data_3SHD
# 
_entry.id   3SHD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.388 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3SHD         pdb_00003shd 10.2210/pdb3shd/pdb 
RCSB  RCSB066203   ?            ?                   
WWPDB D_1000066203 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-06-27 
2 'Structure model' 1 1 2024-03-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' chem_comp_atom         
2 2 'Structure model' chem_comp_bond         
3 2 'Structure model' database_2             
4 2 'Structure model' pdbx_struct_conn_angle 
5 2 'Structure model' struct_conn            
6 2 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_database_2.pdbx_DOI'                        
2  2 'Structure model' '_database_2.pdbx_database_accession'         
3  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
20 2 'Structure model' '_pdbx_struct_conn_angle.value'               
21 2 'Structure model' '_struct_conn.pdbx_dist_value'                
22 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
23 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
30 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 2 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 2 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 2 'Structure model' '_struct_site.pdbx_auth_asym_id'              
36 2 'Structure model' '_struct_site.pdbx_auth_comp_id'              
37 2 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SHD 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hong, M.K.' 1 
'Kim, J.K.'  2 
'Kang, L.W.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure and atypical hydrolysis mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Hong, M.K.' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phosphatase nudJ'   17450.854 12  3.6.1.- ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION' 54.938    24  ?       ? ? ? 
3 non-polymer syn 'SULFATE ION'        96.063    36  ?       ? ? ? 
4 water       nat water                18.015    285 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFL
RFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFL
RFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'SULFATE ION'        SO4 
4 water                HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PHE n 
1 3   LYS n 
1 4   PRO n 
1 5   HIS n 
1 6   VAL n 
1 7   THR n 
1 8   VAL n 
1 9   ALA n 
1 10  CYS n 
1 11  VAL n 
1 12  VAL n 
1 13  HIS n 
1 14  ALA n 
1 15  GLU n 
1 16  GLY n 
1 17  LYS n 
1 18  PHE n 
1 19  LEU n 
1 20  VAL n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  THR n 
1 25  ILE n 
1 26  ASN n 
1 27  GLY n 
1 28  LYS n 
1 29  ALA n 
1 30  LEU n 
1 31  TRP n 
1 32  ASN n 
1 33  GLN n 
1 34  PRO n 
1 35  ALA n 
1 36  GLY n 
1 37  HIS n 
1 38  LEU n 
1 39  GLU n 
1 40  ALA n 
1 41  ASP n 
1 42  GLU n 
1 43  THR n 
1 44  LEU n 
1 45  VAL n 
1 46  GLU n 
1 47  ALA n 
1 48  ALA n 
1 49  ALA n 
1 50  ARG n 
1 51  GLU n 
1 52  LEU n 
1 53  TRP n 
1 54  GLU n 
1 55  GLU n 
1 56  THR n 
1 57  GLY n 
1 58  ILE n 
1 59  SER n 
1 60  ALA n 
1 61  GLN n 
1 62  PRO n 
1 63  GLN n 
1 64  HIS n 
1 65  PHE n 
1 66  ILE n 
1 67  ARG n 
1 68  MET n 
1 69  HIS n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  ALA n 
1 74  PRO n 
1 75  ASP n 
1 76  LYS n 
1 77  THR n 
1 78  PRO n 
1 79  PHE n 
1 80  LEU n 
1 81  ARG n 
1 82  PHE n 
1 83  LEU n 
1 84  PHE n 
1 85  ALA n 
1 86  ILE n 
1 87  GLU n 
1 88  LEU n 
1 89  GLU n 
1 90  GLN n 
1 91  ILE n 
1 92  CYS n 
1 93  PRO n 
1 94  THR n 
1 95  GLN n 
1 96  PRO n 
1 97  HIS n 
1 98  ASP n 
1 99  SER n 
1 100 ASP n 
1 101 ILE n 
1 102 ASP n 
1 103 CYS n 
1 104 CYS n 
1 105 ARG n 
1 106 TRP n 
1 107 VAL n 
1 108 SER n 
1 109 ALA n 
1 110 GLU n 
1 111 GLU n 
1 112 ILE n 
1 113 LEU n 
1 114 GLN n 
1 115 ALA n 
1 116 SER n 
1 117 ASN n 
1 118 LEU n 
1 119 ARG n 
1 120 SER n 
1 121 PRO n 
1 122 LEU n 
1 123 VAL n 
1 124 ALA n 
1 125 GLU n 
1 126 SER n 
1 127 ILE n 
1 128 ARG n 
1 129 CYS n 
1 130 TYR n 
1 131 GLN n 
1 132 SER n 
1 133 GLY n 
1 134 GLN n 
1 135 ARG n 
1 136 TYR n 
1 137 PRO n 
1 138 LEU n 
1 139 GLU n 
1 140 MET n 
1 141 ILE n 
1 142 GLY n 
1 143 ASP n 
1 144 PHE n 
1 145 ASN n 
1 146 TRP n 
1 147 PRO n 
1 148 PHE n 
1 149 THR n 
1 150 LYS n 
1 151 GLY n 
1 152 VAL n 
1 153 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'nudJ, Ecok1_10240, APECO1_216' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'O1:K1 / APEC' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     405955 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'        ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   HIS 5   5   5   HIS HIS A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  CYS 10  10  10  CYS CYS A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ASN 26  26  26  ASN ASN A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  TRP 31  31  31  TRP TRP A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ASP 41  41  41  ASP ASP A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  LEU 44  44  44  LEU LEU A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  TRP 53  53  53  TRP TRP A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  THR 94  94  94  THR THR A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  PRO 96  96  96  PRO PRO A . n 
A 1 97  HIS 97  97  97  HIS HIS A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 CYS 104 104 104 CYS CYS A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 GLN 114 114 114 GLN GLN A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 SER 126 126 126 SER SER A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 CYS 129 129 129 CYS CYS A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 GLN 134 134 134 GLN GLN A . n 
A 1 135 ARG 135 135 135 ARG ARG A . n 
A 1 136 TYR 136 136 136 TYR TYR A . n 
A 1 137 PRO 137 137 137 PRO PRO A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 ASP 143 143 143 ASP ASP A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 TRP 146 146 146 TRP TRP A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 PHE 148 148 148 PHE PHE A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLY 151 151 ?   ?   ?   A . n 
A 1 152 VAL 152 152 ?   ?   ?   A . n 
A 1 153 ILE 153 153 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   PRO 4   4   4   PRO PRO B . n 
B 1 5   HIS 5   5   5   HIS HIS B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   ALA 9   9   9   ALA ALA B . n 
B 1 10  CYS 10  10  10  CYS CYS B . n 
B 1 11  VAL 11  11  11  VAL VAL B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  HIS 13  13  13  HIS HIS B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  PHE 18  18  18  PHE PHE B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  ILE 25  25  25  ILE ILE B . n 
B 1 26  ASN 26  26  26  ASN ASN B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  ALA 29  29  29  ALA ALA B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  TRP 31  31  31  TRP TRP B . n 
B 1 32  ASN 32  32  32  ASN ASN B . n 
B 1 33  GLN 33  33  33  GLN GLN B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  ASP 41  41  41  ASP ASP B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  THR 43  43  43  THR THR B . n 
B 1 44  LEU 44  44  44  LEU LEU B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  ALA 49  49  49  ALA ALA B . n 
B 1 50  ARG 50  50  50  ARG ARG B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  TRP 53  53  53  TRP TRP B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLY 57  57  57  GLY GLY B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  SER 59  59  59  SER SER B . n 
B 1 60  ALA 60  60  60  ALA ALA B . n 
B 1 61  GLN 61  61  61  GLN GLN B . n 
B 1 62  PRO 62  62  62  PRO PRO B . n 
B 1 63  GLN 63  63  63  GLN GLN B . n 
B 1 64  HIS 64  64  64  HIS HIS B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  ARG 67  67  67  ARG ARG B . n 
B 1 68  MET 68  68  68  MET MET B . n 
B 1 69  HIS 69  69  69  HIS HIS B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  TRP 71  71  71  TRP TRP B . n 
B 1 72  ILE 72  72  72  ILE ILE B . n 
B 1 73  ALA 73  73  73  ALA ALA B . n 
B 1 74  PRO 74  74  74  PRO PRO B . n 
B 1 75  ASP 75  75  75  ASP ASP B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  PHE 79  79  79  PHE PHE B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ARG 81  81  81  ARG ARG B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  ILE 86  86  86  ILE ILE B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  GLN 90  90  90  GLN GLN B . n 
B 1 91  ILE 91  91  91  ILE ILE B . n 
B 1 92  CYS 92  92  92  CYS CYS B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  THR 94  94  94  THR THR B . n 
B 1 95  GLN 95  95  95  GLN GLN B . n 
B 1 96  PRO 96  96  96  PRO PRO B . n 
B 1 97  HIS 97  97  97  HIS HIS B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  SER 99  99  99  SER SER B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 ILE 101 101 101 ILE ILE B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 CYS 103 103 103 CYS CYS B . n 
B 1 104 CYS 104 104 104 CYS CYS B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 TRP 106 106 106 TRP TRP B . n 
B 1 107 VAL 107 107 107 VAL VAL B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 GLU 110 110 110 GLU GLU B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 GLN 114 114 114 GLN GLN B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 SER 116 116 116 SER SER B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 GLU 125 125 125 GLU GLU B . n 
B 1 126 SER 126 126 126 SER SER B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 CYS 129 129 129 CYS CYS B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 SER 132 132 132 SER SER B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 GLN 134 134 134 GLN GLN B . n 
B 1 135 ARG 135 135 135 ARG ARG B . n 
B 1 136 TYR 136 136 136 TYR TYR B . n 
B 1 137 PRO 137 137 137 PRO PRO B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 MET 140 140 140 MET MET B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 ASP 143 143 143 ASP ASP B . n 
B 1 144 PHE 144 144 144 PHE PHE B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 TRP 146 146 146 TRP TRP B . n 
B 1 147 PRO 147 147 147 PRO PRO B . n 
B 1 148 PHE 148 148 148 PHE PHE B . n 
B 1 149 THR 149 149 149 THR THR B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 GLY 151 151 ?   ?   ?   B . n 
B 1 152 VAL 152 152 ?   ?   ?   B . n 
B 1 153 ILE 153 153 ?   ?   ?   B . n 
C 1 1   MET 1   1   1   MET MET C . n 
C 1 2   PHE 2   2   2   PHE PHE C . n 
C 1 3   LYS 3   3   3   LYS LYS C . n 
C 1 4   PRO 4   4   4   PRO PRO C . n 
C 1 5   HIS 5   5   5   HIS HIS C . n 
C 1 6   VAL 6   6   6   VAL VAL C . n 
C 1 7   THR 7   7   7   THR THR C . n 
C 1 8   VAL 8   8   8   VAL VAL C . n 
C 1 9   ALA 9   9   9   ALA ALA C . n 
C 1 10  CYS 10  10  10  CYS CYS C . n 
C 1 11  VAL 11  11  11  VAL VAL C . n 
C 1 12  VAL 12  12  12  VAL VAL C . n 
C 1 13  HIS 13  13  13  HIS HIS C . n 
C 1 14  ALA 14  14  14  ALA ALA C . n 
C 1 15  GLU 15  15  15  GLU GLU C . n 
C 1 16  GLY 16  16  16  GLY GLY C . n 
C 1 17  LYS 17  17  17  LYS LYS C . n 
C 1 18  PHE 18  18  18  PHE PHE C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  VAL 20  20  20  VAL VAL C . n 
C 1 21  VAL 21  21  21  VAL VAL C . n 
C 1 22  GLU 22  22  22  GLU GLU C . n 
C 1 23  GLU 23  23  23  GLU GLU C . n 
C 1 24  THR 24  24  24  THR THR C . n 
C 1 25  ILE 25  25  25  ILE ILE C . n 
C 1 26  ASN 26  26  26  ASN ASN C . n 
C 1 27  GLY 27  27  27  GLY GLY C . n 
C 1 28  LYS 28  28  28  LYS LYS C . n 
C 1 29  ALA 29  29  29  ALA ALA C . n 
C 1 30  LEU 30  30  30  LEU LEU C . n 
C 1 31  TRP 31  31  31  TRP TRP C . n 
C 1 32  ASN 32  32  32  ASN ASN C . n 
C 1 33  GLN 33  33  33  GLN GLN C . n 
C 1 34  PRO 34  34  34  PRO PRO C . n 
C 1 35  ALA 35  35  35  ALA ALA C . n 
C 1 36  GLY 36  36  36  GLY GLY C . n 
C 1 37  HIS 37  37  37  HIS HIS C . n 
C 1 38  LEU 38  38  38  LEU LEU C . n 
C 1 39  GLU 39  39  39  GLU GLU C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  ASP 41  41  41  ASP ASP C . n 
C 1 42  GLU 42  42  42  GLU GLU C . n 
C 1 43  THR 43  43  43  THR THR C . n 
C 1 44  LEU 44  44  44  LEU LEU C . n 
C 1 45  VAL 45  45  45  VAL VAL C . n 
C 1 46  GLU 46  46  46  GLU GLU C . n 
C 1 47  ALA 47  47  47  ALA ALA C . n 
C 1 48  ALA 48  48  48  ALA ALA C . n 
C 1 49  ALA 49  49  49  ALA ALA C . n 
C 1 50  ARG 50  50  50  ARG ARG C . n 
C 1 51  GLU 51  51  51  GLU GLU C . n 
C 1 52  LEU 52  52  52  LEU LEU C . n 
C 1 53  TRP 53  53  53  TRP TRP C . n 
C 1 54  GLU 54  54  54  GLU GLU C . n 
C 1 55  GLU 55  55  55  GLU GLU C . n 
C 1 56  THR 56  56  56  THR THR C . n 
C 1 57  GLY 57  57  57  GLY GLY C . n 
C 1 58  ILE 58  58  58  ILE ILE C . n 
C 1 59  SER 59  59  59  SER SER C . n 
C 1 60  ALA 60  60  60  ALA ALA C . n 
C 1 61  GLN 61  61  61  GLN GLN C . n 
C 1 62  PRO 62  62  62  PRO PRO C . n 
C 1 63  GLN 63  63  63  GLN GLN C . n 
C 1 64  HIS 64  64  64  HIS HIS C . n 
C 1 65  PHE 65  65  65  PHE PHE C . n 
C 1 66  ILE 66  66  66  ILE ILE C . n 
C 1 67  ARG 67  67  67  ARG ARG C . n 
C 1 68  MET 68  68  68  MET MET C . n 
C 1 69  HIS 69  69  69  HIS HIS C . n 
C 1 70  GLN 70  70  70  GLN GLN C . n 
C 1 71  TRP 71  71  71  TRP TRP C . n 
C 1 72  ILE 72  72  72  ILE ILE C . n 
C 1 73  ALA 73  73  73  ALA ALA C . n 
C 1 74  PRO 74  74  74  PRO PRO C . n 
C 1 75  ASP 75  75  75  ASP ASP C . n 
C 1 76  LYS 76  76  76  LYS LYS C . n 
C 1 77  THR 77  77  77  THR THR C . n 
C 1 78  PRO 78  78  78  PRO PRO C . n 
C 1 79  PHE 79  79  79  PHE PHE C . n 
C 1 80  LEU 80  80  80  LEU LEU C . n 
C 1 81  ARG 81  81  81  ARG ARG C . n 
C 1 82  PHE 82  82  82  PHE PHE C . n 
C 1 83  LEU 83  83  83  LEU LEU C . n 
C 1 84  PHE 84  84  84  PHE PHE C . n 
C 1 85  ALA 85  85  85  ALA ALA C . n 
C 1 86  ILE 86  86  86  ILE ILE C . n 
C 1 87  GLU 87  87  87  GLU GLU C . n 
C 1 88  LEU 88  88  88  LEU LEU C . n 
C 1 89  GLU 89  89  89  GLU GLU C . n 
C 1 90  GLN 90  90  90  GLN GLN C . n 
C 1 91  ILE 91  91  91  ILE ILE C . n 
C 1 92  CYS 92  92  92  CYS CYS C . n 
C 1 93  PRO 93  93  93  PRO PRO C . n 
C 1 94  THR 94  94  94  THR THR C . n 
C 1 95  GLN 95  95  95  GLN GLN C . n 
C 1 96  PRO 96  96  96  PRO PRO C . n 
C 1 97  HIS 97  97  97  HIS HIS C . n 
C 1 98  ASP 98  98  98  ASP ASP C . n 
C 1 99  SER 99  99  99  SER SER C . n 
C 1 100 ASP 100 100 100 ASP ASP C . n 
C 1 101 ILE 101 101 101 ILE ILE C . n 
C 1 102 ASP 102 102 102 ASP ASP C . n 
C 1 103 CYS 103 103 103 CYS CYS C . n 
C 1 104 CYS 104 104 104 CYS CYS C . n 
C 1 105 ARG 105 105 105 ARG ARG C . n 
C 1 106 TRP 106 106 106 TRP TRP C . n 
C 1 107 VAL 107 107 107 VAL VAL C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 ALA 109 109 109 ALA ALA C . n 
C 1 110 GLU 110 110 110 GLU GLU C . n 
C 1 111 GLU 111 111 111 GLU GLU C . n 
C 1 112 ILE 112 112 112 ILE ILE C . n 
C 1 113 LEU 113 113 113 LEU LEU C . n 
C 1 114 GLN 114 114 114 GLN GLN C . n 
C 1 115 ALA 115 115 115 ALA ALA C . n 
C 1 116 SER 116 116 116 SER SER C . n 
C 1 117 ASN 117 117 117 ASN ASN C . n 
C 1 118 LEU 118 118 118 LEU LEU C . n 
C 1 119 ARG 119 119 119 ARG ARG C . n 
C 1 120 SER 120 120 120 SER SER C . n 
C 1 121 PRO 121 121 121 PRO PRO C . n 
C 1 122 LEU 122 122 122 LEU LEU C . n 
C 1 123 VAL 123 123 123 VAL VAL C . n 
C 1 124 ALA 124 124 124 ALA ALA C . n 
C 1 125 GLU 125 125 125 GLU GLU C . n 
C 1 126 SER 126 126 126 SER SER C . n 
C 1 127 ILE 127 127 127 ILE ILE C . n 
C 1 128 ARG 128 128 128 ARG ARG C . n 
C 1 129 CYS 129 129 129 CYS CYS C . n 
C 1 130 TYR 130 130 130 TYR TYR C . n 
C 1 131 GLN 131 131 131 GLN GLN C . n 
C 1 132 SER 132 132 132 SER SER C . n 
C 1 133 GLY 133 133 133 GLY GLY C . n 
C 1 134 GLN 134 134 134 GLN GLN C . n 
C 1 135 ARG 135 135 135 ARG ARG C . n 
C 1 136 TYR 136 136 136 TYR TYR C . n 
C 1 137 PRO 137 137 137 PRO PRO C . n 
C 1 138 LEU 138 138 138 LEU LEU C . n 
C 1 139 GLU 139 139 139 GLU GLU C . n 
C 1 140 MET 140 140 140 MET MET C . n 
C 1 141 ILE 141 141 141 ILE ILE C . n 
C 1 142 GLY 142 142 142 GLY GLY C . n 
C 1 143 ASP 143 143 143 ASP ASP C . n 
C 1 144 PHE 144 144 144 PHE PHE C . n 
C 1 145 ASN 145 145 145 ASN ASN C . n 
C 1 146 TRP 146 146 146 TRP TRP C . n 
C 1 147 PRO 147 147 147 PRO PRO C . n 
C 1 148 PHE 148 148 148 PHE PHE C . n 
C 1 149 THR 149 149 149 THR THR C . n 
C 1 150 LYS 150 150 150 LYS LYS C . n 
C 1 151 GLY 151 151 ?   ?   ?   C . n 
C 1 152 VAL 152 152 ?   ?   ?   C . n 
C 1 153 ILE 153 153 ?   ?   ?   C . n 
D 1 1   MET 1   1   1   MET MET D . n 
D 1 2   PHE 2   2   2   PHE PHE D . n 
D 1 3   LYS 3   3   3   LYS LYS D . n 
D 1 4   PRO 4   4   4   PRO PRO D . n 
D 1 5   HIS 5   5   5   HIS HIS D . n 
D 1 6   VAL 6   6   6   VAL VAL D . n 
D 1 7   THR 7   7   7   THR THR D . n 
D 1 8   VAL 8   8   8   VAL VAL D . n 
D 1 9   ALA 9   9   9   ALA ALA D . n 
D 1 10  CYS 10  10  10  CYS CYS D . n 
D 1 11  VAL 11  11  11  VAL VAL D . n 
D 1 12  VAL 12  12  12  VAL VAL D . n 
D 1 13  HIS 13  13  13  HIS HIS D . n 
D 1 14  ALA 14  14  14  ALA ALA D . n 
D 1 15  GLU 15  15  15  GLU GLU D . n 
D 1 16  GLY 16  16  16  GLY GLY D . n 
D 1 17  LYS 17  17  17  LYS LYS D . n 
D 1 18  PHE 18  18  18  PHE PHE D . n 
D 1 19  LEU 19  19  19  LEU LEU D . n 
D 1 20  VAL 20  20  20  VAL VAL D . n 
D 1 21  VAL 21  21  21  VAL VAL D . n 
D 1 22  GLU 22  22  22  GLU GLU D . n 
D 1 23  GLU 23  23  23  GLU GLU D . n 
D 1 24  THR 24  24  24  THR THR D . n 
D 1 25  ILE 25  25  25  ILE ILE D . n 
D 1 26  ASN 26  26  26  ASN ASN D . n 
D 1 27  GLY 27  27  27  GLY GLY D . n 
D 1 28  LYS 28  28  28  LYS LYS D . n 
D 1 29  ALA 29  29  29  ALA ALA D . n 
D 1 30  LEU 30  30  30  LEU LEU D . n 
D 1 31  TRP 31  31  31  TRP TRP D . n 
D 1 32  ASN 32  32  32  ASN ASN D . n 
D 1 33  GLN 33  33  33  GLN GLN D . n 
D 1 34  PRO 34  34  34  PRO PRO D . n 
D 1 35  ALA 35  35  35  ALA ALA D . n 
D 1 36  GLY 36  36  36  GLY GLY D . n 
D 1 37  HIS 37  37  37  HIS HIS D . n 
D 1 38  LEU 38  38  38  LEU LEU D . n 
D 1 39  GLU 39  39  39  GLU GLU D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  ASP 41  41  41  ASP ASP D . n 
D 1 42  GLU 42  42  42  GLU GLU D . n 
D 1 43  THR 43  43  43  THR THR D . n 
D 1 44  LEU 44  44  44  LEU LEU D . n 
D 1 45  VAL 45  45  45  VAL VAL D . n 
D 1 46  GLU 46  46  46  GLU GLU D . n 
D 1 47  ALA 47  47  47  ALA ALA D . n 
D 1 48  ALA 48  48  48  ALA ALA D . n 
D 1 49  ALA 49  49  49  ALA ALA D . n 
D 1 50  ARG 50  50  50  ARG ARG D . n 
D 1 51  GLU 51  51  51  GLU GLU D . n 
D 1 52  LEU 52  52  52  LEU LEU D . n 
D 1 53  TRP 53  53  53  TRP TRP D . n 
D 1 54  GLU 54  54  54  GLU GLU D . n 
D 1 55  GLU 55  55  55  GLU GLU D . n 
D 1 56  THR 56  56  56  THR THR D . n 
D 1 57  GLY 57  57  57  GLY GLY D . n 
D 1 58  ILE 58  58  58  ILE ILE D . n 
D 1 59  SER 59  59  59  SER SER D . n 
D 1 60  ALA 60  60  60  ALA ALA D . n 
D 1 61  GLN 61  61  61  GLN GLN D . n 
D 1 62  PRO 62  62  62  PRO PRO D . n 
D 1 63  GLN 63  63  63  GLN GLN D . n 
D 1 64  HIS 64  64  64  HIS HIS D . n 
D 1 65  PHE 65  65  65  PHE PHE D . n 
D 1 66  ILE 66  66  66  ILE ILE D . n 
D 1 67  ARG 67  67  67  ARG ARG D . n 
D 1 68  MET 68  68  68  MET MET D . n 
D 1 69  HIS 69  69  69  HIS HIS D . n 
D 1 70  GLN 70  70  70  GLN GLN D . n 
D 1 71  TRP 71  71  71  TRP TRP D . n 
D 1 72  ILE 72  72  72  ILE ILE D . n 
D 1 73  ALA 73  73  73  ALA ALA D . n 
D 1 74  PRO 74  74  74  PRO PRO D . n 
D 1 75  ASP 75  75  75  ASP ASP D . n 
D 1 76  LYS 76  76  76  LYS LYS D . n 
D 1 77  THR 77  77  77  THR THR D . n 
D 1 78  PRO 78  78  78  PRO PRO D . n 
D 1 79  PHE 79  79  79  PHE PHE D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  ARG 81  81  81  ARG ARG D . n 
D 1 82  PHE 82  82  82  PHE PHE D . n 
D 1 83  LEU 83  83  83  LEU LEU D . n 
D 1 84  PHE 84  84  84  PHE PHE D . n 
D 1 85  ALA 85  85  85  ALA ALA D . n 
D 1 86  ILE 86  86  86  ILE ILE D . n 
D 1 87  GLU 87  87  87  GLU GLU D . n 
D 1 88  LEU 88  88  88  LEU LEU D . n 
D 1 89  GLU 89  89  89  GLU GLU D . n 
D 1 90  GLN 90  90  90  GLN GLN D . n 
D 1 91  ILE 91  91  91  ILE ILE D . n 
D 1 92  CYS 92  92  92  CYS CYS D . n 
D 1 93  PRO 93  93  93  PRO PRO D . n 
D 1 94  THR 94  94  94  THR THR D . n 
D 1 95  GLN 95  95  95  GLN GLN D . n 
D 1 96  PRO 96  96  96  PRO PRO D . n 
D 1 97  HIS 97  97  97  HIS HIS D . n 
D 1 98  ASP 98  98  98  ASP ASP D . n 
D 1 99  SER 99  99  99  SER SER D . n 
D 1 100 ASP 100 100 100 ASP ASP D . n 
D 1 101 ILE 101 101 101 ILE ILE D . n 
D 1 102 ASP 102 102 102 ASP ASP D . n 
D 1 103 CYS 103 103 103 CYS CYS D . n 
D 1 104 CYS 104 104 104 CYS CYS D . n 
D 1 105 ARG 105 105 105 ARG ARG D . n 
D 1 106 TRP 106 106 106 TRP TRP D . n 
D 1 107 VAL 107 107 107 VAL VAL D . n 
D 1 108 SER 108 108 108 SER SER D . n 
D 1 109 ALA 109 109 109 ALA ALA D . n 
D 1 110 GLU 110 110 110 GLU GLU D . n 
D 1 111 GLU 111 111 111 GLU GLU D . n 
D 1 112 ILE 112 112 112 ILE ILE D . n 
D 1 113 LEU 113 113 113 LEU LEU D . n 
D 1 114 GLN 114 114 114 GLN GLN D . n 
D 1 115 ALA 115 115 115 ALA ALA D . n 
D 1 116 SER 116 116 116 SER SER D . n 
D 1 117 ASN 117 117 117 ASN ASN D . n 
D 1 118 LEU 118 118 118 LEU LEU D . n 
D 1 119 ARG 119 119 119 ARG ARG D . n 
D 1 120 SER 120 120 120 SER SER D . n 
D 1 121 PRO 121 121 121 PRO PRO D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 VAL 123 123 123 VAL VAL D . n 
D 1 124 ALA 124 124 124 ALA ALA D . n 
D 1 125 GLU 125 125 125 GLU GLU D . n 
D 1 126 SER 126 126 126 SER SER D . n 
D 1 127 ILE 127 127 127 ILE ILE D . n 
D 1 128 ARG 128 128 128 ARG ARG D . n 
D 1 129 CYS 129 129 129 CYS CYS D . n 
D 1 130 TYR 130 130 130 TYR TYR D . n 
D 1 131 GLN 131 131 131 GLN GLN D . n 
D 1 132 SER 132 132 132 SER SER D . n 
D 1 133 GLY 133 133 133 GLY GLY D . n 
D 1 134 GLN 134 134 134 GLN GLN D . n 
D 1 135 ARG 135 135 135 ARG ARG D . n 
D 1 136 TYR 136 136 136 TYR TYR D . n 
D 1 137 PRO 137 137 137 PRO PRO D . n 
D 1 138 LEU 138 138 138 LEU LEU D . n 
D 1 139 GLU 139 139 139 GLU GLU D . n 
D 1 140 MET 140 140 140 MET MET D . n 
D 1 141 ILE 141 141 141 ILE ILE D . n 
D 1 142 GLY 142 142 142 GLY GLY D . n 
D 1 143 ASP 143 143 143 ASP ASP D . n 
D 1 144 PHE 144 144 144 PHE PHE D . n 
D 1 145 ASN 145 145 145 ASN ASN D . n 
D 1 146 TRP 146 146 146 TRP TRP D . n 
D 1 147 PRO 147 147 147 PRO PRO D . n 
D 1 148 PHE 148 148 148 PHE PHE D . n 
D 1 149 THR 149 149 149 THR THR D . n 
D 1 150 LYS 150 150 150 LYS LYS D . n 
D 1 151 GLY 151 151 ?   ?   ?   D . n 
D 1 152 VAL 152 152 ?   ?   ?   D . n 
D 1 153 ILE 153 153 ?   ?   ?   D . n 
E 1 1   MET 1   1   1   MET MET E . n 
E 1 2   PHE 2   2   2   PHE PHE E . n 
E 1 3   LYS 3   3   3   LYS LYS E . n 
E 1 4   PRO 4   4   4   PRO PRO E . n 
E 1 5   HIS 5   5   5   HIS HIS E . n 
E 1 6   VAL 6   6   6   VAL VAL E . n 
E 1 7   THR 7   7   7   THR THR E . n 
E 1 8   VAL 8   8   8   VAL VAL E . n 
E 1 9   ALA 9   9   9   ALA ALA E . n 
E 1 10  CYS 10  10  10  CYS CYS E . n 
E 1 11  VAL 11  11  11  VAL VAL E . n 
E 1 12  VAL 12  12  12  VAL VAL E . n 
E 1 13  HIS 13  13  13  HIS HIS E . n 
E 1 14  ALA 14  14  14  ALA ALA E . n 
E 1 15  GLU 15  15  15  GLU GLU E . n 
E 1 16  GLY 16  16  16  GLY GLY E . n 
E 1 17  LYS 17  17  17  LYS LYS E . n 
E 1 18  PHE 18  18  18  PHE PHE E . n 
E 1 19  LEU 19  19  19  LEU LEU E . n 
E 1 20  VAL 20  20  20  VAL VAL E . n 
E 1 21  VAL 21  21  21  VAL VAL E . n 
E 1 22  GLU 22  22  22  GLU GLU E . n 
E 1 23  GLU 23  23  23  GLU GLU E . n 
E 1 24  THR 24  24  24  THR THR E . n 
E 1 25  ILE 25  25  25  ILE ILE E . n 
E 1 26  ASN 26  26  26  ASN ASN E . n 
E 1 27  GLY 27  27  27  GLY GLY E . n 
E 1 28  LYS 28  28  28  LYS LYS E . n 
E 1 29  ALA 29  29  29  ALA ALA E . n 
E 1 30  LEU 30  30  30  LEU LEU E . n 
E 1 31  TRP 31  31  31  TRP TRP E . n 
E 1 32  ASN 32  32  32  ASN ASN E . n 
E 1 33  GLN 33  33  33  GLN GLN E . n 
E 1 34  PRO 34  34  34  PRO PRO E . n 
E 1 35  ALA 35  35  35  ALA ALA E . n 
E 1 36  GLY 36  36  36  GLY GLY E . n 
E 1 37  HIS 37  37  37  HIS HIS E . n 
E 1 38  LEU 38  38  38  LEU LEU E . n 
E 1 39  GLU 39  39  39  GLU GLU E . n 
E 1 40  ALA 40  40  40  ALA ALA E . n 
E 1 41  ASP 41  41  41  ASP ASP E . n 
E 1 42  GLU 42  42  42  GLU GLU E . n 
E 1 43  THR 43  43  43  THR THR E . n 
E 1 44  LEU 44  44  44  LEU LEU E . n 
E 1 45  VAL 45  45  45  VAL VAL E . n 
E 1 46  GLU 46  46  46  GLU GLU E . n 
E 1 47  ALA 47  47  47  ALA ALA E . n 
E 1 48  ALA 48  48  48  ALA ALA E . n 
E 1 49  ALA 49  49  49  ALA ALA E . n 
E 1 50  ARG 50  50  50  ARG ARG E . n 
E 1 51  GLU 51  51  51  GLU GLU E . n 
E 1 52  LEU 52  52  52  LEU LEU E . n 
E 1 53  TRP 53  53  53  TRP TRP E . n 
E 1 54  GLU 54  54  54  GLU GLU E . n 
E 1 55  GLU 55  55  55  GLU GLU E . n 
E 1 56  THR 56  56  56  THR THR E . n 
E 1 57  GLY 57  57  57  GLY GLY E . n 
E 1 58  ILE 58  58  58  ILE ILE E . n 
E 1 59  SER 59  59  59  SER SER E . n 
E 1 60  ALA 60  60  60  ALA ALA E . n 
E 1 61  GLN 61  61  61  GLN GLN E . n 
E 1 62  PRO 62  62  62  PRO PRO E . n 
E 1 63  GLN 63  63  63  GLN GLN E . n 
E 1 64  HIS 64  64  64  HIS HIS E . n 
E 1 65  PHE 65  65  65  PHE PHE E . n 
E 1 66  ILE 66  66  66  ILE ILE E . n 
E 1 67  ARG 67  67  67  ARG ARG E . n 
E 1 68  MET 68  68  68  MET MET E . n 
E 1 69  HIS 69  69  69  HIS HIS E . n 
E 1 70  GLN 70  70  70  GLN GLN E . n 
E 1 71  TRP 71  71  71  TRP TRP E . n 
E 1 72  ILE 72  72  72  ILE ILE E . n 
E 1 73  ALA 73  73  73  ALA ALA E . n 
E 1 74  PRO 74  74  74  PRO PRO E . n 
E 1 75  ASP 75  75  75  ASP ASP E . n 
E 1 76  LYS 76  76  76  LYS LYS E . n 
E 1 77  THR 77  77  77  THR THR E . n 
E 1 78  PRO 78  78  78  PRO PRO E . n 
E 1 79  PHE 79  79  79  PHE PHE E . n 
E 1 80  LEU 80  80  80  LEU LEU E . n 
E 1 81  ARG 81  81  81  ARG ARG E . n 
E 1 82  PHE 82  82  82  PHE PHE E . n 
E 1 83  LEU 83  83  83  LEU LEU E . n 
E 1 84  PHE 84  84  84  PHE PHE E . n 
E 1 85  ALA 85  85  85  ALA ALA E . n 
E 1 86  ILE 86  86  86  ILE ILE E . n 
E 1 87  GLU 87  87  87  GLU GLU E . n 
E 1 88  LEU 88  88  88  LEU LEU E . n 
E 1 89  GLU 89  89  89  GLU GLU E . n 
E 1 90  GLN 90  90  90  GLN GLN E . n 
E 1 91  ILE 91  91  91  ILE ILE E . n 
E 1 92  CYS 92  92  92  CYS CYS E . n 
E 1 93  PRO 93  93  93  PRO PRO E . n 
E 1 94  THR 94  94  94  THR THR E . n 
E 1 95  GLN 95  95  95  GLN GLN E . n 
E 1 96  PRO 96  96  96  PRO PRO E . n 
E 1 97  HIS 97  97  97  HIS HIS E . n 
E 1 98  ASP 98  98  98  ASP ASP E . n 
E 1 99  SER 99  99  99  SER SER E . n 
E 1 100 ASP 100 100 100 ASP ASP E . n 
E 1 101 ILE 101 101 101 ILE ILE E . n 
E 1 102 ASP 102 102 102 ASP ASP E . n 
E 1 103 CYS 103 103 103 CYS CYS E . n 
E 1 104 CYS 104 104 104 CYS CYS E . n 
E 1 105 ARG 105 105 105 ARG ARG E . n 
E 1 106 TRP 106 106 106 TRP TRP E . n 
E 1 107 VAL 107 107 107 VAL VAL E . n 
E 1 108 SER 108 108 108 SER SER E . n 
E 1 109 ALA 109 109 109 ALA ALA E . n 
E 1 110 GLU 110 110 110 GLU GLU E . n 
E 1 111 GLU 111 111 111 GLU GLU E . n 
E 1 112 ILE 112 112 112 ILE ILE E . n 
E 1 113 LEU 113 113 113 LEU LEU E . n 
E 1 114 GLN 114 114 114 GLN GLN E . n 
E 1 115 ALA 115 115 115 ALA ALA E . n 
E 1 116 SER 116 116 116 SER SER E . n 
E 1 117 ASN 117 117 117 ASN ASN E . n 
E 1 118 LEU 118 118 118 LEU LEU E . n 
E 1 119 ARG 119 119 119 ARG ARG E . n 
E 1 120 SER 120 120 120 SER SER E . n 
E 1 121 PRO 121 121 121 PRO PRO E . n 
E 1 122 LEU 122 122 122 LEU LEU E . n 
E 1 123 VAL 123 123 123 VAL VAL E . n 
E 1 124 ALA 124 124 124 ALA ALA E . n 
E 1 125 GLU 125 125 125 GLU GLU E . n 
E 1 126 SER 126 126 126 SER SER E . n 
E 1 127 ILE 127 127 127 ILE ILE E . n 
E 1 128 ARG 128 128 128 ARG ARG E . n 
E 1 129 CYS 129 129 129 CYS CYS E . n 
E 1 130 TYR 130 130 130 TYR TYR E . n 
E 1 131 GLN 131 131 131 GLN GLN E . n 
E 1 132 SER 132 132 132 SER SER E . n 
E 1 133 GLY 133 133 133 GLY GLY E . n 
E 1 134 GLN 134 134 134 GLN GLN E . n 
E 1 135 ARG 135 135 135 ARG ARG E . n 
E 1 136 TYR 136 136 136 TYR TYR E . n 
E 1 137 PRO 137 137 137 PRO PRO E . n 
E 1 138 LEU 138 138 138 LEU LEU E . n 
E 1 139 GLU 139 139 139 GLU GLU E . n 
E 1 140 MET 140 140 140 MET MET E . n 
E 1 141 ILE 141 141 141 ILE ILE E . n 
E 1 142 GLY 142 142 142 GLY GLY E . n 
E 1 143 ASP 143 143 143 ASP ASP E . n 
E 1 144 PHE 144 144 144 PHE PHE E . n 
E 1 145 ASN 145 145 145 ASN ASN E . n 
E 1 146 TRP 146 146 146 TRP TRP E . n 
E 1 147 PRO 147 147 147 PRO PRO E . n 
E 1 148 PHE 148 148 148 PHE PHE E . n 
E 1 149 THR 149 149 149 THR THR E . n 
E 1 150 LYS 150 150 150 LYS LYS E . n 
E 1 151 GLY 151 151 ?   ?   ?   E . n 
E 1 152 VAL 152 152 ?   ?   ?   E . n 
E 1 153 ILE 153 153 ?   ?   ?   E . n 
F 1 1   MET 1   1   1   MET MET F . n 
F 1 2   PHE 2   2   2   PHE PHE F . n 
F 1 3   LYS 3   3   3   LYS LYS F . n 
F 1 4   PRO 4   4   4   PRO PRO F . n 
F 1 5   HIS 5   5   5   HIS HIS F . n 
F 1 6   VAL 6   6   6   VAL VAL F . n 
F 1 7   THR 7   7   7   THR THR F . n 
F 1 8   VAL 8   8   8   VAL VAL F . n 
F 1 9   ALA 9   9   9   ALA ALA F . n 
F 1 10  CYS 10  10  10  CYS CYS F . n 
F 1 11  VAL 11  11  11  VAL VAL F . n 
F 1 12  VAL 12  12  12  VAL VAL F . n 
F 1 13  HIS 13  13  13  HIS HIS F . n 
F 1 14  ALA 14  14  14  ALA ALA F . n 
F 1 15  GLU 15  15  15  GLU GLU F . n 
F 1 16  GLY 16  16  16  GLY GLY F . n 
F 1 17  LYS 17  17  17  LYS LYS F . n 
F 1 18  PHE 18  18  18  PHE PHE F . n 
F 1 19  LEU 19  19  19  LEU LEU F . n 
F 1 20  VAL 20  20  20  VAL VAL F . n 
F 1 21  VAL 21  21  21  VAL VAL F . n 
F 1 22  GLU 22  22  22  GLU GLU F . n 
F 1 23  GLU 23  23  23  GLU GLU F . n 
F 1 24  THR 24  24  24  THR THR F . n 
F 1 25  ILE 25  25  25  ILE ILE F . n 
F 1 26  ASN 26  26  26  ASN ASN F . n 
F 1 27  GLY 27  27  27  GLY GLY F . n 
F 1 28  LYS 28  28  28  LYS LYS F . n 
F 1 29  ALA 29  29  29  ALA ALA F . n 
F 1 30  LEU 30  30  30  LEU LEU F . n 
F 1 31  TRP 31  31  31  TRP TRP F . n 
F 1 32  ASN 32  32  32  ASN ASN F . n 
