data_3SEM
# 
_entry.id   3SEM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SEM         
RCSB  RCSB000016   
WWPDB D_1000000016 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SEM 
_pdbx_database_status.recvd_initial_deposition_date   1998-11-02 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nguyen, J.T.'     1 
'Turck, C.W.'      2 
'Cohen, F.E.'      3 
'Zuckermann, R.N.' 4 
'Lim, W.A.'        5 
# 
_citation.id                        primary 
_citation.title                     
'Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            282 
_citation.page_first                2088 
_citation.page_last                 2092 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            'American Association for the Advancement of Science Washington, D.C.' 
_citation.pdbx_database_id_PubMed   9851931 
_citation.pdbx_database_id_DOI      10.1126/science.282.5396.2088 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nguyen, J.T.'     1 
primary 'Turck, C.W.'      2 
primary 'Cohen, F.E.'      3 
primary 'Zuckermann, R.N.' 4 
primary 'Lim, W.A.'        5 
# 
_citation_editor.citation_id   primary 
_citation_editor.name          'Bloom, F.E.' 
_citation_editor.ordinal       1 
# 
_cell.entry_id           3SEM 
_cell.length_a           27.050 
_cell.length_b           68.530 
_cell.length_c           35.020 
_cell.angle_alpha        90.00 
_cell.angle_beta         93.86 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SEM 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'SEX MUSCLE ABNORMAL PROTEIN 5' 7000.690 2  ? ? 'C-TERMINAL SH3' ? 
2 polymer syn 'SH3 PEPTOID INHIBITOR'         1088.328 2  ? ? ?                ? 
3 water   nat water                           18.015   28 ? ? ?                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSN 
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSN A,B ? 
2 'polypeptide(L)' no yes 'PPPV(NMC)PRRR'                                              PPPVGPRRR C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLU n 
1 2  THR n 
1 3  LYS n 
1 4  PHE n 
1 5  VAL n 
1 6  GLN n 
1 7  ALA n 
1 8  LEU n 
1 9  PHE n 
1 10 ASP n 
1 11 PHE n 
1 12 ASN n 
1 13 PRO n 
1 14 GLN n 
1 15 GLU n 
1 16 SER n 
1 17 GLY n 
1 18 GLU n 
1 19 LEU n 
1 20 ALA n 
1 21 PHE n 
1 22 LYS n 
1 23 ARG n 
1 24 GLY n 
1 25 ASP n 
1 26 VAL n 
1 27 ILE n 
1 28 THR n 
1 29 LEU n 
1 30 ILE n 
1 31 ASN n 
1 32 LYS n 
1 33 ASP n 
1 34 ASP n 
1 35 PRO n 
1 36 ASN n 
1 37 TRP n 
1 38 TRP n 
1 39 GLU n 
1 40 GLY n 
1 41 GLN n 
1 42 LEU n 
1 43 ASN n 
1 44 ASN n 
1 45 ARG n 
1 46 ARG n 
1 47 GLY n 
1 48 ILE n 
1 49 PHE n 
1 50 PRO n 
1 51 SER n 
1 52 ASN n 
1 53 TYR n 
1 54 VAL n 
1 55 CYS n 
1 56 PRO n 
1 57 TYR n 
1 58 ASN n 
1 59 SER n 
1 60 ASN n 
2 1  PRO n 
2 2  PRO n 
2 3  PRO n 
2 4  VAL n 
2 5  NMC n 
2 6  PRO n 
2 7  ARG n 
2 8  ARG n 
2 9  ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Caenorhabditis 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Caenorhabditis elegans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6239 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SEM5_CAEEL 1 P29355 ? ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYNSN ? 
2 PDB 3SEM       2 3SEM   ? PPPVGPRRR                                                    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SEM A 1 ? 60 ? P29355 155 ? 214 ? 155 214 
2 1 3SEM B 1 ? 60 ? P29355 155 ? 214 ? 255 314 
3 2 3SEM C 1 ? 9  ? 3SEM   2   ? 10  ? 2   10  
4 2 3SEM D 1 ? 9  ? 3SEM   12  ? 20  ? 12  20  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'               ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                      ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                       ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER                         ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                        ? 'C6 H15 N2 O2 1' 147.195 
NMC 'L-peptide linking' n 'N-CYCLOPROPYLMETHYL GLYCINE' ? 'C6 H11 N O2'    129.157 
PHE 'L-peptide linking' y PHENYLALANINE                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SEM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'pH 8.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           123 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1997-04-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3SEM 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   61158 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.083 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2. 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   64.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.434 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SEM 
_refine.ls_number_reflns_obs                     6292 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               10000000.0 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    96 
_refine.ls_R_factor_obs                          0.248 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.248 
_refine.ls_R_factor_R_free                       0.31 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.4 
_refine.ls_number_reflns_R_free                  655 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1SEM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1056 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             28 
_refine_hist.number_atoms_total               1084 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.124 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.30 
_refine_ls_shell.number_reflns_R_work             649 
_refine_ls_shell.R_factor_R_work                  0.361 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.354 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.981600 
_struct_ncs_oper.matrix[1][2]   0.113000 
_struct_ncs_oper.matrix[1][3]   0.153900 
_struct_ncs_oper.matrix[2][1]   0.113700 
_struct_ncs_oper.matrix[2][2]   -0.993500 
_struct_ncs_oper.matrix[2][3]   0.004000 
_struct_ncs_oper.matrix[3][1]   0.153400 
_struct_ncs_oper.matrix[3][2]   0.013500 
_struct_ncs_oper.matrix[3][3]   -0.988100 
_struct_ncs_oper.vector[1]      -10.93150 
_struct_ncs_oper.vector[2]      80.63640 
_struct_ncs_oper.vector[3]      84.68880 
# 
_struct.entry_id                  3SEM 
_struct.title                     'SEM5 SH3 DOMAIN COMPLEXED WITH PEPTOID INHIBITOR' 
_struct.pdbx_descriptor           'SEM5 SH3 DOMAIN COMPLEXED WITH PEPTOID INHIBITOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SEM 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN/INHIBITOR' 
_struct_keywords.text            
;SH3 DOMAIN, INHIBITORS, PEPTOIDS, PROTEIN-PROTEIN RECOGNITION, PROLINE-RICH MOTIFS, SIGNAL TRANSDUCTION, SIGNALING PROTEIN-INHIBITOR COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 51 ? TYR A 53 ? SER A 205 TYR A 207 5 ? 3 
HELX_P HELX_P2 2 SER B 51 ? TYR B 53 ? SER B 305 TYR B 307 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 55 SG ? ? ? 1_555 B CYS 55 SG ? ? A CYS 209 B CYS 309 1_555 ? ? ? ? ? ? ? 2.036 ? 
covale1 covale ? ? C VAL 4  C  ? ? ? 1_555 C NMC 5  N  ? ? C VAL 5   C NMC 6   1_555 ? ? ? ? ? ? ? 1.345 ? 
covale2 covale ? ? C NMC 5  C  ? ? ? 1_555 C PRO 6  N  ? ? C NMC 6   C PRO 7   1_555 ? ? ? ? ? ? ? 1.343 ? 
covale3 covale ? ? D VAL 4  C  ? ? ? 1_555 D NMC 5  N  ? ? D VAL 15  D NMC 16  1_555 ? ? ? ? ? ? ? 1.348 ? 
covale4 covale ? ? D NMC 5  C  ? ? ? 1_555 D PRO 6  N  ? ? D NMC 16  D PRO 17  1_555 ? ? ? ? ? ? ? 1.345 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 54 ? PRO A 56 ? VAL A 208 PRO A 210 
A 2 PHE A 4  ? ALA A 7  ? PHE A 158 ALA A 161 
A 3 VAL A 26 ? ASN A 31 ? VAL A 180 ASN A 185 
A 4 TRP A 37 ? LEU A 42 ? TRP A 191 LEU A 196 
A 5 ARG A 45 ? PRO A 50 ? ARG A 199 PRO A 204 
B 1 VAL B 54 ? PRO B 56 ? VAL B 308 PRO B 310 
B 2 PHE B 4  ? ALA B 7  ? PHE B 258 ALA B 261 
B 3 VAL B 26 ? ASN B 31 ? VAL B 280 ASN B 285 
B 4 TRP B 37 ? LEU B 42 ? TRP B 291 LEU B 296 
B 5 ARG B 45 ? PRO B 50 ? ARG B 299 PRO B 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS A 55 ? O CYS A 209 N GLN A 6  ? N GLN A 160 
A 2 3 O VAL A 5  ? O VAL A 159 N ILE A 27 ? N ILE A 181 
A 3 4 O THR A 28 ? O THR A 182 N GLN A 41 ? N GLN A 195 
A 4 5 O TRP A 38 ? O TRP A 192 N PHE A 49 ? N PHE A 203 
B 1 2 O CYS B 55 ? O CYS B 309 N GLN B 6  ? N GLN B 260 
B 2 3 O VAL B 5  ? O VAL B 259 N ILE B 27 ? N ILE B 281 
B 3 4 O THR B 28 ? O THR B 282 N GLN B 41 ? N GLN B 295 
B 4 5 O TRP B 38 ? O TRP B 292 N PHE B 49 ? N PHE B 303 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR CHAIN C OF SH3 PEPTOID INHIBITOR' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR CHAIN D OF SH3 PEPTOID INHIBITOR' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 PHE A 9  ? PHE A 163 . ? 1_555 ? 
2  AC1 9 GLN A 14 ? GLN A 168 . ? 1_555 ? 
3  AC1 9 GLU A 15 ? GLU A 169 . ? 1_555 ? 
4  AC1 9 GLU A 18 ? GLU A 172 . ? 1_555 ? 
5  AC1 9 ASN A 36 ? ASN A 190 . ? 1_555 ? 
6  AC1 9 TRP A 37 ? TRP A 191 . ? 1_555 ? 
7  AC1 9 PRO A 50 ? PRO A 204 . ? 1_555 ? 
8  AC1 9 ASN A 52 ? ASN A 206 . ? 1_555 ? 
9  AC1 9 TYR A 53 ? TYR A 207 . ? 1_555 ? 
10 AC2 6 PHE B 9  ? PHE B 263 . ? 1_555 ? 
11 AC2 6 ASN B 36 ? ASN B 290 . ? 1_555 ? 
12 AC2 6 TRP B 37 ? TRP B 291 . ? 1_555 ? 
13 AC2 6 PRO B 50 ? PRO B 304 . ? 1_555 ? 
14 AC2 6 ASN B 52 ? ASN B 306 . ? 1_555 ? 
15 AC2 6 TYR B 53 ? TYR B 307 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SEM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SEM 
_atom_sites.fract_transf_matrix[1][1]   0.036968 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002494 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014592 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028620 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1  ? 29.920 45.490 60.173 1.00 56.75 ? 155 GLU A N   1 
ATOM   2    C CA  . GLU A 1 1  ? 28.613 45.967 59.633 1.00 57.99 ? 155 GLU A CA  1 
ATOM   3    C C   . GLU A 1 1  ? 27.603 44.827 59.518 1.00 53.30 ? 155 GLU A C   1 
ATOM   4    O O   . GLU A 1 1  ? 27.870 43.819 58.863 1.00 54.17 ? 155 GLU A O   1 
ATOM   5    C CB  . GLU A 1 1  ? 28.804 46.607 58.254 1.00 63.18 ? 155 GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1  ? 27.526 47.199 57.680 1.00 72.65 ? 155 GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1  ? 27.599 47.436 56.181 1.00 79.06 ? 155 GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1  ? 28.659 47.892 55.692 1.00 81.78 ? 155 GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1  ? 26.584 47.171 55.494 1.00 82.78 ? 155 GLU A OE2 1 
ATOM   10   N N   . THR A 1 2  ? 26.438 45.001 60.139 1.00 49.15 ? 156 THR A N   1 
ATOM   11   C CA  . THR A 1 2  ? 25.383 43.992 60.093 1.00 44.50 ? 156 THR A CA  1 
ATOM   12   C C   . THR A 1 2  ? 24.812 43.950 58.674 1.00 40.35 ? 156 THR A C   1 
ATOM   13   O O   . THR A 1 2  ? 24.321 44.960 58.162 1.00 39.80 ? 156 THR A O   1 
ATOM   14   C CB  . THR A 1 2  ? 24.252 44.306 61.099 1.00 44.74 ? 156 THR A CB  1 
ATOM   15   O OG1 . THR A 1 2  ? 24.811 44.496 62.406 1.00 42.61 ? 156 THR A OG1 1 
ATOM   16   C CG2 . THR A 1 2  ? 23.256 43.153 61.156 1.00 43.87 ? 156 THR A CG2 1 
ATOM   17   N N   . LYS A 1 3  ? 24.904 42.785 58.038 1.00 34.24 ? 157 LYS A N   1 
ATOM   18   C CA  . LYS A 1 3  ? 24.422 42.612 56.672 1.00 26.72 ? 157 LYS A CA  1 
ATOM   19   C C   . LYS A 1 3  ? 22.967 42.190 56.574 1.00 23.96 ? 157 LYS A C   1 
ATOM   20   O O   . LYS A 1 3  ? 22.460 41.456 57.420 1.00 26.92 ? 157 LYS A O   1 
ATOM   21   C CB  . LYS A 1 3  ? 25.292 41.605 55.919 1.00 29.91 ? 157 LYS A CB  1 
ATOM   22   C CG  . LYS A 1 3  ? 26.742 42.037 55.764 1.00 34.04 ? 157 LYS A CG  1 
ATOM   23   C CD  . LYS A 1 3  ? 26.857 43.385 55.055 1.00 39.61 ? 157 LYS A CD  1 
ATOM   24   C CE  . LYS A 1 3  ? 28.315 43.786 54.883 1.00 41.19 ? 157 LYS A CE  1 
ATOM   25   N NZ  . LYS A 1 3  ? 28.482 45.047 54.106 1.00 45.75 ? 157 LYS A NZ  1 
ATOM   26   N N   . PHE A 1 4  ? 22.305 42.666 55.525 1.00 19.88 ? 158 PHE A N   1 
ATOM   27   C CA  . PHE A 1 4  ? 20.904 42.353 55.273 1.00 18.32 ? 158 PHE A CA  1 
ATOM   28   C C   . PHE A 1 4  ? 20.728 41.885 53.841 1.00 17.11 ? 158 PHE A C   1 
ATOM   29   O O   . PHE A 1 4  ? 21.620 42.041 53.008 1.00 18.95 ? 158 PHE A O   1 
ATOM   30   C CB  . PHE A 1 4  ? 20.019 43.586 55.472 1.00 21.55 ? 158 PHE A CB  1 
ATOM   31   C CG  . PHE A 1 4  ? 20.033 44.128 56.867 1.00 26.20 ? 158 PHE A CG  1 
ATOM   32   C CD1 . PHE A 1 4  ? 20.973 45.081 57.244 1.00 26.38 ? 158 PHE A CD1 1 
ATOM   33   C CD2 . PHE A 1 4  ? 19.115 43.678 57.811 1.00 29.23 ? 158 PHE A CD2 1 
ATOM   34   C CE1 . PHE A 1 4  ? 21.003 45.578 58.536 1.00 23.67 ? 158 PHE A CE1 1 
ATOM   35   C CE2 . PHE A 1 4  ? 19.135 44.169 59.111 1.00 28.80 ? 158 PHE A CE2 1 
ATOM   36   C CZ  . PHE A 1 4  ? 20.083 45.122 59.474 1.00 27.90 ? 158 PHE A CZ  1 
ATOM   37   N N   . VAL A 1 5  ? 19.561 41.315 53.570 1.00 17.12 ? 159 VAL A N   1 
ATOM   38   C CA  . VAL A 1 5  ? 19.193 40.839 52.243 1.00 13.93 ? 159 VAL A CA  1 
ATOM   39   C C   . VAL A 1 5  ? 17.684 40.991 52.115 1.00 15.88 ? 159 VAL A C   1 
ATOM   40   O O   . VAL A 1 5  ? 16.967 41.024 53.117 1.00 13.52 ? 159 VAL A O   1 
ATOM   41   C CB  . VAL A 1 5  ? 19.574 39.344 52.000 1.00 16.73 ? 159 VAL A CB  1 
ATOM   42   C CG1 . VAL A 1 5  ? 21.089 39.165 51.965 1.00 9.01  ? 159 VAL A CG1 1 
ATOM   43   C CG2 . VAL A 1 5  ? 18.951 38.448 53.063 1.00 17.71 ? 159 VAL A CG2 1 
ATOM   44   N N   . GLN A 1 6  ? 17.209 41.153 50.886 1.00 17.42 ? 160 GLN A N   1 
ATOM   45   C CA  . GLN A 1 6  ? 15.779 41.283 50.649 1.00 21.04 ? 160 GLN A CA  1 
