 ? 87  VAL B N     1 
ATOM   2101 C  CA    . VAL B 1 85  ? -43.225 -28.119 4.066   1.00 13.43 ? 87  VAL B CA    1 
ATOM   2102 C  C     . VAL B 1 85  ? -43.195 -29.621 3.771   1.00 17.01 ? 87  VAL B C     1 
ATOM   2103 O  O     . VAL B 1 85  ? -42.121 -30.183 3.571   1.00 14.71 ? 87  VAL B O     1 
ATOM   2104 C  CB    . VAL B 1 85  ? -42.447 -27.812 5.375   1.00 16.24 ? 87  VAL B CB    1 
ATOM   2105 C  CG1   . VAL B 1 85  ? -42.470 -26.325 5.646   1.00 13.86 ? 87  VAL B CG1   1 
ATOM   2106 C  CG2   . VAL B 1 85  ? -43.037 -28.601 6.569   1.00 13.03 ? 87  VAL B CG2   1 
ATOM   2107 N  N     . THR B 1 86  ? -44.364 -30.265 3.731   1.00 15.25 ? 88  THR B N     1 
ATOM   2108 C  CA    . THR B 1 86  ? -44.436 -31.700 3.400   1.00 18.05 ? 88  THR B CA    1 
ATOM   2109 C  C     . THR B 1 86  ? -44.810 -31.995 1.934   1.00 17.41 ? 88  THR B C     1 
ATOM   2110 O  O     . THR B 1 86  ? -44.869 -33.160 1.530   1.00 14.28 ? 88  THR B O     1 
ATOM   2111 C  CB    . THR B 1 86  ? -45.422 -32.488 4.320   1.00 18.33 ? 88  THR B CB    1 
ATOM   2112 O  OG1   . THR B 1 86  ? -46.776 -32.132 4.007   1.00 19.33 ? 88  THR B OG1   1 
ATOM   2113 C  CG2   . THR B 1 86  ? -45.138 -32.224 5.799   1.00 17.33 ? 88  THR B CG2   1 
ATOM   2114 N  N     . SER B 1 87  ? -45.044 -30.946 1.152   1.00 16.80 ? 89  SER B N     1 
ATOM   2115 C  CA    . SER B 1 87  ? -45.525 -31.094 -0.221  1.00 20.21 ? 89  SER B CA    1 
ATOM   2116 C  C     . SER B 1 87  ? -44.731 -30.258 -1.215  1.00 13.77 ? 89  SER B C     1 
ATOM   2117 O  O     . SER B 1 87  ? -44.868 -29.023 -1.258  1.00 16.19 ? 89  SER B O     1 
ATOM   2118 C  CB    . SER B 1 87  ? -47.008 -30.704 -0.324  1.00 15.21 ? 89  SER B CB    1 
ATOM   2119 O  OG    . SER B 1 87  ? -47.380 -30.535 -1.694  1.00 16.55 ? 89  SER B OG    1 
ATOM   2120 N  N     . ILE B 1 88  ? -43.904 -30.923 -2.017  1.00 15.65 ? 90  ILE B N     1 
ATOM   2121 C  CA    . ILE B 1 88  ? -43.186 -30.223 -3.073  1.00 19.51 ? 90  ILE B CA    1 
ATOM   2122 C  C     . ILE B 1 88  ? -44.180 -29.551 -4.027  1.00 14.50 ? 90  ILE B C     1 
ATOM   2123 O  O     . ILE B 1 88  ? -43.989 -28.399 -4.420  1.00 20.06 ? 90  ILE B O     1 
ATOM   2124 C  CB    . ILE B 1 88  ? -42.241 -31.160 -3.846  1.00 20.34 ? 90  ILE B CB    1 
ATOM   2125 C  CG1   . ILE B 1 88  ? -41.186 -31.731 -2.899  1.00 20.01 ? 90  ILE B CG1   1 
ATOM   2126 C  CG2   . ILE B 1 88  ? -41.581 -30.421 -5.021  1.00 17.73 ? 90  ILE B CG2   1 
ATOM   2127 C  CD1   . ILE B 1 88  ? -40.193 -32.613 -3.579  1.00 19.29 ? 90  ILE B CD1   1 
ATOM   2128 N  N     . LYS B 1 89  ? -45.246 -30.256 -4.390  1.00 18.60 ? 91  LYS B N     1 
ATOM   2129 C  CA    . LYS B 1 89  ? -46.247 -29.674 -5.284  1.00 15.03 ? 91  LYS B CA    1 
ATOM   2130 C  C     . LYS B 1 89  ? -46.695 -28.298 -4.769  1.00 18.46 ? 91  LYS B C     1 
ATOM   2131 O  O     . LYS B 1 89  ? -46.816 -27.341 -5.541  1.00 15.47 ? 91  LYS B O     1 
ATOM   2132 C  CB    . LYS B 1 89  ? -47.464 -30.588 -5.395  1.00 17.00 ? 91  LYS B CB    1 
ATOM   2133 C  CG    . LYS B 1 89  ? -48.506 -30.121 -6.426  1.00 23.69 ? 91  LYS B CG    1 
ATOM   2134 C  CD    . LYS B 1 89  ? -47.906 -30.025 -7.821  1.00 23.05 ? 91  LYS B CD    1 
ATOM   2135 C  CE    . LYS B 1 89  ? -48.973 -29.724 -8.858  1.00 26.68 ? 91  LYS B CE    1 
ATOM   2136 N  NZ    . LYS B 1 89  ? -48.348 -29.554 -10.181 1.00 19.94 ? 91  LYS B NZ    1 
ATOM   2137 N  N     . SER B 1 90  ? -46.940 -28.207 -3.464  1.00 16.50 ? 92  SER B N     1 
ATOM   2138 C  CA    . SER B 1 90  ? -47.517 -26.988 -2.892  1.00 15.79 ? 92  SER B CA    1 
ATOM   2139 C  C     . SER B 1 90  ? -46.585 -25.816 -3.121  1.00 15.49 ? 92  SER B C     1 
ATOM   2140 O  O     . SER B 1 90  ? -47.027 -24.686 -3.289  1.00 16.33 ? 92  SER B O     1 
ATOM   2141 C  CB    . SER B 1 90  ? -47.821 -27.148 -1.393  1.00 17.00 ? 92  SER B CB    1 
ATOM   2142 O  OG    . SER B 1 90  ? -46.635 -27.237 -0.629  1.00 15.75 ? 92  SER B OG    1 
ATOM   2143 N  N     . PHE B 1 91  ? -45.289 -26.097 -3.150  1.00 16.21 ? 93  PHE B N     1 
ATOM   2144 C  CA    . PHE B 1 91  ? -44.308 -25.038 -3.306  1.00 12.79 ? 93  PHE B CA    1 
ATOM   2145 C  C     . PHE B 1 91  ? -44.266 -24.585 -4.763  1.00 17.25 ? 93  PHE B C     1 
ATOM   2146 O  O     . PHE B 1 91  ? -44.179 -23.383 -5.047  1.00 16.53 ? 93  PHE B O     1 
ATOM   2147 C  CB    . PHE B 1 91  ? -42.941 -25.532 -2.831  1.00 13.70 ? 93  PHE B CB    1 
ATOM   2148 C  CG    . PHE B 1 91  ? -41.922 -24.449 -2.661  1.00 15.60 ? 93  PHE B CG    1 
ATOM   2149 C  CD1   . PHE B 1 91  ? -41.747 -23.821 -1.430  1.00 21.65 ? 93  PHE B CD1   1 
ATOM   2150 C  CD2   . PHE B 1 91  ? -41.105 -24.075 -3.726  1.00 20.22 ? 93  PHE B CD2   1 
ATOM   2151 C  CE1   . PHE B 1 91  ? -40.789 -22.835 -1.266  1.00 20.33 ? 93  PHE B CE1   1 
ATOM   2152 C  CE2   . PHE B 1 91  ? -40.143 -23.096 -3.571  1.00 14.99 ? 93  PHE B CE2   1 
ATOM   2153 C  CZ    . PHE B 1 91  ? -39.978 -22.471 -2.343  1.00 20.36 ? 93  PHE B CZ    1 
ATOM   2154 N  N     . GLU B 1 92  ? -44.344 -25.547 -5.679  1.00 14.72 ? 94  GLU B N     1 
ATOM   2155 C  CA    . GLU B 1 92  ? -44.411 -25.259 -7.119  1.00 17.17 ? 94  GLU B CA    1 
ATOM   2156 C  C     . GLU B 1 92  ? -45.626 -24.387 -7.395  1.00 15.97 ? 94  GLU B C     1 
ATOM   2157 O  O     . GLU B 1 92  ? -45.568 -23.398 -8.142  1.00 19.00 ? 94  GLU B O     1 
ATOM   2158 C  CB    . GLU B 1 92  ? -44.537 -26.570 -7.906  1.00 13.83 ? 94  GLU B CB    1 
ATOM   2159 C  CG    . GLU B 1 92  ? -44.768 -26.409 -9.418  1.00 24.32 ? 94  GLU B CG    1 
ATOM   2160 C  CD    . GLU B 1 92  ? -45.116 -27.741 -10.099 1.00 37.20 ? 94  GLU B CD    1 
ATOM   2161 O  OE1   . GLU B 1 92  ? -44.335 -28.715 -9.979  1.00 38.06 ? 94  GLU B OE1   1 
ATOM   2162 O  OE2   . GLU B 1 92  ? -46.184 -27.823 -10.741 1.00 30.15 ? 94  GLU B OE2   1 
ATOM   2163 N  N     . VAL B 1 93  ? -46.732 -24.769 -6.777  1.00 15.46 ? 95  VAL B N     1 
ATOM   2164 C  CA    . VAL B 1 93  ? -47.998 -24.095 -6.990  1.00 14.73 ? 95  VAL B CA    1 
ATOM   2165 C  C     . VAL B 1 93  ? -47.997 -22.662 -6.415  1.00 14.02 ? 95  VAL B C     1 
ATOM   2166 O  O     . VAL B 1 93  ? -48.563 -21.750 -7.014  1.00 24.45 ? 95  VAL B O     1 
ATOM   2167 C  CB    . VAL B 1 93  ? -49.157 -24.942 -6.431  1.00 14.77 ? 95  VAL B CB    1 
ATOM   2168 C  CG1   . VAL B 1 93  ? -50.428 -24.135 -6.361  1.00 15.66 ? 95  VAL B CG1   1 
ATOM   2169 C  CG2   . VAL B 1 93  ? -49.364 -26.199 -7.305  1.00 14.41 ? 95  VAL B CG2   1 
ATOM   2170 N  N     . ILE B 1 94  ? -47.356 -22.456 -5.268  1.00 17.45 ? 96  ILE B N     1 
ATOM   2171 C  CA    . ILE B 1 94  ? -47.383 -21.128 -4.644  1.00 15.23 ? 96  ILE B CA    1 
ATOM   2172 C  C     . ILE B 1 94  ? -46.617 -20.143 -5.528  1.00 15.04 ? 96  ILE B C     1 
ATOM   2173 O  O     . ILE B 1 94  ? -46.949 -18.964 -5.606  1.00 15.10 ? 96  ILE B O     1 
ATOM   2174 C  CB    . ILE B 1 94  ? -46.823 -21.137 -3.200  1.00 13.92 ? 96  ILE B CB    1 
ATOM   2175 C  CG1   . ILE B 1 94  ? -47.351 -19.931 -2.405  1.00 18.47 ? 96  ILE B CG1   1 
ATOM   2176 C  CG2   . ILE B 1 94  ? -45.294 -21.192 -3.202  1.00 17.07 ? 96  ILE B CG2   1 
ATOM   2177 C  CD1   . ILE B 1 94  ? -48.875 -19.884 -2.320  1.00 14.64 ? 96  ILE B CD1   1 
ATOM   2178 N  N     . LYS B 1 95  ? -45.598 -20.631 -6.211  1.00 15.32 ? 97  LYS B N     1 
ATOM   2179 C  CA    . LYS B 1 95  ? -44.855 -19.759 -7.130  1.00 16.40 ? 97  LYS B CA    1 
ATOM   2180 C  C     . LYS B 1 95  ? -45.754 -19.317 -8.269  1.00 17.22 ? 97  LYS B C     1 
ATOM   2181 O  O     . LYS B 1 95  ? -45.714 -18.162 -8.693  1.00 16.32 ? 97  LYS B O     1 
ATOM   2182 C  CB    . LYS B 1 95  ? -43.605 -20.463 -7.659  1.00 17.24 ? 97  LYS B CB    1 
ATOM   2183 C  CG    . LYS B 1 95  ? -42.500 -20.634 -6.603  1.00 12.16 ? 97  LYS B CG    1 
ATOM   2184 C  CD    . LYS B 1 95  ? -41.383 -21.572 -7.074  1.00 23.28 ? 97  LYS B CD    1 
ATOM   2185 C  CE    . LYS B 1 95  ? -40.232 -20.835 -7.752  1.00 25.81 ? 97  LYS B CE    1 
ATOM   2186 N  NZ    . LYS B 1 95  ? -40.656 -19.928 -8.858  1.00 22.72 ? 97  LYS B NZ    1 
ATOM   2187 N  N     . VAL B 1 96  ? -46.584 -20.244 -8.743  1.00 19.27 ? 98  VAL B N     1 
ATOM   2188 C  CA    . VAL B 1 96  ? -47.513 -19.975 -9.839  1.00 19.40 ? 98  VAL B CA    1 
ATOM   2189 C  C     . VAL B 1 96  ? -48.609 -19.023 -9.375  1.00 20.24 ? 98  VAL B C     1 
ATOM   2190 O  O     . VAL B 1 96  ? -48.955 -18.068 -10.067 1.00 16.41 ? 98  VAL B O     1 
ATOM   2191 C  CB    . VAL B 1 96  ? -48.141 -21.278 -10.375 1.00 21.65 ? 98  VAL B CB    1 
ATOM   2192 C  CG1   . VAL B 1 96  ? -49.280 -20.969 -11.338 1.00 17.00 ? 98  VAL B CG1   1 
ATOM   2193 C  CG2   . VAL B 1 96  ? -47.065 -22.160 -11.056 1.00 19.09 ? 98  VAL B CG2   1 
ATOM   2194 N  N     . ILE B 1 97  ? -49.151 -19.275 -8.189  1.00 16.69 ? 99  ILE B N     1 
ATOM   2195 C  CA    . ILE B 1 97  ? -50.170 -18.396 -7.642  1.00 18.01 ? 99  ILE B CA    1 
ATOM   2196 C  C     . ILE B 1 97  ? -49.637 -16.966 -7.521  1.00 19.61 ? 99  ILE B C     1 
ATOM   2197 O  O     . ILE B 1 97  ? -50.311 -15.991 -7.873  1.00 20.17 ? 99  ILE B O     1 
ATOM   2198 C  CB    . ILE B 1 97  ? -50.648 -18.892 -6.254  1.00 15.68 ? 99  ILE B CB    1 
ATOM   2199 C  CG1   . ILE B 1 97  ? -51.449 -20.189 -6.406  1.00 18.96 ? 99  ILE B CG1   1 
ATOM   2200 C  CG2   . ILE B 1 97  ? -51.457 -17.809 -5.562  1.00 18.43 ? 99  ILE B CG2   1 
ATOM   2201 C  CD1   . ILE B 1 97  ? -51.701 -20.941 -5.089  1.00 17.03 ? 99  ILE B CD1   1 
ATOM   2202 N  N     . HIS B 1 98  ? -48.423 -16.837 -7.015  1.00 17.13 ? 100 HIS B N     1 
ATOM   2203 C  CA    . HIS B 1 98  ? -47.818 -15.519 -6.893  1.00 20.72 ? 100 HIS B CA    1 
ATOM   2204 C  C     . HIS B 1 98  ? -47.664 -14.826 -8.265  1.00 19.36 ? 100 HIS B C     1 
ATOM   2205 O  O     . HIS B 1 98  ? -47.995 -13.656 -8.408  1.00 20.39 ? 100 HIS B O     1 
ATOM   2206 C  CB    . HIS B 1 98  ? -46.485 -15.625 -6.156  1.00 19.16 ? 100 HIS B CB    1 
ATOM   2207 C  CG    . HIS B 1 98  ? -45.731 -14.333 -6.057  1.00 23.01 ? 100 HIS B CG    1 
ATOM   2208 N  ND1   . HIS B 1 98  ? -44.737 -13.985 -6.952  1.00 21.26 ? 100 HIS B ND1   1 
ATOM   2209 C  CD2   . HIS B 1 98  ? -45.793 -13.323 -5.156  1.00 22.87 ? 100 HIS B CD2   1 
ATOM   2210 C  CE1   . HIS B 1 98  ? -44.239 -12.809 -6.616  1.00 22.86 ? 100 HIS B CE1   1 
ATOM   2211 N  NE2   . HIS B 1 98  ? -44.854 -12.387 -5.525  1.00 20.81 ? 100 HIS B NE2   1 
ATOM   2212 N  N     . GLY B 1 99  ? -47.189 -15.547 -9.270  1.00 22.70 ? 101 GLY B N     1 
ATOM   2213 C  CA    . GLY B 1 99  ? -47.065 -14.972 -10.604 1.00 22.35 ? 101 GLY B CA    1 
ATOM   2214 C  C     . GLY B 1 99  ? -48.392 -14.456 -11.145 1.00 24.00 ? 101 GLY B C     1 
ATOM   2215 O  O     . GLY B 1 99  ? -48.473 -13.377 -11.742 1.00 23.12 ? 101 GLY B O     1 
ATOM   2216 N  N     . LYS B 1 100 ? -49.448 -15.231 -10.933 1.00 19.51 ? 102 LYS B N     1 
ATOM   2217 C  CA    . LYS B 1 100 ? -50.787 -14.819 -11.347 1.00 17.88 ? 102 LYS B CA    1 
ATOM   2218 C  C     . LYS B 1 100 ? -51.242 -13.608 -10.554 1.00 27.80 ? 102 LYS B C     1 
ATOM   2219 O  O     . LYS B 1 100 ? -51.805 -12.663 -11.107 1.00 23.28 ? 102 LYS B O     1 
ATOM   2220 C  CB    . LYS B 1 100 ? -51.782 -15.959 -11.175 1.00 19.27 ? 102 LYS B CB    1 
ATOM   2221 C  CG    . LYS B 1 100 ? -51.644 -17.024 -12.262 1.00 26.35 ? 102 LYS B CG    1 
ATOM   2222 C  CD    . LYS B 1 100 ? -52.542 -18.197 -11.971 1.00 30.14 ? 102 LYS B CD    1 
ATOM   2223 C  CE    . LYS B 1 100 ? -52.348 -19.295 -13.001 1.00 33.51 ? 102 LYS B CE    1 
ATOM   2224 N  NZ    . LYS B 1 100 ? -53.062 -20.517 -12.562 1.00 35.23 ? 102 LYS B NZ    1 
ATOM   2225 N  N     . LEU B 1 101 ? -51.006 -13.643 -9.248  1.00 18.98 ? 103 LEU B N     1 
ATOM   2226 C  CA    . LEU B 1 101 ? -51.343 -12.510 -8.399  1.00 16.99 ? 103 LEU B CA    1 
ATOM   2227 C  C     . LEU B 1 101 ? -50.702 -11.227 -8.927  1.00 24.07 ? 103 LEU B C     1 
ATOM   2228 O  O     . LEU B 1 101 ? -51.374 -10.205 -9.061  1.00 30.32 ? 103 LEU B O     1 
ATOM   2229 C  CB    . LEU B 1 101 ? -50.896 -12.764 -6.963  1.00 21.40 ? 103 LEU B CB    1 
ATOM   2230 C  CG    . LEU B 1 101 ? -50.999 -11.567 -6.006  1.00 27.53 ? 103 LEU B CG    1 
ATOM   2231 C  CD1   . LEU B 1 101 ? -52.428 -11.050 -5.959  1.00 27.51 ? 103 LEU B CD1   1 
ATOM   2232 C  CD2   . LEU B 1 101 ? -50.527 -11.966 -4.609  1.00 23.21 ? 103 LEU B CD2   1 
ATOM   2233 N  N     . LEU B 1 102 ? -49.405 -11.272 -9.220  1.00 18.98 ? 104 LEU B N     1 
ATOM   2234 C  CA    A LEU B 1 102 ? -48.705 -10.107 -9.762  0.35 28.19 ? 104 LEU B CA    1 
ATOM   2235 C  CA    B LEU B 1 102 ? -48.725 -10.094 -9.749  0.65 28.20 ? 104 LEU B CA    1 
ATOM   2236 C  C     . LEU B 1 102 ? -49.272 -9.648  -11.106 1.00 34.23 ? 104 LEU B C     1 
ATOM   2237 O  O     . LEU B 1 102 ? -49.409 -8.449  -11.359 1.00 36.08 ? 104 LEU B O     1 
ATOM   2238 C  CB    A LEU B 1 102 ? -47.207 -10.384 -9.902  0.35 26.32 ? 104 LEU B CB    1 
ATOM   2239 C  CB    B LEU B 1 102 ? -47.213 -10.307 -9.814  0.65 26.30 ? 104 LEU B CB    1 
ATOM   2240 C  CG    A LEU B 1 102 ? -46.443 -10.696 -8.618  0.35 24.10 ? 104 LEU B CG    1 
ATOM   2241 C  CG    B LEU B 1 102 ? -46.472 -9.678  -8.635  0.65 27.06 ? 104 LEU B CG    1 
ATOM   2242 C  CD1   A LEU B 1 102 ? -44.953 -10.630 -8.882  0.35 28.37 ? 104 LEU B CD1   1 
ATOM   2243 C  CD1   B LEU B 1 102 ? -47.113 -10.072 -7.306  0.65 27.58 ? 104 LEU B CD1   1 
ATOM   2244 C  CD2   A LEU B 1 102 ? -46.834 -9.730  -7.509  0.35 28.46 ? 104 LEU B CD2   1 
ATOM   2245 C  CD2   B LEU B 1 102 ? -45.004 -10.045 -8.659  0.65 28.18 ? 104 LEU B CD2   1 
ATOM   2246 N  N     . ASP B 1 103 ? -49.590 -10.596 -11.981 1.00 28.92 ? 105 ASP B N     1 
ATOM   2247 C  CA    . ASP B 1 103 ? -50.187 -10.221 -13.263 1.00 42.73 ? 105 ASP B CA    1 
ATOM   2248 C  C     . ASP B 1 103 ? -51.476 -9.444  -13.009 1.00 37.88 ? 105 ASP B C     1 
ATOM   2249 O  O     . ASP B 1 103 ? -51.829 -8.537  -13.750 1.00 38.10 ? 105 ASP B O     1 
ATOM   2250 C  CB    . ASP B 1 103 ? -50.505 -11.446 -14.120 1.00 23.65 ? 105 ASP B CB    1 
ATOM   2251 C  CG    . ASP B 1 103 ? -49.261 -12.153 -14.631 1.00 40.25 ? 105 ASP B CG    1 
ATOM   2252 O  OD1   . ASP B 1 103 ? -49.343 -13.368 -14.917 1.00 43.86 ? 105 ASP B OD1   1 
ATOM   2253 O  OD2   . ASP B 1 103 ? -48.205 -11.501 -14.748 1.00 50.92 ? 105 ASP B OD2   1 
ATOM   2254 N  N     . MET B 1 104 ? -52.165 -9.812  -11.939 1.00 31.06 ? 106 MET B N     1 
ATOM   2255 C  CA    . MET B 1 104 ? -53.474 -9.259  -11.618 1.00 34.89 ? 106 MET B CA    1 
ATOM   2256 C  C     . MET B 1 104 ? -53.404 -7.851  -11.021 1.00 44.25 ? 106 MET B C     1 
ATOM   2257 O  O     . MET B 1 104 ? -54.290 -7.038  -11.258 1.00 38.98 ? 106 MET B O     1 
ATOM   2258 C  CB    . MET B 1 104 ? -54.196 -10.191 -10.643 1.00 36.33 ? 106 MET B CB    1 
ATOM   2259 C  CG    . MET B 1 104 ? -55.697 -10.272 -10.832 1.00 47.07 ? 106 MET B CG    1 
ATOM   2260 S  SD    . MET B 1 104 ? -56.158 -11.024 -12.405 1.00 78.32 ? 106 MET B SD    1 
ATOM   2261 C  CE    . MET B 1 104 ? -55.381 -12.634 -12.258 1.00 59.67 ? 106 MET B CE    1 
ATOM   2262 N  N     . VAL B 1 105 ? -52.357 -7.565  -10.248 1.00 36.32 ? 107 VAL B N     1 