F 1 33  GLN 33  33  33  GLN GLN F . n 
F 1 34  PRO 34  34  34  PRO PRO F . n 
F 1 35  ALA 35  35  35  ALA ALA F . n 
F 1 36  GLY 36  36  36  GLY GLY F . n 
F 1 37  HIS 37  37  37  HIS HIS F . n 
F 1 38  LEU 38  38  38  LEU LEU F . n 
F 1 39  GLU 39  39  39  GLU GLU F . n 
F 1 40  ALA 40  40  40  ALA ALA F . n 
F 1 41  ASP 41  41  41  ASP ASP F . n 
F 1 42  GLU 42  42  42  GLU GLU F . n 
F 1 43  THR 43  43  43  THR THR F . n 
F 1 44  LEU 44  44  44  LEU LEU F . n 
F 1 45  VAL 45  45  45  VAL VAL F . n 
F 1 46  GLU 46  46  46  GLU GLU F . n 
F 1 47  ALA 47  47  47  ALA ALA F . n 
F 1 48  ALA 48  48  48  ALA ALA F . n 
F 1 49  ALA 49  49  49  ALA ALA F . n 
F 1 50  ARG 50  50  50  ARG ARG F . n 
F 1 51  GLU 51  51  51  GLU GLU F . n 
F 1 52  LEU 52  52  52  LEU LEU F . n 
F 1 53  TRP 53  53  53  TRP TRP F . n 
F 1 54  GLU 54  54  54  GLU GLU F . n 
F 1 55  GLU 55  55  55  GLU GLU F . n 
F 1 56  THR 56  56  56  THR THR F . n 
F 1 57  GLY 57  57  57  GLY GLY F . n 
F 1 58  ILE 58  58  58  ILE ILE F . n 
F 1 59  SER 59  59  59  SER SER F . n 
F 1 60  ALA 60  60  60  ALA ALA F . n 
F 1 61  GLN 61  61  61  GLN GLN F . n 
F 1 62  PRO 62  62  62  PRO PRO F . n 
F 1 63  GLN 63  63  63  GLN GLN F . n 
F 1 64  HIS 64  64  64  HIS HIS F . n 
F 1 65  PHE 65  65  65  PHE PHE F . n 
F 1 66  ILE 66  66  66  ILE ILE F . n 
F 1 67  ARG 67  67  67  ARG ARG F . n 
F 1 68  MET 68  68  68  MET MET F . n 
F 1 69  HIS 69  69  69  HIS HIS F . n 
F 1 70  GLN 70  70  70  GLN GLN F . n 
F 1 71  TRP 71  71  71  TRP TRP F . n 
F 1 72  ILE 72  72  72  ILE ILE F . n 
F 1 73  ALA 73  73  73  ALA ALA F . n 
F 1 74  PRO 74  74  74  PRO PRO F . n 
F 1 75  ASP 75  75  75  ASP ASP F . n 
F 1 76  LYS 76  76  76  LYS LYS F . n 
F 1 77  THR 77  77  77  THR THR F . n 
F 1 78  PRO 78  78  78  PRO PRO F . n 
F 1 79  PHE 79  79  79  PHE PHE F . n 
F 1 80  LEU 80  80  80  LEU LEU F . n 
F 1 81  ARG 81  81  81  ARG ARG F . n 
F 1 82  PHE 82  82  82  PHE PHE F . n 
F 1 83  LEU 83  83  83  LEU LEU F . n 
F 1 84  PHE 84  84  84  PHE PHE F . n 
F 1 85  ALA 85  85  85  ALA ALA F . n 
F 1 86  ILE 86  86  86  ILE ILE F . n 
F 1 87  GLU 87  87  87  GLU GLU F . n 
F 1 88  LEU 88  88  88  LEU LEU F . n 
F 1 89  GLU 89  89  89  GLU GLU F . n 
F 1 90  GLN 90  90  90  GLN GLN F . n 
F 1 91  ILE 91  91  91  ILE ILE F . n 
F 1 92  CYS 92  92  92  CYS CYS F . n 
F 1 93  PRO 93  93  93  PRO PRO F . n 
F 1 94  THR 94  94  94  THR THR F . n 
F 1 95  GLN 95  95  95  GLN GLN F . n 
F 1 96  PRO 96  96  96  PRO PRO F . n 
F 1 97  HIS 97  97  97  HIS HIS F . n 
F 1 98  ASP 98  98  98  ASP ASP F . n 
F 1 99  SER 99  99  99  SER SER F . n 
F 1 100 ASP 100 100 100 ASP ASP F . n 
F 1 101 ILE 101 101 101 ILE ILE F . n 
F 1 102 ASP 102 102 102 ASP ASP F . n 
F 1 103 CYS 103 103 103 CYS CYS F . n 
F 1 104 CYS 104 104 104 CYS CYS F . n 
F 1 105 ARG 105 105 105 ARG ARG F . n 
F 1 106 TRP 106 106 106 TRP TRP F . n 
F 1 107 VAL 107 107 107 VAL VAL F . n 
F 1 108 SER 108 108 108 SER SER F . n 
F 1 109 ALA 109 109 109 ALA ALA F . n 
F 1 110 GLU 110 110 110 GLU GLU F . n 
F 1 111 GLU 111 111 111 GLU GLU F . n 
F 1 112 ILE 112 112 112 ILE ILE F . n 
F 1 113 LEU 113 113 113 LEU LEU F . n 
F 1 114 GLN 114 114 114 GLN GLN F . n 
F 1 115 ALA 115 115 115 ALA ALA F . n 
F 1 116 SER 116 116 116 SER SER F . n 
F 1 117 ASN 117 117 117 ASN ASN F . n 
F 1 118 LEU 118 118 118 LEU LEU F . n 
F 1 119 ARG 119 119 119 ARG ARG F . n 
F 1 120 SER 120 120 120 SER SER F . n 
F 1 121 PRO 121 121 121 PRO PRO F . n 
F 1 122 LEU 122 122 122 LEU LEU F . n 
F 1 123 VAL 123 123 123 VAL VAL F . n 
F 1 124 ALA 124 124 124 ALA ALA F . n 
F 1 125 GLU 125 125 125 GLU GLU F . n 
F 1 126 SER 126 126 126 SER SER F . n 
F 1 127 ILE 127 127 127 ILE ILE F . n 
F 1 128 ARG 128 128 128 ARG ARG F . n 
F 1 129 CYS 129 129 129 CYS CYS F . n 
F 1 130 TYR 130 130 130 TYR TYR F . n 
F 1 131 GLN 131 131 131 GLN GLN F . n 
F 1 132 SER 132 132 132 SER SER F . n 
F 1 133 GLY 133 133 133 GLY GLY F . n 
F 1 134 GLN 134 134 134 GLN GLN F . n 
F 1 135 ARG 135 135 135 ARG ARG F . n 
F 1 136 TYR 136 136 136 TYR TYR F . n 
F 1 137 PRO 137 137 137 PRO PRO F . n 
F 1 138 LEU 138 138 138 LEU LEU F . n 
F 1 139 GLU 139 139 139 GLU GLU F . n 
F 1 140 MET 140 140 140 MET MET F . n 
F 1 141 ILE 141 141 141 ILE ILE F . n 
F 1 142 GLY 142 142 142 GLY GLY F . n 
F 1 143 ASP 143 143 143 ASP ASP F . n 
F 1 144 PHE 144 144 144 PHE PHE F . n 
F 1 145 ASN 145 145 145 ASN ASN F . n 
F 1 146 TRP 146 146 146 TRP TRP F . n 
F 1 147 PRO 147 147 147 PRO PRO F . n 
F 1 148 PHE 148 148 148 PHE PHE F . n 
F 1 149 THR 149 149 149 THR THR F . n 
F 1 150 LYS 150 150 150 LYS LYS F . n 
F 1 151 GLY 151 151 ?   ?   ?   F . n 
F 1 152 VAL 152 152 ?   ?   ?   F . n 
F 1 153 ILE 153 153 ?   ?   ?   F . n 
G 1 1   MET 1   1   1   MET MET G . n 
G 1 2   PHE 2   2   2   PHE PHE G . n 
G 1 3   LYS 3   3   3   LYS LYS G . n 
G 1 4   PRO 4   4   4   PRO PRO G . n 
G 1 5   HIS 5   5   5   HIS HIS G . n 
G 1 6   VAL 6   6   6   VAL VAL G . n 
G 1 7   THR 7   7   7   THR THR G . n 
G 1 8   VAL 8   8   8   VAL VAL G . n 
G 1 9   ALA 9   9   9   ALA ALA G . n 
G 1 10  CYS 10  10  10  CYS CYS G . n 
G 1 11  VAL 11  11  11  VAL VAL G . n 
G 1 12  VAL 12  12  12  VAL VAL G . n 
G 1 13  HIS 13  13  13  HIS HIS G . n 
G 1 14  ALA 14  14  14  ALA ALA G . n 
G 1 15  GLU 15  15  15  GLU GLU G . n 
G 1 16  GLY 16  16  16  GLY GLY G . n 
G 1 17  LYS 17  17  17  LYS LYS G . n 
G 1 18  PHE 18  18  18  PHE PHE G . n 
G 1 19  LEU 19  19  19  LEU LEU G . n 
G 1 20  VAL 20  20  20  VAL VAL G . n 
G 1 21  VAL 21  21  21  VAL VAL G . n 
G 1 22  GLU 22  22  22  GLU GLU G . n 
G 1 23  GLU 23  23  23  GLU GLU G . n 
G 1 24  THR 24  24  24  THR THR G . n 
G 1 25  ILE 25  25  25  ILE ILE G . n 
G 1 26  ASN 26  26  26  ASN ASN G . n 
G 1 27  GLY 27  27  27  GLY GLY G . n 
G 1 28  LYS 28  28  28  LYS LYS G . n 
G 1 29  ALA 29  29  29  ALA ALA G . n 
G 1 30  LEU 30  30  30  LEU LEU G . n 
G 1 31  TRP 31  31  31  TRP TRP G . n 
G 1 32  ASN 32  32  32  ASN ASN G . n 
G 1 33  GLN 33  33  33  GLN GLN G . n 
G 1 34  PRO 34  34  34  PRO PRO G . n 
G 1 35  ALA 35  35  35  ALA ALA G . n 
G 1 36  GLY 36  36  36  GLY GLY G . n 
G 1 37  HIS 37  37  37  HIS HIS G . n 
G 1 38  LEU 38  38  38  LEU LEU G . n 
G 1 39  GLU 39  39  39  GLU GLU G . n 
G 1 40  ALA 40  40  40  ALA ALA G . n 
G 1 41  ASP 41  41  41  ASP ASP G . n 
G 1 42  GLU 42  42  42  GLU GLU G . n 
G 1 43  THR 43  43  43  THR THR G . n 
G 1 44  LEU 44  44  44  LEU LEU G . n 
G 1 45  VAL 45  45  45  VAL VAL G . n 
G 1 46  GLU 46  46  46  GLU GLU G . n 
G 1 47  ALA 47  47  47  ALA ALA G . n 
G 1 48  ALA 48  48  48  ALA ALA G . n 
G 1 49  ALA 49  49  49  ALA ALA G . n 
G 1 50  ARG 50  50  50  ARG ARG G . n 
G 1 51  GLU 51  51  51  GLU GLU G . n 
G 1 52  LEU 52  52  52  LEU LEU G . n 
G 1 53  TRP 53  53  53  TRP TRP G . n 
G 1 54  GLU 54  54  54  GLU GLU G . n 
G 1 55  GLU 55  55  55  GLU GLU G . n 
G 1 56  THR 56  56  56  THR THR G . n 
G 1 57  GLY 57  57  57  GLY GLY G . n 
G 1 58  ILE 58  58  58  ILE ILE G . n 
G 1 59  SER 59  59  59  SER SER G . n 
G 1 60  ALA 60  60  60  ALA ALA G . n 
G 1 61  GLN 61  61  61  GLN GLN G . n 
G 1 62  PRO 62  62  62  PRO PRO G . n 
G 1 63  GLN 63  63  63  GLN GLN G . n 
G 1 64  HIS 64  64  64  HIS HIS G . n 
G 1 65  PHE 65  65  65  PHE PHE G . n 
G 1 66  ILE 66  66  66  ILE ILE G . n 
G 1 67  ARG 67  67  67  ARG ARG G . n 
G 1 68  MET 68  68  68  MET MET G . n 
G 1 69  HIS 69  69  69  HIS HIS G . n 
G 1 70  GLN 70  70  70  GLN GLN G . n 
G 1 71  TRP 71  71  71  TRP TRP G . n 
G 1 72  ILE 72  72  72  ILE ILE G . n 
G 1 73  ALA 73  73  73  ALA ALA G . n 
G 1 74  PRO 74  74  74  PRO PRO G . n 
G 1 75  ASP 75  75  75  ASP ASP G . n 
G 1 76  LYS 76  76  76  LYS LYS G . n 
G 1 77  THR 77  77  77  THR THR G . n 
G 1 78  PRO 78  78  78  PRO PRO G . n 
G 1 79  PHE 79  79  79  PHE PHE G . n 
G 1 80  LEU 80  80  80  LEU LEU G . n 
G 1 81  ARG 81  81  81  ARG ARG G . n 
G 1 82  PHE 82  82  82  PHE PHE G . n 
G 1 83  LEU 83  83  83  LEU LEU G . n 
G 1 84  PHE 84  84  84  PHE PHE G . n 
G 1 85  ALA 85  85  85  ALA ALA G . n 
G 1 86  ILE 86  86  86  ILE ILE G . n 
G 1 87  GLU 87  87  87  GLU GLU G . n 
G 1 88  LEU 88  88  88  LEU LEU G . n 
G 1 89  GLU 89  89  89  GLU GLU G . n 
G 1 90  GLN 90  90  90  GLN GLN G . n 
G 1 91  ILE 91  91  91  ILE ILE G . n 
G 1 92  CYS 92  92  92  CYS CYS G . n 
G 1 93  PRO 93  93  93  PRO PRO G . n 
G 1 94  THR 94  94  94  THR THR G . n 
G 1 95  GLN 95  95  95  GLN GLN G . n 
G 1 96  PRO 96  96  96  PRO PRO G . n 
G 1 97  HIS 97  97  97  HIS HIS G . n 
G 1 98  ASP 98  98  98  ASP ASP G . n 
G 1 99  SER 99  99  99  SER SER G . n 
G 1 100 ASP 100 100 100 ASP ASP G . n 
G 1 101 ILE 101 101 101 ILE ILE G . n 
G 1 102 ASP 102 102 102 ASP ASP G . n 
G 1 103 CYS 103 103 103 CYS CYS G . n 
G 1 104 CYS 104 104 104 CYS CYS G . n 
G 1 105 ARG 105 105 105 ARG ARG G . n 
G 1 106 TRP 106 106 106 TRP TRP G . n 
G 1 107 VAL 107 107 107 VAL VAL G . n 
G 1 108 SER 108 108 108 SER SER G . n 
G 1 109 ALA 109 109 109 ALA ALA G . n 
G 1 110 GLU 110 110 110 GLU GLU G . n 
G 1 111 GLU 111 111 111 GLU GLU G . n 
G 1 112 ILE 112 112 112 ILE ILE G . n 
G 1 113 LEU 113 113 113 LEU LEU G . n 
G 1 114 GLN 114 114 114 GLN GLN G . n 
G 1 115 ALA 115 115 115 ALA ALA G . n 
G 1 116 SER 116 116 116 SER SER G . n 
G 1 117 ASN 117 117 117 ASN ASN G . n 
G 1 118 LEU 118 118 118 LEU LEU G . n 
G 1 119 ARG 119 119 119 ARG ARG G . n 
G 1 120 SER 120 120 120 SER SER G . n 
G 1 121 PRO 121 121 121 PRO PRO G . n 
G 1 122 LEU 122 122 122 LEU LEU G . n 
G 1 123 VAL 123 123 123 VAL VAL G . n 
G 1 124 ALA 124 124 124 ALA ALA G . n 
G 1 125 GLU 125 125 125 GLU GLU G . n 
G 1 126 SER 126 126 126 SER SER G . n 
G 1 127 ILE 127 127 127 ILE ILE G . n 
G 1 128 ARG 128 128 128 ARG ARG G . n 
G 1 129 CYS 129 129 129 CYS CYS G . n 
G 1 130 TYR 130 130 130 TYR TYR G . n 
G 1 131 GLN 131 131 131 GLN GLN G . n 
G 1 132 SER 132 132 132 SER SER G . n 
G 1 133 GLY 133 133 133 GLY GLY G . n 
G 1 134 GLN 134 134 134 GLN GLN G . n 
G 1 135 ARG 135 135 135 ARG ARG G . n 
G 1 136 TYR 136 136 136 TYR TYR G . n 
G 1 137 PRO 137 137 137 PRO PRO G . n 
G 1 138 LEU 138 138 138 LEU LEU G . n 
G 1 139 GLU 139 139 139 GLU GLU G . n 
G 1 140 MET 140 140 140 MET MET G . n 
G 1 141 ILE 141 141 141 ILE ILE G . n 
G 1 142 GLY 142 142 142 GLY GLY G . n 
G 1 143 ASP 143 143 143 ASP ASP G . n 
G 1 144 PHE 144 144 144 PHE PHE G . n 
G 1 145 ASN 145 145 145 ASN ASN G . n 
G 1 146 TRP 146 146 146 TRP TRP G . n 
G 1 147 PRO 147 147 147 PRO PRO G . n 
G 1 148 PHE 148 148 148 PHE PHE G . n 
G 1 149 THR 149 149 149 THR THR G . n 
G 1 150 LYS 150 150 150 LYS LYS G . n 
G 1 151 GLY 151 151 ?   ?   ?   G . n 
G 1 152 VAL 152 152 ?   ?   ?   G . n 
G 1 153 ILE 153 153 ?   ?   ?   G . n 
H 1 1   MET 1   1   1   MET MET H . n 
H 1 2   PHE 2   2   2   PHE PHE H . n 
H 1 3   LYS 3   3   3   LYS LYS H . n 
H 1 4   PRO 4   4   4   PRO PRO H . n 
H 1 5   HIS 5   5   5   HIS HIS H . n 
H 1 6   VAL 6   6   6   VAL VAL H . n 
H 1 7   THR 7   7   7   THR THR H . n 
H 1 8   VAL 8   8   8   VAL VAL H . n 
H 1 9   ALA 9   9   9   ALA ALA H . n 
H 1 10  CYS 10  10  10  CYS CYS H . n 
H 1 11  VAL 11  11  11  VAL VAL H . n 
H 1 12  VAL 12  12  12  VAL VAL H . n 
H 1 13  HIS 13  13  13  HIS HIS H . n 
H 1 14  ALA 14  14  14  ALA ALA H . n 
H 1 15  GLU 15  15  15  GLU GLU H . n 
H 1 16  GLY 16  16  16  GLY GLY H . n 
H 1 17  LYS 17  17  17  LYS LYS H . n 
H 1 18  PHE 18  18  18  PHE PHE H . n 
H 1 19  LEU 19  19  19  LEU LEU H . n 
H 1 20  VAL 20  20  20  VAL VAL H . n 
H 1 21  VAL 21  21  21  VAL VAL H . n 
H 1 22  GLU 22  22  22  GLU GLU H . n 
H 1 23  GLU 23  23  23  GLU GLU H . n 
H 1 24  THR 24  24  24  THR THR H . n 
H 1 25  ILE 25  25  25  ILE ILE H . n 
H 1 26  ASN 26  26  26  ASN ASN H . n 
H 1 27  GLY 27  27  27  GLY GLY H . n 
H 1 28  LYS 28  28  28  LYS LYS H . n 
H 1 29  ALA 29  29  29  ALA ALA H . n 
H 1 30  LEU 30  30  30  LEU LEU H . n 
H 1 31  TRP 31  31  31  TRP TRP H . n 
H 1 32  ASN 32  32  32  ASN ASN H . n 
H 1 33  GLN 33  33  33  GLN GLN H . n 
H 1 34  PRO 34  34  34  PRO PRO H . n 
H 1 35  ALA 35  35  35  ALA ALA H . n 
H 1 36  GLY 36  36  36  GLY GLY H . n 
H 1 37  HIS 37  37  37  HIS HIS H . n 
H 1 38  LEU 38  38  38  LEU LEU H . n 
H 1 39  GLU 39  39  39  GLU GLU H . n 
H 1 40  ALA 40  40  40  ALA ALA H . n 
H 1 41  ASP 41  41  41  ASP ASP H . n 
H 1 42  GLU 42  42  42  GLU GLU H . n 
H 1 43  THR 43  43  43  THR THR H . n 
H 1 44  LEU 44  44  44  LEU LEU H . n 
H 1 45  VAL 45  45  45  VAL VAL H . n 
H 1 46  GLU 46  46  46  GLU GLU H . n 
H 1 47  ALA 47  47  47  ALA ALA H . n 
H 1 48  ALA 48  48  48  ALA ALA H . n 
H 1 49  ALA 49  49  49  ALA ALA H . n 
H 1 50  ARG 50  50  50  ARG ARG H . n 
H 1 51  GLU 51  51  51  GLU GLU H . n 
H 1 52  LEU 52  52  52  LEU LEU H . n 
H 1 53  TRP 53  53  53  TRP TRP H . n 
H 1 54  GLU 54  54  54  GLU GLU H . n 
H 1 55  GLU 55  55  55  GLU GLU H . n 
H 1 56  THR 56  56  56  THR THR H . n 
H 1 57  GLY 57  57  57  GLY GLY H . n 
H 1 58  ILE 58  58  58  ILE ILE H . n 
H 1 59  SER 59  59  59  SER SER H . n 
H 1 60  ALA 60  60  60  ALA ALA H . n 
H 1 61  GLN 61  61  61  GLN GLN H . n 
H 1 62  PRO 62  62  62  PRO PRO H . n 
H 1 63  GLN 63  63  63  GLN GLN H . n 
H 1 64  HIS 64  64  64  HIS HIS H . n 
H 1 65  PHE 65  65  65  PHE PHE H . n 
H 1 66  ILE 66  66  66  ILE ILE H . n 
H 1 67  ARG 67  67  67  ARG ARG H . n 
H 1 68  MET 68  68  68  MET MET H . n 
H 1 69  HIS 69  69  69  HIS HIS H . n 
H 1 70  GLN 70  70  70  GLN GLN H . n 
H 1 71  TRP 71  71  71  TRP TRP H . n 
H 1 72  ILE 72  72  72  ILE ILE H . n 
H 1 73  ALA 73  73  73  ALA ALA H . n 
H 1 74  PRO 74  74  74  PRO PRO H . n 
H 1 75  ASP 75  75  75  ASP ASP H . n 
H 1 76  LYS 76  76  76  LYS LYS H . n 
H 1 77  THR 77  77  77  THR THR H . n 
H 1 78  PRO 78  78  78  PRO PRO H . n 
H 1 79  PHE 79  79  79  PHE PHE H . n 
H 1 80  LEU 80  80  80  LEU LEU H . n 
H 1 81  ARG 81  81  81  ARG ARG H . n 
H 1 82  PHE 82  82  82  PHE PHE H . n 
H 1 83  LEU 83  83  83  LEU LEU H . n 
H 1 84  PHE 84  84  84  PHE PHE H . n 
H 1 85  ALA 85  85  85  ALA ALA H . n 
H 1 86  ILE 86  86  86  ILE ILE H . n 
H 1 87  GLU 87  87  87  GLU GLU H . n 
H 1 88  LEU 88  88  88  LEU LEU H . n 
H 1 89  GLU 89  89  89  GLU GLU H . n 
H 1 90  GLN 90  90  90  GLN GLN H . n 
H 1 91  ILE 91  91  91  ILE ILE H . n 
H 1 92  CYS 92  92  92  CYS CYS H . n 
H 1 93  PRO 93  93  93  PRO PRO H . n 
H 1 94  THR 94  94  94  THR THR H . n 
H 1 95  GLN 95  95  95  GLN GLN H . n 
H 1 96  PRO 96  96  96  PRO PRO H . n 
H 1 97  HIS 97  97  97  HIS HIS H . n 
H 1 98  ASP 98  98  98  ASP ASP H . n 
H 1 99  SER 99  99  99  SER SER H . n 
H 1 100 ASP 100 100 100 ASP ASP H . n 
H 1 101 ILE 101 101 101 ILE ILE H . n 
H 1 102 ASP 102 102 102 ASP ASP H . n 
H 1 103 CYS 103 103 103 CYS CYS H . n 
H 1 104 CYS 104 104 104 CYS CYS H . n 
H 1 105 ARG 105 105 105 ARG ARG H . n 
H 1 106 TRP 106 106 106 TRP TRP H . n 
H 1 107 VAL 107 107 107 VAL VAL H . n 
H 1 108 SER 108 108 108 SER SER H . n 
H 1 109 ALA 109 109 109 ALA ALA H . n 
H 1 110 GLU 110 110 110 GLU GLU H . n 
H 1 111 GLU 111 111 111 GLU GLU H . n 
H 1 112 ILE 112 112 112 ILE ILE H . n 
H 1 113 LEU 113 113 113 LEU LEU H . n 
H 1 114 GLN 114 114 114 GLN GLN H . n 
H 1 115 ALA 115 115 115 ALA ALA H . n 
H 1 116 SER 116 116 116 SER SER H . n 
H 1 117 ASN 117 117 117 ASN ASN H . n 
H 1 118 LEU 118 118 118 LEU LEU H . n 
H 1 119 ARG 119 119 119 ARG ARG H . n 
H 1 120 SER 120 120 120 SER SER H . n 
H 1 121 PRO 121 121 121 PRO PRO H . n 
H 1 122 LEU 122 122 122 LEU LEU H . n 
H 1 123 VAL 123 123 123 VAL VAL H . n 
H 1 124 ALA 124 124 124 ALA ALA H . n 
H 1 125 GLU 125 125 125 GLU GLU H . n 
H 1 126 SER 126 126 126 SER SER H . n 
H 1 127 ILE 127 127 127 ILE ILE H . n 
H 1 128 ARG 128 128 128 ARG ARG H . n 
H 1 129 CYS 129 129 129 CYS CYS H . n 
H 1 130 TYR 130 130 130 TYR TYR H . n 
H 1 131 GLN 131 131 131 GLN GLN H . n 
H 1 132 SER 132 132 132 SER SER H . n 
H 1 133 GLY 133 133 133 GLY GLY H . n 
H 1 134 GLN 134 134 134 GLN GLN H . n 
H 1 135 ARG 135 135 135 ARG ARG H . n 
H 1 136 TYR 136 136 136 TYR TYR H . n 
H 1 137 PRO 137 137 137 PRO PRO H . n 
H 1 138 LEU 138 138 138 LEU LEU H . n 
H 1 139 GLU 139 139 139 GLU GLU H . n 
H 1 140 MET 140 140 140 MET MET H . n 
H 1 141 ILE 141 141 141 ILE ILE H . n 
H 1 142 GLY 142 142 142 GLY GLY H . n 
H 1 143 ASP 143 143 143 ASP ASP H . n 
H 1 144 PHE 144 144 144 PHE PHE H . n 
H 1 145 ASN 145 145 145 ASN ASN H . n 
H 1 146 TRP 146 146 146 TRP TRP H . n 
H 1 147 PRO 147 147 147 PRO PRO H . n 
H 1 148 PHE 148 148 148 PHE PHE H . n 
H 1 149 THR 149 149 149 THR THR H . n 
H 1 150 LYS 150 150 150 LYS LYS H . n 
H 1 151 GLY 151 151 ?   ?   ?   H . n 
H 1 152 VAL 152 152 ?   ?   ?   H . n 
H 1 153 ILE 153 153 ?   ?   ?   H . n 
I 1 1   MET 1   1   1   MET MET I . n 
I 1 2   PHE 2   2   2   PHE PHE I . n 
I 1 3   LYS 3   3   3   LYS LYS I . n 
I 1 4   PRO 4   4   4   PRO PRO I . n 
I 1 5   HIS 5   5   5   HIS HIS I . n 
I 1 6   VAL 6   6   6   VAL VAL I . n 
I 1 7   THR 7   7   7   THR THR I . n 
I 1 8   VAL 8   8   8   VAL VAL I . n 
I 1 9   ALA 9   9   9   ALA ALA I . n 
I 1 10  CYS 10  10  10  CYS CYS I . n 
I 1 11  VAL 11  11  11  VAL VAL I . n 
I 1 12  VAL 12  12  12  VAL VAL I . n 
I 1 13  HIS 13  13  13  HIS HIS I . n 
I 1 14  ALA 14  14  14  ALA ALA I . n 
I 1 15  GLU 15  15  15  GLU GLU I . n 
I 1 16  GLY 16  16  16  GLY GLY I . n 
I 1 17  LYS 17  17  17  LYS LYS I . n 
I 1 18  PHE 18  18  18  PHE PHE I . n 
I 1 19  LEU 19  19  19  LEU LEU I . n 
I 1 20  VAL 20  20  20  VAL VAL I . n 
I 1 21  VAL 21  21  21  VAL VAL I . n 
I 1 22  GLU 22  22  22  GLU GLU I . n 
I 1 23  GLU 23  23  23  GLU GLU I . n 
I 1 24  THR 24  24  24  THR THR I . n 
I 1 25  ILE 25  25  25  ILE ILE I . n 
I 1 26  ASN 26  26  26  ASN ASN I . n 
I 1 27  GLY 27  27  27  GLY GLY I . n 
I 1 28  LYS 28  28  28  LYS LYS I . n 
I 1 29  ALA 29  29  29  ALA ALA I . n 
I 1 30  LEU 30  30  30  LEU LEU I . n 
I 1 31  TRP 31  31  31  TRP TRP I . n 
I 1 32  ASN 32  32  32  ASN ASN I . n 
I 1 33  GLN 33  33  33  GLN GLN I . n 
I 1 34  PRO 34  34  34  PRO PRO I . n 
I 1 35  ALA 35  35  35  ALA ALA I . n 
I 1 36  GLY 36  36  36  GLY GLY I . n 
I 1 37  HIS 37  37  37  HIS HIS I . n 
I 1 38  LEU 38  38  38  LEU LEU I . n 
I 1 39  GLU 39  39  39  GLU GLU I . n 
I 1 40  ALA 40  40  40  ALA ALA I . n 
I 1 41  ASP 41  41  41  ASP ASP I . n 
I 1 42  GLU 42  42  42  GLU GLU I . n 
I 1 43  THR 43  43  43  THR THR I . n 
I 1 44  LEU 44  44  44  LEU LEU I . n 
I 1 45  VAL 45  45  45  VAL VAL I . n 
I 1 46  GLU 46  46  46  GLU GLU I . n 
I 1 47  ALA 47  47  47  ALA ALA I . n 
I 1 48  ALA 48  48  48  ALA ALA I . n 
I 1 49  ALA 49  49  49  ALA ALA I . n 
I 1 50  ARG 50  50  50  ARG ARG I . n 
I 1 51  GLU 51  51  51  GLU GLU I . n 
I 1 52  LEU 52  52  52  LEU LEU I . n 
I 1 53  TRP 53  53  53  TRP TRP I . n 
I 1 54  GLU 54  54  54  GLU GLU I . n 
I 1 55  GLU 55  55  55  GLU GLU I . n 
I 1 56  THR 56  56  56  THR THR I . n 
I 1 57  GLY 57  57  57  GLY GLY I . n 
I 1 58  ILE 58  58  58  ILE ILE I . n 
I 1 59  SER 59  59  59  SER SER I . n 
I 1 60  ALA 60  60  60  ALA ALA I . n 
I 1 61  GLN 61  61  61  GLN GLN I . n 
I 1 62  PRO 62  62  62  PRO PRO I . n 
I 1 63  GLN 63  63  63  GLN GLN I . n 
I 1 64  HIS 64  64  64  HIS HIS I . n 
I 1 65  PHE 65  65  65  PHE PHE I . n 
I 1 66  ILE 66  66  66  ILE ILE I . n 
I 1 67  ARG 67  67  67  ARG ARG I . n 
I 1 68  MET 68  68  68  MET MET I . n 
I 1 69  HIS 69  69  69  HIS HIS I . n 
I 1 70  GLN 70  70  70  GLN GLN I . n 
I 1 71  TRP 71  71  71  TRP TRP I . n 
I 1 72  ILE 72  72  72  ILE ILE I . n 
I 1 73  ALA 73  73  73  ALA ALA I . n 
I 1 74  PRO 74  74  74  PRO PRO I . n 
I 1 75  ASP 75  75  75  ASP ASP I . n 
I 1 76  LYS 76  76  76  LYS LYS I . n 
I 1 77  THR 77  77  77  THR THR I . n 
I 1 78  PRO 78  78  78  PRO PRO I . n 
I 1 79  PHE 79  79  79  PHE PHE I . n 
I 1 80  LEU 80  80  80  LEU LEU I . n 
I 1 81  ARG 81  81  81  ARG ARG I . n 
I 1 82  PHE 82  82  82  PHE PHE I . n 
I 1 83  LEU 83  83  83  LEU LEU I . n 
I 1 84  PHE 84  84  84  PHE PHE I . n 
I 1 85  ALA 85  85  85  ALA ALA I . n 
I 1 86  ILE 86  86  86  ILE ILE I . n 
I 1 87  GLU 87  87  87  GLU GLU I . n 
I 1 88  LEU 88  88  88  LEU LEU I . n 
I 1 89  GLU 89  89  89  GLU GLU I . n 
I 1 90  GLN 90  90  90  GLN GLN I . n 
I 1 91  ILE 91  91  91  ILE ILE I . n 
I 1 92  CYS 92  92  92  CYS CYS I . n 
I 1 93  PRO 93  93  93  PRO PRO I . n 
I 1 94  THR 94  94  94  THR THR I . n 
I 1 95  GLN 95  95  95  GLN GLN I . n 
I 1 96  PRO 96  96  96  PRO PRO I . n 
I 1 97  HIS 97  97  97  HIS HIS I . n 
I 1 98  ASP 98  98  98  ASP ASP I . n 
I 1 99  SER 99  99  99  SER SER I . n 
I 1 100 ASP 100 100 100 ASP ASP I . n 
I 1 101 ILE 101 101 101 ILE ILE I . n 
I 1 102 ASP 102 102 102 ASP ASP I . n 
I 1 103 CYS 103 103 103 CYS CYS I . n 
I 1 104 CYS 104 104 104 CYS CYS I . n 
I 1 105 ARG 105 105 105 ARG ARG I . n 
I 1 106 TRP 106 106 106 TRP TRP I . n 
I 1 107 VAL 107 107 107 VAL VAL I . n 
I 1 108 SER 108 108 108 SER SER I . n 
I 1 109 ALA 109 109 109 ALA ALA I . n 
I 1 110 GLU 110 110 110 GLU GLU I . n 
I 1 111 GLU 111 111 111 GLU GLU I . n 
I 1 112 ILE 112 112 112 ILE ILE I . n 
I 1 113 LEU 113 113 113 LEU LEU I . n 
I 1 114 GLN 114 114 114 GLN GLN I . n 
I 1 115 ALA 115 115 115 ALA ALA I . n 
I 1 116 SER 116 116 116 SER SER I . n 
I 1 117 ASN 117 117 117 ASN ASN I . n 
I 1 118 LEU 118 118 118 LEU LEU I . n 
I 1 119 ARG 119 119 119 ARG ARG I . n 
I 1 120 SER 120 120 120 SER SER I . n 
I 1 121 PRO 121 121 121 PRO PRO I . n 
I 1 122 LEU 122 122 122 LEU LEU I . n 
I 1 123 VAL 123 123 123 VAL VAL I . n 
I 1 124 ALA 124 124 124 ALA ALA I . n 
I 1 125 GLU 125 125 125 GLU GLU I . n 
I 1 126 SER 126 126 126 SER SER I . n 
I 1 127 ILE 127 127 127 ILE ILE I . n 
I 1 128 ARG 128 128 128 ARG ARG I . n 
I 1 129 CYS 129 129 129 CYS CYS I . n 
I 1 130 TYR 130 130 130 TYR TYR I . n 
I 1 131 GLN 131 131 131 GLN GLN I . n 
I 1 132 SER 132 132 132 SER SER I . n 
I 1 133 GLY 133 133 133 GLY GLY I . n 
I 1 134 GLN 134 134 134 GLN GLN I . n 
I 1 135 ARG 135 135 135 ARG ARG I . n 
I 1 136 TYR 136 136 136 TYR TYR I . n 
I 1 137 PRO 137 137 137 PRO PRO I . n 
I 1 138 LEU 138 138 138 LEU LEU I . n 
I 1 139 GLU 139 139 139 GLU GLU I . n 
I 1 140 MET 140 140 140 MET MET I . n 
I 1 141 ILE 141 141 141 ILE ILE I . n 
I 1 142 GLY 142 142 142 GLY GLY I . n 
I 1 143 ASP 143 143 143 ASP ASP I . n 
I 1 144 PHE 144 144 144 PHE PHE I . n 
I 1 145 ASN 145 145 145 ASN ASN I . n 
I 1 146 TRP 146 146 146 TRP TRP I . n 
I 1 147 PRO 147 147 147 PRO PRO I . n 
I 1 148 PHE 148 148 148 PHE PHE I . n 
I 1 149 THR 149 149 149 THR THR I . n 
I 1 150 LYS 150 150 150 LYS LYS I . n 
I 1 151 GLY 151 151 ?   ?   ?   I . n 
I 1 152 VAL 152 152 ?   ?   ?   I . n 
I 1 153 ILE 153 153 ?   ?   ?   I . n 
J 1 1   MET 1   1   1   MET MET J . n 
J 1 2   PHE 2   2   2   PHE PHE J . n 
J 1 3   LYS 3   3   3   LYS LYS J . n 
J 1 4   PRO 4   4   4   PRO PRO J . n 
J 1 5   HIS 5   5   5   HIS HIS J . n 
J 1 6   VAL 6   6   6   VAL VAL J . n 
J 1 7   THR 7   7   7   THR THR J . n 
J 1 8   VAL 8   8   8   VAL VAL J . n 
J 1 9   ALA 9   9   9   ALA ALA J . n 
J 1 10  CYS 10  10  10  CYS CYS J . n 
J 1 11  VAL 11  11  11  VAL VAL J . n 
J 1 12  VAL 12  12  12  VAL VAL J . n 
J 1 13  HIS 13  13  13  HIS HIS J . n 
J 1 14  ALA 14  14  14  ALA ALA J . n 
J 1 15  GLU 15  15  15  GLU GLU J . n 
J 1 16  GLY 16  16  16  GLY GLY J . n 
J 1 17  LYS 17  17  17  LYS LYS J . n 
J 1 18  PHE 18  18  18  PHE PHE J . n 
J 1 19  LEU 19  19  19  LEU LEU J . n 
J 1 20  VAL 20  20  20  VAL VAL J . n 
J 1 21  VAL 21  21  21  VAL VAL J . n 
J 1 22  GLU 22  22  22  GLU GLU J . n 
J 1 23  GLU 23  23  23  GLU GLU J . n 
J 1 24  THR 24  24  24  THR THR J . n 
J 1 25  ILE 25  25  25  ILE ILE J . n 
J 1 26  ASN 26  26  26  ASN ASN J . n 
J 1 27  GLY 27  27  27  GLY GLY J . n 
J 1 28  LYS 28  28  28  LYS LYS J . n 
J 1 29  ALA 29  29  29  ALA ALA J . n 
J 1 30  LEU 30  30  30  LEU LEU J . n 
J 1 31  TRP 31  31  31  TRP TRP J . n 
J 1 32  ASN 32  32  32  ASN ASN J . n 
J 1 33  GLN 33  33  33  GLN GLN J . n 
J 1 34  PRO 34  34  34  PRO PRO J . n 
J 1 35  ALA 35  35  35  ALA ALA J . n 
J 1 36  GLY 36  36  36  GLY GLY J . n 
J 1 37  HIS 37  37  37  HIS HIS J . n 
J 1 38  LEU 38  38  38  LEU LEU J . n 
J 1 39  GLU 39  39  39  GLU GLU J . n 
J 1 40  ALA 40  40  40  ALA ALA J . n 
J 1 41  ASP 41  41  41  ASP ASP J . n 
J 1 42  GLU 42  42  42  GLU GLU J . n 
J 1 43  THR 43  43  43  THR THR J . n 
J 1 44  LEU 44  44  44  LEU LEU J . n 
J 1 45  VAL 45  45  45  VAL VAL J . n 
J 1 46  GLU 46  46  46  GLU GLU J . n 
J 1 47  ALA 47  47  47  ALA ALA J . n 
J 1 48  ALA 48  48  48  ALA ALA J . n 
J 1 49  ALA 49  49  49  ALA ALA J . n 
J 1 50  ARG 50  50  50  ARG ARG J . n 
J 1 51  GLU 51  51  51  GLU GLU J . n 
J 1 52  LEU 52  52  52  LEU LEU J . n 
J 1 53  TRP 53  53  53  TRP TRP J . n 
J 1 54  GLU 54  54  54  GLU GLU J . n 
J 1 55  GLU 55  55  55  GLU GLU J . n 
J 1 56  THR 56  56  56  THR THR J . n 
J 1 57  GLY 57  57  57  GLY GLY J . n 
J 1 58  ILE 58  58  58  ILE ILE J . n 
J 1 59  SER 59  59  59  SER SER J . n 
J 1 60  ALA 60  60  60  ALA ALA J . n 
J 1 61  GLN 61  61  61  GLN GLN J . n 
J 1 62  PRO 62  62  62  PRO PRO J . n 
J 1 63  GLN 63  63  63  GLN GLN J . n 
J 1 64  HIS 64  64  64  HIS HIS J . n 
J 1 65  PHE 65  65  65  PHE PHE J . n 
J 1 66  ILE 66  66  66  ILE ILE J . n 
J 1 67  ARG 67  67  67  ARG ARG J . n 
J 1 68  MET 68  68  68  MET MET J . n 
J 1 69  HIS 69  69  69  HIS HIS J . n 
J 1 70  GLN 70  70  70  GLN GLN J . n 
J 1 71  TRP 71  71  71  TRP TRP J . n 
J 1 72  ILE 72  72  72  ILE ILE J . n 
J 1 73  ALA 73  73  73  ALA ALA J . n 
J 1 74  PRO 74  74  74  PRO PRO J . n 
J 1 75  ASP 75  75  75  ASP ASP J . n 
J 1 76  LYS 76  76  76  LYS LYS J . n 
J 1 77  THR 77  77  77  THR THR J . n 
J 1 78  PRO 78  78  78  PRO PRO J . n 
J 1 79  PHE 79  79  79  PHE PHE J . n 
J 1 80  LEU 80  80  80  LEU LEU J . n 
J 1 81  ARG 81  81  81  ARG ARG J . n 
J 1 82  PHE 82  82  82  PHE PHE J . n 
J 1 83  LEU 83  83  83  LEU LEU J . n 
J 1 84  PHE 84  84  84  PHE PHE J . n 
J 1 85  ALA 85  85  85  ALA ALA J . n 
J 1 86  ILE 86  86  86  ILE ILE J . n 
J 1 87  GLU 87  87  87  GLU GLU J . n 
J 1 88  LEU 88  88  88  LEU LEU J . n 
J 1 89  GLU 89  89  89  GLU GLU J . n 
J 1 90  GLN 90  90  90  GLN GLN J . n 
J 1 91  ILE 91  91  91  ILE ILE J . n 
J 1 92  CYS 92  92  92  CYS CYS J . n 
J 1 93  PRO 93  93  93  PRO PRO J . n 
J 1 94  THR 94  94  94  THR THR J . n 
J 1 95  GLN 95  95  95  GLN GLN J . n 
J 1 96  PRO 96  96  96  PRO PRO J . n 
J 1 97  HIS 97  97  97  HIS HIS J . n 
J 1 98  ASP 98  98  98  ASP ASP J . n 
J 1 99  SER 99  99  99  SER SER J . n 
J 1 100 ASP 100 100 100 ASP ASP J . n 
J 1 101 ILE 101 101 101 ILE ILE J . n 
J 1 102 ASP 102 102 102 ASP ASP J . n 
J 1 103 CYS 103 103 103 CYS CYS J . n 
J 1 104 CYS 104 104 104 CYS CYS J . n 
J 1 105 ARG 105 105 105 ARG ARG J . n 
J 1 106 TRP 106 106 106 TRP TRP J . n 
J 1 107 VAL 107 107 107 VAL VAL J . n 
J 1 108 SER 108 108 108 SER SER J . n 
J 1 109 ALA 109 109 109 ALA ALA J . n 
J 1 110 GLU 110 110 110 GLU GLU J . n 
J 1 111 GLU 111 111 111 GLU GLU J . n 
J 1 112 ILE 112 112 112 ILE ILE J . n 
J 1 113 LEU 113 113 113 LEU LEU J . n 
J 1 114 GLN 114 114 114 GLN GLN J . n 
J 1 115 ALA 115 115 115 ALA ALA J . n 
J 1 116 SER 116 116 116 SER SER J . n 
J 1 117 ASN 117 117 117 ASN ASN J . n 
J 1 118 LEU 118 118 118 LEU LEU J . n 
J 1 119 ARG 119 119 119 ARG ARG J . n 
J 1 120 SER 120 120 120 SER SER J . n 
J 1 121 PRO 121 121 121 PRO PRO J . n 
J 1 122 LEU 122 122 122 LEU LEU J . n 
J 1 123 VAL 123 123 123 VAL VAL J . n 
J 1 124 ALA 124 124 124 ALA ALA J . n 
J 1 125 GLU 125 125 125 GLU GLU J . n 
J 1 126 SER 126 126 126 SER SER J . n 
J 1 127 ILE 127 127 127 ILE ILE J . n 
J 1 128 ARG 128 128 128 ARG ARG J . n 
J 1 129 CYS 129 129 129 CYS CYS J . n 
J 1 130 TYR 130 130 130 TYR TYR J . n 
J 1 131 GLN 131 131 131 GLN GLN J . n 
J 1 132 SER 132 132 132 SER SER J . n 
J 1 133 GLY 133 133 133 GLY GLY J . n 
J 1 134 GLN 134 134 134 GLN GLN J . n 
J 1 135 ARG 135 135 135 ARG ARG J . n 
J 1 136 TYR 136 136 136 TYR TYR J . n 
J 1 137 PRO 137 137 137 PRO PRO J . n 
J 1 138 LEU 138 138 138 LEU LEU J . n 
J 1 139 GLU 139 139 139 GLU GLU J . n 
J 1 140 MET 140 140 140 MET MET J . n 
J 1 141 ILE 141 141 141 ILE ILE J . n 
J 1 142 GLY 142 142 142 GLY GLY J . n 
J 1 143 ASP 143 143 143 ASP ASP J . n 
J 1 144 PHE 144 144 144 PHE PHE J . n 
J 1 145 ASN 145 145 145 ASN ASN J . n 
J 1 146 TRP 146 146 146 TRP TRP J . n 
J 1 147 PRO 147 147 147 PRO PRO J . n 
J 1 148 PHE 148 148 148 PHE PHE J . n 
J 1 149 THR 149 149 149 THR THR J . n 
J 1 150 LYS 150 150 150 LYS LYS J . n 
J 1 151 GLY 151 151 ?   ?   ?   J . n 
J 1 152 VAL 152 152 ?   ?   ?   J . n 
J 1 153 ILE 153 153 ?   ?   ?   J . n 
K 1 1   MET 1   1   1   MET MET K . n 
K 1 2   PHE 2   2   2   PHE PHE K . n 
K 1 3   LYS 3   3   3   LYS LYS K . n 
K 1 4   PRO 4   4   4   PRO PRO K . n 
K 1 5   HIS 5   5   5   HIS HIS K . n 
K 1 6   VAL 6   6   6   VAL VAL K . n 
K 1 7   THR 7   7   7   THR THR K . n 
K 1 8   VAL 8   8   8   VAL VAL K . n 
K 1 9   ALA 9   9   9   ALA ALA K . n 
K 1 10  CYS 10  10  10  CYS CYS K . n 
K 1 11  VAL 11  11  11  VAL VAL K . n 
K 1 12  VAL 12  12  12  VAL VAL K . n 
K 1 13  HIS 13  13  13  HIS HIS K . n 
K 1 14  ALA 14  14  14  ALA ALA K . n 
K 1 15  GLU 15  15  15  GLU GLU K . n 
K 1 16  GLY 16  16  16  GLY GLY K . n 
K 1 17  LYS 17  17  17  LYS LYS K . n 
K 1 18  PHE 18  18  18  PHE PHE K . n 
K 1 19  LEU 19  19  19  LEU LEU K . n 
K 1 20  VAL 20  20  20  VAL VAL K . n 
K 1 21  VAL 21  21  21  VAL VAL K . n 
K 1 22  GLU 22  22  22  GLU GLU K . n 
K 1 23  GLU 23  23  23  GLU GLU K . n 
K 1 24  THR 24  24  24  THR THR K . n 
K 1 25  ILE 25  25  25  ILE ILE K . n 