ATOM   46   C C   . GLN A 1 6  ? 15.260 40.090 49.856 1.00 21.71 ? 160 GLN A C   1 
ATOM   47   O O   . GLN A 1 6  ? 15.947 39.559 48.979 1.00 21.05 ? 160 GLN A O   1 
ATOM   48   C CB  . GLN A 1 6  ? 15.460 42.593 49.936 1.00 19.11 ? 160 GLN A CB  1 
ATOM   49   C CG  . GLN A 1 6  ? 16.256 42.841 48.670 1.00 14.15 ? 160 GLN A CG  1 
ATOM   50   C CD  . GLN A 1 6  ? 15.885 44.150 48.019 1.00 15.93 ? 160 GLN A CD  1 
ATOM   51   O OE1 . GLN A 1 6  ? 14.703 44.490 47.913 1.00 16.90 ? 160 GLN A OE1 1 
ATOM   52   N NE2 . GLN A 1 6  ? 16.889 44.904 47.593 1.00 14.60 ? 160 GLN A NE2 1 
ATOM   53   N N   . ALA A 1 7  ? 14.054 39.656 50.200 1.00 22.72 ? 161 ALA A N   1 
ATOM   54   C CA  . ALA A 1 7  ? 13.429 38.520 49.548 1.00 24.56 ? 161 ALA A CA  1 
ATOM   55   C C   . ALA A 1 7  ? 12.930 38.861 48.152 1.00 25.69 ? 161 ALA A C   1 
ATOM   56   O O   . ALA A 1 7  ? 12.183 39.825 47.967 1.00 22.48 ? 161 ALA A O   1 
ATOM   57   C CB  . ALA A 1 7  ? 12.285 37.997 50.400 1.00 19.30 ? 161 ALA A CB  1 
ATOM   58   N N   . LEU A 1 8  ? 13.365 38.067 47.176 1.00 25.35 ? 162 LEU A N   1 
ATOM   59   C CA  . LEU A 1 8  ? 12.956 38.239 45.784 1.00 23.87 ? 162 LEU A CA  1 
ATOM   60   C C   . LEU A 1 8  ? 11.608 37.560 45.566 1.00 23.96 ? 162 LEU A C   1 
ATOM   61   O O   . LEU A 1 8  ? 10.734 38.095 44.879 1.00 29.07 ? 162 LEU A O   1 
ATOM   62   C CB  . LEU A 1 8  ? 13.994 37.625 44.844 1.00 19.86 ? 162 LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8  ? 15.352 38.317 44.737 1.00 20.85 ? 162 LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8  ? 16.354 37.405 44.058 1.00 17.38 ? 162 LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8  ? 15.199 39.608 43.967 1.00 24.15 ? 162 LEU A CD2 1 
ATOM   66   N N   . PHE A 1 9  ? 11.449 36.381 46.165 1.00 21.71 ? 163 PHE A N   1 
ATOM   67   C CA  . PHE A 1 9  ? 10.218 35.602 46.051 1.00 23.73 ? 163 PHE A CA  1 
ATOM   68   C C   . PHE A 1 9  ? 9.835  35.049 47.422 1.00 24.08 ? 163 PHE A C   1 
ATOM   69   O O   . PHE A 1 9  ? 10.626 35.094 48.367 1.00 23.85 ? 163 PHE A O   1 
ATOM   70   C CB  . PHE A 1 9  ? 10.404 34.409 45.087 1.00 18.90 ? 163 PHE A CB  1 
ATOM   71   C CG  . PHE A 1 9  ? 11.327 34.687 43.935 1.00 15.45 ? 163 PHE A CG  1 
ATOM   72   C CD1 . PHE A 1 9  ? 12.697 34.488 44.068 1.00 14.08 ? 163 PHE A CD1 1 
ATOM   73   C CD2 . PHE A 1 9  ? 10.834 35.171 42.729 1.00 17.99 ? 163 PHE A CD2 1 
ATOM   74   C CE1 . PHE A 1 9  ? 13.566 34.774 43.024 1.00 15.76 ? 163 PHE A CE1 1 
ATOM   75   C CE2 . PHE A 1 9  ? 11.695 35.461 41.675 1.00 16.42 ? 163 PHE A CE2 1 
ATOM   76   C CZ  . PHE A 1 9  ? 13.064 35.261 41.825 1.00 14.93 ? 163 PHE A CZ  1 
ATOM   77   N N   . ASP A 1 10 ? 8.614  34.532 47.518 1.00 26.51 ? 164 ASP A N   1 
ATOM   78   C CA  . ASP A 1 10 ? 8.133  33.921 48.750 1.00 28.37 ? 164 ASP A CA  1 
ATOM   79   C C   . ASP A 1 10 ? 8.872  32.596 48.888 1.00 30.62 ? 164 ASP A C   1 
ATOM   80   O O   . ASP A 1 10 ? 9.267  31.993 47.889 1.00 39.91 ? 164 ASP A O   1 
ATOM   81   C CB  . ASP A 1 10 ? 6.631  33.625 48.661 1.00 24.35 ? 164 ASP A CB  1 
ATOM   82   C CG  . ASP A 1 10 ? 5.783  34.872 48.550 1.00 22.57 ? 164 ASP A CG  1 
ATOM   83   O OD1 . ASP A 1 10 ? 6.338  35.989 48.540 1.00 32.20 ? 164 ASP A OD1 1 
ATOM   84   O OD2 . ASP A 1 10 ? 4.544  34.734 48.478 1.00 23.95 ? 164 ASP A OD2 1 
ATOM   85   N N   . PHE A 1 11 ? 9.066  32.150 50.120 1.00 29.97 ? 165 PHE A N   1 
ATOM   86   C CA  . PHE A 1 11 ? 9.740  30.885 50.368 1.00 32.36 ? 165 PHE A CA  1 
ATOM   87   C C   . PHE A 1 11 ? 9.045  30.174 51.515 1.00 34.90 ? 165 PHE A C   1 
ATOM   88   O O   . PHE A 1 11 ? 9.140  30.593 52.668 1.00 35.34 ? 165 PHE A O   1 
ATOM   89   C CB  . PHE A 1 11 ? 11.223 31.105 50.686 1.00 32.15 ? 165 PHE A CB  1 
ATOM   90   C CG  . PHE A 1 11 ? 11.925 29.880 51.211 1.00 35.67 ? 165 PHE A CG  1 
ATOM   91   C CD1 . PHE A 1 11 ? 12.102 28.759 50.408 1.00 34.00 ? 165 PHE A CD1 1 
ATOM   92   C CD2 . PHE A 1 11 ? 12.399 29.845 52.520 1.00 38.12 ? 165 PHE A CD2 1 
ATOM   93   C CE1 . PHE A 1 11 ? 12.738 27.620 50.905 1.00 38.80 ? 165 PHE A CE1 1 
ATOM   94   C CE2 . PHE A 1 11 ? 13.036 28.712 53.024 1.00 34.69 ? 165 PHE A CE2 1 
ATOM   95   C CZ  . PHE A 1 11 ? 13.205 27.599 52.216 1.00 33.82 ? 165 PHE A CZ  1 
ATOM   96   N N   . ASN A 1 12 ? 8.291  29.135 51.173 1.00 36.68 ? 166 ASN A N   1 
ATOM   97   C CA  . ASN A 1 12 ? 7.576  28.342 52.160 1.00 36.53 ? 166 ASN A CA  1 
ATOM   98   C C   . ASN A 1 12 ? 8.473  27.149 52.484 1.00 35.51 ? 166 ASN A C   1 
ATOM   99   O O   . ASN A 1 12 ? 8.782  26.346 51.602 1.00 38.26 ? 166 ASN A O   1 
ATOM   100  C CB  . ASN A 1 12 ? 6.235  27.872 51.586 1.00 37.88 ? 166 ASN A CB  1 
ATOM   101  C CG  . ASN A 1 12 ? 5.271  27.393 52.658 1.00 39.98 ? 166 ASN A CG  1 
ATOM   102  O OD1 . ASN A 1 12 ? 4.358  26.614 52.382 1.00 42.91 ? 166 ASN A OD1 1 
ATOM   103  N ND2 . ASN A 1 12 ? 5.457  27.871 53.884 1.00 40.48 ? 166 ASN A ND2 1 
ATOM   104  N N   . PRO A 1 13 ? 8.928  27.038 53.748 1.00 34.25 ? 167 PRO A N   1 
ATOM   105  C CA  . PRO A 1 13 ? 9.801  25.959 54.229 1.00 33.30 ? 167 PRO A CA  1 
ATOM   106  C C   . PRO A 1 13 ? 9.257  24.556 53.958 1.00 32.03 ? 167 PRO A C   1 
ATOM   107  O O   . PRO A 1 13 ? 8.061  24.308 54.115 1.00 27.60 ? 167 PRO A O   1 
ATOM   108  C CB  . PRO A 1 13 ? 9.880  26.238 55.729 1.00 31.81 ? 167 PRO A CB  1 
ATOM   109  C CG  . PRO A 1 13 ? 9.741  27.717 55.798 1.00 26.24 ? 167 PRO A CG  1 
ATOM   110  C CD  . PRO A 1 13 ? 8.608  27.963 54.846 1.00 30.13 ? 167 PRO A CD  1 
ATOM   111  N N   . GLN A 1 14 ? 10.140 23.653 53.537 1.00 33.02 ? 168 GLN A N   1 
ATOM   112  C CA  . GLN A 1 14 ? 9.765  22.269 53.243 1.00 38.49 ? 168 GLN A CA  1 
ATOM   113  C C   . GLN A 1 14 ? 10.192 21.374 54.406 1.00 35.37 ? 168 GLN A C   1 
ATOM   114  O O   . GLN A 1 14 ? 9.542  20.371 54.709 1.00 32.15 ? 168 GLN A O   1 
ATOM   115  C CB  . GLN A 1 14 ? 10.444 21.795 51.951 1.00 47.71 ? 168 GLN A CB  1 
ATOM   116  C CG  . GLN A 1 14 ? 9.571  20.933 51.036 1.00 56.65 ? 168 GLN A CG  1 
ATOM   117  C CD  . GLN A 1 14 ? 8.495  21.737 50.312 1.00 61.47 ? 168 GLN A CD  1 
ATOM   118  O OE1 . GLN A 1 14 ? 8.772  22.794 49.739 1.00 65.34 ? 168 GLN A OE1 1 
ATOM   119  N NE2 . GLN A 1 14 ? 7.266  21.234 50.328 1.00 61.73 ? 168 GLN A NE2 1 
ATOM   120  N N   . GLU A 1 15 ? 11.300 21.745 55.041 1.00 33.79 ? 169 GLU A N   1 
ATOM   121  C CA  . GLU A 1 15 ? 11.839 21.006 56.175 1.00 32.66 ? 169 GLU A CA  1 
ATOM   122  C C   . GLU A 1 15 ? 11.967 21.919 57.385 1.00 36.71 ? 169 GLU A C   1 
ATOM   123  O O   . GLU A 1 15 ? 11.919 23.145 57.265 1.00 35.48 ? 169 GLU A O   1 
ATOM   124  C CB  . GLU A 1 15 ? 13.206 20.421 55.828 1.00 33.48 ? 169 GLU A CB  1 
ATOM   125  C CG  . GLU A 1 15 ? 13.161 19.347 54.753 1.00 36.79 ? 169 GLU A CG  1 
ATOM   126  C CD  . GLU A 1 15 ? 14.530 18.798 54.389 1.00 40.34 ? 169 GLU A CD  1 
ATOM   127  O OE1 . GLU A 1 15 ? 15.530 19.144 55.060 1.00 41.51 ? 169 GLU A OE1 1 
ATOM   128  O OE2 . GLU A 1 15 ? 14.605 18.020 53.415 1.00 44.77 ? 169 GLU A OE2 1 
ATOM   129  N N   . SER A 1 16 ? 12.123 21.314 58.558 1.00 38.78 ? 170 SER A N   1 
ATOM   130  C CA  . SER A 1 16 ? 12.269 22.073 59.794 1.00 38.45 ? 170 SER A CA  1 
ATOM   131  C C   . SER A 1 16 ? 13.604 22.817 59.798 1.00 34.62 ? 170 SER A C   1 
ATOM   132  O O   . SER A 1 16 ? 14.551 22.415 59.118 1.00 33.38 ? 170 SER A O   1 
ATOM   133  C CB  . SER A 1 16 ? 12.166 21.142 61.009 1.00 41.36 ? 170 SER A CB  1 
ATOM   134  O OG  . SER A 1 16 ? 13.146 20.117 60.960 1.00 38.89 ? 170 SER A OG  1 
ATOM   135  N N   . GLY A 1 17 ? 13.662 23.912 60.551 1.00 33.60 ? 171 GLY A N   1 
ATOM   136  C CA  . GLY A 1 17 ? 14.879 24.703 60.625 1.00 31.69 ? 171 GLY A CA  1 
ATOM   137  C C   . GLY A 1 17 ? 15.027 25.709 59.496 1.00 28.84 ? 171 GLY A C   1 
ATOM   138  O O   . GLY A 1 17 ? 16.049 26.392 59.396 1.00 24.89 ? 171 GLY A O   1 
ATOM   139  N N   . GLU A 1 18 ? 14.013 25.789 58.638 1.00 27.65 ? 172 GLU A N   1 
ATOM   140  C CA  . GLU A 1 18 ? 14.026 26.714 57.509 1.00 30.83 ? 172 GLU A CA  1 
ATOM   141  C C   . GLU A 1 18 ? 13.182 27.955 57.794 1.00 29.88 ? 172 GLU A C   1 
ATOM   142  O O   . GLU A 1 18 ? 12.073 27.862 58.329 1.00 27.09 ? 172 GLU A O   1 
ATOM   143  C CB  . GLU A 1 18 ? 13.551 26.014 56.227 1.00 26.99 ? 172 GLU A CB  1 
ATOM   144  C CG  . GLU A 1 18 ? 14.559 25.010 55.658 1.00 26.14 ? 172 GLU A CG  1 
ATOM   145  C CD  . GLU A 1 18 ? 14.006 24.165 54.510 1.00 27.91 ? 172 GLU A CD  1 
ATOM   146  O OE1 . GLU A 1 18 ? 12.838 24.359 54.106 1.00 30.25 ? 172 GLU A OE1 1 
ATOM   147  O OE2 . GLU A 1 18 ? 14.748 23.290 54.016 1.00 27.77 ? 172 GLU A OE2 1 
ATOM   148  N N   . LEU A 1 19 ? 13.736 29.111 57.433 1.00 28.05 ? 173 LEU A N   1 
ATOM   149  C CA  . LEU A 1 19 ? 13.102 30.410 57.630 1.00 23.37 ? 173 LEU A CA  1 
ATOM   150  C C   . LEU A 1 19 ? 12.075 30.742 56.548 1.00 24.67 ? 173 LEU A C   1 
ATOM   151  O O   . LEU A 1 19 ? 12.376 30.702 55.356 1.00 26.13 ? 173 LEU A O   1 
ATOM   152  C CB  . LEU A 1 19 ? 14.180 31.500 57.680 1.00 23.28 ? 173 LEU A CB  1 
ATOM   153  C CG  . LEU A 1 19 ? 13.757 32.956 57.886 1.00 23.10 ? 173 LEU A CG  1 
ATOM   154  C CD1 . LEU A 1 19 ? 13.047 33.125 59.217 1.00 27.14 ? 173 LEU A CD1 1 
ATOM   155  C CD2 . LEU A 1 19 ? 14.987 33.838 57.833 1.00 22.22 ? 173 LEU A CD2 1 
ATOM   156  N N   . ALA A 1 20 ? 10.861 31.067 56.977 1.00 24.20 ? 174 ALA A N   1 
ATOM   157  C CA  . ALA A 1 20 ? 9.784  31.424 56.063 1.00 28.25 ? 174 ALA A CA  1 
ATOM   158  C C   . ALA A 1 20 ? 9.785  32.929 55.829 1.00 33.99 ? 174 ALA A C   1 
ATOM   159  O O   . ALA A 1 20 ? 9.971  33.704 56.770 1.00 36.79 ? 174 ALA A O   1 
ATOM   160  C CB  . ALA A 1 20 ? 8.442  30.995 56.644 1.00 26.49 ? 174 ALA A CB  1 
ATOM   161  N N   . PHE A 1 21 ? 9.605  33.338 54.575 1.00 33.69 ? 175 PHE A N   1 
ATOM   162  C CA  . PHE A 1 21 ? 9.556  34.756 54.235 1.00 31.64 ? 175 PHE A CA  1 
ATOM   163  C C   . PHE A 1 21 ? 8.781  35.065 52.960 1.00 34.30 ? 175 PHE A C   1 
ATOM   164  O O   . PHE A 1 21 ? 8.620  34.208 52.089 1.00 35.64 ? 175 PHE A O   1 
ATOM   165  C CB  . PHE A 1 21 ? 10.961 35.388 54.191 1.00 22.89 ? 175 PHE A CB  1 
ATOM   166  C CG  . PHE A 1 21 ? 11.915 34.740 53.216 1.00 23.50 ? 175 PHE A CG  1 
ATOM   167  C CD1 . PHE A 1 21 ? 11.665 34.746 51.846 1.00 22.99 ? 175 PHE A CD1 1 
ATOM   168  C CD2 . PHE A 1 21 ? 13.099 34.169 53.670 1.00 24.89 ? 175 PHE A CD2 1 
ATOM   169  C CE1 . PHE A 1 21 ? 12.582 34.198 50.945 1.00 20.04 ? 175 PHE A CE1 1 
ATOM   170  C CE2 . PHE A 1 21 ? 14.023 33.619 52.781 1.00 25.18 ? 175 PHE A CE2 1 
ATOM   171  C CZ  . PHE A 1 21 ? 13.765 33.635 51.417 1.00 21.96 ? 175 PHE A CZ  1 
ATOM   172  N N   . LYS A 1 22 ? 8.247  36.283 52.903 1.00 35.83 ? 176 LYS A N   1 
ATOM   173  C CA  . LYS A 1 22 ? 7.491  36.773 51.755 1.00 30.92 ? 176 LYS A CA  1 
ATOM   174  C C   . LYS A 1 22 ? 8.426  37.647 50.925 1.00 29.70 ? 176 LYS A C   1 
ATOM   175  O O   . LYS A 1 22 ? 9.432  38.137 51.437 1.00 28.17 ? 176 LYS A O   1 
ATOM   176  C CB  . LYS A 1 22 ? 6.301  37.601 52.237 1.00 34.61 ? 176 LYS A CB  1 
ATOM   177  C CG  . LYS A 1 22 ? 5.222  36.797 52.940 1.00 37.24 ? 176 LYS A CG  1 
ATOM   178  C CD  . LYS A 1 22 ? 4.360  36.048 51.941 1.00 38.94 ? 176 LYS A CD  1 
ATOM   179  C CE  . LYS A 1 22 ? 4.361  34.554 52.210 1.00 41.93 ? 176 LYS A CE  1 
ATOM   180  N NZ  . LYS A 1 22 ? 3.839  34.219 53.566 1.00 43.67 ? 176 LYS A NZ  1 
ATOM   181  N N   . ARG A 1 23 ? 8.116  37.842 49.647 1.00 29.29 ? 177 ARG A N   1 
ATOM   182  C CA  . ARG A 1 23 ? 8.981  38.674 48.825 1.00 30.63 ? 177 ARG A CA  1 
ATOM   183  C C   . ARG A 1 23 ? 8.900  40.106 49.338 1.00 27.58 ? 177 ARG A C   1 
ATOM   184  O O   . ARG A 1 23 ? 7.843  40.557 49.781 1.00 26.92 ? 177 ARG A O   1 
ATOM   185  C CB  . ARG A 1 23 ? 8.615  38.590 47.338 1.00 33.64 ? 177 ARG A CB  1 
ATOM   186  C CG  . ARG A 1 23 ? 7.566  39.568 46.850 1.00 39.01 ? 177 ARG A CG  1 
ATOM   187  C CD  . ARG A 1 23 ? 7.601  39.654 45.330 1.00 41.18 ? 177 ARG A CD  1 
ATOM   188  N NE  . ARG A 1 23 ? 6.698  40.675 44.807 1.00 43.08 ? 177 ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 23 ? 5.376  40.550 44.743 1.00 44.10 ? 177 ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 23 ? 4.784  39.443 45.174 1.00 49.54 ? 177 ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 23 ? 4.645  41.527 44.223 1.00 51.25 ? 177 ARG A NH2 1 
ATOM   192  N N   . GLY A 1 24 ? 10.032 40.796 49.328 1.00 26.34 ? 178 GLY A N   1 
ATOM   193  C CA  . GLY A 1 24 ? 10.051 42.160 49.813 1.00 26.86 ? 178 GLY A CA  1 
ATOM   194  C C   . GLY A 1 24 ? 10.485 42.236 51.263 1.00 29.45 ? 178 GLY A C   1 
ATOM   195  O O   . GLY A 1 24 ? 10.830 43.315 51.744 1.00 31.98 ? 178 GLY A O   1 
ATOM   196  N N   . ASP A 1 25 ? 10.461 41.101 51.964 1.00 29.09 ? 179 ASP A N   1 
ATOM   197  C CA  . ASP A 1 25 ? 10.878 41.053 53.367 1.00 26.93 ? 179 ASP A CA  1 
ATOM   198  C C   . ASP A 1 25 ? 12.379 41.260 53.454 1.00 24.74 ? 179 ASP A C   1 
ATOM   199  O O   . ASP A 1 25 ? 13.126 40.806 52.586 1.00 25.34 ? 179 ASP A O   1 
ATOM   200  C CB  . ASP A 1 25 ? 10.529 39.703 54.015 1.00 25.07 ? 179 ASP A CB  1 
ATOM   201  C CG  . ASP A 1 25 ? 9.074  39.602 54.443 1.00 27.20 ? 179 ASP A CG  1 
ATOM   202  O OD1 . ASP A 1 25 ? 8.358  40.628 54.428 1.00 32.36 ? 179 ASP A OD1 1 
ATOM   203  O OD2 . ASP A 1 25 ? 8.647  38.486 54.810 1.00 23.87 ? 179 ASP A OD2 1 
ATOM   204  N N   . VAL A 1 26 ? 12.812 41.982 54.482 1.00 25.97 ? 180 VAL A N   1 
ATOM   205  C CA  . VAL A 1 26 ? 14.232 42.227 54.688 1.00 26.56 ? 180 VAL A CA  1 