ATOM   2263 C  CA    . VAL B 1 105 ? -52.306 -6.333  -9.457  1.00 38.88 ? 107 VAL B CA    1 
ATOM   2264 C  C     . VAL B 1 105 ? -51.395 -5.246  -10.029 1.00 43.17 ? 107 VAL B C     1 
ATOM   2265 O  O     . VAL B 1 105 ? -51.714 -4.059  -9.944  1.00 54.68 ? 107 VAL B O     1 
ATOM   2266 C  CB    . VAL B 1 105 ? -51.890 -6.608  -7.990  1.00 43.00 ? 107 VAL B CB    1 
ATOM   2267 C  CG1   . VAL B 1 105 ? -52.885 -7.541  -7.319  1.00 39.16 ? 107 VAL B CG1   1 
ATOM   2268 C  CG2   . VAL B 1 105 ? -50.482 -7.181  -7.931  1.00 38.42 ? 107 VAL B CG2   1 
ATOM   2269 N  N     . GLY B 1 106 ? -50.267 -5.648  -10.606 1.00 51.89 ? 108 GLY B N     1 
ATOM   2270 C  CA    . GLY B 1 106 ? -49.283 -4.698  -11.099 1.00 54.45 ? 108 GLY B CA    1 
ATOM   2271 C  C     . GLY B 1 106 ? -48.025 -4.702  -10.250 1.00 61.47 ? 108 GLY B C     1 
ATOM   2272 O  O     . GLY B 1 106 ? -47.986 -5.347  -9.197  1.00 67.81 ? 108 GLY B O     1 
ATOM   2273 N  N     . LYS B 1 107 ? -46.995 -3.985  -10.697 1.00 56.73 ? 109 LYS B N     1 
ATOM   2274 C  CA    . LYS B 1 107 ? -45.736 -3.923  -9.949  1.00 64.96 ? 109 LYS B CA    1 
ATOM   2275 C  C     . LYS B 1 107 ? -45.871 -3.078  -8.677  1.00 59.01 ? 109 LYS B C     1 
ATOM   2276 O  O     . LYS B 1 107 ? -44.877 -2.606  -8.107  1.00 38.85 ? 109 LYS B O     1 
ATOM   2277 C  CB    . LYS B 1 107 ? -44.586 -3.418  -10.830 1.00 62.75 ? 109 LYS B CB    1 
ATOM   2278 C  CG    . LYS B 1 107 ? -44.745 -1.996  -11.340 1.00 60.11 ? 109 LYS B CG    1 
ATOM   2279 C  CD    . LYS B 1 107 ? -43.460 -1.514  -12.008 1.00 64.76 ? 109 LYS B CD    1 
ATOM   2280 C  CE    . LYS B 1 107 ? -43.557 -0.060  -12.470 1.00 68.67 ? 109 LYS B CE    1 
ATOM   2281 N  NZ    . LYS B 1 107 ? -43.806 0.899   -11.350 1.00 49.39 ? 109 LYS B NZ    1 
ATOM   2282 N  N     . VAL B 1 108 ? -47.116 -2.896  -8.244  1.00 56.11 ? 110 VAL B N     1 
ATOM   2283 C  CA    . VAL B 1 108 ? -47.406 -2.241  -6.974  1.00 63.04 ? 110 VAL B CA    1 
ATOM   2284 C  C     . VAL B 1 108 ? -46.873 -3.064  -5.807  1.00 64.59 ? 110 VAL B C     1 
ATOM   2285 O  O     . VAL B 1 108 ? -47.083 -4.277  -5.744  1.00 61.76 ? 110 VAL B O     1 
ATOM   2286 C  CB    . VAL B 1 108 ? -48.924 -1.984  -6.793  1.00 50.80 ? 110 VAL B CB    1 
ATOM   2287 C  CG1   . VAL B 1 108 ? -49.727 -3.050  -7.495  1.00 50.58 ? 110 VAL B CG1   1 
ATOM   2288 C  CG2   . VAL B 1 108 ? -49.288 -1.903  -5.308  1.00 46.67 ? 110 VAL B CG2   1 
ATOM   2289 N  N     . GLN B 1 109 ? -46.169 -2.404  -4.893  1.00 59.14 ? 111 GLN B N     1 
ATOM   2290 C  CA    . GLN B 1 109 ? -45.667 -3.080  -3.705  1.00 64.02 ? 111 GLN B CA    1 
ATOM   2291 C  C     . GLN B 1 109 ? -46.823 -3.380  -2.751  1.00 56.69 ? 111 GLN B C     1 
ATOM   2292 O  O     . GLN B 1 109 ? -47.421 -2.471  -2.171  1.00 64.87 ? 111 GLN B O     1 
ATOM   2293 C  CB    . GLN B 1 109 ? -44.578 -2.245  -3.022  1.00 65.86 ? 111 GLN B CB    1 
ATOM   2294 C  CG    . GLN B 1 109 ? -44.897 -0.759  -2.934  1.00 70.45 ? 111 GLN B CG    1 
ATOM   2295 C  CD    . GLN B 1 109 ? -43.721 0.066   -2.445  1.00 73.03 ? 111 GLN B CD    1 
ATOM   2296 O  OE1   . GLN B 1 109 ? -42.896 -0.408  -1.660  1.00 74.64 ? 111 GLN B OE1   1 
ATOM   2297 N  NE2   . GLN B 1 109 ? -43.635 1.308   -2.913  1.00 68.39 ? 111 GLN B NE2   1 
ATOM   2298 N  N     . ILE B 1 110 ? -47.152 -4.659  -2.614  1.00 39.66 ? 112 ILE B N     1 
ATOM   2299 C  CA    . ILE B 1 110 ? -48.232 -5.075  -1.734  1.00 34.77 ? 112 ILE B CA    1 
ATOM   2300 C  C     . ILE B 1 110 ? -47.644 -5.904  -0.609  1.00 32.39 ? 112 ILE B C     1 
ATOM   2301 O  O     . ILE B 1 110 ? -46.782 -6.754  -0.850  1.00 29.87 ? 112 ILE B O     1 
ATOM   2302 C  CB    . ILE B 1 110 ? -49.253 -5.964  -2.459  1.00 42.85 ? 112 ILE B CB    1 
ATOM   2303 C  CG1   . ILE B 1 110 ? -49.402 -5.549  -3.920  1.00 54.13 ? 112 ILE B CG1   1 
ATOM   2304 C  CG2   . ILE B 1 110 ? -50.601 -5.947  -1.722  1.00 40.23 ? 112 ILE B CG2   1 
ATOM   2305 C  CD1   . ILE B 1 110 ? -50.330 -6.456  -4.699  1.00 59.97 ? 112 ILE B CD1   1 
ATOM   2306 N  N     . PRO B 1 111 ? -48.106 -5.663  0.623   1.00 30.26 ? 113 PRO B N     1 
ATOM   2307 C  CA    . PRO B 1 111 ? -47.679 -6.499  1.745   1.00 25.18 ? 113 PRO B CA    1 
ATOM   2308 C  C     . PRO B 1 111 ? -47.933 -7.961  1.411   1.00 22.45 ? 113 PRO B C     1 
ATOM   2309 O  O     . PRO B 1 111 ? -49.058 -8.355  1.065   1.00 17.75 ? 113 PRO B O     1 
ATOM   2310 C  CB    . PRO B 1 111 ? -48.581 -6.033  2.883   1.00 23.63 ? 113 PRO B CB    1 
ATOM   2311 C  CG    . PRO B 1 111 ? -48.851 -4.607  2.551   1.00 26.95 ? 113 PRO B CG    1 
ATOM   2312 C  CD    . PRO B 1 111 ? -49.009 -4.585  1.056   1.00 33.97 ? 113 PRO B CD    1 
ATOM   2313 N  N     . ILE B 1 112 ? -46.869 -8.749  1.458   1.00 19.64 ? 114 ILE B N     1 
ATOM   2314 C  CA    . ILE B 1 112 ? -46.985 -10.168 1.179   1.00 23.89 ? 114 ILE B CA    1 
ATOM   2315 C  C     . ILE B 1 112 ? -46.153 -10.925 2.173   1.00 19.51 ? 114 ILE B C     1 
ATOM   2316 O  O     . ILE B 1 112 ? -45.099 -10.464 2.592   1.00 21.93 ? 114 ILE B O     1 
ATOM   2317 C  CB    . ILE B 1 112 ? -46.475 -10.532 -0.230  1.00 28.68 ? 114 ILE B CB    1 
ATOM   2318 C  CG1   . ILE B 1 112 ? -47.281 -9.818  -1.309  1.00 43.60 ? 114 ILE B CG1   1 
ATOM   2319 C  CG2   . ILE B 1 112 ? -46.522 -12.063 -0.437  1.00 22.96 ? 114 ILE B CG2   1 
ATOM   2320 C  CD1   . ILE B 1 112 ? -46.894 -10.219 -2.731  1.00 38.15 ? 114 ILE B CD1   1 
ATOM   2321 N  N     . MET B 1 113 ? -46.621 -12.091 2.569   1.00 14.68 ? 115 MET B N     1 
ATOM   2322 C  CA    . MET B 1 113 ? -45.732 -12.983 3.269   1.00 22.94 ? 115 MET B CA    1 
ATOM   2323 C  C     . MET B 1 113 ? -45.880 -14.418 2.766   1.00 24.04 ? 115 MET B C     1 
ATOM   2324 O  O     . MET B 1 113 ? -46.952 -14.854 2.340   1.00 25.73 ? 115 MET B O     1 
ATOM   2325 C  CB    . MET B 1 113 ? -45.955 -12.908 4.770   1.00 16.83 ? 115 MET B CB    1 
ATOM   2326 C  CG    . MET B 1 113 ? -47.262 -13.473 5.203   1.00 21.64 ? 115 MET B CG    1 
ATOM   2327 S  SD    . MET B 1 113 ? -47.445 -13.298 6.983   1.00 28.72 ? 115 MET B SD    1 
ATOM   2328 C  CE    . MET B 1 113 ? -45.915 -14.059 7.564   1.00 13.06 ? 115 MET B CE    1 
ATOM   2329 N  N     . LEU B 1 114 ? -44.774 -15.137 2.816   1.00 20.69 ? 116 LEU B N     1 
ATOM   2330 C  CA    . LEU B 1 114 ? -44.741 -16.526 2.426   1.00 13.82 ? 116 LEU B CA    1 
ATOM   2331 C  C     . LEU B 1 114 ? -44.712 -17.339 3.715   1.00 19.28 ? 116 LEU B C     1 
ATOM   2332 O  O     . LEU B 1 114 ? -43.927 -17.036 4.620   1.00 16.15 ? 116 LEU B O     1 
ATOM   2333 C  CB    . LEU B 1 114 ? -43.471 -16.760 1.609   1.00 16.15 ? 116 LEU B CB    1 
ATOM   2334 C  CG    . LEU B 1 114 ? -43.228 -18.159 1.066   1.00 15.36 ? 116 LEU B CG    1 
ATOM   2335 C  CD1   . LEU B 1 114 ? -44.409 -18.563 0.187   1.00 14.77 ? 116 LEU B CD1   1 
ATOM   2336 C  CD2   . LEU B 1 114 ? -41.904 -18.197 0.289   1.00 12.97 ? 116 LEU B CD2   1 
ATOM   2337 N  N     . VAL B 1 115 ? -45.572 -18.351 3.809   1.00 15.05 ? 117 VAL B N     1 
ATOM   2338 C  CA    . VAL B 1 115 ? -45.635 -19.204 4.992   1.00 12.84 ? 117 VAL B CA    1 
ATOM   2339 C  C     . VAL B 1 115 ? -45.469 -20.685 4.649   1.00 16.80 ? 117 VAL B C     1 
ATOM   2340 O  O     . VAL B 1 115 ? -46.232 -21.242 3.852   1.00 17.45 ? 117 VAL B O     1 
ATOM   2341 C  CB    . VAL B 1 115 ? -46.998 -19.051 5.726   1.00 16.00 ? 117 VAL B CB    1 
ATOM   2342 C  CG1   . VAL B 1 115 ? -47.102 -20.030 6.919   1.00 16.36 ? 117 VAL B CG1   1 
ATOM   2343 C  CG2   . VAL B 1 115 ? -47.219 -17.602 6.180   1.00 17.19 ? 117 VAL B CG2   1 
ATOM   2344 N  N     . GLY B 1 116 ? -44.473 -21.321 5.254   1.00 13.76 ? 118 GLY B N     1 
ATOM   2345 C  CA    . GLY B 1 116 ? -44.320 -22.759 5.141   1.00 14.51 ? 118 GLY B CA    1 
ATOM   2346 C  C     . GLY B 1 116 ? -44.990 -23.428 6.329   1.00 18.35 ? 118 GLY B C     1 
ATOM   2347 O  O     . GLY B 1 116 ? -44.466 -23.398 7.454   1.00 12.94 ? 118 GLY B O     1 
ATOM   2348 N  N     . ASN B 1 117 ? -46.152 -24.027 6.080   1.00 16.79 ? 119 ASN B N     1 
ATOM   2349 C  CA    . ASN B 1 117 ? -46.975 -24.587 7.140   1.00 14.31 ? 119 ASN B CA    1 
ATOM   2350 C  C     . ASN B 1 117 ? -46.667 -26.066 7.387   1.00 19.16 ? 119 ASN B C     1 
ATOM   2351 O  O     . ASN B 1 117 ? -45.927 -26.695 6.622   1.00 18.36 ? 119 ASN B O     1 
ATOM   2352 C  CB    . ASN B 1 117 ? -48.462 -24.387 6.821   1.00 16.43 ? 119 ASN B CB    1 
ATOM   2353 C  CG    . ASN B 1 117 ? -49.382 -24.728 8.016   1.00 17.56 ? 119 ASN B CG    1 
ATOM   2354 O  OD1   . ASN B 1 117 ? -49.102 -24.372 9.174   1.00 16.21 ? 119 ASN B OD1   1 
ATOM   2355 N  ND2   . ASN B 1 117 ? -50.476 -25.419 7.730   1.00 13.95 ? 119 ASN B ND2   1 
ATOM   2356 N  N     . LYS B 1 118 ? -47.255 -26.609 8.450   1.00 16.91 ? 120 LYS B N     1 
ATOM   2357 C  CA    . LYS B 1 118 ? -47.070 -28.011 8.826   1.00 11.40 ? 120 LYS B CA    1 
ATOM   2358 C  C     . LYS B 1 118 ? -45.645 -28.352 9.279   1.00 12.23 ? 120 LYS B C     1 
ATOM   2359 O  O     . LYS B 1 118 ? -45.198 -29.471 9.101   1.00 15.69 ? 120 LYS B O     1 
ATOM   2360 C  CB    . LYS B 1 118 ? -47.493 -28.948 7.681   1.00 13.12 ? 120 LYS B CB    1 
ATOM   2361 C  CG    . LYS B 1 118 ? -48.942 -28.783 7.245   1.00 14.26 ? 120 LYS B CG    1 
ATOM   2362 C  CD    . LYS B 1 118 ? -49.410 -29.952 6.332   1.00 16.61 ? 120 LYS B CD    1 
ATOM   2363 C  CE    . LYS B 1 118 ? -50.834 -29.719 5.875   1.00 20.35 ? 120 LYS B CE    1 
ATOM   2364 N  NZ    . LYS B 1 118 ? -51.420 -30.891 5.161   1.00 18.29 ? 120 LYS B NZ    1 
ATOM   2365 N  N     . LYS B 1 119 ? -44.950 -27.398 9.895   1.00 14.36 ? 121 LYS B N     1 
ATOM   2366 C  CA    . LYS B 1 119 ? -43.580 -27.630 10.342  1.00 14.36 ? 121 LYS B CA    1 
ATOM   2367 C  C     . LYS B 1 119 ? -43.516 -28.610 11.523  1.00 12.72 ? 121 LYS B C     1 
ATOM   2368 O  O     . LYS B 1 119 ? -42.453 -29.133 11.834  1.00 19.63 ? 121 LYS B O     1 
ATOM   2369 C  CB    . LYS B 1 119 ? -42.904 -26.319 10.731  1.00 11.18 ? 121 LYS B CB    1 
ATOM   2370 C  CG    . LYS B 1 119 ? -43.425 -25.715 12.054  1.00 17.08 ? 121 LYS B CG    1 
ATOM   2371 C  CD    . LYS B 1 119 ? -42.709 -24.423 12.379  1.00 21.76 ? 121 LYS B CD    1 
ATOM   2372 C  CE    . LYS B 1 119 ? -43.243 -23.807 13.667  1.00 26.27 ? 121 LYS B CE    1 
ATOM   2373 N  NZ    . LYS B 1 119 ? -42.949 -24.668 14.848  1.00 34.09 ? 121 LYS B NZ    1 
ATOM   2374 N  N     . ASP B 1 120 ? -44.647 -28.856 12.174  1.00 12.18 ? 122 ASP B N     1 
ATOM   2375 C  CA    . ASP B 1 120 ? -44.707 -29.897 13.216  1.00 18.90 ? 122 ASP B CA    1 
ATOM   2376 C  C     . ASP B 1 120 ? -44.431 -31.291 12.648  1.00 20.54 ? 122 ASP B C     1 
ATOM   2377 O  O     . ASP B 1 120 ? -44.013 -32.197 13.372  1.00 18.84 ? 122 ASP B O     1 
ATOM   2378 C  CB    . ASP B 1 120 ? -46.075 -29.902 13.899  1.00 17.04 ? 122 ASP B CB    1 
ATOM   2379 C  CG    . ASP B 1 120 ? -47.201 -30.136 12.920  1.00 24.37 ? 122 ASP B CG    1 
ATOM   2380 O  OD1   . ASP B 1 120 ? -47.526 -29.174 12.195  1.00 14.90 ? 122 ASP B OD1   1 
ATOM   2381 O  OD2   . ASP B 1 120 ? -47.747 -31.270 12.856  1.00 18.11 ? 122 ASP B OD2   1 
ATOM   2382 N  N     . LEU B 1 121 ? -44.657 -31.476 11.350  1.00 17.82 ? 123 LEU B N     1 
ATOM   2383 C  CA    . LEU B 1 121 ? -44.427 -32.796 10.730  1.00 15.74 ? 123 LEU B CA    1 
ATOM   2384 C  C     . LEU B 1 121 ? -42.966 -32.985 10.338  1.00 17.99 ? 123 LEU B C     1 
ATOM   2385 O  O     . LEU B 1 121 ? -42.634 -33.233 9.161   1.00 14.00 ? 123 LEU B O     1 
ATOM   2386 C  CB    . LEU B 1 121 ? -45.353 -33.013 9.526   1.00 17.04 ? 123 LEU B CB    1 
ATOM   2387 C  CG    . LEU B 1 121 ? -46.858 -32.910 9.811   1.00 18.33 ? 123 LEU B CG    1 
ATOM   2388 C  CD1   . LEU B 1 121 ? -47.687 -32.859 8.516   1.00 17.01 ? 123 LEU B CD1   1 
ATOM   2389 C  CD2   . LEU B 1 121 ? -47.325 -34.045 10.739  1.00 24.30 ? 123 LEU B CD2   1 
ATOM   2390 N  N     . HIS B 1 122 ? -42.106 -32.899 11.351  1.00 18.57 ? 124 HIS B N     1 
ATOM   2391 C  CA    . HIS B 1 122 ? -40.655 -32.901 11.178  1.00 14.93 ? 124 HIS B CA    1 
ATOM   2392 C  C     . HIS B 1 122 ? -40.098 -34.098 10.397  1.00 15.90 ? 124 HIS B C     1 
ATOM   2393 O  O     . HIS B 1 122 ? -39.101 -33.967 9.675   1.00 19.01 ? 124 HIS B O     1 
ATOM   2394 C  CB    . HIS B 1 122 ? -39.954 -32.756 12.542  1.00 17.82 ? 124 HIS B CB    1 
ATOM   2395 C  CG    . HIS B 1 122 ? -40.159 -33.930 13.458  1.00 25.65 ? 124 HIS B CG    1 
ATOM   2396 N  ND1   . HIS B 1 122 ? -39.125 -34.759 13.838  1.00 24.07 ? 124 HIS B ND1   1 
ATOM   2397 C  CD2   . HIS B 1 122 ? -41.269 -34.402 14.061  1.00 24.35 ? 124 HIS B CD2   1 
ATOM   2398 C  CE1   . HIS B 1 122 ? -39.596 -35.695 14.644  1.00 27.09 ? 124 HIS B CE1   1 
ATOM   2399 N  NE2   . HIS B 1 122 ? -40.891 -35.509 14.796  1.00 23.58 ? 124 HIS B NE2   1 
ATOM   2400 N  N     . MET B 1 123 ? -40.745 -35.254 10.516  1.00 17.86 ? 125 MET B N     1 
ATOM   2401 C  CA    . MET B 1 123 ? -40.232 -36.457 9.868   1.00 19.80 ? 125 MET B CA    1 
ATOM   2402 C  C     . MET B 1 123 ? -40.702 -36.561 8.410   1.00 19.45 ? 125 MET B C     1 
ATOM   2403 O  O     . MET B 1 123 ? -40.326 -37.500 7.697   1.00 22.96 ? 125 MET B O     1 
ATOM   2404 C  CB    . MET B 1 123 ? -40.620 -37.713 10.655  1.00 18.59 ? 125 MET B CB    1 
ATOM   2405 C  CG    . MET B 1 123 ? -39.855 -37.897 11.975  1.00 24.03 ? 125 MET B CG    1 
ATOM   2406 S  SD    . MET B 1 123 ? -38.062 -38.042 11.779  1.00 30.46 ? 125 MET B SD    1 
ATOM   2407 C  CE    . MET B 1 123 ? -37.954 -39.552 10.814  1.00 23.33 ? 125 MET B CE    1 
ATOM   2408 N  N     . GLU B 1 124 ? -41.518 -35.601 7.977   1.00 18.03 ? 126 GLU B N     1 
ATOM   2409 C  CA    . GLU B 1 124 ? -42.102 -35.614 6.626   1.00 17.42 ? 126 GLU B CA    1 
ATOM   2410 C  C     . GLU B 1 124 ? -41.647 -34.433 5.771   1.00 20.56 ? 126 GLU B C     1 
ATOM   2411 O  O     . GLU B 1 124 ? -42.124 -34.246 4.644   1.00 16.33 ? 126 GLU B O     1 
ATOM   2412 C  CB    . GLU B 1 124 ? -43.621 -35.586 6.710   1.00 17.29 ? 126 GLU B CB    1 
ATOM   2413 C  CG    . GLU B 1 124 ? -44.231 -36.826 7.341   1.00 23.85 ? 126 GLU B CG    1 
ATOM   2414 C  CD    . GLU B 1 124 ? -45.715 -36.653 7.591   1.00 24.51 ? 126 GLU B CD    1 
ATOM   2415 O  OE1   . GLU B 1 124 ? -46.410 -36.129 6.699   1.00 26.03 ? 126 GLU B OE1   1 
ATOM   2416 O  OE2   . GLU B 1 124 ? -46.179 -37.017 8.686   1.00 30.82 ? 126 GLU B OE2   1 
ATOM   2417 N  N     . ARG B 1 125 ? -40.720 -33.648 6.303   1.00 18.57 ? 127 ARG B N     1 
ATOM   2418 C  CA    . ARG B 1 125 ? -40.326 -32.402 5.661   1.00 19.12 ? 127 ARG B CA    1 
ATOM   2419 C  C     . ARG B 1 125 ? -39.581 -32.652 4.371   1.00 22.00 ? 127 ARG B C     1 
ATOM   2420 O  O     . ARG B 1 125 ? -38.703 -33.518 4.318   1.00 19.40 ? 127 ARG B O     1 
ATOM   2421 C  CB    . ARG B 1 125 ? -39.466 -31.553 6.597   1.00 20.43 ? 127 ARG B CB    1 
ATOM   2422 C  CG    . ARG B 1 125 ? -38.841 -30.331 5.915   1.00 20.04 ? 127 ARG B CG    1 
ATOM   2423 C  CD    . ARG B 1 125 ? -37.967 -29.508 6.884   1.00 20.54 ? 127 ARG B CD    1 