K 1 26  ASN 26  26  26  ASN ASN K . n 
K 1 27  GLY 27  27  27  GLY GLY K . n 
K 1 28  LYS 28  28  28  LYS LYS K . n 
K 1 29  ALA 29  29  29  ALA ALA K . n 
K 1 30  LEU 30  30  30  LEU LEU K . n 
K 1 31  TRP 31  31  31  TRP TRP K . n 
K 1 32  ASN 32  32  32  ASN ASN K . n 
K 1 33  GLN 33  33  33  GLN GLN K . n 
K 1 34  PRO 34  34  34  PRO PRO K . n 
K 1 35  ALA 35  35  35  ALA ALA K . n 
K 1 36  GLY 36  36  36  GLY GLY K . n 
K 1 37  HIS 37  37  37  HIS HIS K . n 
K 1 38  LEU 38  38  38  LEU LEU K . n 
K 1 39  GLU 39  39  39  GLU GLU K . n 
K 1 40  ALA 40  40  40  ALA ALA K . n 
K 1 41  ASP 41  41  41  ASP ASP K . n 
K 1 42  GLU 42  42  42  GLU GLU K . n 
K 1 43  THR 43  43  43  THR THR K . n 
K 1 44  LEU 44  44  44  LEU LEU K . n 
K 1 45  VAL 45  45  45  VAL VAL K . n 
K 1 46  GLU 46  46  46  GLU GLU K . n 
K 1 47  ALA 47  47  47  ALA ALA K . n 
K 1 48  ALA 48  48  48  ALA ALA K . n 
K 1 49  ALA 49  49  49  ALA ALA K . n 
K 1 50  ARG 50  50  50  ARG ARG K . n 
K 1 51  GLU 51  51  51  GLU GLU K . n 
K 1 52  LEU 52  52  52  LEU LEU K . n 
K 1 53  TRP 53  53  53  TRP TRP K . n 
K 1 54  GLU 54  54  54  GLU GLU K . n 
K 1 55  GLU 55  55  55  GLU GLU K . n 
K 1 56  THR 56  56  56  THR THR K . n 
K 1 57  GLY 57  57  57  GLY GLY K . n 
K 1 58  ILE 58  58  58  ILE ILE K . n 
K 1 59  SER 59  59  59  SER SER K . n 
K 1 60  ALA 60  60  60  ALA ALA K . n 
K 1 61  GLN 61  61  61  GLN GLN K . n 
K 1 62  PRO 62  62  62  PRO PRO K . n 
K 1 63  GLN 63  63  63  GLN GLN K . n 
K 1 64  HIS 64  64  64  HIS HIS K . n 
K 1 65  PHE 65  65  65  PHE PHE K . n 
K 1 66  ILE 66  66  66  ILE ILE K . n 
K 1 67  ARG 67  67  67  ARG ARG K . n 
K 1 68  MET 68  68  68  MET MET K . n 
K 1 69  HIS 69  69  69  HIS HIS K . n 
K 1 70  GLN 70  70  70  GLN GLN K . n 
K 1 71  TRP 71  71  71  TRP TRP K . n 
K 1 72  ILE 72  72  72  ILE ILE K . n 
K 1 73  ALA 73  73  73  ALA ALA K . n 
K 1 74  PRO 74  74  74  PRO PRO K . n 
K 1 75  ASP 75  75  75  ASP ASP K . n 
K 1 76  LYS 76  76  76  LYS LYS K . n 
K 1 77  THR 77  77  77  THR THR K . n 
K 1 78  PRO 78  78  78  PRO PRO K . n 
K 1 79  PHE 79  79  79  PHE PHE K . n 
K 1 80  LEU 80  80  80  LEU LEU K . n 
K 1 81  ARG 81  81  81  ARG ARG K . n 
K 1 82  PHE 82  82  82  PHE PHE K . n 
K 1 83  LEU 83  83  83  LEU LEU K . n 
K 1 84  PHE 84  84  84  PHE PHE K . n 
K 1 85  ALA 85  85  85  ALA ALA K . n 
K 1 86  ILE 86  86  86  ILE ILE K . n 
K 1 87  GLU 87  87  87  GLU GLU K . n 
K 1 88  LEU 88  88  88  LEU LEU K . n 
K 1 89  GLU 89  89  89  GLU GLU K . n 
K 1 90  GLN 90  90  90  GLN GLN K . n 
K 1 91  ILE 91  91  91  ILE ILE K . n 
K 1 92  CYS 92  92  92  CYS CYS K . n 
K 1 93  PRO 93  93  93  PRO PRO K . n 
K 1 94  THR 94  94  94  THR THR K . n 
K 1 95  GLN 95  95  95  GLN GLN K . n 
K 1 96  PRO 96  96  96  PRO PRO K . n 
K 1 97  HIS 97  97  97  HIS HIS K . n 
K 1 98  ASP 98  98  98  ASP ASP K . n 
K 1 99  SER 99  99  99  SER SER K . n 
K 1 100 ASP 100 100 100 ASP ASP K . n 
K 1 101 ILE 101 101 101 ILE ILE K . n 
K 1 102 ASP 102 102 102 ASP ASP K . n 
K 1 103 CYS 103 103 103 CYS CYS K . n 
K 1 104 CYS 104 104 104 CYS CYS K . n 
K 1 105 ARG 105 105 105 ARG ARG K . n 
K 1 106 TRP 106 106 106 TRP TRP K . n 
K 1 107 VAL 107 107 107 VAL VAL K . n 
K 1 108 SER 108 108 108 SER SER K . n 
K 1 109 ALA 109 109 109 ALA ALA K . n 
K 1 110 GLU 110 110 110 GLU GLU K . n 
K 1 111 GLU 111 111 111 GLU GLU K . n 
K 1 112 ILE 112 112 112 ILE ILE K . n 
K 1 113 LEU 113 113 113 LEU LEU K . n 
K 1 114 GLN 114 114 114 GLN GLN K . n 
K 1 115 ALA 115 115 115 ALA ALA K . n 
K 1 116 SER 116 116 116 SER SER K . n 
K 1 117 ASN 117 117 117 ASN ASN K . n 
K 1 118 LEU 118 118 118 LEU LEU K . n 
K 1 119 ARG 119 119 119 ARG ARG K . n 
K 1 120 SER 120 120 120 SER SER K . n 
K 1 121 PRO 121 121 121 PRO PRO K . n 
K 1 122 LEU 122 122 122 LEU LEU K . n 
K 1 123 VAL 123 123 123 VAL VAL K . n 
K 1 124 ALA 124 124 124 ALA ALA K . n 
K 1 125 GLU 125 125 125 GLU GLU K . n 
K 1 126 SER 126 126 126 SER SER K . n 
K 1 127 ILE 127 127 127 ILE ILE K . n 
K 1 128 ARG 128 128 128 ARG ARG K . n 
K 1 129 CYS 129 129 129 CYS CYS K . n 
K 1 130 TYR 130 130 130 TYR TYR K . n 
K 1 131 GLN 131 131 131 GLN GLN K . n 
K 1 132 SER 132 132 132 SER SER K . n 
K 1 133 GLY 133 133 133 GLY GLY K . n 
K 1 134 GLN 134 134 134 GLN GLN K . n 
K 1 135 ARG 135 135 135 ARG ARG K . n 
K 1 136 TYR 136 136 136 TYR TYR K . n 
K 1 137 PRO 137 137 137 PRO PRO K . n 
K 1 138 LEU 138 138 138 LEU LEU K . n 
K 1 139 GLU 139 139 139 GLU GLU K . n 
K 1 140 MET 140 140 140 MET MET K . n 
K 1 141 ILE 141 141 141 ILE ILE K . n 
K 1 142 GLY 142 142 142 GLY GLY K . n 
K 1 143 ASP 143 143 143 ASP ASP K . n 
K 1 144 PHE 144 144 144 PHE PHE K . n 
K 1 145 ASN 145 145 145 ASN ASN K . n 
K 1 146 TRP 146 146 146 TRP TRP K . n 
K 1 147 PRO 147 147 147 PRO PRO K . n 
K 1 148 PHE 148 148 148 PHE PHE K . n 
K 1 149 THR 149 149 149 THR THR K . n 
K 1 150 LYS 150 150 150 LYS LYS K . n 
K 1 151 GLY 151 151 ?   ?   ?   K . n 
K 1 152 VAL 152 152 ?   ?   ?   K . n 
K 1 153 ILE 153 153 ?   ?   ?   K . n 
L 1 1   MET 1   1   1   MET MET L . n 
L 1 2   PHE 2   2   2   PHE PHE L . n 
L 1 3   LYS 3   3   3   LYS LYS L . n 
L 1 4   PRO 4   4   4   PRO PRO L . n 
L 1 5   HIS 5   5   5   HIS HIS L . n 
L 1 6   VAL 6   6   6   VAL VAL L . n 
L 1 7   THR 7   7   7   THR THR L . n 
L 1 8   VAL 8   8   8   VAL VAL L . n 
L 1 9   ALA 9   9   9   ALA ALA L . n 
L 1 10  CYS 10  10  10  CYS CYS L . n 
L 1 11  VAL 11  11  11  VAL VAL L . n 
L 1 12  VAL 12  12  12  VAL VAL L . n 
L 1 13  HIS 13  13  13  HIS HIS L . n 
L 1 14  ALA 14  14  14  ALA ALA L . n 
L 1 15  GLU 15  15  15  GLU GLU L . n 
L 1 16  GLY 16  16  16  GLY GLY L . n 
L 1 17  LYS 17  17  17  LYS LYS L . n 
L 1 18  PHE 18  18  18  PHE PHE L . n 
L 1 19  LEU 19  19  19  LEU LEU L . n 
L 1 20  VAL 20  20  20  VAL VAL L . n 
L 1 21  VAL 21  21  21  VAL VAL L . n 
L 1 22  GLU 22  22  22  GLU GLU L . n 
L 1 23  GLU 23  23  23  GLU GLU L . n 
L 1 24  THR 24  24  24  THR THR L . n 
L 1 25  ILE 25  25  25  ILE ILE L . n 
L 1 26  ASN 26  26  26  ASN ASN L . n 
L 1 27  GLY 27  27  27  GLY GLY L . n 
L 1 28  LYS 28  28  28  LYS LYS L . n 
L 1 29  ALA 29  29  29  ALA ALA L . n 
L 1 30  LEU 30  30  30  LEU LEU L . n 
L 1 31  TRP 31  31  31  TRP TRP L . n 
L 1 32  ASN 32  32  32  ASN ASN L . n 
L 1 33  GLN 33  33  33  GLN GLN L . n 
L 1 34  PRO 34  34  34  PRO PRO L . n 
L 1 35  ALA 35  35  35  ALA ALA L . n 
L 1 36  GLY 36  36  36  GLY GLY L . n 
L 1 37  HIS 37  37  37  HIS HIS L . n 
L 1 38  LEU 38  38  38  LEU LEU L . n 
L 1 39  GLU 39  39  39  GLU GLU L . n 
L 1 40  ALA 40  40  40  ALA ALA L . n 
L 1 41  ASP 41  41  41  ASP ASP L . n 
L 1 42  GLU 42  42  42  GLU GLU L . n 
L 1 43  THR 43  43  43  THR THR L . n 
L 1 44  LEU 44  44  44  LEU LEU L . n 
L 1 45  VAL 45  45  45  VAL VAL L . n 
L 1 46  GLU 46  46  46  GLU GLU L . n 
L 1 47  ALA 47  47  47  ALA ALA L . n 
L 1 48  ALA 48  48  48  ALA ALA L . n 
L 1 49  ALA 49  49  49  ALA ALA L . n 
L 1 50  ARG 50  50  50  ARG ARG L . n 
L 1 51  GLU 51  51  51  GLU GLU L . n 
L 1 52  LEU 52  52  52  LEU LEU L . n 
L 1 53  TRP 53  53  53  TRP TRP L . n 
L 1 54  GLU 54  54  54  GLU GLU L . n 
L 1 55  GLU 55  55  55  GLU GLU L . n 
L 1 56  THR 56  56  56  THR THR L . n 
L 1 57  GLY 57  57  57  GLY GLY L . n 
L 1 58  ILE 58  58  58  ILE ILE L . n 
L 1 59  SER 59  59  59  SER SER L . n 
L 1 60  ALA 60  60  60  ALA ALA L . n 
L 1 61  GLN 61  61  61  GLN GLN L . n 
L 1 62  PRO 62  62  62  PRO PRO L . n 
L 1 63  GLN 63  63  63  GLN GLN L . n 
L 1 64  HIS 64  64  64  HIS HIS L . n 
L 1 65  PHE 65  65  65  PHE PHE L . n 
L 1 66  ILE 66  66  66  ILE ILE L . n 
L 1 67  ARG 67  67  67  ARG ARG L . n 
L 1 68  MET 68  68  68  MET MET L . n 
L 1 69  HIS 69  69  69  HIS HIS L . n 
L 1 70  GLN 70  70  70  GLN GLN L . n 
L 1 71  TRP 71  71  71  TRP TRP L . n 
L 1 72  ILE 72  72  72  ILE ILE L . n 
L 1 73  ALA 73  73  73  ALA ALA L . n 
L 1 74  PRO 74  74  74  PRO PRO L . n 
L 1 75  ASP 75  75  75  ASP ASP L . n 
L 1 76  LYS 76  76  76  LYS LYS L . n 
L 1 77  THR 77  77  77  THR THR L . n 
L 1 78  PRO 78  78  78  PRO PRO L . n 
L 1 79  PHE 79  79  79  PHE PHE L . n 
L 1 80  LEU 80  80  80  LEU LEU L . n 
L 1 81  ARG 81  81  81  ARG ARG L . n 
L 1 82  PHE 82  82  82  PHE PHE L . n 
L 1 83  LEU 83  83  83  LEU LEU L . n 
L 1 84  PHE 84  84  84  PHE PHE L . n 
L 1 85  ALA 85  85  85  ALA ALA L . n 
L 1 86  ILE 86  86  86  ILE ILE L . n 
L 1 87  GLU 87  87  87  GLU GLU L . n 
L 1 88  LEU 88  88  88  LEU LEU L . n 
L 1 89  GLU 89  89  89  GLU GLU L . n 
L 1 90  GLN 90  90  90  GLN GLN L . n 
L 1 91  ILE 91  91  91  ILE ILE L . n 
L 1 92  CYS 92  92  92  CYS CYS L . n 
L 1 93  PRO 93  93  93  PRO PRO L . n 
L 1 94  THR 94  94  94  THR THR L . n 
L 1 95  GLN 95  95  95  GLN GLN L . n 
L 1 96  PRO 96  96  96  PRO PRO L . n 
L 1 97  HIS 97  97  97  HIS HIS L . n 
L 1 98  ASP 98  98  98  ASP ASP L . n 
L 1 99  SER 99  99  99  SER SER L . n 
L 1 100 ASP 100 100 100 ASP ASP L . n 
L 1 101 ILE 101 101 101 ILE ILE L . n 
L 1 102 ASP 102 102 102 ASP ASP L . n 
L 1 103 CYS 103 103 103 CYS CYS L . n 
L 1 104 CYS 104 104 104 CYS CYS L . n 
L 1 105 ARG 105 105 105 ARG ARG L . n 
L 1 106 TRP 106 106 106 TRP TRP L . n 
L 1 107 VAL 107 107 107 VAL VAL L . n 
L 1 108 SER 108 108 108 SER SER L . n 
L 1 109 ALA 109 109 109 ALA ALA L . n 
L 1 110 GLU 110 110 110 GLU GLU L . n 
L 1 111 GLU 111 111 111 GLU GLU L . n 
L 1 112 ILE 112 112 112 ILE ILE L . n 
L 1 113 LEU 113 113 113 LEU LEU L . n 
L 1 114 GLN 114 114 114 GLN GLN L . n 
L 1 115 ALA 115 115 115 ALA ALA L . n 
L 1 116 SER 116 116 116 SER SER L . n 
L 1 117 ASN 117 117 117 ASN ASN L . n 
L 1 118 LEU 118 118 118 LEU LEU L . n 
L 1 119 ARG 119 119 119 ARG ARG L . n 
L 1 120 SER 120 120 120 SER SER L . n 
L 1 121 PRO 121 121 121 PRO PRO L . n 
L 1 122 LEU 122 122 122 LEU LEU L . n 
L 1 123 VAL 123 123 123 VAL VAL L . n 
L 1 124 ALA 124 124 124 ALA ALA L . n 
L 1 125 GLU 125 125 125 GLU GLU L . n 
L 1 126 SER 126 126 126 SER SER L . n 
L 1 127 ILE 127 127 127 ILE ILE L . n 
L 1 128 ARG 128 128 128 ARG ARG L . n 
L 1 129 CYS 129 129 129 CYS CYS L . n 
L 1 130 TYR 130 130 130 TYR TYR L . n 
L 1 131 GLN 131 131 131 GLN GLN L . n 
L 1 132 SER 132 132 132 SER SER L . n 
L 1 133 GLY 133 133 133 GLY GLY L . n 
L 1 134 GLN 134 134 134 GLN GLN L . n 
L 1 135 ARG 135 135 135 ARG ARG L . n 
L 1 136 TYR 136 136 136 TYR TYR L . n 
L 1 137 PRO 137 137 137 PRO PRO L . n 
L 1 138 LEU 138 138 138 LEU LEU L . n 
L 1 139 GLU 139 139 139 GLU GLU L . n 
L 1 140 MET 140 140 140 MET MET L . n 
L 1 141 ILE 141 141 141 ILE ILE L . n 
L 1 142 GLY 142 142 142 GLY GLY L . n 
L 1 143 ASP 143 143 143 ASP ASP L . n 
L 1 144 PHE 144 144 144 PHE PHE L . n 
L 1 145 ASN 145 145 145 ASN ASN L . n 
L 1 146 TRP 146 146 146 TRP TRP L . n 
L 1 147 PRO 147 147 147 PRO PRO L . n 
L 1 148 PHE 148 148 148 PHE PHE L . n 
L 1 149 THR 149 149 149 THR THR L . n 
L 1 150 LYS 150 150 150 LYS LYS L . n 
L 1 151 GLY 151 151 ?   ?   ?   L . n 
L 1 152 VAL 152 152 ?   ?   ?   L . n 
L 1 153 ILE 153 153 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M  2 MN  1  154 1   MN  MN  A . 
N  2 MN  1  155 2   MN  MN  A . 
O  3 SO4 1  156 33  SO4 SO4 A . 
P  3 SO4 1  157 34  SO4 SO4 A . 
Q  3 SO4 1  158 35  SO4 SO4 A . 
R  2 MN  1  154 3   MN  MN  B . 
S  2 MN  1  155 4   MN  MN  B . 
T  3 SO4 1  156 1   SO4 SO4 B . 
U  3 SO4 1  157 2   SO4 SO4 B . 
V  3 SO4 1  158 3   SO4 SO4 B . 
W  2 MN  1  154 5   MN  MN  C . 
X  2 MN  1  155 6   MN  MN  C . 
Y  3 SO4 1  156 4   SO4 SO4 C . 
Z  3 SO4 1  157 5   SO4 SO4 C . 
AA 3 SO4 1  158 6   SO4 SO4 C . 
BA 2 MN  1  154 7   MN  MN  D . 
CA 2 MN  1  155 8   MN  MN  D . 
DA 3 SO4 1  156 7   SO4 SO4 D . 
EA 3 SO4 1  157 8   SO4 SO4 D . 
FA 3 SO4 1  158 9   SO4 SO4 D . 
GA 2 MN  1  154 9   MN  MN  E . 
HA 2 MN  1  155 10  MN  MN  E . 
IA 3 SO4 1  156 10  SO4 SO4 E . 
JA 3 SO4 1  157 11  SO4 SO4 E . 
KA 3 SO4 1  158 12  SO4 SO4 E . 
LA 2 MN  1  154 11  MN  MN  F . 
MA 2 MN  1  155 12  MN  MN  F . 
NA 3 SO4 1  156 13  SO4 SO4 F . 
OA 3 SO4 1  157 14  SO4 SO4 F . 
PA 3 SO4 1  158 15  SO4 SO4 F . 
QA 2 MN  1  154 13  MN  MN  G . 
RA 2 MN  1  155 14  MN  MN  G . 
SA 3 SO4 1  156 16  SO4 SO4 G . 
TA 3 SO4 1  157 17  SO4 SO4 G . 
UA 3 SO4 1  158 36  SO4 SO4 G . 
VA 2 MN  1  154 15  MN  MN  H . 
WA 2 MN  1  155 16  MN  MN  H . 
XA 3 SO4 1  156 18  SO4 SO4 H . 
YA 3 SO4 1  157 19  SO4 SO4 H . 
ZA 3 SO4 1  158 20  SO4 SO4 H . 
AB 2 MN  1  154 17  MN  MN  I . 
BB 2 MN  1  155 18  MN  MN  I . 
CB 3 SO4 1  156 21  SO4 SO4 I . 
DB 3 SO4 1  157 22  SO4 SO4 I . 
EB 3 SO4 1  158 23  SO4 SO4 I . 
FB 2 MN  1  154 19  MN  MN  J . 
GB 2 MN  1  155 20  MN  MN  J . 
HB 3 SO4 1  156 24  SO4 SO4 J . 
IB 3 SO4 1  157 25  SO4 SO4 J . 
JB 3 SO4 1  158 26  SO4 SO4 J . 
KB 2 MN  1  154 21  MN  MN  K . 
LB 2 MN  1  155 22  MN  MN  K . 
MB 3 SO4 1  156 27  SO4 SO4 K . 
NB 3 SO4 1  157 28  SO4 SO4 K . 
OB 3 SO4 1  158 29  SO4 SO4 K . 
PB 2 MN  1  154 23  MN  MN  L . 
QB 2 MN  1  155 24  MN  MN  L . 
RB 3 SO4 1  156 30  SO4 SO4 L . 
SB 3 SO4 1  157 31  SO4 SO4 L . 
TB 3 SO4 1  158 32  SO4 SO4 L . 
UB 4 HOH 1  159 1   HOH HOH A . 
UB 4 HOH 2  160 2   HOH HOH A . 
UB 4 HOH 3  161 3   HOH HOH A . 
UB 4 HOH 4  162 4   HOH HOH A . 
UB 4 HOH 5  163 5   HOH HOH A . 
UB 4 HOH 6  164 6   HOH HOH A . 
UB 4 HOH 7  165 7   HOH HOH A . 
UB 4 HOH 8  166 8   HOH HOH A . 
UB 4 HOH 9  167 9   HOH HOH A . 
UB 4 HOH 10 168 10  HOH HOH A . 
UB 4 HOH 11 169 16  HOH HOH A . 
UB 4 HOH 12 170 28  HOH HOH A . 
UB 4 HOH 13 171 30  HOH HOH A . 
UB 4 HOH 14 172 31  HOH HOH A . 
UB 4 HOH 15 173 42  HOH HOH A . 
UB 4 HOH 16 174 58  HOH HOH A . 
UB 4 HOH 17 175 86  HOH HOH A . 
UB 4 HOH 18 176 87  HOH HOH A . 
UB 4 HOH 19 177 109 HOH HOH A . 
UB 4 HOH 20 178 111 HOH HOH A . 
UB 4 HOH 21 179 179 HOH HOH A . 
UB 4 HOH 22 180 114 HOH HOH A . 
UB 4 HOH 23 181 181 HOH HOH A . 
UB 4 HOH 24 182 115 HOH HOH A . 
UB 4 HOH 25 183 120 HOH HOH A . 
UB 4 HOH 26 184 122 HOH HOH A . 
UB 4 HOH 27 185 150 HOH HOH A . 
UB 4 HOH 28 186 157 HOH HOH A . 
UB 4 HOH 29 187 187 HOH HOH A . 
UB 4 HOH 30 194 194 HOH HOH A . 
UB 4 HOH 31 218 218 HOH HOH A . 
UB 4 HOH 32 265 265 HOH HOH A . 
UB 4 HOH 33 270 270 HOH HOH A . 
UB 4 HOH 34 275 275 HOH HOH A . 
UB 4 HOH 35 277 277 HOH HOH A . 
VB 4 HOH 1  159 12  HOH HOH B . 
VB 4 HOH 2  160 27  HOH HOH B . 
VB 4 HOH 3  161 33  HOH HOH B . 
VB 4 HOH 4  162 45  HOH HOH B . 
VB 4 HOH 5  163 163 HOH HOH B . 
VB 4 HOH 6  164 46  HOH HOH B . 
VB 4 HOH 7  165 70  HOH HOH B . 
VB 4 HOH 8  166 71  HOH HOH B . 
VB 4 HOH 9  167 75  HOH HOH B . 
VB 4 HOH 10 168 168 HOH HOH B . 
VB 4 HOH 11 169 78  HOH HOH B . 
VB 4 HOH 12 170 84  HOH HOH B . 
VB 4 HOH 13 171 103 HOH HOH B . 
VB 4 HOH 14 172 117 HOH HOH B . 
VB 4 HOH 15 173 126 HOH HOH B . 
VB 4 HOH 16 174 130 HOH HOH B . 
VB 4 HOH 17 175 149 HOH HOH B . 
VB 4 HOH 18 176 152 HOH HOH B . 
VB 4 HOH 19 177 177 HOH HOH B . 
VB 4 HOH 20 206 206 HOH HOH B . 
VB 4 HOH 21 213 213 HOH HOH B . 
VB 4 HOH 22 219 219 HOH HOH B . 
VB 4 HOH 23 223 223 HOH HOH B . 
VB 4 HOH 24 240 240 HOH HOH B . 
VB 4 HOH 25 247 247 HOH HOH B . 
VB 4 HOH 26 249 249 HOH HOH B . 
VB 4 HOH 27 251 251 HOH HOH B . 
VB 4 HOH 28 255 255 HOH HOH B . 
VB 4 HOH 29 284 284 HOH HOH B . 
VB 4 HOH 30 285 285 HOH HOH B . 
WB 4 HOH 1  159 15  HOH HOH C . 
WB 4 HOH 2  160 24  HOH HOH C . 
WB 4 HOH 3  161 43  HOH HOH C . 
WB 4 HOH 4  162 47  HOH HOH C . 
WB 4 HOH 5  163 56  HOH HOH C . 
WB 4 HOH 6  164 67  HOH HOH C . 
WB 4 HOH 7  165 79  HOH HOH C . 
WB 4 HOH 8  166 82  HOH HOH C . 
WB 4 HOH 9  167 83  HOH HOH C . 
WB 4 HOH 10 168 90  HOH HOH C . 
WB 4 HOH 11 169 93  HOH HOH C . 
WB 4 HOH 12 170 97  HOH HOH C . 
WB 4 HOH 13 171 98  HOH HOH C . 
WB 4 HOH 14 172 106 HOH HOH C . 
WB 4 HOH 15 173 119 HOH HOH C . 
WB 4 HOH 16 174 124 HOH HOH C . 
WB 4 HOH 17 175 129 HOH HOH C . 
WB 4 HOH 18 176 135 HOH HOH C . 
WB 4 HOH 19 177 136 HOH HOH C . 
WB 4 HOH 20 178 137 HOH HOH C . 
WB 4 HOH 21 183 183 HOH HOH C . 
WB 4 HOH 22 186 186 HOH HOH C . 
WB 4 HOH 23 212 212 HOH HOH C . 
WB 4 HOH 24 225 225 HOH HOH C . 
WB 4 HOH 25 242 242 HOH HOH C . 
WB 4 HOH 26 250 250 HOH HOH C . 
WB 4 HOH 27 253 253 HOH HOH C . 
WB 4 HOH 28 263 263 HOH HOH C . 
WB 4 HOH 29 269 269 HOH HOH C . 
WB 4 HOH 30 273 273 HOH HOH C . 
WB 4 HOH 31 276 276 HOH HOH C . 
WB 4 HOH 32 280 280 HOH HOH C . 
WB 4 HOH 33 281 281 HOH HOH C . 
XB 4 HOH 1  159 25  HOH HOH D . 
XB 4 HOH 2  160 40  HOH HOH D . 
XB 4 HOH 3  161 72  HOH HOH D . 
XB 4 HOH 4  162 80  HOH HOH D . 
XB 4 HOH 5  163 110 HOH HOH D . 
XB 4 HOH 6  164 139 HOH HOH D . 
XB 4 HOH 7  165 151 HOH HOH D . 
XB 4 HOH 8  166 155 HOH HOH D . 
XB 4 HOH 9  167 167 HOH HOH D . 
XB 4 HOH 10 195 195 HOH HOH D . 
XB 4 HOH 11 208 208 HOH HOH D . 
XB 4 HOH 12 222 222 HOH HOH D . 
XB 4 HOH 13 252 252 HOH HOH D . 
XB 4 HOH 14 259 259 HOH HOH D . 
XB 4 HOH 15 260 260 HOH HOH D . 
XB 4 HOH 16 266 266 HOH HOH D . 
XB 4 HOH 17 271 271 HOH HOH D . 
XB 4 HOH 18 274 274 HOH HOH D . 
YB 4 HOH 1  159 17  HOH HOH E . 
YB 4 HOH 2  160 23  HOH HOH E . 
YB 4 HOH 3  161 161 HOH HOH E . 
YB 4 HOH 4  162 29  HOH HOH E . 
YB 4 HOH 5  163 32  HOH HOH E . 
YB 4 HOH 6  164 41  HOH HOH E . 
YB 4 HOH 7  165 48  HOH HOH E . 
YB 4 HOH 8  166 52  HOH HOH E . 
YB 4 HOH 9  167 60  HOH HOH E . 
YB 4 HOH 10 168 68  HOH HOH E . 
YB 4 HOH 11 169 81  HOH HOH E . 
YB 4 HOH 12 170 91  HOH HOH E . 
YB 4 HOH 13 171 96  HOH HOH E . 
YB 4 HOH 14 172 172 HOH HOH E . 
YB 4 HOH 15 173 108 HOH HOH E . 
YB 4 HOH 16 174 174 HOH HOH E . 
YB 4 HOH 17 175 113 HOH HOH E . 
YB 4 HOH 18 176 156 HOH HOH E . 
YB 4 HOH 19 177 158 HOH HOH E . 
YB 4 HOH 20 184 184 HOH HOH E . 
YB 4 HOH 21 189 189 HOH HOH E . 
YB 4 HOH 22 191 191 HOH HOH E . 
YB 4 HOH 23 205 205 HOH HOH E . 
YB 4 HOH 24 217 217 HOH HOH E . 
YB 4 HOH 25 226 226 HOH HOH E . 
YB 4 HOH 26 227 227 HOH HOH E . 
YB 4 HOH 27 231 231 HOH HOH E . 
YB 4 HOH 28 232 232 HOH HOH E . 
YB 4 HOH 29 235 235 HOH HOH E . 
YB 4 HOH 30 237 237 HOH HOH E . 
YB 4 HOH 31 243 243 HOH HOH E . 
YB 4 HOH 32 248 248 HOH HOH E . 
YB 4 HOH 33 264 264 HOH HOH E . 
YB 4 HOH 34 278 278 HOH HOH E . 
YB 4 HOH 35 279 279 HOH HOH E . 
ZB 4 HOH 1  159 38  HOH HOH F . 
ZB 4 HOH 2  160 85  HOH HOH F . 
ZB 4 HOH 3  161 99  HOH HOH F . 
ZB 4 HOH 4  162 133 HOH HOH F . 
ZB 4 HOH 5  163 143 HOH HOH F . 
ZB 4 HOH 6  169 169 HOH HOH F . 
ZB 4 HOH 7  185 185 HOH HOH F . 
ZB 4 HOH 8  211 211 HOH HOH F . 
ZB 4 HOH 9  216 216 HOH HOH F . 
ZB 4 HOH 10 230 230 HOH HOH F . 
ZB 4 HOH 11 272 272 HOH HOH F . 
AC 4 HOH 1  159 34  HOH HOH G . 
AC 4 HOH 2  160 63  HOH HOH G . 
AC 4 HOH 3  161 73  HOH HOH G . 
AC 4 HOH 4  162 74  HOH HOH G . 
AC 4 HOH 5  163 94  HOH HOH G . 
AC 4 HOH 6  164 95  HOH HOH G . 
AC 4 HOH 7  165 101 HOH HOH G . 
AC 4 HOH 8  166 102 HOH HOH G . 
AC 4 HOH 9  167 112 HOH HOH G . 
AC 4 HOH 10 168 125 HOH HOH G . 
AC 4 HOH 11 169 132 HOH HOH G . 
AC 4 HOH 12 170 138 HOH HOH G . 
AC 4 HOH 13 171 171 HOH HOH G . 
AC 4 HOH 14 172 142 HOH HOH G . 
AC 4 HOH 15 173 145 HOH HOH G . 
AC 4 HOH 16 174 147 HOH HOH G . 
AC 4 HOH 17 175 153 HOH HOH G . 
AC 4 HOH 18 188 188 HOH HOH G . 
AC 4 HOH 19 192 192 HOH HOH G . 
AC 4 HOH 20 198 198 HOH HOH G . 
AC 4 HOH 21 200 200 HOH HOH G . 
AC 4 HOH 22 202 202 HOH HOH G . 
AC 4 HOH 23 210 210 HOH HOH G . 
AC 4 HOH 24 233 233 HOH HOH G . 
AC 4 HOH 25 241 241 HOH HOH G . 
AC 4 HOH 26 257 257 HOH HOH G . 
AC 4 HOH 27 283 283 HOH HOH G . 
BC 4 HOH 1  159 11  HOH HOH H . 
BC 4 HOH 2  160 20  HOH HOH H . 
BC 4 HOH 3  161 53  HOH HOH H . 
BC 4 HOH 4  162 55  HOH HOH H . 
BC 4 HOH 5  163 57  HOH HOH H . 
BC 4 HOH 6  164 62  HOH HOH H . 
BC 4 HOH 7  165 64  HOH HOH H . 
BC 4 HOH 8  166 89  HOH HOH H . 
BC 4 HOH 9  167 107 HOH HOH H . 
BC 4 HOH 10 168 131 HOH HOH H . 
BC 4 HOH 11 169 146 HOH HOH H . 
BC 4 HOH 12 170 170 HOH HOH H . 
BC 4 HOH 13 180 180 HOH HOH H . 
BC 4 HOH 14 220 220 HOH HOH H . 
BC 4 HOH 15 228 228 HOH HOH H . 
BC 4 HOH 16 234 234 HOH HOH H . 
BC 4 HOH 17 262 262 HOH HOH H . 
CC 4 HOH 1  159 36  HOH HOH I . 
CC 4 HOH 2  160 160 HOH HOH I . 
CC 4 HOH 3  161 39  HOH HOH I . 
CC 4 HOH 4  162 44  HOH HOH I . 
CC 4 HOH 5  163 65  HOH HOH I . 
CC 4 HOH 6  164 66  HOH HOH I . 
CC 4 HOH 7  165 76  HOH HOH I . 
CC 4 HOH 8  166 92  HOH HOH I . 
CC 4 HOH 9  167 105 HOH HOH I . 
CC 4 HOH 10 168 128 HOH HOH I . 
CC 4 HOH 11 169 141 HOH HOH I . 
CC 4 HOH 12 170 148 HOH HOH I . 
CC 4 HOH 13 171 154 HOH HOH I . 
CC 4 HOH 14 224 224 HOH HOH I . 
CC 4 HOH 15 239 239 HOH HOH I . 
CC 4 HOH 16 245 245 HOH HOH I . 
CC 4 HOH 17 256 256 HOH HOH I . 
CC 4 HOH 18 258 258 HOH HOH I . 
DC 4 HOH 1  159 13  HOH HOH J . 
DC 4 HOH 2  160 61  HOH HOH J . 
DC 4 HOH 3  161 77  HOH HOH J . 
DC 4 HOH 4  162 100 HOH HOH J . 
DC 4 HOH 5  163 116 HOH HOH J . 
DC 4 HOH 6  164 118 HOH HOH J . 
DC 4 HOH 7  165 165 HOH HOH J . 
DC 4 HOH 8  166 166 HOH HOH J . 
DC 4 HOH 9  167 144 HOH HOH J . 
DC 4 HOH 10 175 175 HOH HOH J . 
DC 4 HOH 11 193 193 HOH HOH J . 
DC 4 HOH 12 214 214 HOH HOH J . 
DC 4 HOH 13 238 238 HOH HOH J . 
DC 4 HOH 14 267 267 HOH HOH J . 
EC 4 HOH 1  159 159 HOH HOH K . 
EC 4 HOH 2  160 14  HOH HOH K . 
EC 4 HOH 3  161 18  HOH HOH K . 
EC 4 HOH 4  162 162 HOH HOH K . 
EC 4 HOH 5  163 19  HOH HOH K . 
EC 4 HOH 6  164 164 HOH HOH K . 
EC 4 HOH 7  165 21  HOH HOH K . 
EC 4 HOH 8  166 26  HOH HOH K . 
EC 4 HOH 9  167 35  HOH HOH K . 
EC 4 HOH 10 168 50  HOH HOH K . 
EC 4 HOH 11 169 69  HOH HOH K . 
EC 4 HOH 12 170 88  HOH HOH K . 
EC 4 HOH 13 171 104 HOH HOH K . 
EC 4 HOH 14 172 121 HOH HOH K . 
EC 4 HOH 15 173 127 HOH HOH K . 
EC 4 HOH 16 174 140 HOH HOH K . 
EC 4 HOH 17 178 178 HOH HOH K . 
EC 4 HOH 18 182 182 HOH HOH K . 
EC 4 HOH 19 190 190 HOH HOH K . 
EC 4 HOH 20 197 197 HOH HOH K . 
EC 4 HOH 21 199 199 HOH HOH K . 
EC 4 HOH 22 203 203 HOH HOH K . 
EC 4 HOH 23 204 204 HOH HOH K . 
EC 4 HOH 24 207 207 HOH HOH K . 
EC 4 HOH 25 209 209 HOH HOH K . 
EC 4 HOH 26 236 236 HOH HOH K . 
EC 4 HOH 27 244 244 HOH HOH K . 
EC 4 HOH 28 246 246 HOH HOH K . 
EC 4 HOH 29 254 254 HOH HOH K . 
EC 4 HOH 30 261 261 HOH HOH K . 
EC 4 HOH 31 268 268 HOH HOH K . 
FC 4 HOH 1  159 22  HOH HOH L . 
FC 4 HOH 2  160 37  HOH HOH L . 
FC 4 HOH 3  161 49  HOH HOH L . 
FC 4 HOH 4  162 51  HOH HOH L . 
FC 4 HOH 5  163 54  HOH HOH L . 
FC 4 HOH 6  164 59  HOH HOH L . 
FC 4 HOH 7  165 123 HOH HOH L . 
FC 4 HOH 8  166 134 HOH HOH L . 
FC 4 HOH 9  173 173 HOH HOH L . 
FC 4 HOH 10 176 176 HOH HOH L . 
FC 4 HOH 11 196 196 HOH HOH L . 
FC 4 HOH 12 201 201 HOH HOH L . 
FC 4 HOH 13 215 215 HOH HOH L . 
FC 4 HOH 14 221 221 HOH HOH L . 
FC 4 HOH 15 229 229 HOH HOH L . 
FC 4 HOH 16 282 282 HOH HOH L . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .        ? 1 
PHASES   phasing           .        ? 2 
REFMAC   refinement        5.5.0109 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_cell.entry_id           3SHD 
_cell.length_a           111.126 
_cell.length_b           111.126 
_cell.length_c           247.306 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SHD 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          3SHD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.65 
_exptl_crystal.density_percent_sol   66.26 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            283 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'1.4M ammonium sulfate, 0.1M MES buffer pH 6.0, 100mM MnCl2 , VAPOR DIFFUSION, HANGING DROP, temperature 283K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2009-09-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 4A' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     3SHD 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   182291 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  2.0 
_reflns_shell.d_res_low                   50 
_reflns_shell.percent_possible_all        90.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3SHD 
_refine.ls_number_reflns_obs                     93734 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    95.74 
_refine.ls_R_factor_obs                          0.22967 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.22638 
_refine.ls_R_factor_R_free                       0.29147 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4943 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.919 
_refine.correlation_coeff_Fo_to_Fc_free          0.867 
_refine.B_iso_mean                               38.889 
_refine.aniso_B[1][1]                            0.12 
_refine.aniso_B[2][2]                            0.12 
_refine.aniso_B[3][3]                            -0.25 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.301 
_refine.overall_SU_ML                            0.259 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.797 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.389 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        14496 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         204 
_refine_hist.number_atoms_solvent             285 
_refine_hist.number_atoms_total               14985 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.017  0.022  ? 15060 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.790  1.943  ? 20532 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       7.625  5.000  ? 1788  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.498 24.355 ? 744   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       21.737 15.000 ? 2412  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.293 15.000 ? 84    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.120  0.200  ? 2184  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007  0.021  ? 11580 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.826  1.500  ? 9036  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.551  2.000  ? 14652 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.992  3.000  ? 6024  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.289  4.500  ? 5880  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.500 
_refine_ls_shell.d_res_low                        2.564 
_refine_ls_shell.number_reflns_R_work             6491 
_refine_ls_shell.R_factor_R_work                  0.312 
_refine_ls_shell.percent_reflns_obs               90.42 
_refine_ls_shell.R_factor_R_free                  0.359 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             346 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_database_PDB_matrix.entry_id          3SHD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  3SHD 
_struct.title                     'Crystal structure of Nudix hydrolase Orf153, ymfB, from Escherichia coli K-1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SHD 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'Nudix fold, Nudix motif, Hydrolase, (d)NDP/(d)NTP binding, dephosphorylation' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 3 ? 
Q  N N 3 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 2 ? 
RA N N 2 ? 
SA N N 3 ? 
TA N N 3 ? 
UA N N 3 ? 
VA N N 2 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 3 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 3 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 2 ? 
GB N N 2 ? 
HB N N 3 ? 
IB N N 3 ? 
JB N N 3 ? 
KB N N 2 ? 
LB N N 2 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 3 ? 
PB N N 2 ? 
QB N N 2 ? 
RB N N 3 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 4 ? 
VB N N 4 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 4 ? 
AC N N 4 ? 
BC N N 4 ? 
CC N N 4 ? 
DC N N 4 ? 
EC N N 4 ? 
FC N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NUDJ_ECOK1 
_struct_ref.pdbx_db_accession          A1AA28 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFL
RFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3SHD A 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
2  1 3SHD B 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
3  1 3SHD C 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
4  1 3SHD D 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
5  1 3SHD E 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
6  1 3SHD F 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
7  1 3SHD G 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
8  1 3SHD H 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
9  1 3SHD I 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
10 1 3SHD J 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
11 1 3SHD K 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
12 1 3SHD L 1 ? 153 ? A1AA28 1 ? 153 ? 1 153 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1  author_defined_assembly   ?    monomeric 1 
2  author_defined_assembly   ?    monomeric 1 
3  author_defined_assembly   ?    monomeric 1 
4  author_defined_assembly   ?    monomeric 1 
5  author_defined_assembly   ?    monomeric 1 
6  author_defined_assembly   ?    monomeric 1 
7  author_defined_assembly   ?    monomeric 1 
8  author_defined_assembly   ?    monomeric 1 
9  author_defined_assembly   ?    monomeric 1 
10 author_defined_assembly   ?    monomeric 1 
11 author_defined_assembly   ?    monomeric 1 
12 author_defined_assembly   ?    monomeric 1 
13 software_defined_assembly PISA dimeric   2 
14 software_defined_assembly PISA dimeric   2 
15 software_defined_assembly PISA dimeric   2 
16 software_defined_assembly PISA dimeric   2 
17 software_defined_assembly PISA dimeric   2 
18 software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
13 'ABSA (A^2)' 5400  ? 
13 MORE         -169  ? 
13 'SSA (A^2)'  13320 ? 
14 'ABSA (A^2)' 5350  ? 
14 MORE         -174  ? 
14 'SSA (A^2)'  13290 ? 
15 'ABSA (A^2)' 5430  ? 
15 MORE         -170  ? 
15 'SSA (A^2)'  13040 ? 
16 'ABSA (A^2)' 5380  ? 
16 MORE         -171  ? 
16 'SSA (A^2)'  13210 ? 
17 'ABSA (A^2)' 5460  ? 
17 MORE         -170  ? 
17 'SSA (A^2)'  13190 ? 
18 'ABSA (A^2)' 5390  ? 