ATOM   206  C C   . VAL A 1 26 ? 14.707 41.276 55.783 1.00 29.51 ? 180 VAL A C   1 
ATOM   207  O O   . VAL A 1 26 ? 14.186 41.289 56.901 1.00 32.68 ? 180 VAL A O   1 
ATOM   208  C CB  . VAL A 1 26 ? 14.512 43.692 55.083 1.00 24.98 ? 180 VAL A CB  1 
ATOM   209  C CG1 . VAL A 1 26 ? 16.005 43.905 55.305 1.00 21.32 ? 180 VAL A CG1 1 
ATOM   210  C CG2 . VAL A 1 26 ? 14.001 44.627 54.000 1.00 24.30 ? 180 VAL A CG2 1 
ATOM   211  N N   . ILE A 1 27 ? 15.660 40.420 55.426 1.00 28.23 ? 181 ILE A N   1 
ATOM   212  C CA  . ILE A 1 27 ? 16.222 39.426 56.333 1.00 23.30 ? 181 ILE A CA  1 
ATOM   213  C C   . ILE A 1 27 ? 17.616 39.839 56.808 1.00 23.28 ? 181 ILE A C   1 
ATOM   214  O O   . ILE A 1 27 ? 18.397 40.414 56.053 1.00 24.64 ? 181 ILE A O   1 
ATOM   215  C CB  . ILE A 1 27 ? 16.318 38.022 55.637 1.00 20.28 ? 181 ILE A CB  1 
ATOM   216  C CG1 . ILE A 1 27 ? 14.932 37.514 55.221 1.00 19.03 ? 181 ILE A CG1 1 
ATOM   217  C CG2 . ILE A 1 27 ? 16.965 36.996 56.558 1.00 22.32 ? 181 ILE A CG2 1 
ATOM   218  C CD1 . ILE A 1 27 ? 14.450 38.009 53.882 1.00 23.33 ? 181 ILE A CD1 1 
ATOM   219  N N   . THR A 1 28 ? 17.911 39.553 58.071 1.00 25.98 ? 182 THR A N   1 
ATOM   220  C CA  . THR A 1 28 ? 19.210 39.862 58.655 1.00 23.75 ? 182 THR A CA  1 
ATOM   221  C C   . THR A 1 28 ? 20.076 38.618 58.527 1.00 24.94 ? 182 THR A C   1 
ATOM   222  O O   . THR A 1 28 ? 19.653 37.526 58.905 1.00 26.00 ? 182 THR A O   1 
ATOM   223  C CB  . THR A 1 28 ? 19.088 40.211 60.151 1.00 21.38 ? 182 THR A CB  1 
ATOM   224  O OG1 . THR A 1 28 ? 18.163 41.290 60.321 1.00 23.08 ? 182 THR A OG1 1 
ATOM   225  C CG2 . THR A 1 28 ? 20.443 40.618 60.712 1.00 18.37 ? 182 THR A CG2 1 
ATOM   226  N N   . LEU A 1 29 ? 21.284 38.782 57.999 1.00 27.15 ? 183 LEU A N   1 
ATOM   227  C CA  . LEU A 1 29 ? 22.198 37.659 57.827 1.00 30.32 ? 183 LEU A CA  1 
ATOM   228  C C   . LEU A 1 29 ? 22.967 37.285 59.090 1.00 28.99 ? 183 LEU A C   1 
ATOM   229  O O   . LEU A 1 29 ? 23.582 38.137 59.731 1.00 30.94 ? 183 LEU A O   1 
ATOM   230  C CB  . LEU A 1 29 ? 23.190 37.937 56.694 1.00 29.71 ? 183 LEU A CB  1 
ATOM   231  C CG  . LEU A 1 29 ? 22.662 37.887 55.261 1.00 30.32 ? 183 LEU A CG  1 
ATOM   232  C CD1 . LEU A 1 29 ? 23.788 38.199 54.288 1.00 24.58 ? 183 LEU A CD1 1 
ATOM   233  C CD2 . LEU A 1 29 ? 22.086 36.509 54.984 1.00 27.08 ? 183 LEU A CD2 1 
ATOM   234  N N   . ILE A 1 30 ? 22.914 36.003 59.438 1.00 31.31 ? 184 ILE A N   1 
ATOM   235  C CA  . ILE A 1 30 ? 23.622 35.465 60.595 1.00 29.12 ? 184 ILE A CA  1 
ATOM   236  C C   . ILE A 1 30 ? 24.844 34.721 60.053 1.00 30.87 ? 184 ILE A C   1 
ATOM   237  O O   . ILE A 1 30 ? 25.974 34.976 60.477 1.00 28.37 ? 184 ILE A O   1 
ATOM   238  C CB  . ILE A 1 30 ? 22.727 34.493 61.413 1.00 27.90 ? 184 ILE A CB  1 
ATOM   239  C CG1 . ILE A 1 30 ? 21.520 35.242 61.982 1.00 23.11 ? 184 ILE A CG1 1 
ATOM   240  C CG2 . ILE A 1 30 ? 23.530 33.851 62.547 1.00 28.79 ? 184 ILE A CG2 1 
ATOM   241  C CD1 . ILE A 1 30 ? 20.536 34.353 62.709 1.00 21.06 ? 184 ILE A CD1 1 
ATOM   242  N N   . ASN A 1 31 ? 24.609 33.823 59.094 1.00 32.88 ? 185 ASN A N   1 
ATOM   243  C CA  . ASN A 1 31 ? 25.685 33.056 58.469 1.00 34.30 ? 185 ASN A CA  1 
ATOM   244  C C   . ASN A 1 31 ? 25.508 32.993 56.953 1.00 36.11 ? 185 ASN A C   1 
ATOM   245  O O   . ASN A 1 31 ? 24.435 32.651 56.450 1.00 38.07 ? 185 ASN A O   1 
ATOM   246  C CB  . ASN A 1 31 ? 25.766 31.640 59.041 1.00 33.49 ? 185 ASN A CB  1 
ATOM   247  C CG  . ASN A 1 31 ? 27.019 30.908 58.593 1.00 41.35 ? 185 ASN A CG  1 
ATOM   248  O OD1 . ASN A 1 31 ? 27.095 30.402 57.472 1.00 44.45 ? 185 ASN A OD1 1 
ATOM   249  N ND2 . ASN A 1 31 ? 28.020 30.866 59.465 1.00 41.08 ? 185 ASN A ND2 1 
ATOM   250  N N   . LYS A 1 32 ? 26.588 33.281 56.237 1.00 35.62 ? 186 LYS A N   1 
ATOM   251  C CA  . LYS A 1 32 ? 26.581 33.292 54.781 1.00 37.13 ? 186 LYS A CA  1 
ATOM   252  C C   . LYS A 1 32 ? 27.685 32.382 54.225 1.00 40.17 ? 186 LYS A C   1 
ATOM   253  O O   . LYS A 1 32 ? 27.947 32.372 53.019 1.00 41.73 ? 186 LYS A O   1 
ATOM   254  C CB  . LYS A 1 32 ? 26.779 34.737 54.306 1.00 38.05 ? 186 LYS A CB  1 
ATOM   255  C CG  . LYS A 1 32 ? 26.643 34.975 52.818 1.00 40.92 ? 186 LYS A CG  1 
ATOM   256  C CD  . LYS A 1 32 ? 26.903 36.435 52.476 1.00 43.70 ? 186 LYS A CD  1 
ATOM   257  C CE  . LYS A 1 32 ? 26.958 36.648 50.972 1.00 49.25 ? 186 LYS A CE  1 
ATOM   258  N NZ  . LYS A 1 32 ? 27.189 38.075 50.613 1.00 54.37 ? 186 LYS A NZ  1 
ATOM   259  N N   . ASP A 1 33 ? 28.298 31.591 55.104 1.00 39.72 ? 187 ASP A N   1 
ATOM   260  C CA  . ASP A 1 33 ? 29.382 30.687 54.719 1.00 42.90 ? 187 ASP A CA  1 
ATOM   261  C C   . ASP A 1 33 ? 29.071 29.714 53.580 1.00 43.11 ? 187 ASP A C   1 
ATOM   262  O O   . ASP A 1 33 ? 29.829 29.636 52.611 1.00 45.42 ? 187 ASP A O   1 
ATOM   263  C CB  . ASP A 1 33 ? 29.919 29.942 55.944 1.00 44.57 ? 187 ASP A CB  1 
ATOM   264  C CG  . ASP A 1 33 ? 30.863 30.796 56.774 1.00 42.26 ? 187 ASP A CG  1 
ATOM   265  O OD1 . ASP A 1 33 ? 30.517 31.960 57.067 1.00 43.54 ? 187 ASP A OD1 1 
ATOM   266  O OD2 . ASP A 1 33 ? 31.960 30.308 57.122 1.00 43.21 ? 187 ASP A OD2 1 
ATOM   267  N N   . ASP A 1 34 ? 27.977 28.965 53.693 1.00 43.62 ? 188 ASP A N   1 
ATOM   268  C CA  . ASP A 1 34 ? 27.597 28.030 52.635 1.00 39.38 ? 188 ASP A CA  1 
ATOM   269  C C   . ASP A 1 34 ? 26.973 28.829 51.496 1.00 37.96 ? 188 ASP A C   1 
ATOM   270  O O   . ASP A 1 34 ? 25.999 29.550 51.703 1.00 38.09 ? 188 ASP A O   1 
ATOM   271  C CB  . ASP A 1 34 ? 26.599 26.987 53.148 1.00 40.13 ? 188 ASP A CB  1 
ATOM   272  C CG  . ASP A 1 34 ? 26.298 25.911 52.112 1.00 41.04 ? 188 ASP A CG  1 
ATOM   273  O OD1 . ASP A 1 34 ? 27.207 25.111 51.800 1.00 42.43 ? 188 ASP A OD1 1 
ATOM   274  O OD2 . ASP A 1 34 ? 25.158 25.869 51.605 1.00 38.32 ? 188 ASP A OD2 1 
ATOM   275  N N   . PRO A 1 35 ? 27.509 28.690 50.272 1.00 35.12 ? 189 PRO A N   1 
ATOM   276  C CA  . PRO A 1 35 ? 27.027 29.392 49.079 1.00 31.71 ? 189 PRO A CA  1 
ATOM   277  C C   . PRO A 1 35 ? 25.573 29.138 48.700 1.00 30.09 ? 189 PRO A C   1 
ATOM   278  O O   . PRO A 1 35 ? 24.981 29.925 47.961 1.00 32.56 ? 189 PRO A O   1 
ATOM   279  C CB  . PRO A 1 35 ? 27.979 28.894 47.992 1.00 35.06 ? 189 PRO A CB  1 
ATOM   280  C CG  . PRO A 1 35 ? 28.322 27.516 48.454 1.00 35.42 ? 189 PRO A CG  1 
ATOM   281  C CD  . PRO A 1 35 ? 28.584 27.751 49.917 1.00 35.74 ? 189 PRO A CD  1 
ATOM   282  N N   . ASN A 1 36 ? 24.990 28.061 49.216 1.00 28.72 ? 190 ASN A N   1 
ATOM   283  C CA  . ASN A 1 36 ? 23.606 27.723 48.891 1.00 26.27 ? 190 ASN A CA  1 
ATOM   284  C C   . ASN A 1 36 ? 22.613 28.025 50.002 1.00 26.00 ? 190 ASN A C   1 
ATOM   285  O O   . ASN A 1 36 ? 21.595 28.670 49.770 1.00 29.54 ? 190 ASN A O   1 
ATOM   286  C CB  . ASN A 1 36 ? 23.502 26.251 48.493 1.00 26.66 ? 190 ASN A CB  1 
ATOM   287  C CG  . ASN A 1 36 ? 24.392 25.904 47.318 1.00 26.58 ? 190 ASN A CG  1 
ATOM   288  O OD1 . ASN A 1 36 ? 25.497 25.386 47.491 1.00 31.13 ? 190 ASN A OD1 1 
ATOM   289  N ND2 . ASN A 1 36 ? 23.922 26.204 46.113 1.00 28.58 ? 190 ASN A ND2 1 
ATOM   290  N N   . TRP A 1 37 ? 22.899 27.536 51.203 1.00 29.26 ? 191 TRP A N   1 
ATOM   291  C CA  . TRP A 1 37 ? 22.015 27.759 52.342 1.00 29.71 ? 191 TRP A CA  1 
ATOM   292  C C   . TRP A 1 37 ? 22.579 28.764 53.341 1.00 31.27 ? 191 TRP A C   1 
ATOM   293  O O   . TRP A 1 37 ? 23.578 28.504 54.013 1.00 35.69 ? 191 TRP A O   1 
ATOM   294  C CB  . TRP A 1 37 ? 21.689 26.432 53.039 1.00 26.02 ? 191 TRP A CB  1 
ATOM   295  C CG  . TRP A 1 37 ? 20.846 25.513 52.200 1.00 21.44 ? 191 TRP A CG  1 
ATOM   296  C CD1 . TRP A 1 37 ? 21.290 24.555 51.330 1.00 17.07 ? 191 TRP A CD1 1 
ATOM   297  C CD2 . TRP A 1 37 ? 19.415 25.493 52.123 1.00 15.02 ? 191 TRP A CD2 1 
ATOM   298  N NE1 . TRP A 1 37 ? 20.222 23.947 50.713 1.00 18.39 ? 191 TRP A NE1 1 
ATOM   299  C CE2 . TRP A 1 37 ? 19.060 24.504 51.180 1.00 17.36 ? 191 TRP A CE2 1 
ATOM   300  C CE3 . TRP A 1 37 ? 18.397 26.216 52.760 1.00 15.94 ? 191 TRP A CE3 1 
ATOM   301  C CZ2 . TRP A 1 37 ? 17.725 24.219 50.855 1.00 15.72 ? 191 TRP A CZ2 1 
ATOM   302  C CZ3 . TRP A 1 37 ? 17.069 25.932 52.438 1.00 15.38 ? 191 TRP A CZ3 1 
ATOM   303  C CH2 . TRP A 1 37 ? 16.748 24.941 51.493 1.00 17.54 ? 191 TRP A CH2 1 
ATOM   304  N N   . TRP A 1 38 ? 21.945 29.929 53.397 1.00 27.38 ? 192 TRP A N   1 
ATOM   305  C CA  . TRP A 1 38 ? 22.352 30.989 54.305 1.00 24.97 ? 192 TRP A CA  1 
ATOM   306  C C   . TRP A 1 38 ? 21.419 30.991 55.499 1.00 26.40 ? 192 TRP A C   1 
ATOM   307  O O   . TRP A 1 38 ? 20.270 30.557 55.398 1.00 21.36 ? 192 TRP A O   1 
ATOM   308  C CB  . TRP A 1 38 ? 22.282 32.350 53.609 1.00 27.49 ? 192 TRP A CB  1 
ATOM   309  C CG  . TRP A 1 38 ? 23.248 32.521 52.474 1.00 27.42 ? 192 TRP A CG  1 
ATOM   310  C CD1 . TRP A 1 38 ? 24.279 31.694 52.143 1.00 25.39 ? 192 TRP A CD1 1 
ATOM   311  C CD2 . TRP A 1 38 ? 23.276 33.597 51.532 1.00 26.89 ? 192 TRP A CD2 1 
ATOM   312  N NE1 . TRP A 1 38 ? 24.953 32.186 51.050 1.00 21.99 ? 192 TRP A NE1 1 
ATOM   313  C CE2 . TRP A 1 38 ? 24.359 33.353 50.653 1.00 26.65 ? 192 TRP A CE2 1 
ATOM   314  C CE3 . TRP A 1 38 ? 22.494 34.745 51.340 1.00 24.91 ? 192 TRP A CE3 1 
ATOM   315  C CZ2 . TRP A 1 38 ? 24.677 34.216 49.599 1.00 24.48 ? 192 TRP A CZ2 1 
ATOM   316  C CZ3 . TRP A 1 38 ? 22.811 35.603 50.293 1.00 26.82 ? 192 TRP A CZ3 1 
ATOM   317  C CH2 . TRP A 1 38 ? 23.895 35.332 49.436 1.00 23.61 ? 192 TRP A CH2 1 
ATOM   318  N N   . GLU A 1 39 ? 21.919 31.483 56.626 1.00 27.73 ? 193 GLU A N   1 
ATOM   319  C CA  . GLU A 1 39 ? 21.125 31.552 57.844 1.00 30.08 ? 193 GLU A CA  1 
ATOM   320  C C   . GLU A 1 39 ? 20.837 33.005 58.208 1.00 32.13 ? 193 GLU A C   1 
ATOM   321  O O   . GLU A 1 39 ? 21.720 33.862 58.119 1.00 28.59 ? 193 GLU A O   1 
ATOM   322  C CB  . GLU A 1 39 ? 21.856 30.860 58.994 1.00 30.27 ? 193 GLU A CB  1 
ATOM   323  C CG  . GLU A 1 39 ? 21.071 30.852 60.297 1.00 30.77 ? 193 GLU A CG  1 
ATOM   324  C CD  . GLU A 1 39 ? 21.808 30.166 61.423 1.00 32.06 ? 193 GLU A CD  1 
ATOM   325  O OE1 . GLU A 1 39 ? 23.060 30.178 61.415 1.00 32.83 ? 193 GLU A OE1 1 
ATOM   326  O OE2 . GLU A 1 39 ? 21.131 29.614 62.316 1.00 33.17 ? 193 GLU A OE2 1 
ATOM   327  N N   . GLY A 1 40 ? 19.606 33.271 58.636 1.00 31.27 ? 194 GLY A N   1 
ATOM   328  C CA  . GLY A 1 40 ? 19.226 34.621 59.008 1.00 30.22 ? 194 GLY A CA  1 
ATOM   329  C C   . GLY A 1 40 ? 18.094 34.714 60.016 1.00 30.02 ? 194 GLY A C   1 
ATOM   330  O O   . GLY A 1 40 ? 17.516 33.702 60.418 1.00 23.24 ? 194 GLY A O   1 
ATOM   331  N N   . GLN A 1 41 ? 17.784 35.945 60.418 1.00 29.74 ? 195 GLN A N   1 
ATOM   332  C CA  . GLN A 1 41 ? 16.724 36.220 61.384 1.00 26.67 ? 195 GLN A CA  1 
ATOM   333  C C   . GLN A 1 41 ? 15.682 37.159 60.784 1.00 27.19 ? 195 GLN A C   1 
ATOM   334  O O   . GLN A 1 41 ? 16.020 38.099 60.063 1.00 26.83 ? 195 GLN A O   1 
ATOM   335  C CB  . GLN A 1 41 ? 17.318 36.860 62.644 1.00 30.58 ? 195 GLN A CB  1 
ATOM   336  C CG  . GLN A 1 41 ? 16.307 37.225 63.739 1.00 30.27 ? 195 GLN A CG  1 
ATOM   337  C CD  . GLN A 1 41 ? 16.304 36.251 64.910 1.00 28.26 ? 195 GLN A CD  1 
ATOM   338  O OE1 . GLN A 1 41 ? 15.253 35.948 65.472 1.00 33.42 ? 195 GLN A OE1 1 
ATOM   339  N NE2 . GLN A 1 41 ? 17.486 35.770 65.292 1.00 23.46 ? 195 GLN A NE2 1 
ATOM   340  N N   . LEU A 1 42 ? 14.416 36.880 61.071 1.00 27.91 ? 196 LEU A N   1 
ATOM   341  C CA  . LEU A 1 42 ? 13.306 37.698 60.594 1.00 30.05 ? 196 LEU A CA  1 
ATOM   342  C C   . LEU A 1 42 ? 12.355 37.879 61.776 1.00 31.78 ? 196 LEU A C   1 
ATOM   343  O O   . LEU A 1 42 ? 11.422 37.090 61.976 1.00 27.24 ? 196 LEU A O   1 
ATOM   344  C CB  . LEU A 1 42 ? 12.595 37.024 59.414 1.00 30.86 ? 196 LEU A CB  1 
ATOM   345  C CG  . LEU A 1 42 ? 11.574 37.876 58.649 1.00 32.46 ? 196 LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 42 ? 12.253 39.126 58.103 1.00 31.96 ? 196 LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 42 ? 10.952 37.069 57.515 1.00 37.00 ? 196 LEU A CD2 1 
ATOM   348  N N   . ASN A 1 43 ? 12.633 38.919 62.562 1.00 31.54 ? 197 ASN A N   1 
ATOM   349  C CA  . ASN A 1 43 ? 11.882 39.260 63.764 1.00 29.07 ? 197 ASN A CA  1 
ATOM   350  C C   . ASN A 1 43 ? 12.148 38.180 64.815 1.00 30.18 ? 197 ASN A C   1 
ATOM   351  O O   . ASN A 1 43 ? 13.261 38.082 65.328 1.00 31.90 ? 197 ASN A O   1 
ATOM   352  C CB  . ASN A 1 43 ? 10.381 39.411 63.464 1.00 29.80 ? 197 ASN A CB  1 
ATOM   353  C CG  . ASN A 1 43 ? 9.605  40.058 64.612 1.00 29.06 ? 197 ASN A CG  1 
ATOM   354  O OD1 . ASN A 1 43 ? 10.164 40.387 65.660 1.00 29.04 ? 197 ASN A OD1 1 
ATOM   355  N ND2 . ASN A 1 43 ? 8.310  40.246 64.407 1.00 28.21 ? 197 ASN A ND2 1 
ATOM   356  N N   . ASN A 1 44 ? 11.161 37.328 65.075 1.00 34.29 ? 198 ASN A N   1 
ATOM   357  C CA  . ASN A 1 44 ? 11.294 36.267 66.071 1.00 33.49 ? 198 ASN A CA  1 
ATOM   358  C C   . ASN A 1 44 ? 12.006 35.035 65.520 1.00 33.60 ? 198 ASN A C   1 
ATOM   359  O O   . ASN A 1 44 ? 12.900 34.478 66.161 1.00 35.66 ? 198 ASN A O   1 
ATOM   360  C CB  . ASN A 1 44 ? 9.910  35.865 66.584 1.00 33.61 ? 198 ASN A CB  1 
ATOM   361  C CG  . ASN A 1 44 ? 8.995  37.061 66.789 1.00 39.33 ? 198 ASN A CG  1 
ATOM   362  O OD1 . ASN A 1 44 ? 7.946  37.169 66.150 1.00 39.19 ? 198 ASN A OD1 1 
ATOM   363  N ND2 . ASN A 1 44 ? 9.400  37.976 67.664 1.00 35.68 ? 198 ASN A ND2 1 
ATOM   364  N N   . ARG A 1 45 ? 11.605 34.631 64.320 1.00 34.37 ? 199 ARG A N   1 
ATOM   365  C CA  . ARG A 1 45 ? 12.153 33.457 63.646 1.00 32.96 ? 199 ARG A CA  1 
ATOM   366  C C   . ARG A 1 45 ? 13.639 33.510 63.302 1.00 31.56 ? 199 ARG A C   1 