ATOM   2424 N  NE    . ARG B 1 125 ? -38.761 -28.762 7.850   1.00 18.37 ? 127 ARG B NE    1 
ATOM   2425 C  CZ    . ARG B 1 125 ? -39.091 -27.481 7.711   1.00 21.08 ? 127 ARG B CZ    1 
ATOM   2426 N  NH1   . ARG B 1 125 ? -38.689 -26.791 6.644   1.00 13.51 ? 127 ARG B NH1   1 
ATOM   2427 N  NH2   . ARG B 1 125 ? -39.804 -26.880 8.651   1.00 23.09 ? 127 ARG B NH2   1 
ATOM   2428 N  N     . VAL B 1 126 ? -39.928 -31.883 3.334   1.00 18.73 ? 128 VAL B N     1 
ATOM   2429 C  CA    . VAL B 1 126 ? -39.290 -32.030 2.032   1.00 24.95 ? 128 VAL B CA    1 
ATOM   2430 C  C     . VAL B 1 126 ? -38.862 -30.692 1.425   1.00 22.86 ? 128 VAL B C     1 
ATOM   2431 O  O     . VAL B 1 126 ? -38.284 -30.657 0.344   1.00 19.61 ? 128 VAL B O     1 
ATOM   2432 C  CB    . VAL B 1 126 ? -40.161 -32.842 1.039   1.00 23.67 ? 128 VAL B CB    1 
ATOM   2433 C  CG1   . VAL B 1 126 ? -40.381 -34.244 1.574   1.00 20.18 ? 128 VAL B CG1   1 
ATOM   2434 C  CG2   . VAL B 1 126 ? -41.487 -32.138 0.755   1.00 15.61 ? 128 VAL B CG2   1 
ATOM   2435 N  N     . ILE B 1 127 ? -39.149 -29.607 2.145   1.00 20.61 ? 129 ILE B N     1 
ATOM   2436 C  CA    A ILE B 1 127 ? -38.759 -28.257 1.751   0.24 16.61 ? 129 ILE B CA    1 
ATOM   2437 C  CA    B ILE B 1 127 ? -38.723 -28.277 1.737   0.76 16.52 ? 129 ILE B CA    1 
ATOM   2438 C  C     . ILE B 1 127 ? -37.933 -27.657 2.878   1.00 17.73 ? 129 ILE B C     1 
ATOM   2439 O  O     . ILE B 1 127 ? -38.319 -27.759 4.039   1.00 15.94 ? 129 ILE B O     1 
ATOM   2440 C  CB    A ILE B 1 127 ? -39.988 -27.348 1.563   0.24 16.29 ? 129 ILE B CB    1 
ATOM   2441 C  CB    B ILE B 1 127 ? -39.918 -27.382 1.393   0.76 16.29 ? 129 ILE B CB    1 
ATOM   2442 C  CG1   A ILE B 1 127 ? -41.133 -28.107 0.889   0.24 17.24 ? 129 ILE B CG1   1 
ATOM   2443 C  CG1   B ILE B 1 127 ? -40.727 -28.005 0.255   0.76 18.78 ? 129 ILE B CG1   1 
ATOM   2444 C  CG2   A ILE B 1 127 ? -39.608 -26.081 0.799   0.24 15.13 ? 129 ILE B CG2   1 
ATOM   2445 C  CG2   B ILE B 1 127 ? -39.443 -25.984 1.005   0.76 14.72 ? 129 ILE B CG2   1 
ATOM   2446 C  CD1   A ILE B 1 127 ? -40.812 -28.587 -0.502  0.24 18.05 ? 129 ILE B CD1   1 
ATOM   2447 C  CD1   B ILE B 1 127 ? -42.118 -27.452 0.127   0.76 13.89 ? 129 ILE B CD1   1 
ATOM   2448 N  N     . SER B 1 128 ? -36.816 -27.024 2.551   1.00 16.50 ? 130 SER B N     1 
ATOM   2449 C  CA    . SER B 1 128 ? -35.927 -26.511 3.591   1.00 18.66 ? 130 SER B CA    1 
ATOM   2450 C  C     . SER B 1 128 ? -36.327 -25.106 3.987   1.00 21.69 ? 130 SER B C     1 
ATOM   2451 O  O     . SER B 1 128 ? -37.023 -24.421 3.240   1.00 12.83 ? 130 SER B O     1 
ATOM   2452 C  CB    . SER B 1 128 ? -34.478 -26.501 3.112   1.00 19.96 ? 130 SER B CB    1 
ATOM   2453 O  OG    . SER B 1 128 ? -34.254 -25.421 2.222   1.00 14.76 ? 130 SER B OG    1 
ATOM   2454 N  N     . TYR B 1 129 ? -35.890 -24.681 5.168   1.00 13.67 ? 131 TYR B N     1 
ATOM   2455 C  CA    . TYR B 1 129 ? -36.126 -23.312 5.590   1.00 16.86 ? 131 TYR B CA    1 
ATOM   2456 C  C     . TYR B 1 129 ? -35.571 -22.324 4.551   1.00 15.41 ? 131 TYR B C     1 
ATOM   2457 O  O     . TYR B 1 129 ? -36.225 -21.358 4.185   1.00 14.01 ? 131 TYR B O     1 
ATOM   2458 C  CB    . TYR B 1 129 ? -35.502 -23.053 6.972   1.00 14.23 ? 131 TYR B CB    1 
ATOM   2459 C  CG    . TYR B 1 129 ? -35.706 -21.634 7.428   1.00 17.25 ? 131 TYR B CG    1 
ATOM   2460 C  CD1   . TYR B 1 129 ? -36.822 -21.275 8.172   1.00 19.36 ? 131 TYR B CD1   1 
ATOM   2461 C  CD2   . TYR B 1 129 ? -34.791 -20.652 7.102   1.00 18.97 ? 131 TYR B CD2   1 
ATOM   2462 C  CE1   . TYR B 1 129 ? -37.009 -19.962 8.595   1.00 19.17 ? 131 TYR B CE1   1 
ATOM   2463 C  CE2   . TYR B 1 129 ? -34.966 -19.342 7.506   1.00 23.25 ? 131 TYR B CE2   1 
ATOM   2464 C  CZ    . TYR B 1 129 ? -36.071 -18.999 8.253   1.00 15.98 ? 131 TYR B CZ    1 
ATOM   2465 O  OH    . TYR B 1 129 ? -36.249 -17.684 8.631   1.00 16.98 ? 131 TYR B OH    1 
ATOM   2466 N  N     . GLU B 1 130 ? -34.368 -22.583 4.055   1.00 18.17 ? 132 GLU B N     1 
ATOM   2467 C  CA    . GLU B 1 130 ? -33.741 -21.647 3.129   1.00 18.60 ? 132 GLU B CA    1 
ATOM   2468 C  C     . GLU B 1 130 ? -34.489 -21.555 1.804   1.00 15.69 ? 132 GLU B C     1 
ATOM   2469 O  O     . GLU B 1 130 ? -34.553 -20.495 1.184   1.00 16.74 ? 132 GLU B O     1 
ATOM   2470 C  CB    . GLU B 1 130 ? -32.277 -22.025 2.885   1.00 19.31 ? 132 GLU B CB    1 
ATOM   2471 C  CG    . GLU B 1 130 ? -31.566 -21.139 1.843   1.00 22.04 ? 132 GLU B CG    1 
ATOM   2472 C  CD    . GLU B 1 130 ? -31.321 -19.709 2.331   1.00 24.59 ? 132 GLU B CD    1 
ATOM   2473 O  OE1   . GLU B 1 130 ? -31.545 -19.412 3.534   1.00 25.63 ? 132 GLU B OE1   1 
ATOM   2474 O  OE2   . GLU B 1 130 ? -30.874 -18.883 1.511   1.00 32.45 ? 132 GLU B OE2   1 
ATOM   2475 N  N     . GLU B 1 131 ? -35.046 -22.670 1.352   1.00 16.52 ? 133 GLU B N     1 
ATOM   2476 C  CA    . GLU B 1 131 ? -35.772 -22.662 0.099   1.00 18.09 ? 133 GLU B CA    1 
ATOM   2477 C  C     . GLU B 1 131 ? -36.950 -21.697 0.139   1.00 20.00 ? 133 GLU B C     1 
ATOM   2478 O  O     . GLU B 1 131 ? -37.186 -20.961 -0.826  1.00 15.85 ? 133 GLU B O     1 
ATOM   2479 C  CB    . GLU B 1 131 ? -36.190 -24.084 -0.284  1.00 16.24 ? 133 GLU B CB    1 
ATOM   2480 C  CG    . GLU B 1 131 ? -35.032 -24.840 -0.880  1.00 17.15 ? 133 GLU B CG    1 
ATOM   2481 C  CD    . GLU B 1 131 ? -35.284 -26.333 -0.997  1.00 22.40 ? 133 GLU B CD    1 
ATOM   2482 O  OE1   . GLU B 1 131 ? -34.618 -26.981 -1.826  1.00 21.33 ? 133 GLU B OE1   1 
ATOM   2483 O  OE2   . GLU B 1 131 ? -36.132 -26.856 -0.260  1.00 16.62 ? 133 GLU B OE2   1 
ATOM   2484 N  N     . GLY B 1 132 ? -37.671 -21.685 1.261   1.00 20.85 ? 134 GLY B N     1 
ATOM   2485 C  CA    . GLY B 1 132 ? -38.730 -20.713 1.467   1.00 13.77 ? 134 GLY B CA    1 
ATOM   2486 C  C     . GLY B 1 132 ? -38.232 -19.278 1.643   1.00 16.80 ? 134 GLY B C     1 
ATOM   2487 O  O     . GLY B 1 132 ? -38.758 -18.347 1.028   1.00 16.81 ? 134 GLY B O     1 
ATOM   2488 N  N     A LYS B 1 133 ? -37.222 -19.102 2.489   0.37 15.54 ? 135 LYS B N     1 
ATOM   2489 N  N     B LYS B 1 133 ? -37.227 -19.096 2.496   0.63 15.52 ? 135 LYS B N     1 
ATOM   2490 C  CA    A LYS B 1 133 ? -36.667 -17.778 2.739   0.37 16.47 ? 135 LYS B CA    1 
ATOM   2491 C  CA    B LYS B 1 133 ? -36.666 -17.771 2.743   0.63 16.46 ? 135 LYS B CA    1 
ATOM   2492 C  C     A LYS B 1 133 ? -36.137 -17.147 1.451   0.37 17.87 ? 135 LYS B C     1 
ATOM   2493 C  C     B LYS B 1 133 ? -36.142 -17.147 1.446   0.63 17.88 ? 135 LYS B C     1 
ATOM   2494 O  O     A LYS B 1 133 ? -36.432 -15.992 1.150   0.37 15.93 ? 135 LYS B O     1 
ATOM   2495 O  O     B LYS B 1 133 ? -36.447 -15.997 1.132   0.63 15.86 ? 135 LYS B O     1 
ATOM   2496 C  CB    A LYS B 1 133 ? -35.564 -17.843 3.800   0.37 17.57 ? 135 LYS B CB    1 
ATOM   2497 C  CB    B LYS B 1 133 ? -35.551 -17.840 3.796   0.63 17.55 ? 135 LYS B CB    1 
ATOM   2498 C  CG    A LYS B 1 133 ? -34.975 -16.486 4.160   0.37 18.91 ? 135 LYS B CG    1 
ATOM   2499 C  CG    B LYS B 1 133 ? -34.965 -16.481 4.194   0.63 18.87 ? 135 LYS B CG    1 
ATOM   2500 C  CD    A LYS B 1 133 ? -33.992 -16.598 5.311   0.37 22.44 ? 135 LYS B CD    1 
ATOM   2501 C  CD    B LYS B 1 133 ? -36.041 -15.547 4.718   0.63 19.84 ? 135 LYS B CD    1 
ATOM   2502 C  CE    A LYS B 1 133 ? -33.418 -15.241 5.672   0.37 21.32 ? 135 LYS B CE    1 
ATOM   2503 C  CE    B LYS B 1 133 ? -35.452 -14.379 5.538   0.63 29.21 ? 135 LYS B CE    1 
ATOM   2504 N  NZ    A LYS B 1 133 ? -34.491 -14.279 6.045   0.37 24.18 ? 135 LYS B NZ    1 
ATOM   2505 N  NZ    B LYS B 1 133 ? -34.489 -13.510 4.784   0.63 22.77 ? 135 LYS B NZ    1 
ATOM   2506 N  N     . ALA B 1 134 ? -35.359 -17.911 0.690   1.00 17.07 ? 136 ALA B N     1 
ATOM   2507 C  CA    . ALA B 1 134 ? -34.835 -17.414 -0.580  1.00 16.84 ? 136 ALA B CA    1 
ATOM   2508 C  C     . ALA B 1 134 ? -35.969 -16.970 -1.502  1.00 19.70 ? 136 ALA B C     1 
ATOM   2509 O  O     . ALA B 1 134 ? -35.891 -15.918 -2.135  1.00 19.80 ? 136 ALA B O     1 
ATOM   2510 C  CB    . ALA B 1 134 ? -33.971 -18.468 -1.265  1.00 14.02 ? 136 ALA B CB    1 
ATOM   2511 N  N     . LEU B 1 135 ? -37.024 -17.772 -1.584  1.00 18.37 ? 137 LEU B N     1 
ATOM   2512 C  CA    . LEU B 1 135 ? -38.146 -17.424 -2.447  1.00 16.54 ? 137 LEU B CA    1 
ATOM   2513 C  C     . LEU B 1 135 ? -38.779 -16.154 -1.916  1.00 19.41 ? 137 LEU B C     1 
ATOM   2514 O  O     . LEU B 1 135 ? -38.995 -15.209 -2.663  1.00 16.34 ? 137 LEU B O     1 
ATOM   2515 C  CB    . LEU B 1 135 ? -39.180 -18.551 -2.527  1.00 12.92 ? 137 LEU B CB    1 
ATOM   2516 C  CG    . LEU B 1 135 ? -40.423 -18.204 -3.343  1.00 12.00 ? 137 LEU B CG    1 
ATOM   2517 C  CD1   . LEU B 1 135 ? -40.014 -17.917 -4.812  1.00 16.21 ? 137 LEU B CD1   1 
ATOM   2518 C  CD2   . LEU B 1 135 ? -41.443 -19.345 -3.270  1.00 12.20 ? 137 LEU B CD2   1 
ATOM   2519 N  N     . ALA B 1 136 ? -39.053 -16.114 -0.618  1.00 16.34 ? 138 ALA B N     1 
ATOM   2520 C  CA    . ALA B 1 136 ? -39.632 -14.907 -0.023  1.00 17.32 ? 138 ALA B CA    1 
ATOM   2521 C  C     . ALA B 1 136 ? -38.807 -13.661 -0.361  1.00 18.66 ? 138 ALA B C     1 
ATOM   2522 O  O     . ALA B 1 136 ? -39.345 -12.639 -0.805  1.00 20.55 ? 138 ALA B O     1 
ATOM   2523 C  CB    . ALA B 1 136 ? -39.764 -15.072 1.497   1.00 16.22 ? 138 ALA B CB    1 
ATOM   2524 N  N     . GLU B 1 137 ? -37.496 -13.744 -0.161  1.00 20.30 ? 139 GLU B N     1 
ATOM   2525 C  CA    . GLU B 1 137 ? -36.617 -12.607 -0.462  1.00 25.53 ? 139 GLU B CA    1 
ATOM   2526 C  C     . GLU B 1 137 ? -36.752 -12.112 -1.902  1.00 19.76 ? 139 GLU B C     1 
ATOM   2527 O  O     . GLU B 1 137 ? -36.767 -10.911 -2.138  1.00 19.95 ? 139 GLU B O     1 
ATOM   2528 C  CB    . GLU B 1 137 ? -35.153 -12.940 -0.174  1.00 22.49 ? 139 GLU B CB    1 
ATOM   2529 C  CG    . GLU B 1 137 ? -34.838 -13.162 1.299   1.00 24.10 ? 139 GLU B CG    1 
ATOM   2530 C  CD    . GLU B 1 137 ? -33.397 -13.597 1.510   1.00 41.07 ? 139 GLU B CD    1 
ATOM   2531 O  OE1   . GLU B 1 137 ? -33.019 -13.914 2.656   1.00 39.57 ? 139 GLU B OE1   1 
ATOM   2532 O  OE2   . GLU B 1 137 ? -32.637 -13.631 0.518   1.00 47.27 ? 139 GLU B OE2   1 
ATOM   2533 N  N     . SER B 1 138 ? -36.824 -13.027 -2.867  1.00 19.63 ? 140 SER B N     1 
ATOM   2534 C  CA    . SER B 1 138 ? -36.958 -12.623 -4.271  1.00 21.92 ? 140 SER B CA    1 
ATOM   2535 C  C     . SER B 1 138 ? -38.267 -11.879 -4.502  1.00 27.08 ? 140 SER B C     1 
ATOM   2536 O  O     . SER B 1 138 ? -38.406 -11.131 -5.476  1.00 20.73 ? 140 SER B O     1 
ATOM   2537 C  CB    . SER B 1 138 ? -36.879 -13.826 -5.216  1.00 18.40 ? 140 SER B CB    1 
ATOM   2538 O  OG    . SER B 1 138 ? -38.075 -14.585 -5.192  1.00 15.09 ? 140 SER B OG    1 
ATOM   2539 N  N     . TRP B 1 139 ? -39.231 -12.099 -3.610  1.00 17.41 ? 141 TRP B N     1 
ATOM   2540 C  CA    . TRP B 1 139 ? -40.528 -11.429 -3.681  1.00 17.85 ? 141 TRP B CA    1 
ATOM   2541 C  C     . TRP B 1 139 ? -40.541 -10.144 -2.846  1.00 24.76 ? 141 TRP B C     1 
ATOM   2542 O  O     . TRP B 1 139 ? -41.536 -9.427  -2.809  1.00 24.86 ? 141 TRP B O     1 
ATOM   2543 C  CB    . TRP B 1 139 ? -41.641 -12.335 -3.133  1.00 20.89 ? 141 TRP B CB    1 
ATOM   2544 C  CG    . TRP B 1 139 ? -41.960 -13.576 -3.913  1.00 14.06 ? 141 TRP B CG    1 
ATOM   2545 C  CD1   . TRP B 1 139 ? -41.410 -13.983 -5.094  1.00 22.17 ? 141 TRP B CD1   1 
ATOM   2546 C  CD2   . TRP B 1 139 ? -42.908 -14.584 -3.545  1.00 22.97 ? 141 TRP B CD2   1 
ATOM   2547 N  NE1   . TRP B 1 139 ? -41.962 -15.182 -5.483  1.00 20.82 ? 141 TRP B NE1   1 
ATOM   2548 C  CE2   . TRP B 1 139 ? -42.889 -15.566 -4.550  1.00 22.60 ? 141 TRP B CE2   1 
ATOM   2549 C  CE3   . TRP B 1 139 ? -43.777 -14.741 -2.462  1.00 20.12 ? 141 TRP B CE3   1 
ATOM   2550 C  CZ2   . TRP B 1 139 ? -43.707 -16.697 -4.505  1.00 25.64 ? 141 TRP B CZ2   1 
ATOM   2551 C  CZ3   . TRP B 1 139 ? -44.582 -15.868 -2.413  1.00 20.75 ? 141 TRP B CZ3   1 
ATOM   2552 C  CH2   . TRP B 1 139 ? -44.543 -16.831 -3.430  1.00 21.47 ? 141 TRP B CH2   1 
ATOM   2553 N  N     . ASN B 1 140 ? -39.451 -9.873  -2.148  1.00 20.85 ? 142 ASN B N     1 
ATOM   2554 C  CA    . ASN B 1 140 ? -39.491 -8.861  -1.113  1.00 26.43 ? 142 ASN B CA    1 
ATOM   2555 C  C     . ASN B 1 140 ? -40.655 -9.113  -0.141  1.00 27.34 ? 142 ASN B C     1 
ATOM   2556 O  O     . ASN B 1 140 ? -41.393 -8.188  0.210   1.00 20.57 ? 142 ASN B O     1 
ATOM   2557 C  CB    . ASN B 1 140 ? -39.613 -7.463  -1.730  1.00 32.04 ? 142 ASN B CB    1 
ATOM   2558 C  CG    . ASN B 1 140 ? -39.381 -6.371  -0.711  1.00 52.55 ? 142 ASN B CG    1 
ATOM   2559 O  OD1   . ASN B 1 140 ? -38.739 -6.600  0.322   1.00 43.33 ? 142 ASN B OD1   1 
ATOM   2560 N  ND2   . ASN B 1 140 ? -39.909 -5.181  -0.981  1.00 54.58 ? 142 ASN B ND2   1 
ATOM   2561 N  N     . ALA B 1 141 ? -40.830 -10.373 0.265   1.00 22.78 ? 143 ALA B N     1 
ATOM   2562 C  CA    . ALA B 1 141 ? -41.901 -10.749 1.191   1.00 20.45 ? 143 ALA B CA    1 
ATOM   2563 C  C     . ALA B 1 141 ? -41.312 -11.257 2.495   1.00 18.92 ? 143 ALA B C     1 
ATOM   2564 O  O     . ALA B 1 141 ? -40.183 -11.748 2.518   1.00 19.92 ? 143 ALA B O     1 
ATOM   2565 C  CB    . ALA B 1 141 ? -42.805 -11.831 0.577   1.00 16.17 ? 143 ALA B CB    1 
ATOM   2566 N  N     . ALA B 1 142 ? -42.076 -11.159 3.578   1.00 14.77 ? 144 ALA B N     1 
ATOM   2567 C  CA    . ALA B 1 142 ? -41.640 -11.757 4.828   1.00 18.02 ? 144 ALA B CA    1 
ATOM   2568 C  C     . ALA B 1 142 ? -41.791 -13.269 4.706   1.00 20.17 ? 144 ALA B C     1 
ATOM   2569 O  O     . ALA B 1 142 ? -42.515 -13.786 3.835   1.00 12.89 ? 144 ALA B O     1 
ATOM   2570 C  CB    . ALA B 1 142 ? -42.448 -11.226 6.000   1.00 22.64 ? 144 ALA B CB    1 
ATOM   2571 N  N     . PHE B 1 143 ? -41.099 -13.991 5.568   1.00 22.19 ? 145 PHE B N     1 
ATOM   2572 C  CA    . PHE B 1 143 ? -41.192 -15.436 5.539   1.00 18.23 ? 145 PHE B CA    1 
ATOM   2573 C  C     . PHE B 1 143 ? -41.162 -16.064 6.935   1.00 18.66 ? 145 PHE B C     1 
ATOM   2574 O  O     . PHE B 1 143 ? -40.299 -15.744 7.751   1.00 19.71 ? 145 PHE B O     1 
ATOM   2575 C  CB    . PHE B 1 143 ? -40.066 -16.020 4.681   1.00 18.72 ? 145 PHE B CB    1 
ATOM   2576 C  CG    . PHE B 1 143 ? -39.961 -17.511 4.773   1.00 14.85 ? 145 PHE B CG    1 
ATOM   2577 C  CD1   . PHE B 1 143 ? -40.889 -18.320 4.140   1.00 15.98 ? 145 PHE B CD1   1 
ATOM   2578 C  CD2   . PHE B 1 143 ? -38.947 -18.100 5.511   1.00 14.78 ? 145 PHE B CD2   1 
ATOM   2579 C  CE1   . PHE B 1 143 ? -40.798 -19.715 4.226   1.00 16.28 ? 145 PHE B CE1   1 
ATOM   2580 C  CE2   . PHE B 1 143 ? -38.852 -19.473 5.611   1.00 16.60 ? 145 PHE B CE2   1 
ATOM   2581 C  CZ    . PHE B 1 143 ? -39.781 -20.287 4.960   1.00 20.23 ? 145 PHE B CZ    1 
ATOM   2582 N  N     . LEU B 1 144 ? -42.107 -16.964 7.203   1.00 16.55 ? 146 LEU B N     1 
ATOM   2583 C  CA    . LEU B 1 144 ? -41.970 -17.860 8.352   1.00 14.62 ? 146 LEU B CA    1 
ATOM   2584 C  C     . LEU B 1 144 ? -42.573 -19.250 8.141   1.00 16.82 ? 146 LEU B C     1 
ATOM   2585 O  O     . LEU B 1 144 ? -43.332 -19.485 7.204   1.00 17.26 ? 146 LEU B O     1 