18 MORE         -172  ? 
18 'SSA (A^2)'  13130 ? 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1  1 A,M,N,O,P,Q,UB                          
2  1 B,R,S,T,U,V,VB                          
3  1 C,W,X,Y,Z,AA,WB                         
4  1 D,BA,CA,DA,EA,FA,XB                     
5  1 E,GA,HA,IA,JA,KA,YB                     
6  1 F,LA,MA,NA,OA,PA,ZB                     
7  1 G,QA,RA,SA,TA,UA,AC                     
8  1 H,VA,WA,XA,YA,ZA,BC                     
9  1 I,AB,BB,CB,DB,EB,CC                     
10 1 J,FB,GB,HB,IB,JB,DC                     
11 1 K,KB,LB,MB,NB,OB,EC                     
12 1 L,PB,QB,RB,SB,TB,FC                     
13 1 A,I,M,N,O,P,Q,AB,BB,CB,DB,EB,UB,CC      
14 1 B,L,R,S,T,U,V,PB,QB,RB,SB,TB,VB,FC      
15 1 C,G,W,X,Y,Z,AA,QA,RA,SA,TA,UA,WB,AC     
16 1 D,E,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,XB,YB 
17 1 F,K,LA,MA,NA,OA,PA,KB,LB,MB,NB,OB,ZB,EC 
18 1 H,VA,WA,XA,YA,ZA,BC                     
18 2 J,FB,GB,HB,IB,JB,DC                     
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 3_555 -y,x,z+1/4 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 61.8265000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 43  ? GLY A 57  ? THR A 43  GLY A 57  1 ? 15 
HELX_P HELX_P2  2  SER A 108 ? GLN A 114 ? SER A 108 GLN A 114 1 ? 7  
HELX_P HELX_P3  3  PRO A 121 ? SER A 132 ? PRO A 121 SER A 132 1 ? 12 
HELX_P HELX_P4  4  PRO A 137 ? GLY A 142 ? PRO A 137 GLY A 142 5 ? 6  
HELX_P HELX_P5  5  THR B 43  ? GLY B 57  ? THR B 43  GLY B 57  1 ? 15 
HELX_P HELX_P6  6  SER B 108 ? GLN B 114 ? SER B 108 GLN B 114 1 ? 7  
HELX_P HELX_P7  7  SER B 120 ? SER B 132 ? SER B 120 SER B 132 1 ? 13 
HELX_P HELX_P8  8  PRO B 137 ? GLY B 142 ? PRO B 137 GLY B 142 5 ? 6  
HELX_P HELX_P9  9  THR C 43  ? GLY C 57  ? THR C 43  GLY C 57  1 ? 15 
HELX_P HELX_P10 10 ALA C 109 ? GLN C 114 ? ALA C 109 GLN C 114 1 ? 6  
HELX_P HELX_P11 11 SER C 120 ? SER C 132 ? SER C 120 SER C 132 1 ? 13 
HELX_P HELX_P12 12 PRO C 137 ? GLY C 142 ? PRO C 137 GLY C 142 5 ? 6  
HELX_P HELX_P13 13 THR D 43  ? GLY D 57  ? THR D 43  GLY D 57  1 ? 15 
HELX_P HELX_P14 14 SER D 108 ? GLN D 114 ? SER D 108 GLN D 114 1 ? 7  
HELX_P HELX_P15 15 PRO D 121 ? SER D 132 ? PRO D 121 SER D 132 1 ? 12 
HELX_P HELX_P16 16 PRO D 137 ? GLU D 139 ? PRO D 137 GLU D 139 5 ? 3  
HELX_P HELX_P17 17 THR E 43  ? GLY E 57  ? THR E 43  GLY E 57  1 ? 15 
HELX_P HELX_P18 18 SER E 108 ? ALA E 115 ? SER E 108 ALA E 115 1 ? 8  
HELX_P HELX_P19 19 PRO E 121 ? SER E 132 ? PRO E 121 SER E 132 1 ? 12 
HELX_P HELX_P20 20 PRO E 137 ? GLY E 142 ? PRO E 137 GLY E 142 5 ? 6  
HELX_P HELX_P21 21 THR F 43  ? GLY F 57  ? THR F 43  GLY F 57  1 ? 15 
HELX_P HELX_P22 22 SER F 108 ? ALA F 115 ? SER F 108 ALA F 115 1 ? 8  
HELX_P HELX_P23 23 PRO F 121 ? SER F 132 ? PRO F 121 SER F 132 1 ? 12 
HELX_P HELX_P24 24 PRO F 137 ? GLY F 142 ? PRO F 137 GLY F 142 5 ? 6  
HELX_P HELX_P25 25 THR G 43  ? GLU G 55  ? THR G 43  GLU G 55  1 ? 13 
HELX_P HELX_P26 26 ALA G 109 ? GLN G 114 ? ALA G 109 GLN G 114 1 ? 6  
HELX_P HELX_P27 27 PRO G 121 ? SER G 132 ? PRO G 121 SER G 132 1 ? 12 
HELX_P HELX_P28 28 PRO G 137 ? GLY G 142 ? PRO G 137 GLY G 142 5 ? 6  
HELX_P HELX_P29 29 THR H 43  ? GLY H 57  ? THR H 43  GLY H 57  1 ? 15 
HELX_P HELX_P30 30 SER H 108 ? ALA H 115 ? SER H 108 ALA H 115 1 ? 8  
HELX_P HELX_P31 31 PRO H 121 ? GLN H 131 ? PRO H 121 GLN H 131 1 ? 11 
HELX_P HELX_P32 32 PRO H 137 ? GLY H 142 ? PRO H 137 GLY H 142 5 ? 6  
HELX_P HELX_P33 33 THR I 43  ? GLY I 57  ? THR I 43  GLY I 57  1 ? 15 
HELX_P HELX_P34 34 ALA I 109 ? GLN I 114 ? ALA I 109 GLN I 114 1 ? 6  
HELX_P HELX_P35 35 SER I 120 ? GLN I 131 ? SER I 120 GLN I 131 1 ? 12 
HELX_P HELX_P36 36 PRO I 137 ? GLY I 142 ? PRO I 137 GLY I 142 5 ? 6  
HELX_P HELX_P37 37 THR J 43  ? GLY J 57  ? THR J 43  GLY J 57  1 ? 15 
HELX_P HELX_P38 38 SER J 108 ? ALA J 115 ? SER J 108 ALA J 115 1 ? 8  
HELX_P HELX_P39 39 PRO J 121 ? GLY J 133 ? PRO J 121 GLY J 133 1 ? 13 
HELX_P HELX_P40 40 PRO J 137 ? GLY J 142 ? PRO J 137 GLY J 142 5 ? 6  
HELX_P HELX_P41 41 THR K 43  ? GLY K 57  ? THR K 43  GLY K 57  1 ? 15 
HELX_P HELX_P42 42 SER K 108 ? ALA K 115 ? SER K 108 ALA K 115 1 ? 8  
HELX_P HELX_P43 43 SER K 120 ? GLN K 131 ? SER K 120 GLN K 131 1 ? 12 
HELX_P HELX_P44 44 PRO K 137 ? GLY K 142 ? PRO K 137 GLY K 142 5 ? 6  
HELX_P HELX_P45 45 THR L 43  ? GLY L 57  ? THR L 43  GLY L 57  1 ? 15 
HELX_P HELX_P46 46 ALA L 109 ? GLN L 114 ? ALA L 109 GLN L 114 1 ? 6  
HELX_P HELX_P47 47 LEU L 122 ? GLN L 131 ? LEU L 122 GLN L 131 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A  GLU 51 OE1 ? ? ? 1_555 M  MN  . MN ? ? A GLU 51  A MN  154 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc2  metalc ? ? A  GLU 51 OE2 ? ? ? 1_555 N  MN  . MN ? ? A GLU 51  A MN  155 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc3  metalc ? ? A  GLU 55 OE2 ? ? ? 1_555 M  MN  . MN ? ? A GLU 55  A MN  154 1_555 ? ? ? ? ? ? ? 2.624 ? ? 
metalc4  metalc ? ? M  MN  .  MN  ? ? ? 1_555 O  SO4 . O4 ? ? A MN  154 A SO4 156 1_555 ? ? ? ? ? ? ? 2.079 ? ? 
metalc5  metalc ? ? M  MN  .  MN  ? ? ? 1_555 P  SO4 . O1 ? ? A MN  154 A SO4 157 1_555 ? ? ? ? ? ? ? 2.127 ? ? 
metalc6  metalc ? ? M  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  154 A HOH 160 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc7  metalc ? ? M  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  154 A HOH 162 1_555 ? ? ? ? ? ? ? 2.431 ? ? 
metalc8  metalc ? ? M  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  154 A HOH 163 1_555 ? ? ? ? ? ? ? 2.382 ? ? 
metalc9  metalc ? ? N  MN  .  MN  ? ? ? 1_555 O  SO4 . O1 ? ? A MN  155 A SO4 156 1_555 ? ? ? ? ? ? ? 2.648 ? ? 
metalc10 metalc ? ? N  MN  .  MN  ? ? ? 1_555 O  SO4 . O4 ? ? A MN  155 A SO4 156 1_555 ? ? ? ? ? ? ? 2.754 ? ? 
metalc11 metalc ? ? N  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  155 A HOH 159 1_555 ? ? ? ? ? ? ? 2.066 ? ? 
metalc12 metalc ? ? N  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  155 A HOH 163 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc13 metalc ? ? N  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  155 A HOH 164 1_555 ? ? ? ? ? ? ? 1.932 ? ? 
metalc14 metalc ? ? N  MN  .  MN  ? ? ? 1_555 UB HOH . O  ? ? A MN  155 A HOH 166 1_555 ? ? ? ? ? ? ? 2.396 ? ? 
metalc15 metalc ? ? B  GLU 51 OE1 ? ? ? 1_555 R  MN  . MN ? ? B GLU 51  B MN  154 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc16 metalc ? ? B  GLU 51 OE2 ? ? ? 1_555 S  MN  . MN ? ? B GLU 51  B MN  155 1_555 ? ? ? ? ? ? ? 2.196 ? ? 
metalc17 metalc ? ? B  GLU 55 OE2 ? ? ? 1_555 R  MN  . MN ? ? B GLU 55  B MN  154 1_555 ? ? ? ? ? ? ? 2.312 ? ? 
metalc18 metalc ? ? R  MN  .  MN  ? ? ? 1_555 T  SO4 . O2 ? ? B MN  154 B SO4 156 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc19 metalc ? ? R  MN  .  MN  ? ? ? 1_555 U  SO4 . O4 ? ? B MN  154 B SO4 157 1_555 ? ? ? ? ? ? ? 2.224 ? ? 
metalc20 metalc ? ? S  MN  .  MN  ? ? ? 1_555 T  SO4 . O2 ? ? B MN  155 B SO4 156 1_555 ? ? ? ? ? ? ? 2.548 ? ? 
metalc21 metalc ? ? S  MN  .  MN  ? ? ? 1_555 VB HOH . O  ? ? B MN  155 B HOH 177 1_555 ? ? ? ? ? ? ? 2.003 ? ? 
metalc22 metalc ? ? C  GLU 51 OE1 ? ? ? 1_555 W  MN  . MN ? ? C GLU 51  C MN  154 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc23 metalc ? ? C  GLU 51 OE2 ? ? ? 1_555 X  MN  . MN ? ? C GLU 51  C MN  155 1_555 ? ? ? ? ? ? ? 2.394 ? ? 
metalc24 metalc ? ? C  GLU 55 OE2 ? ? ? 1_555 W  MN  . MN ? ? C GLU 55  C MN  154 1_555 ? ? ? ? ? ? ? 2.522 ? ? 
metalc25 metalc ? ? W  MN  .  MN  ? ? ? 1_555 Y  SO4 . O2 ? ? C MN  154 C SO4 156 1_555 ? ? ? ? ? ? ? 1.954 ? ? 
metalc26 metalc ? ? W  MN  .  MN  ? ? ? 1_555 Z  SO4 . O3 ? ? C MN  154 C SO4 157 1_555 ? ? ? ? ? ? ? 2.360 ? ? 
metalc27 metalc ? ? X  MN  .  MN  ? ? ? 1_555 Y  SO4 . O3 ? ? C MN  155 C SO4 156 1_555 ? ? ? ? ? ? ? 2.780 ? ? 
metalc28 metalc ? ? X  MN  .  MN  ? ? ? 1_555 WB HOH . O  ? ? C MN  155 C HOH 269 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc29 metalc ? ? D  GLU 51 OE2 ? ? ? 1_555 BA MN  . MN ? ? D GLU 51  D MN  154 1_555 ? ? ? ? ? ? ? 2.319 ? ? 
metalc30 metalc ? ? D  GLU 51 OE1 ? ? ? 1_555 CA MN  . MN ? ? D GLU 51  D MN  155 1_555 ? ? ? ? ? ? ? 2.199 ? ? 
metalc31 metalc ? ? D  GLU 55 OE2 ? ? ? 1_555 CA MN  . MN ? ? D GLU 55  D MN  155 1_555 ? ? ? ? ? ? ? 2.470 ? ? 
metalc32 metalc ? ? BA MN  .  MN  ? ? ? 1_555 DA SO4 . O4 ? ? D MN  154 D SO4 156 1_555 ? ? ? ? ? ? ? 2.450 ? ? 
metalc33 metalc ? ? CA MN  .  MN  ? ? ? 1_555 DA SO4 . O2 ? ? D MN  155 D SO4 156 1_555 ? ? ? ? ? ? ? 1.885 ? ? 
metalc34 metalc ? ? CA MN  .  MN  ? ? ? 1_555 EA SO4 . O4 ? ? D MN  155 D SO4 157 1_555 ? ? ? ? ? ? ? 2.573 ? ? 
metalc35 metalc ? ? E  GLU 51 OE2 ? ? ? 1_555 GA MN  . MN ? ? E GLU 51  E MN  154 1_555 ? ? ? ? ? ? ? 1.982 ? ? 
metalc36 metalc ? ? E  GLU 51 OE1 ? ? ? 1_555 HA MN  . MN ? ? E GLU 51  E MN  155 1_555 ? ? ? ? ? ? ? 2.421 ? ? 
metalc37 metalc ? ? GA MN  .  MN  ? ? ? 1_555 YB HOH . O  ? ? E MN  154 E HOH 172 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc38 metalc ? ? HA MN  .  MN  ? ? ? 1_555 IA SO4 . O3 ? ? E MN  155 E SO4 156 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc39 metalc ? ? HA MN  .  MN  ? ? ? 1_555 JA SO4 . O2 ? ? E MN  155 E SO4 157 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc40 metalc ? ? F  GLU 51 OE1 ? ? ? 1_555 LA MN  . MN ? ? F GLU 51  F MN  154 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc41 metalc ? ? F  GLU 51 OE2 ? ? ? 1_555 MA MN  . MN ? ? F GLU 51  F MN  155 1_555 ? ? ? ? ? ? ? 2.232 ? ? 
metalc42 metalc ? ? F  GLU 55 OE2 ? ? ? 1_555 LA MN  . MN ? ? F GLU 55  F MN  154 1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc43 metalc ? ? LA MN  .  MN  ? ? ? 1_555 NA SO4 . O1 ? ? F MN  154 F SO4 156 1_555 ? ? ? ? ? ? ? 2.308 ? ? 
metalc44 metalc ? ? LA MN  .  MN  ? ? ? 1_555 OA SO4 . O3 ? ? F MN  154 F SO4 157 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc45 metalc ? ? MA MN  .  MN  ? ? ? 1_555 NA SO4 . O3 ? ? F MN  155 F SO4 156 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc46 metalc ? ? G  GLU 51 OE1 ? ? ? 1_555 QA MN  . MN ? ? G GLU 51  G MN  154 1_555 ? ? ? ? ? ? ? 2.347 ? ? 
metalc47 metalc ? ? G  GLU 51 OE2 ? ? ? 1_555 RA MN  . MN ? ? G GLU 51  G MN  155 1_555 ? ? ? ? ? ? ? 2.235 ? ? 
metalc48 metalc ? ? G  GLU 55 OE2 ? ? ? 1_555 QA MN  . MN ? ? G GLU 55  G MN  154 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc49 metalc ? ? QA MN  .  MN  ? ? ? 1_555 SA SO4 . O4 ? ? G MN  154 G SO4 156 1_555 ? ? ? ? ? ? ? 1.976 ? ? 
metalc50 metalc ? ? QA MN  .  MN  ? ? ? 1_555 UA SO4 . O2 ? ? G MN  154 G SO4 158 1_555 ? ? ? ? ? ? ? 2.458 ? ? 
metalc51 metalc ? ? RA MN  .  MN  ? ? ? 1_555 SA SO4 . O1 ? ? G MN  155 G SO4 156 1_555 ? ? ? ? ? ? ? 2.646 ? ? 
metalc52 metalc ? ? H  GLU 51 OE1 ? ? ? 1_555 VA MN  . MN ? ? H GLU 51  H MN  154 1_555 ? ? ? ? ? ? ? 2.094 ? ? 
metalc53 metalc ? ? H  GLU 51 OE2 ? ? ? 1_555 WA MN  . MN ? ? H GLU 51  H MN  155 1_555 ? ? ? ? ? ? ? 2.175 ? ? 
metalc54 metalc ? ? H  GLU 55 OE2 ? ? ? 1_555 VA MN  . MN ? ? H GLU 55  H MN  154 1_555 ? ? ? ? ? ? ? 2.623 ? ? 
metalc55 metalc ? ? VA MN  .  MN  ? ? ? 1_555 XA SO4 . O1 ? ? H MN  154 H SO4 156 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc56 metalc ? ? VA MN  .  MN  ? ? ? 1_555 YA SO4 . O4 ? ? H MN  154 H SO4 157 1_555 ? ? ? ? ? ? ? 2.498 ? ? 
metalc57 metalc ? ? WA MN  .  MN  ? ? ? 1_555 XA SO4 . O4 ? ? H MN  155 H SO4 156 1_555 ? ? ? ? ? ? ? 1.925 ? ? 
metalc58 metalc ? ? I  GLU 51 OE1 ? ? ? 1_555 AB MN  . MN ? ? I GLU 51  I MN  154 1_555 ? ? ? ? ? ? ? 2.700 ? ? 
metalc59 metalc ? ? I  GLU 51 OE2 ? ? ? 1_555 BB MN  . MN ? ? I GLU 51  I MN  155 1_555 ? ? ? ? ? ? ? 2.666 ? ? 
metalc60 metalc ? ? AB MN  .  MN  ? ? ? 1_555 CB SO4 . O2 ? ? I MN  154 I SO4 156 1_555 ? ? ? ? ? ? ? 2.449 ? ? 
metalc61 metalc ? ? BB MN  .  MN  ? ? ? 1_555 CB SO4 . O3 ? ? I MN  155 I SO4 156 1_555 ? ? ? ? ? ? ? 2.416 ? ? 
metalc62 metalc ? ? J  GLU 51 OE1 ? ? ? 1_555 FB MN  . MN ? ? J GLU 51  J MN  154 1_555 ? ? ? ? ? ? ? 2.552 ? ? 
metalc63 metalc ? ? J  GLU 51 OE2 ? ? ? 1_555 GB MN  . MN ? ? J GLU 51  J MN  155 1_555 ? ? ? ? ? ? ? 2.485 ? ? 
metalc64 metalc ? ? J  GLU 55 OE2 ? ? ? 1_555 FB MN  . MN ? ? J GLU 55  J MN  154 1_555 ? ? ? ? ? ? ? 2.457 ? ? 
metalc65 metalc ? ? FB MN  .  MN  ? ? ? 1_555 HB SO4 . O4 ? ? J MN  154 J SO4 156 1_555 ? ? ? ? ? ? ? 2.673 ? ? 
metalc66 metalc ? ? FB MN  .  MN  ? ? ? 1_555 IB SO4 . O2 ? ? J MN  154 J SO4 157 1_555 ? ? ? ? ? ? ? 2.186 ? ? 
metalc67 metalc ? ? GB MN  .  MN  ? ? ? 1_555 HB SO4 . O4 ? ? J MN  155 J SO4 156 1_555 ? ? ? ? ? ? ? 2.013 ? ? 
metalc68 metalc ? ? GB MN  .  MN  ? ? ? 1_555 DC HOH . O  ? ? J MN  155 J HOH 267 1_555 ? ? ? ? ? ? ? 1.962 ? ? 
metalc69 metalc ? ? K  GLU 51 OE1 ? ? ? 1_555 KB MN  . MN ? ? K GLU 51  K MN  154 1_555 ? ? ? ? ? ? ? 2.051 ? ? 
metalc70 metalc ? ? K  GLU 51 OE2 ? ? ? 1_555 LB MN  . MN ? ? K GLU 51  K MN  155 1_555 ? ? ? ? ? ? ? 2.129 ? ? 
metalc71 metalc ? ? K  GLU 55 OE2 ? ? ? 1_555 KB MN  . MN ? ? K GLU 55  K MN  154 1_555 ? ? ? ? ? ? ? 2.132 ? ? 
metalc72 metalc ? ? KB MN  .  MN  ? ? ? 1_555 NB SO4 . O2 ? ? K MN  154 K SO4 157 1_555 ? ? ? ? ? ? ? 2.301 ? ? 
metalc73 metalc ? ? KB MN  .  MN  ? ? ? 1_555 EC HOH . O  ? ? K MN  154 K HOH 178 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
metalc74 metalc ? ? KB MN  .  MN  ? ? ? 1_555 EC HOH . O  ? ? K MN  154 K HOH 204 1_555 ? ? ? ? ? ? ? 2.608 ? ? 
metalc75 metalc ? ? LB MN  .  MN  ? ? ? 1_555 MB SO4 . O2 ? ? K MN  155 K SO4 156 1_555 ? ? ? ? ? ? ? 2.003 ? ? 
metalc76 metalc ? ? L  GLU 51 OE2 ? ? ? 1_555 PB MN  . MN ? ? L GLU 51  L MN  154 1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc77 metalc ? ? L  GLU 51 OE1 ? ? ? 1_555 QB MN  . MN ? ? L GLU 51  L MN  155 1_555 ? ? ? ? ? ? ? 2.490 ? ? 
metalc78 metalc ? ? L  GLU 55 OE2 ? ? ? 1_555 QB MN  . MN ? ? L GLU 55  L MN  155 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc79 metalc ? ? PB MN  .  MN  ? ? ? 1_555 RB SO4 . O2 ? ? L MN  154 L SO4 156 1_555 ? ? ? ? ? ? ? 2.653 ? ? 
metalc80 metalc ? ? PB MN  .  MN  ? ? ? 1_555 RB SO4 . O3 ? ? L MN  154 L SO4 156 1_555 ? ? ? ? ? ? ? 2.707 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 95.1  ? 
2   OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O4  ? O  SO4 .  ? A SO4 156 ? 1_555 72.8  ? 
3   OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O4  ? O  SO4 .  ? A SO4 156 ? 1_555 107.5 ? 
4   OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O1  ? P  SO4 .  ? A SO4 157 ? 1_555 87.6  ? 
5   OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O1  ? P  SO4 .  ? A SO4 157 ? 1_555 51.3  ? 
6   O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O1  ? P  SO4 .  ? A SO4 157 ? 1_555 56.9  ? 
7   OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 160 ? 1_555 94.2  ? 
8   OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 160 ? 1_555 116.2 ? 
9   O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 160 ? 1_555 135.4 ? 
10  O1  ? P  SO4 .  ? A SO4 157 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 160 ? 1_555 167.5 ? 
11  OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 162 ? 1_555 169.1 ? 
12  OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 162 ? 1_555 75.8  ? 
13  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 162 ? 1_555 115.3 ? 
14  O1  ? P  SO4 .  ? A SO4 157 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 162 ? 1_555 91.1  ? 
15  O   ? UB HOH .  ? A HOH 160 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 162 ? 1_555 84.8  ? 
16  OE1 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 98.1  ? 
17  OE2 ? A  GLU 55 ? A GLU 55  ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 165.0 ? 
18  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 70.0  ? 
19  O1  ? P  SO4 .  ? A SO4 157 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 122.1 ? 
20  O   ? UB HOH .  ? A HOH 160 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 69.9  ? 
21  O   ? UB HOH .  ? A HOH 162 ? 1_555 MN ? M  MN . ? A MN 154 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 91.8  ? 
22  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O1  ? O  SO4 .  ? A SO4 156 ? 1_555 106.5 ? 
23  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O4  ? O  SO4 .  ? A SO4 156 ? 1_555 82.2  ? 
24  O1  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O4  ? O  SO4 .  ? A SO4 156 ? 1_555 48.8  ? 
25  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 159 ? 1_555 72.8  ? 
26  O1  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 159 ? 1_555 176.2 ? 
27  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 159 ? 1_555 127.5 ? 
28  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 106.9 ? 
29  O1  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 95.3  ? 
30  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 62.6  ? 
31  O   ? UB HOH .  ? A HOH 159 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 163 ? 1_555 81.5  ? 
32  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 164 ? 1_555 89.1  ? 
33  O1  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 164 ? 1_555 73.3  ? 
34  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 164 ? 1_555 114.7 ? 
35  O   ? UB HOH .  ? A HOH 159 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 164 ? 1_555 110.3 ? 
36  O   ? UB HOH .  ? A HOH 163 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 164 ? 1_555 162.6 ? 
37  OE2 ? A  GLU 51 ? A GLU 51  ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 164.1 ? 
38  O1  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 71.3  ? 
39  O4  ? O  SO4 .  ? A SO4 156 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 106.0 ? 
40  O   ? UB HOH .  ? A HOH 159 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 110.5 ? 
41  O   ? UB HOH .  ? A HOH 163 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 89.0  ? 
42  O   ? UB HOH .  ? A HOH 164 ? 1_555 MN ? N  MN . ? A MN 155 ? 1_555 O   ? UB HOH .  ? A HOH 166 ? 1_555 75.1  ? 
43  OE1 ? B  GLU 51 ? B GLU 51  ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 OE2 ? B  GLU 55 ? B GLU 55  ? 1_555 81.4  ? 
44  OE1 ? B  GLU 51 ? B GLU 51  ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 O2  ? T  SO4 .  ? B SO4 156 ? 1_555 84.0  ? 
45  OE2 ? B  GLU 55 ? B GLU 55  ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 O2  ? T  SO4 .  ? B SO4 156 ? 1_555 114.8 ? 
46  OE1 ? B  GLU 51 ? B GLU 51  ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 O4  ? U  SO4 .  ? B SO4 157 ? 1_555 79.9  ? 
47  OE2 ? B  GLU 55 ? B GLU 55  ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 O4  ? U  SO4 .  ? B SO4 157 ? 1_555 56.8  ? 
48  O2  ? T  SO4 .  ? B SO4 156 ? 1_555 MN ? R  MN . ? B MN 154 ? 1_555 O4  ? U  SO4 .  ? B SO4 157 ? 1_555 58.1  ? 
49  OE2 ? B  GLU 51 ? B GLU 51  ? 1_555 MN ? S  MN . ? B MN 155 ? 1_555 O2  ? T  SO4 .  ? B SO4 156 ? 1_555 71.5  ? 
50  OE2 ? B  GLU 51 ? B GLU 51  ? 1_555 MN ? S  MN . ? B MN 155 ? 1_555 O   ? VB HOH .  ? B HOH 177 ? 1_555 69.5  ? 
51  O2  ? T  SO4 .  ? B SO4 156 ? 1_555 MN ? S  MN . ? B MN 155 ? 1_555 O   ? VB HOH .  ? B HOH 177 ? 1_555 104.4 ? 
52  OE1 ? C  GLU 51 ? C GLU 51  ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 OE2 ? C  GLU 55 ? C GLU 55  ? 1_555 91.8  ? 
53  OE1 ? C  GLU 51 ? C GLU 51  ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 O2  ? Y  SO4 .  ? C SO4 156 ? 1_555 90.7  ? 
54  OE2 ? C  GLU 55 ? C GLU 55  ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 O2  ? Y  SO4 .  ? C SO4 156 ? 1_555 117.3 ? 
55  OE1 ? C  GLU 51 ? C GLU 51  ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 O3  ? Z  SO4 .  ? C SO4 157 ? 1_555 79.6  ? 
56  OE2 ? C  GLU 55 ? C GLU 55  ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 O3  ? Z  SO4 .  ? C SO4 157 ? 1_555 54.8  ? 
57  O2  ? Y  SO4 .  ? C SO4 156 ? 1_555 MN ? W  MN . ? C MN 154 ? 1_555 O3  ? Z  SO4 .  ? C SO4 157 ? 1_555 64.2  ? 
58  OE2 ? C  GLU 51 ? C GLU 51  ? 1_555 MN ? X  MN . ? C MN 155 ? 1_555 O3  ? Y  SO4 .  ? C SO4 156 ? 1_555 82.7  ? 
59  OE2 ? C  GLU 51 ? C GLU 51  ? 1_555 MN ? X  MN . ? C MN 155 ? 1_555 O   ? WB HOH .  ? C HOH 269 ? 1_555 71.4  ? 
60  O3  ? Y  SO4 .  ? C SO4 156 ? 1_555 MN ? X  MN . ? C MN 155 ? 1_555 O   ? WB HOH .  ? C HOH 269 ? 1_555 77.6  ? 
61  OE2 ? D  GLU 51 ? D GLU 51  ? 1_555 MN ? BA MN . ? D MN 154 ? 1_555 O4  ? DA SO4 .  ? D SO4 156 ? 1_555 76.5  ? 
62  OE1 ? D  GLU 51 ? D GLU 51  ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 OE2 ? D  GLU 55 ? D GLU 55  ? 1_555 71.8  ? 
63  OE1 ? D  GLU 51 ? D GLU 51  ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 O2  ? DA SO4 .  ? D SO4 156 ? 1_555 111.3 ? 
64  OE2 ? D  GLU 55 ? D GLU 55  ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 O2  ? DA SO4 .  ? D SO4 156 ? 1_555 106.7 ? 
65  OE1 ? D  GLU 51 ? D GLU 51  ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 O4  ? EA SO4 .  ? D SO4 157 ? 1_555 84.5  ? 
66  OE2 ? D  GLU 55 ? D GLU 55  ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 O4  ? EA SO4 .  ? D SO4 157 ? 1_555 52.9  ? 
67  O2  ? DA SO4 .  ? D SO4 156 ? 1_555 MN ? CA MN . ? D MN 155 ? 1_555 O4  ? EA SO4 .  ? D SO4 157 ? 1_555 54.7  ? 
68  OE2 ? E  GLU 51 ? E GLU 51  ? 1_555 MN ? GA MN . ? E MN 154 ? 1_555 O   ? YB HOH .  ? E HOH 172 ? 1_555 159.5 ? 
69  OE1 ? E  GLU 51 ? E GLU 51  ? 1_555 MN ? HA MN . ? E MN 155 ? 1_555 O3  ? IA SO4 .  ? E SO4 156 ? 1_555 87.3  ? 
70  OE1 ? E  GLU 51 ? E GLU 51  ? 1_555 MN ? HA MN . ? E MN 155 ? 1_555 O2  ? JA SO4 .  ? E SO4 157 ? 1_555 75.7  ? 
71  O3  ? IA SO4 .  ? E SO4 156 ? 1_555 MN ? HA MN . ? E MN 155 ? 1_555 O2  ? JA SO4 .  ? E SO4 157 ? 1_555 50.2  ? 
72  OE1 ? F  GLU 51 ? F GLU 51  ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 OE2 ? F  GLU 55 ? F GLU 55  ? 1_555 95.8  ? 
73  OE1 ? F  GLU 51 ? F GLU 51  ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 O1  ? NA SO4 .  ? F SO4 156 ? 1_555 90.8  ? 
74  OE2 ? F  GLU 55 ? F GLU 55  ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 O1  ? NA SO4 .  ? F SO4 156 ? 1_555 109.5 ? 
75  OE1 ? F  GLU 51 ? F GLU 51  ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 O3  ? OA SO4 .  ? F SO4 157 ? 1_555 83.2  ? 
76  OE2 ? F  GLU 55 ? F GLU 55  ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 O3  ? OA SO4 .  ? F SO4 157 ? 1_555 55.3  ? 
77  O1  ? NA SO4 .  ? F SO4 156 ? 1_555 MN ? LA MN . ? F MN 154 ? 1_555 O3  ? OA SO4 .  ? F SO4 157 ? 1_555 56.1  ? 
78  OE2 ? F  GLU 51 ? F GLU 51  ? 1_555 MN ? MA MN . ? F MN 155 ? 1_555 O3  ? NA SO4 .  ? F SO4 156 ? 1_555 115.9 ? 
79  OE1 ? G  GLU 51 ? G GLU 51  ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 OE2 ? G  GLU 55 ? G GLU 55  ? 1_555 71.8  ? 
80  OE1 ? G  GLU 51 ? G GLU 51  ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 O4  ? SA SO4 .  ? G SO4 156 ? 1_555 123.3 ? 
81  OE2 ? G  GLU 55 ? G GLU 55  ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 O4  ? SA SO4 .  ? G SO4 156 ? 1_555 121.4 ? 
82  OE1 ? G  GLU 51 ? G GLU 51  ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 O2  ? UA SO4 .  ? G SO4 158 ? 1_555 77.6  ? 
83  OE2 ? G  GLU 55 ? G GLU 55  ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 O2  ? UA SO4 .  ? G SO4 158 ? 1_555 54.0  ? 
84  O4  ? SA SO4 .  ? G SO4 156 ? 1_555 MN ? QA MN . ? G MN 154 ? 1_555 O2  ? UA SO4 .  ? G SO4 158 ? 1_555 73.3  ? 
85  OE2 ? G  GLU 51 ? G GLU 51  ? 1_555 MN ? RA MN . ? G MN 155 ? 1_555 O1  ? SA SO4 .  ? G SO4 156 ? 1_555 80.0  ? 
86  OE1 ? H  GLU 51 ? H GLU 51  ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 OE2 ? H  GLU 55 ? H GLU 55  ? 1_555 87.7  ? 
87  OE1 ? H  GLU 51 ? H GLU 51  ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 O1  ? XA SO4 .  ? H SO4 156 ? 1_555 92.3  ? 
88  OE2 ? H  GLU 55 ? H GLU 55  ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 O1  ? XA SO4 .  ? H SO4 156 ? 1_555 91.3  ? 
89  OE1 ? H  GLU 51 ? H GLU 51  ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 O4  ? YA SO4 .  ? H SO4 157 ? 1_555 71.0  ? 
90  OE2 ? H  GLU 55 ? H GLU 55  ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 O4  ? YA SO4 .  ? H SO4 157 ? 1_555 44.1  ? 
91  O1  ? XA SO4 .  ? H SO4 156 ? 1_555 MN ? VA MN . ? H MN 154 ? 1_555 O4  ? YA SO4 .  ? H SO4 157 ? 1_555 53.1  ? 
92  OE2 ? H  GLU 51 ? H GLU 51  ? 1_555 MN ? WA MN . ? H MN 155 ? 1_555 O4  ? XA SO4 .  ? H SO4 156 ? 1_555 112.6 ? 
93  OE1 ? I  GLU 51 ? I GLU 51  ? 1_555 MN ? AB MN . ? I MN 154 ? 1_555 O2  ? CB SO4 .  ? I SO4 156 ? 1_555 94.8  ? 
94  OE2 ? I  GLU 51 ? I GLU 51  ? 1_555 MN ? BB MN . ? I MN 155 ? 1_555 O3  ? CB SO4 .  ? I SO4 156 ? 1_555 62.6  ? 
95  OE1 ? J  GLU 51 ? J GLU 51  ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 OE2 ? J  GLU 55 ? J GLU 55  ? 1_555 87.0  ? 
96  OE1 ? J  GLU 51 ? J GLU 51  ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 O4  ? HB SO4 .  ? J SO4 156 ? 1_555 80.8  ? 
97  OE2 ? J  GLU 55 ? J GLU 55  ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 O4  ? HB SO4 .  ? J SO4 156 ? 1_555 124.3 ? 
98  OE1 ? J  GLU 51 ? J GLU 51  ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 O2  ? IB SO4 .  ? J SO4 157 ? 1_555 75.5  ? 
99  OE2 ? J  GLU 55 ? J GLU 55  ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 O2  ? IB SO4 .  ? J SO4 157 ? 1_555 67.6  ? 
100 O4  ? HB SO4 .  ? J SO4 156 ? 1_555 MN ? FB MN . ? J MN 154 ? 1_555 O2  ? IB SO4 .  ? J SO4 157 ? 1_555 56.7  ? 
101 OE2 ? J  GLU 51 ? J GLU 51  ? 1_555 MN ? GB MN . ? J MN 155 ? 1_555 O4  ? HB SO4 .  ? J SO4 156 ? 1_555 99.3  ? 
102 OE2 ? J  GLU 51 ? J GLU 51  ? 1_555 MN ? GB MN . ? J MN 155 ? 1_555 O   ? DC HOH .  ? J HOH 267 ? 1_555 79.3  ? 
103 O4  ? HB SO4 .  ? J SO4 156 ? 1_555 MN ? GB MN . ? J MN 155 ? 1_555 O   ? DC HOH .  ? J HOH 267 ? 1_555 154.9 ? 
104 OE1 ? K  GLU 51 ? K GLU 51  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 OE2 ? K  GLU 55 ? K GLU 55  ? 1_555 87.7  ? 
105 OE1 ? K  GLU 51 ? K GLU 51  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O2  ? NB SO4 .  ? K SO4 157 ? 1_555 78.1  ? 
106 OE2 ? K  GLU 55 ? K GLU 55  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O2  ? NB SO4 .  ? K SO4 157 ? 1_555 56.9  ? 
107 OE1 ? K  GLU 51 ? K GLU 51  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 178 ? 1_555 151.0 ? 
108 OE2 ? K  GLU 55 ? K GLU 55  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 178 ? 1_555 64.2  ? 
109 O2  ? NB SO4 .  ? K SO4 157 ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 178 ? 1_555 80.5  ? 
110 OE1 ? K  GLU 51 ? K GLU 51  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 204 ? 1_555 103.8 ? 
111 OE2 ? K  GLU 55 ? K GLU 55  ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 204 ? 1_555 94.3  ? 
112 O2  ? NB SO4 .  ? K SO4 157 ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 204 ? 1_555 151.2 ? 
113 O   ? EC HOH .  ? K HOH 178 ? 1_555 MN ? KB MN . ? K MN 154 ? 1_555 O   ? EC HOH .  ? K HOH 204 ? 1_555 86.0  ? 
114 OE2 ? K  GLU 51 ? K GLU 51  ? 1_555 MN ? LB MN . ? K MN 155 ? 1_555 O2  ? MB SO4 .  ? K SO4 156 ? 1_555 124.4 ? 
115 OE2 ? L  GLU 51 ? L GLU 51  ? 1_555 MN ? PB MN . ? L MN 154 ? 1_555 O2  ? RB SO4 .  ? L SO4 156 ? 1_555 89.2  ? 
116 OE2 ? L  GLU 51 ? L GLU 51  ? 1_555 MN ? PB MN . ? L MN 154 ? 1_555 O3  ? RB SO4 .  ? L SO4 156 ? 1_555 105.8 ? 
117 O2  ? RB SO4 .  ? L SO4 156 ? 1_555 MN ? PB MN . ? L MN 154 ? 1_555 O3  ? RB SO4 .  ? L SO4 156 ? 1_555 51.7  ? 
118 OE1 ? L  GLU 51 ? L GLU 51  ? 1_555 MN ? QB MN . ? L MN 155 ? 1_555 OE2 ? L  GLU 55 ? L GLU 55  ? 1_555 73.3  ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
D ? 4 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
I ? 3 ? 
J ? 6 ? 
K ? 4 ? 
L ? 5 ? 
M ? 4 ? 
N ? 5 ? 
O ? 4 ? 
P ? 5 ? 
Q ? 4 ? 
R ? 4 ? 
S ? 4 ? 
T ? 5 ? 
U ? 4 ? 
V ? 5 ? 
W ? 4 ? 
X ? 5 ? 