ATOM   367  O O   . ARG A 1 45 ? 14.236 34.579 63.204 1.00 36.22 ? 199 ARG A O   1 
ATOM   368  C CB  . ARG A 1 45 ? 11.363 33.163 62.368 1.00 36.45 ? 199 ARG A CB  1 
ATOM   369  C CG  . ARG A 1 45 ? 9.971  32.588 62.580 1.00 40.93 ? 199 ARG A CG  1 
ATOM   370  C CD  . ARG A 1 45 ? 8.991  33.632 63.056 1.00 47.65 ? 199 ARG A CD  1 
ATOM   371  N NE  . ARG A 1 45 ? 7.639  33.092 63.151 1.00 57.67 ? 199 ARG A NE  1 
ATOM   372  C CZ  . ARG A 1 45 ? 6.607  33.747 63.675 1.00 62.61 ? 199 ARG A CZ  1 
ATOM   373  N NH1 . ARG A 1 45 ? 6.771  34.974 64.158 1.00 65.25 ? 199 ARG A NH1 1 
ATOM   374  N NH2 . ARG A 1 45 ? 5.406  33.181 63.708 1.00 64.57 ? 199 ARG A NH2 1 
ATOM   375  N N   . ARG A 1 46 ? 14.212 32.330 63.094 1.00 28.31 ? 200 ARG A N   1 
ATOM   376  C CA  . ARG A 1 46 ? 15.613 32.168 62.726 1.00 27.50 ? 200 ARG A CA  1 
ATOM   377  C C   . ARG A 1 46 ? 15.705 30.857 61.946 1.00 28.79 ? 200 ARG A C   1 
ATOM   378  O O   . ARG A 1 46 ? 15.062 29.871 62.310 1.00 31.03 ? 200 ARG A O   1 
ATOM   379  C CB  . ARG A 1 46 ? 16.502 32.100 63.973 1.00 27.67 ? 200 ARG A CB  1 
ATOM   380  C CG  . ARG A 1 46 ? 17.988 31.911 63.666 1.00 32.63 ? 200 ARG A CG  1 
ATOM   381  C CD  . ARG A 1 46 ? 18.817 31.656 64.919 1.00 37.97 ? 200 ARG A CD  1 
ATOM   382  N NE  . ARG A 1 46 ? 18.793 32.791 65.839 1.00 47.74 ? 200 ARG A NE  1 
ATOM   383  C CZ  . ARG A 1 46 ? 19.875 33.401 66.316 1.00 51.04 ? 200 ARG A CZ  1 
ATOM   384  N NH1 . ARG A 1 46 ? 21.089 32.992 65.965 1.00 48.02 ? 200 ARG A NH1 1 
ATOM   385  N NH2 . ARG A 1 46 ? 19.742 34.428 67.145 1.00 51.07 ? 200 ARG A NH2 1 
ATOM   386  N N   . GLY A 1 47 ? 16.473 30.851 60.863 1.00 27.78 ? 201 GLY A N   1 
ATOM   387  C CA  . GLY A 1 47 ? 16.602 29.635 60.080 1.00 28.99 ? 201 GLY A CA  1 
ATOM   388  C C   . GLY A 1 47 ? 17.353 29.809 58.780 1.00 27.58 ? 201 GLY A C   1 
ATOM   389  O O   . GLY A 1 47 ? 17.758 30.916 58.432 1.00 28.20 ? 201 GLY A O   1 
ATOM   390  N N   . ILE A 1 48 ? 17.546 28.703 58.067 1.00 26.14 ? 202 ILE A N   1 
ATOM   391  C CA  . ILE A 1 48 ? 18.250 28.725 56.791 1.00 26.44 ? 202 ILE A CA  1 
ATOM   392  C C   . ILE A 1 48 ? 17.291 28.887 55.612 1.00 25.37 ? 202 ILE A C   1 
ATOM   393  O O   . ILE A 1 48 ? 16.110 28.552 55.708 1.00 21.01 ? 202 ILE A O   1 
ATOM   394  C CB  . ILE A 1 48 ? 19.133 27.466 56.595 1.00 24.21 ? 202 ILE A CB  1 
ATOM   395  C CG1 . ILE A 1 48 ? 18.289 26.191 56.665 1.00 23.82 ? 202 ILE A CG1 1 
ATOM   396  C CG2 . ILE A 1 48 ? 20.233 27.437 57.639 1.00 21.61 ? 202 ILE A CG2 1 
ATOM   397  C CD1 . ILE A 1 48 ? 19.074 24.926 56.367 1.00 26.97 ? 202 ILE A CD1 1 
ATOM   398  N N   . PHE A 1 49 ? 17.814 29.398 54.501 1.00 27.16 ? 203 PHE A N   1 
ATOM   399  C CA  . PHE A 1 49 ? 17.015 29.635 53.301 1.00 24.68 ? 203 PHE A CA  1 
ATOM   400  C C   . PHE A 1 49 ? 17.892 29.581 52.047 1.00 21.24 ? 203 PHE A C   1 
ATOM   401  O O   . PHE A 1 49 ? 19.120 29.647 52.136 1.00 18.15 ? 203 PHE A O   1 
ATOM   402  C CB  . PHE A 1 49 ? 16.340 31.011 53.404 1.00 22.89 ? 203 PHE A CB  1 
ATOM   403  C CG  . PHE A 1 49 ? 17.307 32.141 53.642 1.00 23.16 ? 203 PHE A CG  1 
ATOM   404  C CD1 . PHE A 1 49 ? 17.945 32.769 52.575 1.00 18.88 ? 203 PHE A CD1 1 
ATOM   405  C CD2 . PHE A 1 49 ? 17.603 32.555 54.935 1.00 20.73 ? 203 PHE A CD2 1 
ATOM   406  C CE1 . PHE A 1 49 ? 18.866 33.786 52.791 1.00 17.98 ? 203 PHE A CE1 1 
ATOM   407  C CE2 . PHE A 1 49 ? 18.521 33.571 55.161 1.00 20.76 ? 203 PHE A CE2 1 
ATOM   408  C CZ  . PHE A 1 49 ? 19.154 34.188 54.086 1.00 16.76 ? 203 PHE A CZ  1 
ATOM   409  N N   . PRO A 1 50 ? 17.272 29.437 50.861 1.00 23.73 ? 204 PRO A N   1 
ATOM   410  C CA  . PRO A 1 50 ? 17.974 29.374 49.576 1.00 24.28 ? 204 PRO A CA  1 
ATOM   411  C C   . PRO A 1 50 ? 18.511 30.756 49.196 1.00 25.82 ? 204 PRO A C   1 
ATOM   412  O O   . PRO A 1 50 ? 17.744 31.711 49.057 1.00 25.09 ? 204 PRO A O   1 
ATOM   413  C CB  . PRO A 1 50 ? 16.872 28.929 48.607 1.00 23.81 ? 204 PRO A CB  1 
ATOM   414  C CG  . PRO A 1 50 ? 15.891 28.240 49.479 1.00 26.65 ? 204 PRO A CG  1 
ATOM   415  C CD  . PRO A 1 50 ? 15.851 29.134 50.678 1.00 26.69 ? 204 PRO A CD  1 
ATOM   416  N N   . SER A 1 51 ? 19.826 30.850 49.025 1.00 25.45 ? 205 SER A N   1 
ATOM   417  C CA  . SER A 1 51 ? 20.478 32.107 48.672 1.00 27.17 ? 205 SER A CA  1 
ATOM   418  C C   . SER A 1 51 ? 20.004 32.695 47.344 1.00 30.26 ? 205 SER A C   1 
ATOM   419  O O   . SER A 1 51 ? 20.092 33.902 47.131 1.00 31.17 ? 205 SER A O   1 
ATOM   420  C CB  . SER A 1 51 ? 21.998 31.928 48.656 1.00 26.90 ? 205 SER A CB  1 
ATOM   421  O OG  . SER A 1 51 ? 22.405 30.978 47.687 1.00 26.07 ? 205 SER A OG  1 
ATOM   422  N N   . ASN A 1 52 ? 19.501 31.840 46.457 1.00 32.94 ? 206 ASN A N   1 
ATOM   423  C CA  . ASN A 1 52 ? 19.009 32.274 45.152 1.00 31.54 ? 206 ASN A CA  1 
ATOM   424  C C   . ASN A 1 52 ? 17.608 32.884 45.236 1.00 29.23 ? 206 ASN A C   1 
ATOM   425  O O   . ASN A 1 52 ? 16.973 33.159 44.217 1.00 31.50 ? 206 ASN A O   1 
ATOM   426  C CB  . ASN A 1 52 ? 19.047 31.115 44.140 1.00 34.31 ? 206 ASN A CB  1 
ATOM   427  C CG  . ASN A 1 52 ? 18.091 29.979 44.494 1.00 37.02 ? 206 ASN A CG  1 
ATOM   428  O OD1 . ASN A 1 52 ? 17.691 29.818 45.647 1.00 35.90 ? 206 ASN A OD1 1 
ATOM   429  N ND2 . ASN A 1 52 ? 17.723 29.186 43.493 1.00 35.88 ? 206 ASN A ND2 1 
ATOM   430  N N   . TYR A 1 53 ? 17.124 33.066 46.461 1.00 25.29 ? 207 TYR A N   1 
ATOM   431  C CA  . TYR A 1 53 ? 15.815 33.664 46.697 1.00 22.92 ? 207 TYR A CA  1 
ATOM   432  C C   . TYR A 1 53 ? 15.975 35.075 47.254 1.00 19.35 ? 207 TYR A C   1 
ATOM   433  O O   . TYR A 1 53 ? 14.991 35.770 47.491 1.00 20.06 ? 207 TYR A O   1 
ATOM   434  C CB  . TYR A 1 53 ? 14.997 32.804 47.668 1.00 20.37 ? 207 TYR A CB  1 
ATOM   435  C CG  . TYR A 1 53 ? 14.100 31.810 46.978 1.00 19.03 ? 207 TYR A CG  1 
ATOM   436  C CD1 . TYR A 1 53 ? 14.637 30.747 46.250 1.00 26.18 ? 207 TYR A CD1 1 
ATOM   437  C CD2 . TYR A 1 53 ? 12.714 31.945 47.025 1.00 19.21 ? 207 TYR A CD2 1 
ATOM   438  C CE1 . TYR A 1 53 ? 13.817 29.844 45.582 1.00 24.61 ? 207 TYR A CE1 1 
ATOM   439  C CE2 . TYR A 1 53 ? 11.883 31.047 46.360 1.00 27.19 ? 207 TYR A CE2 1 
ATOM   440  C CZ  . TYR A 1 53 ? 12.441 29.999 45.639 1.00 26.58 ? 207 TYR A CZ  1 
ATOM   441  O OH  . TYR A 1 53 ? 11.625 29.116 44.970 1.00 28.24 ? 207 TYR A OH  1 
ATOM   442  N N   . VAL A 1 54 ? 17.221 35.494 47.456 1.00 17.65 ? 208 VAL A N   1 
ATOM   443  C CA  . VAL A 1 54 ? 17.501 36.820 47.989 1.00 18.81 ? 208 VAL A CA  1 
ATOM   444  C C   . VAL A 1 54 ? 18.649 37.507 47.264 1.00 22.13 ? 208 VAL A C   1 
ATOM   445  O O   . VAL A 1 54 ? 19.381 36.894 46.490 1.00 21.89 ? 208 VAL A O   1 
ATOM   446  C CB  . VAL A 1 54 ? 17.865 36.783 49.513 1.00 16.26 ? 208 VAL A CB  1 
ATOM   447  C CG1 . VAL A 1 54 ? 16.787 36.070 50.319 1.00 13.58 ? 208 VAL A CG1 1 
ATOM   448  C CG2 . VAL A 1 54 ? 19.239 36.142 49.729 1.00 8.83  ? 208 VAL A CG2 1 
ATOM   449  N N   . CYS A 1 55 ? 18.788 38.798 47.541 1.00 28.61 ? 209 CYS A N   1 
ATOM   450  C CA  . CYS A 1 55 ? 19.853 39.622 46.987 1.00 34.57 ? 209 CYS A CA  1 
ATOM   451  C C   . CYS A 1 55 ? 20.108 40.703 48.038 1.00 31.71 ? 209 CYS A C   1 
ATOM   452  O O   . CYS A 1 55 ? 19.245 40.956 48.886 1.00 30.24 ? 209 CYS A O   1 
ATOM   453  C CB  . CYS A 1 55 ? 19.451 40.204 45.623 1.00 37.70 ? 209 CYS A CB  1 
ATOM   454  S SG  . CYS A 1 55 ? 18.131 41.449 45.609 1.00 48.80 ? 209 CYS A SG  1 
ATOM   455  N N   . PRO A 1 56 ? 21.301 41.328 48.029 1.00 29.89 ? 210 PRO A N   1 
ATOM   456  C CA  . PRO A 1 56 ? 21.653 42.369 48.999 1.00 29.32 ? 210 PRO A CA  1 
ATOM   457  C C   . PRO A 1 56 ? 20.668 43.530 49.161 1.00 28.92 ? 210 PRO A C   1 
ATOM   458  O O   . PRO A 1 56 ? 19.938 43.886 48.234 1.00 23.28 ? 210 PRO A O   1 
ATOM   459  C CB  . PRO A 1 56 ? 23.046 42.817 48.540 1.00 31.06 ? 210 PRO A CB  1 
ATOM   460  C CG  . PRO A 1 56 ? 23.084 42.440 47.084 1.00 30.95 ? 210 PRO A CG  1 
ATOM   461  C CD  . PRO A 1 56 ? 22.379 41.120 47.054 1.00 26.04 ? 210 PRO A CD  1 
ATOM   462  N N   . TYR A 1 57 ? 20.617 44.070 50.376 1.00 32.67 ? 211 TYR A N   1 
ATOM   463  C CA  . TYR A 1 57 ? 19.736 45.191 50.700 1.00 39.56 ? 211 TYR A CA  1 
ATOM   464  C C   . TYR A 1 57 ? 20.563 46.240 51.432 1.00 48.22 ? 211 TYR A C   1 
ATOM   465  O O   . TYR A 1 57 ? 20.614 47.400 51.025 1.00 50.55 ? 211 TYR A O   1 
ATOM   466  C CB  . TYR A 1 57 ? 18.589 44.712 51.588 1.00 31.53 ? 211 TYR A CB  1 
ATOM   467  C CG  . TYR A 1 57 ? 17.620 45.796 52.013 1.00 25.94 ? 211 TYR A CG  1 
ATOM   468  C CD1 . TYR A 1 57 ? 16.530 46.143 51.216 1.00 26.64 ? 211 TYR A CD1 1 
ATOM   469  C CD2 . TYR A 1 57 ? 17.773 46.451 53.236 1.00 28.26 ? 211 TYR A CD2 1 
ATOM   470  C CE1 . TYR A 1 57 ? 15.613 47.117 51.627 1.00 29.17 ? 211 TYR A CE1 1 
ATOM   471  C CE2 . TYR A 1 57 ? 16.868 47.422 53.656 1.00 22.19 ? 211 TYR A CE2 1 
ATOM   472  C CZ  . TYR A 1 57 ? 15.787 47.748 52.852 1.00 28.40 ? 211 TYR A CZ  1 
ATOM   473  O OH  . TYR A 1 57 ? 14.872 48.683 53.276 1.00 33.35 ? 211 TYR A OH  1 
ATOM   474  N N   . ASN A 1 58 ? 21.212 45.819 52.510 1.00 59.06 ? 212 ASN A N   1 
ATOM   475  C CA  . ASN A 1 58 ? 22.058 46.700 53.309 1.00 69.58 ? 212 ASN A CA  1 
ATOM   476  C C   . ASN A 1 58 ? 23.217 45.897 53.927 1.00 73.24 ? 212 ASN A C   1 
ATOM   477  O O   . ASN A 1 58 ? 24.156 45.535 53.179 1.00 76.78 ? 212 ASN A O   1 
ATOM   478  C CB  . ASN A 1 58 ? 21.226 47.419 54.406 1.00 69.84 ? 212 ASN A CB  1 
ATOM   479  N N   . GLU B 1 1  ? 32.321 39.327 31.128 1.00 52.60 ? 255 GLU B N   1 
ATOM   480  C CA  . GLU B 1 1  ? 31.087 38.607 30.700 1.00 50.41 ? 255 GLU B CA  1 
ATOM   481  C C   . GLU B 1 1  ? 29.903 39.564 30.602 1.00 49.45 ? 255 GLU B C   1 
ATOM   482  O O   . GLU B 1 1  ? 29.973 40.709 31.053 1.00 50.94 ? 255 GLU B O   1 
ATOM   483  C CB  . GLU B 1 1  ? 30.750 37.492 31.696 1.00 50.57 ? 255 GLU B CB  1 
ATOM   484  C CG  . GLU B 1 1  ? 30.490 37.992 33.112 1.00 51.78 ? 255 GLU B CG  1 
ATOM   485  C CD  . GLU B 1 1  ? 29.808 36.960 33.991 1.00 52.99 ? 255 GLU B CD  1 
ATOM   486  O OE1 . GLU B 1 1  ? 30.509 36.073 34.523 1.00 54.55 ? 255 GLU B OE1 1 
ATOM   487  O OE2 . GLU B 1 1  ? 28.570 37.044 34.157 1.00 52.14 ? 255 GLU B OE2 1 
ATOM   488  N N   . THR B 1 2  ? 28.814 39.085 30.011 1.00 47.32 ? 256 THR B N   1 
ATOM   489  C CA  . THR B 1 2  ? 27.604 39.885 29.870 1.00 46.16 ? 256 THR B CA  1 
ATOM   490  C C   . THR B 1 2  ? 26.894 39.904 31.225 1.00 41.99 ? 256 THR B C   1 
ATOM   491  O O   . THR B 1 2  ? 26.621 38.853 31.805 1.00 42.24 ? 256 THR B O   1 
ATOM   492  C CB  . THR B 1 2  ? 26.651 39.290 28.798 1.00 48.23 ? 256 THR B CB  1 
ATOM   493  O OG1 . THR B 1 2  ? 27.375 39.046 27.585 1.00 46.55 ? 256 THR B OG1 1 
ATOM   494  C CG2 . THR B 1 2  ? 25.512 40.259 28.502 1.00 46.64 ? 256 THR B CG2 1 
ATOM   495  N N   . LYS B 1 3  ? 26.634 41.102 31.740 1.00 39.26 ? 257 LYS B N   1 
ATOM   496  C CA  . LYS B 1 3  ? 25.963 41.249 33.026 1.00 32.44 ? 257 LYS B CA  1 
ATOM   497  C C   . LYS B 1 3  ? 24.465 41.467 32.854 1.00 30.13 ? 257 LYS B C   1 
ATOM   498  O O   . LYS B 1 3  ? 24.022 42.083 31.884 1.00 28.44 ? 257 LYS B O   1 
ATOM   499  C CB  . LYS B 1 3  ? 26.564 42.416 33.814 1.00 33.14 ? 257 LYS B CB  1 
ATOM   500  C CG  . LYS B 1 3  ? 28.059 42.305 34.071 1.00 37.96 ? 257 LYS B CG  1 
ATOM   501  C CD  . LYS B 1 3  ? 28.407 41.076 34.891 1.00 40.71 ? 257 LYS B CD  1 
ATOM   502  C CE  . LYS B 1 3  ? 29.900 40.999 35.160 1.00 45.45 ? 257 LYS B CE  1 
ATOM   503  N NZ  . LYS B 1 3  ? 30.252 39.787 35.952 1.00 51.24 ? 257 LYS B NZ  1 
ATOM   504  N N   . PHE B 1 4  ? 23.691 40.931 33.790 1.00 26.50 ? 258 PHE B N   1 
ATOM   505  C CA  . PHE B 1 4  ? 22.241 41.065 33.774 1.00 26.08 ? 258 PHE B CA  1 
ATOM   506  C C   . PHE B 1 4  ? 21.761 41.496 35.151 1.00 27.96 ? 258 PHE B C   1 
ATOM   507  O O   . PHE B 1 4  ? 22.437 41.273 36.155 1.00 29.37 ? 258 PHE B O   1 
ATOM   508  C CB  . PHE B 1 4  ? 21.571 39.737 33.407 1.00 23.26 ? 258 PHE B CB  1 
ATOM   509  C CG  . PHE B 1 4  ? 21.891 39.261 32.024 1.00 24.03 ? 258 PHE B CG  1 
ATOM   510  C CD1 . PHE B 1 4  ? 21.128 39.675 30.937 1.00 22.68 ? 258 PHE B CD1 1 
ATOM   511  C CD2 . PHE B 1 4  ? 22.970 38.413 31.801 1.00 28.43 ? 258 PHE B CD2 1 
ATOM   512  C CE1 . PHE B 1 4  ? 21.437 39.255 29.647 1.00 19.97 ? 258 PHE B CE1 1 
ATOM   513  C CE2 . PHE B 1 4  ? 23.291 37.985 30.515 1.00 29.11 ? 258 PHE B CE2 1 
ATOM   514  C CZ  . PHE B 1 4  ? 22.522 38.407 29.435 1.00 22.79 ? 258 PHE B CZ  1 
ATOM   515  N N   . VAL B 1 5  ? 20.606 42.146 35.185 1.00 25.92 ? 259 VAL B N   1 
ATOM   516  C CA  . VAL B 1 5  ? 20.011 42.588 36.435 1.00 21.49 ? 259 VAL B CA  1 
ATOM   517  C C   . VAL B 1 5  ? 18.522 42.283 36.376 1.00 20.21 ? 259 VAL B C   1 
ATOM   518  O O   . VAL B 1 5  ? 17.899 42.396 35.320 1.00 21.92 ? 259 VAL B O   1 
ATOM   519  C CB  . VAL B 1 5  ? 20.230 44.108 36.697 1.00 25.17 ? 259 VAL B CB  1 
ATOM   520  C CG1 . VAL B 1 5  ? 21.695 44.387 37.043 1.00 14.52 ? 259 VAL B CG1 1 
ATOM   521  C CG2 . VAL B 1 5  ? 19.797 44.933 35.490 1.00 22.90 ? 259 VAL B CG2 1 
ATOM   522  N N   . GLN B 1 6  ? 17.967 41.833 37.495 1.00 21.23 ? 260 GLN B N   1 
ATOM   523  C CA  . GLN B 1 6  ? 16.546 41.520 37.558 1.00 21.60 ? 260 GLN B CA  1 
ATOM   524  C C   . GLN B 1 6  ? 15.782 42.637 38.264 1.00 24.69 ? 260 GLN B C   1 
ATOM   525  O O   . GLN B 1 6  ? 16.317 43.311 39.150 1.00 22.91 ? 260 GLN B O   1 
ATOM   526  C CB  . GLN B 1 6  ? 16.313 40.175 38.250 1.00 21.85 ? 260 GLN B CB  1 
ATOM   527  C CG  . GLN B 1 6  ? 16.869 40.080 39.661 1.00 23.27 ? 260 GLN B CG  1 