ATOM   2586 C  CB    . LEU B 1 144 ? -42.471 -17.207 9.657   1.00 23.44 ? 146 LEU B CB    1 
ATOM   2587 C  CG    . LEU B 1 144 ? -43.835 -16.527 9.674   1.00 26.30 ? 146 LEU B CG    1 
ATOM   2588 C  CD1   . LEU B 1 144 ? -44.917 -17.562 9.523   1.00 32.13 ? 146 LEU B CD1   1 
ATOM   2589 C  CD2   . LEU B 1 144 ? -44.021 -15.748 10.967  1.00 16.42 ? 146 LEU B CD2   1 
ATOM   2590 N  N     . GLU B 1 145 ? -42.195 -20.172 9.011   1.00 10.82 ? 147 GLU B N     1 
ATOM   2591 C  CA    . GLU B 1 145 ? -42.761 -21.505 9.015   1.00 13.90 ? 147 GLU B CA    1 
ATOM   2592 C  C     . GLU B 1 145 ? -43.682 -21.598 10.211  1.00 18.45 ? 147 GLU B C     1 
ATOM   2593 O  O     . GLU B 1 145 ? -43.368 -21.063 11.288  1.00 16.02 ? 147 GLU B O     1 
ATOM   2594 C  CB    . GLU B 1 145 ? -41.655 -22.554 9.091   1.00 12.30 ? 147 GLU B CB    1 
ATOM   2595 C  CG    . GLU B 1 145 ? -40.661 -22.448 7.930   1.00 19.40 ? 147 GLU B CG    1 
ATOM   2596 C  CD    . GLU B 1 145 ? -39.685 -23.613 7.867   1.00 17.42 ? 147 GLU B CD    1 
ATOM   2597 O  OE1   . GLU B 1 145 ? -39.372 -24.070 6.747   1.00 18.69 ? 147 GLU B OE1   1 
ATOM   2598 O  OE2   . GLU B 1 145 ? -39.218 -24.069 8.927   1.00 20.91 ? 147 GLU B OE2   1 
ATOM   2599 N  N     . SER B 1 146 ? -44.812 -22.271 10.021  1.00 15.25 ? 148 SER B N     1 
ATOM   2600 C  CA    . SER B 1 146 ? -45.863 -22.313 11.024  1.00 15.73 ? 148 SER B CA    1 
ATOM   2601 C  C     . SER B 1 146 ? -46.369 -23.731 11.229  1.00 19.86 ? 148 SER B C     1 
ATOM   2602 O  O     . SER B 1 146 ? -46.037 -24.638 10.469  1.00 15.86 ? 148 SER B O     1 
ATOM   2603 C  CB    . SER B 1 146 ? -47.040 -21.458 10.552  1.00 14.85 ? 148 SER B CB    1 
ATOM   2604 O  OG    . SER B 1 146 ? -47.546 -21.976 9.325   1.00 13.62 ? 148 SER B OG    1 
ATOM   2605 N  N     . SER B 1 147 ? -47.187 -23.901 12.264  1.00 15.54 ? 149 SER B N     1 
ATOM   2606 C  CA    . SER B 1 147 ? -48.003 -25.097 12.440  1.00 16.82 ? 149 SER B CA    1 
ATOM   2607 C  C     . SER B 1 147 ? -49.374 -24.676 12.956  1.00 17.14 ? 149 SER B C     1 
ATOM   2608 O  O     . SER B 1 147 ? -49.473 -23.968 13.961  1.00 16.63 ? 149 SER B O     1 
ATOM   2609 C  CB    . SER B 1 147 ? -47.368 -26.077 13.431  1.00 15.58 ? 149 SER B CB    1 
ATOM   2610 O  OG    . SER B 1 147 ? -48.296 -27.102 13.747  1.00 19.59 ? 149 SER B OG    1 
ATOM   2611 N  N     . ALA B 1 148 ? -50.428 -25.114 12.276  1.00 14.18 ? 150 ALA B N     1 
ATOM   2612 C  CA    . ALA B 1 148 ? -51.787 -24.833 12.731  1.00 14.30 ? 150 ALA B CA    1 
ATOM   2613 C  C     . ALA B 1 148 ? -52.118 -25.492 14.067  1.00 18.75 ? 150 ALA B C     1 
ATOM   2614 O  O     . ALA B 1 148 ? -53.152 -25.192 14.678  1.00 17.28 ? 150 ALA B O     1 
ATOM   2615 C  CB    . ALA B 1 148 ? -52.798 -25.257 11.671  1.00 17.66 ? 150 ALA B CB    1 
ATOM   2616 N  N     . LYS B 1 149 ? -51.252 -26.401 14.508  1.00 16.18 ? 151 LYS B N     1 
ATOM   2617 C  CA    . LYS B 1 149 ? -51.419 -27.043 15.806  1.00 24.83 ? 151 LYS B CA    1 
ATOM   2618 C  C     . LYS B 1 149 ? -50.790 -26.186 16.881  1.00 22.49 ? 151 LYS B C     1 
ATOM   2619 O  O     . LYS B 1 149 ? -50.964 -26.457 18.069  1.00 26.42 ? 151 LYS B O     1 
ATOM   2620 C  CB    . LYS B 1 149 ? -50.741 -28.417 15.844  1.00 21.03 ? 151 LYS B CB    1 
ATOM   2621 C  CG    . LYS B 1 149 ? -51.338 -29.453 14.926  1.00 26.10 ? 151 LYS B CG    1 
ATOM   2622 C  CD    . LYS B 1 149 ? -50.775 -30.816 15.307  1.00 29.77 ? 151 LYS B CD    1 
ATOM   2623 C  CE    . LYS B 1 149 ? -51.515 -31.941 14.623  1.00 38.53 ? 151 LYS B CE    1 
ATOM   2624 N  NZ    . LYS B 1 149 ? -51.018 -33.262 15.101  1.00 42.56 ? 151 LYS B NZ    1 
ATOM   2625 N  N     . GLU B 1 150 ? -50.038 -25.170 16.466  1.00 16.69 ? 152 GLU B N     1 
ATOM   2626 C  CA    . GLU B 1 150 ? -49.264 -24.357 17.407  1.00 21.52 ? 152 GLU B CA    1 
ATOM   2627 C  C     . GLU B 1 150 ? -49.729 -22.910 17.390  1.00 22.17 ? 152 GLU B C     1 
ATOM   2628 O  O     . GLU B 1 150 ? -49.361 -22.134 16.503  1.00 18.07 ? 152 GLU B O     1 
ATOM   2629 C  CB    . GLU B 1 150 ? -47.774 -24.460 17.090  1.00 18.96 ? 152 GLU B CB    1 
ATOM   2630 C  CG    . GLU B 1 150 ? -47.201 -25.826 17.416  1.00 31.15 ? 152 GLU B CG    1 
ATOM   2631 C  CD    . GLU B 1 150 ? -45.747 -25.984 17.004  1.00 38.31 ? 152 GLU B CD    1 
ATOM   2632 O  OE1   . GLU B 1 150 ? -45.049 -24.958 16.833  1.00 34.35 ? 152 GLU B OE1   1 
ATOM   2633 O  OE2   . GLU B 1 150 ? -45.304 -27.145 16.847  1.00 39.45 ? 152 GLU B OE2   1 
ATOM   2634 N  N     . ASN B 1 151 ? -50.552 -22.559 18.369  1.00 17.60 ? 153 ASN B N     1 
ATOM   2635 C  CA    . ASN B 1 151 ? -51.218 -21.265 18.386  1.00 18.77 ? 153 ASN B CA    1 
ATOM   2636 C  C     . ASN B 1 151 ? -50.316 -20.065 18.149  1.00 20.54 ? 153 ASN B C     1 
ATOM   2637 O  O     . ASN B 1 151 ? -50.638 -19.194 17.345  1.00 18.91 ? 153 ASN B O     1 
ATOM   2638 C  CB    . ASN B 1 151 ? -51.972 -21.051 19.697  1.00 18.56 ? 153 ASN B CB    1 
ATOM   2639 C  CG    . ASN B 1 151 ? -52.681 -19.719 19.725  1.00 21.44 ? 153 ASN B CG    1 
ATOM   2640 O  OD1   . ASN B 1 151 ? -52.162 -18.746 20.258  1.00 22.22 ? 153 ASN B OD1   1 
ATOM   2641 N  ND2   . ASN B 1 151 ? -53.854 -19.654 19.102  1.00 19.80 ? 153 ASN B ND2   1 
ATOM   2642 N  N     . GLN B 1 152 ? -49.192 -20.004 18.854  1.00 21.08 ? 154 GLN B N     1 
ATOM   2643 C  CA    . GLN B 1 152 ? -48.340 -18.821 18.752  1.00 24.58 ? 154 GLN B CA    1 
ATOM   2644 C  C     . GLN B 1 152 ? -47.786 -18.645 17.340  1.00 22.11 ? 154 GLN B C     1 
ATOM   2645 O  O     . GLN B 1 152 ? -47.566 -17.515 16.907  1.00 20.13 ? 154 GLN B O     1 
ATOM   2646 C  CB    . GLN B 1 152 ? -47.213 -18.824 19.789  1.00 25.95 ? 154 GLN B CB    1 
ATOM   2647 C  CG    . GLN B 1 152 ? -46.420 -17.509 19.845  1.00 29.27 ? 154 GLN B CG    1 
ATOM   2648 C  CD    . GLN B 1 152 ? -47.298 -16.309 20.170  1.00 36.41 ? 154 GLN B CD    1 
ATOM   2649 O  OE1   . GLN B 1 152 ? -48.172 -16.382 21.040  1.00 29.17 ? 154 GLN B OE1   1 
ATOM   2650 N  NE2   . GLN B 1 152 ? -47.087 -15.204 19.456  1.00 26.91 ? 154 GLN B NE2   1 
ATOM   2651 N  N     . THR B 1 153 ? -47.574 -19.744 16.614  1.00 17.58 ? 155 THR B N     1 
ATOM   2652 C  CA    . THR B 1 153 ? -47.088 -19.607 15.234  1.00 21.73 ? 155 THR B CA    1 
ATOM   2653 C  C     . THR B 1 153 ? -48.173 -19.043 14.327  1.00 19.12 ? 155 THR B C     1 
ATOM   2654 O  O     . THR B 1 153 ? -47.886 -18.325 13.356  1.00 13.84 ? 155 THR B O     1 
ATOM   2655 C  CB    . THR B 1 153 ? -46.527 -20.927 14.638  1.00 25.73 ? 155 THR B CB    1 
ATOM   2656 O  OG1   . THR B 1 153 ? -47.604 -21.749 14.166  1.00 19.53 ? 155 THR B OG1   1 
ATOM   2657 C  CG2   . THR B 1 153 ? -45.673 -21.681 15.677  1.00 16.23 ? 155 THR B CG2   1 
ATOM   2658 N  N     . ALA B 1 154 ? -49.426 -19.358 14.638  1.00 15.24 ? 156 ALA B N     1 
ATOM   2659 C  CA    . ALA B 1 154 ? -50.523 -18.781 13.863  1.00 16.69 ? 156 ALA B CA    1 
ATOM   2660 C  C     . ALA B 1 154 ? -50.691 -17.284 14.170  1.00 21.34 ? 156 ALA B C     1 
ATOM   2661 O  O     . ALA B 1 154 ? -50.816 -16.466 13.255  1.00 17.59 ? 156 ALA B O     1 
ATOM   2662 C  CB    . ALA B 1 154 ? -51.825 -19.551 14.091  1.00 18.98 ? 156 ALA B CB    1 
ATOM   2663 N  N     . VAL B 1 155 ? -50.670 -16.918 15.451  1.00 21.22 ? 157 VAL B N     1 
ATOM   2664 C  CA    . VAL B 1 155 ? -50.673 -15.499 15.824  1.00 20.36 ? 157 VAL B CA    1 
ATOM   2665 C  C     . VAL B 1 155 ? -49.544 -14.770 15.093  1.00 19.61 ? 157 VAL B C     1 
ATOM   2666 O  O     . VAL B 1 155 ? -49.719 -13.663 14.579  1.00 18.33 ? 157 VAL B O     1 
ATOM   2667 C  CB    . VAL B 1 155 ? -50.516 -15.314 17.347  1.00 23.82 ? 157 VAL B CB    1 
ATOM   2668 C  CG1   . VAL B 1 155 ? -50.263 -13.849 17.704  1.00 20.24 ? 157 VAL B CG1   1 
ATOM   2669 C  CG2   . VAL B 1 155 ? -51.751 -15.846 18.078  1.00 21.63 ? 157 VAL B CG2   1 
ATOM   2670 N  N     . ASP B 1 156 ? -48.380 -15.401 15.034  1.00 19.92 ? 158 ASP B N     1 
ATOM   2671 C  CA    . ASP B 1 156 ? -47.215 -14.747 14.453  1.00 15.58 ? 158 ASP B CA    1 
ATOM   2672 C  C     . ASP B 1 156 ? -47.385 -14.478 12.953  1.00 20.10 ? 158 ASP B C     1 
ATOM   2673 O  O     . ASP B 1 156 ? -46.911 -13.471 12.433  1.00 17.32 ? 158 ASP B O     1 
ATOM   2674 C  CB    . ASP B 1 156 ? -45.959 -15.575 14.725  1.00 16.98 ? 158 ASP B CB    1 
ATOM   2675 C  CG    . ASP B 1 156 ? -45.430 -15.374 16.140  1.00 20.04 ? 158 ASP B CG    1 
ATOM   2676 O  OD1   . ASP B 1 156 ? -46.013 -14.570 16.894  1.00 21.48 ? 158 ASP B OD1   1 
ATOM   2677 O  OD2   . ASP B 1 156 ? -44.430 -16.006 16.491  1.00 18.17 ? 158 ASP B OD2   1 
ATOM   2678 N  N     . VAL B 1 157 ? -48.064 -15.391 12.267  1.00 16.59 ? 159 VAL B N     1 
ATOM   2679 C  CA    . VAL B 1 157 ? -48.333 -15.226 10.840  1.00 16.89 ? 159 VAL B CA    1 
ATOM   2680 C  C     . VAL B 1 157 ? -49.120 -13.951 10.588  1.00 19.51 ? 159 VAL B C     1 
ATOM   2681 O  O     . VAL B 1 157 ? -48.747 -13.124 9.749   1.00 16.88 ? 159 VAL B O     1 
ATOM   2682 C  CB    . VAL B 1 157 ? -49.118 -16.431 10.275  1.00 15.50 ? 159 VAL B CB    1 
ATOM   2683 C  CG1   . VAL B 1 157 ? -49.733 -16.079 8.927   1.00 17.00 ? 159 VAL B CG1   1 
ATOM   2684 C  CG2   . VAL B 1 157 ? -48.210 -17.641 10.164  1.00 13.31 ? 159 VAL B CG2   1 
ATOM   2685 N  N     . PHE B 1 158 ? -50.208 -13.777 11.325  1.00 15.61 ? 160 PHE B N     1 
ATOM   2686 C  CA    . PHE B 1 158 ? -51.070 -12.637 11.070  1.00 17.53 ? 160 PHE B CA    1 
ATOM   2687 C  C     . PHE B 1 158 ? -50.504 -11.353 11.642  1.00 20.94 ? 160 PHE B C     1 
ATOM   2688 O  O     . PHE B 1 158 ? -50.726 -10.284 11.085  1.00 16.96 ? 160 PHE B O     1 
ATOM   2689 C  CB    . PHE B 1 158 ? -52.491 -12.920 11.548  1.00 21.98 ? 160 PHE B CB    1 
ATOM   2690 C  CG    . PHE B 1 158 ? -53.145 -14.013 10.778  1.00 23.38 ? 160 PHE B CG    1 
ATOM   2691 C  CD1   . PHE B 1 158 ? -53.737 -13.746 9.548   1.00 17.13 ? 160 PHE B CD1   1 
ATOM   2692 C  CD2   . PHE B 1 158 ? -53.111 -15.318 11.243  1.00 18.51 ? 160 PHE B CD2   1 
ATOM   2693 C  CE1   . PHE B 1 158 ? -54.320 -14.757 8.815   1.00 16.45 ? 160 PHE B CE1   1 
ATOM   2694 C  CE2   . PHE B 1 158 ? -53.698 -16.335 10.518  1.00 23.81 ? 160 PHE B CE2   1 
ATOM   2695 C  CZ    . PHE B 1 158 ? -54.303 -16.052 9.299   1.00 16.43 ? 160 PHE B CZ    1 
ATOM   2696 N  N     . ARG B 1 159 ? -49.743 -11.446 12.729  1.00 19.44 ? 161 ARG B N     1 
ATOM   2697 C  CA    . ARG B 1 159 ? -49.043 -10.263 13.190  1.00 22.64 ? 161 ARG B CA    1 
ATOM   2698 C  C     . ARG B 1 159 ? -48.032 -9.801  12.143  1.00 18.59 ? 161 ARG B C     1 
ATOM   2699 O  O     . ARG B 1 159 ? -47.889 -8.604  11.894  1.00 17.83 ? 161 ARG B O     1 
ATOM   2700 C  CB    . ARG B 1 159 ? -48.343 -10.497 14.527  1.00 18.09 ? 161 ARG B CB    1 
ATOM   2701 C  CG    . ARG B 1 159 ? -48.080 -9.191  15.227  1.00 37.14 ? 161 ARG B CG    1 
ATOM   2702 C  CD    . ARG B 1 159 ? -47.539 -9.367  16.629  1.00 36.40 ? 161 ARG B CD    1 
ATOM   2703 N  NE    . ARG B 1 159 ? -46.114 -9.623  16.569  1.00 40.59 ? 161 ARG B NE    1 
ATOM   2704 C  CZ    . ARG B 1 159 ? -45.578 -10.828 16.634  1.00 27.99 ? 161 ARG B CZ    1 
ATOM   2705 N  NH1   . ARG B 1 159 ? -46.358 -11.887 16.782  1.00 45.50 ? 161 ARG B NH1   1 
ATOM   2706 N  NH2   . ARG B 1 159 ? -44.266 -10.968 16.556  1.00 29.66 ? 161 ARG B NH2   1 
ATOM   2707 N  N     . ARG B 1 160 ? -47.331 -10.752 11.526  1.00 15.83 ? 162 ARG B N     1 
ATOM   2708 C  CA    . ARG B 1 160 ? -46.298 -10.398 10.565  1.00 12.39 ? 162 ARG B CA    1 
ATOM   2709 C  C     . ARG B 1 160 ? -46.878 -9.663  9.345   1.00 14.06 ? 162 ARG B C     1 
ATOM   2710 O  O     . ARG B 1 160 ? -46.303 -8.695  8.873   1.00 16.58 ? 162 ARG B O     1 
ATOM   2711 C  CB    . ARG B 1 160 ? -45.484 -11.624 10.147  1.00 16.03 ? 162 ARG B CB    1 
ATOM   2712 C  CG    . ARG B 1 160 ? -44.366 -11.318 9.137   1.00 16.01 ? 162 ARG B CG    1 
ATOM   2713 C  CD    . ARG B 1 160 ? -43.373 -10.256 9.614   1.00 18.10 ? 162 ARG B CD    1 
ATOM   2714 N  NE    . ARG B 1 160 ? -42.845 -10.539 10.961  1.00 15.96 ? 162 ARG B NE    1 
ATOM   2715 C  CZ    . ARG B 1 160 ? -42.440 -9.605  11.814  1.00 16.21 ? 162 ARG B CZ    1 
ATOM   2716 N  NH1   . ARG B 1 160 ? -42.495 -8.324  11.466  1.00 14.15 ? 162 ARG B NH1   1 
ATOM   2717 N  NH2   . ARG B 1 160 ? -41.983 -9.949  13.018  1.00 20.14 ? 162 ARG B NH2   1 
ATOM   2718 N  N     . ILE B 1 161 ? -48.027 -10.098 8.848   1.00 16.13 ? 163 ILE B N     1 
ATOM   2719 C  CA    . ILE B 1 161 ? -48.578 -9.455  7.659   1.00 15.72 ? 163 ILE B CA    1 
ATOM   2720 C  C     . ILE B 1 161 ? -49.038 -8.018  7.992   1.00 18.66 ? 163 ILE B C     1 
ATOM   2721 O  O     . ILE B 1 161 ? -48.975 -7.138  7.151   1.00 19.04 ? 163 ILE B O     1 
ATOM   2722 C  CB    . ILE B 1 161 ? -49.713 -10.285 7.023   1.00 17.57 ? 163 ILE B CB    1 
ATOM   2723 C  CG1   . ILE B 1 161 ? -50.060 -9.772  5.622   1.00 17.53 ? 163 ILE B CG1   1 
ATOM   2724 C  CG2   . ILE B 1 161 ? -50.948 -10.290 7.940   1.00 17.43 ? 163 ILE B CG2   1 
ATOM   2725 C  CD1   . ILE B 1 161 ? -48.902 -9.764  4.652   1.00 15.60 ? 163 ILE B CD1   1 
ATOM   2726 N  N     . ILE B 1 162 ? -49.490 -7.781  9.222   1.00 17.06 ? 164 ILE B N     1 
ATOM   2727 C  CA    . ILE B 1 162 ? -49.789 -6.417  9.660   1.00 15.39 ? 164 ILE B CA    1 
ATOM   2728 C  C     . ILE B 1 162 ? -48.515 -5.593  9.689   1.00 22.33 ? 164 ILE B C     1 
ATOM   2729 O  O     . ILE B 1 162 ? -48.494 -4.470  9.210   1.00 21.57 ? 164 ILE B O     1 
ATOM   2730 C  CB    . ILE B 1 162 ? -50.392 -6.390  11.065  1.00 22.94 ? 164 ILE B CB    1 
ATOM   2731 C  CG1   . ILE B 1 162 ? -51.786 -7.013  11.052  1.00 20.07 ? 164 ILE B CG1   1 
ATOM   2732 C  CG2   . ILE B 1 162 ? -50.415 -4.946  11.618  1.00 20.87 ? 164 ILE B CG2   1 
ATOM   2733 C  CD1   . ILE B 1 162 ? -52.356 -7.208  12.439  1.00 24.43 ? 164 ILE B CD1   1 
ATOM   2734 N  N     . LEU B 1 163 ? -47.451 -6.159  10.255  1.00 15.72 ? 165 LEU B N     1 
ATOM   2735 C  CA    . LEU B 1 163 ? -46.167 -5.453  10.341  1.00 20.74 ? 165 LEU B CA    1 
ATOM   2736 C  C     . LEU B 1 163 ? -45.511 -5.241  8.982   1.00 29.11 ? 165 LEU B C     1 
ATOM   2737 O  O     . LEU B 1 163 ? -44.789 -4.257  8.781   1.00 20.14 ? 165 LEU B O     1 
ATOM   2738 C  CB    . LEU B 1 163 ? -45.211 -6.171  11.287  1.00 14.79 ? 165 LEU B CB    1 
ATOM   2739 C  CG    . LEU B 1 163 ? -45.652 -6.115  12.747  1.00 20.03 ? 165 LEU B CG    1 
ATOM   2740 C  CD1   . LEU B 1 163 ? -44.808 -7.053  13.588  1.00 22.02 ? 165 LEU B CD1   1 
ATOM   2741 C  CD2   . LEU B 1 163 ? -45.572 -4.688  13.274  1.00 23.70 ? 165 LEU B CD2   1 
ATOM   2742 N  N     . GLU B 1 164 ? -45.775 -6.154  8.048   1.00 23.08 ? 166 GLU B N     1 
ATOM   2743 C  CA    . GLU B 1 164 ? -45.278 -6.011  6.678   1.00 21.86 ? 166 GLU B CA    1 
ATOM   2744 C  C     . GLU B 1 164 ? -45.825 -4.780  5.971   1.00 29.75 ? 166 GLU B C     1 
ATOM   2745 O  O     . GLU B 1 164 ? -45.176 -4.238  5.077   1.00 29.55 ? 166 GLU B O     1 
ATOM   2746 C  CB    . GLU B 1 164 ? -45.594 -7.247  5.833   1.00 21.58 ? 166 GLU B CB    1 
ATOM   2747 C  CG    . GLU B 1 164 ? -44.513 -8.301  5.846   1.00 24.09 ? 166 GLU B CG    1 