Y ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? parallel      
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? parallel      
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? parallel      
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? parallel      
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? parallel      
N 4 5 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? parallel      
P 4 5 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? parallel      
R 3 4 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
T 3 4 ? parallel      
T 4 5 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
V 3 4 ? parallel      
V 4 5 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
W 3 4 ? anti-parallel 
X 1 2 ? anti-parallel 
X 2 3 ? anti-parallel 
X 3 4 ? parallel      
X 4 5 ? anti-parallel 
Y 1 2 ? anti-parallel 
Y 2 3 ? anti-parallel 
Y 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 28  ? ASN A 32  ? LYS A 28  ASN A 32  
A 2 LYS A 17  ? ILE A 25  ? LYS A 17  ILE A 25  
A 3 HIS A 5   ? ALA A 14  ? HIS A 5   ALA A 14  
A 4 PHE A 79  ? GLU A 87  ? PHE A 79  GLU A 87  
A 5 HIS A 64  ? TRP A 71  ? HIS A 64  TRP A 71  
B 1 ALA A 35  ? HIS A 37  ? ALA A 35  HIS A 37  
B 2 HIS A 5   ? ALA A 14  ? HIS A 5   ALA A 14  
B 3 LYS A 17  ? ILE A 25  ? LYS A 17  ILE A 25  
B 4 CYS A 103 ? VAL A 107 ? CYS A 103 VAL A 107 
C 1 ALA B 29  ? ASN B 32  ? ALA B 29  ASN B 32  
C 2 LYS B 17  ? THR B 24  ? LYS B 17  THR B 24  
C 3 HIS B 5   ? ALA B 14  ? HIS B 5   ALA B 14  
C 4 PHE B 79  ? GLU B 87  ? PHE B 79  GLU B 87  
C 5 HIS B 64  ? TRP B 71  ? HIS B 64  TRP B 71  
D 1 ALA B 35  ? HIS B 37  ? ALA B 35  HIS B 37  
D 2 HIS B 5   ? ALA B 14  ? HIS B 5   ALA B 14  
D 3 LYS B 17  ? THR B 24  ? LYS B 17  THR B 24  
D 4 CYS B 103 ? VAL B 107 ? CYS B 103 VAL B 107 
E 1 ALA C 29  ? ASN C 32  ? ALA C 29  ASN C 32  
E 2 LYS C 17  ? THR C 24  ? LYS C 17  THR C 24  
E 3 HIS C 5   ? ALA C 14  ? HIS C 5   ALA C 14  
E 4 PRO C 78  ? GLU C 87  ? PRO C 78  GLU C 87  
E 5 HIS C 64  ? ILE C 72  ? HIS C 64  ILE C 72  
F 1 ALA C 35  ? HIS C 37  ? ALA C 35  HIS C 37  
F 2 HIS C 5   ? ALA C 14  ? HIS C 5   ALA C 14  
F 3 LYS C 17  ? THR C 24  ? LYS C 17  THR C 24  
F 4 CYS C 103 ? SER C 108 ? CYS C 103 SER C 108 
G 1 LYS D 17  ? PHE D 18  ? LYS D 17  PHE D 18  
G 2 HIS D 5   ? ALA D 14  ? HIS D 5   ALA D 14  
G 3 ALA D 35  ? HIS D 37  ? ALA D 35  HIS D 37  
H 1 LYS D 17  ? PHE D 18  ? LYS D 17  PHE D 18  
H 2 HIS D 5   ? ALA D 14  ? HIS D 5   ALA D 14  
H 3 PHE D 79  ? GLU D 87  ? PHE D 79  GLU D 87  
H 4 HIS D 64  ? TRP D 71  ? HIS D 64  TRP D 71  
I 1 ALA D 29  ? ASN D 32  ? ALA D 29  ASN D 32  
I 2 VAL D 20  ? THR D 24  ? VAL D 20  THR D 24  
I 3 CYS D 104 ? ARG D 105 ? CYS D 104 ARG D 105 
J 1 ILE D 141 ? ASP D 143 ? ILE D 141 ASP D 143 
J 2 HIS E 64  ? ILE E 72  ? HIS E 64  ILE E 72  
J 3 PRO E 78  ? GLU E 87  ? PRO E 78  GLU E 87  
J 4 HIS E 5   ? ALA E 14  ? HIS E 5   ALA E 14  
J 5 LYS E 17  ? ILE E 25  ? LYS E 17  ILE E 25  
J 6 ALA E 35  ? HIS E 37  ? ALA E 35  HIS E 37  
K 1 LYS E 28  ? ASN E 32  ? LYS E 28  ASN E 32  
K 2 LYS E 17  ? ILE E 25  ? LYS E 17  ILE E 25  
K 3 HIS E 5   ? ALA E 14  ? HIS E 5   ALA E 14  
K 4 CYS E 103 ? VAL E 107 ? CYS E 103 VAL E 107 
L 1 ALA F 29  ? ASN F 32  ? ALA F 29  ASN F 32  
L 2 LYS F 17  ? THR F 24  ? LYS F 17  THR F 24  
L 3 HIS F 5   ? ALA F 14  ? HIS F 5   ALA F 14  
L 4 PHE F 79  ? GLU F 87  ? PHE F 79  GLU F 87  
L 5 HIS F 64  ? TRP F 71  ? HIS F 64  TRP F 71  
M 1 ALA F 35  ? HIS F 37  ? ALA F 35  HIS F 37  
M 2 HIS F 5   ? ALA F 14  ? HIS F 5   ALA F 14  
M 3 LYS F 17  ? THR F 24  ? LYS F 17  THR F 24  
M 4 CYS F 104 ? VAL F 107 ? CYS F 104 VAL F 107 
N 1 ALA G 29  ? ASN G 32  ? ALA G 29  ASN G 32  
N 2 LYS G 17  ? THR G 24  ? LYS G 17  THR G 24  
N 3 HIS G 5   ? ALA G 14  ? HIS G 5   ALA G 14  
N 4 PHE G 79  ? GLU G 87  ? PHE G 79  GLU G 87  
N 5 HIS G 64  ? TRP G 71  ? HIS G 64  TRP G 71  
O 1 ALA G 35  ? HIS G 37  ? ALA G 35  HIS G 37  
O 2 HIS G 5   ? ALA G 14  ? HIS G 5   ALA G 14  
O 3 LYS G 17  ? THR G 24  ? LYS G 17  THR G 24  
O 4 ILE G 101 ? SER G 108 ? ILE G 101 SER G 108 
P 1 ALA H 29  ? ASN H 32  ? ALA H 29  ASN H 32  
P 2 LYS H 17  ? THR H 24  ? LYS H 17  THR H 24  
P 3 HIS H 5   ? ALA H 14  ? HIS H 5   ALA H 14  
P 4 PHE H 79  ? GLU H 87  ? PHE H 79  GLU H 87  
P 5 HIS H 64  ? TRP H 71  ? HIS H 64  TRP H 71  
Q 1 GLY H 36  ? HIS H 37  ? GLY H 36  HIS H 37  
Q 2 HIS H 5   ? ALA H 14  ? HIS H 5   ALA H 14  
Q 3 LYS H 17  ? THR H 24  ? LYS H 17  THR H 24  
Q 4 ILE H 101 ? VAL H 107 ? ILE H 101 VAL H 107 
R 1 GLY I 36  ? HIS I 37  ? GLY I 36  HIS I 37  
R 2 HIS I 5   ? ALA I 14  ? HIS I 5   ALA I 14  
R 3 PHE I 79  ? GLU I 87  ? PHE I 79  GLU I 87  
R 4 HIS I 64  ? TRP I 71  ? HIS I 64  TRP I 71  
S 1 GLY I 36  ? HIS I 37  ? GLY I 36  HIS I 37  
S 2 HIS I 5   ? ALA I 14  ? HIS I 5   ALA I 14  
S 3 LYS I 17  ? GLU I 23  ? LYS I 17  GLU I 23  
S 4 ILE I 101 ? VAL I 107 ? ILE I 101 VAL I 107 
T 1 LYS J 28  ? ASN J 32  ? LYS J 28  ASN J 32  
T 2 LYS J 17  ? ILE J 25  ? LYS J 17  ILE J 25  
T 3 HIS J 5   ? ALA J 14  ? HIS J 5   ALA J 14  
T 4 PRO J 78  ? GLU J 87  ? PRO J 78  GLU J 87  
T 5 HIS J 64  ? ILE J 72  ? HIS J 64  ILE J 72  
U 1 ALA J 35  ? HIS J 37  ? ALA J 35  HIS J 37  
U 2 HIS J 5   ? ALA J 14  ? HIS J 5   ALA J 14  
U 3 LYS J 17  ? ILE J 25  ? LYS J 17  ILE J 25  
U 4 CYS J 104 ? VAL J 107 ? CYS J 104 VAL J 107 
V 1 ALA K 29  ? ASN K 32  ? ALA K 29  ASN K 32  
V 2 LYS K 17  ? THR K 24  ? LYS K 17  THR K 24  
V 3 HIS K 5   ? ALA K 14  ? HIS K 5   ALA K 14  
V 4 PHE K 79  ? GLU K 87  ? PHE K 79  GLU K 87  
V 5 HIS K 64  ? TRP K 71  ? HIS K 64  TRP K 71  
W 1 ALA K 35  ? HIS K 37  ? ALA K 35  HIS K 37  
W 2 HIS K 5   ? ALA K 14  ? HIS K 5   ALA K 14  
W 3 LYS K 17  ? THR K 24  ? LYS K 17  THR K 24  
W 4 ILE K 101 ? VAL K 107 ? ILE K 101 VAL K 107 
X 1 TRP L 31  ? ASN L 32  ? TRP L 31  ASN L 32  
X 2 LYS L 17  ? GLU L 22  ? LYS L 17  GLU L 22  
X 3 HIS L 5   ? ALA L 14  ? HIS L 5   ALA L 14  
X 4 PHE L 79  ? GLU L 87  ? PHE L 79  GLU L 87  
X 5 HIS L 64  ? TRP L 71  ? HIS L 64  TRP L 71  
Y 1 ALA L 35  ? HIS L 37  ? ALA L 35  HIS L 37  
Y 2 HIS L 5   ? ALA L 14  ? HIS L 5   ALA L 14  
Y 3 LYS L 17  ? GLU L 22  ? LYS L 17  GLU L 22  
Y 4 CYS L 104 ? VAL L 107 ? CYS L 104 VAL L 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 28  ? O LYS A 28  N ILE A 25  ? N ILE A 25  
A 2 3 O LYS A 17  ? O LYS A 17  N ALA A 14  ? N ALA A 14  
A 3 4 N VAL A 11  ? N VAL A 11  O PHE A 84  ? O PHE A 84  
A 4 5 O ARG A 81  ? O ARG A 81  N HIS A 69  ? N HIS A 69  
B 1 2 O GLY A 36  ? O GLY A 36  N VAL A 8   ? N VAL A 8   
B 2 3 N ALA A 14  ? N ALA A 14  O LYS A 17  ? O LYS A 17  
B 3 4 N PHE A 18  ? N PHE A 18  O VAL A 107 ? O VAL A 107 
C 1 2 O ASN B 32  ? O ASN B 32  N VAL B 21  ? N VAL B 21  
C 2 3 O LEU B 19  ? O LEU B 19  N VAL B 12  ? N VAL B 12  
C 3 4 N VAL B 11  ? N VAL B 11  O PHE B 84  ? O PHE B 84  
C 4 5 O LEU B 83  ? O LEU B 83  N ARG B 67  ? N ARG B 67  
D 1 2 O GLY B 36  ? O GLY B 36  N VAL B 8   ? N VAL B 8   
D 2 3 N VAL B 12  ? N VAL B 12  O LEU B 19  ? O LEU B 19  
D 3 4 N PHE B 18  ? N PHE B 18  O VAL B 107 ? O VAL B 107 
E 1 2 O LEU C 30  ? O LEU C 30  N GLU C 23  ? N GLU C 23  
E 2 3 O LEU C 19  ? O LEU C 19  N VAL C 12  ? N VAL C 12  
E 3 4 N VAL C 11  ? N VAL C 11  O PHE C 84  ? O PHE C 84  
E 4 5 O LEU C 83  ? O LEU C 83  N ILE C 66  ? N ILE C 66  
F 1 2 O GLY C 36  ? O GLY C 36  N VAL C 8   ? N VAL C 8   
F 2 3 N VAL C 12  ? N VAL C 12  O LEU C 19  ? O LEU C 19  
F 3 4 N PHE C 18  ? N PHE C 18  O VAL C 107 ? O VAL C 107 
G 1 2 O LYS D 17  ? O LYS D 17  N ALA D 14  ? N ALA D 14  
G 2 3 N VAL D 8   ? N VAL D 8   O GLY D 36  ? O GLY D 36  
H 1 2 O LYS D 17  ? O LYS D 17  N ALA D 14  ? N ALA D 14  
H 2 3 N VAL D 11  ? N VAL D 11  O PHE D 84  ? O PHE D 84  
H 3 4 O ARG D 81  ? O ARG D 81  N HIS D 69  ? N HIS D 69  
I 1 2 O ASN D 32  ? O ASN D 32  N VAL D 21  ? N VAL D 21  
I 2 3 N VAL D 20  ? N VAL D 20  O ARG D 105 ? O ARG D 105 
J 1 2 N GLY D 142 ? N GLY D 142 O GLN E 70  ? O GLN E 70  
J 2 3 N ILE E 66  ? N ILE E 66  O LEU E 83  ? O LEU E 83  
J 3 4 O PHE E 84  ? O PHE E 84  N VAL E 11  ? N VAL E 11  
J 4 5 N VAL E 12  ? N VAL E 12  O LEU E 19  ? O LEU E 19  
K 1 2 O LEU E 30  ? O LEU E 30  N GLU E 23  ? N GLU E 23  
K 2 3 O LEU E 19  ? O LEU E 19  N VAL E 12  ? N VAL E 12  
L 1 2 O LEU F 30  ? O LEU F 30  N GLU F 23  ? N GLU F 23  
L 2 3 O LYS F 17  ? O LYS F 17  N ALA F 14  ? N ALA F 14  
L 3 4 N THR F 7   ? N THR F 7   O PHE F 82  ? O PHE F 82  
L 4 5 O LEU F 83  ? O LEU F 83  N ILE F 66  ? N ILE F 66  
M 1 2 O GLY F 36  ? O GLY F 36  N VAL F 8   ? N VAL F 8   
M 2 3 N ALA F 14  ? N ALA F 14  O LYS F 17  ? O LYS F 17  
M 3 4 N PHE F 18  ? N PHE F 18  O VAL F 107 ? O VAL F 107 
N 1 2 O LEU G 30  ? O LEU G 30  N GLU G 23  ? N GLU G 23  
N 2 3 O LYS G 17  ? O LYS G 17  N ALA G 14  ? N ALA G 14  
N 3 4 N THR G 7   ? N THR G 7   O LEU G 80  ? O LEU G 80  
N 4 5 O LEU G 83  ? O LEU G 83  N ILE G 66  ? N ILE G 66  
O 1 2 O GLY G 36  ? O GLY G 36  N VAL G 8   ? N VAL G 8   
O 2 3 N ALA G 14  ? N ALA G 14  O LYS G 17  ? O LYS G 17  
O 3 4 N PHE G 18  ? N PHE G 18  O VAL G 107 ? O VAL G 107 
P 1 2 O LEU H 30  ? O LEU H 30  N GLU H 23  ? N GLU H 23  
P 2 3 O LYS H 17  ? O LYS H 17  N ALA H 14  ? N ALA H 14  
P 3 4 N VAL H 11  ? N VAL H 11  O PHE H 84  ? O PHE H 84  
P 4 5 O LEU H 83  ? O LEU H 83  N ARG H 67  ? N ARG H 67  
Q 1 2 O GLY H 36  ? O GLY H 36  N VAL H 8   ? N VAL H 8   
Q 2 3 N ALA H 14  ? N ALA H 14  O LYS H 17  ? O LYS H 17  
Q 3 4 N PHE H 18  ? N PHE H 18  O VAL H 107 ? O VAL H 107 
R 1 2 O GLY I 36  ? O GLY I 36  N VAL I 8   ? N VAL I 8   
R 2 3 N HIS I 13  ? N HIS I 13  O ILE I 86  ? O ILE I 86  
R 3 4 O LEU I 83  ? O LEU I 83  N ARG I 67  ? N ARG I 67  
S 1 2 O GLY I 36  ? O GLY I 36  N VAL I 8   ? N VAL I 8   
S 2 3 N VAL I 12  ? N VAL I 12  O LEU I 19  ? O LEU I 19  
S 3 4 N VAL I 20  ? N VAL I 20  O ARG I 105 ? O ARG I 105 
T 1 2 O LEU J 30  ? O LEU J 30  N GLU J 23  ? N GLU J 23  
T 2 3 O LYS J 17  ? O LYS J 17  N ALA J 14  ? N ALA J 14  
T 3 4 N THR J 7   ? N THR J 7   O PHE J 82  ? O PHE J 82  
T 4 5 O PHE J 79  ? O PHE J 79  N TRP J 71  ? N TRP J 71  
U 1 2 O GLY J 36  ? O GLY J 36  N VAL J 8   ? N VAL J 8   
U 2 3 N ALA J 14  ? N ALA J 14  O LYS J 17  ? O LYS J 17  
U 3 4 N PHE J 18  ? N PHE J 18  O VAL J 107 ? O VAL J 107 
V 1 2 O LEU K 30  ? O LEU K 30  N GLU K 23  ? N GLU K 23  
V 2 3 O LYS K 17  ? O LYS K 17  N ALA K 14  ? N ALA K 14  
V 3 4 N VAL K 11  ? N VAL K 11  O ILE K 86  ? O ILE K 86  
V 4 5 O PHE K 79  ? O PHE K 79  N TRP K 71  ? N TRP K 71  
W 1 2 O GLY K 36  ? O GLY K 36  N VAL K 8   ? N VAL K 8   
W 2 3 N ALA K 14  ? N ALA K 14  O LYS K 17  ? O LYS K 17  
W 3 4 N PHE K 18  ? N PHE K 18  O VAL K 107 ? O VAL K 107 
X 1 2 O ASN L 32  ? O ASN L 32  N VAL L 21  ? N VAL L 21  
X 2 3 O LYS L 17  ? O LYS L 17  N ALA L 14  ? N ALA L 14  
X 3 4 N ALA L 9   ? N ALA L 9   O PHE L 84  ? O PHE L 84  
X 4 5 O ARG L 81  ? O ARG L 81  N HIS L 69  ? N HIS L 69  
Y 1 2 O GLY L 36  ? O GLY L 36  N VAL L 8   ? N VAL L 8   
Y 2 3 N ALA L 14  ? N ALA L 14  O LYS L 17  ? O LYS L 17  
Y 3 4 N PHE L 18  ? N PHE L 18  O VAL L 107 ? O VAL L 107 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  154 ? 8  'BINDING SITE FOR RESIDUE MN A 154'  
AC2 Software A MN  155 ? 7  'BINDING SITE FOR RESIDUE MN A 155'  
AC3 Software A SO4 156 ? 11 'BINDING SITE FOR RESIDUE SO4 A 156' 
AC4 Software A SO4 157 ? 10 'BINDING SITE FOR RESIDUE SO4 A 157' 
AC5 Software A SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 A 158' 
AC6 Software B MN  154 ? 4  'BINDING SITE FOR RESIDUE MN B 154'  
AC7 Software B MN  155 ? 3  'BINDING SITE FOR RESIDUE MN B 155'  
AC8 Software B SO4 156 ? 8  'BINDING SITE FOR RESIDUE SO4 B 156' 
AC9 Software B SO4 157 ? 8  'BINDING SITE FOR RESIDUE SO4 B 157' 
BC1 Software B SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 B 158' 
BC2 Software C MN  154 ? 5  'BINDING SITE FOR RESIDUE MN C 154'  
BC3 Software C MN  155 ? 4  'BINDING SITE FOR RESIDUE MN C 155'  
BC4 Software C SO4 156 ? 8  'BINDING SITE FOR RESIDUE SO4 C 156' 
BC5 Software C SO4 157 ? 8  'BINDING SITE FOR RESIDUE SO4 C 157' 
BC6 Software C SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 C 158' 
BC7 Software D MN  154 ? 2  'BINDING SITE FOR RESIDUE MN D 154'  
BC8 Software D MN  155 ? 4  'BINDING SITE FOR RESIDUE MN D 155'  
BC9 Software D SO4 156 ? 8  'BINDING SITE FOR RESIDUE SO4 D 156' 
CC1 Software D SO4 157 ? 10 'BINDING SITE FOR RESIDUE SO4 D 157' 
CC2 Software D SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 D 158' 
CC3 Software E MN  154 ? 4  'BINDING SITE FOR RESIDUE MN E 154'  
CC4 Software E MN  155 ? 5  'BINDING SITE FOR RESIDUE MN E 155'  
CC5 Software E SO4 156 ? 9  'BINDING SITE FOR RESIDUE SO4 E 156' 
CC6 Software E SO4 157 ? 8  'BINDING SITE FOR RESIDUE SO4 E 157' 
CC7 Software E SO4 158 ? 7  'BINDING SITE FOR RESIDUE SO4 E 158' 
CC8 Software F MN  154 ? 5  'BINDING SITE FOR RESIDUE MN F 154'  
CC9 Software F MN  155 ? 3  'BINDING SITE FOR RESIDUE MN F 155'  
DC1 Software F SO4 156 ? 6  'BINDING SITE FOR RESIDUE SO4 F 156' 
DC2 Software F SO4 157 ? 10 'BINDING SITE FOR RESIDUE SO4 F 157' 
DC3 Software F SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 F 158' 
DC4 Software G MN  154 ? 6  'BINDING SITE FOR RESIDUE MN G 154'  
DC5 Software G MN  155 ? 3  'BINDING SITE FOR RESIDUE MN G 155'  
DC6 Software G SO4 156 ? 6  'BINDING SITE FOR RESIDUE SO4 G 156' 
DC7 Software G SO4 157 ? 6  'BINDING SITE FOR RESIDUE SO4 G 157' 
DC8 Software G SO4 158 ? 9  'BINDING SITE FOR RESIDUE SO4 G 158' 
DC9 Software H MN  154 ? 4  'BINDING SITE FOR RESIDUE MN H 154'  
EC1 Software H MN  155 ? 2  'BINDING SITE FOR RESIDUE MN H 155'  
EC2 Software H SO4 156 ? 9  'BINDING SITE FOR RESIDUE SO4 H 156' 
EC3 Software H SO4 157 ? 9  'BINDING SITE FOR RESIDUE SO4 H 157' 
EC4 Software H SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 H 158' 
EC5 Software I MN  154 ? 5  'BINDING SITE FOR RESIDUE MN I 154'  
EC6 Software I MN  155 ? 5  'BINDING SITE FOR RESIDUE MN I 155'  
EC7 Software I SO4 156 ? 5  'BINDING SITE FOR RESIDUE SO4 I 156' 
EC8 Software I SO4 157 ? 6  'BINDING SITE FOR RESIDUE SO4 I 157' 
EC9 Software I SO4 158 ? 5  'BINDING SITE FOR RESIDUE SO4 I 158' 
FC1 Software J MN  154 ? 5  'BINDING SITE FOR RESIDUE MN J 154'  
FC2 Software J MN  155 ? 4  'BINDING SITE FOR RESIDUE MN J 155'  
FC3 Software J SO4 156 ? 7  'BINDING SITE FOR RESIDUE SO4 J 156' 
FC4 Software J SO4 157 ? 9  'BINDING SITE FOR RESIDUE SO4 J 157' 
FC5 Software J SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 J 158' 
FC6 Software K MN  154 ? 7  'BINDING SITE FOR RESIDUE MN K 154'  
FC7 Software K MN  155 ? 3  'BINDING SITE FOR RESIDUE MN K 155'  
FC8 Software K SO4 156 ? 7  'BINDING SITE FOR RESIDUE SO4 K 156' 
FC9 Software K SO4 157 ? 10 'BINDING SITE FOR RESIDUE SO4 K 157' 
GC1 Software K SO4 158 ? 6  'BINDING SITE FOR RESIDUE SO4 K 158' 
GC2 Software L MN  154 ? 3  'BINDING SITE FOR RESIDUE MN L 154'  
GC3 Software L MN  155 ? 6  'BINDING SITE FOR RESIDUE MN L 155'  
GC4 Software L SO4 156 ? 7  'BINDING SITE FOR RESIDUE SO4 L 156' 
GC5 Software L SO4 157 ? 9  'BINDING SITE FOR RESIDUE SO4 L 157' 
GC6 Software L SO4 158 ? 4  'BINDING SITE FOR RESIDUE SO4 L 158' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  GLU A  51  ? GLU A 51  . ? 1_555 ? 