ATOM   528  C CD  . GLN B 1 6  ? 16.606 38.730 40.289 1.00 19.15 ? 260 GLN B CD  1 
ATOM   529  O OE1 . GLN B 1 6  ? 15.469 38.259 40.314 1.00 22.63 ? 260 GLN B OE1 1 
ATOM   530  N NE2 . GLN B 1 6  ? 17.658 38.093 40.789 1.00 21.28 ? 260 GLN B NE2 1 
ATOM   531  N N   . ALA B 1 7  ? 14.524 42.812 37.870 1.00 23.44 ? 261 ALA B N   1 
ATOM   532  C CA  . ALA B 1 7  ? 13.671 43.851 38.419 1.00 21.69 ? 261 ALA B CA  1 
ATOM   533  C C   . ALA B 1 7  ? 12.984 43.483 39.719 1.00 24.64 ? 261 ALA B C   1 
ATOM   534  O O   . ALA B 1 7  ? 12.290 42.470 39.808 1.00 24.78 ? 261 ALA B O   1 
ATOM   535  C CB  . ALA B 1 7  ? 12.643 44.267 37.392 1.00 25.01 ? 261 ALA B CB  1 
ATOM   536  N N   . LEU B 1 8  ? 13.175 44.340 40.719 1.00 25.74 ? 262 LEU B N   1 
ATOM   537  C CA  . LEU B 1 8  ? 12.575 44.173 42.039 1.00 23.15 ? 262 LEU B CA  1 
ATOM   538  C C   . LEU B 1 8  ? 11.176 44.776 42.032 1.00 23.30 ? 262 LEU B C   1 
ATOM   539  O O   . LEU B 1 8  ? 10.252 44.226 42.632 1.00 27.66 ? 262 LEU B O   1 
ATOM   540  C CB  . LEU B 1 8  ? 13.429 44.873 43.100 1.00 16.49 ? 262 LEU B CB  1 
ATOM   541  C CG  . LEU B 1 8  ? 14.811 44.292 43.409 1.00 15.58 ? 262 LEU B CG  1 
ATOM   542  C CD1 . LEU B 1 8  ? 15.650 45.298 44.173 1.00 10.47 ? 262 LEU B CD1 1 
ATOM   543  C CD2 . LEU B 1 8  ? 14.654 43.008 44.203 1.00 19.95 ? 262 LEU B CD2 1 
ATOM   544  N N   . PHE B 1 9  ? 11.029 45.907 41.339 1.00 24.22 ? 263 PHE B N   1 
ATOM   545  C CA  . PHE B 1 9  ? 9.749  46.610 41.244 1.00 24.56 ? 263 PHE B CA  1 
ATOM   546  C C   . PHE B 1 9  ? 9.492  47.091 39.816 1.00 23.31 ? 263 PHE B C   1 
ATOM   547  O O   . PHE B 1 9  ? 10.390 47.081 38.969 1.00 20.26 ? 263 PHE B O   1 
ATOM   548  C CB  . PHE B 1 9  ? 9.733  47.839 42.167 1.00 22.13 ? 263 PHE B CB  1 
ATOM   549  C CG  . PHE B 1 9  ? 10.336 47.601 43.522 1.00 22.01 ? 263 PHE B CG  1 
ATOM   550  C CD1 . PHE B 1 9  ? 11.700 47.813 43.734 1.00 20.11 ? 263 PHE B CD1 1 
ATOM   551  C CD2 . PHE B 1 9  ? 9.548  47.167 44.583 1.00 21.33 ? 263 PHE B CD2 1 
ATOM   552  C CE1 . PHE B 1 9  ? 12.268 47.596 44.979 1.00 24.98 ? 263 PHE B CE1 1 
ATOM   553  C CE2 . PHE B 1 9  ? 10.104 46.947 45.834 1.00 19.36 ? 263 PHE B CE2 1 
ATOM   554  C CZ  . PHE B 1 9  ? 11.468 47.161 46.035 1.00 20.92 ? 263 PHE B CZ  1 
ATOM   555  N N   . ASP B 1 10 ? 8.257  47.516 39.566 1.00 24.50 ? 264 ASP B N   1 
ATOM   556  C CA  . ASP B 1 10 ? 7.859  48.045 38.266 1.00 27.29 ? 264 ASP B CA  1 
ATOM   557  C C   . ASP B 1 10 ? 8.407  49.462 38.156 1.00 29.83 ? 264 ASP B C   1 
ATOM   558  O O   . ASP B 1 10 ? 8.331  50.229 39.118 1.00 32.94 ? 264 ASP B O   1 
ATOM   559  C CB  . ASP B 1 10 ? 6.329  48.114 38.148 1.00 25.52 ? 264 ASP B CB  1 
ATOM   560  C CG  . ASP B 1 10 ? 5.683  46.757 37.930 1.00 26.89 ? 264 ASP B CG  1 
ATOM   561  O OD1 . ASP B 1 10 ? 6.335  45.720 38.163 1.00 34.84 ? 264 ASP B OD1 1 
ATOM   562  O OD2 . ASP B 1 10 ? 4.500  46.734 37.529 1.00 29.77 ? 264 ASP B OD2 1 
ATOM   563  N N   . PHE B 1 11 ? 8.959  49.808 36.995 1.00 31.53 ? 265 PHE B N   1 
ATOM   564  C CA  . PHE B 1 11 ? 9.491  51.148 36.779 1.00 29.30 ? 265 PHE B CA  1 
ATOM   565  C C   . PHE B 1 11 ? 8.823  51.861 35.608 1.00 32.46 ? 265 PHE B C   1 
ATOM   566  O O   . PHE B 1 11 ? 9.023  51.491 34.450 1.00 32.10 ? 265 PHE B O   1 
ATOM   567  C CB  . PHE B 1 11 ? 11.007 51.114 36.565 1.00 26.72 ? 265 PHE B CB  1 
ATOM   568  C CG  . PHE B 1 11 ? 11.604 52.465 36.282 1.00 30.04 ? 265 PHE B CG  1 
ATOM   569  C CD1 . PHE B 1 11 ? 11.351 53.541 37.130 1.00 25.62 ? 265 PHE B CD1 1 
ATOM   570  C CD2 . PHE B 1 11 ? 12.383 52.673 35.147 1.00 27.42 ? 265 PHE B CD2 1 
ATOM   571  C CE1 . PHE B 1 11 ? 11.863 54.801 36.847 1.00 28.28 ? 265 PHE B CE1 1 
ATOM   572  C CE2 . PHE B 1 11 ? 12.901 53.932 34.853 1.00 24.88 ? 265 PHE B CE2 1 
ATOM   573  C CZ  . PHE B 1 11 ? 12.640 54.998 35.704 1.00 27.22 ? 265 PHE B CZ  1 
ATOM   574  N N   . ASN B 1 12 ? 8.022  52.878 35.927 1.00 35.08 ? 266 ASN B N   1 
ATOM   575  C CA  . ASN B 1 12 ? 7.323  53.688 34.927 1.00 37.19 ? 266 ASN B CA  1 
ATOM   576  C C   . ASN B 1 12 ? 8.031  55.043 34.834 1.00 34.59 ? 266 ASN B C   1 
ATOM   577  O O   . ASN B 1 12 ? 7.946  55.857 35.753 1.00 38.39 ? 266 ASN B O   1 
ATOM   578  C CB  . ASN B 1 12 ? 5.852  53.898 35.322 1.00 39.34 ? 266 ASN B CB  1 
ATOM   579  C CG  . ASN B 1 12 ? 5.050  52.609 35.304 1.00 40.99 ? 266 ASN B CG  1 
ATOM   580  O OD1 . ASN B 1 12 ? 4.877  51.958 36.334 1.00 42.45 ? 266 ASN B OD1 1 
ATOM   581  N ND2 . ASN B 1 12 ? 4.548  52.240 34.132 1.00 45.94 ? 266 ASN B ND2 1 
ATOM   582  N N   . PRO B 1 13 ? 8.765  55.284 33.735 1.00 29.85 ? 267 PRO B N   1 
ATOM   583  C CA  . PRO B 1 13 ? 9.508  56.522 33.494 1.00 32.46 ? 267 PRO B CA  1 
ATOM   584  C C   . PRO B 1 13 ? 8.677  57.800 33.477 1.00 32.08 ? 267 PRO B C   1 
ATOM   585  O O   . PRO B 1 13 ? 7.515  57.798 33.070 1.00 31.69 ? 267 PRO B O   1 
ATOM   586  C CB  . PRO B 1 13 ? 10.155 56.263 32.135 1.00 29.92 ? 267 PRO B CB  1 
ATOM   587  C CG  . PRO B 1 13 ? 10.386 54.793 32.161 1.00 27.83 ? 267 PRO B CG  1 
ATOM   588  C CD  . PRO B 1 13 ? 9.060  54.303 32.681 1.00 29.19 ? 267 PRO B CD  1 
ATOM   589  N N   . GLN B 1 14 ? 9.284  58.881 33.960 1.00 35.79 ? 268 GLN B N   1 
ATOM   590  C CA  . GLN B 1 14 ? 8.642  60.192 33.996 1.00 39.03 ? 268 GLN B CA  1 
ATOM   591  C C   . GLN B 1 14 ? 9.332  61.109 32.985 1.00 35.11 ? 268 GLN B C   1 
ATOM   592  O O   . GLN B 1 14 ? 8.802  62.157 32.615 1.00 35.90 ? 268 GLN B O   1 
ATOM   593  C CB  . GLN B 1 14 ? 8.715  60.796 35.406 1.00 43.51 ? 268 GLN B CB  1 
ATOM   594  C CG  . GLN B 1 14 ? 7.981  59.997 36.487 1.00 54.73 ? 268 GLN B CG  1 
ATOM   595  C CD  . GLN B 1 14 ? 6.485  59.872 36.228 1.00 57.66 ? 268 GLN B CD  1 
ATOM   596  O OE1 . GLN B 1 14 ? 5.765  60.871 36.182 1.00 55.69 ? 268 GLN B OE1 1 
ATOM   597  N NE2 . GLN B 1 14 ? 6.011  58.638 36.065 1.00 58.14 ? 268 GLN B NE2 1 
ATOM   598  N N   . GLU B 1 15 ? 10.519 60.696 32.546 1.00 31.58 ? 269 GLU B N   1 
ATOM   599  C CA  . GLU B 1 15 ? 11.303 61.440 31.569 1.00 33.01 ? 269 GLU B CA  1 
ATOM   600  C C   . GLU B 1 15 ? 11.710 60.523 30.420 1.00 32.95 ? 269 GLU B C   1 
ATOM   601  O O   . GLU B 1 15 ? 11.640 59.297 30.536 1.00 28.53 ? 269 GLU B O   1 
ATOM   602  C CB  . GLU B 1 15 ? 12.557 62.027 32.213 1.00 38.14 ? 269 GLU B CB  1 
ATOM   603  C CG  . GLU B 1 15 ? 12.300 63.190 33.158 1.00 46.10 ? 269 GLU B CG  1 
ATOM   604  C CD  . GLU B 1 15 ? 13.580 63.734 33.775 1.00 52.62 ? 269 GLU B CD  1 
ATOM   605  O OE1 . GLU B 1 15 ? 14.657 63.593 33.151 1.00 54.89 ? 269 GLU B OE1 1 
ATOM   606  O OE2 . GLU B 1 15 ? 13.506 64.301 34.887 1.00 54.43 ? 269 GLU B OE2 1 
ATOM   607  N N   . SER B 1 16 ? 12.139 61.125 29.313 1.00 31.39 ? 270 SER B N   1 
ATOM   608  C CA  . SER B 1 16 ? 12.561 60.372 28.137 1.00 30.48 ? 270 SER B CA  1 
ATOM   609  C C   . SER B 1 16 ? 13.982 59.856 28.302 1.00 27.57 ? 270 SER B C   1 
ATOM   610  O O   . SER B 1 16 ? 14.783 60.427 29.046 1.00 28.61 ? 270 SER B O   1 
ATOM   611  C CB  . SER B 1 16 ? 12.466 61.239 26.879 1.00 34.99 ? 270 SER B CB  1 
ATOM   612  O OG  . SER B 1 16 ? 13.378 62.323 26.934 1.00 43.22 ? 270 SER B OG  1 
ATOM   613  N N   . GLY B 1 17 ? 14.290 58.779 27.587 1.00 26.08 ? 271 GLY B N   1 
ATOM   614  C CA  . GLY B 1 17 ? 15.612 58.184 27.665 1.00 24.40 ? 271 GLY B CA  1 
ATOM   615  C C   . GLY B 1 17 ? 15.722 57.177 28.794 1.00 23.53 ? 271 GLY B C   1 
ATOM   616  O O   . GLY B 1 17 ? 16.804 56.653 29.060 1.00 21.46 ? 271 GLY B O   1 
ATOM   617  N N   . GLU B 1 18 ? 14.597 56.905 29.450 1.00 23.00 ? 272 GLU B N   1 
ATOM   618  C CA  . GLU B 1 18 ? 14.548 55.964 30.562 1.00 25.30 ? 272 GLU B CA  1 
ATOM   619  C C   . GLU B 1 18 ? 13.927 54.633 30.146 1.00 25.64 ? 272 GLU B C   1 
ATOM   620  O O   . GLU B 1 18 ? 12.988 54.597 29.347 1.00 19.38 ? 272 GLU B O   1 
ATOM   621  C CB  . GLU B 1 18 ? 13.772 56.570 31.738 1.00 23.99 ? 272 GLU B CB  1 
ATOM   622  C CG  . GLU B 1 18 ? 14.450 57.794 32.354 1.00 21.34 ? 272 GLU B CG  1 
ATOM   623  C CD  . GLU B 1 18 ? 13.620 58.484 33.432 1.00 20.57 ? 272 GLU B CD  1 
ATOM   624  O OE1 . GLU B 1 18 ? 12.400 58.233 33.532 1.00 17.33 ? 272 GLU B OE1 1 
ATOM   625  O OE2 . GLU B 1 18 ? 14.198 59.301 34.177 1.00 24.37 ? 272 GLU B OE2 1 
ATOM   626  N N   . LEU B 1 19 ? 14.442 53.548 30.722 1.00 28.89 ? 273 LEU B N   1 
ATOM   627  C CA  . LEU B 1 19 ? 13.970 52.198 30.422 1.00 25.01 ? 273 LEU B CA  1 
ATOM   628  C C   . LEU B 1 19 ? 12.830 51.707 31.314 1.00 24.37 ? 273 LEU B C   1 
ATOM   629  O O   . LEU B 1 19 ? 13.009 51.506 32.515 1.00 24.23 ? 273 LEU B O   1 
ATOM   630  C CB  . LEU B 1 19 ? 15.137 51.210 30.506 1.00 23.24 ? 273 LEU B CB  1 
ATOM   631  C CG  . LEU B 1 19 ? 14.820 49.768 30.111 1.00 28.17 ? 273 LEU B CG  1 
ATOM   632  C CD1 . LEU B 1 19 ? 14.481 49.703 28.626 1.00 19.25 ? 273 LEU B CD1 1 
ATOM   633  C CD2 . LEU B 1 19 ? 16.006 48.879 30.431 1.00 24.41 ? 273 LEU B CD2 1 
ATOM   634  N N   . ALA B 1 20 ? 11.667 51.484 30.711 1.00 23.42 ? 274 ALA B N   1 
ATOM   635  C CA  . ALA B 1 20 ? 10.506 50.989 31.444 1.00 26.13 ? 274 ALA B CA  1 
ATOM   636  C C   . ALA B 1 20 ? 10.570 49.469 31.549 1.00 27.53 ? 274 ALA B C   1 
ATOM   637  O O   . ALA B 1 20 ? 11.000 48.794 30.613 1.00 35.01 ? 274 ALA B O   1 
ATOM   638  C CB  . ALA B 1 20 ? 9.223  51.406 30.745 1.00 20.02 ? 274 ALA B CB  1 
ATOM   639  N N   . PHE B 1 21 ? 10.167 48.938 32.699 1.00 30.76 ? 275 PHE B N   1 
ATOM   640  C CA  . PHE B 1 21 ? 10.153 47.494 32.924 1.00 26.62 ? 275 PHE B CA  1 
ATOM   641  C C   . PHE B 1 21 ? 9.221  47.089 34.056 1.00 25.90 ? 275 PHE B C   1 
ATOM   642  O O   . PHE B 1 21 ? 8.706  47.938 34.789 1.00 24.64 ? 275 PHE B O   1 
ATOM   643  C CB  . PHE B 1 21 ? 11.571 46.946 33.171 1.00 22.49 ? 275 PHE B CB  1 
ATOM   644  C CG  . PHE B 1 21 ? 12.310 47.610 34.302 1.00 26.55 ? 275 PHE B CG  1 
ATOM   645  C CD1 . PHE B 1 21 ? 11.916 47.425 35.627 1.00 32.26 ? 275 PHE B CD1 1 
ATOM   646  C CD2 . PHE B 1 21 ? 13.433 48.392 34.040 1.00 30.91 ? 275 PHE B CD2 1 
ATOM   647  C CE1 . PHE B 1 21 ? 12.632 48.008 36.675 1.00 29.48 ? 275 PHE B CE1 1 
ATOM   648  C CE2 . PHE B 1 21 ? 14.160 48.979 35.077 1.00 30.22 ? 275 PHE B CE2 1 
ATOM   649  C CZ  . PHE B 1 21 ? 13.759 48.788 36.398 1.00 31.85 ? 275 PHE B CZ  1 
ATOM   650  N N   . LYS B 1 22 ? 8.970  45.789 34.160 1.00 27.13 ? 276 LYS B N   1 
ATOM   651  C CA  . LYS B 1 22 ? 8.109  45.249 35.203 1.00 25.81 ? 276 LYS B CA  1 
ATOM   652  C C   . LYS B 1 22 ? 8.941  44.409 36.164 1.00 24.08 ? 276 LYS B C   1 
ATOM   653  O O   . LYS B 1 22 ? 10.067 44.020 35.848 1.00 25.79 ? 276 LYS B O   1 
ATOM   654  C CB  . LYS B 1 22 ? 6.979  44.406 34.600 1.00 22.99 ? 276 LYS B CB  1 
ATOM   655  C CG  . LYS B 1 22 ? 6.053  45.191 33.681 1.00 27.16 ? 276 LYS B CG  1 
ATOM   656  C CD  . LYS B 1 22 ? 4.730  44.479 33.439 1.00 32.21 ? 276 LYS B CD  1 
ATOM   657  C CE  . LYS B 1 22 ? 3.772  45.376 32.659 1.00 35.06 ? 276 LYS B CE  1 
ATOM   658  N NZ  . LYS B 1 22 ? 2.398  44.807 32.506 1.00 41.27 ? 276 LYS B NZ  1 
ATOM   659  N N   . ARG B 1 23 ? 8.399  44.166 37.353 1.00 24.33 ? 277 ARG B N   1 
ATOM   660  C CA  . ARG B 1 23 ? 9.084  43.359 38.352 1.00 22.62 ? 277 ARG B CA  1 
ATOM   661  C C   . ARG B 1 23 ? 9.276  41.963 37.781 1.00 19.31 ? 277 ARG B C   1 
ATOM   662  O O   . ARG B 1 23 ? 8.341  41.377 37.235 1.00 19.90 ? 277 ARG B O   1 
ATOM   663  C CB  . ARG B 1 23 ? 8.258  43.288 39.639 1.00 24.26 ? 277 ARG B CB  1 
ATOM   664  C CG  . ARG B 1 23 ? 8.769  42.277 40.659 1.00 22.75 ? 277 ARG B CG  1 
ATOM   665  C CD  . ARG B 1 23 ? 7.913  42.288 41.910 1.00 24.72 ? 277 ARG B CD  1 
ATOM   666  N NE  . ARG B 1 23 ? 6.499  42.052 41.624 1.00 29.75 ? 277 ARG B NE  1 
ATOM   667  C CZ  . ARG B 1 23 ? 5.985  40.872 41.289 1.00 34.07 ? 277 ARG B CZ  1 
ATOM   668  N NH1 . ARG B 1 23 ? 6.770  39.803 41.191 1.00 37.94 ? 277 ARG B NH1 1 
ATOM   669  N NH2 . ARG B 1 23 ? 4.678  40.753 41.079 1.00 27.02 ? 277 ARG B NH2 1 
ATOM   670  N N   . GLY B 1 24 ? 10.496 41.451 37.878 1.00 16.28 ? 278 GLY B N   1 
ATOM   671  C CA  . GLY B 1 24 ? 10.767 40.124 37.370 1.00 19.49 ? 278 GLY B CA  1 
ATOM   672  C C   . GLY B 1 24 ? 11.548 40.141 36.075 1.00 25.37 ? 278 GLY B C   1 
ATOM   673  O O   . GLY B 1 24 ? 12.226 39.164 35.752 1.00 29.66 ? 278 GLY B O   1 
ATOM   674  N N   . ASP B 1 25 ? 11.465 41.248 35.341 1.00 25.68 ? 279 ASP B N   1 
ATOM   675  C CA  . ASP B 1 25 ? 12.175 41.387 34.074 1.00 21.40 ? 279 ASP B CA  1 
ATOM   676  C C   . ASP B 1 25 ? 13.685 41.378 34.260 1.00 22.74 ? 279 ASP B C   1 
ATOM   677  O O   . ASP B 1 25 ? 14.202 41.856 35.269 1.00 22.53 ? 279 ASP B O   1 
ATOM   678  C CB  . ASP B 1 25 ? 11.764 42.673 33.354 1.00 16.40 ? 279 ASP B CB  1 
ATOM   679  C CG  . ASP B 1 25 ? 10.335 42.637 32.863 1.00 17.50 ? 279 ASP B CG  1 
ATOM   680  O OD1 . ASP B 1 25 ? 9.669  41.593 33.021 1.00 23.49 ? 279 ASP B OD1 1 
ATOM   681  O OD2 . ASP B 1 25 ? 9.872  43.662 32.319 1.00 21.86 ? 279 ASP B OD2 1 
ATOM   682  N N   . VAL B 1 26 ? 14.384 40.796 33.295 1.00 25.30 ? 280 VAL B N   1 
ATOM   683  C CA  . VAL B 1 26 ? 15.837 40.733 33.331 1.00 23.82 ? 280 VAL B CA  1 
ATOM   684  C C   . VAL B 1 26 ? 16.354 41.732 32.303 1.00 26.90 ? 280 VAL B C   1 
ATOM   685  O O   . VAL B 1 26 ? 16.002 41.670 31.122 1.00 29.93 ? 280 VAL B O   1 
ATOM   686  C CB  . VAL B 1 26 ? 16.358 39.313 33.004 1.00 19.97 ? 280 VAL B CB  1 
ATOM   687  C CG1 . VAL B 1 26 ? 17.871 39.288 33.032 1.00 20.81 ? 280 VAL B CG1 1 
ATOM   688  C CG2 . VAL B 1 26 ? 15.797 38.300 33.996 1.00 24.52 ? 280 VAL B CG2 1 