ATOM   2748 C  CD    . GLU B 1 164 ? -43.153 -7.778  5.395   1.00 29.59 ? 166 GLU B CD    1 
ATOM   2749 O  OE1   . GLU B 1 164 ? -42.333 -7.434  6.276   1.00 25.45 ? 166 GLU B OE1   1 
ATOM   2750 O  OE2   . GLU B 1 164 ? -42.892 -7.739  4.168   1.00 26.50 ? 166 GLU B OE2   1 
ATOM   2751 N  N     . ALA B 1 165 ? -47.024 -4.360  6.357   1.00 26.53 ? 167 ALA B N     1 
ATOM   2752 C  CA    . ALA B 1 165 ? -47.682 -3.218  5.718   1.00 40.73 ? 167 ALA B CA    1 
ATOM   2753 C  C     . ALA B 1 165 ? -47.003 -1.903  6.076   1.00 52.59 ? 167 ALA B C     1 
ATOM   2754 O  O     . ALA B 1 165 ? -46.711 -1.074  5.208   1.00 45.73 ? 167 ALA B O     1 
ATOM   2755 C  CB    . ALA B 1 165 ? -49.150 -3.168  6.107   1.00 43.03 ? 167 ALA B CB    1 
ATOM   2756 N  N     . GLU B 1 166 ? -46.768 -1.711  7.368   1.00 57.78 ? 168 GLU B N     1 
ATOM   2757 C  CA    . GLU B 1 166 ? -46.063 -0.531  7.847   1.00 51.30 ? 168 GLU B CA    1 
ATOM   2758 C  C     . GLU B 1 166 ? -44.573 -0.797  7.796   1.00 51.20 ? 168 GLU B C     1 
ATOM   2759 O  O     . GLU B 1 166 ? -43.872 -0.666  8.798   1.00 59.68 ? 168 GLU B O     1 
ATOM   2760 C  CB    . GLU B 1 166 ? -46.497 -0.184  9.274   1.00 52.24 ? 168 GLU B CB    1 
ATOM   2761 C  CG    . GLU B 1 166 ? -48.007 0.019   9.445   1.00 60.42 ? 168 GLU B CG    1 
ATOM   2762 C  CD    . GLU B 1 166 ? -48.742 -1.224  9.945   1.00 58.18 ? 168 GLU B CD    1 
ATOM   2763 O  OE1   . GLU B 1 166 ? -48.314 -1.803  10.969  1.00 58.71 ? 168 GLU B OE1   1 
ATOM   2764 O  OE2   . GLU B 1 166 ? -49.756 -1.609  9.321   1.00 47.10 ? 168 GLU B OE2   1 
ATOM   2765 N  N     . LYS B 1 167 ? -44.096 -1.190  6.622   1.00 53.85 ? 169 LYS B N     1 
ATOM   2766 C  CA    . LYS B 1 167 ? -42.697 -1.549  6.461   1.00 53.26 ? 169 LYS B CA    1 
ATOM   2767 C  C     . LYS B 1 167 ? -41.909 -0.365  5.912   1.00 62.39 ? 169 LYS B C     1 
ATOM   2768 O  O     . LYS B 1 167 ? -42.201 0.787   6.238   1.00 58.64 ? 169 LYS B O     1 
ATOM   2769 C  CB    . LYS B 1 167 ? -42.550 -2.778  5.551   1.00 52.09 ? 169 LYS B CB    1 
ATOM   2770 C  CG    . LYS B 1 167 ? -41.251 -3.568  5.744   1.00 51.92 ? 169 LYS B CG    1 
ATOM   2771 C  CD    . LYS B 1 167 ? -41.295 -4.476  6.987   1.00 54.98 ? 169 LYS B CD    1 
ATOM   2772 C  CE    . LYS B 1 167 ? -41.118 -3.700  8.300   1.00 58.56 ? 169 LYS B CE    1 
ATOM   2773 N  NZ    . LYS B 1 167 ? -41.575 -4.465  9.512   1.00 35.55 ? 169 LYS B NZ    1 
HETATM 2774 MG MG    . MG  C 2 .   ? -13.614 -10.354 17.705  1.00 21.78 ? 202 MG  A MG    1 
HETATM 2775 P  PB    . GDP D 3 .   ? -16.176 -12.533 17.118  1.00 16.98 ? 201 GDP A PB    1 
HETATM 2776 O  O1B   . GDP D 3 .   ? -15.556 -13.377 18.224  1.00 18.26 ? 201 GDP A O1B   1 
HETATM 2777 O  O2B   . GDP D 3 .   ? -17.582 -12.131 17.478  1.00 15.56 ? 201 GDP A O2B   1 
HETATM 2778 O  O3B   . GDP D 3 .   ? -15.405 -11.292 16.789  1.00 16.15 ? 201 GDP A O3B   1 
HETATM 2779 O  O3A   . GDP D 3 .   ? -16.277 -13.439 15.768  1.00 19.83 ? 201 GDP A O3A   1 
HETATM 2780 P  PA    . GDP D 3 .   ? -15.187 -13.444 14.585  1.00 17.25 ? 201 GDP A PA    1 
HETATM 2781 O  O1A   . GDP D 3 .   ? -13.794 -13.601 15.139  1.00 18.41 ? 201 GDP A O1A   1 
HETATM 2782 O  O2A   . GDP D 3 .   ? -15.325 -12.191 13.762  1.00 16.17 ? 201 GDP A O2A   1 
HETATM 2783 O  "O5'" . GDP D 3 .   ? -15.637 -14.725 13.726  1.00 19.72 ? 201 GDP A "O5'" 1 
HETATM 2784 C  "C5'" . GDP D 3 .   ? -15.479 -16.042 14.232  1.00 15.57 ? 201 GDP A "C5'" 1 
HETATM 2785 C  "C4'" . GDP D 3 .   ? -15.441 -16.962 13.029  1.00 21.77 ? 201 GDP A "C4'" 1 
HETATM 2786 O  "O4'" . GDP D 3 .   ? -16.650 -16.806 12.283  1.00 19.62 ? 201 GDP A "O4'" 1 
HETATM 2787 C  "C3'" . GDP D 3 .   ? -14.308 -16.560 12.094  1.00 25.39 ? 201 GDP A "C3'" 1 
HETATM 2788 O  "O3'" . GDP D 3 .   ? -13.739 -17.760 11.568  1.00 23.59 ? 201 GDP A "O3'" 1 
HETATM 2789 C  "C2'" . GDP D 3 .   ? -14.984 -15.816 10.955  1.00 25.76 ? 201 GDP A "C2'" 1 
HETATM 2790 O  "O2'" . GDP D 3 .   ? -14.290 -15.963 9.706   1.00 24.63 ? 201 GDP A "O2'" 1 
HETATM 2791 C  "C1'" . GDP D 3 .   ? -16.347 -16.482 10.921  1.00 20.21 ? 201 GDP A "C1'" 1 
HETATM 2792 N  N9    . GDP D 3 .   ? -17.423 -15.583 10.473  1.00 18.52 ? 201 GDP A N9    1 
HETATM 2793 C  C8    . GDP D 3 .   ? -17.748 -14.405 11.015  1.00 14.56 ? 201 GDP A C8    1 
HETATM 2794 N  N7    . GDP D 3 .   ? -18.801 -13.847 10.374  1.00 21.09 ? 201 GDP A N7    1 
HETATM 2795 C  C5    . GDP D 3 .   ? -19.167 -14.709 9.409   1.00 22.00 ? 201 GDP A C5    1 
HETATM 2796 C  C6    . GDP D 3 .   ? -20.201 -14.752 8.375   1.00 16.45 ? 201 GDP A C6    1 
HETATM 2797 O  O6    . GDP D 3 .   ? -21.002 -13.806 8.284   1.00 19.33 ? 201 GDP A O6    1 
HETATM 2798 N  N1    . GDP D 3 .   ? -20.249 -15.819 7.561   1.00 23.57 ? 201 GDP A N1    1 
HETATM 2799 C  C2    . GDP D 3 .   ? -19.387 -16.851 7.660   1.00 19.71 ? 201 GDP A C2    1 
HETATM 2800 N  N2    . GDP D 3 .   ? -19.500 -17.900 6.799   1.00 15.26 ? 201 GDP A N2    1 
HETATM 2801 N  N3    . GDP D 3 .   ? -18.408 -16.878 8.600   1.00 24.88 ? 201 GDP A N3    1 
HETATM 2802 C  C4    . GDP D 3 .   ? -18.263 -15.858 9.482   1.00 19.52 ? 201 GDP A C4    1 
HETATM 2803 MG MG    . MG  E 2 .   ? -59.620 -24.353 3.391   1.00 26.74 ? 178 MG  B MG    1 
HETATM 2804 P  PG    . GNP F 4 .   ? -58.419 -26.153 0.957   1.00 22.06 ? 179 GNP B PG    1 
HETATM 2805 O  O1G   . GNP F 4 .   ? -59.110 -27.263 0.199   1.00 21.62 ? 179 GNP B O1G   1 
HETATM 2806 O  O2G   . GNP F 4 .   ? -59.401 -25.155 1.493   1.00 18.70 ? 179 GNP B O2G   1 
HETATM 2807 O  O3G   . GNP F 4 .   ? -57.418 -25.527 -0.002  1.00 18.30 ? 179 GNP B O3G   1 
HETATM 2808 N  N3B   . GNP F 4 .   ? -57.567 -26.796 2.168   1.00 13.71 ? 179 GNP B N3B   1 
HETATM 2809 P  PB    . GNP F 4 .   ? -56.737 -25.982 3.286   1.00 18.49 ? 179 GNP B PB    1 
HETATM 2810 O  O1B   . GNP F 4 .   ? -55.527 -25.328 2.739   1.00 19.13 ? 179 GNP B O1B   1 
HETATM 2811 O  O2B   . GNP F 4 .   ? -57.668 -25.081 3.976   1.00 20.48 ? 179 GNP B O2B   1 
HETATM 2812 O  O3A   . GNP F 4 .   ? -56.217 -26.978 4.346   1.00 22.10 ? 179 GNP B O3A   1 
HETATM 2813 P  PA    . GNP F 4 .   ? -56.925 -27.435 5.640   1.00 21.99 ? 179 GNP B PA    1 
HETATM 2814 O  O1A   . GNP F 4 .   ? -56.784 -26.430 6.705   1.00 22.33 ? 179 GNP B O1A   1 
HETATM 2815 O  O2A   . GNP F 4 .   ? -58.302 -27.874 5.379   1.00 18.17 ? 179 GNP B O2A   1 
HETATM 2816 O  "O5'" . GNP F 4 .   ? -56.135 -28.699 6.161   1.00 21.23 ? 179 GNP B "O5'" 1 
HETATM 2817 C  "C5'" . GNP F 4 .   ? -55.848 -29.831 5.301   1.00 18.41 ? 179 GNP B "C5'" 1 
HETATM 2818 C  "C4'" . GNP F 4 .   ? -55.387 -31.000 6.156   1.00 21.27 ? 179 GNP B "C4'" 1 
HETATM 2819 O  "O4'" . GNP F 4 .   ? -54.073 -30.731 6.727   1.00 22.08 ? 179 GNP B "O4'" 1 
HETATM 2820 C  "C3'" . GNP F 4 .   ? -56.297 -31.273 7.354   1.00 21.90 ? 179 GNP B "C3'" 1 
HETATM 2821 O  "O3'" . GNP F 4 .   ? -56.338 -32.664 7.626   1.00 20.69 ? 179 GNP B "O3'" 1 
HETATM 2822 C  "C2'" . GNP F 4 .   ? -55.608 -30.509 8.477   1.00 22.61 ? 179 GNP B "C2'" 1 
HETATM 2823 O  "O2'" . GNP F 4 .   ? -55.881 -31.040 9.756   1.00 25.08 ? 179 GNP B "O2'" 1 
HETATM 2824 C  "C1'" . GNP F 4 .   ? -54.140 -30.738 8.137   1.00 17.32 ? 179 GNP B "C1'" 1 
HETATM 2825 N  N9    . GNP F 4 .   ? -53.268 -29.668 8.596   1.00 21.03 ? 179 GNP B N9    1 
HETATM 2826 C  C8    . GNP F 4 .   ? -53.417 -28.329 8.308   1.00 20.13 ? 179 GNP B C8    1 
HETATM 2827 N  N7    . GNP F 4 .   ? -52.482 -27.593 8.836   1.00 20.29 ? 179 GNP B N7    1 
HETATM 2828 C  C5    . GNP F 4 .   ? -51.663 -28.492 9.508   1.00 17.63 ? 179 GNP B C5    1 
HETATM 2829 C  C6    . GNP F 4 .   ? -50.491 -28.263 10.264  1.00 15.33 ? 179 GNP B C6    1 
HETATM 2830 O  O6    . GNP F 4 .   ? -49.919 -27.185 10.471  1.00 16.49 ? 179 GNP B O6    1 
HETATM 2831 N  N1    . GNP F 4 .   ? -49.966 -29.453 10.766  1.00 17.43 ? 179 GNP B N1    1 
HETATM 2832 C  C2    . GNP F 4 .   ? -50.511 -30.702 10.574  1.00 17.71 ? 179 GNP B C2    1 
HETATM 2833 N  N2    . GNP F 4 .   ? -49.880 -31.738 11.152  1.00 15.71 ? 179 GNP B N2    1 
HETATM 2834 N  N3    . GNP F 4 .   ? -51.610 -30.922 9.866   1.00 22.14 ? 179 GNP B N3    1 
HETATM 2835 C  C4    . GNP F 4 .   ? -52.131 -29.778 9.364   1.00 20.98 ? 179 GNP B C4    1 
HETATM 2836 C  C     . ACT G 5 .   ? -63.707 -25.269 5.974   1.00 54.96 ? 1   ACT B C     1 
HETATM 2837 O  O     . ACT G 5 .   ? -64.819 -25.841 5.916   1.00 55.60 ? 1   ACT B O     1 
HETATM 2838 O  OXT   . ACT G 5 .   ? -63.454 -24.472 5.039   1.00 51.35 ? 1   ACT B OXT   1 
HETATM 2839 C  CH3   . ACT G 5 .   ? -62.739 -25.527 7.096   1.00 51.09 ? 1   ACT B CH3   1 
HETATM 2840 O  O     . HOH H 6 .   ? -32.186 -14.634 12.861  1.00 14.57 ? 2   HOH A O     1 
HETATM 2841 O  O     . HOH H 6 .   ? -14.695 -8.862  18.649  1.00 17.18 ? 170 HOH A O     1 
HETATM 2842 O  O     . HOH H 6 .   ? -12.010 5.774   6.220   1.00 32.16 ? 171 HOH A O     1 
HETATM 2843 O  O     . HOH H 6 .   ? -12.545 -12.080 16.877  1.00 22.88 ? 172 HOH A O     1 
HETATM 2844 O  O     . HOH H 6 .   ? -25.334 -24.256 13.378  1.00 16.83 ? 173 HOH A O     1 
HETATM 2845 O  O     . HOH H 6 .   ? -37.620 -19.404 21.275  1.00 43.17 ? 174 HOH A O     1 
HETATM 2846 O  O     . HOH H 6 .   ? -9.656  -0.262  21.687  1.00 39.91 ? 175 HOH A O     1 
HETATM 2847 O  O     . HOH H 6 .   ? -11.914 -9.686  18.694  1.00 17.82 ? 176 HOH A O     1 
HETATM 2848 O  O     . HOH H 6 .   ? -33.425 -8.636  27.199  1.00 23.61 ? 177 HOH A O     1 
HETATM 2849 O  O     . HOH H 6 .   ? -20.603 0.717   26.893  1.00 25.46 ? 178 HOH A O     1 
HETATM 2850 O  O     . HOH H 6 .   ? -20.983 -18.018 18.100  1.00 21.14 ? 179 HOH A O     1 
HETATM 2851 O  O     . HOH H 6 .   ? -31.295 -22.896 6.853   1.00 33.78 ? 180 HOH A O     1 
HETATM 2852 O  O     . HOH H 6 .   ? -24.420 -12.972 20.836  1.00 11.60 ? 181 HOH A O     1 
HETATM 2853 O  O     . HOH H 6 .   ? -32.145 -8.096  6.995   1.00 19.49 ? 182 HOH A O     1 
HETATM 2854 O  O     . HOH H 6 .   ? -15.818 -7.596  -0.057  1.00 33.56 ? 183 HOH A O     1 
HETATM 2855 O  O     . HOH H 6 .   ? -34.427 -2.063  23.981  1.00 26.92 ? 184 HOH A O     1 
HETATM 2856 O  O     . HOH H 6 .   ? -26.849 6.468   35.581  1.00 40.23 ? 185 HOH A O     1 
HETATM 2857 O  O     . HOH H 6 .   ? -45.003 -11.953 13.820  1.00 16.15 ? 186 HOH A O     1 
HETATM 2858 O  O     . HOH H 6 .   ? -13.435 5.168   3.836   1.00 39.57 ? 187 HOH A O     1 
HETATM 2859 O  O     . HOH H 6 .   ? -18.067 -8.280  -0.209  1.00 18.92 ? 188 HOH A O     1 
HETATM 2860 O  O     . HOH H 6 .   ? -17.530 -20.139 6.632   1.00 43.86 ? 189 HOH A O     1 
HETATM 2861 O  O     . HOH H 6 .   ? -32.719 3.594   26.668  1.00 27.77 ? 190 HOH A O     1 
HETATM 2862 O  O     . HOH H 6 .   ? -17.302 -19.902 14.462  1.00 33.48 ? 191 HOH A O     1 
HETATM 2863 O  O     . HOH H 6 .   ? -19.051 12.394  21.399  1.00 34.02 ? 192 HOH A O     1 
HETATM 2864 O  O     . HOH H 6 .   ? -14.623 -0.217  1.602   1.00 48.94 ? 193 HOH A O     1 
HETATM 2865 O  O     . HOH H 6 .   ? -37.726 2.956   22.769  1.00 42.14 ? 194 HOH A O     1 
HETATM 2866 O  O     . HOH H 6 .   ? -32.535 0.305   16.929  1.00 25.13 ? 195 HOH A O     1 
HETATM 2867 O  O     . HOH H 6 .   ? -26.620 -23.863 18.324  1.00 18.95 ? 196 HOH A O     1 
HETATM 2868 O  O     . HOH H 6 .   ? -14.002 -11.676 19.708  1.00 16.92 ? 197 HOH A O     1 
HETATM 2869 O  O     . HOH H 6 .   ? -27.591 -6.186  6.759   1.00 21.84 ? 198 HOH A O     1 
HETATM 2870 O  O     . HOH H 6 .   ? -21.432 -18.804 15.519  1.00 18.37 ? 199 HOH A O     1 
HETATM 2871 O  O     . HOH H 6 .   ? -23.600 4.436   27.027  1.00 26.96 ? 200 HOH A O     1 
HETATM 2872 O  O     . HOH H 6 .   ? -16.152 5.361   25.408  1.00 26.16 ? 203 HOH A O     1 
HETATM 2873 O  O     . HOH H 6 .   ? -41.401 -4.155  12.719  1.00 26.38 ? 204 HOH A O     1 
HETATM 2874 O  O     . HOH H 6 .   ? -16.608 -9.282  32.474  1.00 21.51 ? 205 HOH A O     1 
HETATM 2875 O  O     . HOH H 6 .   ? -15.577 -7.373  33.161  1.00 29.61 ? 206 HOH A O     1 
HETATM 2876 O  O     . HOH H 6 .   ? -20.447 9.423   30.389  1.00 20.22 ? 207 HOH A O     1 
HETATM 2877 O  O     . HOH H 6 .   ? -22.544 -21.960 19.991  1.00 34.12 ? 208 HOH A O     1 
HETATM 2878 O  O     . HOH H 6 .   ? -25.972 -3.767  33.886  1.00 29.57 ? 209 HOH A O     1 
HETATM 2879 O  O     . HOH H 6 .   ? -10.212 -10.991 2.429   1.00 38.76 ? 210 HOH A O     1 
HETATM 2880 O  O     . HOH H 6 .   ? -28.983 0.605   6.590   1.00 28.52 ? 211 HOH A O     1 
HETATM 2881 O  O     . HOH H 6 .   ? -24.339 -23.367 4.941   1.00 26.56 ? 212 HOH A O     1 
HETATM 2882 O  O     . HOH H 6 .   ? -23.454 -10.277 34.656  1.00 35.59 ? 213 HOH A O     1 
HETATM 2883 O  O     . HOH H 6 .   ? -28.447 -0.824  0.891   1.00 39.65 ? 214 HOH A O     1 
HETATM 2884 O  O     . HOH H 6 .   ? -34.624 4.591   22.642  1.00 42.58 ? 215 HOH A O     1 
HETATM 2885 O  O     . HOH H 6 .   ? -29.334 8.905   19.697  1.00 38.70 ? 216 HOH A O     1 
HETATM 2886 O  O     . HOH H 6 .   ? -26.733 8.561   19.756  1.00 36.72 ? 217 HOH A O     1 
HETATM 2887 O  O     . HOH H 6 .   ? -24.685 9.605   23.995  1.00 29.25 ? 218 HOH A O     1 
HETATM 2888 O  O     . HOH H 6 .   ? -31.227 -15.986 27.236  1.00 24.90 ? 219 HOH A O     1 
HETATM 2889 O  O     . HOH H 6 .   ? -35.231 -17.247 24.990  1.00 35.82 ? 220 HOH A O     1 
HETATM 2890 O  O     . HOH H 6 .   ? -26.168 9.659   14.010  1.00 35.71 ? 221 HOH A O     1 
HETATM 2891 O  O     . HOH H 6 .   ? -21.234 11.649  21.907  1.00 30.26 ? 222 HOH A O     1 
HETATM 2892 O  O     . HOH H 6 .   ? -31.440 -10.313 5.142   1.00 25.71 ? 223 HOH A O     1 
HETATM 2893 O  O     . HOH H 6 .   ? -42.166 -9.051  19.151  1.00 17.96 ? 224 HOH A O     1 
HETATM 2894 O  O     . HOH H 6 .   ? -20.531 -18.988 2.861   1.00 23.81 ? 225 HOH A O     1 
HETATM 2895 O  O     . HOH H 6 .   ? -32.671 6.223   32.743  1.00 31.18 ? 226 HOH A O     1 
HETATM 2896 O  O     . HOH H 6 .   ? -20.823 -20.934 19.304  1.00 33.93 ? 227 HOH A O     1 
HETATM 2897 O  O     . HOH H 6 .   ? -31.653 2.168   24.505  1.00 32.57 ? 228 HOH A O     1 
HETATM 2898 O  O     . HOH H 6 .   ? -33.913 2.619   17.689  1.00 34.47 ? 229 HOH A O     1 
HETATM 2899 O  O     . HOH H 6 .   ? -28.711 -8.794  4.761   1.00 35.73 ? 230 HOH A O     1 
HETATM 2900 O  O     . HOH H 6 .   ? -27.940 4.782   34.049  1.00 26.94 ? 231 HOH A O     1 
HETATM 2901 O  O     . HOH H 6 .   ? -29.136 2.903   35.665  1.00 45.47 ? 232 HOH A O     1 
HETATM 2902 O  O     . HOH H 6 .   ? -20.574 -2.160  38.349  1.00 30.84 ? 233 HOH A O     1 
HETATM 2903 O  O     . HOH H 6 .   ? -24.489 -3.034  37.665  1.00 41.88 ? 234 HOH A O     1 
HETATM 2904 O  O     . HOH H 6 .   ? -12.081 -15.460 15.027  1.00 34.89 ? 235 HOH A O     1 
HETATM 2905 O  O     . HOH H 6 .   ? -22.630 -24.680 12.733  1.00 32.94 ? 236 HOH A O     1 
HETATM 2906 O  O     . HOH H 6 .   ? -25.538 9.916   21.813  1.00 30.49 ? 237 HOH A O     1 
HETATM 2907 O  O     . HOH H 6 .   ? -21.084 -19.274 28.709  1.00 25.59 ? 238 HOH A O     1 
HETATM 2908 O  O     . HOH H 6 .   ? -10.754 3.536   7.444   1.00 41.52 ? 239 HOH A O     1 
HETATM 2909 O  O     . HOH H 6 .   ? -27.444 -28.777 7.223   1.00 22.45 ? 240 HOH A O     1 