2   AC1 8  GLU A  55  ? GLU A 55  . ? 1_555 ? 
3   AC1 8  MN  N  .   ? MN  A 155 . ? 1_555 ? 
4   AC1 8  SO4 O  .   ? SO4 A 156 . ? 1_555 ? 
5   AC1 8  SO4 P  .   ? SO4 A 157 . ? 1_555 ? 
6   AC1 8  HOH UB .   ? HOH A 160 . ? 1_555 ? 
7   AC1 8  HOH UB .   ? HOH A 162 . ? 1_555 ? 
8   AC1 8  HOH UB .   ? HOH A 163 . ? 1_555 ? 
9   AC2 7  GLU A  51  ? GLU A 51  . ? 1_555 ? 
10  AC2 7  MN  M  .   ? MN  A 154 . ? 1_555 ? 
11  AC2 7  SO4 O  .   ? SO4 A 156 . ? 1_555 ? 
12  AC2 7  HOH UB .   ? HOH A 159 . ? 1_555 ? 
13  AC2 7  HOH UB .   ? HOH A 163 . ? 1_555 ? 
14  AC2 7  HOH UB .   ? HOH A 164 . ? 1_555 ? 
15  AC2 7  HOH UB .   ? HOH A 166 . ? 1_555 ? 
16  AC3 11 ALA A  35  ? ALA A 35  . ? 1_555 ? 
17  AC3 11 GLY A  36  ? GLY A 36  . ? 1_555 ? 
18  AC3 11 HIS A  37  ? HIS A 37  . ? 1_555 ? 
19  AC3 11 GLU A  51  ? GLU A 51  . ? 1_555 ? 
20  AC3 11 MN  M  .   ? MN  A 154 . ? 1_555 ? 
21  AC3 11 MN  N  .   ? MN  A 155 . ? 1_555 ? 
22  AC3 11 SO4 P  .   ? SO4 A 157 . ? 1_555 ? 
23  AC3 11 HOH UB .   ? HOH A 163 . ? 1_555 ? 
24  AC3 11 HOH UB .   ? HOH A 164 . ? 1_555 ? 
25  AC3 11 HOH UB .   ? HOH A 165 . ? 1_555 ? 
26  AC3 11 HOH UB .   ? HOH A 166 . ? 1_555 ? 
27  AC4 10 GLU A  23  ? GLU A 23  . ? 1_555 ? 
28  AC4 10 ASN A  32  ? ASN A 32  . ? 1_555 ? 
29  AC4 10 ALA A  35  ? ALA A 35  . ? 1_555 ? 
30  AC4 10 GLY A  36  ? GLY A 36  . ? 1_555 ? 
31  AC4 10 GLU A  51  ? GLU A 51  . ? 1_555 ? 
32  AC4 10 GLU A  55  ? GLU A 55  . ? 1_555 ? 
33  AC4 10 MN  M  .   ? MN  A 154 . ? 1_555 ? 
34  AC4 10 SO4 O  .   ? SO4 A 156 . ? 1_555 ? 
35  AC4 10 SO4 Q  .   ? SO4 A 158 . ? 1_555 ? 
36  AC4 10 HOH UB .   ? HOH A 162 . ? 1_555 ? 
37  AC5 6  THR A  7   ? THR A 7   . ? 1_555 ? 
38  AC5 6  ASN A  32  ? ASN A 32  . ? 1_555 ? 
39  AC5 6  ALA A  35  ? ALA A 35  . ? 1_555 ? 
40  AC5 6  GLY A  36  ? GLY A 36  . ? 1_555 ? 
41  AC5 6  ARG A  81  ? ARG A 81  . ? 1_555 ? 
42  AC5 6  SO4 P  .   ? SO4 A 157 . ? 1_555 ? 
43  AC6 4  GLU B  51  ? GLU B 51  . ? 1_555 ? 
44  AC6 4  GLU B  55  ? GLU B 55  . ? 1_555 ? 
45  AC6 4  SO4 T  .   ? SO4 B 156 . ? 1_555 ? 
46  AC6 4  SO4 U  .   ? SO4 B 157 . ? 1_555 ? 
47  AC7 3  GLU B  51  ? GLU B 51  . ? 1_555 ? 
48  AC7 3  SO4 T  .   ? SO4 B 156 . ? 1_555 ? 
49  AC7 3  HOH VB .   ? HOH B 177 . ? 1_555 ? 
50  AC8 8  GLY B  36  ? GLY B 36  . ? 1_555 ? 
51  AC8 8  HIS B  37  ? HIS B 37  . ? 1_555 ? 
52  AC8 8  GLU B  51  ? GLU B 51  . ? 1_555 ? 
53  AC8 8  MN  R  .   ? MN  B 154 . ? 1_555 ? 
54  AC8 8  MN  S  .   ? MN  B 155 . ? 1_555 ? 
55  AC8 8  SO4 U  .   ? SO4 B 157 . ? 1_555 ? 
56  AC8 8  HOH VB .   ? HOH B 161 . ? 1_555 ? 
57  AC8 8  HOH VB .   ? HOH B 213 . ? 1_555 ? 
58  AC9 8  GLU B  23  ? GLU B 23  . ? 1_555 ? 
59  AC9 8  ALA B  35  ? ALA B 35  . ? 1_555 ? 
60  AC9 8  GLY B  36  ? GLY B 36  . ? 1_555 ? 
61  AC9 8  GLU B  51  ? GLU B 51  . ? 1_555 ? 
62  AC9 8  GLU B  55  ? GLU B 55  . ? 1_555 ? 
63  AC9 8  MN  R  .   ? MN  B 154 . ? 1_555 ? 
64  AC9 8  SO4 T  .   ? SO4 B 156 . ? 1_555 ? 
65  AC9 8  SO4 V  .   ? SO4 B 158 . ? 1_555 ? 
66  BC1 6  THR B  7   ? THR B 7   . ? 1_555 ? 
67  BC1 6  ASN B  32  ? ASN B 32  . ? 1_555 ? 
68  BC1 6  ALA B  35  ? ALA B 35  . ? 1_555 ? 
69  BC1 6  GLY B  36  ? GLY B 36  . ? 1_555 ? 
70  BC1 6  ARG B  81  ? ARG B 81  . ? 1_555 ? 
71  BC1 6  SO4 U  .   ? SO4 B 157 . ? 1_555 ? 
72  BC2 5  GLU C  51  ? GLU C 51  . ? 1_555 ? 
73  BC2 5  GLU C  55  ? GLU C 55  . ? 1_555 ? 
74  BC2 5  MN  X  .   ? MN  C 155 . ? 1_555 ? 
75  BC2 5  SO4 Y  .   ? SO4 C 156 . ? 1_555 ? 
76  BC2 5  SO4 Z  .   ? SO4 C 157 . ? 1_555 ? 
77  BC3 4  GLU C  51  ? GLU C 51  . ? 1_555 ? 
78  BC3 4  MN  W  .   ? MN  C 154 . ? 1_555 ? 
79  BC3 4  SO4 Y  .   ? SO4 C 156 . ? 1_555 ? 
80  BC3 4  HOH WB .   ? HOH C 269 . ? 1_555 ? 
81  BC4 8  GLY C  36  ? GLY C 36  . ? 1_555 ? 
82  BC4 8  HIS C  37  ? HIS C 37  . ? 1_555 ? 
83  BC4 8  GLU C  51  ? GLU C 51  . ? 1_555 ? 
84  BC4 8  MN  W  .   ? MN  C 154 . ? 1_555 ? 
85  BC4 8  MN  X  .   ? MN  C 155 . ? 1_555 ? 
86  BC4 8  SO4 Z  .   ? SO4 C 157 . ? 1_555 ? 
87  BC4 8  HOH WB .   ? HOH C 250 . ? 1_555 ? 
88  BC4 8  HOH WB .   ? HOH C 269 . ? 1_555 ? 
89  BC5 8  GLU C  23  ? GLU C 23  . ? 1_555 ? 
90  BC5 8  ALA C  35  ? ALA C 35  . ? 1_555 ? 
91  BC5 8  GLY C  36  ? GLY C 36  . ? 1_555 ? 
92  BC5 8  GLU C  51  ? GLU C 51  . ? 1_555 ? 
93  BC5 8  GLU C  55  ? GLU C 55  . ? 1_555 ? 
94  BC5 8  MN  W  .   ? MN  C 154 . ? 1_555 ? 
95  BC5 8  SO4 Y  .   ? SO4 C 156 . ? 1_555 ? 
96  BC5 8  SO4 AA .   ? SO4 C 158 . ? 1_555 ? 
97  BC6 6  THR C  7   ? THR C 7   . ? 1_555 ? 
98  BC6 6  ASN C  32  ? ASN C 32  . ? 1_555 ? 
99  BC6 6  ALA C  35  ? ALA C 35  . ? 1_555 ? 
100 BC6 6  GLY C  36  ? GLY C 36  . ? 1_555 ? 
101 BC6 6  ARG C  81  ? ARG C 81  . ? 1_555 ? 
102 BC6 6  SO4 Z  .   ? SO4 C 157 . ? 1_555 ? 
103 BC7 2  GLU D  51  ? GLU D 51  . ? 1_555 ? 
104 BC7 2  SO4 DA .   ? SO4 D 156 . ? 1_555 ? 
105 BC8 4  GLU D  51  ? GLU D 51  . ? 1_555 ? 
106 BC8 4  GLU D  55  ? GLU D 55  . ? 1_555 ? 
107 BC8 4  SO4 DA .   ? SO4 D 156 . ? 1_555 ? 
108 BC8 4  SO4 EA .   ? SO4 D 157 . ? 1_555 ? 
109 BC9 8  GLY D  36  ? GLY D 36  . ? 1_555 ? 
110 BC9 8  HIS D  37  ? HIS D 37  . ? 1_555 ? 
111 BC9 8  GLU D  51  ? GLU D 51  . ? 1_555 ? 
112 BC9 8  GLU D  55  ? GLU D 55  . ? 1_555 ? 
113 BC9 8  MN  BA .   ? MN  D 154 . ? 1_555 ? 
114 BC9 8  MN  CA .   ? MN  D 155 . ? 1_555 ? 
115 BC9 8  SO4 EA .   ? SO4 D 157 . ? 1_555 ? 
116 BC9 8  HOH XB .   ? HOH D 252 . ? 1_555 ? 
117 CC1 10 GLU D  23  ? GLU D 23  . ? 1_555 ? 
118 CC1 10 ASN D  32  ? ASN D 32  . ? 1_555 ? 
119 CC1 10 ALA D  35  ? ALA D 35  . ? 1_555 ? 
120 CC1 10 GLY D  36  ? GLY D 36  . ? 1_555 ? 
121 CC1 10 GLU D  51  ? GLU D 51  . ? 1_555 ? 
122 CC1 10 GLU D  55  ? GLU D 55  . ? 1_555 ? 
123 CC1 10 ARG D  119 ? ARG D 119 . ? 1_555 ? 
124 CC1 10 MN  CA .   ? MN  D 155 . ? 1_555 ? 
125 CC1 10 SO4 DA .   ? SO4 D 156 . ? 1_555 ? 
126 CC1 10 SO4 FA .   ? SO4 D 158 . ? 1_555 ? 
127 CC2 6  THR D  7   ? THR D 7   . ? 1_555 ? 
128 CC2 6  ASN D  32  ? ASN D 32  . ? 1_555 ? 
129 CC2 6  ALA D  35  ? ALA D 35  . ? 1_555 ? 
130 CC2 6  GLY D  36  ? GLY D 36  . ? 1_555 ? 
131 CC2 6  ARG D  81  ? ARG D 81  . ? 1_555 ? 
132 CC2 6  SO4 EA .   ? SO4 D 157 . ? 1_555 ? 
133 CC3 4  GLU E  51  ? GLU E 51  . ? 1_555 ? 
134 CC3 4  MN  HA .   ? MN  E 155 . ? 1_555 ? 
135 CC3 4  SO4 IA .   ? SO4 E 156 . ? 1_555 ? 
136 CC3 4  HOH YB .   ? HOH E 172 . ? 1_555 ? 
137 CC4 5  GLU E  51  ? GLU E 51  . ? 1_555 ? 
138 CC4 5  GLU E  55  ? GLU E 55  . ? 1_555 ? 
139 CC4 5  MN  GA .   ? MN  E 154 . ? 1_555 ? 
140 CC4 5  SO4 IA .   ? SO4 E 156 . ? 1_555 ? 
141 CC4 5  SO4 JA .   ? SO4 E 157 . ? 1_555 ? 
142 CC5 9  ALA E  35  ? ALA E 35  . ? 1_555 ? 
143 CC5 9  GLY E  36  ? GLY E 36  . ? 1_555 ? 
144 CC5 9  HIS E  37  ? HIS E 37  . ? 1_555 ? 
145 CC5 9  GLU E  51  ? GLU E 51  . ? 1_555 ? 
146 CC5 9  MN  GA .   ? MN  E 154 . ? 1_555 ? 
147 CC5 9  MN  HA .   ? MN  E 155 . ? 1_555 ? 
148 CC5 9  SO4 JA .   ? SO4 E 157 . ? 1_555 ? 
149 CC5 9  HOH YB .   ? HOH E 171 . ? 1_555 ? 
150 CC5 9  HOH YB .   ? HOH E 172 . ? 1_555 ? 
151 CC6 8  GLU E  23  ? GLU E 23  . ? 1_555 ? 
152 CC6 8  ALA E  35  ? ALA E 35  . ? 1_555 ? 
153 CC6 8  GLY E  36  ? GLY E 36  . ? 1_555 ? 
154 CC6 8  GLU E  51  ? GLU E 51  . ? 1_555 ? 
155 CC6 8  GLU E  55  ? GLU E 55  . ? 1_555 ? 
156 CC6 8  MN  HA .   ? MN  E 155 . ? 1_555 ? 
157 CC6 8  SO4 IA .   ? SO4 E 156 . ? 1_555 ? 
158 CC6 8  SO4 KA .   ? SO4 E 158 . ? 1_555 ? 
159 CC7 7  THR E  7   ? THR E 7   . ? 1_555 ? 
160 CC7 7  ASN E  32  ? ASN E 32  . ? 1_555 ? 
161 CC7 7  ALA E  35  ? ALA E 35  . ? 1_555 ? 
162 CC7 7  GLY E  36  ? GLY E 36  . ? 1_555 ? 
163 CC7 7  ARG E  81  ? ARG E 81  . ? 1_555 ? 
164 CC7 7  SO4 JA .   ? SO4 E 157 . ? 1_555 ? 
165 CC7 7  HOH YB .   ? HOH E 235 . ? 1_555 ? 
166 CC8 5  GLU F  51  ? GLU F 51  . ? 1_555 ? 
167 CC8 5  GLU F  55  ? GLU F 55  . ? 1_555 ? 
168 CC8 5  MN  MA .   ? MN  F 155 . ? 1_555 ? 
169 CC8 5  SO4 NA .   ? SO4 F 156 . ? 1_555 ? 
170 CC8 5  SO4 OA .   ? SO4 F 157 . ? 1_555 ? 
171 CC9 3  GLU F  51  ? GLU F 51  . ? 1_555 ? 
172 CC9 3  MN  LA .   ? MN  F 154 . ? 1_555 ? 
173 CC9 3  SO4 NA .   ? SO4 F 156 . ? 1_555 ? 
174 DC1 6  GLY F  36  ? GLY F 36  . ? 1_555 ? 
175 DC1 6  HIS F  37  ? HIS F 37  . ? 1_555 ? 
176 DC1 6  GLU F  51  ? GLU F 51  . ? 1_555 ? 
177 DC1 6  MN  LA .   ? MN  F 154 . ? 1_555 ? 
178 DC1 6  MN  MA .   ? MN  F 155 . ? 1_555 ? 
179 DC1 6  SO4 OA .   ? SO4 F 157 . ? 1_555 ? 
180 DC2 10 GLU F  23  ? GLU F 23  . ? 1_555 ? 
181 DC2 10 ALA F  35  ? ALA F 35  . ? 1_555 ? 
182 DC2 10 GLY F  36  ? GLY F 36  . ? 1_555 ? 
183 DC2 10 GLU F  51  ? GLU F 51  . ? 1_555 ? 
184 DC2 10 GLU F  55  ? GLU F 55  . ? 1_555 ? 
185 DC2 10 ARG F  119 ? ARG F 119 . ? 1_555 ? 
186 DC2 10 MN  LA .   ? MN  F 154 . ? 1_555 ? 
187 DC2 10 SO4 NA .   ? SO4 F 156 . ? 1_555 ? 
188 DC2 10 SO4 PA .   ? SO4 F 158 . ? 1_555 ? 
189 DC2 10 HOH ZB .   ? HOH F 169 . ? 1_555 ? 
190 DC3 6  THR F  7   ? THR F 7   . ? 1_555 ? 
191 DC3 6  ASN F  32  ? ASN F 32  . ? 1_555 ? 
192 DC3 6  ALA F  35  ? ALA F 35  . ? 1_555 ? 
193 DC3 6  GLY F  36  ? GLY F 36  . ? 1_555 ? 
194 DC3 6  ARG F  81  ? ARG F 81  . ? 1_555 ? 
195 DC3 6  SO4 OA .   ? SO4 F 157 . ? 1_555 ? 
196 DC4 6  GLU G  51  ? GLU G 51  . ? 1_555 ? 
197 DC4 6  GLU G  54  ? GLU G 54  . ? 1_555 ? 
198 DC4 6  GLU G  55  ? GLU G 55  . ? 1_555 ? 
199 DC4 6  MN  RA .   ? MN  G 155 . ? 1_555 ? 
200 DC4 6  SO4 SA .   ? SO4 G 156 . ? 1_555 ? 
201 DC4 6  SO4 UA .   ? SO4 G 158 . ? 1_555 ? 
202 DC5 3  GLU G  51  ? GLU G 51  . ? 1_555 ? 
203 DC5 3  MN  QA .   ? MN  G 154 . ? 1_555 ? 
204 DC5 3  SO4 SA .   ? SO4 G 156 . ? 1_555 ? 
205 DC6 6  GLY G  36  ? GLY G 36  . ? 1_555 ? 
206 DC6 6  HIS G  37  ? HIS G 37  . ? 1_555 ? 
207 DC6 6  GLU G  51  ? GLU G 51  . ? 1_555 ? 
208 DC6 6  MN  QA .   ? MN  G 154 . ? 1_555 ? 
209 DC6 6  MN  RA .   ? MN  G 155 . ? 1_555 ? 
210 DC6 6  SO4 UA .   ? SO4 G 158 . ? 1_555 ? 
211 DC7 6  THR G  7   ? THR G 7   . ? 1_555 ? 
212 DC7 6  ASN G  32  ? ASN G 32  . ? 1_555 ? 
213 DC7 6  ALA G  35  ? ALA G 35  . ? 1_555 ? 
214 DC7 6  GLY G  36  ? GLY G 36  . ? 1_555 ? 
215 DC7 6  ARG G  81  ? ARG G 81  . ? 1_555 ? 
216 DC7 6  SO4 UA .   ? SO4 G 158 . ? 1_555 ? 
217 DC8 9  GLU G  23  ? GLU G 23  . ? 1_555 ? 
218 DC8 9  ALA G  35  ? ALA G 35  . ? 1_555 ? 
219 DC8 9  GLY G  36  ? GLY G 36  . ? 1_555 ? 
220 DC8 9  GLU G  51  ? GLU G 51  . ? 1_555 ? 
221 DC8 9  GLU G  55  ? GLU G 55  . ? 1_555 ? 
222 DC8 9  MN  QA .   ? MN  G 154 . ? 1_555 ? 
223 DC8 9  SO4 SA .   ? SO4 G 156 . ? 1_555 ? 
224 DC8 9  SO4 TA .   ? SO4 G 157 . ? 1_555 ? 
225 DC8 9  HOH AC .   ? HOH G 168 . ? 1_555 ? 
226 DC9 4  GLU H  51  ? GLU H 51  . ? 1_555 ? 
227 DC9 4  GLU H  55  ? GLU H 55  . ? 1_555 ? 
228 DC9 4  SO4 XA .   ? SO4 H 156 . ? 1_555 ? 
229 DC9 4  SO4 YA .   ? SO4 H 157 . ? 1_555 ? 
230 EC1 2  GLU H  51  ? GLU H 51  . ? 1_555 ? 
231 EC1 2  SO4 XA .   ? SO4 H 156 . ? 1_555 ? 
232 EC2 9  GLY H  36  ? GLY H 36  . ? 1_555 ? 
233 EC2 9  HIS H  37  ? HIS H 37  . ? 1_555 ? 
234 EC2 9  GLU H  51  ? GLU H 51  . ? 1_555 ? 
235 EC2 9  GLU H  55  ? GLU H 55  . ? 1_555 ? 
236 EC2 9  MN  VA .   ? MN  H 154 . ? 1_555 ? 
237 EC2 9  MN  WA .   ? MN  H 155 . ? 1_555 ? 
238 EC2 9  SO4 YA .   ? SO4 H 157 . ? 1_555 ? 
239 EC2 9  HOH BC .   ? HOH H 160 . ? 1_555 ? 
240 EC2 9  HOH BC .   ? HOH H 162 . ? 1_555 ? 
241 EC3 9  GLU H  23  ? GLU H 23  . ? 1_555 ? 
242 EC3 9  ASN H  32  ? ASN H 32  . ? 1_555 ? 
243 EC3 9  ALA H  35  ? ALA H 35  . ? 1_555 ? 
244 EC3 9  GLY H  36  ? GLY H 36  . ? 1_555 ? 
245 EC3 9  GLU H  51  ? GLU H 51  . ? 1_555 ? 
246 EC3 9  GLU H  55  ? GLU H 55  . ? 1_555 ? 
247 EC3 9  MN  VA .   ? MN  H 154 . ? 1_555 ? 
248 EC3 9  SO4 XA .   ? SO4 H 156 . ? 1_555 ? 
249 EC3 9  SO4 ZA .   ? SO4 H 158 . ? 1_555 ? 
250 EC4 6  THR H  7   ? THR H 7   . ? 1_555 ? 
251 EC4 6  ASN H  32  ? ASN H 32  . ? 1_555 ? 
252 EC4 6  ALA H  35  ? ALA H 35  . ? 1_555 ? 
253 EC4 6  GLY H  36  ? GLY H 36  . ? 1_555 ? 
254 EC4 6  ARG H  81  ? ARG H 81  . ? 1_555 ? 
255 EC4 6  SO4 YA .   ? SO4 H 157 . ? 1_555 ? 
256 EC5 5  GLU I  51  ? GLU I 51  . ? 1_555 ? 
257 EC5 5  GLU I  55  ? GLU I 55  . ? 1_555 ? 
258 EC5 5  MN  BB .   ? MN  I 155 . ? 1_555 ? 
259 EC5 5  SO4 CB .   ? SO4 I 156 . ? 1_555 ? 
260 EC5 5  SO4 DB .   ? SO4 I 157 . ? 1_555 ? 
261 EC6 5  ARG I  50  ? ARG I 50  . ? 1_555 ? 
262 EC6 5  GLU I  51  ? GLU I 51  . ? 1_555 ? 
263 EC6 5  GLU I  54  ? GLU I 54  . ? 1_555 ? 
264 EC6 5  MN  AB .   ? MN  I 154 . ? 1_555 ? 
265 EC6 5  SO4 CB .   ? SO4 I 156 . ? 1_555 ? 
266 EC7 5  HIS I  37  ? HIS I 37  . ? 1_555 ? 
267 EC7 5  GLU I  51  ? GLU I 51  . ? 1_555 ? 
268 EC7 5  MN  AB .   ? MN  I 154 . ? 1_555 ? 
269 EC7 5  MN  BB .   ? MN  I 155 . ? 1_555 ? 
270 EC7 5  SO4 DB .   ? SO4 I 157 . ? 1_555 ? 
271 EC8 6  ALA I  35  ? ALA I 35  . ? 1_555 ? 
272 EC8 6  GLY I  36  ? GLY I 36  . ? 1_555 ? 
273 EC8 6  GLU I  55  ? GLU I 55  . ? 1_555 ? 
274 EC8 6  MN  AB .   ? MN  I 154 . ? 1_555 ? 
275 EC8 6  SO4 CB .   ? SO4 I 156 . ? 1_555 ? 
276 EC8 6  SO4 EB .   ? SO4 I 158 . ? 1_555 ? 
277 EC9 5  THR I  7   ? THR I 7   . ? 1_555 ? 
278 EC9 5  ASN I  32  ? ASN I 32  . ? 1_555 ? 
279 EC9 5  ALA I  35  ? ALA I 35  . ? 1_555 ? 
280 EC9 5  ARG I  81  ? ARG I 81  . ? 1_555 ? 
281 EC9 5  SO4 DB .   ? SO4 I 157 . ? 1_555 ? 
282 FC1 5  GLU J  51  ? GLU J 51  . ? 1_555 ? 
283 FC1 5  GLU J  55  ? GLU J 55  . ? 1_555 ? 
284 FC1 5  MN  GB .   ? MN  J 155 . ? 1_555 ? 
285 FC1 5  SO4 HB .   ? SO4 J 156 . ? 1_555 ? 
286 FC1 5  SO4 IB .   ? SO4 J 157 . ? 1_555 ? 
287 FC2 4  GLU J  51  ? GLU J 51  . ? 1_555 ? 
288 FC2 4  MN  FB .   ? MN  J 154 . ? 1_555 ? 
289 FC2 4  SO4 HB .   ? SO4 J 156 . ? 1_555 ? 
290 FC2 4  HOH DC .   ? HOH J 267 . ? 1_555 ? 
291 FC3 7  GLY J  36  ? GLY J 36  . ? 1_555 ? 
292 FC3 7  HIS J  37  ? HIS J 37  . ? 1_555 ? 
293 FC3 7  GLU J  51  ? GLU J 51  . ? 1_555 ? 
294 FC3 7  MN  FB .   ? MN  J 154 . ? 1_555 ? 
295 FC3 7  MN  GB .   ? MN  J 155 . ? 1_555 ? 
296 FC3 7  SO4 IB .   ? SO4 J 157 . ? 1_555 ? 
297 FC3 7  HOH DC .   ? HOH J 175 . ? 1_555 ? 
298 FC4 9  GLU J  23  ? GLU J 23  . ? 1_555 ? 
299 FC4 9  ALA J  35  ? ALA J 35  . ? 1_555 ? 
300 FC4 9  GLY J  36  ? GLY J 36  . ? 1_555 ? 
301 FC4 9  GLU J  51  ? GLU J 51  . ? 1_555 ? 
302 FC4 9  GLU J  55  ? GLU J 55  . ? 1_555 ? 
303 FC4 9  MN  FB .   ? MN  J 154 . ? 1_555 ? 
304 FC4 9  SO4 HB .   ? SO4 J 156 . ? 1_555 ? 
305 FC4 9  SO4 JB .   ? SO4 J 158 . ? 1_555 ? 
306 FC4 9  HOH DC .   ? HOH J 175 . ? 1_555 ? 
307 FC5 6  THR J  7   ? THR J 7   . ? 1_555 ? 
308 FC5 6  ASN J  32  ? ASN J 32  . ? 1_555 ? 
309 FC5 6  ALA J  35  ? ALA J 35  . ? 1_555 ? 
310 FC5 6  GLY J  36  ? GLY J 36  . ? 1_555 ? 
311 FC5 6  ARG J  81  ? ARG J 81  . ? 1_555 ? 
312 FC5 6  SO4 IB .   ? SO4 J 157 . ? 1_555 ? 
313 FC6 7  GLU K  51  ? GLU K 51  . ? 1_555 ? 
314 FC6 7  GLU K  55  ? GLU K 55  . ? 1_555 ? 
315 FC6 7  MN  LB .   ? MN  K 155 . ? 1_555 ? 
316 FC6 7  SO4 MB .   ? SO4 K 156 . ? 1_555 ? 
317 FC6 7  SO4 NB .   ? SO4 K 157 . ? 1_555 ? 
318 FC6 7  HOH EC .   ? HOH K 178 . ? 1_555 ? 
319 FC6 7  HOH EC .   ? HOH K 204 . ? 1_555 ? 
320 FC7 3  GLU K  51  ? GLU K 51  . ? 1_555 ? 
321 FC7 3  MN  KB .   ? MN  K 154 . ? 1_555 ? 
322 FC7 3  SO4 MB .   ? SO4 K 156 . ? 1_555 ? 
323 FC8 7  GLY K  36  ? GLY K 36  . ? 1_555 ? 
324 FC8 7  HIS K  37  ? HIS K 37  . ? 1_555 ? 
325 FC8 7  GLU K  51  ? GLU K 51  . ? 1_555 ? 
326 FC8 7  MN  KB .   ? MN  K 154 . ? 1_555 ? 
327 FC8 7  MN  LB .   ? MN  K 155 . ? 1_555 ? 
328 FC8 7  SO4 NB .   ? SO4 K 157 . ? 1_555 ? 
329 FC8 7  HOH EC .   ? HOH K 172 . ? 1_555 ? 
330 FC9 10 GLU K  23  ? GLU K 23  . ? 1_555 ? 
331 FC9 10 ASN K  32  ? ASN K 32  . ? 1_555 ? 
332 FC9 10 ALA K  35  ? ALA K 35  . ? 1_555 ? 
333 FC9 10 GLY K  36  ? GLY K 36  . ? 1_555 ? 
334 FC9 10 GLU K  51  ? GLU K 51  . ? 1_555 ? 
335 FC9 10 GLU K  55  ? GLU K 55  . ? 1_555 ? 
336 FC9 10 MN  KB .   ? MN  K 154 . ? 1_555 ? 
337 FC9 10 SO4 MB .   ? SO4 K 156 . ? 1_555 ? 
338 FC9 10 SO4 OB .   ? SO4 K 158 . ? 1_555 ? 
339 FC9 10 HOH EC .   ? HOH K 178 . ? 1_555 ? 
340 GC1 6  THR K  7   ? THR K 7   . ? 1_555 ? 
341 GC1 6  ASN K  32  ? ASN K 32  . ? 1_555 ? 
342 GC1 6  ALA K  35  ? ALA K 35  . ? 1_555 ? 
343 GC1 6  GLY K  36  ? GLY K 36  . ? 1_555 ? 
344 GC1 6  ARG K  81  ? ARG K 81  . ? 1_555 ? 
345 GC1 6  SO4 NB .   ? SO4 K 157 . ? 1_555 ? 
346 GC2 3  GLU L  51  ? GLU L 51  . ? 1_555 ? 
347 GC2 3  MN  QB .   ? MN  L 155 . ? 1_555 ? 
348 GC2 3  SO4 RB .   ? SO4 L 156 . ? 1_555 ? 
349 GC3 6  GLU L  51  ? GLU L 51  . ? 1_555 ? 
350 GC3 6  GLU L  54  ? GLU L 54  . ? 1_555 ? 
351 GC3 6  GLU L  55  ? GLU L 55  . ? 1_555 ? 
352 GC3 6  MN  PB .   ? MN  L 154 . ? 1_555 ? 
353 GC3 6  SO4 RB .   ? SO4 L 156 . ? 1_555 ? 
354 GC3 6  SO4 SB .   ? SO4 L 157 . ? 1_555 ? 
355 GC4 7  GLY L  36  ? GLY L 36  . ? 1_555 ? 
356 GC4 7  HIS L  37  ? HIS L 37  . ? 1_555 ? 
357 GC4 7  GLU L  51  ? GLU L 51  . ? 1_555 ? 
358 GC4 7  MN  PB .   ? MN  L 154 . ? 1_555 ? 
359 GC4 7  MN  QB .   ? MN  L 155 . ? 1_555 ? 
360 GC4 7  SO4 SB .   ? SO4 L 157 . ? 1_555 ? 
361 GC4 7  HOH FC .   ? HOH L 173 . ? 1_555 ? 
362 GC5 9  GLU L  23  ? GLU L 23  . ? 1_555 ? 
363 GC5 9  ALA L  35  ? ALA L 35  . ? 1_555 ? 
364 GC5 9  GLY L  36  ? GLY L 36  . ? 1_555 ? 
365 GC5 9  GLU L  51  ? GLU L 51  . ? 1_555 ? 
366 GC5 9  GLU L  55  ? GLU L 55  . ? 1_555 ? 
367 GC5 9  MN  QB .   ? MN  L 155 . ? 1_555 ? 
368 GC5 9  SO4 RB .   ? SO4 L 156 . ? 1_555 ? 
369 GC5 9  SO4 TB .   ? SO4 L 158 . ? 1_555 ? 
370 GC5 9  HOH FC .   ? HOH L 173 . ? 1_555 ? 
371 GC6 4  THR L  7   ? THR L 7   . ? 1_555 ? 
372 GC6 4  ASN L  32  ? ASN L 32  . ? 1_555 ? 
373 GC6 4  ARG L  81  ? ARG L 81  . ? 1_555 ? 
374 GC6 4  SO4 SB .   ? SO4 L 157 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 OE2 H GLU 55  ? ? O4 H SO4 157 ? ? 1.92 
2  1 O3  E SO4 156 ? ? O2 E SO4 157 ? ? 1.94 
3  1 O4  A SO4 156 ? ? O1 A SO4 157 ? ? 2.00 
4  1 O   H ILE 72  ? ? O  H THR 77  ? ? 2.04 
5  1 O   B ALA 35  ? ? O2 B SO4 157 ? ? 2.08 
6  1 OE2 A GLU 55  ? ? O1 A SO4 157 ? ? 2.11 
7  1 OE2 K GLU 55  ? ? O2 K SO4 157 ? ? 2.12 
8  1 O   A ALA 35  ? ? O1 A SO4 157 ? ? 2.12 
9  1 O2  D SO4 156 ? ? O4 D SO4 157 ? ? 2.14 
10 1 O2  B SO4 156 ? ? O4 B SO4 157 ? ? 2.14 
11 1 OE2 G GLU 55  ? ? O2 G SO4 158 ? ? 2.15 
12 1 OE2 E GLU 55  ? ? O2 E SO4 157 ? ? 2.16 
13 1 OE2 B GLU 55  ? ? O4 B SO4 157 ? ? 2.16 
14 1 OE2 L GLU 55  ? ? O1 L SO4 157 ? ? 2.16 
15 1 O   H ALA 35  ? ? O2 H SO4 157 ? ? 2.17 
16 1 OG1 G THR 77  ? ? O  G HOH 198 ? ? 2.18 
17 1 OD2 A ASP 143 ? ? NZ A LYS 150 ? ? 2.18 
18 1 O   E ALA 35  ? ? O2 E SO4 157 ? ? 2.19 
19 1 O1  F SO4 156 ? ? O3 F SO4 157 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            B 
_pdbx_validate_rmsd_bond.auth_comp_id_1            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_1             104 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            SG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            B 
_pdbx_validate_rmsd_bond.auth_comp_id_2            CYS 
_pdbx_validate_rmsd_bond.auth_seq_id_2             104 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.701 
_pdbx_validate_rmsd_bond.bond_target_value         1.812 
_pdbx_validate_rmsd_bond.bond_deviation            -0.111 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  B ALA 73  ? ? N  B PRO 74  ? ? CA B PRO 74  ? ? 129.28 119.30 9.98  1.50 Y 
2 1 C  E TRP 146 ? ? N  E PRO 147 ? ? CA E PRO 147 ? ? 130.02 119.30 10.72 1.50 Y 
3 1 C  G ALA 73  ? ? N  G PRO 74  ? ? CA G PRO 74  ? ? 128.94 119.30 9.64  1.50 Y 
4 1 CA I LEU 52  ? ? CB I LEU 52  ? ? CG I LEU 52  ? ? 131.15 115.30 15.85 2.30 N 
5 1 C  L CYS 92  ? ? N  L PRO 93  ? ? CA L PRO 93  ? ? 128.38 119.30 9.08  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 ALA A 14  ? ? -171.82 127.94  
2   1 ASN A 26  ? ? 7.18    86.72   
3   1 THR A 56  ? ? -143.52 -18.88  
4   1 ALA A 73  ? ? 83.35   143.63  
5   1 LYS A 76  ? ? 73.86   -1.88   
6   1 PRO A 93  ? ? -46.02  151.49  
7   1 GLU A 139 ? ? -45.32  -18.27  
8   1 ASN A 145 ? ? 57.30   81.65   
9   1 ALA B 14  ? ? 177.36  132.14  
10  1 ARG B 67  ? ? 167.37  171.59  
11  1 ILE B 72  ? ? -88.63  -76.42  
12  1 ALA B 73  ? ? 101.63  136.34  
13  1 ASP B 75  ? ? -37.09  -32.45  
14  1 PRO B 93  ? ? -35.45  137.27  
15  1 GLN B 95  ? ? -164.55 94.41   
16  1 ARG B 135 ? ? -177.53 138.76  
17  1 ASN B 145 ? ? 63.59   72.02   
18  1 ASN C 26  ? ? -179.13 114.17  
19  1 THR C 56  ? ? -151.74 -16.37  
20  1 ARG C 67  ? ? 171.35  161.45  
21  1 GLN C 95  ? ? -165.43 91.67   
22  1 CYS C 103 ? ? -174.57 -173.91 
23  1 GLU C 139 ? ? -56.83  -8.00   
24  1 ILE C 141 ? ? -143.41 40.80   
25  1 THR C 149 ? ? -105.46 -151.20 
26  1 GLU D 15  ? ? 34.57   58.46   
27  1 ILE D 25  ? ? -79.77  -76.74  
28  1 GLU D 46  ? ? -62.39  -70.52  
29  1 ARG D 67  ? ? 172.86  168.15  
30  1 ALA D 73  ? ? 74.29   130.27  
31  1 PRO D 74  ? ? -23.74  -64.91  
32  1 ASP D 75  ? ? -67.72  11.85   
33  1 PRO D 93  ? ? -36.97  161.10  
34  1 THR D 94  ? ? -120.85 -136.19 
35  1 GLN D 95  ? ? 97.63   84.84   
36  1 THR E 24  ? ? -69.92  91.14   
37  1 ASN E 26  ? ? -8.31   92.48   
38  1 ARG E 67  ? ? 170.20  158.99  
39  1 LYS E 76  ? ? 78.54   -8.06   
40  1 PRO E 93  ? ? -37.17  129.05  
41  1 SER E 99  ? ? -49.80  -16.18  
42  1 CYS E 103 ? ? -175.51 -176.37 
43  1 ASN E 145 ? ? 39.74   46.01   
44  1 GLU F 15  ? ? 36.18   56.99   
45  1 ILE F 25  ? ? -79.13  -120.25 
46  1 ALA F 47  ? ? -65.79  -70.50  
47  1 THR F 56  ? ? -147.66 -15.92  
48  1 ARG F 67  ? ? 178.97  171.94  
49  1 ALA F 73  ? ? 74.11   133.01  
50  1 ASP F 75  ? ? -84.63  36.40   
51  1 LYS F 76  ? ? 59.68   -2.23   
52  1 PRO F 93  ? ? -53.04  109.35  
53  1 SER F 99  ? ? -18.24  -67.24  
54  1 ALA F 115 ? ? -49.34  154.03  
55  1 ASN G 26  ? ? -153.81 81.88   
56  1 GLU G 54  ? ? -39.46  -22.88  
57  1 ALA G 73  ? ? 81.63   142.49  
58  1 PRO G 93  ? ? -27.89  -167.08 
59  1 THR G 94  ? ? 174.04  -134.02 
60  1 GLN G 95  ? ? 77.83   116.80  
61  1 PRO G 96  ? ? -44.69  -179.55 
62  1 CYS G 103 ? ? 176.34  -170.30 
63  1 ASN H 26  ? ? 169.27  84.13   
64  1 PRO H 34  ? ? -64.70  99.33   
65  1 ILE H 72  ? ? -83.97  -73.52  
66  1 ALA H 73  ? ? 112.25  143.46  
67  1 PRO H 96  ? ? -41.14  156.30  
68  1 ASN H 145 ? ? 33.55   55.63   
69  1 VAL I 21  ? ? -114.85 -162.61 
70  1 GLU I 22  ? ? -169.42 113.20  
71  1 ILE I 25  ? ? -98.02  -124.60 
72  1 PRO I 34  ? ? -60.67  74.20   
73  1 ALA I 35  ? ? -91.74  -156.82 
74  1 GLU I 39  ? ? -68.37  -162.06 
75  1 THR I 56  ? ? -143.21 -25.44  
76  1 ARG I 67  ? ? 178.60  155.71  
77  1 ALA I 73  ? ? 74.97   153.55  
78  1 ASP I 75  ? ? -87.17  41.33   
79  1 LYS I 76  ? ? 50.98   11.64   
80  1 GLU I 89  ? ? -40.18  -71.89  
81  1 PRO I 93  ? ? -33.16  92.06   
82  1 GLN I 95  ? ? -164.05 98.04   
83  1 ASP I 102 ? ? -95.98  -75.66  
84  1 CYS I 103 ? ? -151.67 -156.24 
85  1 GLU I 111 ? ? -60.25  14.91   
86  1 ILE I 112 ? ? -146.75 -51.02  
87  1 ALA I 115 ? ? -49.14  154.40  
88  1 SER I 116 ? ? -143.24 48.25   
89  1 ALA I 124 ? ? -60.55  -85.73  
90  1 GLU I 125 ? ? -10.90  -55.36  
91  1 GLU I 139 ? ? -59.89  -7.85   
92  1 ALA J 14  ? ? -170.81 136.41  
93  1 PRO J 34  ? ? -56.32  107.67  
94  1 THR J 56  ? ? -149.42 -17.74  
95  1 ARG J 67  ? ? 169.41  156.74  
96  1 ASP J 75  ? ? -67.38  33.30   
97  1 LYS J 76  ? ? 55.64   6.93    
98  1 ASN J 145 ? ? 34.25   71.55   
99  1 GLU K 15  ? ? 38.85   50.50   
100 1 ILE K 25  ? ? -112.87 -109.91 
101 1 PRO K 34  ? ? -69.39  98.41   
102 1 ARG K 67  ? ? 173.15  151.97  
103 1 ILE K 72  ? ? -77.72  -93.81  
104 1 ALA K 73  ? ? 128.66  148.69  
105 1 GLN K 95  ? ? -170.46 91.79   
106 1 PRO K 96  ? ? -41.18  150.01  
107 1 THR L 24  ? ? -15.69  102.42  
108 1 ASN L 26  ? ? -52.44  95.96   
109 1 ALA L 35  ? ? -143.24 -156.85 
110 1 GLU L 39  ? ? -68.21  -160.04 
111 1 SER L 59  ? ? -105.49 56.07   
112 1 ARG L 67  ? ? 169.45  162.91  
113 1 ILE L 72  ? ? -91.03  -116.48 
114 1 ALA L 73  ? ? 152.03  155.23  
115 1 PRO L 74  ? ? -20.48  -79.42  
116 1 PRO L 93  ? ? -49.97  90.30   
117 1 HIS L 97  ? ? -88.44  -73.77  
118 1 ASP L 98  ? ? -34.61  125.06  
119 1 ASP L 100 ? ? -81.94  30.87   
120 1 ASP L 102 ? ? -107.92 -105.03 
121 1 CYS L 103 ? ? -114.70 -166.35 
122 1 CYS L 104 ? ? -177.81 131.40  
123 1 GLU L 139 ? ? -75.29  27.56   
124 1 PHE L 148 ? ? 68.32   161.59  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 151 ? A GLY 151 
2  1 Y 1 A VAL 152 ? A VAL 152 
3  1 Y 1 A ILE 153 ? A ILE 153 
4  1 Y 1 B GLY 151 ? B GLY 151 
5  1 Y 1 B VAL 152 ? B VAL 152 
6  1 Y 1 B ILE 153 ? B ILE 153 
7  1 Y 1 C GLY 151 ? C GLY 151 
8  1 Y 1 C VAL 152 ? C VAL 152 
9  1 Y 1 C ILE 153 ? C ILE 153 
10 1 Y 1 D GLY 151 ? D GLY 151 
11 1 Y 1 D VAL 152 ? D VAL 152 
12 1 Y 1 D ILE 153 ? D ILE 153 
13 1 Y 1 E GLY 151 ? E GLY 151 
14 1 Y 1 E VAL 152 ? E VAL 152 
15 1 Y 1 E ILE 153 ? E ILE 153 
16 1 Y 1 F GLY 151 ? F GLY 151 
17 1 Y 1 F VAL 152 ? F VAL 152 
18 1 Y 1 F ILE 153 ? F ILE 153 
19 1 Y 1 G GLY 151 ? G GLY 151 
20 1 Y 1 G VAL 152 ? G VAL 152 
21 1 Y 1 G ILE 153 ? G ILE 153 
22 1 Y 1 H GLY 151 ? H GLY 151 
23 1 Y 1 H VAL 152 ? H VAL 152 
24 1 Y 1 H ILE 153 ? H ILE 153 
25 1 Y 1 I GLY 151 ? I GLY 151 
26 1 Y 1 I VAL 152 ? I VAL 152 
27 1 Y 1 I ILE 153 ? I ILE 153 
28 1 Y 1 J GLY 151 ? J GLY 151 
29 1 Y 1 J VAL 152 ? J VAL 152 
30 1 Y 1 J ILE 153 ? J ILE 153 
31 1 Y 1 K GLY 151 ? K GLY 151 
32 1 Y 1 K VAL 152 ? K VAL 152 
33 1 Y 1 K ILE 153 ? K ILE 153 
34 1 Y 1 L GLY 151 ? L GLY 151 
35 1 Y 1 L VAL 152 ? L VAL 152 
36 1 Y 1 L ILE 153 ? L ILE 153 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
HOH O    O  N N 158 
HOH H1   H  N N 159 
HOH H2   H  N N 160 
ILE N    N  N N 161 
ILE CA   C  N S 162 
ILE C    C  N N 163 
ILE O    O  N N 164 
ILE CB   C  N S 165 
ILE CG1  C  N N 166 
ILE CG2  C  N N 167 
ILE CD1  C  N N 168 
ILE OXT  O  N N 169 
ILE H    H  N N 170 
ILE H2   H  N N 171 
ILE HA   H  N N 172 
ILE HB   H  N N 173 
ILE HG12 H  N N 174 
ILE HG13 H  N N 175 
ILE HG21 H  N N 176 
ILE HG22 H  N N 177 
ILE HG23 H  N N 178 
ILE HD11 H  N N 179 
ILE HD12 H  N N 180 
ILE HD13 H  N N 181 
ILE HXT  H  N N 182 
LEU N    N  N N 183 
LEU CA   C  N S 184 
LEU C    C  N N 185 
LEU O    O  N N 186 
LEU CB   C  N N 187 
LEU CG   C  N N 188 
LEU CD1  C  N N 189 
LEU CD2  C  N N 190 
LEU OXT  O  N N 191 
LEU H    H  N N 192 
LEU H2   H  N N 193 
LEU HA   H  N N 194 
LEU HB2  H  N N 195 
LEU HB3  H  N N 196 
LEU HG   H  N N 197 
LEU HD11 H  N N 198 
LEU HD12 H  N N 199 
LEU HD13 H  N N 200 
LEU HD21 H  N N 201 
LEU HD22 H  N N 202 
LEU HD23 H  N N 203 
LEU HXT  H  N N 204 
LYS N    N  N N 205 
LYS CA   C  N S 206 
LYS C    C  N N 207 
LYS O    O  N N 208 
LYS CB   C  N N 209 
LYS CG   C  N N 210 
LYS CD   C  N N 211 
LYS CE   C  N N 212 
LYS NZ   N  N N 213 
LYS OXT  O  N N 214 
LYS H    H  N N 215 
LYS H2   H  N N 216 
LYS HA   H  N N 217 
LYS HB2  H  N N 218 
LYS HB3  H  N N 219 
LYS HG2  H  N N 220 
LYS HG3  H  N N 221 
LYS HD2  H  N N 222 
LYS HD3  H  N N 223 
LYS HE2  H  N N 224 
LYS HE3  H  N N 225 
LYS HZ1  H  N N 226 
LYS HZ2  H  N N 227 
LYS HZ3  H  N N 228 
LYS HXT  H  N N 229 
MET N    N  N N 230 
MET CA   C  N S 231 
MET C    C  N N 232 
MET O    O  N N 233 
MET CB   C  N N 234 
MET CG   C  N N 235 
MET SD   S  N N 236 
MET CE   C  N N 237 
MET OXT  O  N N 238 
MET H    H  N N 239 
MET H2   H  N N 240 
MET HA   H  N N 241 
MET HB2  H  N N 242 
MET HB3  H  N N 243 
MET HG2  H  N N 244 
MET HG3  H  N N 245 
MET HE1  H  N N 246 
MET HE2  H  N N 247 
MET HE3  H  N N 248 
MET HXT  H  N N 249 
MN  MN   MN N N 250 
PHE N    N  N N 251 
PHE CA   C  N S 252 
PHE C    C  N N 253 
PHE O    O  N N 254 
PHE CB   C  N N 255 
PHE CG   C  Y N 256 
PHE CD1  C  Y N 257 
PHE CD2  C  Y N 258 
PHE CE1  C  Y N 259 
PHE CE2  C  Y N 260 
PHE CZ   C  Y N 261 
PHE OXT  O  N N 262 
PHE H    H  N N 263 
PHE H2   H  N N 264 
PHE HA   H  N N 265 
PHE HB2  H  N N 266 
PHE HB3  H  N N 267 
PHE HD1  H  N N 268 
PHE HD2  H  N N 269 
PHE HE1  H  N N 270 
PHE HE2  H  N N 271 
PHE HZ   H  N N 272 
PHE HXT  H  N N 273 
PRO N    N  N N 274 
PRO CA   C  N S 275 
PRO C    C  N N 276 
PRO O    O  N N 277 
PRO CB   C  N N 278 
PRO CG   C  N N 279 
PRO CD   C  N N 280 
PRO OXT  O  N N 281 
PRO H    H  N N 282 
PRO HA   H  N N 283 
PRO HB2  H  N N 284 
PRO HB3  H  N N 285 
PRO HG2  H  N N 286 
PRO HG3  H  N N 287 
PRO HD2  H  N N 288 
PRO HD3  H  N N 289 
PRO HXT  H  N N 290 
SER N    N  N N 291 
SER CA   C  N S 292 
SER C    C  N N 293 
SER O    O  N N 294 
SER CB   C  N N 295 
SER OG   O  N N 296 
SER OXT  O  N N 297 
SER H    H  N N 298 
SER H2   H  N N 299 
SER HA   H  N N 300 
SER HB2  H  N N 301 
SER HB3  H  N N 302 
SER HG   H  N N 303 
SER HXT  H  N N 304 
SO4 S    S  N N 305 
SO4 O1   O  N N 306 
SO4 O2   O  N N 307 
SO4 O3   O  N N 308 
SO4 O4   O  N N 309 
THR N    N  N N 310 
THR CA   C  N S 311 
THR C    C  N N 312 
THR O    O  N N 313 
THR CB   C  N R 314 
THR OG1  O  N N 315 
THR CG2  C  N N 316 
THR OXT  O  N N 317 
THR H    H  N N 318 
THR H2   H  N N 319 
THR HA   H  N N 320 
THR HB   H  N N 321 
THR HG1  H  N N 322 
THR HG21 H  N N 323 
THR HG22 H  N N 324 
THR HG23 H  N N 325 
THR HXT  H  N N 326 
TRP N    N  N N 327 
TRP CA   C  N S 328 
TRP C    C  N N 329 
TRP O    O  N N 330 
TRP CB   C  N N 331 
TRP CG   C  Y N 332 
TRP CD1  C  Y N 333 
TRP CD2  C  Y N 334 
TRP NE1  N  Y N 335 
TRP CE2  C  Y N 336 
TRP CE3  C  Y N 337 
TRP CZ2  C  Y N 338 
TRP CZ3  C  Y N 339 
TRP CH2  C  Y N 340 
TRP OXT  O  N N 341 
TRP H    H  N N 342 
TRP H2   H  N N 343 
TRP HA   H  N N 344 
TRP HB2  H  N N 345 
TRP HB3  H  N N 346 
TRP HD1  H  N N 347 
TRP HE1  H  N N 348 
TRP HE3  H  N N 349 
TRP HZ2  H  N N 350 
TRP HZ3  H  N N 351 
TRP HH2  H  N N 352 
TRP HXT  H  N N 353 
TYR N    N  N N 354 
TYR CA   C  N S 355 
TYR C    C  N N 356 
TYR O    O  N N 357 
TYR CB   C  N N 358 
TYR CG   C  Y N 359 
TYR CD1  C  Y N 360 
TYR CD2  C  Y N 361 
TYR CE1  C  Y N 362 
TYR CE2  C  Y N 363 
TYR CZ   C  Y N 364 
TYR OH   O  N N 365 
TYR OXT  O  N N 366 
TYR H    H  N N 367 
TYR H2   H  N N 368 
TYR HA   H  N N 369 
TYR HB2  H  N N 370 
TYR HB3  H  N N 371 
TYR HD1  H  N N 372 
TYR HD2  H  N N 373 
TYR HE1  H  N N 374 
TYR HE2  H  N N 375 
TYR HH   H  N N 376 
TYR HXT  H  N N 377 
VAL N    N  N N 378 
VAL CA   C  N S 379 
VAL C    C  N N 380 
VAL O    O  N N 381 
VAL CB   C  N N 382 
VAL CG1  C  N N 383 
VAL CG2  C  N N 384 
VAL OXT  O  N N 385 
VAL H    H  N N 386 
VAL H2   H  N N 387 
VAL HA   H  N N 388 
VAL HB   H  N N 389 
VAL HG11 H  N N 390 
VAL HG12 H  N N 391 
VAL HG13 H  N N 392 
VAL HG21 H  N N 393 
VAL HG22 H  N N 394 
VAL HG23 H  N N 395 
VAL HXT  H  N N 396 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
HOH O   H1   sing N N 150 
HOH O   H2   sing N N 151 
ILE N   CA   sing N N 152 
ILE N   H    sing N N 153 
ILE N   H2   sing N N 154 
ILE CA  C    sing N N 155 
ILE CA  CB   sing N N 156 
ILE CA  HA   sing N N 157 
ILE C   O    doub N N 158 
ILE C   OXT  sing N N 159 
ILE CB  CG1  sing N N 160 
ILE CB  CG2  sing N N 161 
ILE CB  HB   sing N N 162 
ILE CG1 CD1  sing N N 163 
ILE CG1 HG12 sing N N 164 
ILE CG1 HG13 sing N N 165 
ILE CG2 HG21 sing N N 166 
ILE CG2 HG22 sing N N 167 
ILE CG2 HG23 sing N N 168 
ILE CD1 HD11 sing N N 169 
ILE CD1 HD12 sing N N 170 
ILE CD1 HD13 sing N N 171 
ILE OXT HXT  sing N N 172 
LEU N   CA   sing N N 173 
LEU N   H    sing N N 174 
LEU N   H2   sing N N 175 
LEU CA  C    sing N N 176 
LEU CA  CB   sing N N 177 
LEU CA  HA   sing N N 178 
LEU C   O    doub N N 179 
LEU C   OXT  sing N N 180 
LEU CB  CG   sing N N 181 
LEU CB  HB2  sing N N 182 
LEU CB  HB3  sing N N 183 
LEU CG  CD1  sing N N 184 
LEU CG  CD2  sing N N 185 
LEU CG  HG   sing N N 186 
LEU CD1 HD11 sing N N 187 
LEU CD1 HD12 sing N N 188 
LEU CD1 HD13 sing N N 189 
LEU CD2 HD21 sing N N 190 
LEU CD2 HD22 sing N N 191 
LEU CD2 HD23 sing N N 192 
LEU OXT HXT  sing N N 193 
LYS N   CA   sing N N 194 
LYS N   H    sing N N 195 
LYS N   H2   sing N N 196 
LYS CA  C    sing N N 197 
LYS CA  CB   sing N N 198 
LYS CA  HA   sing N N 199 
LYS C   O    doub N N 200 
LYS C   OXT  sing N N 201 
LYS CB  CG   sing N N 202 
LYS CB  HB2  sing N N 203 
LYS CB  HB3  sing N N 204 
LYS CG  CD   sing N N 205 
LYS CG  HG2  sing N N 206 
LYS CG  HG3  sing N N 207 
LYS CD  CE   sing N N 208 
LYS CD  HD2  sing N N 209 
LYS CD  HD3  sing N N 210 
LYS CE  NZ   sing N N 211 
LYS CE  HE2  sing N N 212 
LYS CE  HE3  sing N N 213 
LYS NZ  HZ1  sing N N 214 
LYS NZ  HZ2  sing N N 215 
LYS NZ  HZ3  sing N N 216 
LYS OXT HXT  sing N N 217 
MET N   CA   sing N N 218 
MET N   H    sing N N 219 
MET N   H2   sing N N 220 
MET CA  C    sing N N 221 
MET CA  CB   sing N N 222 
MET CA  HA   sing N N 223 
MET C   O    doub N N 224 
MET C   OXT  sing N N 225 
MET CB  CG   sing N N 226 
MET CB  HB2  sing N N 227 
MET CB  HB3  sing N N 228 
MET CG  SD   sing N N 229 
MET CG  HG2  sing N N 230 
MET CG  HG3  sing N N 231 
MET SD  CE   sing N N 232 
MET CE  HE1  sing N N 233 
MET CE  HE2  sing N N 234 
MET CE  HE3  sing N N 235 
MET OXT HXT  sing N N 236 
PHE N   CA   sing N N 237 
PHE N   H    sing N N 238 
PHE N   H2   sing N N 239 
PHE CA  C    sing N N 240 
PHE CA  CB   sing N N 241 
PHE CA  HA   sing N N 242 
PHE C   O    doub N N 243 
PHE C   OXT  sing N N 244 
PHE CB  CG   sing N N 245 
PHE CB  HB2  sing N N 246 
PHE CB  HB3  sing N N 247 
PHE CG  CD1  doub Y N 248 
PHE CG  CD2  sing Y N 249 
PHE CD1 CE1  sing Y N 250 
PHE CD1 HD1  sing N N 251 
PHE CD2 CE2  doub Y N 252 
PHE CD2 HD2  sing N N 253 
PHE CE1 CZ   doub Y N 254 
PHE CE1 HE1  sing N N 255 
PHE CE2 CZ   sing Y N 256 
PHE CE2 HE2  sing N N 257 
PHE CZ  HZ   sing N N 258 
PHE OXT HXT  sing N N 259 
PRO N   CA   sing N N 260 
PRO N   CD   sing N N 261 
PRO N   H    sing N N 262 
PRO CA  C    sing N N 263 
PRO CA  CB   sing N N 264 
PRO CA  HA   sing N N 265 
PRO C   O    doub N N 266 
PRO C   OXT  sing N N 267 
PRO CB  CG   sing N N 268 
PRO CB  HB2  sing N N 269 
PRO CB  HB3  sing N N 270 
PRO CG  CD   sing N N 271 
PRO CG  HG2  sing N N 272 
PRO CG  HG3  sing N N 273 
PRO CD  HD2  sing N N 274 
PRO CD  HD3  sing N N 275 
PRO OXT HXT  sing N N 276 
SER N   CA   sing N N 277 
SER N   H    sing N N 278 
SER N   H2   sing N N 279 
SER CA  C    sing N N 280 
SER CA  CB   sing N N 281 
SER CA  HA   sing N N 282 
SER C   O    doub N N 283 
SER C   OXT  sing N N 284 
SER CB  OG   sing N N 285 
SER CB  HB2  sing N N 286 
SER CB  HB3  sing N N 287 
SER OG  HG   sing N N 288 
SER OXT HXT  sing N N 289 
SO4 S   O1   doub N N 290 
SO4 S   O2   doub N N 291 