ATOM   689  N N   . ILE B 1 27 ? 17.145 42.686 32.775 1.00 27.08 ? 281 ILE B N   1 
ATOM   690  C CA  . ILE B 1 27 ? 17.704 43.721 31.918 1.00 22.01 ? 281 ILE B CA  1 
ATOM   691  C C   . ILE B 1 27 ? 19.185 43.466 31.649 1.00 21.97 ? 281 ILE B C   1 
ATOM   692  O O   . ILE B 1 27 ? 19.932 43.069 32.543 1.00 23.33 ? 281 ILE B O   1 
ATOM   693  C CB  . ILE B 1 27 ? 17.552 45.135 32.566 1.00 20.22 ? 281 ILE B CB  1 
ATOM   694  C CG1 . ILE B 1 27 ? 16.081 45.466 32.827 1.00 19.11 ? 281 ILE B CG1 1 
ATOM   695  C CG2 . ILE B 1 27 ? 18.157 46.205 31.679 1.00 15.71 ? 281 ILE B CG2 1 
ATOM   696  C CD1 . ILE B 1 27 ? 15.570 44.995 34.171 1.00 28.01 ? 281 ILE B CD1 1 
ATOM   697  N N   . THR B 1 28 ? 19.596 43.658 30.402 1.00 22.03 ? 282 THR B N   1 
ATOM   698  C CA  . THR B 1 28 ? 20.997 43.490 30.042 1.00 23.71 ? 282 THR B CA  1 
ATOM   699  C C   . THR B 1 28 ? 21.657 44.772 30.516 1.00 26.30 ? 282 THR B C   1 
ATOM   700  O O   . THR B 1 28 ? 21.086 45.848 30.376 1.00 29.42 ? 282 THR B O   1 
ATOM   701  C CB  . THR B 1 28 ? 21.186 43.384 28.530 1.00 20.08 ? 282 THR B CB  1 
ATOM   702  O OG1 . THR B 1 28 ? 20.411 42.293 28.026 1.00 25.47 ? 282 THR B OG1 1 
ATOM   703  C CG2 . THR B 1 28 ? 22.643 43.155 28.203 1.00 14.81 ? 282 THR B CG2 1 
ATOM   704  N N   . LEU B 1 29 ? 22.845 44.668 31.094 1.00 30.13 ? 283 LEU B N   1 
ATOM   705  C CA  . LEU B 1 29 ? 23.517 45.857 31.588 1.00 33.01 ? 283 LEU B CA  1 
ATOM   706  C C   . LEU B 1 29 ? 24.557 46.385 30.610 1.00 33.82 ? 283 LEU B C   1 
ATOM   707  O O   . LEU B 1 29 ? 25.549 45.715 30.313 1.00 37.72 ? 283 LEU B O   1 
ATOM   708  C CB  . LEU B 1 29 ? 24.147 45.583 32.957 1.00 36.70 ? 283 LEU B CB  1 
ATOM   709  C CG  . LEU B 1 29 ? 24.280 46.801 33.875 1.00 38.60 ? 283 LEU B CG  1 
ATOM   710  C CD1 . LEU B 1 29 ? 22.916 47.458 34.066 1.00 37.16 ? 283 LEU B CD1 1 
ATOM   711  C CD2 . LEU B 1 29 ? 24.869 46.377 35.212 1.00 40.21 ? 283 LEU B CD2 1 
ATOM   712  N N   . ILE B 1 30 ? 24.308 47.591 30.106 1.00 34.75 ? 284 ILE B N   1 
ATOM   713  C CA  . ILE B 1 30 ? 25.206 48.249 29.162 1.00 34.80 ? 284 ILE B CA  1 
ATOM   714  C C   . ILE B 1 30 ? 26.250 49.085 29.908 1.00 38.46 ? 284 ILE B C   1 
ATOM   715  O O   . ILE B 1 30 ? 27.456 48.897 29.722 1.00 36.50 ? 284 ILE B O   1 
ATOM   716  C CB  . ILE B 1 30 ? 24.415 49.167 28.202 1.00 34.09 ? 284 ILE B CB  1 
ATOM   717  C CG1 . ILE B 1 30 ? 23.300 48.372 27.521 1.00 31.99 ? 284 ILE B CG1 1 
ATOM   718  C CG2 . ILE B 1 30 ? 25.343 49.767 27.158 1.00 34.05 ? 284 ILE B CG2 1 
ATOM   719  C CD1 . ILE B 1 30 ? 22.359 49.212 26.699 1.00 29.71 ? 284 ILE B CD1 1 
ATOM   720  N N   . ASN B 1 31 ? 25.776 49.986 30.769 1.00 41.55 ? 285 ASN B N   1 
ATOM   721  C CA  . ASN B 1 31 ? 26.646 50.868 31.549 1.00 41.93 ? 285 ASN B CA  1 
ATOM   722  C C   . ASN B 1 31 ? 26.276 50.881 33.025 1.00 42.50 ? 285 ASN B C   1 
ATOM   723  O O   . ASN B 1 31 ? 25.196 50.438 33.417 1.00 40.76 ? 285 ASN B O   1 
ATOM   724  C CB  . ASN B 1 31 ? 26.549 52.312 31.040 1.00 44.18 ? 285 ASN B CB  1 
ATOM   725  C CG  . ASN B 1 31 ? 26.949 52.457 29.587 1.00 51.40 ? 285 ASN B CG  1 
ATOM   726  O OD1 . ASN B 1 31 ? 26.100 52.434 28.693 1.00 54.42 ? 285 ASN B OD1 1 
ATOM   727  N ND2 . ASN B 1 31 ? 28.241 52.634 29.342 1.00 55.62 ? 285 ASN B ND2 1 
ATOM   728  N N   . LYS B 1 32 ? 27.176 51.455 33.821 1.00 46.84 ? 286 LYS B N   1 
ATOM   729  C CA  . LYS B 1 32 ? 27.010 51.601 35.267 1.00 49.82 ? 286 LYS B CA  1 
ATOM   730  C C   . LYS B 1 32 ? 27.595 52.950 35.679 1.00 52.98 ? 286 LYS B C   1 
ATOM   731  O O   . LYS B 1 32 ? 27.619 53.295 36.863 1.00 54.24 ? 286 LYS B O   1 
ATOM   732  C CB  . LYS B 1 32 ? 27.748 50.492 36.014 1.00 49.51 ? 286 LYS B CB  1 
ATOM   733  C CG  . LYS B 1 32 ? 26.852 49.598 36.841 1.00 47.46 ? 286 LYS B CG  1 
ATOM   734  C CD  . LYS B 1 32 ? 27.638 48.940 37.954 1.00 55.58 ? 286 LYS B CD  1 
ATOM   735  C CE  . LYS B 1 32 ? 27.545 47.430 37.884 1.00 58.01 ? 286 LYS B CE  1 
ATOM   736  N NZ  . LYS B 1 32 ? 28.307 46.796 38.993 1.00 63.57 ? 286 LYS B NZ  1 
ATOM   737  N N   . ASP B 1 33 ? 28.071 53.690 34.677 1.00 56.81 ? 287 ASP B N   1 
ATOM   738  C CA  . ASP B 1 33 ? 28.689 55.010 34.825 1.00 59.01 ? 287 ASP B CA  1 
ATOM   739  C C   . ASP B 1 33 ? 28.164 55.816 36.011 1.00 58.35 ? 287 ASP B C   1 
ATOM   740  O O   . ASP B 1 33 ? 28.916 56.140 36.928 1.00 61.08 ? 287 ASP B O   1 
ATOM   741  C CB  . ASP B 1 33 ? 28.507 55.814 33.532 1.00 62.58 ? 287 ASP B CB  1 
ATOM   742  C CG  . ASP B 1 33 ? 29.148 55.142 32.322 1.00 67.87 ? 287 ASP B CG  1 
ATOM   743  O OD1 . ASP B 1 33 ? 29.052 53.904 32.188 1.00 72.68 ? 287 ASP B OD1 1 
ATOM   744  O OD2 . ASP B 1 33 ? 29.742 55.860 31.492 1.00 72.36 ? 287 ASP B OD2 1 
ATOM   745  N N   . ASP B 1 34 ? 26.872 56.140 35.979 1.00 54.09 ? 288 ASP B N   1 
ATOM   746  C CA  . ASP B 1 34 ? 26.228 56.889 37.054 1.00 49.63 ? 288 ASP B CA  1 
ATOM   747  C C   . ASP B 1 34 ? 25.832 55.884 38.142 1.00 46.73 ? 288 ASP B C   1 
ATOM   748  O O   . ASP B 1 34 ? 25.102 54.925 37.871 1.00 46.27 ? 288 ASP B O   1 
ATOM   749  C CB  . ASP B 1 34 ? 24.983 57.614 36.508 1.00 48.40 ? 288 ASP B CB  1 
ATOM   750  C CG  . ASP B 1 34 ? 24.374 58.606 37.504 1.00 47.88 ? 288 ASP B CG  1 
ATOM   751  O OD1 . ASP B 1 34 ? 24.530 58.429 38.729 1.00 48.33 ? 288 ASP B OD1 1 
ATOM   752  O OD2 . ASP B 1 34 ? 23.716 59.569 37.056 1.00 48.07 ? 288 ASP B OD2 1 
ATOM   753  N N   . PRO B 1 35 ? 26.311 56.089 39.386 1.00 44.08 ? 289 PRO B N   1 
ATOM   754  C CA  . PRO B 1 35 ? 26.027 55.212 40.532 1.00 40.97 ? 289 PRO B CA  1 
ATOM   755  C C   . PRO B 1 35 ? 24.537 55.060 40.898 1.00 39.54 ? 289 PRO B C   1 
ATOM   756  O O   . PRO B 1 35 ? 24.168 54.187 41.689 1.00 45.26 ? 289 PRO B O   1 
ATOM   757  C CB  . PRO B 1 35 ? 26.837 55.856 41.661 1.00 39.73 ? 289 PRO B CB  1 
ATOM   758  C CG  . PRO B 1 35 ? 26.870 57.313 41.267 1.00 39.54 ? 289 PRO B CG  1 
ATOM   759  C CD  . PRO B 1 35 ? 27.179 57.206 39.793 1.00 42.43 ? 289 PRO B CD  1 
ATOM   760  N N   . ASN B 1 36 ? 23.689 55.878 40.283 1.00 36.71 ? 290 ASN B N   1 
ATOM   761  C CA  . ASN B 1 36 ? 22.249 55.845 40.543 1.00 32.03 ? 290 ASN B CA  1 
ATOM   762  C C   . ASN B 1 36 ? 21.436 55.466 39.312 1.00 30.81 ? 290 ASN B C   1 
ATOM   763  O O   . ASN B 1 36 ? 20.341 54.916 39.428 1.00 31.88 ? 290 ASN B O   1 
ATOM   764  C CB  . ASN B 1 36 ? 21.779 57.206 41.065 1.00 33.82 ? 290 ASN B CB  1 
ATOM   765  C CG  . ASN B 1 36 ? 22.415 57.575 42.390 1.00 39.08 ? 290 ASN B CG  1 
ATOM   766  O OD1 . ASN B 1 36 ? 23.240 58.485 42.459 1.00 42.04 ? 290 ASN B OD1 1 
ATOM   767  N ND2 . ASN B 1 36 ? 22.043 56.860 43.450 1.00 36.43 ? 290 ASN B ND2 1 
ATOM   768  N N   . TRP B 1 37 ? 21.960 55.785 38.133 1.00 29.04 ? 291 TRP B N   1 
ATOM   769  C CA  . TRP B 1 37 ? 21.272 55.482 36.887 1.00 24.68 ? 291 TRP B CA  1 
ATOM   770  C C   . TRP B 1 37 ? 22.145 54.623 35.997 1.00 27.10 ? 291 TRP B C   1 
ATOM   771  O O   . TRP B 1 37 ? 23.231 55.030 35.580 1.00 30.55 ? 291 TRP B O   1 
ATOM   772  C CB  . TRP B 1 37 ? 20.871 56.770 36.157 1.00 19.09 ? 291 TRP B CB  1 
ATOM   773  C CG  . TRP B 1 37 ? 19.819 57.555 36.879 1.00 19.86 ? 291 TRP B CG  1 
ATOM   774  C CD1 . TRP B 1 37 ? 20.019 58.469 37.876 1.00 21.44 ? 291 TRP B CD1 1 
ATOM   775  C CD2 . TRP B 1 37 ? 18.402 57.461 36.698 1.00 17.78 ? 291 TRP B CD2 1 
ATOM   776  N NE1 . TRP B 1 37 ? 18.812 58.942 38.333 1.00 19.48 ? 291 TRP B NE1 1 
ATOM   777  C CE2 . TRP B 1 37 ? 17.803 58.344 37.628 1.00 18.11 ? 291 TRP B CE2 1 
ATOM   778  C CE3 . TRP B 1 37 ? 17.573 56.723 35.845 1.00 14.79 ? 291 TRP B CE3 1 
ATOM   779  C CZ2 . TRP B 1 37 ? 16.417 58.501 37.727 1.00 22.92 ? 291 TRP B CZ2 1 
ATOM   780  C CZ3 . TRP B 1 37 ? 16.193 56.881 35.944 1.00 14.29 ? 291 TRP B CZ3 1 
ATOM   781  C CH2 . TRP B 1 37 ? 15.631 57.764 36.878 1.00 23.60 ? 291 TRP B CH2 1 
ATOM   782  N N   . TRP B 1 38 ? 21.679 53.409 35.746 1.00 24.52 ? 292 TRP B N   1 
ATOM   783  C CA  . TRP B 1 38 ? 22.407 52.479 34.902 1.00 23.50 ? 292 TRP B CA  1 
ATOM   784  C C   . TRP B 1 38 ? 21.726 52.390 33.549 1.00 18.55 ? 292 TRP B C   1 
ATOM   785  O O   . TRP B 1 38 ? 20.531 52.655 33.434 1.00 16.16 ? 292 TRP B O   1 
ATOM   786  C CB  . TRP B 1 38 ? 22.439 51.098 35.556 1.00 29.14 ? 292 TRP B CB  1 
ATOM   787  C CG  . TRP B 1 38 ? 23.215 51.042 36.839 1.00 35.25 ? 292 TRP B CG  1 
ATOM   788  C CD1 . TRP B 1 38 ? 24.071 51.989 37.328 1.00 36.26 ? 292 TRP B CD1 1 
ATOM   789  C CD2 . TRP B 1 38 ? 23.232 49.964 37.780 1.00 37.13 ? 292 TRP B CD2 1 
ATOM   790  N NE1 . TRP B 1 38 ? 24.624 51.563 38.514 1.00 34.50 ? 292 TRP B NE1 1 
ATOM   791  C CE2 . TRP B 1 38 ? 24.126 50.323 38.814 1.00 38.24 ? 292 TRP B CE2 1 
ATOM   792  C CE3 . TRP B 1 38 ? 22.578 48.725 37.848 1.00 33.89 ? 292 TRP B CE3 1 
ATOM   793  C CZ2 . TRP B 1 38 ? 24.385 49.486 39.904 1.00 38.19 ? 292 TRP B CZ2 1 
ATOM   794  C CZ3 . TRP B 1 38 ? 22.835 47.895 38.933 1.00 31.33 ? 292 TRP B CZ3 1 
ATOM   795  C CH2 . TRP B 1 38 ? 23.732 48.279 39.944 1.00 34.31 ? 292 TRP B CH2 1 
ATOM   796  N N   . GLU B 1 39 ? 22.491 52.046 32.520 1.00 21.29 ? 293 GLU B N   1 
ATOM   797  C CA  . GLU B 1 39 ? 21.923 51.910 31.187 1.00 24.02 ? 293 GLU B CA  1 
ATOM   798  C C   . GLU B 1 39 ? 21.794 50.438 30.796 1.00 23.03 ? 293 GLU B C   1 
ATOM   799  O O   . GLU B 1 39 ? 22.753 49.671 30.896 1.00 19.77 ? 293 GLU B O   1 
ATOM   800  C CB  . GLU B 1 39 ? 22.744 52.677 30.150 1.00 25.02 ? 293 GLU B CB  1 
ATOM   801  C CG  . GLU B 1 39 ? 22.122 52.632 28.763 1.00 26.37 ? 293 GLU B CG  1 
ATOM   802  C CD  . GLU B 1 39 ? 22.691 53.654 27.809 1.00 26.47 ? 293 GLU B CD  1 
ATOM   803  O OE1 . GLU B 1 39 ? 23.905 53.941 27.874 1.00 30.74 ? 293 GLU B OE1 1 
ATOM   804  O OE2 . GLU B 1 39 ? 21.912 54.168 26.983 1.00 30.53 ? 293 GLU B OE2 1 
ATOM   805  N N   . GLY B 1 40 ? 20.598 50.055 30.360 1.00 23.40 ? 294 GLY B N   1 
ATOM   806  C CA  . GLY B 1 40 ? 20.360 48.680 29.971 1.00 26.53 ? 294 GLY B CA  1 
ATOM   807  C C   . GLY B 1 40 ? 19.391 48.502 28.819 1.00 28.54 ? 294 GLY B C   1 
ATOM   808  O O   . GLY B 1 40 ? 18.757 49.459 28.367 1.00 29.98 ? 294 GLY B O   1 
ATOM   809  N N   . GLN B 1 41 ? 19.260 47.255 28.368 1.00 29.36 ? 295 GLN B N   1 
ATOM   810  C CA  . GLN B 1 41 ? 18.384 46.909 27.255 1.00 26.55 ? 295 GLN B CA  1 
ATOM   811  C C   . GLN B 1 41 ? 17.397 45.795 27.625 1.00 26.12 ? 295 GLN B C   1 
ATOM   812  O O   . GLN B 1 41 ? 17.770 44.803 28.258 1.00 19.83 ? 295 GLN B O   1 
ATOM   813  C CB  . GLN B 1 41 ? 19.237 46.482 26.048 1.00 31.60 ? 295 GLN B CB  1 
ATOM   814  C CG  . GLN B 1 41 ? 18.471 46.299 24.735 1.00 34.68 ? 295 GLN B CG  1 
ATOM   815  C CD  . GLN B 1 41 ? 18.855 47.318 23.667 1.00 33.35 ? 295 GLN B CD  1 
ATOM   816  O OE1 . GLN B 1 41 ? 19.962 47.867 23.674 1.00 34.39 ? 295 GLN B OE1 1 
ATOM   817  N NE2 . GLN B 1 41 ? 17.940 47.568 22.739 1.00 37.57 ? 295 GLN B NE2 1 
ATOM   818  N N   . LEU B 1 42 ? 16.137 45.983 27.236 1.00 28.36 ? 296 LEU B N   1 
ATOM   819  C CA  . LEU B 1 42 ? 15.074 45.012 27.485 1.00 29.91 ? 296 LEU B CA  1 
ATOM   820  C C   . LEU B 1 42 ? 14.348 44.809 26.154 1.00 31.28 ? 296 LEU B C   1 
ATOM   821  O O   . LEU B 1 42 ? 13.352 45.475 25.860 1.00 32.58 ? 296 LEU B O   1 
ATOM   822  C CB  . LEU B 1 42 ? 14.113 45.525 28.562 1.00 29.55 ? 296 LEU B CB  1 
ATOM   823  C CG  . LEU B 1 42 ? 13.047 44.554 29.088 1.00 31.24 ? 296 LEU B CG  1 
ATOM   824  C CD1 . LEU B 1 42 ? 13.708 43.300 29.646 1.00 29.33 ? 296 LEU B CD1 1 
ATOM   825  C CD2 . LEU B 1 42 ? 12.205 45.237 30.158 1.00 27.30 ? 296 LEU B CD2 1 
ATOM   826  N N   . ASN B 1 43 ? 14.882 43.877 25.364 1.00 35.98 ? 297 ASN B N   1 
ATOM   827  C CA  . ASN B 1 43 ? 14.407 43.527 24.022 1.00 33.29 ? 297 ASN B CA  1 
ATOM   828  C C   . ASN B 1 43 ? 14.752 44.655 23.039 1.00 30.70 ? 297 ASN B C   1 
ATOM   829  O O   . ASN B 1 43 ? 15.928 44.959 22.843 1.00 30.31 ? 297 ASN B O   1 
ATOM   830  C CB  . ASN B 1 43 ? 12.906 43.175 23.999 1.00 29.09 ? 297 ASN B CB  1 
ATOM   831  C CG  . ASN B 1 43 ? 12.487 42.440 22.713 1.00 26.75 ? 297 ASN B CG  1 
ATOM   832  O OD1 . ASN B 1 43 ? 13.296 41.777 22.062 1.00 26.74 ? 297 ASN B OD1 1 
ATOM   833  N ND2 . ASN B 1 43 ? 11.220 42.564 22.352 1.00 25.00 ? 297 ASN B ND2 1 
ATOM   834  N N   . ASN B 1 44 ? 13.742 45.304 22.466 1.00 36.26 ? 298 ASN B N   1 
ATOM   835  C CA  . ASN B 1 44 ? 13.960 46.384 21.502 1.00 38.31 ? 298 ASN B CA  1 
ATOM   836  C C   . ASN B 1 44 ? 14.297 47.730 22.147 1.00 39.03 ? 298 ASN B C   1 
ATOM   837  O O   . ASN B 1 44 ? 14.922 48.591 21.521 1.00 37.76 ? 298 ASN B O   1 
ATOM   838  C CB  . ASN B 1 44 ? 12.718 46.542 20.620 1.00 41.17 ? 298 ASN B CB  1 
ATOM   839  C CG  . ASN B 1 44 ? 12.296 45.237 19.965 1.00 44.67 ? 298 ASN B CG  1 
ATOM   840  O OD1 . ASN B 1 44 ? 13.137 44.419 19.586 1.00 45.96 ? 298 ASN B OD1 1 
ATOM   841  N ND2 . ASN B 1 44 ? 10.990 45.032 19.839 1.00 45.57 ? 298 ASN B ND2 1 
ATOM   842  N N   . ARG B 1 45 ? 13.900 47.886 23.407 1.00 37.43 ? 299 ARG B N   1 
ATOM   843  C CA  . ARG B 1 45 ? 14.106 49.124 24.154 1.00 33.79 ? 299 ARG B CA  1 
ATOM   844  C C   . ARG B 1 45 ? 15.463 49.303 24.833 1.00 31.38 ? 299 ARG B C   1 
ATOM   845  O O   . ARG B 1 45 ? 16.044 48.355 25.360 1.00 30.70 ? 299 ARG B O   1 
ATOM   846  C CB  . ARG B 1 45 ? 12.995 49.271 25.194 1.00 40.39 ? 299 ARG B CB  1 
ATOM   847  C CG  . ARG B 1 45 ? 11.605 49.145 24.612 1.00 51.39 ? 299 ARG B CG  1 
ATOM   848  C CD  . ARG B 1 45 ? 10.545 49.105 25.693 1.00 64.22 ? 299 ARG B CD  1 
ATOM   849  N NE  . ARG B 1 45 ? 9.226  48.840 25.124 1.00 74.13 ? 299 ARG B NE  1 