HETATM 2910 O  O     . HOH H 6 .   ? -29.498 -7.995  2.479   1.00 40.88 ? 241 HOH A O     1 
HETATM 2911 O  O     . HOH H 6 .   ? -20.576 12.408  19.098  1.00 29.99 ? 242 HOH A O     1 
HETATM 2912 O  O     . HOH H 6 .   ? -17.006 13.144  19.728  1.00 38.78 ? 243 HOH A O     1 
HETATM 2913 O  O     . HOH H 6 .   ? -18.633 22.777  10.978  1.00 48.49 ? 244 HOH A O     1 
HETATM 2914 O  O     . HOH H 6 .   ? -37.963 -21.282 14.730  1.00 37.54 ? 245 HOH A O     1 
HETATM 2915 O  O     . HOH H 6 .   ? -26.468 -15.124 1.545   1.00 40.51 ? 246 HOH A O     1 
HETATM 2916 O  O     . HOH H 6 .   ? -27.281 -19.450 27.636  1.00 38.14 ? 247 HOH A O     1 
HETATM 2917 O  O     . HOH H 6 .   ? -34.144 8.819   19.883  1.00 41.45 ? 248 HOH A O     1 
HETATM 2918 O  O     . HOH H 6 .   ? -20.826 15.271  15.771  1.00 35.38 ? 249 HOH A O     1 
HETATM 2919 O  O     . HOH H 6 .   ? -17.954 -14.585 24.571  1.00 30.98 ? 250 HOH A O     1 
HETATM 2920 O  O     . HOH H 6 .   ? -39.556 -18.933 14.399  1.00 34.49 ? 251 HOH A O     1 
HETATM 2921 O  O     . HOH H 6 .   ? -35.814 -6.135  9.425   1.00 33.60 ? 252 HOH A O     1 
HETATM 2922 O  O     . HOH H 6 .   ? -35.896 -3.377  11.732  1.00 30.00 ? 253 HOH A O     1 
HETATM 2923 O  O     . HOH H 6 .   ? -12.886 -10.602 27.162  1.00 30.18 ? 254 HOH A O     1 
HETATM 2924 O  O     . HOH H 6 .   ? -31.836 -12.696 5.715   1.00 24.73 ? 255 HOH A O     1 
HETATM 2925 O  O     . HOH H 6 .   ? -23.413 -10.736 30.829  1.00 33.34 ? 256 HOH A O     1 
HETATM 2926 O  O     . HOH H 6 .   ? -20.442 -21.824 22.489  1.00 39.59 ? 257 HOH A O     1 
HETATM 2927 O  O     . HOH H 6 .   ? -23.886 -12.539 36.104  1.00 37.54 ? 258 HOH A O     1 
HETATM 2928 O  O     . HOH H 6 .   ? -13.896 -9.515  7.870   1.00 20.41 ? 259 HOH A O     1 
HETATM 2929 O  O     . HOH H 6 .   ? -39.352 -22.051 13.000  1.00 34.50 ? 260 HOH A O     1 
HETATM 2930 O  O     . HOH H 6 .   ? -21.249 -21.404 12.591  1.00 28.75 ? 261 HOH A O     1 
HETATM 2931 O  O     . HOH H 6 .   ? -38.324 -13.899 19.150  1.00 19.53 ? 262 HOH A O     1 
HETATM 2932 O  O     . HOH H 6 .   ? -10.487 -9.392  27.277  1.00 30.06 ? 263 HOH A O     1 
HETATM 2933 O  O     . HOH H 6 .   ? -25.331 -23.240 20.574  1.00 31.65 ? 264 HOH A O     1 
HETATM 2934 O  O     . HOH H 6 .   ? -18.915 -6.369  -2.382  1.00 28.58 ? 265 HOH A O     1 
HETATM 2935 O  O     . HOH H 6 .   ? -37.063 -4.282  13.706  1.00 31.23 ? 266 HOH A O     1 
HETATM 2936 O  O     . HOH H 6 .   ? -37.037 -15.558 21.109  1.00 28.66 ? 267 HOH A O     1 
HETATM 2937 O  O     . HOH H 6 .   ? -16.290 -1.330  2.952   1.00 36.35 ? 268 HOH A O     1 
HETATM 2938 O  O     . HOH H 6 .   ? -14.013 -18.478 8.323   1.00 28.59 ? 269 HOH A O     1 
HETATM 2939 O  O     . HOH H 6 .   ? -22.008 -3.981  36.886  1.00 24.39 ? 270 HOH A O     1 
HETATM 2940 O  O     . HOH H 6 .   ? -30.129 -9.677  31.400  1.00 23.03 ? 271 HOH A O     1 
HETATM 2941 O  O     . HOH H 6 .   ? -14.020 -5.424  25.118  1.00 33.56 ? 272 HOH A O     1 
HETATM 2942 O  O     . HOH H 6 .   ? -13.817 -15.436 17.871  1.00 24.58 ? 273 HOH A O     1 
HETATM 2943 O  O     . HOH H 6 .   ? -9.045  -5.687  25.321  1.00 33.16 ? 274 HOH A O     1 
HETATM 2944 O  O     . HOH H 6 .   ? -21.409 6.009   1.293   1.00 30.38 ? 275 HOH A O     1 
HETATM 2945 O  O     . HOH H 6 .   ? -29.012 -5.628  4.715   1.00 30.76 ? 276 HOH A O     1 
HETATM 2946 O  O     . HOH H 6 .   ? -25.271 -5.837  34.859  1.00 28.41 ? 277 HOH A O     1 
HETATM 2947 O  O     . HOH H 6 .   ? -33.093 -5.196  32.097  1.00 39.64 ? 278 HOH A O     1 
HETATM 2948 O  O     . HOH H 6 .   ? -26.957 -13.216 33.775  1.00 39.97 ? 279 HOH A O     1 
HETATM 2949 O  O     . HOH H 6 .   ? -19.093 10.122  20.520  1.00 33.46 ? 280 HOH A O     1 
HETATM 2950 O  O     . HOH H 6 .   ? -36.893 -17.897 19.680  1.00 36.28 ? 281 HOH A O     1 
HETATM 2951 O  O     . HOH H 6 .   ? -34.387 -20.504 19.599  1.00 29.01 ? 282 HOH A O     1 
HETATM 2952 O  O     . HOH H 6 .   ? -40.381 -12.580 9.301   1.00 37.87 ? 283 HOH A O     1 
HETATM 2953 O  O     . HOH H 6 .   ? -21.503 -15.143 0.460   1.00 37.51 ? 284 HOH A O     1 
HETATM 2954 O  O     . HOH H 6 .   ? -30.843 -8.257  33.748  1.00 41.77 ? 285 HOH A O     1 
HETATM 2955 O  O     . HOH H 6 .   ? -13.024 -13.000 25.360  1.00 33.58 ? 286 HOH A O     1 
HETATM 2956 O  O     . HOH H 6 .   ? -41.334 -2.659  17.615  1.00 36.76 ? 287 HOH A O     1 
HETATM 2957 O  O     . HOH H 6 .   ? -32.897 1.411   19.821  1.00 40.73 ? 288 HOH A O     1 
HETATM 2958 O  O     . HOH H 6 .   ? -18.489 -19.236 11.003  1.00 32.78 ? 289 HOH A O     1 
HETATM 2959 O  O     . HOH H 6 .   ? -15.658 -19.976 11.582  1.00 43.86 ? 290 HOH A O     1 
HETATM 2960 O  O     . HOH H 6 .   ? -42.620 -11.438 20.501  1.00 40.46 ? 291 HOH A O     1 
HETATM 2961 O  O     . HOH H 6 .   ? -39.846 -12.165 20.804  1.00 31.29 ? 292 HOH A O     1 
HETATM 2962 O  O     . HOH H 6 .   ? -38.777 -2.624  12.975  1.00 40.23 ? 293 HOH A O     1 
HETATM 2963 O  O     . HOH H 6 .   ? -16.400 -12.208 0.550   1.00 37.37 ? 294 HOH A O     1 
HETATM 2964 O  O     . HOH H 6 .   ? -31.544 -0.670  7.035   1.00 35.55 ? 295 HOH A O     1 
HETATM 2965 O  O     . HOH H 6 .   ? -15.843 -13.374 26.115  1.00 38.22 ? 296 HOH A O     1 
HETATM 2966 O  O     . HOH H 6 .   ? -35.966 13.354  23.898  1.00 31.52 ? 297 HOH A O     1 
HETATM 2967 O  O     . HOH H 6 .   ? -14.620 -9.962  1.257   1.00 32.51 ? 298 HOH A O     1 
HETATM 2968 O  O     . HOH H 6 .   ? -14.299 3.914   23.596  1.00 29.50 ? 299 HOH A O     1 
HETATM 2969 O  O     . HOH I 6 .   ? -52.448 -33.195 17.427  1.00 41.23 ? 170 HOH B O     1 
HETATM 2970 O  O     . HOH I 6 .   ? -40.030 -19.084 11.042  1.00 10.44 ? 171 HOH B O     1 
HETATM 2971 O  O     . HOH I 6 .   ? -48.863 -4.054  21.633  1.00 42.34 ? 172 HOH B O     1 
HETATM 2972 O  O     . HOH I 6 .   ? -48.307 -32.901 -2.555  1.00 29.62 ? 173 HOH B O     1 
HETATM 2973 O  O     . HOH I 6 .   ? -58.833 -22.395 2.601   1.00 20.39 ? 174 HOH B O     1 
HETATM 2974 O  O     . HOH I 6 .   ? -40.444 -15.503 17.837  1.00 18.82 ? 175 HOH B O     1 
HETATM 2975 O  O     . HOH I 6 .   ? -42.028 -19.213 13.216  1.00 37.04 ? 176 HOH B O     1 
HETATM 2976 O  O     . HOH I 6 .   ? -40.368 -29.372 -7.965  1.00 17.03 ? 177 HOH B O     1 
HETATM 2977 O  O     . HOH I 6 .   ? -42.197 -7.103  9.007   1.00 20.67 ? 180 HOH B O     1 
HETATM 2978 O  O     . HOH I 6 .   ? -45.810 -0.983  12.053  1.00 36.91 ? 181 HOH B O     1 
HETATM 2979 O  O     . HOH I 6 .   ? -46.313 -1.092  14.426  1.00 44.02 ? 182 HOH B O     1 
HETATM 2980 O  O     . HOH I 6 .   ? -42.379 -14.240 16.307  1.00 18.83 ? 183 HOH B O     1 
HETATM 2981 O  O     . HOH I 6 .   ? -48.542 -1.275  14.788  1.00 47.66 ? 184 HOH B O     1 
HETATM 2982 O  O     . HOH I 6 .   ? -38.647 -16.870 9.708   1.00 16.22 ? 185 HOH B O     1 
HETATM 2983 O  O     . HOH I 6 .   ? -31.693 -25.472 1.175   1.00 35.46 ? 186 HOH B O     1 
HETATM 2984 O  O     . HOH I 6 .   ? -39.769 -24.438 4.055   1.00 16.05 ? 187 HOH B O     1 
HETATM 2985 O  O     . HOH I 6 .   ? -66.110 -22.374 2.126   1.00 32.89 ? 188 HOH B O     1 
HETATM 2986 O  O     . HOH I 6 .   ? -45.764 -36.759 3.953   1.00 17.46 ? 189 HOH B O     1 
HETATM 2987 O  O     . HOH I 6 .   ? -40.763 -28.745 -12.818 1.00 29.71 ? 190 HOH B O     1 
HETATM 2988 O  O     . HOH I 6 .   ? -50.253 -33.035 -4.445  1.00 21.34 ? 191 HOH B O     1 
HETATM 2989 O  O     . HOH I 6 .   ? -49.426 -23.729 -1.870  1.00 17.24 ? 192 HOH B O     1 
HETATM 2990 O  O     . HOH I 6 .   ? -57.501 -24.944 13.170  1.00 21.47 ? 193 HOH B O     1 
HETATM 2991 O  O     . HOH I 6 .   ? -66.039 -14.982 2.384   1.00 28.84 ? 194 HOH B O     1 
HETATM 2992 O  O     . HOH I 6 .   ? -60.281 -26.354 -4.288  1.00 40.49 ? 195 HOH B O     1 
HETATM 2993 O  O     . HOH I 6 .   ? -55.961 -20.082 -2.835  1.00 23.45 ? 196 HOH B O     1 
HETATM 2994 O  O     . HOH I 6 .   ? -50.879 -32.500 -0.587  1.00 30.05 ? 197 HOH B O     1 
HETATM 2995 O  O     . HOH I 6 .   ? -60.110 -23.156 -6.718  1.00 36.68 ? 198 HOH B O     1 
HETATM 2996 O  O     . HOH I 6 .   ? -59.525 -23.971 -9.387  1.00 46.36 ? 199 HOH B O     1 
HETATM 2997 O  O     . HOH I 6 .   ? -46.913 -29.491 17.433  1.00 29.52 ? 200 HOH B O     1 
HETATM 2998 O  O     . HOH I 6 .   ? -43.340 -35.972 11.707  1.00 26.89 ? 201 HOH B O     1 
HETATM 2999 O  O     . HOH I 6 .   ? -37.082 -32.530 9.696   1.00 21.52 ? 202 HOH B O     1 
HETATM 3000 O  O     . HOH I 6 .   ? -55.257 -5.727  -3.733  1.00 34.29 ? 203 HOH B O     1 
HETATM 3001 O  O     . HOH I 6 .   ? -51.906 -2.021  2.154   1.00 45.75 ? 204 HOH B O     1 
HETATM 3002 O  O     . HOH I 6 .   ? -51.267 -32.762 6.856   1.00 26.46 ? 205 HOH B O     1 
HETATM 3003 O  O     . HOH I 6 .   ? -35.980 -21.491 -3.140  1.00 16.74 ? 206 HOH B O     1 
HETATM 3004 O  O     . HOH I 6 .   ? -44.551 -5.964  17.453  1.00 24.96 ? 207 HOH B O     1 
HETATM 3005 O  O     . HOH I 6 .   ? -50.274 -35.956 8.928   1.00 31.30 ? 208 HOH B O     1 
HETATM 3006 O  O     . HOH I 6 .   ? -36.687 -11.734 4.576   1.00 42.71 ? 209 HOH B O     1 
HETATM 3007 O  O     . HOH I 6 .   ? -48.923 -35.802 6.367   1.00 28.61 ? 210 HOH B O     1 
HETATM 3008 O  O     . HOH I 6 .   ? -66.154 -20.461 12.415  1.00 42.38 ? 211 HOH B O     1 
HETATM 3009 O  O     . HOH I 6 .   ? -50.322 -14.771 22.331  1.00 42.80 ? 212 HOH B O     1 
HETATM 3010 O  O     . HOH I 6 .   ? -48.079 -21.906 20.554  1.00 33.29 ? 213 HOH B O     1 
HETATM 3011 O  O     . HOH I 6 .   ? -43.440 -8.464  16.887  1.00 21.18 ? 214 HOH B O     1 
HETATM 3012 O  O     . HOH I 6 .   ? -60.845 -25.775 -1.550  1.00 28.34 ? 215 HOH B O     1 
HETATM 3013 O  O     . HOH I 6 .   ? -41.568 -17.314 -8.038  1.00 25.02 ? 216 HOH B O     1 
HETATM 3014 O  O     . HOH I 6 .   ? -51.289 -3.165  8.331   1.00 37.73 ? 217 HOH B O     1 
HETATM 3015 O  O     . HOH I 6 .   ? -34.639 -26.658 6.711   1.00 28.20 ? 218 HOH B O     1 
HETATM 3016 O  O     . HOH I 6 .   ? -32.510 -24.592 5.467   1.00 19.05 ? 219 HOH B O     1 
HETATM 3017 O  O     . HOH I 6 .   ? -49.629 -30.845 2.830   1.00 17.93 ? 220 HOH B O     1 
HETATM 3018 O  O     . HOH I 6 .   ? -44.700 -35.186 13.501  1.00 37.48 ? 221 HOH B O     1 
HETATM 3019 O  O     . HOH I 6 .   ? -60.400 -21.997 -11.655 1.00 42.53 ? 222 HOH B O     1 
HETATM 3020 O  O     . HOH I 6 .   ? -52.595 -30.729 -18.350 1.00 33.54 ? 223 HOH B O     1 
HETATM 3021 O  O     . HOH I 6 .   ? -55.580 -16.000 -13.664 1.00 41.42 ? 224 HOH B O     1 
HETATM 3022 O  O     . HOH I 6 .   ? -44.585 -38.251 10.616  1.00 37.33 ? 225 HOH B O     1 
HETATM 3023 O  O     . HOH I 6 .   ? -40.545 -18.317 18.191  1.00 41.07 ? 226 HOH B O     1 
HETATM 3024 O  O     . HOH I 6 .   ? -44.075 -7.485  1.885   1.00 24.32 ? 227 HOH B O     1 
HETATM 3025 O  O     . HOH I 6 .   ? -45.629 -5.919  -7.411  1.00 41.52 ? 228 HOH B O     1 
HETATM 3026 O  O     . HOH I 6 .   ? -68.242 -15.195 3.982   1.00 40.00 ? 229 HOH B O     1 
HETATM 3027 O  O     . HOH I 6 .   ? -52.611 -0.890  3.948   1.00 42.62 ? 230 HOH B O     1 
HETATM 3028 O  O     . HOH I 6 .   ? -66.189 -25.375 3.103   1.00 45.35 ? 231 HOH B O     1 
HETATM 3029 O  O     . HOH I 6 .   ? -43.915 -13.015 18.108  1.00 25.89 ? 232 HOH B O     1 
HETATM 3030 O  O     . HOH I 6 .   ? -38.541 -12.636 6.339   1.00 33.72 ? 233 HOH B O     1 
HETATM 3031 O  O     . HOH I 6 .   ? -51.238 -24.334 20.286  1.00 30.39 ? 234 HOH B O     1 
HETATM 3032 O  O     . HOH I 6 .   ? -48.287 -37.436 10.365  1.00 30.16 ? 235 HOH B O     1 
HETATM 3033 O  O     . HOH I 6 .   ? -61.793 -19.011 -3.068  1.00 31.00 ? 236 HOH B O     1 
HETATM 3034 O  O     . HOH I 6 .   ? -43.926 -16.137 -8.834  1.00 29.88 ? 237 HOH B O     1 
HETATM 3035 O  O     . HOH I 6 .   ? -31.160 -23.798 -0.932  1.00 41.16 ? 238 HOH B O     1 
HETATM 3036 O  O     . HOH I 6 .   ? -40.913 -24.429 -9.625  1.00 29.71 ? 239 HOH B O     1 
HETATM 3037 O  O     . HOH I 6 .   ? -45.433 -5.812  -2.816  1.00 51.86 ? 240 HOH B O     1 
HETATM 3038 O  O     . HOH I 6 .   ? -52.462 -29.840 -10.306 1.00 28.40 ? 241 HOH B O     1 
HETATM 3039 O  O     . HOH I 6 .   ? -61.753 -13.677 -12.545 1.00 43.54 ? 242 HOH B O     1 
HETATM 3040 O  O     . HOH I 6 .   ? -53.502 -31.401 -2.045  1.00 31.42 ? 243 HOH B O     1 
HETATM 3041 O  O     . HOH I 6 .   ? -34.353 -28.129 -4.254  1.00 22.89 ? 244 HOH B O     1 
HETATM 3042 O  O     . HOH I 6 .   ? -49.883 -9.692  18.918  1.00 45.97 ? 245 HOH B O     1 
HETATM 3043 O  O     . HOH I 6 .   ? -39.402 -15.337 -7.589  1.00 26.39 ? 246 HOH B O     1 
HETATM 3044 O  O     . HOH I 6 .   ? -45.031 -19.158 -12.952 1.00 37.14 ? 247 HOH B O     1 
HETATM 3045 O  O     . HOH I 6 .   ? -43.594 -35.615 2.668   1.00 20.89 ? 248 HOH B O     1 
HETATM 3046 O  O     . HOH I 6 .   ? -54.018 -17.219 -15.269 1.00 46.84 ? 249 HOH B O     1 
HETATM 3047 O  O     . HOH I 6 .   ? -54.491 -15.041 20.243  1.00 48.59 ? 250 HOH B O     1 
HETATM 3048 O  O     . HOH I 6 .   ? -57.162 -17.756 21.063  1.00 46.11 ? 251 HOH B O     1 
HETATM 3049 O  O     . HOH I 6 .   ? -31.725 -16.533 1.369   1.00 42.71 ? 252 HOH B O     1 
HETATM 3050 O  O     . HOH I 6 .   ? -43.508 -18.182 15.092  1.00 31.33 ? 253 HOH B O     1 
HETATM 3051 O  O     . HOH I 6 .   ? -43.486 -23.233 -10.124 1.00 25.24 ? 254 HOH B O     1 
HETATM 3052 O  O     . HOH I 6 .   ? -48.093 -12.299 20.180  1.00 38.91 ? 255 HOH B O     1 
HETATM 3053 O  O     . HOH I 6 .   ? -50.703 -29.903 0.343   1.00 22.14 ? 256 HOH B O     1 
HETATM 3054 O  O     . HOH I 6 .   ? -55.883 -11.159 19.136  1.00 30.99 ? 257 HOH B O     1 
HETATM 3055 O  O     . HOH I 6 .   ? -33.441 -14.626 -3.083  1.00 27.46 ? 258 HOH B O     1 
HETATM 3056 O  O     . HOH I 6 .   ? -49.355 -33.314 2.011   1.00 40.93 ? 259 HOH B O     1 
HETATM 3057 O  O     . HOH I 6 .   ? -48.785 -33.313 5.201   1.00 24.07 ? 260 HOH B O     1 
HETATM 3058 O  O     . HOH I 6 .   ? -30.207 -17.272 4.997   1.00 19.75 ? 261 HOH B O     1 
HETATM 3059 O  O     . HOH I 6 .   ? -60.071 -26.143 4.303   1.00 18.77 ? 262 HOH B O     1 
HETATM 3060 O  O     . HOH I 6 .   ? -53.987 3.370   8.561   1.00 40.27 ? 263 HOH B O     1 
HETATM 3061 O  O     . HOH I 6 .   ? -43.524 -3.664  16.049  1.00 29.29 ? 264 HOH B O     1 
HETATM 3062 O  O     . HOH I 6 .   ? -47.401 -17.685 -12.634 1.00 29.30 ? 265 HOH B O     1 
HETATM 3063 O  O     . HOH I 6 .   ? -43.868 -9.810  -4.674  1.00 26.00 ? 266 HOH B O     1 
HETATM 3064 O  O     . HOH I 6 .   ? -62.849 -22.056 5.307   1.00 34.56 ? 267 HOH B O     1 
HETATM 3065 O  O     . HOH I 6 .   ? -41.912 -21.138 -10.762 1.00 27.41 ? 268 HOH B O     1 
HETATM 3066 O  O     . HOH I 6 .   ? -39.322 -24.706 11.599  1.00 27.10 ? 269 HOH B O     1 
HETATM 3067 O  O     . HOH I 6 .   ? -31.294 -20.516 6.085   1.00 26.82 ? 270 HOH B O     1 
HETATM 3068 O  O     . HOH I 6 .   ? -53.253 -32.921 3.982   1.00 32.33 ? 271 HOH B O     1 
HETATM 3069 O  O     . HOH I 6 .   ? -53.970 -9.268  20.728  1.00 38.62 ? 272 HOH B O     1 
HETATM 3070 O  O     . HOH I 6 .   ? -41.829 -22.305 16.415  1.00 30.15 ? 273 HOH B O     1 