SO4 S   O3   sing N N 292 
SO4 S   O4   sing N N 293 
THR N   CA   sing N N 294 
THR N   H    sing N N 295 
THR N   H2   sing N N 296 
THR CA  C    sing N N 297 
THR CA  CB   sing N N 298 
THR CA  HA   sing N N 299 
THR C   O    doub N N 300 
THR C   OXT  sing N N 301 
THR CB  OG1  sing N N 302 
THR CB  CG2  sing N N 303 
THR CB  HB   sing N N 304 
THR OG1 HG1  sing N N 305 
THR CG2 HG21 sing N N 306 
THR CG2 HG22 sing N N 307 
THR CG2 HG23 sing N N 308 
THR OXT HXT  sing N N 309 
TRP N   CA   sing N N 310 
TRP N   H    sing N N 311 
TRP N   H2   sing N N 312 
TRP CA  C    sing N N 313 
TRP CA  CB   sing N N 314 
TRP CA  HA   sing N N 315 
TRP C   O    doub N N 316 
TRP C   OXT  sing N N 317 
TRP CB  CG   sing N N 318 
TRP CB  HB2  sing N N 319 
TRP CB  HB3  sing N N 320 
TRP CG  CD1  doub Y N 321 
TRP CG  CD2  sing Y N 322 
TRP CD1 NE1  sing Y N 323 
TRP CD1 HD1  sing N N 324 
TRP CD2 CE2  doub Y N 325 
TRP CD2 CE3  sing Y N 326 
TRP NE1 CE2  sing Y N 327 
TRP NE1 HE1  sing N N 328 
TRP CE2 CZ2  sing Y N 329 
TRP CE3 CZ3  doub Y N 330 
TRP CE3 HE3  sing N N 331 
TRP CZ2 CH2  doub Y N 332 
TRP CZ2 HZ2  sing N N 333 
TRP CZ3 CH2  sing Y N 334 
TRP CZ3 HZ3  sing N N 335 
TRP CH2 HH2  sing N N 336 
TRP OXT HXT  sing N N 337 
TYR N   CA   sing N N 338 
TYR N   H    sing N N 339 
TYR N   H2   sing N N 340 
TYR CA  C    sing N N 341 
TYR CA  CB   sing N N 342 
TYR CA  HA   sing N N 343 
TYR C   O    doub N N 344 
TYR C   OXT  sing N N 345 
TYR CB  CG   sing N N 346 
TYR CB  HB2  sing N N 347 
TYR CB  HB3  sing N N 348 
TYR CG  CD1  doub Y N 349 
TYR CG  CD2  sing Y N 350 
TYR CD1 CE1  sing Y N 351 
TYR CD1 HD1  sing N N 352 
TYR CD2 CE2  doub Y N 353 
TYR CD2 HD2  sing N N 354 
TYR CE1 CZ   doub Y N 355 
TYR CE1 HE1  sing N N 356 
TYR CE2 CZ   sing Y N 357 
TYR CE2 HE2  sing N N 358 
TYR CZ  OH   sing N N 359 
TYR OH  HH   sing N N 360 
TYR OXT HXT  sing N N 361 
VAL N   CA   sing N N 362 
VAL N   H    sing N N 363 
VAL N   H2   sing N N 364 
VAL CA  C    sing N N 365 
VAL CA  CB   sing N N 366 
VAL CA  HA   sing N N 367 
VAL C   O    doub N N 368 
VAL C   OXT  sing N N 369 
VAL CB  CG1  sing N N 370 
VAL CB  CG2  sing N N 371 
VAL CB  HB   sing N N 372 
VAL CG1 HG11 sing N N 373 
VAL CG1 HG12 sing N N 374 
VAL CG1 HG13 sing N N 375 
VAL CG2 HG21 sing N N 376 
VAL CG2 HG22 sing N N 377 
VAL CG2 HG23 sing N N 378 
VAL OXT HXT  sing N N 379 
# 
_atom_sites.entry_id                    3SHD 
_atom_sites.fract_transf_matrix[1][1]   0.008999 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008999 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004044 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A  1 1   ? -66.357 76.141  -1.232  1.00 59.69  ?  1   MET A N   1 
ATOM   2     C  CA  . MET A  1 1   ? -65.420 75.143  -1.848  1.00 59.43  ?  1   MET A CA  1 
ATOM   3     C  C   . MET A  1 1   ? -64.155 74.950  -1.006  1.00 58.06  ?  1   MET A C   1 
ATOM   4     O  O   . MET A  1 1   ? -63.311 75.854  -0.867  1.00 58.12  ?  1   MET A O   1 
ATOM   5     C  CB  . MET A  1 1   ? -65.083 75.503  -3.303  1.00 60.36  ?  1   MET A CB  1 
ATOM   6     C  CG  . MET A  1 1   ? -64.227 76.772  -3.514  1.00 62.72  ?  1   MET A CG  1 
ATOM   7     S  SD  . MET A  1 1   ? -62.708 76.324  -4.412  1.00 68.70  ?  1   MET A SD  1 
ATOM   8     C  CE  . MET A  1 1   ? -63.335 75.062  -5.546  1.00 66.40  ?  1   MET A CE  1 
ATOM   9     N  N   . PHE A  1 2   ? -64.053 73.753  -0.448  1.00 56.16  ?  2   PHE A N   1 
ATOM   10    C  CA  . PHE A  1 2   ? -63.071 73.438  0.564   1.00 54.22  ?  2   PHE A CA  1 
ATOM   11    C  C   . PHE A  1 2   ? -61.638 73.289  0.049   1.00 52.64  ?  2   PHE A C   1 
ATOM   12    O  O   . PHE A  1 2   ? -61.362 72.473  -0.816  1.00 52.63  ?  2   PHE A O   1 
ATOM   13    C  CB  . PHE A  1 2   ? -63.480 72.153  1.238   1.00 54.59  ?  2   PHE A CB  1 
ATOM   14    C  CG  . PHE A  1 2   ? -62.484 71.651  2.209   1.00 56.34  ?  2   PHE A CG  1 
ATOM   15    C  CD1 . PHE A  1 2   ? -62.723 71.750  3.564   1.00 57.27  ?  2   PHE A CD1 1 
ATOM   16    C  CD2 . PHE A  1 2   ? -61.292 71.081  1.773   1.00 58.08  ?  2   PHE A CD2 1 
ATOM   17    C  CE1 . PHE A  1 2   ? -61.800 71.268  4.472   1.00 59.20  ?  2   PHE A CE1 1 
ATOM   18    C  CE2 . PHE A  1 2   ? -60.358 70.606  2.670   1.00 58.06  ?  2   PHE A CE2 1 
ATOM   19    C  CZ  . PHE A  1 2   ? -60.609 70.693  4.017   1.00 58.90  ?  2   PHE A CZ  1 
ATOM   20    N  N   . LYS A  1 3   ? -60.737 74.092  0.598   1.00 50.00  ?  3   LYS A N   1 
ATOM   21    C  CA  . LYS A  1 3   ? -59.322 73.899  0.444   1.00 47.54  ?  3   LYS A CA  1 
ATOM   22    C  C   . LYS A  1 3   ? -58.807 73.594  1.863   1.00 45.94  ?  3   LYS A C   1 
ATOM   23    O  O   . LYS A  1 3   ? -59.345 74.143  2.829   1.00 45.91  ?  3   LYS A O   1 
ATOM   24    C  CB  . LYS A  1 3   ? -58.670 75.177  -0.077  1.00 47.43  ?  3   LYS A CB  1 
ATOM   25    C  CG  . LYS A  1 3   ? -59.374 75.862  -1.253  1.00 48.27  ?  3   LYS A CG  1 
ATOM   26    C  CD  . LYS A  1 3   ? -58.391 76.809  -1.953  1.00 48.12  ?  3   LYS A CD  1 
ATOM   27    C  CE  . LYS A  1 3   ? -59.002 77.739  -3.022  1.00 49.74  ?  3   LYS A CE  1 
ATOM   28    N  NZ  . LYS A  1 3   ? -57.919 78.189  -4.016  1.00 49.41  ?  3   LYS A NZ  1 
ATOM   29    N  N   . PRO A  1 4   ? -57.792 72.700  2.012   1.00 43.54  ?  4   PRO A N   1 
ATOM   30    C  CA  . PRO A  1 4   ? -57.244 72.521  3.353   1.00 41.26  ?  4   PRO A CA  1 
ATOM   31    C  C   . PRO A  1 4   ? -55.963 73.314  3.545   1.00 39.43  ?  4   PRO A C   1 
ATOM   32    O  O   . PRO A  1 4   ? -55.430 73.870  2.584   1.00 39.12  ?  4   PRO A O   1 
ATOM   33    C  CB  . PRO A  1 4   ? -56.963 71.018  3.422   1.00 41.06  ?  4   PRO A CB  1 
ATOM   34    C  CG  . PRO A  1 4   ? -56.909 70.551  2.001   1.00 42.17  ?  4   PRO A CG  1 
ATOM   35    C  CD  . PRO A  1 4   ? -57.284 71.676  1.085   1.00 42.98  ?  4   PRO A CD  1 
ATOM   36    N  N   . HIS A  1 5   ? -55.476 73.363  4.778   1.00 36.94  ?  5   HIS A N   1 
ATOM   37    C  CA  . HIS A  1 5   ? -54.212 73.992  5.054   1.00 35.27  ?  5   HIS A CA  1 
ATOM   38    C  C   . HIS A  1 5   ? -53.070 73.114  4.521   1.00 33.20  ?  5   HIS A C   1 
ATOM   39    O  O   . HIS A  1 5   ? -53.099 71.882  4.652   1.00 32.86  ?  5   HIS A O   1 
ATOM   40    C  CB  . HIS A  1 5   ? -54.064 74.182  6.564   1.00 36.16  ?  5   HIS A CB  1 
ATOM   41    C  CG  . HIS A  1 5   ? -54.904 75.292  7.130   1.00 38.79  ?  5   HIS A CG  1 
ATOM   42    N  ND1 . HIS A  1 5   ? -54.361 76.364  7.810   1.00 40.42  ?  5   HIS A ND1 1 
ATOM   43    C  CD2 . HIS A  1 5   ? -56.248 75.491  7.125   1.00 40.80  ?  5   HIS A CD2 1 
ATOM   44    C  CE1 . HIS A  1 5   ? -55.336 77.163  8.210   1.00 42.70  ?  5   HIS A CE1 1 
ATOM   45    N  NE2 . HIS A  1 5   ? -56.490 76.657  7.809   1.00 41.35  ?  5   HIS A NE2 1 
ATOM   46    N  N   . VAL A  1 6   ? -52.076 73.723  3.894   1.00 29.77  ?  6   VAL A N   1 
ATOM   47    C  CA  . VAL A  1 6   ? -50.991 72.929  3.414   1.00 26.73  ?  6   VAL A CA  1 
ATOM   48    C  C   . VAL A  1 6   ? -49.724 73.440  4.039   1.00 25.88  ?  6   VAL A C   1 
ATOM   49    O  O   . VAL A  1 6   ? -49.336 74.613  3.896   1.00 25.31  ?  6   VAL A O   1 
ATOM   50    C  CB  . VAL A  1 6   ? -50.887 72.881  1.869   1.00 26.79  ?  6   VAL A CB  1 
ATOM   51    C  CG1 . VAL A  1 6   ? -49.667 72.084  1.438   1.00 24.49  ?  6   VAL A CG1 1 
ATOM   52    C  CG2 . VAL A  1 6   ? -52.110 72.259  1.273   1.00 25.29  ?  6   VAL A CG2 1 
ATOM   53    N  N   . THR A  1 7   ? -49.060 72.529  4.721   1.00 24.27  ?  7   THR A N   1 
ATOM   54    C  CA  . THR A  1 7   ? -47.851 72.870  5.435   1.00 23.04  ?  7   THR A CA  1 
ATOM   55    C  C   . THR A  1 7   ? -46.749 71.890  5.062   1.00 22.04  ?  7   THR A C   1 
ATOM   56    O  O   . THR A  1 7   ? -47.025 70.805  4.561   1.00 22.48  ?  7   THR A O   1 
ATOM   57    C  CB  . THR A  1 7   ? -48.114 72.871  6.953   1.00 22.91  ?  7   THR A CB  1 
ATOM   58    O  OG1 . THR A  1 7   ? -48.454 71.543  7.401   1.00 21.67  ?  7   THR A OG1 1 
ATOM   59    C  CG2 . THR A  1 7   ? -49.257 73.808  7.250   1.00 21.99  ?  7   THR A CG2 1 
ATOM   60    N  N   . VAL A  1 8   ? -45.508 72.285  5.293   1.00 21.15  ?  8   VAL A N   1 
ATOM   61    C  CA  . VAL A  1 8   ? -44.369 71.444  4.994   1.00 20.07  ?  8   VAL A CA  1 
ATOM   62    C  C   . VAL A  1 8   ? -43.549 71.373  6.261   1.00 20.38  ?  8   VAL A C   1 
ATOM   63    O  O   . VAL A  1 8   ? -43.652 72.251  7.115   1.00 19.56  ?  8   VAL A O   1 
ATOM   64    C  CB  . VAL A  1 8   ? -43.536 72.009  3.822   1.00 20.41  ?  8   VAL A CB  1 
ATOM   65    C  CG1 . VAL A  1 8   ? -44.351 71.990  2.524   1.00 18.37  ?  8   VAL A CG1 1 
ATOM   66    C  CG2 . VAL A  1 8   ? -43.064 73.401  4.124   1.00 20.02  ?  8   VAL A CG2 1 
ATOM   67    N  N   . ALA A  1 9   ? -42.771 70.306  6.417   1.00 21.07  ?  9   ALA A N   1 
ATOM   68    C  CA  . ALA A  1 9   ? -41.988 70.075  7.651   1.00 21.19  ?  9   ALA A CA  1 
ATOM   69    C  C   . ALA A  1 9   ? -40.701 69.315  7.334   1.00 21.77  ?  9   ALA A C   1 
ATOM   70    O  O   . ALA A  1 9   ? -40.668 68.496  6.392   1.00 22.46  ?  9   ALA A O   1 
ATOM   71    C  CB  . ALA A  1 9   ? -42.806 69.297  8.618   1.00 20.97  ?  9   ALA A CB  1 
ATOM   72    N  N   . CYS A  1 10  ? -39.645 69.565  8.091   1.00 21.54  ?  10  CYS A N   1 
ATOM   73    C  CA  . CYS A  1 10  ? -38.409 68.854  7.828   1.00 22.35  ?  10  CYS A CA  1 
ATOM   74    C  C   . CYS A  1 10  ? -37.841 68.279  9.074   1.00 22.03  ?  10  CYS A C   1 
ATOM   75    O  O   . CYS A  1 10  ? -37.763 68.949  10.124  1.00 22.44  ?  10  CYS A O   1 
ATOM   76    C  CB  . CYS A  1 10  ? -37.352 69.755  7.220   1.00 22.77  ?  10  CYS A CB  1 
ATOM   77    S  SG  . CYS A  1 10  ? -37.944 70.530  5.761   1.00 27.66  ?  10  CYS A SG  1 
ATOM   78    N  N   . VAL A  1 11  ? -37.440 67.021  8.918   1.00 21.11  ?  11  VAL A N   1 
ATOM   79    C  CA  . VAL A  1 11  ? -36.679 66.259  9.886   1.00 19.68  ?  11  VAL A CA  1 
ATOM   80    C  C   . VAL A  1 11  ? -35.216 66.584  9.590   1.00 18.70  ?  11  VAL A C   1 
ATOM   81    O  O   . VAL A  1 11  ? -34.687 66.230  8.559   1.00 18.70  ?  11  VAL A O   1 
ATOM   82    C  CB  . VAL A  1 11  ? -37.008 64.754  9.703   1.00 19.30  ?  11  VAL A CB  1 
ATOM   83    C  CG1 . VAL A  1 11  ? -36.218 63.883  10.648  1.00 19.91  ?  11  VAL A CG1 1 
ATOM   84    C  CG2 . VAL A  1 11  ? -38.476 64.536  9.922   1.00 18.06  ?  11  VAL A CG2 1 
ATOM   85    N  N   . VAL A  1 12  ? -34.556 67.298  10.464  1.00 17.88  ?  12  VAL A N   1 
ATOM   86    C  CA  . VAL A  1 12  ? -33.180 67.605  10.156  1.00 17.58  ?  12  VAL A CA  1 
ATOM   87    C  C   . VAL A  1 12  ? -32.333 66.862  11.130  1.00 17.27  ?  12  VAL A C   1 
ATOM   88    O  O   . VAL A  1 12  ? -32.550 66.989  12.322  1.00 17.83  ?  12  VAL A O   1 
ATOM   89    C  CB  . VAL A  1 12  ? -32.962 69.096  10.286  1.00 17.76  ?  12  VAL A CB  1 
ATOM   90    C  CG1 . VAL A  1 12  ? -31.525 69.440  10.040  1.00 18.47  ?  12  VAL A CG1 1 
ATOM   91    C  CG2 . VAL A  1 12  ? -33.880 69.834  9.318   1.00 17.58  ?  12  VAL A CG2 1 
ATOM   92    N  N   . HIS A  1 13  ? -31.367 66.091  10.648  1.00 17.44  ?  13  HIS A N   1 
ATOM   93    C  CA  . HIS A  1 13  ? -30.668 65.038  11.463  1.00 17.15  ?  13  HIS A CA  1 
ATOM   94    C  C   . HIS A  1 13  ? -29.162 65.151  11.316  1.00 17.02  ?  13  HIS A C   1 
ATOM   95    O  O   . HIS A  1 13  ? -28.671 65.375  10.245  1.00 16.84  ?  13  HIS A O   1 
ATOM   96    C  CB  . HIS A  1 13  ? -31.141 63.651  11.039  1.00 17.04  ?  13  HIS A CB  1 
ATOM   97    C  CG  . HIS A  1 13  ? -30.374 62.511  11.645  1.00 19.95  ?  13  HIS A CG  1 
ATOM   98    N  ND1 . HIS A  1 13  ? -30.590 62.060  12.933  1.00 21.69  ?  13  HIS A ND1 1 
ATOM   99    C  CD2 . HIS A  1 13  ? -29.436 61.695  11.118  1.00 19.35  ?  13  HIS A CD2 1 
ATOM   100   C  CE1 . HIS A  1 13  ? -29.787 61.051  13.191  1.00 19.74  ?  13  HIS A CE1 1 
ATOM   101   N  NE2 . HIS A  1 13  ? -29.074 60.813  12.105  1.00 23.30  ?  13  HIS A NE2 1 
ATOM   102   N  N   . ALA A  1 14  ? -28.443 65.029  12.418  1.00 17.69  ?  14  ALA A N   1 
ATOM   103   C  CA  . ALA A  1 14  ? -27.038 65.385  12.482  1.00 18.50  ?  14  ALA A CA  1 
ATOM   104   C  C   . ALA A  1 14  ? -26.458 64.939  13.821  1.00 19.18  ?  14  ALA A C   1 
ATOM   105   O  O   . ALA A  1 14  ? -27.007 65.222  14.894  1.00 19.68  ?  14  ALA A O   1 
ATOM   106   C  CB  . ALA A  1 14  ? -26.863 66.878  12.313  1.00 17.68  ?  14  ALA A CB  1 
ATOM   107   N  N   . GLU A  1 15  ? -25.359 64.208  13.749  1.00 20.61  ?  15  GLU A N   1 
ATOM   108   C  CA  . GLU A  1 15  ? -24.688 63.705  14.942  1.00 22.66  ?  15  GLU A CA  1 
ATOM   109   C  C   . GLU A  1 15  ? -25.660 63.031  15.913  1.00 22.70  ?  15  GLU A C   1 
ATOM   110   O  O   . GLU A  1 15  ? -25.562 63.224  17.119  1.00 23.84  ?  15  GLU A O   1 
ATOM   111   C  CB  . GLU A  1 15  ? -23.931 64.833  15.651  1.00 23.10  ?  15  GLU A CB  1 
ATOM   112   C  CG  . GLU A  1 15  ? -23.005 65.636  14.713  1.00 26.47  ?  15  GLU A CG  1 
ATOM   113   C  CD  . GLU A  1 15  ? -22.078 66.592  15.452  1.00 29.67  ?  15  GLU A CD  1 
ATOM   114   O  OE1 . GLU A  1 15  ? -21.442 66.158  16.443  1.00 28.25  ?  15  GLU A OE1 1 
ATOM   115   O  OE2 . GLU A  1 15  ? -21.985 67.781  15.017  1.00 34.87  -1 15  GLU A OE2 1 
ATOM   116   N  N   . GLY A  1 16  ? -26.569 62.214  15.386  1.00 22.46  ?  16  GLY A N   1 
ATOM   117   C  CA  . GLY A  1 16  ? -27.492 61.454  16.217  1.00 22.85  ?  16  GLY A CA  1 
ATOM   118   C  C   . GLY A  1 16  ? -28.574 62.292  16.888  1.00 23.75  ?  16  GLY A C   1 
ATOM   119   O  O   . GLY A  1 16  ? -29.148 61.865  17.891  1.00 24.26  ?  16  GLY A O   1 
ATOM   120   N  N   . LYS A  1 17  ? -28.836 63.494  16.375  1.00 23.72  ?  17  LYS A N   1 
ATOM   121   C  CA  . LYS A  1 17  ? -29.859 64.338  16.962  1.00 23.75  ?  17  LYS A CA  1 
ATOM   122   C  C   . LYS A  1 17  ? -30.728 64.985  15.910  1.00 22.82  ?  17  LYS A C   1 
ATOM   123   O  O   . LYS A  1 17  ? -30.370 65.066  14.745  1.00 22.89  ?  17  LYS A O   1 
ATOM   124   C  CB  . LYS A  1 17  ? -29.247 65.406  17.883  1.00 25.33  ?  17  LYS A CB  1 
ATOM   125   C  CG  . LYS A  1 17  ? -27.835 65.061  18.429  1.00 28.27  ?  17  LYS A CG  1 
ATOM   126   C  CD  . LYS A  1 17  ? -27.729 65.179  19.967  1.00 32.06  ?  17  LYS A CD  1 
ATOM   127   C  CE  . LYS A  1 17  ? -28.400 63.987  20.645  1.00 34.95  ?  17  LYS A CE  1 
ATOM   128   N  NZ  . LYS A  1 17  ? -28.154 64.010  22.115  1.00 37.47  ?  17  LYS A NZ  1 
ATOM   129   N  N   . PHE A  1 18  ? -31.892 65.433  16.337  1.00 21.60  ?  18  PHE A N   1 
ATOM   130   C  CA  . PHE A  1 18  ? -32.823 66.063  15.447  1.00 21.14  ?  18  PHE A CA  1 
ATOM   131   C  C   . PHE A  1 18  ? -33.027 67.483  15.894  1.00 20.41  ?  18  PHE A C   1 
ATOM   132   O  O   . PHE A  1 18  ? -32.915 67.778  17.088  1.00 20.73  ?  18  PHE A O   1 
ATOM   133   C  CB  . PHE A  1 18  ? -34.153 65.302  15.428  1.00 21.17  ?  18  PHE A CB  1 
ATOM   134   C  CG  . PHE A  1 18  ? -34.007 63.903  15.013  1.00 20.50  ?  18  PHE A CG  1 
ATOM   135   C  CD1 . PHE A  1 18  ? -34.339 63.523  13.722  1.00 20.25  ?  18  PHE A CD1 1 
ATOM   136   C  CD2 . PHE A  1 18  ? -33.458 62.959  15.891  1.00 19.19  ?  18  PHE A CD2 1 
ATOM   137   C  CE1 . PHE A  1 18  ? -34.162 62.193  13.317  1.00 21.34  ?  18  PHE A CE1 1 
ATOM   138   C  CE2 . PHE A  1 18  ? -33.267 61.648  15.500  1.00 18.77  ?  18  PHE A CE2 1 
ATOM   139   C  CZ  . PHE A  1 18  ? -33.625 61.249  14.218  1.00 18.84  ?  18  PHE A CZ  1 
ATOM   140   N  N   . LEU A  1 19  ? -33.298 68.350  14.923  1.00 19.75  ?  19  LEU A N   1 
ATOM   141   C  CA  . LEU A  1 19  ? -33.482 69.769  15.156  1.00 19.28  ?  19  LEU A CA  1 
ATOM   142   C  C   . LEU A  1 19  ? -34.929 70.063  15.461  1.00 19.92  ?  19  LEU A C   1 
ATOM   143   O  O   . LEU A  1 19  ? -35.841 69.650  14.755  1.00 21.07  ?  19  LEU A O   1 
ATOM   144   C  CB  . LEU A  1 19  ? -33.051 70.602  13.958  1.00 18.52  ?  19  LEU A CB  1 
ATOM   145   C  CG  . LEU A  1 19  ? -33.136 72.140  14.074  1.00 16.48  ?  19  LEU A CG  1 
ATOM   146   C  CD1 . LEU A  1 19  ? -32.140 72.751  15.077  1.00 13.10  ?  19  LEU A CD1 1 
ATOM   147   C  CD2 . LEU A  1 19  ? -32.958 72.776  12.744  1.00 13.59  ?  19  LEU A CD2 1 
ATOM   148   N  N   . VAL A  1 20  ? -35.132 70.843  16.499  1.00 19.75  ?  20  VAL A N   1 
ATOM   149   C  CA  . VAL A  1 20  ? -36.445 71.104  16.933  1.00 19.73  ?  20  VAL A CA  1 
ATOM   150   C  C   . VAL A  1 20  ? -36.554 72.625  17.158  1.00 19.77  ?  20  VAL A C   1 
ATOM   151   O  O   . VAL A  1 20  ? -35.562 73.270  17.529  1.00 20.47  ?  20  VAL A O   1 
ATOM   152   C  CB  . VAL A  1 20  ? -36.591 70.174  18.158  1.00 21.18  ?  20  VAL A CB  1 
ATOM   153   C  CG1 . VAL A  1 20  ? -36.806 70.921  19.515  1.00 18.79  ?  20  VAL A CG1 1 
ATOM   154   C  CG2 . VAL A  1 20  ? -37.538 68.973  17.828  1.00 20.36  ?  20  VAL A CG2 1 
ATOM   155   N  N   . VAL A  1 21  ? -37.694 73.225  16.856  1.00 18.91  ?  21  VAL A N   1 
ATOM   156   C  CA  . VAL A  1 21  ? -37.913 74.631  17.192  1.00 19.44  ?  21  VAL A CA  1 
ATOM   157   C  C   . VAL A  1 21  ? -38.895 74.802  18.370  1.00 20.80  ?  21  VAL A C   1 
ATOM   158   O  O   . VAL A  1 21  ? -39.972 74.173  18.414  1.00 19.78  ?  21  VAL A O   1 
ATOM   159   C  CB  . VAL A  1 21  ? -38.465 75.465  16.017  1.00 19.52  ?  21  VAL A CB  1 
ATOM   160   C  CG1 . VAL A  1 21  ? -37.442 75.604  14.892  1.00 21.67  ?  21  VAL A CG1 1 
ATOM   161   C  CG2 . VAL A  1 21  ? -39.755 74.892  15.486  1.00 18.70  ?  21  VAL A CG2 1 
ATOM   162   N  N   . GLU A  1 22  ? -38.501 75.667  19.312  1.00 21.94  ?  22  GLU A N   1 
ATOM   163   C  CA  . GLU A  1 22  ? -39.290 76.058  20.482  1.00 23.45  ?  22  GLU A CA  1 
ATOM   164   C  C   . GLU A  1 22  ? -40.202 77.290  20.214  1.00 24.02  ?  22  GLU A C   1 
ATOM   165   O  O   . GLU A  1 22  ? -39.726 78.375  19.941  1.00 24.49  ?  22  GLU A O   1 
ATOM   166   C  CB  . GLU A  1 22  ? -38.302 76.359  21.590  1.00 23.24  ?  22  GLU A CB  1 
ATOM   167   C  CG  . GLU A  1 22  ? -38.869 76.469  22.940  1.00 26.66  ?  22  GLU A CG  1 
ATOM   168   C  CD  . GLU A  1 22  ? -37.917 76.003  24.030  1.00 30.77  ?  22  GLU A CD  1 
ATOM   169   O  OE1 . GLU A  1 22  ? -37.528 76.862  24.856  1.00 32.26  ?  22  GLU A OE1 1 
ATOM   170   O  OE2 . GLU A  1 22  ? -37.576 74.789  24.070  1.00 31.78  -1 22  GLU A OE2 1 
ATOM   171   N  N   . GLU A  1 23  ? -41.510 77.120  20.271  1.00 24.60  ?  23  GLU A N   1 
ATOM   172   C  CA  . GLU A  1 23  ? -42.433 78.250  20.060  1.00 25.59  ?  23  GLU A CA  1 
ATOM   173   C  C   . GLU A  1 23  ? -43.279 78.355  21.306  1.00 26.10  ?  23  GLU A C   1 
ATOM   174   O  O   . GLU A  1 23  ? -43.867 77.336  21.742  1.00 25.92  ?  23  GLU A O   1 
ATOM   175   C  CB  . GLU A  1 23  ? -43.411 77.988  18.908  1.00 25.30  ?  23  GLU A CB  1 
ATOM   176   C  CG  . GLU A  1 23  ? -42.978 78.357  17.500  1.00 27.02  ?  23  GLU A CG  1 
ATOM   177   C  CD  . GLU A  1 23  ? -43.659 77.486  16.436  1.00 29.31  ?  23  GLU A CD  1 
ATOM   178   O  OE1 . GLU A  1 23  ? -43.300 76.277  16.308  1.00 27.76  ?  23  GLU A OE1 1 
ATOM   179   O  OE2 . GLU A  1 23  ? -44.545 78.024  15.724  1.00 30.05  -1 23  GLU A OE2 1 
ATOM   180   N  N   . THR A  1 24  ? -43.371 79.553  21.875  1.00 26.17  ?  24  THR A N   1 
ATOM   181   C  CA  . THR A  1 24  ? -44.278 79.739  22.999  1.00 26.48  ?  24  THR A CA  1 
ATOM   182   C  C   . THR A  1 24  ? -45.694 79.809  22.519  1.00 26.45  ?  24  THR A C   1 
ATOM   183   O  O   . THR A  1 24  ? -46.078 80.764  21.877  1.00 26.10  ?  24  THR A O   1 
ATOM   184   C  CB  . THR A  1 24  ? -43.946 80.978  23.802  1.00 26.85  ?  24  THR A CB  1 
ATOM   185   O  OG1 . THR A  1 24  ? -42.609 80.836  24.286  1.00 29.54  ?  24  THR A OG1 1 
ATOM   186   C  CG2 . THR A  1 24  ? -44.900 81.127  24.989  1.00 24.27  ?  24  THR A CG2 1 
ATOM   187   N  N   . ILE A  1 25  ? -46.480 78.787  22.804  1.00 27.04  ?  25  ILE A N   1 
ATOM   188   C  CA  . ILE A  1 25  ? -47.865 78.904  22.415  1.00 28.61  ?  25  ILE A CA  1 
ATOM   189   C  C   . ILE A  1 25  ? -48.850 78.986  23.595  1.00 28.96  ?  25  ILE A C   1 
ATOM   190   O  O   . ILE A  1 25  ? -48.879 78.134  24.455  1.00 29.31  ?  25  ILE A O   1 
ATOM   191   C  CB  . ILE A  1 25  ? -48.276 77.946  21.224  1.00 29.19  ?  25  ILE A CB  1 
ATOM   192   C  CG1 . ILE A  1 25  ? -49.417 77.009  21.585  1.00 29.08  ?  25  ILE A CG1 1 
ATOM   193   C  CG2 . ILE A  1 25  ? -47.072 77.300  20.494  1.00 29.11  ?  25  ILE A CG2 1 
ATOM   194   C  CD1 . ILE A  1 25  ? -50.689 77.415  20.891  1.00 30.06  ?  25  ILE A CD1 1 
ATOM   195   N  N   . ASN A  1 26  ? -49.690 80.010  23.569  1.00 29.68  ?  26  ASN A N   1 
ATOM   196   C  CA  . ASN A  1 26  ? -50.221 80.631  24.789  1.00 30.31  ?  26  ASN A CA  1 
ATOM   197   C  C   . ASN A  1 26  ? -49.663 80.185  26.119  1.00 29.98  ?  26  ASN A C   1 
ATOM   198   O  O   . ASN A  1 26  ? -50.170 79.266  26.740  1.00 30.60  ?  26  ASN A O   1 
ATOM   199   C  CB  . ASN A  1 26  ? -51.755 80.851  24.836  1.00 30.68  ?  26  ASN A CB  1 
ATOM   200   C  CG  . ASN A  1 26  ? -52.521 79.981  23.894  1.00 29.99  ?  26  ASN A CG  1 
ATOM   201   O  OD1 . ASN A  1 26  ? -53.076 80.467  22.925  1.00 26.87  ?  26  ASN A OD1 1 
ATOM   202   N  ND2 . ASN A  1 26  ? -52.610 78.693  24.204  1.00 31.29  ?  26  ASN A ND2 1 
ATOM   203   N  N   . GLY A  1 27  ? -48.577 80.825  26.511  1.00 29.39  ?  27  GLY A N   1 
ATOM   204   C  CA  . GLY A  1 27  ? -48.010 80.628  27.800  1.00 28.60  ?  27  GLY A CA  1 
ATOM   205   C  C   . GLY A  1 27  ? -46.864 79.666  27.845  1.00 29.06  ?  27  GLY A C   1 
ATOM   206   O  O   . GLY A  1 27  ? -45.887 79.945  28.531  1.00 29.60  ?  27  GLY A O   1 
ATOM   207   N  N   . LYS A  1 28  ? -46.972 78.539  27.129  1.00 28.67  ?  28  LYS A N   1 
ATOM   208   C  CA  . LYS A  1 28  ? -46.004 77.427  27.260  1.00 27.88  ?  28  LYS A CA  1 
ATOM   209   C  C   . LYS A  1 28  ? -45.132 77.277  26.036  1.00 27.51  ?  28  LYS A C   1 
ATOM   210   O  O   . LYS A  1 28  ? -45.573 77.594  24.946  1.00 27.32  ?  28  LYS A O   1 
ATOM   211   C  CB  . LYS A  1 28  ? -46.723 76.078  27.473  1.00 27.39  ?  28  LYS A CB  1 
ATOM   212   C  CG  . LYS A  1 28  ? -45.887 75.109  28.293  1.00 26.73  ?  28  LYS A CG  1 
ATOM   213   C  CD  . LYS A  1 28  ? -45.871 73.708  27.783  1.00 23.24  ?  28  LYS A CD  1 
ATOM   214   C  CE  . LYS A  1 28  ? -46.932 72.842  28.368  1.00 22.71  ?  28  LYS A CE  1 
ATOM   215   N  NZ  . LYS A  1 28  ? -46.389 71.469  28.612  1.00 23.74  ?  28  LYS A NZ  1 
ATOM   216   N  N   . ALA A  1 29  ? -43.930 76.733  26.224  1.00 27.14  ?  29  ALA A N   1 
ATOM   217   C  CA  . ALA A  1 29  ? -43.000 76.492  25.133  1.00 27.55  ?  29  ALA A CA  1 
ATOM   218   C  C   . ALA A  1 29  ? -43.114 75.066  24.546  1.00 28.20  ?  29  ALA A C   1 
ATOM   219   O  O   . ALA A  1 29  ? -42.853 74.059  25.219  1.00 28.99  ?  29  ALA A O   1 
ATOM   220   C  CB  . ALA A  1 29  ? -41.602 76.740  25.605  1.00 27.41  ?  29  ALA A CB  1 
ATOM   221   N  N   . LEU A  1 30  ? -43.485 74.990  23.280  1.00 27.78  ?  30  LEU A N   1 
ATOM   222   C  CA  . LEU A  1 30  ? -43.733 73.730  22.593  1.00 26.82  ?  30  LEU A CA  1 
ATOM   223   C  C   . LEU A  1 30  ? -42.662 73.407  21.549  1.00 26.84  ?  30  LEU A C   1 
ATOM   224   O  O   . LEU A  1 30  ? -42.046 74.316  20.966  1.00 28.00  ?  30  LEU A O   1 
ATOM   225   C  CB  . LEU A  1 30  ? -45.102 73.847  21.926  1.00 26.80  ?  30  LEU A CB  1 
ATOM   226   C  CG  . LEU A  1 30  ? -46.337 73.406  22.743  1.00 26.29  ?  30  LEU A CG  1 
ATOM   227   C  CD1 . LEU A  1 30  ? -46.143 73.378  24.242  1.00 26.36  ?  30  LEU A CD1 1 
ATOM   228   C  CD2 . LEU A  1 30  ? -47.549 74.173  22.399  1.00 21.99  ?  30  LEU A CD2 1 
ATOM   229   N  N   . TRP A  1 31  ? -42.436 72.125  21.290  1.00 26.19  ?  31  TRP A N   1 
ATOM   230   C  CA  . TRP A  1 31  ? -41.474 71.702  20.259  1.00 25.28  ?  31  TRP A CA  1 
ATOM   231   C  C   . TRP A  1 31  ? -42.108 71.310  18.935  1.00 25.43  ?  31  TRP A C   1 
ATOM   232   O  O   . TRP A  1 31  ? -43.196 70.720  18.896  1.00 25.32  ?  31  TRP A O   1 
ATOM   233   C  CB  . TRP A  1 31  ? -40.650 70.529  20.741  1.00 25.83  ?  31  TRP A CB  1 
ATOM   234   C  CG  . TRP A  1 31  ? -39.622 70.879  21.766  1.00 24.29  ?  31  TRP A CG  1 
ATOM   235   C  CD1 . TRP A  1 31  ? -39.302 72.108  22.212  1.00 23.76  ?  31  TRP A CD1 1 
ATOM   236   C  CD2 . TRP A  1 31  ? -38.773 69.962  22.452  1.00 24.92  ?  31  TRP A CD2 1 
ATOM   237   N  NE1 . TRP A  1 31  ? -38.301 72.032  23.149  1.00 24.93  ?  31  TRP A NE1 1 
ATOM   238   C  CE2 . TRP A  1 31  ? -37.955 70.718  23.314  1.00 25.23  ?  31  TRP A CE2 1 
ATOM   239   C  CE3 . TRP A  1 31  ? -38.622 68.573  22.422  1.00 23.90  ?  31  TRP A CE3 1 
ATOM   240   C  CZ2 . TRP A  1 31  ? -36.992 70.128  24.151  1.00 23.65  ?  31  TRP A CZ2 1 
ATOM   241   C  CZ3 . TRP A  1 31  ? -37.659 67.993  23.244  1.00 24.01  ?  31  TRP A CZ3 1 
ATOM   242   C  CH2 . TRP A  1 31  ? -36.865 68.775  24.099  1.00 23.40  ?  31  TRP A CH2 1 
ATOM   243   N  N   . ASN A  1 32  ? -41.430 71.653  17.839  1.00 25.05  ?  32  ASN A N   1 
ATOM   244   C  CA  . ASN A  1 32  ? -41.935 71.323  16.503  1.00 24.52  ?  32  ASN A CA  1 
ATOM   245   C  C   . ASN A  1 32  ? -40.792 71.095  15.578  1.00 23.82  ?  32  ASN A C   1 
ATOM   246   O  O   . ASN A  1 32  ? -39.701 71.522  15.872  1.00 25.07  ?  32  ASN A O   1 
ATOM   247   C  CB  . ASN A  1 32  ? -42.843 72.419  15.930  1.00 24.55  ?  32  ASN A CB  1 
ATOM   248   C  CG  . ASN A  1 32  ? -43.588 71.957  14.691  1.00 24.61  ?  32  ASN A CG  1 
ATOM   249   O  OD1 . ASN A  1 32  ? -43.703 70.761  14.422  1.00 25.50  ?  32  ASN A OD1 1 
ATOM   250   N  ND2 . ASN A  1 32  ? -44.094 72.892  13.935  1.00 24.83  ?  32  ASN A ND2 1 
ATOM   251   N  N   . GLN A  1 33  ? -41.015 70.375  14.492  1.00 22.42  ?  33  GLN A N   1 
ATOM   252   C  CA  . GLN A  1 33  ? -40.078 70.428  13.379  1.00 21.54  ?  33  GLN A CA  1 
ATOM   253   C  C   . GLN A  1 33  ? -40.062 71.861  12.882  1.00 20.62  ?  33  GLN A C   1 
ATOM   254   O  O   . GLN A  1 33  ? -41.056 72.575  13.060  1.00 21.17  ?  33  GLN A O   1 
ATOM   255   C  CB  . GLN A  1 33  ? -40.575 69.549  12.226  1.00 21.01  ?  33  GLN A CB  1 
ATOM   256   C  CG  . GLN A  1 33  ? -39.997 68.178  12.202  1.00 22.19  ?  33  GLN A CG  1 
ATOM   257   C  CD  . GLN A  1 33  ? -40.679 67.213  13.176  1.00 21.36  ?  33  GLN A CD  1 
ATOM   258   O  OE1 . GLN A  1 33  ? -41.898 67.102  13.202  1.00 19.83  ?  33  GLN A OE1 1 
ATOM   259   N  NE2 . GLN A  1 33  ? -39.871 66.497  13.966  1.00 20.49  ?  33  GLN A NE2 1 
ATOM   260   N  N   . PRO A  1 34  ? -38.969 72.283  12.225  1.00 19.89  ?  34  PRO A N   1 
ATOM   261   C  CA  . PRO A  1 34  ? -39.050 73.508  11.408  1.00 19.82  ?  34  PRO A CA  1 
ATOM   262   C  C   . PRO A  1 34  ? -40.089 73.240  10.358  1.00 19.94  ?  34  PRO A C   1 
ATOM   263   O  O   . PRO A  1 34  ? -39.953 72.270  9.624   1.00 19.84  ?  34  PRO A O   1 
ATOM   264   C  CB  . PRO A  1 34  ? -37.670 73.613  10.786  1.00 18.60  ?  34  PRO A CB  1 
ATOM   265   C  CG  . PRO A  1 34  ? -36.789 72.887  11.823  1.00 20.41  ?  34  PRO A CG  1 
ATOM   266   C  CD  . PRO A  1 34  ? -37.614 71.726  12.257  1.00 19.17  ?  34  PRO A CD  1 
ATOM   267   N  N   . ALA A  1 35  ? -41.143 74.055  10.332  1.00 20.35  ?  35  ALA A N   1 
ATOM   268   C  CA  . ALA A  1 35  ? -42.372 73.697  9.618   1.00 20.72  ?  35  ALA A CA  1 
ATOM   269   C  C   . ALA A  1 35  ? -43.281 74.888  9.463   1.00 21.19  ?  35  ALA A C   1 
ATOM   270   O  O   . ALA A  1 35  ? -43.274 75.758  10.285  1.00 21.27  ?  35  ALA A O   1 
ATOM   271   C  CB  . ALA A  1 35  ? -43.102 72.580  10.332  1.00 20.14  ?  35  ALA A CB  1 
ATOM   272   N  N   . GLY A  1 36  ? -44.052 74.926  8.392   1.00 21.96  ?  36  GLY A N   1 
ATOM   273   C  CA  . GLY A  1 36  ? -45.008 75.980  8.184   1.00 23.41  ?  36  GLY A CA  1 
ATOM   274   C  C   . GLY A  1 36  ? -45.916 75.825  6.960   1.00 24.79  ?  36  GLY A C   1 
ATOM   275   O  O   . GLY A  1 36  ? -46.035 74.724  6.359   1.00 24.23  ?  36  GLY A O   1 
ATOM   276   N  N   . HIS A  1 37  ? -46.545 76.945  6.582   1.00 24.81  ?  37  HIS A N   1 
ATOM   277   C  CA  . HIS A  1 37  ? -47.591 76.903  5.591   1.00 24.96  ?  37  HIS A CA  1 
ATOM   278   C  C   . HIS A  1 37  ? -47.000 77.124  4.214   1.00 26.13  ?  37  HIS A C   1 
ATOM   279   O  O   . HIS A  1 37  ? -46.018 77.849  4.080   1.00 25.85  ?  37  HIS A O   1 
ATOM   280   C  CB  . HIS A  1 37  ? -48.679 77.935  5.901   1.00 24.20  ?  37  HIS A CB  1 
ATOM   281   C  CG  . HIS A  1 37  ? -49.676 77.477  6.912   1.00 22.09  ?  37  HIS A CG  1 
ATOM   282   N  ND1 . HIS A  1 37  ? -49.470 77.595  8.274   1.00 21.78  ?  37  HIS A ND1 1 
ATOM   283   C  CD2 . HIS A  1 37  ? -50.886 76.892  6.763   1.00 22.12  ?  37  HIS A CD2 1 
ATOM   284   C  CE1 . HIS A  1 37  ? -50.512 77.101  8.918   1.00 22.47  ?  37  HIS A CE1 1 
ATOM   285   N  NE2 . HIS A  1 37  ? -51.384 76.663  8.026   1.00 22.25  ?  37  HIS A NE2 1 
ATOM   286   N  N   . LEU A  1 38  ? -47.579 76.481  3.196   1.00 27.56  ?  38  LEU A N   1 
ATOM   287   C  CA  . LEU A  1 38  ? -47.199 76.776  1.831   1.00 29.65  ?  38  LEU A CA  1 
ATOM   288   C  C   . LEU A  1 38  ? -47.806 78.122  1.406   1.00 32.12  ?  38  LEU A C   1 
ATOM   289   O  O   . LEU A  1 38  ? -48.988 78.422  1.704   1.00 32.18  ?  38  LEU A O   1 
ATOM   290   C  CB  . LEU A  1 38  ? -47.659 75.659  0.902   1.00 29.15  ?  38  LEU A CB  1 
ATOM   291   C  CG  . LEU A  1 38  ? -47.518 75.830  -0.616  1.00 27.85  ?  38  LEU A CG  1 
ATOM   292   C  CD1 . LEU A  1 38  ? -46.059 76.073  -1.049  1.00 26.73  ?  38  LEU A CD1 1 
ATOM   293   C  CD2 . LEU A  1 38  ? -48.090 74.606  -1.337  1.00 26.87  ?  38  LEU A CD2 1 
ATOM   294   N  N   . GLU A  1 39  ? -46.991 78.924  0.722   1.00 34.46  ?  39  GLU A N   1 
ATOM   295   C  CA  . GLU A  1 39  ? -47.426 80.224  0.191   1.00 37.37  ?  39  GLU A CA  1 
ATOM   296   C  C   . GLU A  1 39  ? -47.556 80.290  -1.340  1.00 37.59  ?  39  GLU A C   1 
ATOM   297   O  O   . GLU A  1 39  ? -47.105 79.382  -2.059  1.00 38.40  ?  39  GLU A O   1 
ATOM   298   C  CB  . GLU A  1 39  ? -46.528 81.344  0.721   1.00 37.83  ?  39  GLU A CB  1 
ATOM   299   C  CG  . GLU A  1 39  ? -46.992 81.901  2.098   1.00 42.83  ?  39  GLU A CG  1 
ATOM   300   C  CD  . GLU A  1 39  ? -45.796 82.407  2.930   1.00 49.92  ?  39  GLU A CD  1 
ATOM   301   O  OE1 . GLU A  1 39  ? -44.924 83.128  2.347   1.00 50.33  ?  39  GLU A OE1 1 
ATOM   302   O  OE2 . GLU A  1 39  ? -45.711 82.059  4.150   1.00 52.73  -1 39  GLU A OE2 1 
ATOM   303   N  N   . ALA A  1 40  ? -48.203 81.355  -1.826  1.00 38.13  ?  40  ALA A N   1 
ATOM   304   C  CA  . ALA A  1 40  ? -48.519 81.523  -3.265  1.00 37.92  ?  40  ALA A CA  1 
ATOM   305   C  C   . ALA A  1 40  ? -47.301 81.365  -4.152  1.00 37.68  ?  40  ALA A C   1 
ATOM   306   O  O   . ALA A  1 40  ? -46.232 81.922  -3.872  1.00 36.68  ?  40  ALA A O   1 
ATOM   307   C  CB  . ALA A  1 40  ? -49.181 82.859  -3.548  1.00 37.87  ?  40  ALA A CB  1 
ATOM   308   N  N   . ASP A  1 41  ? -47.496 80.582  -5.217  1.00 37.92  ?  41  ASP A N   1 
ATOM   309   C  CA  . ASP A  1 41  ? -46.520 80.446  -6.278  1.00 37.38  ?  41  ASP A CA  1 
ATOM   310   C  C   . ASP A  1 41  ? -45.204 79.858  -5.767  1.00 37.05  ?  41  ASP A C   1 
ATOM   311   O  O   . ASP A  1 41  ? -44.088 80.345  -6.061  1.00 37.19  ?  41  ASP A O   1 
ATOM   312   C  CB  . ASP A  1 41  ? -46.385 81.807  -6.948  1.00 37.39  ?  41  ASP A CB  1 
ATOM   313   C  CG  . ASP A  1 41  ? -47.726 82.312  -7.429  1.00 38.50  ?  41  ASP A CG  1 
ATOM   314   O  OD1 . ASP A  1 41  ? -47.788 83.491  -7.857  1.00 37.37  ?  41  ASP A OD1 1 
ATOM   315   O  OD2 . ASP A  1 41  ? -48.713 81.500  -7.348  1.00 38.98  -1 41  ASP A OD2 1 
ATOM   316   N  N   . GLU A  1 42  ? -45.356 78.786  -4.994  1.00 36.36  ?  42  GLU A N   1 
ATOM   317   C  CA  . GLU A  1 42  ? -44.239 78.196  -4.290  1.00 35.72  ?  42  GLU A CA  1 
ATOM   318   C  C   . GLU A  1 42  ? -44.410 76.690  -4.378  1.00 35.42  ?  42  GLU A C   1 
ATOM   319   O  O   . GLU A  1 42  ? -45.538 76.166  -4.260  1.00 35.32  ?  42  GLU A O   1 
ATOM   320   C  CB  . GLU A  1 42  ? -44.280 78.648  -2.843  1.00 35.51  ?  42  GLU A CB  1 
ATOM   321   C  CG  . GLU A  1 42  ? -42.946 78.753  -2.147  1.00 35.50  ?  42  GLU A CG  1 
ATOM   322   C  CD  . GLU A  1 42  ? -43.136 79.099  -0.666  1.00 34.83  ?  42  GLU A CD  1 
ATOM   323   O  OE1 . GLU A  1 42  ? -42.212 79.731  -0.114  1.00 30.86  ?  42  GLU A OE1 1 
ATOM   324   O  OE2 . GLU A  1 42  ? -44.213 78.742  -0.081  1.00 33.08  -1 42  GLU A OE2 1 
ATOM   325   N  N   . THR A  1 43  ? -43.292 76.031  -4.662  1.00 34.52  ?  43  THR A N   1 
ATOM   326   C  CA  . THR A  1 43  ? -43.170 74.579  -4.593  1.00 33.66  ?  43  THR A CA  1 
ATOM   327   C  C   . THR A  1 43  ? -43.075 74.185  -3.130  1.00 32.48  ?  43  THR A C   1 
ATOM   328   O  O   . THR A  1 43  ? -42.319 74.829  -2.327  1.00 32.15  ?  43  THR A O   1 
ATOM   329   C  CB  . THR A  1 43  ? -41.843 74.087  -5.244  1.00 33.57  ?  43  THR A CB  1 
ATOM   330   O  OG1 . THR A  1 43  ? -41.790 74.541  -6.589  1.00 34.14  ?  43  THR A OG1 1 
ATOM   331   C  CG2 . THR A  1 43  ? -41.743 72.544  -5.245  1.00 35.50  ?  43  THR A CG2 1 
ATOM   332   N  N   . LEU A  1 44  ? -43.798 73.110  -2.811  1.00 30.44  ?  44  LEU A N   1 
ATOM   333   C  CA  . LEU A  1 44  ? -43.662 72.407  -1.549  1.00 28.91  ?  44  LEU A CA  1 
ATOM   334   C  C   . LEU A  1 44  ? -42.209 72.394  -1.118  1.00 28.62  ?  44  LEU A C   1 
ATOM   335   O  O   . LEU A  1 44  ? -41.891 72.836  -0.008  1.00 28.95  ?  44  LEU A O   1 
ATOM   336   C  CB  . LEU A  1 44  ? -44.171 70.985  -1.671  1.00 28.03  ?  44  LEU A CB  1 
ATOM   337   C  CG  . LEU A  1 44  ? -45.643 70.825  -1.961  1.00 27.29  ?  44  LEU A CG  1 
ATOM   338   C  CD1 . LEU A  1 44  ? -45.885 69.389  -2.254  1.00 29.41  ?  44  LEU A CD1 1 
ATOM   339   C  CD2 . LEU A  1 44  ? -46.490 71.234  -0.803  1.00 25.34  ?  44  LEU A CD2 1 
ATOM   340   N  N   . VAL A  1 45  ? -41.316 71.933  -1.986  1.00 27.75  ?  45  VAL A N   1 
ATOM   341   C  CA  . VAL A  1 45  ? -39.919 71.905  -1.588  1.00 27.66  ?  45  VAL A CA  1 