ATOM   850  C CZ  . ARG B 1 45 ? 8.083  48.933 25.797 1.00 78.52 ? 299 ARG B CZ  1 
ATOM   851  N NH1 . ARG B 1 45 ? 8.087  49.290 27.076 1.00 81.42 ? 299 ARG B NH1 1 
ATOM   852  N NH2 . ARG B 1 45 ? 6.933  48.668 25.190 1.00 76.38 ? 299 ARG B NH2 1 
ATOM   853  N N   . ARG B 1 46 ? 15.950 50.542 24.820 1.00 30.21 ? 300 ARG B N   1 
ATOM   854  C CA  . ARG B 1 46 ? 17.215 50.907 25.450 1.00 27.92 ? 300 ARG B CA  1 
ATOM   855  C C   . ARG B 1 46 ? 17.004 52.193 26.249 1.00 30.66 ? 300 ARG B C   1 
ATOM   856  O O   . ARG B 1 46 ? 16.193 53.041 25.871 1.00 29.60 ? 300 ARG B O   1 
ATOM   857  C CB  . ARG B 1 46 ? 18.326 51.109 24.410 1.00 23.55 ? 300 ARG B CB  1 
ATOM   858  C CG  . ARG B 1 46 ? 19.672 51.513 25.018 1.00 14.99 ? 300 ARG B CG  1 
ATOM   859  C CD  . ARG B 1 46 ? 20.810 51.433 24.016 1.00 16.37 ? 300 ARG B CD  1 
ATOM   860  N NE  . ARG B 1 46 ? 22.063 51.949 24.569 1.00 15.91 ? 300 ARG B NE  1 
ATOM   861  C CZ  . ARG B 1 46 ? 23.277 51.640 24.117 1.00 19.87 ? 300 ARG B CZ  1 
ATOM   862  N NH1 . ARG B 1 46 ? 23.420 50.802 23.095 1.00 29.46 ? 300 ARG B NH1 1 
ATOM   863  N NH2 . ARG B 1 46 ? 24.354 52.177 24.677 1.00 18.39 ? 300 ARG B NH2 1 
ATOM   864  N N   . GLY B 1 47 ? 17.711 52.314 27.370 1.00 30.97 ? 301 GLY B N   1 
ATOM   865  C CA  . GLY B 1 47 ? 17.586 53.500 28.197 1.00 26.68 ? 301 GLY B CA  1 
ATOM   866  C C   . GLY B 1 47 ? 18.209 53.333 29.565 1.00 25.11 ? 301 GLY B C   1 
ATOM   867  O O   . GLY B 1 47 ? 18.869 52.327 29.839 1.00 23.19 ? 301 GLY B O   1 
ATOM   868  N N   . ILE B 1 48 ? 18.018 54.334 30.417 1.00 24.71 ? 302 ILE B N   1 
ATOM   869  C CA  . ILE B 1 48 ? 18.553 54.302 31.772 1.00 23.93 ? 302 ILE B CA  1 
ATOM   870  C C   . ILE B 1 48 ? 17.471 54.027 32.814 1.00 21.82 ? 302 ILE B C   1 
ATOM   871  O O   . ILE B 1 48 ? 16.292 54.321 32.606 1.00 17.40 ? 302 ILE B O   1 
ATOM   872  C CB  . ILE B 1 48 ? 19.292 55.609 32.137 1.00 27.14 ? 302 ILE B CB  1 
ATOM   873  C CG1 . ILE B 1 48 ? 18.367 56.818 31.952 1.00 24.22 ? 302 ILE B CG1 1 
ATOM   874  C CG2 . ILE B 1 48 ? 20.582 55.721 31.331 1.00 20.38 ? 302 ILE B CG2 1 
ATOM   875  C CD1 . ILE B 1 48 ? 18.993 58.137 32.334 1.00 22.29 ? 302 ILE B CD1 1 
ATOM   876  N N   . PHE B 1 49 ? 17.896 53.491 33.951 1.00 23.42 ? 303 PHE B N   1 
ATOM   877  C CA  . PHE B 1 49 ? 16.982 53.152 35.033 1.00 20.35 ? 303 PHE B CA  1 
ATOM   878  C C   . PHE B 1 49 ? 17.655 53.309 36.404 1.00 18.59 ? 303 PHE B C   1 
ATOM   879  O O   . PHE B 1 49 ? 18.888 53.313 36.515 1.00 17.97 ? 303 PHE B O   1 
ATOM   880  C CB  . PHE B 1 49 ? 16.496 51.706 34.847 1.00 20.07 ? 303 PHE B CB  1 
ATOM   881  C CG  . PHE B 1 49 ? 17.614 50.696 34.794 1.00 22.19 ? 303 PHE B CG  1 
ATOM   882  C CD1 . PHE B 1 49 ? 18.255 50.411 33.593 1.00 22.95 ? 303 PHE B CD1 1 
ATOM   883  C CD2 . PHE B 1 49 ? 18.053 50.060 35.953 1.00 17.81 ? 303 PHE B CD2 1 
ATOM   884  C CE1 . PHE B 1 49 ? 19.323 49.510 33.548 1.00 24.05 ? 303 PHE B CE1 1 
ATOM   885  C CE2 . PHE B 1 49 ? 19.116 49.162 35.917 1.00 18.15 ? 303 PHE B CE2 1 
ATOM   886  C CZ  . PHE B 1 49 ? 19.752 48.886 34.714 1.00 19.56 ? 303 PHE B CZ  1 
ATOM   887  N N   . PRO B 1 50 ? 16.849 53.497 37.461 1.00 17.02 ? 304 PRO B N   1 
ATOM   888  C CA  . PRO B 1 50 ? 17.342 53.656 38.834 1.00 19.54 ? 304 PRO B CA  1 
ATOM   889  C C   . PRO B 1 50 ? 17.975 52.362 39.369 1.00 17.44 ? 304 PRO B C   1 
ATOM   890  O O   . PRO B 1 50 ? 17.323 51.323 39.437 1.00 18.88 ? 304 PRO B O   1 
ATOM   891  C CB  . PRO B 1 50 ? 16.078 54.053 39.607 1.00 21.82 ? 304 PRO B CB  1 
ATOM   892  C CG  . PRO B 1 50 ? 14.961 53.460 38.799 1.00 16.61 ? 304 PRO B CG  1 
ATOM   893  C CD  . PRO B 1 50 ? 15.397 53.723 37.391 1.00 16.47 ? 304 PRO B CD  1 
ATOM   894  N N   . SER B 1 51 ? 19.247 52.441 39.749 1.00 16.04 ? 305 SER B N   1 
ATOM   895  C CA  . SER B 1 51 ? 19.995 51.291 40.256 1.00 20.40 ? 305 SER B CA  1 
ATOM   896  C C   . SER B 1 51 ? 19.419 50.616 41.499 1.00 24.93 ? 305 SER B C   1 
ATOM   897  O O   . SER B 1 51 ? 19.806 49.496 41.828 1.00 27.93 ? 305 SER B O   1 
ATOM   898  C CB  . SER B 1 51 ? 21.453 51.681 40.520 1.00 16.75 ? 305 SER B CB  1 
ATOM   899  O OG  . SER B 1 51 ? 21.558 52.637 41.561 1.00 19.09 ? 305 SER B OG  1 
ATOM   900  N N   . ASN B 1 52 ? 18.511 51.301 42.190 1.00 26.78 ? 306 ASN B N   1 
ATOM   901  C CA  . ASN B 1 52 ? 17.897 50.767 43.401 1.00 25.75 ? 306 ASN B CA  1 
ATOM   902  C C   . ASN B 1 52 ? 16.638 49.939 43.121 1.00 26.78 ? 306 ASN B C   1 
ATOM   903  O O   . ASN B 1 52 ? 15.982 49.449 44.044 1.00 25.32 ? 306 ASN B O   1 
ATOM   904  C CB  . ASN B 1 52 ? 17.598 51.904 44.396 1.00 29.54 ? 306 ASN B CB  1 
ATOM   905  C CG  . ASN B 1 52 ? 16.590 52.921 43.862 1.00 31.77 ? 306 ASN B CG  1 
ATOM   906  O OD1 . ASN B 1 52 ? 16.521 53.185 42.659 1.00 27.87 ? 306 ASN B OD1 1 
ATOM   907  N ND2 . ASN B 1 52 ? 15.806 53.499 44.767 1.00 30.78 ? 306 ASN B ND2 1 
ATOM   908  N N   . TYR B 1 53 ? 16.305 49.801 41.840 1.00 27.63 ? 307 TYR B N   1 
ATOM   909  C CA  . TYR B 1 53 ? 15.141 49.028 41.412 1.00 26.57 ? 307 TYR B CA  1 
ATOM   910  C C   . TYR B 1 53 ? 15.535 47.637 40.904 1.00 23.53 ? 307 TYR B C   1 
ATOM   911  O O   . TYR B 1 53 ? 14.668 46.827 40.567 1.00 25.40 ? 307 TYR B O   1 
ATOM   912  C CB  . TYR B 1 53 ? 14.371 49.776 40.317 1.00 15.96 ? 307 TYR B CB  1 
ATOM   913  C CG  . TYR B 1 53 ? 13.308 50.710 40.841 1.00 13.40 ? 307 TYR B CG  1 
ATOM   914  C CD1 . TYR B 1 53 ? 13.631 51.754 41.717 1.00 17.08 ? 307 TYR B CD1 1 
ATOM   915  C CD2 . TYR B 1 53 ? 11.975 50.545 40.475 1.00 8.99  ? 307 TYR B CD2 1 
ATOM   916  C CE1 . TYR B 1 53 ? 12.645 52.605 42.217 1.00 12.31 ? 307 TYR B CE1 1 
ATOM   917  C CE2 . TYR B 1 53 ? 10.981 51.390 40.972 1.00 13.76 ? 307 TYR B CE2 1 
ATOM   918  C CZ  . TYR B 1 53 ? 11.322 52.415 41.844 1.00 15.39 ? 307 TYR B CZ  1 
ATOM   919  O OH  . TYR B 1 53 ? 10.335 53.221 42.363 1.00 20.26 ? 307 TYR B OH  1 
ATOM   920  N N   . VAL B 1 54 ? 16.836 47.363 40.853 1.00 19.82 ? 308 VAL B N   1 
ATOM   921  C CA  . VAL B 1 54 ? 17.317 46.077 40.371 1.00 24.12 ? 308 VAL B CA  1 
ATOM   922  C C   . VAL B 1 54 ? 18.354 45.413 41.273 1.00 27.87 ? 308 VAL B C   1 
ATOM   923  O O   . VAL B 1 54 ? 18.972 46.053 42.125 1.00 24.88 ? 308 VAL B O   1 
ATOM   924  C CB  . VAL B 1 54 ? 17.926 46.187 38.936 1.00 21.73 ? 308 VAL B CB  1 
ATOM   925  C CG1 . VAL B 1 54 ? 16.930 46.824 37.975 1.00 15.90 ? 308 VAL B CG1 1 
ATOM   926  C CG2 . VAL B 1 54 ? 19.245 46.961 38.959 1.00 14.85 ? 308 VAL B CG2 1 
ATOM   927  N N   . CYS B 1 55 ? 18.525 44.113 41.059 1.00 33.76 ? 309 CYS B N   1 
ATOM   928  C CA  . CYS B 1 55 ? 19.484 43.290 41.784 1.00 38.32 ? 309 CYS B CA  1 
ATOM   929  C C   . CYS B 1 55 ? 20.205 42.428 40.743 1.00 38.47 ? 309 CYS B C   1 
ATOM   930  O O   . CYS B 1 55 ? 19.663 42.164 39.668 1.00 39.05 ? 309 CYS B O   1 
ATOM   931  C CB  . CYS B 1 55 ? 18.761 42.408 42.807 1.00 38.55 ? 309 CYS B CB  1 
ATOM   932  S SG  . CYS B 1 55 ? 18.951 42.969 44.531 1.00 46.77 ? 309 CYS B SG  1 
ATOM   933  N N   . PRO B 1 56 ? 21.441 41.989 41.037 1.00 37.98 ? 310 PRO B N   1 
ATOM   934  C CA  . PRO B 1 56 ? 22.239 41.159 40.125 1.00 39.96 ? 310 PRO B CA  1 
ATOM   935  C C   . PRO B 1 56 ? 21.554 39.833 39.791 1.00 41.26 ? 310 PRO B C   1 
ATOM   936  O O   . PRO B 1 56 ? 21.343 38.999 40.672 1.00 44.89 ? 310 PRO B O   1 
ATOM   937  C CB  . PRO B 1 56 ? 23.532 40.934 40.915 1.00 37.17 ? 310 PRO B CB  1 
ATOM   938  C CG  . PRO B 1 56 ? 23.614 42.154 41.798 1.00 36.77 ? 310 PRO B CG  1 
ATOM   939  C CD  . PRO B 1 56 ? 22.193 42.291 42.268 1.00 35.12 ? 310 PRO B CD  1 
ATOM   940  N N   . TYR B 1 57 ? 21.183 39.658 38.525 1.00 43.17 ? 311 TYR B N   1 
ATOM   941  C CA  . TYR B 1 57 ? 20.527 38.428 38.087 1.00 47.95 ? 311 TYR B CA  1 
ATOM   942  C C   . TYR B 1 57 ? 21.541 37.380 37.647 1.00 51.04 ? 311 TYR B C   1 
ATOM   943  O O   . TYR B 1 57 ? 21.458 36.218 38.048 1.00 50.72 ? 311 TYR B O   1 
ATOM   944  C CB  . TYR B 1 57 ? 19.548 38.700 36.942 1.00 44.85 ? 311 TYR B CB  1 
ATOM   945  C CG  . TYR B 1 57 ? 18.903 37.445 36.390 1.00 45.20 ? 311 TYR B CG  1 
ATOM   946  C CD1 . TYR B 1 57 ? 17.820 36.855 37.034 1.00 46.96 ? 311 TYR B CD1 1 
ATOM   947  C CD2 . TYR B 1 57 ? 19.385 36.841 35.226 1.00 48.47 ? 311 TYR B CD2 1 
ATOM   948  C CE1 . TYR B 1 57 ? 17.229 35.693 36.537 1.00 46.28 ? 311 TYR B CE1 1 
ATOM   949  C CE2 . TYR B 1 57 ? 18.802 35.679 34.721 1.00 44.81 ? 311 TYR B CE2 1 
ATOM   950  C CZ  . TYR B 1 57 ? 17.725 35.113 35.381 1.00 44.93 ? 311 TYR B CZ  1 
ATOM   951  O OH  . TYR B 1 57 ? 17.136 33.972 34.885 1.00 47.17 ? 311 TYR B OH  1 
ATOM   952  N N   . ASN B 1 58 ? 22.480 37.793 36.801 1.00 56.73 ? 312 ASN B N   1 
ATOM   953  C CA  . ASN B 1 58 ? 23.507 36.888 36.297 1.00 64.55 ? 312 ASN B CA  1 
ATOM   954  C C   . ASN B 1 58 ? 24.418 36.355 37.408 1.00 66.72 ? 312 ASN B C   1 
ATOM   955  O O   . ASN B 1 58 ? 24.802 37.138 38.307 1.00 68.15 ? 312 ASN B O   1 
ATOM   956  C CB  . ASN B 1 58 ? 24.332 37.563 35.185 1.00 65.96 ? 312 ASN B CB  1 
ATOM   957  C CG  . ASN B 1 58 ? 25.172 38.731 35.688 1.00 64.15 ? 312 ASN B CG  1 
ATOM   958  O OD1 . ASN B 1 58 ? 24.659 39.671 36.296 1.00 67.31 ? 312 ASN B OD1 1 
ATOM   959  N ND2 . ASN B 1 58 ? 26.473 38.675 35.425 1.00 63.85 ? 312 ASN B ND2 1 
ATOM   960  N N   . PRO C 2 1  ? 10.272 32.327 40.010 1.00 33.35 ? 2   PRO C N   1 
ATOM   961  C CA  . PRO C 2 1  ? 10.746 31.770 41.301 1.00 34.68 ? 2   PRO C CA  1 
ATOM   962  C C   . PRO C 2 1  ? 11.609 30.542 41.035 1.00 35.05 ? 2   PRO C C   1 
ATOM   963  O O   . PRO C 2 1  ? 11.094 29.473 40.724 1.00 36.72 ? 2   PRO C O   1 
ATOM   964  C CB  . PRO C 2 1  ? 9.506  31.376 42.096 1.00 27.66 ? 2   PRO C CB  1 
ATOM   965  C CG  . PRO C 2 1  ? 8.434  32.260 41.461 1.00 30.95 ? 2   PRO C CG  1 
ATOM   966  C CD  . PRO C 2 1  ? 8.799  32.303 39.970 1.00 33.01 ? 2   PRO C CD  1 
ATOM   967  N N   . PRO C 2 2  ? 12.939 30.671 41.169 1.00 34.97 ? 3   PRO C N   1 
ATOM   968  C CA  . PRO C 2 2  ? 13.872 29.565 40.937 1.00 38.71 ? 3   PRO C CA  1 
ATOM   969  C C   . PRO C 2 2  ? 13.630 28.387 41.881 1.00 40.99 ? 3   PRO C C   1 
ATOM   970  O O   . PRO C 2 2  ? 13.066 28.553 42.964 1.00 43.79 ? 3   PRO C O   1 
ATOM   971  C CB  . PRO C 2 2  ? 15.237 30.226 41.170 1.00 37.30 ? 3   PRO C CB  1 
ATOM   972  C CG  . PRO C 2 2  ? 14.932 31.270 42.196 1.00 35.64 ? 3   PRO C CG  1 
ATOM   973  C CD  . PRO C 2 2  ? 13.634 31.859 41.687 1.00 34.78 ? 3   PRO C CD  1 
ATOM   974  N N   . PRO C 2 3  ? 13.979 27.168 41.448 1.00 41.00 ? 4   PRO C N   1 
ATOM   975  C CA  . PRO C 2 3  ? 13.806 25.954 42.246 1.00 39.10 ? 4   PRO C CA  1 
ATOM   976  C C   . PRO C 2 3  ? 14.781 25.911 43.428 1.00 37.29 ? 4   PRO C C   1 
ATOM   977  O O   . PRO C 2 3  ? 15.932 26.341 43.311 1.00 34.05 ? 4   PRO C O   1 
ATOM   978  C CB  . PRO C 2 3  ? 14.087 24.846 41.228 1.00 39.48 ? 4   PRO C CB  1 
ATOM   979  C CG  . PRO C 2 3  ? 15.130 25.489 40.336 1.00 42.87 ? 4   PRO C CG  1 
ATOM   980  C CD  . PRO C 2 3  ? 14.511 26.850 40.109 1.00 39.84 ? 4   PRO C CD  1 
ATOM   981  N N   . VAL C 2 4  ? 14.295 25.439 44.571 1.00 37.68 ? 5   VAL C N   1 
ATOM   982  C CA  . VAL C 2 4  ? 15.112 25.332 45.775 1.00 36.09 ? 5   VAL C CA  1 
ATOM   983  C C   . VAL C 2 4  ? 16.078 24.161 45.598 1.00 35.97 ? 5   VAL C C   1 
ATOM   984  O O   . VAL C 2 4  ? 15.664 23.070 45.210 1.00 38.75 ? 5   VAL C O   1 
ATOM   985  C CB  . VAL C 2 4  ? 14.225 25.094 47.010 1.00 34.46 ? 5   VAL C CB  1 
ATOM   986  C CG1 . VAL C 2 4  ? 15.081 24.925 48.244 1.00 34.72 ? 5   VAL C CG1 1 
ATOM   987  C CG2 . VAL C 2 4  ? 13.241 26.251 47.187 1.00 25.57 ? 5   VAL C CG2 1 
HETATM 988  N N   . NMC C 2 5  ? 17.383 24.388 45.831 1.00 39.62 ? 6   NMC C N   1 
HETATM 989  C CA  . NMC C 2 5  ? 18.322 23.320 45.532 1.00 35.61 ? 6   NMC C CA  1 
HETATM 990  C C   . NMC C 2 5  ? 18.319 22.189 46.541 1.00 35.91 ? 6   NMC C C   1 
HETATM 991  O O   . NMC C 2 5  ? 17.453 22.130 47.417 1.00 35.65 ? 6   NMC C O   1 
HETATM 992  C CN  . NMC C 2 5  ? 17.926 25.692 46.287 1.00 46.27 ? 6   NMC C CN  1 
HETATM 993  C CX1 . NMC C 2 5  ? 18.849 25.341 47.420 1.00 46.10 ? 6   NMC C CX1 1 
HETATM 994  C CX2 . NMC C 2 5  ? 19.535 26.484 48.066 1.00 49.24 ? 6   NMC C CX2 1 
HETATM 995  C CX3 . NMC C 2 5  ? 20.295 25.572 47.179 1.00 48.20 ? 6   NMC C CX3 1 
ATOM   996  N N   . PRO C 2 6  ? 19.291 21.268 46.436 1.00 39.10 ? 7   PRO C N   1 
ATOM   997  C CA  . PRO C 2 6  ? 19.442 20.107 47.323 1.00 42.02 ? 7   PRO C CA  1 
ATOM   998  C C   . PRO C 2 6  ? 19.613 20.486 48.795 1.00 43.23 ? 7   PRO C C   1 
ATOM   999  O O   . PRO C 2 6  ? 20.483 21.288 49.140 1.00 41.82 ? 7   PRO C O   1 
ATOM   1000 C CB  . PRO C 2 6  ? 20.700 19.429 46.778 1.00 41.63 ? 7   PRO C CB  1 
ATOM   1001 C CG  . PRO C 2 6  ? 20.677 19.792 45.316 1.00 39.73 ? 7   PRO C CG  1 
ATOM   1002 C CD  . PRO C 2 6  ? 20.314 21.246 45.373 1.00 38.67 ? 7   PRO C CD  1 
ATOM   1003 N N   . ARG C 2 7  ? 18.783 19.895 49.653 1.00 46.38 ? 8   ARG C N   1 
ATOM   1004 C CA  . ARG C 2 7  ? 18.821 20.154 51.095 1.00 48.08 ? 8   ARG C CA  1 
ATOM   1005 C C   . ARG C 2 7  ? 19.818 19.281 51.862 1.00 49.57 ? 8   ARG C C   1 
ATOM   1006 O O   . ARG C 2 7  ? 20.165 18.188 51.364 1.00 52.79 ? 8   ARG C O   1 
ATOM   1007 C CB  . ARG C 2 7  ? 17.425 19.986 51.694 1.00 45.77 ? 8   ARG C CB  1 
ATOM   1008 C CG  . ARG C 2 7  ? 16.440 21.055 51.270 1.00 46.84 ? 8   ARG C CG  1 
ATOM   1009 C CD  . ARG C 2 7  ? 15.035 20.712 51.721 1.00 45.23 ? 8   ARG C CD  1 
ATOM   1010 N NE  . ARG C 2 7  ? 14.134 21.860 51.694 1.00 46.93 ? 8   ARG C NE  1 