HETATM 3071 O  O     . HOH I 6 .   ? -41.597 -28.356 -10.401 1.00 31.32 ? 274 HOH B O     1 
HETATM 3072 O  O     . HOH I 6 .   ? -27.955 -17.893 2.035   1.00 39.86 ? 275 HOH B O     1 
HETATM 3073 O  O     . HOH I 6 .   ? -40.549 -26.194 -11.164 1.00 35.12 ? 276 HOH B O     1 
HETATM 3074 O  O     . HOH I 6 .   ? -55.702 1.127   19.058  1.00 36.49 ? 277 HOH B O     1 
HETATM 3075 O  O     . HOH I 6 .   ? -59.325 -19.540 -4.688  1.00 26.09 ? 278 HOH B O     1 
HETATM 3076 O  O     . HOH I 6 .   ? -55.348 -17.093 18.857  1.00 25.10 ? 279 HOH B O     1 
HETATM 3077 O  O     . HOH I 6 .   ? -54.779 -25.981 19.331  1.00 38.08 ? 280 HOH B O     1 
HETATM 3078 O  O     . HOH I 6 .   ? -46.741 -6.243  19.478  1.00 42.64 ? 281 HOH B O     1 
HETATM 3079 O  O     . HOH I 6 .   ? -61.703 -7.770  -2.336  1.00 46.10 ? 282 HOH B O     1 
HETATM 3080 O  O     . HOH I 6 .   ? -51.954 -31.702 -8.118  1.00 37.03 ? 283 HOH B O     1 
HETATM 3081 O  O     . HOH I 6 .   ? -57.127 -27.414 19.485  1.00 30.27 ? 284 HOH B O     1 
HETATM 3082 O  O     . HOH I 6 .   ? -30.599 -25.738 3.756   1.00 30.88 ? 285 HOH B O     1 
HETATM 3083 O  O     . HOH I 6 .   ? -37.764 -10.492 2.241   1.00 41.97 ? 286 HOH B O     1 
HETATM 3084 O  O     . HOH I 6 .   ? -60.241 -20.672 -6.771  1.00 27.43 ? 287 HOH B O     1 
HETATM 3085 O  O     . HOH I 6 .   ? -36.081 -29.452 -0.737  1.00 24.18 ? 288 HOH B O     1 
HETATM 3086 O  O     . HOH I 6 .   ? -51.112 -34.286 10.851  1.00 37.91 ? 289 HOH B O     1 
HETATM 3087 O  O     . HOH I 6 .   ? -62.866 -14.984 17.220  1.00 36.39 ? 290 HOH B O     1 
HETATM 3088 O  O     . HOH I 6 .   ? -63.670 -25.267 -3.597  1.00 38.37 ? 291 HOH B O     1 
HETATM 3089 O  O     . HOH I 6 .   ? -29.987 -19.735 -0.975  1.00 41.30 ? 292 HOH B O     1 
HETATM 3090 O  O     . HOH I 6 .   ? -42.617 -2.479  14.298  1.00 38.08 ? 293 HOH B O     1 
HETATM 3091 O  O     . HOH I 6 .   ? -40.380 -29.721 10.011  1.00 28.65 ? 294 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   3   3   GLN GLN A . n 
A 1 2   SER 2   4   4   SER SER A . n 
A 1 3   LYS 3   5   5   LYS LYS A . n 
A 1 4   SER 4   6   6   SER SER A . n 
A 1 5   ARG 5   7   7   ARG ARG A . n 
A 1 6   LYS 6   8   8   LYS LYS A . n 
A 1 7   ILE 7   9   9   ILE ILE A . n 
A 1 8   ALA 8   10  10  ALA ALA A . n 
A 1 9   ILE 9   11  11  ILE ILE A . n 
A 1 10  LEU 10  12  12  LEU LEU A . n 
A 1 11  GLY 11  13  13  GLY GLY A . n 
A 1 12  TYR 12  14  14  TYR TYR A . n 
A 1 13  ARG 13  15  15  ARG ARG A . n 
A 1 14  SER 14  16  16  SER SER A . n 
A 1 15  VAL 15  17  17  VAL VAL A . n 
A 1 16  GLY 16  18  18  GLY GLY A . n 
A 1 17  LYS 17  19  19  LYS LYS A . n 
A 1 18  SER 18  20  20  SER SER A . n 
A 1 19  SER 19  21  21  SER SER A . n 
A 1 20  LEU 20  22  22  LEU LEU A . n 
A 1 21  THR 21  23  23  THR THR A . n 
A 1 22  ILE 22  24  24  ILE ILE A . n 
A 1 23  GLN 23  25  25  GLN GLN A . n 
A 1 24  PHE 24  26  26  PHE PHE A . n 
A 1 25  VAL 25  27  27  VAL VAL A . n 
A 1 26  GLU 26  28  28  GLU GLU A . n 
A 1 27  GLY 27  29  29  GLY GLY A . n 
A 1 28  GLN 28  30  30  GLN GLN A . n 
A 1 29  PHE 29  31  31  PHE PHE A . n 
A 1 30  VAL 30  32  32  VAL VAL A . n 
A 1 31  ASP 31  33  33  ASP ASP A . n 
A 1 32  SER 32  34  34  SER SER A . n 
A 1 33  ALA 33  35  35  ALA ALA A . n 
A 1 34  ASP 34  36  36  ASP ASP A . n 
A 1 35  PRO 35  37  37  PRO PRO A . n 
A 1 36  THR 36  38  38  THR THR A . n 
A 1 37  ILE 37  39  39  ILE ILE A . n 
A 1 38  GLU 38  40  40  GLU GLU A . n 
A 1 39  ASN 39  41  41  ASN ASN A . n 
A 1 40  THR 40  42  42  THR THR A . n 
A 1 41  PHE 41  43  43  PHE PHE A . n 
A 1 42  THR 42  44  44  THR THR A . n 
A 1 43  LYS 43  45  45  LYS LYS A . n 
A 1 44  LEU 44  46  46  LEU LEU A . n 
A 1 45  ILE 45  47  47  ILE ILE A . n 
A 1 46  THR 46  48  48  THR THR A . n 
A 1 47  VAL 47  49  49  VAL VAL A . n 
A 1 48  ASN 48  50  50  ASN ASN A . n 
A 1 49  GLY 49  51  51  GLY GLY A . n 
A 1 50  GLN 50  52  52  GLN GLN A . n 
A 1 51  GLU 51  53  53  GLU GLU A . n 
A 1 52  TYR 52  54  54  TYR TYR A . n 
A 1 53  HIS 53  55  55  HIS HIS A . n 
A 1 54  LEU 54  56  56  LEU LEU A . n 
A 1 55  GLN 55  57  57  GLN GLN A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  VAL 57  59  59  VAL VAL A . n 
A 1 58  ASP 58  60  60  ASP ASP A . n 
A 1 59  THR 59  61  61  THR THR A . n 
A 1 60  ALA 60  62  62  ALA ALA A . n 
A 1 61  GLY 61  63  63  GLY GLY A . n 
A 1 62  GLN 62  64  64  GLN GLN A . n 
A 1 63  ASP 63  65  65  ASP ASP A . n 
A 1 64  GLU 64  66  66  GLU GLU A . n 
A 1 65  TYR 65  67  67  TYR TYR A . n 
A 1 66  SER 66  68  68  SER SER A . n 
A 1 67  ILE 67  69  69  ILE ILE A . n 
A 1 68  PHE 68  70  70  PHE PHE A . n 
A 1 69  PRO 69  71  71  PRO PRO A . n 
A 1 70  GLN 70  72  72  GLN GLN A . n 
A 1 71  THR 71  73  73  THR THR A . n 
A 1 72  TYR 72  74  74  TYR TYR A . n 
A 1 73  SER 73  75  75  SER SER A . n 
A 1 74  ILE 74  76  76  ILE ILE A . n 
A 1 75  ASP 75  77  77  ASP ASP A . n 
A 1 76  ILE 76  78  78  ILE ILE A . n 
A 1 77  ASN 77  79  79  ASN ASN A . n 
A 1 78  GLY 78  80  80  GLY GLY A . n 
A 1 79  TYR 79  81  81  TYR TYR A . n 
A 1 80  ILE 80  82  82  ILE ILE A . n 
A 1 81  LEU 81  83  83  LEU LEU A . n 
A 1 82  VAL 82  84  84  VAL VAL A . n 
A 1 83  TYR 83  85  85  TYR TYR A . n 
A 1 84  SER 84  86  86  SER SER A . n 
A 1 85  VAL 85  87  87  VAL VAL A . n 
A 1 86  THR 86  88  88  THR THR A . n 
A 1 87  SER 87  89  89  SER SER A . n 
A 1 88  ILE 88  90  90  ILE ILE A . n 
A 1 89  LYS 89  91  91  LYS LYS A . n 
A 1 90  SER 90  92  92  SER SER A . n 
A 1 91  PHE 91  93  93  PHE PHE A . n 
A 1 92  GLU 92  94  94  GLU GLU A . n 
A 1 93  VAL 93  95  95  VAL VAL A . n 
A 1 94  ILE 94  96  96  ILE ILE A . n 
A 1 95  LYS 95  97  97  LYS LYS A . n 
A 1 96  VAL 96  98  98  VAL VAL A . n 
A 1 97  ILE 97  99  99  ILE ILE A . n 
A 1 98  HIS 98  100 100 HIS HIS A . n 
A 1 99  GLY 99  101 101 GLY GLY A . n 
A 1 100 LYS 100 102 102 LYS LYS A . n 
A 1 101 LEU 101 103 103 LEU LEU A . n 
A 1 102 LEU 102 104 104 LEU LEU A . n 
A 1 103 ASP 103 105 105 ASP ASP A . n 
A 1 104 MET 104 106 106 MET MET A . n 
A 1 105 VAL 105 107 107 VAL VAL A . n 
A 1 106 GLY 106 108 108 GLY GLY A . n 
A 1 107 LYS 107 109 109 LYS LYS A . n 
A 1 108 VAL 108 110 110 VAL VAL A . n 
A 1 109 GLN 109 111 111 GLN GLN A . n 
A 1 110 ILE 110 112 112 ILE ILE A . n 
A 1 111 PRO 111 113 113 PRO PRO A . n 
A 1 112 ILE 112 114 114 ILE ILE A . n 
A 1 113 MET 113 115 115 MET MET A . n 
A 1 114 LEU 114 116 116 LEU LEU A . n 
A 1 115 VAL 115 117 117 VAL VAL A . n 
A 1 116 GLY 116 118 118 GLY GLY A . n 
A 1 117 ASN 117 119 119 ASN ASN A . n 
A 1 118 LYS 118 120 120 LYS LYS A . n 
A 1 119 LYS 119 121 121 LYS LYS A . n 
A 1 120 ASP 120 122 122 ASP ASP A . n 
A 1 121 LEU 121 123 123 LEU LEU A . n 
A 1 122 HIS 122 124 124 HIS HIS A . n 
A 1 123 MET 123 125 125 MET MET A . n 
A 1 124 GLU 124 126 126 GLU GLU A . n 
A 1 125 ARG 125 127 127 ARG ARG A . n 
A 1 126 VAL 126 128 128 VAL VAL A . n 
A 1 127 ILE 127 129 129 ILE ILE A . n 
A 1 128 SER 128 130 130 SER SER A . n 
A 1 129 TYR 129 131 131 TYR TYR A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 GLU 131 133 133 GLU GLU A . n 
A 1 132 GLY 132 134 134 GLY GLY A . n 
A 1 133 LYS 133 135 135 LYS LYS A . n 
A 1 134 ALA 134 136 136 ALA ALA A . n 
A 1 135 LEU 135 137 137 LEU LEU A . n 
A 1 136 ALA 136 138 138 ALA ALA A . n 
A 1 137 GLU 137 139 139 GLU GLU A . n 
A 1 138 SER 138 140 140 SER SER A . n 
A 1 139 TRP 139 141 141 TRP TRP A . n 
A 1 140 ASN 140 142 142 ASN ASN A . n 
A 1 141 ALA 141 143 143 ALA ALA A . n 
A 1 142 ALA 142 144 144 ALA ALA A . n 
A 1 143 PHE 143 145 145 PHE PHE A . n 
A 1 144 LEU 144 146 146 LEU LEU A . n 
A 1 145 GLU 145 147 147 GLU GLU A . n 
A 1 146 SER 146 148 148 SER SER A . n 
A 1 147 SER 147 149 149 SER SER A . n 
A 1 148 ALA 148 150 150 ALA ALA A . n 
A 1 149 LYS 149 151 151 LYS LYS A . n 
A 1 150 GLU 150 152 152 GLU GLU A . n 
A 1 151 ASN 151 153 153 ASN ASN A . n 
A 1 152 GLN 152 154 154 GLN GLN A . n 
A 1 153 THR 153 155 155 THR THR A . n 
A 1 154 ALA 154 156 156 ALA ALA A . n 
A 1 155 VAL 155 157 157 VAL VAL A . n 
A 1 156 ASP 156 158 158 ASP ASP A . n 
A 1 157 VAL 157 159 159 VAL VAL A . n 
A 1 158 PHE 158 160 160 PHE PHE A . n 
A 1 159 ARG 159 161 161 ARG ARG A . n 
A 1 160 ARG 160 162 162 ARG ARG A . n 
A 1 161 ILE 161 163 163 ILE ILE A . n 
A 1 162 ILE 162 164 164 ILE ILE A . n 
A 1 163 LEU 163 165 165 LEU LEU A . n 
A 1 164 GLU 164 166 166 GLU GLU A . n 
A 1 165 ALA 165 167 167 ALA ALA A . n 
A 1 166 GLU 166 168 168 GLU GLU A . n 
A 1 167 LYS 167 169 169 LYS LYS A . n 
B 1 1   GLN 1   3   3   GLN GLN B . n 
B 1 2   SER 2   4   4   SER SER B . n 
B 1 3   LYS 3   5   5   LYS LYS B . n 
B 1 4   SER 4   6   6   SER SER B . n 
B 1 5   ARG 5   7   7   ARG ARG B . n 
B 1 6   LYS 6   8   8   LYS LYS B . n 
B 1 7   ILE 7   9   9   ILE ILE B . n 
B 1 8   ALA 8   10  10  ALA ALA B . n 
B 1 9   ILE 9   11  11  ILE ILE B . n 
B 1 10  LEU 10  12  12  LEU LEU B . n 
B 1 11  GLY 11  13  13  GLY GLY B . n 
B 1 12  TYR 12  14  14  TYR TYR B . n 
B 1 13  ARG 13  15  15  ARG ARG B . n 
B 1 14  SER 14  16  16  SER SER B . n 
B 1 15  VAL 15  17  17  VAL VAL B . n 
B 1 16  GLY 16  18  18  GLY GLY B . n 
B 1 17  LYS 17  19  19  LYS LYS B . n 
B 1 18  SER 18  20  20  SER SER B . n 
B 1 19  SER 19  21  21  SER SER B . n 
B 1 20  LEU 20  22  22  LEU LEU B . n 
B 1 21  THR 21  23  23  THR THR B . n 
B 1 22  ILE 22  24  24  ILE ILE B . n 
B 1 23  GLN 23  25  25  GLN GLN B . n 
B 1 24  PHE 24  26  26  PHE PHE B . n 
B 1 25  VAL 25  27  27  VAL VAL B . n 
B 1 26  GLU 26  28  28  GLU GLU B . n 
B 1 27  GLY 27  29  29  GLY GLY B . n 
B 1 28  GLN 28  30  30  GLN GLN B . n 
B 1 29  PHE 29  31  31  PHE PHE B . n 
B 1 30  VAL 30  32  32  VAL VAL B . n 
B 1 31  ASP 31  33  33  ASP ASP B . n 
B 1 32  SER 32  34  34  SER SER B . n 
B 1 33  ALA 33  35  35  ALA ALA B . n 
B 1 34  ASP 34  36  36  ASP ASP B . n 
B 1 35  PRO 35  37  37  PRO PRO B . n 
B 1 36  THR 36  38  38  THR THR B . n 
B 1 37  ILE 37  39  39  ILE ILE B . n 
B 1 38  GLU 38  40  40  GLU GLU B . n 
B 1 39  ASN 39  41  41  ASN ASN B . n 
B 1 40  THR 40  42  42  THR THR B . n 
B 1 41  PHE 41  43  43  PHE PHE B . n 
B 1 42  THR 42  44  44  THR THR B . n 
B 1 43  LYS 43  45  45  LYS LYS B . n 
B 1 44  LEU 44  46  46  LEU LEU B . n 
B 1 45  ILE 45  47  47  ILE ILE B . n 
B 1 46  THR 46  48  48  THR THR B . n 
B 1 47  VAL 47  49  49  VAL VAL B . n 
B 1 48  ASN 48  50  50  ASN ASN B . n 
B 1 49  GLY 49  51  51  GLY GLY B . n 
B 1 50  GLN 50  52  52  GLN GLN B . n 
B 1 51  GLU 51  53  53  GLU GLU B . n 
B 1 52  TYR 52  54  54  TYR TYR B . n 
B 1 53  HIS 53  55  55  HIS HIS B . n 
B 1 54  LEU 54  56  56  LEU LEU B . n 
B 1 55  GLN 55  57  57  GLN GLN B . n 
B 1 56  LEU 56  58  58  LEU LEU B . n 
B 1 57  VAL 57  59  59  VAL VAL B . n 
B 1 58  ASP 58  60  60  ASP ASP B . n 
B 1 59  THR 59  61  61  THR THR B . n 
B 1 60  ALA 60  62  62  ALA ALA B . n 
B 1 61  GLY 61  63  63  GLY GLY B . n 
B 1 62  GLN 62  64  64  GLN GLN B . n 
B 1 63  ASP 63  65  65  ASP ASP B . n 
B 1 64  GLU 64  66  66  GLU GLU B . n 
B 1 65  TYR 65  67  67  TYR TYR B . n 
B 1 66  SER 66  68  68  SER SER B . n 
B 1 67  ILE 67  69  69  ILE ILE B . n 
B 1 68  PHE 68  70  70  PHE PHE B . n 
B 1 69  PRO 69  71  71  PRO PRO B . n 
B 1 70  GLN 70  72  72  GLN GLN B . n 
B 1 71  THR 71  73  73  THR THR B . n 
B 1 72  TYR 72  74  74  TYR TYR B . n 
B 1 73  SER 73  75  75  SER SER B . n 
B 1 74  ILE 74  76  76  ILE ILE B . n 
B 1 75  ASP 75  77  77  ASP ASP B . n 
B 1 76  ILE 76  78  78  ILE ILE B . n 
B 1 77  ASN 77  79  79  ASN ASN B . n 
B 1 78  GLY 78  80  80  GLY GLY B . n 
B 1 79  TYR 79  81  81  TYR TYR B . n 
B 1 80  ILE 80  82  82  ILE ILE B . n 
B 1 81  LEU 81  83  83  LEU LEU B . n 
B 1 82  VAL 82  84  84  VAL VAL B . n 
B 1 83  TYR 83  85  85  TYR TYR B . n 
B 1 84  SER 84  86  86  SER SER B . n 
B 1 85  VAL 85  87  87  VAL VAL B . n 
B 1 86  THR 86  88  88  THR THR B . n 
B 1 87  SER 87  89  89  SER SER B . n 
B 1 88  ILE 88  90  90  ILE ILE B . n 
B 1 89  LYS 89  91  91  LYS LYS B . n 
B 1 90  SER 90  92  92  SER SER B . n 
B 1 91  PHE 91  93  93  PHE PHE B . n 
B 1 92  GLU 92  94  94  GLU GLU B . n 
B 1 93  VAL 93  95  95  VAL VAL B . n 
B 1 94  ILE 94  96  96  ILE ILE B . n 
B 1 95  LYS 95  97  97  LYS LYS B . n 
B 1 96  VAL 96  98  98  VAL VAL B . n 
B 1 97  ILE 97  99  99  ILE ILE B . n 
B 1 98  HIS 98  100 100 HIS HIS B . n 
B 1 99  GLY 99  101 101 GLY GLY B . n 
B 1 100 LYS 100 102 102 LYS LYS B . n 
B 1 101 LEU 101 103 103 LEU LEU B . n 
B 1 102 LEU 102 104 104 LEU LEU B . n 
B 1 103 ASP 103 105 105 ASP ASP B . n 
B 1 104 MET 104 106 106 MET MET B . n 
B 1 105 VAL 105 107 107 VAL VAL B . n 
B 1 106 GLY 106 108 108 GLY GLY B . n 
B 1 107 LYS 107 109 109 LYS LYS B . n 
B 1 108 VAL 108 110 110 VAL VAL B . n 
B 1 109 GLN 109 111 111 GLN GLN B . n 
B 1 110 ILE 110 112 112 ILE ILE B . n 
B 1 111 PRO 111 113 113 PRO PRO B . n 
B 1 112 ILE 112 114 114 ILE ILE B . n 
B 1 113 MET 113 115 115 MET MET B . n 
B 1 114 LEU 114 116 116 LEU LEU B . n 
B 1 115 VAL 115 117 117 VAL VAL B . n 
B 1 116 GLY 116 118 118 GLY GLY B . n 
B 1 117 ASN 117 119 119 ASN ASN B . n 
B 1 118 LYS 118 120 120 LYS LYS B . n 
B 1 119 LYS 119 121 121 LYS LYS B . n 
B 1 120 ASP 120 122 122 ASP ASP B . n 
B 1 121 LEU 121 123 123 LEU LEU B . n 
B 1 122 HIS 122 124 124 HIS HIS B . n 
B 1 123 MET 123 125 125 MET MET B . n 
B 1 124 GLU 124 126 126 GLU GLU B . n 
B 1 125 ARG 125 127 127 ARG ARG B . n 
B 1 126 VAL 126 128 128 VAL VAL B . n 
B 1 127 ILE 127 129 129 ILE ILE B . n 
B 1 128 SER 128 130 130 SER SER B . n 
B 1 129 TYR 129 131 131 TYR TYR B . n 
B 1 130 GLU 130 132 132 GLU GLU B . n 
B 1 131 GLU 131 133 133 GLU GLU B . n 
B 1 132 GLY 132 134 134 GLY GLY B . n 
B 1 133 LYS 133 135 135 LYS LYS B . n 
B 1 134 ALA 134 136 136 ALA ALA B . n 
B 1 135 LEU 135 137 137 LEU LEU B . n 
B 1 136 ALA 136 138 138 ALA ALA B . n 
B 1 137 GLU 137 139 139 GLU GLU B . n 
B 1 138 SER 138 140 140 SER SER B . n 
B 1 139 TRP 139 141 141 TRP TRP B . n 
B 1 140 ASN 140 142 142 ASN ASN B . n 
B 1 141 ALA 141 143 143 ALA ALA B . n 
B 1 142 ALA 142 144 144 ALA ALA B . n 
B 1 143 PHE 143 145 145 PHE PHE B . n 
B 1 144 LEU 144 146 146 LEU LEU B . n 
B 1 145 GLU 145 147 147 GLU GLU B . n 
B 1 146 SER 146 148 148 SER SER B . n 
B 1 147 SER 147 149 149 SER SER B . n 
B 1 148 ALA 148 150 150 ALA ALA B . n 
B 1 149 LYS 149 151 151 LYS LYS B . n 
B 1 150 GLU 150 152 152 GLU GLU B . n 
B 1 151 ASN 151 153 153 ASN ASN B . n 
B 1 152 GLN 152 154 154 GLN GLN B . n 
B 1 153 THR 153 155 155 THR THR B . n 
B 1 154 ALA 154 156 156 ALA ALA B . n 
B 1 155 VAL 155 157 157 VAL VAL B . n 
B 1 156 ASP 156 158 158 ASP ASP B . n 
B 1 157 VAL 157 159 159 VAL VAL B . n 
B 1 158 PHE 158 160 160 PHE PHE B . n 
B 1 159 ARG 159 161 161 ARG ARG B . n 
B 1 160 ARG 160 162 162 ARG ARG B . n 
B 1 161 ILE 161 163 163 ILE ILE B . n 
B 1 162 ILE 162 164 164 ILE ILE B . n 
B 1 163 LEU 163 165 165 LEU LEU B . n 
B 1 164 GLU 164 166 166 GLU GLU B . n 
B 1 165 ALA 165 167 167 ALA ALA B . n 
B 1 166 GLU 166 168 168 GLU GLU B . n 
B 1 167 LYS 167 169 169 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MG  1   202 202 MG  MG  A . 
D 3 GDP 1   201 201 GDP GDP A . 
E 2 MG  1   178 178 MG  MG  B . 
F 4 GNP 1   179 179 GNP GNP B . 
G 5 ACT 1   1   1   ACT ACT B . 
H 6 HOH 1   2   2   HOH HOH A . 
H 6 HOH 2   170 5   HOH HOH A . 
H 6 HOH 3   171 171 HOH HOH A . 
H 6 HOH 4   172 6   HOH HOH A . 
H 6 HOH 5   173 7   HOH HOH A . 
H 6 HOH 6   174 174 HOH HOH A . 
H 6 HOH 7   175 175 HOH HOH A . 
H 6 HOH 8   176 8   HOH HOH A . 
H 6 HOH 9   177 15  HOH HOH A . 
H 6 HOH 10  178 178 HOH HOH A . 
H 6 HOH 11  179 17  HOH HOH A . 
H 6 HOH 12  180 180 HOH HOH A . 
H 6 HOH 13  181 19  HOH HOH A . 
H 6 HOH 14  182 20  HOH HOH A . 
H 6 HOH 15  183 183 HOH HOH A . 
H 6 HOH 16  184 21  HOH HOH A . 
H 6 HOH 17  185 185 HOH HOH A . 
H 6 HOH 18  186 22  HOH HOH A . 
H 6 HOH 19  187 187 HOH HOH A . 
H 6 HOH 20  188 23  HOH HOH A . 
H 6 HOH 21  189 189 HOH HOH A . 
H 6 HOH 22  190 24  HOH HOH A . 
H 6 HOH 23  191 191 HOH HOH A . 
H 6 HOH 24  192 192 HOH HOH A . 
H 6 HOH 25  193 193 HOH HOH A . 
H 6 HOH 26  194 194 HOH HOH A . 
H 6 HOH 27  195 27  HOH HOH A . 
H 6 HOH 28  196 28  HOH HOH A . 
H 6 HOH 29  197 29  HOH HOH A . 
H 6 HOH 30  198 30  HOH HOH A . 
H 6 HOH 31  199 31  HOH HOH A . 
H 6 HOH 32  200 33  HOH HOH A . 
H 6 HOH 33  203 34  HOH HOH A . 
H 6 HOH 34  204 35  HOH HOH A . 
H 6 HOH 35  205 205 HOH HOH A . 
H 6 HOH 36  206 206 HOH HOH A . 
H 6 HOH 37  207 207 HOH HOH A . 
H 6 HOH 38  208 208 HOH HOH A . 
H 6 HOH 39  209 36  HOH HOH A . 
H 6 HOH 40  210 210 HOH HOH A . 
H 6 HOH 41  211 38  HOH HOH A . 
H 6 HOH 42  212 39  HOH HOH A . 
H 6 HOH 43  213 40  HOH HOH A . 
H 6 HOH 44  214 214 HOH HOH A . 
H 6 HOH 45  215 215 HOH HOH A . 
H 6 HOH 46  216 216 HOH HOH A . 
H 6 HOH 47  217 217 HOH HOH A . 
H 6 HOH 48  218 218 HOH HOH A . 
H 6 HOH 49  219 219 HOH HOH A . 
H 6 HOH 50  220 220 HOH HOH A . 
H 6 HOH 51  221 41  HOH HOH A . 
H 6 HOH 52  222 42  HOH HOH A . 
H 6 HOH 53  223 43  HOH HOH A . 
H 6 HOH 54  224 45  HOH HOH A . 
H 6 HOH 55  225 46  HOH HOH A . 
H 6 HOH 56  226 48  HOH HOH A . 
H 6 HOH 57  227 227 HOH HOH A . 
H 6 HOH 58  228 51  HOH HOH A . 
H 6 HOH 59  229 53  HOH HOH A . 
H 6 HOH 60  230 56  HOH HOH A . 
H 6 HOH 61  231 60  HOH HOH A . 
H 6 HOH 62  232 232 HOH HOH A . 
H 6 HOH 63  233 61  HOH HOH A . 
H 6 HOH 64  234 234 HOH HOH A . 
H 6 HOH 65  235 235 HOH HOH A . 
H 6 HOH 66  236 236 HOH HOH A . 
H 6 HOH 67  237 237 HOH HOH A . 
H 6 HOH 68  238 63  HOH HOH A . 
H 6 HOH 69  239 239 HOH HOH A . 
H 6 HOH 70  240 66  HOH HOH A . 
H 6 HOH 71  241 241 HOH HOH A . 
H 6 HOH 72  242 67  HOH HOH A . 
H 6 HOH 73  243 243 HOH HOH A . 
H 6 HOH 74  244 244 HOH HOH A . 
H 6 HOH 75  245 69  HOH HOH A . 
H 6 HOH 76  246 246 HOH HOH A . 
H 6 HOH 77  247 70  HOH HOH A . 
H 6 HOH 78  248 248 HOH HOH A . 
H 6 HOH 79  249 73  HOH HOH A . 
H 6 HOH 80  250 74  HOH HOH A . 
H 6 HOH 81  251 75  HOH HOH A . 
H 6 HOH 82  252 77  HOH HOH A . 
H 6 HOH 83  253 78  HOH HOH A . 
H 6 HOH 84  254 80  HOH HOH A . 
H 6 HOH 85  255 82  HOH HOH A . 
H 6 HOH 86  256 83  HOH HOH A . 
H 6 HOH 87  257 84  HOH HOH A . 
H 6 HOH 88  258 89  HOH HOH A . 
H 6 HOH 89  259 90  HOH HOH A . 
H 6 HOH 90  260 92  HOH HOH A . 
H 6 HOH 91  261 94  HOH HOH A . 
H 6 HOH 92  262 97  HOH HOH A . 
H 6 HOH 93  263 100 HOH HOH A . 
H 6 HOH 94  264 101 HOH HOH A . 
H 6 HOH 95  265 103 HOH HOH A . 
H 6 HOH 96  266 104 HOH HOH A . 
H 6 HOH 97  267 105 HOH HOH A . 
H 6 HOH 98  268 107 HOH HOH A . 
H 6 HOH 99  269 108 HOH HOH A . 
H 6 HOH 100 270 110 HOH HOH A . 
H 6 HOH 101 271 113 HOH HOH A . 
H 6 HOH 102 272 114 HOH HOH A . 
H 6 HOH 103 273 116 HOH HOH A . 
H 6 HOH 104 274 117 HOH HOH A . 
H 6 HOH 105 275 124 HOH HOH A . 
H 6 HOH 106 276 125 HOH HOH A . 
H 6 HOH 107 277 127 HOH HOH A . 
H 6 HOH 108 278 128 HOH HOH A . 
H 6 HOH 109 279 129 HOH HOH A . 
H 6 HOH 110 280 130 HOH HOH A . 
H 6 HOH 111 281 131 HOH HOH A . 
H 6 HOH 112 282 134 HOH HOH A . 
H 6 HOH 113 283 135 HOH HOH A . 
H 6 HOH 114 284 138 HOH HOH A . 
H 6 HOH 115 285 139 HOH HOH A . 
H 6 HOH 116 286 142 HOH HOH A . 
H 6 HOH 117 287 143 HOH HOH A . 
H 6 HOH 118 288 145 HOH HOH A . 
H 6 HOH 119 289 146 HOH HOH A . 
H 6 HOH 120 290 147 HOH HOH A . 
H 6 HOH 121 291 148 HOH HOH A . 
H 6 HOH 122 292 149 HOH HOH A . 
H 6 HOH 123 293 153 HOH HOH A . 
H 6 HOH 124 294 158 HOH HOH A . 
H 6 HOH 125 295 159 HOH HOH A . 
H 6 HOH 126 296 160 HOH HOH A . 
H 6 HOH 127 297 164 HOH HOH A . 
H 6 HOH 128 298 167 HOH HOH A . 
H 6 HOH 129 299 168 HOH HOH A . 
I 6 HOH 1   170 170 HOH HOH B . 
I 6 HOH 2   171 1   HOH HOH B . 
I 6 HOH 3   172 172 HOH HOH B . 
I 6 HOH 4   173 173 HOH HOH B . 
I 6 HOH 5   174 3   HOH HOH B . 
I 6 HOH 6   175 4   HOH HOH B . 
I 6 HOH 7   176 176 HOH HOH B . 
I 6 HOH 8   177 177 HOH HOH B . 
I 6 HOH 9   180 9   HOH HOH B . 
I 6 HOH 10  181 181 HOH HOH B . 
I 6 HOH 11  182 182 HOH HOH B . 
I 6 HOH 12  183 10  HOH HOH B . 
I 6 HOH 13  184 184 HOH HOH B . 
I 6 HOH 14  185 11  HOH HOH B . 
I 6 HOH 15  186 186 HOH HOH B . 
I 6 HOH 16  187 12  HOH HOH B . 
I 6 HOH 17  188 188 HOH HOH B . 
I 6 HOH 18  189 13  HOH HOH B . 
I 6 HOH 19  190 190 HOH HOH B . 
I 6 HOH 20  191 14  HOH HOH B . 
I 6 HOH 21  192 16  HOH HOH B . 
I 6 HOH 22  193 18  HOH HOH B . 
I 6 HOH 23  194 25  HOH HOH B . 
I 6 HOH 24  195 195 HOH HOH B . 
I 6 HOH 25  196 196 HOH HOH B . 
I 6 HOH 26  197 197 HOH HOH B . 
I 6 HOH 27  198 198 HOH HOH B . 
I 6 HOH 28  199 199 HOH HOH B . 
I 6 HOH 29  200 200 HOH HOH B . 
I 6 HOH 30  201 201 HOH HOH B . 
I 6 HOH 31  202 202 HOH HOH B . 
I 6 HOH 32  203 203 HOH HOH B . 
I 6 HOH 33  204 204 HOH HOH B . 
I 6 HOH 34  205 26  HOH HOH B . 
I 6 HOH 35  206 32  HOH HOH B . 
I 6 HOH 36  207 37  HOH HOH B . 
I 6 HOH 37  208 44  HOH HOH B . 
I 6 HOH 38  209 209 HOH HOH B . 
I 6 HOH 39  210 47  HOH HOH B . 
I 6 HOH 40  211 211 HOH HOH B . 
I 6 HOH 41  212 212 HOH HOH B . 
I 6 HOH 42  213 213 HOH HOH B . 
I 6 HOH 43  214 49  HOH HOH B . 
I 6 HOH 44  215 50  HOH HOH B . 
I 6 HOH 45  216 52  HOH HOH B . 
I 6 HOH 46  217 54  HOH HOH B . 
I 6 HOH 47  218 55  HOH HOH B . 
I 6 HOH 48  219 57  HOH HOH B . 
I 6 HOH 49  220 58  HOH HOH B . 
I 6 HOH 50  221 221 HOH HOH B . 
I 6 HOH 51  222 222 HOH HOH B . 
I 6 HOH 52  223 223 HOH HOH B . 
I 6 HOH 53  224 224 HOH HOH B . 
I 6 HOH 54  225 225 HOH HOH B . 
I 6 HOH 55  226 226 HOH HOH B . 
I 6 HOH 56  227 59  HOH HOH B . 
I 6 HOH 57  228 228 HOH HOH B . 
I 6 HOH 58  229 229 HOH HOH B . 
I 6 HOH 59  230 230 HOH HOH B . 
I 6 HOH 60  231 231 HOH HOH B . 
I 6 HOH 61  232 62  HOH HOH B . 
I 6 HOH 62  233 233 HOH HOH B . 
I 6 HOH 63  234 64  HOH HOH B . 
I 6 HOH 64  235 65  HOH HOH B . 
I 6 HOH 65  236 68  HOH HOH B . 
I 6 HOH 66  237 71  HOH HOH B . 
I 6 HOH 67  238 238 HOH HOH B . 
I 6 HOH 68  239 72  HOH HOH B . 
I 6 HOH 69  240 240 HOH HOH B . 
I 6 HOH 70  241 76  HOH HOH B . 
I 6 HOH 71  242 242 HOH HOH B . 
I 6 HOH 72  243 79  HOH HOH B . 
I 6 HOH 73  244 81  HOH HOH B . 
I 6 HOH 74  245 245 HOH HOH B . 
I 6 HOH 75  246 85  HOH HOH B . 
I 6 HOH 76  247 247 HOH HOH B . 
I 6 HOH 77  248 86  HOH HOH B . 
I 6 HOH 78  249 249 HOH HOH B . 
I 6 HOH 79  250 250 HOH HOH B . 
I 6 HOH 80  251 251 HOH HOH B . 
I 6 HOH 81  252 252 HOH HOH B . 
I 6 HOH 82  253 87  HOH HOH B . 
I 6 HOH 83  254 88  HOH HOH B . 
I 6 HOH 84  255 91  HOH HOH B . 
I 6 HOH 85  256 93  HOH HOH B . 
I 6 HOH 86  257 95  HOH HOH B . 
I 6 HOH 87  258 96  HOH HOH B . 
I 6 HOH 88  259 98  HOH HOH B . 
I 6 HOH 89  260 99  HOH HOH B . 
I 6 HOH 90  261 102 HOH HOH B . 
I 6 HOH 91  262 106 HOH HOH B . 
I 6 HOH 92  263 109 HOH HOH B . 
I 6 HOH 93  264 111 HOH HOH B . 
I 6 HOH 94  265 112 HOH HOH B . 
I 6 HOH 95  266 115 HOH HOH B . 
I 6 HOH 96  267 118 HOH HOH B . 
I 6 HOH 97  268 119 HOH HOH B . 
I 6 HOH 98  269 120 HOH HOH B . 
I 6 HOH 99  270 121 HOH HOH B . 
I 6 HOH 100 271 122 HOH HOH B . 
I 6 HOH 101 272 123 HOH HOH B . 
I 6 HOH 102 273 126 HOH HOH B . 
I 6 HOH 103 274 132 HOH HOH B . 
I 6 HOH 104 275 133 HOH HOH B . 
I 6 HOH 105 276 136 HOH HOH B . 
I 6 HOH 106 277 137 HOH HOH B . 
I 6 HOH 107 278 140 HOH HOH B . 
I 6 HOH 108 279 141 HOH HOH B . 
I 6 HOH 109 280 144 HOH HOH B . 
I 6 HOH 110 281 150 HOH HOH B . 
I 6 HOH 111 282 151 HOH HOH B . 
I 6 HOH 112 283 152 HOH HOH B . 
I 6 HOH 113 284 154 HOH HOH B . 
I 6 HOH 114 285 155 HOH HOH B . 
I 6 HOH 115 286 156 HOH HOH B . 
I 6 HOH 116 287 157 HOH HOH B . 
I 6 HOH 117 288 161 HOH HOH B . 
I 6 HOH 118 289 162 HOH HOH B . 
I 6 HOH 119 290 163 HOH HOH B . 
I 6 HOH 120 291 165 HOH HOH B . 
I 6 HOH 121 292 166 HOH HOH B . 
I 6 HOH 122 293 169 HOH HOH B . 
I 6 HOH 123 294 179 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric  1 
2 author_defined_assembly   ?    monomeric  1 
3 software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,C,D,H   
2 1   B,E,F,G,I 
3 1,2 B,E,F,G,I 
3 3,4 A,C,D,H   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 8580  ? 
3 MORE         -98   ? 
3 'SSA (A^2)'  28720 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z             1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 2_545 x,-y-1,-z         1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 
-1.0000000000 0.0000000000 -69.8730000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000   
3 'crystal symmetry operation' 3_445 -x-1,y-1/2,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 -57.2470000000 0.0000000000 
1.0000000000  0.0000000000 -34.9365000000 0.0000000000 0.0000000000 -1.0000000000 39.5975000000  
4 'crystal symmetry operation' 4_444 -x-1,-y-1/2,z-1/2 -1.0000000000 0.0000000000 0.0000000000 -57.2470000000 0.0000000000 
-1.0000000000 0.0000000000 -34.9365000000 0.0000000000 0.0000000000 1.0000000000  -39.5975000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O2G ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 OG1 ? B THR 36 ? B THR 38  ? 1_555 98.3  ? 
2  O2G ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O2B ? F GNP .  ? B GNP 179 ? 1_555 91.3  ? 
3  OG1 ? B THR 36 ? B THR 38  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O2B ? F GNP .  ? B GNP 179 ? 1_555 170.5 ? 
4  O2G ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 OG  ? B SER 18 ? B SER 20  ? 1_555 174.1 ? 
5  OG1 ? B THR 36 ? B THR 38  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 OG  ? B SER 18 ? B SER 20  ? 1_555 78.7  ? 
6  O2B ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 OG  ? B SER 18 ? B SER 20  ? 1_555 91.9  ? 
7  O2G ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 262 ? 1_555 95.3  ? 
8  OG1 ? B THR 36 ? B THR 38  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 262 ? 1_555 101.1 ? 
9  O2B ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 262 ? 1_555 77.6  ? 
10 OG  ? B SER 18 ? B SER 20  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 262 ? 1_555 90.3  ? 
11 O2G ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 174 ? 1_555 88.8  ? 
12 OG1 ? B THR 36 ? B THR 38  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 174 ? 1_555 86.4  ? 
13 O2B ? F GNP .  ? B GNP 179 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 174 ? 1_555 94.1  ? 
14 OG  ? B SER 18 ? B SER 20  ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 174 ? 1_555 86.0  ? 
15 O   ? I HOH .  ? B HOH 262 ? 1_555 MG ? E MG . ? B MG 178 ? 1_555 O   ? I HOH .  ? B HOH 174 ? 1_555 170.8 ? 
16 OG  ? A SER 18 ? A SER 20  ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O3B ? D GDP .  ? A GDP 201 ? 1_555 95.8  ? 
17 OG  ? A SER 18 ? A SER 20  ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 170 ? 1_555 90.1  ? 
18 O3B ? D GDP .  ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 170 ? 1_555 94.1  ? 
19 OG  ? A SER 18 ? A SER 20  ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 176 ? 1_555 90.4  ? 
20 O3B ? D GDP .  ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 176 ? 1_555 173.1 ? 
21 O   ? H HOH .  ? A HOH 170 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 176 ? 1_555 88.8  ? 
22 OG  ? A SER 18 ? A SER 20  ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 172 ? 1_555 96.1  ? 
23 O3B ? D GDP .  ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 172 ? 1_555 84.5  ? 
24 O   ? H HOH .  ? A HOH 170 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 172 ? 1_555 173.8 ? 
25 O   ? H HOH .  ? A HOH 176 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 172 ? 1_555 91.9  ? 
26 OG  ? A SER 18 ? A SER 20  ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 197 ? 1_555 174.2 ? 
27 O3B ? D GDP .  ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 197 ? 1_555 88.9  ? 
28 O   ? H HOH .  ? A HOH 170 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 197 ? 1_555 86.2  ? 
29 O   ? H HOH .  ? A HOH 176 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 197 ? 1_555 85.0  ? 
30 O   ? H HOH .  ? A HOH 172 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O   ? H HOH .  ? A HOH 197 ? 1_555 87.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-20 
2 'Structure model' 1 1 2012-08-15 
3 'Structure model' 1 2 2012-09-26 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' .                            ? 1 
PHENIX       'model building'  .                            ? 2 
PHENIX       refinement        '(phenix.refine: 1.6.4_486)' ? 3 
HKL-2000     'data reduction'  .                            ? 4 
HKL-2000     'data scaling'    .                            ? 5 
PHENIX       phasing           .                            ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N   B ILE 112 ? ? O B HOH 240 ? ? 2.08 
2 1 O   A HOH 208 ? ? O A HOH 227 ? ? 2.12 
3 1 O   A HIS 124 ? ? O A HOH 180 ? ? 2.14 
4 1 OE1 A GLN 111 ? A O A HOH 297 ? ? 2.16 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NZ 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    LYS 
_pdbx_validate_symm_contact.auth_seq_id_1     109 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     181 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 36  ? ? -35.73  112.80  
2 1 ASP A 65  ? ? -122.91 -167.23 
3 1 PRO A 71  ? ? -49.90  153.10  
4 1 GLU A 168 ? ? -109.67 44.32   
5 1 ILE B 39  ? ? -97.47  -61.32  
6 1 GLU B 40  ? ? -174.76 132.94  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 "GUANOSINE-5'-DIPHOSPHATE"                    GDP 
4 'PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER' GNP 
5 'ACETATE ION'                                 ACT 
6 water                                         HOH 
#