ATOM   1011 C CZ  . ARG C 2 7  ? 13.692 22.451 50.588 1.00 48.75 ? 8   ARG C CZ  1 
ATOM   1012 N NH1 . ARG C 2 7  ? 14.066 22.009 49.393 1.00 50.57 ? 8   ARG C NH1 1 
ATOM   1013 N NH2 . ARG C 2 7  ? 12.868 23.487 50.677 1.00 44.16 ? 8   ARG C NH2 1 
ATOM   1014 N N   . PRO D 2 1  ? 7.684  50.292 46.685 1.00 26.60 ? 12  PRO D N   1 
ATOM   1015 C CA  . PRO D 2 1  ? 8.711  50.696 45.696 1.00 25.60 ? 12  PRO D CA  1 
ATOM   1016 C C   . PRO D 2 1  ? 9.472  51.906 46.233 1.00 26.69 ? 12  PRO D C   1 
ATOM   1017 O O   . PRO D 2 1  ? 8.863  52.905 46.616 1.00 27.82 ? 12  PRO D O   1 
ATOM   1018 C CB  . PRO D 2 1  ? 7.975  51.077 44.413 1.00 24.21 ? 12  PRO D CB  1 
ATOM   1019 C CG  . PRO D 2 1  ? 6.592  50.441 44.621 1.00 25.13 ? 12  PRO D CG  1 
ATOM   1020 C CD  . PRO D 2 1  ? 6.340  50.531 46.130 1.00 27.95 ? 12  PRO D CD  1 
ATOM   1021 N N   . PRO D 2 2  ? 10.814 51.842 46.257 1.00 25.84 ? 13  PRO D N   1 
ATOM   1022 C CA  . PRO D 2 2  ? 11.665 52.927 46.746 1.00 29.77 ? 13  PRO D CA  1 
ATOM   1023 C C   . PRO D 2 2  ? 11.551 54.180 45.875 1.00 32.59 ? 13  PRO D C   1 
ATOM   1024 O O   . PRO D 2 2  ? 11.036 54.126 44.757 1.00 32.21 ? 13  PRO D O   1 
ATOM   1025 C CB  . PRO D 2 2  ? 13.066 52.310 46.691 1.00 27.61 ? 13  PRO D CB  1 
ATOM   1026 C CG  . PRO D 2 2  ? 12.982 51.383 45.539 1.00 26.23 ? 13  PRO D CG  1 
ATOM   1027 C CD  . PRO D 2 2  ? 11.627 50.733 45.732 1.00 28.93 ? 13  PRO D CD  1 
ATOM   1028 N N   . PRO D 2 3  ? 11.987 55.337 46.399 1.00 34.74 ? 14  PRO D N   1 
ATOM   1029 C CA  . PRO D 2 3  ? 11.940 56.610 45.675 1.00 33.01 ? 14  PRO D CA  1 
ATOM   1030 C C   . PRO D 2 3  ? 12.946 56.632 44.533 1.00 31.20 ? 14  PRO D C   1 
ATOM   1031 O O   . PRO D 2 3  ? 14.032 56.053 44.631 1.00 27.87 ? 14  PRO D O   1 
ATOM   1032 C CB  . PRO D 2 3  ? 12.321 57.631 46.752 1.00 33.69 ? 14  PRO D CB  1 
ATOM   1033 C CG  . PRO D 2 3  ? 11.953 56.954 48.037 1.00 32.25 ? 14  PRO D CG  1 
ATOM   1034 C CD  . PRO D 2 3  ? 12.408 55.546 47.794 1.00 31.11 ? 14  PRO D CD  1 
ATOM   1035 N N   . VAL D 2 4  ? 12.561 57.274 43.439 1.00 32.68 ? 15  VAL D N   1 
ATOM   1036 C CA  . VAL D 2 4  ? 13.435 57.401 42.285 1.00 38.58 ? 15  VAL D CA  1 
ATOM   1037 C C   . VAL D 2 4  ? 14.235 58.687 42.496 1.00 42.67 ? 15  VAL D C   1 
ATOM   1038 O O   . VAL D 2 4  ? 13.651 59.749 42.715 1.00 46.55 ? 15  VAL D O   1 
ATOM   1039 C CB  . VAL D 2 4  ? 12.624 57.492 40.968 1.00 40.61 ? 15  VAL D CB  1 
ATOM   1040 C CG1 . VAL D 2 4  ? 13.559 57.593 39.773 1.00 35.69 ? 15  VAL D CG1 1 
ATOM   1041 C CG2 . VAL D 2 4  ? 11.719 56.275 40.822 1.00 43.15 ? 15  VAL D CG2 1 
HETATM 1042 N N   . NMC D 2 5  ? 15.580 58.604 42.456 1.00 49.08 ? 16  NMC D N   1 
HETATM 1043 C CA  . NMC D 2 5  ? 16.424 59.766 42.700 1.00 50.07 ? 16  NMC D CA  1 
HETATM 1044 C C   . NMC D 2 5  ? 16.287 60.912 41.707 1.00 52.73 ? 16  NMC D C   1 
HETATM 1045 O O   . NMC D 2 5  ? 15.191 61.184 41.222 1.00 54.07 ? 16  NMC D O   1 
HETATM 1046 C CN  . NMC D 2 5  ? 16.122 57.234 42.257 1.00 58.41 ? 16  NMC D CN  1 
HETATM 1047 C CX1 . NMC D 2 5  ? 17.454 57.442 41.604 1.00 62.06 ? 16  NMC D CX1 1 
HETATM 1048 C CX2 . NMC D 2 5  ? 18.217 56.213 41.293 1.00 63.24 ? 16  NMC D CX2 1 
HETATM 1049 C CX3 . NMC D 2 5  ? 18.635 57.079 42.421 1.00 64.50 ? 16  NMC D CX3 1 
ATOM   1050 N N   . PRO D 2 6  ? 17.393 61.607 41.385 1.00 55.66 ? 17  PRO D N   1 
ATOM   1051 C CA  . PRO D 2 6  ? 17.419 62.740 40.447 1.00 58.06 ? 17  PRO D CA  1 
ATOM   1052 C C   . PRO D 2 6  ? 17.055 62.412 38.990 1.00 59.63 ? 17  PRO D C   1 
ATOM   1053 O O   . PRO D 2 6  ? 17.969 62.149 38.176 1.00 56.76 ? 17  PRO D O   1 
ATOM   1054 C CB  . PRO D 2 6  ? 18.854 63.254 40.583 1.00 59.27 ? 17  PRO D CB  1 
ATOM   1055 C CG  . PRO D 2 6  ? 19.632 62.008 40.903 1.00 56.52 ? 17  PRO D CG  1 
ATOM   1056 C CD  . PRO D 2 6  ? 18.744 61.345 41.923 1.00 56.30 ? 17  PRO D CD  1 
HETATM 1057 O O   . HOH E 3 .  ? 22.570 38.038 47.940 1.00 27.86 ? 21  HOH A O   1 
HETATM 1058 O O   . HOH E 3 .  ? 21.409 33.619 43.232 1.00 29.14 ? 22  HOH A O   1 
HETATM 1059 O O   . HOH E 3 .  ? 11.703 42.000 46.168 1.00 67.46 ? 24  HOH A O   1 
HETATM 1060 O O   . HOH E 3 .  ? 10.612 24.958 61.367 1.00 30.82 ? 25  HOH A O   1 
HETATM 1061 O O   . HOH E 3 .  ? 24.190 41.312 51.959 1.00 21.75 ? 26  HOH A O   1 
HETATM 1062 O O   . HOH E 3 .  ? 23.141 44.686 45.023 1.00 38.34 ? 27  HOH A O   1 
HETATM 1063 O O   . HOH E 3 .  ? 22.163 27.248 64.570 1.00 40.40 ? 28  HOH A O   1 
HETATM 1064 O O   . HOH E 3 .  ? 25.490 29.080 55.800 1.00 28.64 ? 29  HOH A O   1 
HETATM 1065 O O   . HOH E 3 .  ? 7.931  31.440 65.820 1.00 51.26 ? 31  HOH A O   1 
HETATM 1066 O O   . HOH E 3 .  ? 16.708 22.150 55.634 1.00 21.32 ? 33  HOH A O   1 
HETATM 1067 O O   . HOH E 3 .  ? 9.109  33.991 59.583 1.00 21.28 ? 34  HOH A O   1 
HETATM 1068 O O   . HOH E 3 .  ? 13.671 41.379 61.631 1.00 27.34 ? 35  HOH A O   1 
HETATM 1069 O O   . HOH E 3 .  ? 24.478 38.770 49.993 1.00 29.13 ? 36  HOH A O   1 
HETATM 1070 O O   . HOH E 3 .  ? 11.124 39.993 42.398 1.00 37.95 ? 39  HOH A O   1 
HETATM 1071 O O   . HOH E 3 .  ? 18.433 47.556 46.560 1.00 36.77 ? 41  HOH A O   1 
HETATM 1072 O O   . HOH E 3 .  ? 15.470 42.173 59.314 1.00 29.72 ? 43  HOH A O   1 
HETATM 1073 O O   . HOH E 3 .  ? 22.278 30.832 64.777 1.00 33.19 ? 44  HOH A O   1 
HETATM 1074 O O   . HOH E 3 .  ? 5.559  40.265 54.959 1.00 35.96 ? 45  HOH A O   1 
HETATM 1075 O O   . HOH E 3 .  ? 10.205 30.309 60.095 1.00 30.15 ? 47  HOH A O   1 
HETATM 1076 O O   . HOH F 3 .  ? 3.421  44.241 41.909 1.00 38.93 ? 20  HOH B O   1 
HETATM 1077 O O   . HOH F 3 .  ? 6.285  46.583 41.707 1.00 28.77 ? 23  HOH B O   1 
HETATM 1078 O O   . HOH F 3 .  ? 4.108  43.549 38.682 1.00 47.65 ? 30  HOH B O   1 
HETATM 1079 O O   . HOH F 3 .  ? 2.631  37.504 40.916 1.00 34.68 ? 32  HOH B O   1 
HETATM 1080 O O   . HOH F 3 .  ? 16.551 53.265 47.618 1.00 29.91 ? 37  HOH B O   1 
HETATM 1081 O O   . HOH F 3 .  ? 14.313 52.192 22.854 1.00 29.14 ? 38  HOH B O   1 
HETATM 1082 O O   . HOH F 3 .  ? 25.134 60.117 44.085 1.00 30.72 ? 40  HOH B O   1 
HETATM 1083 O O   . HOH F 3 .  ? 22.432 45.442 41.474 1.00 35.70 ? 46  HOH B O   1 
HETATM 1084 O O   . HOH G 3 .  ? 11.353 24.061 44.436 1.00 31.07 ? 42  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLU 1  155 155 GLU GLU A . n 
A 1 2  THR 2  156 156 THR THR A . n 
A 1 3  LYS 3  157 157 LYS LYS A . n 
A 1 4  PHE 4  158 158 PHE PHE A . n 
A 1 5  VAL 5  159 159 VAL VAL A . n 
A 1 6  GLN 6  160 160 GLN GLN A . n 
A 1 7  ALA 7  161 161 ALA ALA A . n 
A 1 8  LEU 8  162 162 LEU LEU A . n 
A 1 9  PHE 9  163 163 PHE PHE A . n 
A 1 10 ASP 10 164 164 ASP ASP A . n 
A 1 11 PHE 11 165 165 PHE PHE A . n 
A 1 12 ASN 12 166 166 ASN ASN A . n 
A 1 13 PRO 13 167 167 PRO PRO A . n 
A 1 14 GLN 14 168 168 GLN GLN A . n 
A 1 15 GLU 15 169 169 GLU GLU A . n 
A 1 16 SER 16 170 170 SER SER A . n 
A 1 17 GLY 17 171 171 GLY GLY A . n 
A 1 18 GLU 18 172 172 GLU GLU A . n 
A 1 19 LEU 19 173 173 LEU LEU A . n 
A 1 20 ALA 20 174 174 ALA ALA A . n 
A 1 21 PHE 21 175 175 PHE PHE A . n 
A 1 22 LYS 22 176 176 LYS LYS A . n 
A 1 23 ARG 23 177 177 ARG ARG A . n 
A 1 24 GLY 24 178 178 GLY GLY A . n 
A 1 25 ASP 25 179 179 ASP ASP A . n 
A 1 26 VAL 26 180 180 VAL VAL A . n 
A 1 27 ILE 27 181 181 ILE ILE A . n 
A 1 28 THR 28 182 182 THR THR A . n 
A 1 29 LEU 29 183 183 LEU LEU A . n 
A 1 30 ILE 30 184 184 ILE ILE A . n 
A 1 31 ASN 31 185 185 ASN ASN A . n 
A 1 32 LYS 32 186 186 LYS LYS A . n 
A 1 33 ASP 33 187 187 ASP ASP A . n 
A 1 34 ASP 34 188 188 ASP ASP A . n 
A 1 35 PRO 35 189 189 PRO PRO A . n 
A 1 36 ASN 36 190 190 ASN ASN A . n 
A 1 37 TRP 37 191 191 TRP TRP A . n 
A 1 38 TRP 38 192 192 TRP TRP A . n 
A 1 39 GLU 39 193 193 GLU GLU A . n 
A 1 40 GLY 40 194 194 GLY GLY A . n 
A 1 41 GLN 41 195 195 GLN GLN A . n 
A 1 42 LEU 42 196 196 LEU LEU A . n 
A 1 43 ASN 43 197 197 ASN ASN A . n 
A 1 44 ASN 44 198 198 ASN ASN A . n 
A 1 45 ARG 45 199 199 ARG ARG A . n 
A 1 46 ARG 46 200 200 ARG ARG A . n 
A 1 47 GLY 47 201 201 GLY GLY A . n 
A 1 48 ILE 48 202 202 ILE ILE A . n 
A 1 49 PHE 49 203 203 PHE PHE A . n 
A 1 50 PRO 50 204 204 PRO PRO A . n 
A 1 51 SER 51 205 205 SER SER A . n 
A 1 52 ASN 52 206 206 ASN ASN A . n 
A 1 53 TYR 53 207 207 TYR TYR A . n 
A 1 54 VAL 54 208 208 VAL VAL A . n 
A 1 55 CYS 55 209 209 CYS CYS A . n 
A 1 56 PRO 56 210 210 PRO PRO A . n 
A 1 57 TYR 57 211 211 TYR TYR A . n 
A 1 58 ASN 58 212 212 ASN ASN A . n 
A 1 59 SER 59 213 ?   ?   ?   A . n 
A 1 60 ASN 60 214 ?   ?   ?   A . n 
B 1 1  GLU 1  255 255 GLU GLU B . n 
B 1 2  THR 2  256 256 THR THR B . n 
B 1 3  LYS 3  257 257 LYS LYS B . n 
B 1 4  PHE 4  258 258 PHE PHE B . n 
B 1 5  VAL 5  259 259 VAL VAL B . n 
B 1 6  GLN 6  260 260 GLN GLN B . n 
B 1 7  ALA 7  261 261 ALA ALA B . n 
B 1 8  LEU 8  262 262 LEU LEU B . n 
B 1 9  PHE 9  263 263 PHE PHE B . n 
B 1 10 ASP 10 264 264 ASP ASP B . n 
B 1 11 PHE 11 265 265 PHE PHE B . n 
B 1 12 ASN 12 266 266 ASN ASN B . n 
B 1 13 PRO 13 267 267 PRO PRO B . n 
B 1 14 GLN 14 268 268 GLN GLN B . n 
B 1 15 GLU 15 269 269 GLU GLU B . n 
B 1 16 SER 16 270 270 SER SER B . n 
B 1 17 GLY 17 271 271 GLY GLY B . n 
B 1 18 GLU 18 272 272 GLU GLU B . n 
B 1 19 LEU 19 273 273 LEU LEU B . n 
B 1 20 ALA 20 274 274 ALA ALA B . n 
B 1 21 PHE 21 275 275 PHE PHE B . n 
B 1 22 LYS 22 276 276 LYS LYS B . n 
B 1 23 ARG 23 277 277 ARG ARG B . n 
B 1 24 GLY 24 278 278 GLY GLY B . n 
B 1 25 ASP 25 279 279 ASP ASP B . n 
B 1 26 VAL 26 280 280 VAL VAL B . n 
B 1 27 ILE 27 281 281 ILE ILE B . n 
B 1 28 THR 28 282 282 THR THR B . n 
B 1 29 LEU 29 283 283 LEU LEU B . n 
B 1 30 ILE 30 284 284 ILE ILE B . n 
B 1 31 ASN 31 285 285 ASN ASN B . n 
B 1 32 LYS 32 286 286 LYS LYS B . n 
B 1 33 ASP 33 287 287 ASP ASP B . n 
B 1 34 ASP 34 288 288 ASP ASP B . n 
B 1 35 PRO 35 289 289 PRO PRO B . n 
B 1 36 ASN 36 290 290 ASN ASN B . n 
B 1 37 TRP 37 291 291 TRP TRP B . n 
B 1 38 TRP 38 292 292 TRP TRP B . n 
B 1 39 GLU 39 293 293 GLU GLU B . n 
B 1 40 GLY 40 294 294 GLY GLY B . n 
B 1 41 GLN 41 295 295 GLN GLN B . n 
B 1 42 LEU 42 296 296 LEU LEU B . n 
B 1 43 ASN 43 297 297 ASN ASN B . n 
B 1 44 ASN 44 298 298 ASN ASN B . n 
B 1 45 ARG 45 299 299 ARG ARG B . n 
B 1 46 ARG 46 300 300 ARG ARG B . n 
B 1 47 GLY 47 301 301 GLY GLY B . n 
B 1 48 ILE 48 302 302 ILE ILE B . n 
B 1 49 PHE 49 303 303 PHE PHE B . n 
B 1 50 PRO 50 304 304 PRO PRO B . n 
B 1 51 SER 51 305 305 SER SER B . n 
B 1 52 ASN 52 306 306 ASN ASN B . n 
B 1 53 TYR 53 307 307 TYR TYR B . n 
B 1 54 VAL 54 308 308 VAL VAL B . n 
B 1 55 CYS 55 309 309 CYS CYS B . n 
B 1 56 PRO 56 310 310 PRO PRO B . n 
B 1 57 TYR 57 311 311 TYR TYR B . n 
B 1 58 ASN 58 312 312 ASN ASN B . n 
B 1 59 SER 59 313 ?   ?   ?   B . n 
B 1 60 ASN 60 314 ?   ?   ?   B . n 
C 2 1  PRO 1  2   2   PRO PRO C . n 
C 2 2  PRO 2  3   3   PRO PRO C . n 
C 2 3  PRO 3  4   4   PRO PRO C . n 
C 2 4  VAL 4  5   5   VAL VAL C . n 
C 2 5  NMC 5  6   6   NMC NMC C . n 
C 2 6  PRO 6  7   7   PRO PRO C . n 
C 2 7  ARG 7  8   8   ARG ARG C . n 
C 2 8  ARG 8  9   ?   ?   ?   C . n 
C 2 9  ARG 9  10  ?   ?   ?   C . n 
D 2 1  PRO 1  12  12  PRO PRO D . n 
D 2 2  PRO 2  13  13  PRO PRO D . n 
D 2 3  PRO 3  14  14  PRO PRO D . n 
D 2 4  VAL 4  15  15  VAL VAL D . n 
D 2 5  NMC 5  16  16  NMC NMC D . n 
D 2 6  PRO 6  17  17  PRO PRO D . n 
D 2 7  ARG 7  18  ?   ?   ?   D . n 
D 2 8  ARG 8  19  ?   ?   ?   D . n 
D 2 9  ARG 9  20  ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C NMC 5 C NMC 6  ? GLY 'N-CYCLOPROPYLMETHYL GLYCINE' 
2 D NMC 5 D NMC 16 ? GLY 'N-CYCLOPROPYLMETHYL GLYCINE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 760  ? 
1 MORE         -5   ? 
1 'SSA (A^2)'  4370 ? 
2 'ABSA (A^2)' 620  ? 
2 MORE         -6   ? 
2 'SSA (A^2)'  4370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-01-06 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .     ? 1 
SCALEPACK 'data scaling'   .     ? 2 
AMoRE     phasing          .     ? 3 
X-PLOR    refinement       3.843 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 197 ? ? 68.80   -107.30 
2 1 TYR A 211 ? ? -131.55 -54.87  
3 1 ASP B 287 ? ? -29.73  -62.83  
4 1 PRO B 289 ? ? -59.47  -9.70   
5 1 ASN B 297 ? ? 71.77   -116.13 
6 1 NMC D 16  ? ? -63.05  -144.04 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASN 212 ? CG  ? A ASN 58 CG  
2 1 Y 1 A ASN 212 ? OD1 ? A ASN 58 OD1 
3 1 Y 1 A ASN 212 ? ND2 ? A ASN 58 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 213 ? A SER 59 
2 1 Y 1 A ASN 214 ? A ASN 60 
3 1 Y 1 B SER 313 ? B SER 59 
4 1 Y 1 B ASN 314 ? B ASN 60 
5 1 Y 1 C ARG 9   ? C ARG 8  
6 1 Y 1 C ARG 10  ? C ARG 9  
7 1 Y 1 D ARG 18  ? D ARG 7  
8 1 Y 1 D ARG 19  ? D ARG 8  
9 1 Y 1 D ARG 20  ? D ARG 9  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  21 21 HOH HOH A . 
E 3 HOH 2  22 22 HOH HOH A . 
E 3 HOH 3  24 24 HOH HOH A . 
E 3 HOH 4  25 25 HOH HOH A . 
E 3 HOH 5  26 26 HOH HOH A . 
E 3 HOH 6  27 27 HOH HOH A . 
E 3 HOH 7  28 28 HOH HOH A . 
E 3 HOH 8  29 29 HOH HOH A . 
E 3 HOH 9  31 31 HOH HOH A . 
E 3 HOH 10 33 33 HOH HOH A . 
E 3 HOH 11 34 34 HOH HOH A . 
E 3 HOH 12 35 35 HOH HOH A . 
E 3 HOH 13 36 36 HOH HOH A . 
E 3 HOH 14 39 39 HOH HOH A . 
E 3 HOH 15 41 41 HOH HOH A . 
E 3 HOH 16 43 43 HOH HOH A . 
E 3 HOH 17 44 44 HOH HOH A . 
E 3 HOH 18 45 45 HOH HOH A . 
E 3 HOH 19 47 47 HOH HOH A . 
F 3 HOH 1  20 20 HOH HOH B . 
F 3 HOH 2  23 23 HOH HOH B . 
F 3 HOH 3  30 30 HOH HOH B . 
F 3 HOH 4  32 32 HOH HOH B . 
F 3 HOH 5  37 37 HOH HOH B . 
F 3 HOH 6  38 38 HOH HOH B . 
F 3 HOH 7  40 40 HOH HOH B . 
F 3 HOH 8  46 46 HOH HOH B . 
G 3 HOH 1  42 42 HOH HOH C . 
#