ATOM   342   C  C   . VAL A  1 45  ? -39.415 73.312  -1.260  1.00 27.81  ?  45  VAL A C   1 
ATOM   343   O  O   . VAL A  1 45  ? -39.016 73.573  -0.124  1.00 28.36  ?  45  VAL A O   1 
ATOM   344   C  CB  . VAL A  1 45  ? -39.035 70.932  -2.457  1.00 27.35  ?  45  VAL A CB  1 
ATOM   345   C  CG1 . VAL A  1 45  ? -39.755 70.530  -3.762  1.00 29.05  ?  45  VAL A CG1 1 
ATOM   346   C  CG2 . VAL A  1 45  ? -37.657 71.456  -2.692  1.00 27.46  ?  45  VAL A CG2 1 
ATOM   347   N  N   . GLU A  1 46  ? -39.543 74.259  -2.181  1.00 28.56  ?  46  GLU A N   1 
ATOM   348   C  CA  . GLU A  1 46  ? -39.194 75.662  -1.865  1.00 28.49  ?  46  GLU A CA  1 
ATOM   349   C  C   . GLU A  1 46  ? -39.761 76.114  -0.499  1.00 28.10  ?  46  GLU A C   1 
ATOM   350   O  O   . GLU A  1 46  ? -39.028 76.648  0.353   1.00 26.94  ?  46  GLU A O   1 
ATOM   351   C  CB  . GLU A  1 46  ? -39.718 76.588  -2.954  1.00 29.05  ?  46  GLU A CB  1 
ATOM   352   C  CG  . GLU A  1 46  ? -38.665 77.077  -3.909  1.00 30.39  ?  46  GLU A CG  1 
ATOM   353   C  CD  . GLU A  1 46  ? -39.248 77.657  -5.191  1.00 34.88  ?  46  GLU A CD  1 
ATOM   354   O  OE1 . GLU A  1 46  ? -38.415 78.051  -6.056  1.00 36.32  ?  46  GLU A OE1 1 
ATOM   355   O  OE2 . GLU A  1 46  ? -40.518 77.718  -5.330  1.00 37.24  -1 46  GLU A OE2 1 
ATOM   356   N  N   . ALA A  1 47  ? -41.069 75.891  -0.312  1.00 26.62  ?  47  ALA A N   1 
ATOM   357   C  CA  . ALA A  1 47  ? -41.702 76.126  0.968   1.00 26.05  ?  47  ALA A CA  1 
ATOM   358   C  C   . ALA A  1 47  ? -40.866 75.554  2.154   1.00 25.82  ?  47  ALA A C   1 
ATOM   359   O  O   . ALA A  1 47  ? -40.389 76.308  3.025   1.00 25.39  ?  47  ALA A O   1 
ATOM   360   C  CB  . ALA A  1 47  ? -43.105 75.574  0.953   1.00 25.27  ?  47  ALA A CB  1 
ATOM   361   N  N   . ALA A  1 48  ? -40.638 74.241  2.125   1.00 25.38  ?  48  ALA A N   1 
ATOM   362   C  CA  . ALA A  1 48  ? -39.849 73.559  3.145   1.00 24.89  ?  48  ALA A CA  1 
ATOM   363   C  C   . ALA A  1 48  ? -38.483 74.193  3.321   1.00 24.08  ?  48  ALA A C   1 
ATOM   364   O  O   . ALA A  1 48  ? -38.018 74.378  4.433   1.00 24.14  ?  48  ALA A O   1 
ATOM   365   C  CB  . ALA A  1 48  ? -39.720 72.066  2.829   1.00 24.59  ?  48  ALA A CB  1 
ATOM   366   N  N   . ALA A  1 49  ? -37.851 74.566  2.229   1.00 23.99  ?  49  ALA A N   1 
ATOM   367   C  CA  . ALA A  1 49  ? -36.602 75.298  2.347   1.00 24.59  ?  49  ALA A CA  1 
ATOM   368   C  C   . ALA A  1 49  ? -36.802 76.660  2.990   1.00 24.83  ?  49  ALA A C   1 
ATOM   369   O  O   . ALA A  1 49  ? -35.950 77.105  3.771   1.00 25.53  ?  49  ALA A O   1 
ATOM   370   C  CB  . ALA A  1 49  ? -35.953 75.464  1.008   1.00 24.65  ?  49  ALA A CB  1 
ATOM   371   N  N   . ARG A  1 50  ? -37.910 77.331  2.682   1.00 24.78  ?  50  ARG A N   1 
ATOM   372   C  CA  . ARG A  1 50  ? -38.074 78.712  3.172   1.00 24.96  ?  50  ARG A CA  1 
ATOM   373   C  C   . ARG A  1 50  ? -38.351 78.688  4.690   1.00 24.92  ?  50  ARG A C   1 
ATOM   374   O  O   . ARG A  1 50  ? -37.669 79.362  5.504   1.00 24.85  ?  50  ARG A O   1 
ATOM   375   C  CB  . ARG A  1 50  ? -39.179 79.442  2.403   1.00 24.32  ?  50  ARG A CB  1 
ATOM   376   C  CG  . ARG A  1 50  ? -39.612 80.727  3.052   1.00 24.18  ?  50  ARG A CG  1 
ATOM   377   C  CD  . ARG A  1 50  ? -40.661 81.414  2.243   1.00 23.76  ?  50  ARG A CD  1 
ATOM   378   N  NE  . ARG A  1 50  ? -41.771 80.510  2.012   1.00 25.59  ?  50  ARG A NE  1 
ATOM   379   C  CZ  . ARG A  1 50  ? -42.596 80.094  2.954   1.00 25.68  ?  50  ARG A CZ  1 
ATOM   380   N  NH1 . ARG A  1 50  ? -42.445 80.516  4.209   1.00 29.00  ?  50  ARG A NH1 1 
ATOM   381   N  NH2 . ARG A  1 50  ? -43.545 79.240  2.642   1.00 23.83  ?  50  ARG A NH2 1 
ATOM   382   N  N   . GLU A  1 51  ? -39.325 77.871  5.075   1.00 24.32  ?  51  GLU A N   1 
ATOM   383   C  CA  . GLU A  1 51  ? -39.685 77.782  6.470   1.00 23.19  ?  51  GLU A CA  1 
ATOM   384   C  C   . GLU A  1 51  ? -38.536 77.263  7.342   1.00 22.24  ?  51  GLU A C   1 
ATOM   385   O  O   . GLU A  1 51  ? -38.447 77.602  8.519   1.00 21.25  ?  51  GLU A O   1 
ATOM   386   C  CB  . GLU A  1 51  ? -40.948 76.967  6.613   1.00 23.33  ?  51  GLU A CB  1 
ATOM   387   C  CG  . GLU A  1 51  ? -42.160 77.673  6.029   1.00 24.65  ?  51  GLU A CG  1 
ATOM   388   C  CD  . GLU A  1 51  ? -42.836 78.588  7.014   1.00 27.42  ?  51  GLU A CD  1 
ATOM   389   O  OE1 . GLU A  1 51  ? -42.585 78.415  8.223   1.00 27.53  ?  51  GLU A OE1 1 
ATOM   390   O  OE2 . GLU A  1 51  ? -43.607 79.475  6.571   1.00 29.31  -1 51  GLU A OE2 1 
ATOM   391   N  N   . LEU A  1 52  ? -37.632 76.485  6.767   1.00 21.35  ?  52  LEU A N   1 
ATOM   392   C  CA  . LEU A  1 52  ? -36.434 76.138  7.500   1.00 21.30  ?  52  LEU A CA  1 
ATOM   393   C  C   . LEU A  1 52  ? -35.593 77.386  7.762   1.00 21.42  ?  52  LEU A C   1 
ATOM   394   O  O   . LEU A  1 52  ? -35.191 77.663  8.908   1.00 20.80  ?  52  LEU A O   1 
ATOM   395   C  CB  . LEU A  1 52  ? -35.622 75.138  6.710   1.00 21.46  ?  52  LEU A CB  1 
ATOM   396   C  CG  . LEU A  1 52  ? -34.830 74.021  7.380   1.00 23.78  ?  52  LEU A CG  1 
ATOM   397   C  CD1 . LEU A  1 52  ? -33.415 74.010  6.795   1.00 23.38  ?  52  LEU A CD1 1 
ATOM   398   C  CD2 . LEU A  1 52  ? -34.775 74.079  8.938   1.00 24.50  ?  52  LEU A CD2 1 
ATOM   399   N  N   . TRP A  1 53  ? -35.322 78.153  6.704   1.00 22.49  ?  53  TRP A N   1 
ATOM   400   C  CA  . TRP A  1 53  ? -34.436 79.327  6.843   1.00 23.28  ?  53  TRP A CA  1 
ATOM   401   C  C   . TRP A  1 53  ? -35.040 80.292  7.874   1.00 22.89  ?  53  TRP A C   1 
ATOM   402   O  O   . TRP A  1 53  ? -34.400 80.647  8.841   1.00 22.34  ?  53  TRP A O   1 
ATOM   403   C  CB  . TRP A  1 53  ? -34.072 80.005  5.482   1.00 23.70  ?  53  TRP A CB  1 
ATOM   404   C  CG  . TRP A  1 53  ? -33.095 81.120  5.719   1.00 24.93  ?  53  TRP A CG  1 
ATOM   405   C  CD1 . TRP A  1 53  ? -31.735 81.018  5.894   1.00 27.57  ?  53  TRP A CD1 1 
ATOM   406   C  CD2 . TRP A  1 53  ? -33.418 82.488  5.945   1.00 26.38  ?  53  TRP A CD2 1 
ATOM   407   N  NE1 . TRP A  1 53  ? -31.186 82.261  6.185   1.00 25.31  ?  53  TRP A NE1 1 
ATOM   408   C  CE2 . TRP A  1 53  ? -32.201 83.174  6.229   1.00 24.80  ?  53  TRP A CE2 1 
ATOM   409   C  CE3 . TRP A  1 53  ? -34.619 83.214  5.922   1.00 26.98  ?  53  TRP A CE3 1 
ATOM   410   C  CZ2 . TRP A  1 53  ? -32.153 84.542  6.458   1.00 26.26  ?  53  TRP A CZ2 1 
ATOM   411   C  CZ3 . TRP A  1 53  ? -34.564 84.583  6.164   1.00 27.43  ?  53  TRP A CZ3 1 
ATOM   412   C  CH2 . TRP A  1 53  ? -33.337 85.231  6.418   1.00 25.01  ?  53  TRP A CH2 1 
ATOM   413   N  N   . GLU A  1 54  ? -36.308 80.632  7.665   1.00 23.26  ?  54  GLU A N   1 
ATOM   414   C  CA  . GLU A  1 54  ? -37.119 81.429  8.583   1.00 23.59  ?  54  GLU A CA  1 
ATOM   415   C  C   . GLU A  1 54  ? -37.132 80.986  10.056  1.00 23.91  ?  54  GLU A C   1 
ATOM   416   O  O   . GLU A  1 54  ? -36.931 81.799  10.968  1.00 25.10  ?  54  GLU A O   1 
ATOM   417   C  CB  . GLU A  1 54  ? -38.557 81.454  8.083   1.00 23.28  ?  54  GLU A CB  1 
ATOM   418   C  CG  . GLU A  1 54  ? -38.766 82.232  6.794   1.00 23.50  ?  54  GLU A CG  1 
ATOM   419   C  CD  . GLU A  1 54  ? -40.243 82.432  6.490   1.00 28.22  ?  54  GLU A CD  1 
ATOM   420   O  OE1 . GLU A  1 54  ? -41.074 82.205  7.413   1.00 31.05  ?  54  GLU A OE1 1 
ATOM   421   O  OE2 . GLU A  1 54  ? -40.588 82.797  5.340   1.00 27.50  -1 54  GLU A OE2 1 
ATOM   422   N  N   . GLU A  1 55  ? -37.368 79.713  10.311  1.00 23.09  ?  55  GLU A N   1 
ATOM   423   C  CA  . GLU A  1 55  ? -37.473 79.271  11.687  1.00 22.56  ?  55  GLU A CA  1 
ATOM   424   C  C   . GLU A  1 55  ? -36.206 78.878  12.371  1.00 22.34  ?  55  GLU A C   1 
ATOM   425   O  O   . GLU A  1 55  ? -36.233 78.653  13.590  1.00 22.94  ?  55  GLU A O   1 
ATOM   426   C  CB  . GLU A  1 55  ? -38.412 78.097  11.760  1.00 23.54  ?  55  GLU A CB  1 
ATOM   427   C  CG  . GLU A  1 55  ? -39.859 78.516  11.668  1.00 23.17  ?  55  GLU A CG  1 
ATOM   428   C  CD  . GLU A  1 55  ? -40.765 77.381  11.914  1.00 25.08  ?  55  GLU A CD  1 
ATOM   429   O  OE1 . GLU A  1 55  ? -40.266 76.252  12.279  1.00 25.78  ?  55  GLU A OE1 1 
ATOM   430   O  OE2 . GLU A  1 55  ? -41.980 77.641  11.753  1.00 21.56  -1 55  GLU A OE2 1 
ATOM   431   N  N   . THR A  1 56  ? -35.103 78.776  11.621  1.00 21.51  ?  56  THR A N   1 
ATOM   432   C  CA  . THR A  1 56  ? -33.830 78.301  12.181  1.00 20.55  ?  56  THR A CA  1 
ATOM   433   C  C   . THR A  1 56  ? -32.643 79.006  11.604  1.00 20.73  ?  56  THR A C   1 
ATOM   434   O  O   . THR A  1 56  ? -31.551 78.887  12.141  1.00 19.69  ?  56  THR A O   1 
ATOM   435   C  CB  . THR A  1 56  ? -33.517 76.848  11.749  1.00 20.47  ?  56  THR A CB  1 
ATOM   436   O  OG1 . THR A  1 56  ? -33.408 76.810  10.315  1.00 21.68  ?  56  THR A OG1 1 
ATOM   437   C  CG2 . THR A  1 56  ? -34.541 75.886  12.211  1.00 18.09  ?  56  THR A CG2 1 
ATOM   438   N  N   . GLY A  1 57  ? -32.838 79.639  10.444  1.00 21.54  ?  57  GLY A N   1 
ATOM   439   C  CA  . GLY A  1 57  ? -31.734 80.144  9.608   1.00 22.10  ?  57  GLY A CA  1 
ATOM   440   C  C   . GLY A  1 57  ? -30.724 79.110  9.109   1.00 22.91  ?  57  GLY A C   1 
ATOM   441   O  O   . GLY A  1 57  ? -29.559 79.423  8.916   1.00 23.08  ?  57  GLY A O   1 
ATOM   442   N  N   . ILE A  1 58  ? -31.143 77.859  8.941   1.00 23.43  ?  58  ILE A N   1 
ATOM   443   C  CA  . ILE A  1 58  ? -30.302 76.926  8.270   1.00 23.17  ?  58  ILE A CA  1 
ATOM   444   C  C   . ILE A  1 58  ? -30.545 77.198  6.813   1.00 23.80  ?  58  ILE A C   1 
ATOM   445   O  O   . ILE A  1 58  ? -31.680 77.430  6.419   1.00 23.68  ?  58  ILE A O   1 
ATOM   446   C  CB  . ILE A  1 58  ? -30.730 75.514  8.566   1.00 23.46  ?  58  ILE A CB  1 
ATOM   447   C  CG1 . ILE A  1 58  ? -30.656 75.246  10.069  1.00 22.91  ?  58  ILE A CG1 1 
ATOM   448   C  CG2 . ILE A  1 58  ? -29.929 74.512  7.732   1.00 21.38  ?  58  ILE A CG2 1 
ATOM   449   C  CD1 . ILE A  1 58  ? -29.405 74.574  10.510  1.00 22.63  ?  58  ILE A CD1 1 
ATOM   450   N  N   . SER A  1 59  ? -29.472 77.215  6.022   1.00 24.94  ?  59  SER A N   1 
ATOM   451   C  CA  . SER A  1 59  ? -29.584 77.155  4.561   1.00 26.09  ?  59  SER A CA  1 
ATOM   452   C  C   . SER A  1 59  ? -29.319 75.756  3.961   1.00 26.02  ?  59  SER A C   1 
ATOM   453   O  O   . SER A  1 59  ? -28.163 75.339  3.768   1.00 25.90  ?  59  SER A O   1 
ATOM   454   C  CB  . SER A  1 59  ? -28.707 78.217  3.904   1.00 26.25  ?  59  SER A CB  1 
ATOM   455   O  OG  . SER A  1 59  ? -29.560 79.233  3.363   1.00 29.79  ?  59  SER A OG  1 
ATOM   456   N  N   . ALA A  1 60  ? -30.409 75.031  3.701   1.00 25.75  ?  60  ALA A N   1 
ATOM   457   C  CA  . ALA A  1 60  ? -30.343 73.672  3.133   1.00 24.77  ?  60  ALA A CA  1 
ATOM   458   C  C   . ALA A  1 60  ? -31.586 73.398  2.338   1.00 24.84  ?  60  ALA A C   1 
ATOM   459   O  O   . ALA A  1 60  ? -32.656 73.943  2.619   1.00 25.35  ?  60  ALA A O   1 
ATOM   460   C  CB  . ALA A  1 60  ? -30.185 72.621  4.217   1.00 24.48  ?  60  ALA A CB  1 
ATOM   461   N  N   . GLN A  1 61  ? -31.429 72.580  1.313   1.00 24.68  ?  61  GLN A N   1 
ATOM   462   C  CA  . GLN A  1 61  ? -32.557 72.102  0.509   1.00 24.86  ?  61  GLN A CA  1 
ATOM   463   C  C   . GLN A  1 61  ? -33.033 70.708  1.059   1.00 23.49  ?  61  GLN A C   1 
ATOM   464   O  O   . GLN A  1 61  ? -32.197 69.883  1.467   1.00 22.58  ?  61  GLN A O   1 
ATOM   465   C  CB  . GLN A  1 61  ? -32.082 72.067  -0.962  1.00 24.63  ?  61  GLN A CB  1 
ATOM   466   C  CG  . GLN A  1 61  ? -33.107 72.507  -2.013  1.00 27.10  ?  61  GLN A CG  1 
ATOM   467   C  CD  . GLN A  1 61  ? -33.519 74.016  -1.967  1.00 28.18  ?  61  GLN A CD  1 
ATOM   468   O  OE1 . GLN A  1 61  ? -34.618 74.364  -2.442  1.00 29.23  ?  61  GLN A OE1 1 
ATOM   469   N  NE2 . GLN A  1 61  ? -32.651 74.893  -1.422  1.00 24.13  ?  61  GLN A NE2 1 
ATOM   470   N  N   . PRO A  1 62  ? -34.359 70.453  1.095   1.00 22.74  ?  62  PRO A N   1 
ATOM   471   C  CA  . PRO A  1 62  ? -34.886 69.141  1.551   1.00 22.21  ?  62  PRO A CA  1 
ATOM   472   C  C   . PRO A  1 62  ? -34.293 68.030  0.703   1.00 22.77  ?  62  PRO A C   1 
ATOM   473   O  O   . PRO A  1 62  ? -34.376 68.131  -0.517  1.00 24.45  ?  62  PRO A O   1 
ATOM   474   C  CB  . PRO A  1 62  ? -36.396 69.212  1.247   1.00 21.58  ?  62  PRO A CB  1 
ATOM   475   C  CG  . PRO A  1 62  ? -36.680 70.499  0.702   1.00 20.80  ?  62  PRO A CG  1 
ATOM   476   C  CD  . PRO A  1 62  ? -35.442 71.398  0.805   1.00 22.70  ?  62  PRO A CD  1 
ATOM   477   N  N   . GLN A  1 63  ? -33.722 66.983  1.300   1.00 21.90  ?  63  GLN A N   1 
ATOM   478   C  CA  . GLN A  1 63  ? -33.136 65.911  0.502   1.00 21.20  ?  63  GLN A CA  1 
ATOM   479   C  C   . GLN A  1 63  ? -34.025 64.772  0.053   1.00 20.27  ?  63  GLN A C   1 
ATOM   480   O  O   . GLN A  1 63  ? -33.757 64.214  -0.962  1.00 20.12  ?  63  GLN A O   1 
ATOM   481   C  CB  . GLN A  1 63  ? -31.893 65.364  1.159   1.00 22.17  ?  63  GLN A CB  1 
ATOM   482   C  CG  . GLN A  1 63  ? -30.884 66.435  1.487   1.00 23.75  ?  63  GLN A CG  1 
ATOM   483   C  CD  . GLN A  1 63  ? -29.913 65.958  2.511   1.00 27.44  ?  63  GLN A CD  1 
ATOM   484   O  OE1 . GLN A  1 63  ? -28.890 66.595  2.772   1.00 28.22  ?  63  GLN A OE1 1 
ATOM   485   N  NE2 . GLN A  1 63  ? -30.211 64.804  3.102   1.00 29.46  ?  63  GLN A NE2 1 
ATOM   486   N  N   . HIS A  1 64  ? -35.045 64.378  0.794   1.00 19.72  ?  64  HIS A N   1 
ATOM   487   C  CA  . HIS A  1 64  ? -35.955 63.327  0.323   1.00 18.51  ?  64  HIS A CA  1 
ATOM   488   C  C   . HIS A  1 64  ? -37.330 63.574  0.887   1.00 19.22  ?  64  HIS A C   1 
ATOM   489   O  O   . HIS A  1 64  ? -37.490 64.244  1.871   1.00 20.19  ?  64  HIS A O   1 
ATOM   490   C  CB  . HIS A  1 64  ? -35.527 61.939  0.834   1.00 18.69  ?  64  HIS A CB  1 
ATOM   491   C  CG  . HIS A  1 64  ? -34.244 61.433  0.253   1.00 17.81  ?  64  HIS A CG  1 
ATOM   492   N  ND1 . HIS A  1 64  ? -33.012 61.858  0.694   1.00 19.55  ?  64  HIS A ND1 1 
ATOM   493   C  CD2 . HIS A  1 64  ? -34.005 60.558  -0.752  1.00 16.91  ?  64  HIS A CD2 1 
ATOM   494   C  CE1 . HIS A  1 64  ? -32.062 61.282  -0.025  1.00 20.88  ?  64  HIS A CE1 1 
ATOM   495   N  NE2 . HIS A  1 64  ? -32.640 60.488  -0.911  1.00 22.85  ?  64  HIS A NE2 1 
ATOM   496   N  N   . PHE A  1 65  ? -38.335 62.973  0.310   1.00 19.82  ?  65  PHE A N   1 
ATOM   497   C  CA  . PHE A  1 65  ? -39.654 63.103  0.823   1.00 19.52  ?  65  PHE A CA  1 
ATOM   498   C  C   . PHE A  1 65  ? -39.885 61.929  1.745   1.00 19.73  ?  65  PHE A C   1 
ATOM   499   O  O   . PHE A  1 65  ? -39.855 60.776  1.315   1.00 20.50  ?  65  PHE A O   1 
ATOM   500   C  CB  . PHE A  1 65  ? -40.608 63.057  -0.353  1.00 19.33  ?  65  PHE A CB  1 
ATOM   501   C  CG  . PHE A  1 65  ? -42.041 63.042  0.033   1.00 19.40  ?  65  PHE A CG  1 
ATOM   502   C  CD1 . PHE A  1 65  ? -42.587 64.078  0.783   1.00 19.64  ?  65  PHE A CD1 1 
ATOM   503   C  CD2 . PHE A  1 65  ? -42.863 62.016  -0.398  1.00 17.02  ?  65  PHE A CD2 1 
ATOM   504   C  CE1 . PHE A  1 65  ? -43.949 64.054  1.146   1.00 19.49  ?  65  PHE A CE1 1 
ATOM   505   C  CE2 . PHE A  1 65  ? -44.235 61.981  -0.057  1.00 18.59  ?  65  PHE A CE2 1 
ATOM   506   C  CZ  . PHE A  1 65  ? -44.778 62.992  0.722   1.00 18.43  ?  65  PHE A CZ  1 
ATOM   507   N  N   . ILE A  1 66  ? -40.119 62.192  3.020   1.00 19.68  ?  66  ILE A N   1 
ATOM   508   C  CA  . ILE A  1 66  ? -40.460 61.088  3.897   1.00 19.35  ?  66  ILE A CA  1 
ATOM   509   C  C   . ILE A  1 66  ? -41.891 60.618  3.640   1.00 19.70  ?  66  ILE A C   1 
ATOM   510   O  O   . ILE A  1 66  ? -42.117 59.468  3.263   1.00 18.64  ?  66  ILE A O   1 
ATOM   511   C  CB  . ILE A  1 66  ? -40.252 61.426  5.342   1.00 19.09  ?  66  ILE A CB  1 
ATOM   512   C  CG1 . ILE A  1 66  ? -38.782 61.633  5.584   1.00 18.30  ?  66  ILE A CG1 1 
ATOM   513   C  CG2 . ILE A  1 66  ? -40.618 60.258  6.212   1.00 18.95  ?  66  ILE A CG2 1 
ATOM   514   C  CD1 . ILE A  1 66  ? -38.554 62.250  6.909   1.00 18.91  ?  66  ILE A CD1 1 
ATOM   515   N  N   . ARG A  1 67  ? -42.856 61.515  3.783   1.00 19.90  ?  67  ARG A N   1 
ATOM   516   C  CA  . ARG A  1 67  ? -44.239 61.099  3.725   1.00 20.49  ?  67  ARG A CA  1 
ATOM   517   C  C   . ARG A  1 67  ? -45.090 62.353  3.859   1.00 21.12  ?  67  ARG A C   1 
ATOM   518   O  O   . ARG A  1 67  ? -44.540 63.445  4.041   1.00 21.82  ?  67  ARG A O   1 
ATOM   519   C  CB  . ARG A  1 67  ? -44.446 60.213  4.946   1.00 20.70  ?  67  ARG A CB  1 
ATOM   520   C  CG  . ARG A  1 67  ? -45.611 59.375  4.905   1.00 19.98  ?  67  ARG A CG  1 
ATOM   521   C  CD  . ARG A  1 67  ? -46.169 59.212  6.259   1.00 16.65  ?  67  ARG A CD  1 
ATOM   522   N  NE  . ARG A  1 67  ? -47.595 59.474  6.124   1.00 19.50  ?  67  ARG A NE  1 
ATOM   523   C  CZ  . ARG A  1 67  ? -48.573 58.684  6.536   1.00 17.92  ?  67  ARG A CZ  1 
ATOM   524   N  NH1 . ARG A  1 67  ? -48.306 57.542  7.149   1.00 15.39  ?  67  ARG A NH1 1 
ATOM   525   N  NH2 . ARG A  1 67  ? -49.834 59.070  6.344   1.00 20.22  ?  67  ARG A NH2 1 
ATOM   526   N  N   . MET A  1 68  ? -46.413 62.194  3.805   1.00 21.22  ?  68  MET A N   1 
ATOM   527   C  CA  . MET A  1 68  ? -47.369 63.250  4.035   1.00 21.27  ?  68  MET A CA  1 
ATOM   528   C  C   . MET A  1 68  ? -48.483 62.785  4.964   1.00 22.63  ?  68  MET A C   1 
ATOM   529   O  O   . MET A  1 68  ? -49.020 61.683  4.813   1.00 22.88  ?  68  MET A O   1 
ATOM   530   C  CB  . MET A  1 68  ? -48.006 63.679  2.735   1.00 20.98  ?  68  MET A CB  1 
ATOM   531   C  CG  . MET A  1 68  ? -48.966 64.846  2.959   1.00 20.99  ?  68  MET A CG  1 
ATOM   532   S  SD  . MET A  1 68  ? -50.453 64.797  1.972   1.00 24.37  ?  68  MET A SD  1 
ATOM   533   C  CE  . MET A  1 68  ? -51.476 63.601  2.835   1.00 21.27  ?  68  MET A CE  1 
ATOM   534   N  N   . HIS A  1 69  ? -48.855 63.621  5.922   1.00 23.48  ?  69  HIS A N   1 
ATOM   535   C  CA  . HIS A  1 69  ? -49.919 63.228  6.833   1.00 25.00  ?  69  HIS A CA  1 
ATOM   536   C  C   . HIS A  1 69  ? -51.164 64.109  6.594   1.00 26.03  ?  69  HIS A C   1 
ATOM   537   O  O   . HIS A  1 69  ? -51.042 65.316  6.449   1.00 26.50  ?  69  HIS A O   1 
ATOM   538   C  CB  . HIS A  1 69  ? -49.431 63.332  8.282   1.00 24.83  ?  69  HIS A CB  1 
ATOM   539   C  CG  . HIS A  1 69  ? -48.343 62.359  8.654   1.00 23.94  ?  69  HIS A CG  1 
ATOM   540   N  ND1 . HIS A  1 69  ? -47.002 62.648  8.520   1.00 22.37  ?  69  HIS A ND1 1 
ATOM   541   C  CD2 . HIS A  1 69  ? -48.404 61.124  9.210   1.00 22.79  ?  69  HIS A CD2 1 
ATOM   542   C  CE1 . HIS A  1 69  ? -46.284 61.627  8.951   1.00 21.60  ?  69  HIS A CE1 1 
ATOM   543   N  NE2 . HIS A  1 69  ? -47.112 60.687  9.371   1.00 23.60  ?  69  HIS A NE2 1 
ATOM   544   N  N   . GLN A  1 70  ? -52.342 63.516  6.493   1.00 27.46  ?  70  GLN A N   1 
ATOM   545   C  CA  . GLN A  1 70  ? -53.572 64.298  6.469   1.00 29.86  ?  70  GLN A CA  1 
ATOM   546   C  C   . GLN A  1 70  ? -54.151 64.188  7.863   1.00 30.99  ?  70  GLN A C   1 
ATOM   547   O  O   . GLN A  1 70  ? -54.412 63.074  8.323   1.00 31.10  ?  70  GLN A O   1 
ATOM   548   C  CB  . GLN A  1 70  ? -54.540 63.698  5.450   1.00 30.78  ?  70  GLN A CB  1 
ATOM   549   C  CG  . GLN A  1 70  ? -56.006 64.178  5.486   1.00 32.93  ?  70  GLN A CG  1 
ATOM   550   C  CD  . GLN A  1 70  ? -56.838 63.677  4.268   1.00 36.64  ?  70  GLN A CD  1 
ATOM   551   O  OE1 . GLN A  1 70  ? -56.632 62.550  3.755   1.00 40.74  ?  70  GLN A OE1 1 
ATOM   552   N  NE2 . GLN A  1 70  ? -57.789 64.502  3.822   1.00 31.82  ?  70  GLN A NE2 1 
ATOM   553   N  N   . TRP A  1 71  ? -54.312 65.307  8.574   1.00 32.41  ?  71  TRP A N   1 
ATOM   554   C  CA  . TRP A  1 71  ? -54.909 65.218  9.919   1.00 33.86  ?  71  TRP A CA  1 
ATOM   555   C  C   . TRP A  1 71  ? -55.829 66.375  10.229  1.00 34.44  ?  71  TRP A C   1 
ATOM   556   O  O   . TRP A  1 71  ? -55.717 67.438  9.614   1.00 34.97  ?  71  TRP A O   1 
ATOM   557   C  CB  . TRP A  1 71  ? -53.833 65.019  11.003  1.00 34.39  ?  71  TRP A CB  1 
ATOM   558   C  CG  . TRP A  1 71  ? -53.388 66.270  11.713  1.00 35.70  ?  71  TRP A CG  1 
ATOM   559   C  CD1 . TRP A  1 71  ? -52.828 67.395  11.150  1.00 39.15  ?  71  TRP A CD1 1 
ATOM   560   C  CD2 . TRP A  1 71  ? -53.449 66.520  13.116  1.00 35.10  ?  71  TRP A CD2 1 
ATOM   561   N  NE1 . TRP A  1 71  ? -52.547 68.339  12.132  1.00 36.03  ?  71  TRP A NE1 1 
ATOM   562   C  CE2 . TRP A  1 71  ? -52.919 67.830  13.341  1.00 35.43  ?  71  TRP A CE2 1 
ATOM   563   C  CE3 . TRP A  1 71  ? -53.910 65.785  14.197  1.00 33.94  ?  71  TRP A CE3 1 
ATOM   564   C  CZ2 . TRP A  1 71  ? -52.828 68.399  14.599  1.00 34.86  ?  71  TRP A CZ2 1 
ATOM   565   C  CZ3 . TRP A  1 71  ? -53.818 66.350  15.455  1.00 38.54  ?  71  TRP A CZ3 1 
ATOM   566   C  CH2 . TRP A  1 71  ? -53.281 67.655  15.645  1.00 37.47  ?  71  TRP A CH2 1 
ATOM   567   N  N   . ILE A  1 72  ? -56.748 66.185  11.167  1.00 35.57  ?  72  ILE A N   1 
ATOM   568   C  CA  . ILE A  1 72  ? -57.712 67.252  11.404  1.00 36.73  ?  72  ILE A CA  1 
ATOM   569   C  C   . ILE A  1 72  ? -57.352 68.305  12.411  1.00 37.21  ?  72  ILE A C   1 
ATOM   570   O  O   . ILE A  1 72  ? -57.746 69.441  12.205  1.00 38.60  ?  72  ILE A O   1 
ATOM   571   C  CB  . ILE A  1 72  ? -59.159 66.786  11.696  1.00 37.29  ?  72  ILE A CB  1 
ATOM   572   C  CG1 . ILE A  1 72  ? -59.869 66.342  10.399  1.00 37.39  ?  72  ILE A CG1 1 
ATOM   573   C  CG2 . ILE A  1 72  ? -59.960 67.906  12.399  1.00 36.09  ?  72  ILE A CG2 1 
ATOM   574   C  CD1 . ILE A  1 72  ? -59.437 67.078  9.177   1.00 38.19  ?  72  ILE A CD1 1 
ATOM   575   N  N   . ALA A  1 73  ? -56.672 67.975  13.495  1.00 36.82  ?  73  ALA A N   1 
ATOM   576   C  CA  . ALA A  1 73  ? -56.299 69.036  14.451  1.00 37.67  ?  73  ALA A CA  1 
ATOM   577   C  C   . ALA A  1 73  ? -57.378 69.398  15.436  1.00 38.29  ?  73  ALA A C   1 
ATOM   578   O  O   . ALA A  1 73  ? -58.557 69.445  15.086  1.00 37.79  ?  73  ALA A O   1 
ATOM   579   C  CB  . ALA A  1 73  ? -55.807 70.314  13.770  1.00 36.81  ?  73  ALA A CB  1 
ATOM   580   N  N   . PRO A  1 74  ? -56.951 69.706  16.682  1.00 39.26  ?  74  PRO A N   1 
ATOM   581   C  CA  . PRO A  1 74  ? -57.866 69.663  17.800  1.00 39.45  ?  74  PRO A CA  1 
ATOM   582   C  C   . PRO A  1 74  ? -58.966 70.689  17.608  1.00 39.97  ?  74  PRO A C   1 
ATOM   583   O  O   . PRO A  1 74  ? -60.103 70.449  18.020  1.00 40.57  ?  74  PRO A O   1 
ATOM   584   C  CB  . PRO A  1 74  ? -56.969 69.985  18.999  1.00 39.06  ?  74  PRO A CB  1 
ATOM   585   C  CG  . PRO A  1 74  ? -55.824 70.680  18.439  1.00 39.15  ?  74  PRO A CG  1 
ATOM   586   C  CD  . PRO A  1 74  ? -55.606 70.155  17.093  1.00 38.83  ?  74  PRO A CD  1 
ATOM   587   N  N   . ASP A  1 75  ? -58.648 71.795  16.941  1.00 39.84  ?  75  ASP A N   1 
ATOM   588   C  CA  . ASP A  1 75  ? -59.625 72.838  16.784  1.00 39.60  ?  75  ASP A CA  1 
ATOM   589   C  C   . ASP A  1 75  ? -60.296 72.741  15.422  1.00 39.68  ?  75  ASP A C   1 
ATOM   590   O  O   . ASP A  1 75  ? -60.823 73.724  14.909  1.00 40.09  ?  75  ASP A O   1 
ATOM   591   C  CB  . ASP A  1 75  ? -58.973 74.196  17.045  1.00 40.03  ?  75  ASP A CB  1 
ATOM   592   C  CG  . ASP A  1 75  ? -58.601 74.920  15.789  1.00 39.48  ?  75  ASP A CG  1 
ATOM   593   O  OD1 . ASP A  1 75  ? -59.228 75.941  15.546  1.00 38.59  ?  75  ASP A OD1 1 
ATOM   594   O  OD2 . ASP A  1 75  ? -57.705 74.489  15.051  1.00 41.08  -1 75  ASP A OD2 1 
ATOM   595   N  N   . LYS A  1 76  ? -60.273 71.537  14.853  1.00 39.44  ?  76  LYS A N   1 
ATOM   596   C  CA  . LYS A  1 76  ? -60.934 71.191  13.570  1.00 39.79  ?  76  LYS A CA  1 
ATOM   597   C  C   . LYS A  1 76  ? -60.263 71.725  12.277  1.00 39.05  ?  76  LYS A C   1 
ATOM   598   O  O   . LYS A  1 76  ? -60.744 71.455  11.162  1.00 39.84  ?  76  LYS A O   1 
ATOM   599   C  CB  . LYS A  1 76  ? -62.466 71.474  13.586  1.00 40.03  ?  76  LYS A CB  1 
ATOM   600   C  CG  . LYS A  1 76  ? -63.292 70.790  14.738  1.00 43.09  ?  76  LYS A CG  1 
ATOM   601   C  CD  . LYS A  1 76  ? -63.010 69.261  14.948  1.00 47.13  ?  76  LYS A CD  1 
ATOM   602   C  CE  . LYS A  1 76  ? -63.908 68.335  14.073  1.00 50.49  ?  76  LYS A CE  1 
ATOM   603   N  NZ  . LYS A  1 76  ? -63.352 66.930  13.835  1.00 49.54  ?  76  LYS A NZ  1 
ATOM   604   N  N   . THR A  1 77  ? -59.177 72.478  12.426  1.00 37.36  ?  77  THR A N   1 
ATOM   605   C  CA  . THR A  1 77  ? -58.448 73.033  11.287  1.00 36.90  ?  77  THR A CA  1 
ATOM   606   C  C   . THR A  1 77  ? -57.776 71.928  10.451  1.00 36.52  ?  77  THR A C   1 
ATOM   607   O  O   . THR A  1 77  ? -56.806 71.306  10.920  1.00 36.80  ?  77  THR A O   1 
ATOM   608   C  CB  . THR A  1 77  ? -57.322 73.989  11.736  1.00 36.76  ?  77  THR A CB  1 
ATOM   609   O  OG1 . THR A  1 77  ? -57.848 75.003  12.595  1.00 37.44  ?  77  THR A OG1 1 
ATOM   610   C  CG2 . THR A  1 77  ? -56.685 74.630  10.540  1.00 36.65  ?  77  THR A CG2 1 
ATOM   611   N  N   . PRO A  1 78  ? -58.245 71.708  9.199   1.00 35.26  ?  78  PRO A N   1 
ATOM   612   C  CA  . PRO A  1 78  ? -57.738 70.592  8.371   1.00 33.61  ?  78  PRO A CA  1 
ATOM   613   C  C   . PRO A  1 78  ? -56.336 70.802  7.726   1.00 31.73  ?  78  PRO A C   1 
ATOM   614   O  O   . PRO A  1 78  ? -56.059 71.852  7.132   1.00 30.09  ?  78  PRO A O   1 
ATOM   615   C  CB  . PRO A  1 78  ? -58.815 70.469  7.314   1.00 33.69  ?  78  PRO A CB  1 
ATOM   616   C  CG  . PRO A  1 78  ? -59.218 71.941  7.079   1.00 34.64  ?  78  PRO A CG  1 
ATOM   617   C  CD  . PRO A  1 78  ? -59.189 72.562  8.450   1.00 35.36  ?  78  PRO A CD  1 
ATOM   618   N  N   . PHE A  1 79  ? -55.484 69.777  7.831   1.00 30.27  ?  79  PHE A N   1 
ATOM   619   C  CA  . PHE A  1 79  ? -54.092 69.851  7.338   1.00 28.80  ?  79  PHE A CA  1 
ATOM   620   C  C   . PHE A  1 79  ? -53.646 68.772  6.314   1.00 28.49  ?  79  PHE A C   1 
ATOM   621   O  O   . PHE A  1 79  ? -54.051 67.592  6.385   1.00 29.14  ?  79  PHE A O   1 
ATOM   622   C  CB  . PHE A  1 79  ? -53.125 69.831  8.531   1.00 28.47  ?  79  PHE A CB  1 
ATOM   623   C  CG  . PHE A  1 79  ? -53.046 71.131  9.251   1.00 28.37  ?  79  PHE A CG  1 
ATOM   624   C  CD1 . PHE A  1 79  ? -52.140 72.109  8.844   1.00 27.44  ?  79  PHE A CD1 1 
ATOM   625   C  CD2 . PHE A  1 79  ? -53.909 71.409  10.311  1.00 26.99  ?  79  PHE A CD2 1 
ATOM   626   C  CE1 . PHE A  1 79  ? -52.076 73.341  9.486   1.00 27.15  ?  79  PHE A CE1 1 
ATOM   627   C  CE2 . PHE A  1 79  ? -53.858 72.634  10.964  1.00 25.94  ?  79  PHE A CE2 1 
ATOM   628   C  CZ  . PHE A  1 79  ? -52.935 73.606  10.550  1.00 27.53  ?  79  PHE A CZ  1 
ATOM   629   N  N   . LEU A  1 80  ? -52.784 69.176  5.386   1.00 27.37  ?  80  LEU A N   1 
ATOM   630   C  CA  . LEU A  1 80  ? -52.036 68.259  4.532   1.00 25.81  ?  80  LEU A CA  1 
ATOM   631   C  C   . LEU A  1 80  ? -50.601 68.633  4.797   1.00 25.31  ?  80  LEU A C   1 
ATOM   632   O  O   . LEU A  1 80  ? -50.134 69.713  4.379   1.00 25.10  ?  80  LEU A O   1 
ATOM   633   C  CB  . LEU A  1 80  ? -52.422 68.456  3.047   1.00 25.72  ?  80  LEU A CB  1 
ATOM   634   C  CG  . LEU A  1 80  ? -53.298 67.414  2.334   1.00 24.17  ?  80  LEU A CG  1 
ATOM   635   C  CD1 . LEU A  1 80  ? -54.333 66.782  3.227   1.00 24.44  ?  80  LEU A CD1 1 
ATOM   636   C  CD2 . LEU A  1 80  ? -53.962 67.928  1.044   1.00 24.14  ?  80  LEU A CD2 1 
ATOM   637   N  N   . ARG A  1 81  ? -49.911 67.785  5.556   1.00 24.66  ?  81  ARG A N   1 
ATOM   638   C  CA  . ARG A  1 81  ? -48.581 68.154  6.103   1.00 23.99  ?  81  ARG A CA  1 
ATOM   639   C  C   . ARG A  1 81  ? -47.464 67.368  5.400   1.00 23.78  ?  81  ARG A C   1 
ATOM   640   O  O   . ARG A  1 81  ? -47.358 66.140  5.560   1.00 24.48  ?  81  ARG A O   1 
ATOM   641   C  CB  . ARG A  1 81  ? -48.545 67.930  7.631   1.00 22.89  ?  81  ARG A CB  1 
ATOM   642   C  CG  . ARG A  1 81  ? -47.228 68.327  8.322   1.00 22.78  ?  81  ARG A CG  1 
ATOM   643   C  CD  . ARG A  1 81  ? -47.339 68.241  9.864   1.00 19.58  ?  81  ARG A CD  1 
ATOM   644   N  NE  . ARG A  1 81  ? -46.207 68.735  10.668  1.00 16.93  ?  81  ARG A NE  1 
ATOM   645   C  CZ  . ARG A  1 81  ? -45.144 68.020  11.072  1.00 18.79  ?  81  ARG A CZ  1 
ATOM   646   N  NH1 . ARG A  1 81  ? -44.987 66.753  10.714  1.00 20.11  ?  81  ARG A NH1 1 
ATOM   647   N  NH2 . ARG A  1 81  ? -44.220 68.571  11.859  1.00 17.98  ?  81  ARG A NH2 1 
ATOM   648   N  N   . PHE A  1 82  ? -46.650 68.054  4.613   1.00 22.71  ?  82  PHE A N   1 
ATOM   649   C  CA  . PHE A  1 82  ? -45.607 67.358  3.858   1.00 22.70  ?  82  PHE A CA  1 
ATOM   650   C  C   . PHE A  1 82  ? -44.315 67.292  4.636   1.00 21.79  ?  82  PHE A C   1 
ATOM   651   O  O   . PHE A  1 82  ? -43.816 68.319  5.095   1.00 21.88  ?  82  PHE A O   1 
ATOM   652   C  CB  . PHE A  1 82  ? -45.393 67.999  2.475   1.00 23.12  ?  82  PHE A CB  1 
ATOM   653   C  CG  . PHE A  1 82  ? -46.514 67.708  1.515   1.00 24.50  ?  82  PHE A CG  1 
ATOM   654   C  CD1 . PHE A  1 82  ? -47.723 68.426  1.593   1.00 23.86  ?  82  PHE A CD1 1 
ATOM   655   C  CD2 . PHE A  1 82  ? -46.391 66.684  0.555   1.00 24.27  ?  82  PHE A CD2 1 
ATOM   656   C  CE1 . PHE A  1 82  ? -48.801 68.140  0.718   1.00 23.11  ?  82  PHE A CE1 1 
ATOM   657   C  CE2 . PHE A  1 82  ? -47.452 66.396  -0.322  1.00 22.26  ?  82  PHE A CE2 1 
ATOM   658   C  CZ  . PHE A  1 82  ? -48.655 67.130  -0.244  1.00 22.47  ?  82  PHE A CZ  1 
ATOM   659   N  N   . LEU A  1 83  ? -43.774 66.075  4.758   1.00 20.88  ?  83  LEU A N   1 
ATOM   660   C  CA  . LEU A  1 83  ? -42.609 65.798  5.603   1.00 19.63  ?  83  LEU A CA  1 
ATOM   661   C  C   . LEU A  1 83  ? -41.353 65.414  4.828   1.00 19.31  ?  83  LEU A C   1 
ATOM   662   O  O   . LEU A  1 83  ? -41.388 64.519  3.988   1.00 18.85  ?  83  LEU A O   1 
ATOM   663   C  CB  . LEU A  1 83  ? -42.966 64.701  6.635   1.00 19.43  ?  83  LEU A CB  1 
ATOM   664   C  CG  . LEU A  1 83  ? -41.826 64.441  7.639   1.00 18.79  ?  83  LEU A CG  1 
ATOM   665   C  CD1 . LEU A  1 83  ? -41.332 65.736  8.319   1.00 15.57  ?  83  LEU A CD1 1 
ATOM   666   C  CD2 . LEU A  1 83  ? -42.187 63.399  8.640   1.00 15.73  ?  83  LEU A CD2 1 
ATOM   667   N  N   . PHE A  1 84  ? -40.239 66.062  5.161   1.00 19.19  ?  84  PHE A N   1 
ATOM   668   C  CA  . PHE A  1 84  ? -38.990 65.934  4.429   1.00 18.91  ?  84  PHE A CA  1 
ATOM   669   C  C   . PHE A  1 84  ? -37.786 65.629  5.308   1.00 19.88  ?  84  PHE A C   1 
ATOM   670   O  O   . PHE A  1 84  ? -37.833 65.774  6.507   1.00 20.45  ?  84  PHE A O   1 
ATOM   671   C  CB  . PHE A  1 84  ? -38.690 67.237  3.724   1.00 19.13  ?  84  PHE A CB  1 
ATOM   672   C  CG  . PHE A  1 84  ? -39.672 67.582  2.683   1.00 20.76  ?  84  PHE A CG  1 
ATOM   673   C  CD1 . PHE A  1 84  ? -40.669 68.500  2.948   1.00 20.54  ?  84  PHE A CD1 1 
ATOM   674   C  CD2 . PHE A  1 84  ? -39.622 66.964  1.442   1.00 23.09  ?  84  PHE A CD2 1 
ATOM   675   C  CE1 . PHE A  1 84  ? -41.603 68.817  2.004   1.00 23.58  ?  84  PHE A CE1 1 
ATOM   676   C  CE2 . PHE A  1 84  ? -40.559 67.271  0.474   1.00 25.99  ?  84  PHE A CE2 1 
ATOM   677   C  CZ  . PHE A  1 84  ? -41.555 68.218  0.753   1.00 25.70  ?  84  PHE A CZ  1 
ATOM   678   N  N   . ALA A  1 85  ? -36.681 65.255  4.687   1.00 20.19  ?  85  ALA A N   1 
ATOM   679   C  CA  . ALA A  1 85  ? -35.522 64.816  5.408   1.00 21.38  ?  85  ALA A CA  1 
ATOM   680   C  C   . ALA A  1 85  ? -34.289 65.480  4.813   1.00 22.26  ?  85  ALA A C   1 
ATOM   681   O  O   . ALA A  1 85  ? -34.157 65.613  3.596   1.00 23.21  ?  85  ALA A O   1 
ATOM   682   C  CB  . ALA A  1 85  ? -35.385 63.297  5.322   1.00 20.92  ?  85  ALA A CB  1 
ATOM   683   N  N   . ILE A  1 86  ? -33.391 65.873  5.696   1.00 22.49  ?  86  ILE A N   1 
ATOM   684   C  CA  . ILE A  1 86  ? -32.139 66.480  5.375   1.00 22.51  ?  86  ILE A CA  1 
ATOM   685   C  C   . ILE A  1 86  ? -31.155 65.862  6.355   1.00 22.67  ?  86  ILE A C   1 
ATOM   686   O  O   . ILE A  1 86  ? -31.432 65.884  7.566   1.00 22.67  ?  86  ILE A O   1 
ATOM   687   C  CB  . ILE A  1 86  ? -32.210 67.978  5.677   1.00 22.65  ?  86  ILE A CB  1 
ATOM   688   C  CG1 . ILE A  1 86  ? -33.220 68.632  4.754   1.00 23.77  ?  86  ILE A CG1 1 
ATOM   689   C  CG2 . ILE A  1 86  ? -30.841 68.623  5.550   1.00 21.96  ?  86  ILE A CG2 1 
ATOM   690   C  CD1 . ILE A  1 86  ? -33.491 70.065  5.083   1.00 25.18  ?  86  ILE A CD1 1 
ATOM   691   N  N   . GLU A  1 87  ? -30.059 65.276  5.850   1.00 22.69  ?  87  GLU A N   1 
ATOM   692   C  CA  . GLU A  1 87  ? -28.928 64.861  6.690   1.00 23.43  ?  87  GLU A CA  1 
ATOM   693   C  C   . GLU A  1 87  ? -27.794 65.861  6.512   1.00 25.04  ?  87  GLU A C   1 
ATOM   694   O  O   . GLU A  1 87  ? -27.480 66.211  5.378   1.00 25.50  ?  87  GLU A O   1 
ATOM   695   C  CB  . GLU A  1 87  ? -28.403 63.490  6.302   1.00 22.17  ?  87  GLU A CB  1 
ATOM   696   C  CG  . GLU A  1 87  ? -29.449 62.416  6.190   1.00 22.15  ?  87  GLU A CG  1 
ATOM   697   C  CD  . GLU A  1 87  ? -29.850 61.852  7.544   1.00 22.73  ?  87  GLU A CD  1 
ATOM   698   O  OE1 . GLU A  1 87  ? -30.939 61.229  7.596   1.00 25.37  ?  87  GLU A OE1 1 
ATOM   699   O  OE2 . GLU A  1 87  ? -29.101 62.033  8.543   1.00 16.05  -1 87  GLU A OE2 1 
ATOM   700   N  N   . LEU A  1 88  ? -27.176 66.293  7.616   1.00 25.98  ?  88  LEU A N   1 
ATOM   701   C  CA  . LEU A  1 88  ? -25.992 67.123  7.561   1.00 27.83  ?  88  LEU A CA  1 
ATOM   702   C  C   . LEU A  1 88  ? -24.823 66.507  8.350   1.00 29.38  ?  88  LEU A C   1 
ATOM   703   O  O   . LEU A  1 88  ? -25.037 65.861  9.383   1.00 30.05  ?  88  LEU A O   1 
ATOM   704   C  CB  . LEU A  1 88  ? -26.306 68.508  8.109   1.00 28.21  ?  88  LEU A CB  1 
ATOM   705   C  CG  . LEU A  1 88  ? -27.686 69.134  7.907   1.00 28.21  ?  88  LEU A CG  1 
ATOM   706   C  CD1 . LEU A  1 88  ? -27.871 70.243  8.937   1.00 27.22  ?  88  LEU A CD1 1 
ATOM   707   C  CD2 . LEU A  1 88  ? -27.827 69.665  6.495   1.00 26.84  ?  88  LEU A CD2 1 
ATOM   708   N  N   . GLU A  1 89  ? -23.588 66.733  7.885   1.00 30.92  ?  89  GLU A N   1 
ATOM   709   C  CA  . GLU A  1 89  ? -22.445 65.976  8.396   1.00 32.14  ?  89  GLU A CA  1 
ATOM   710   C  C   . GLU A  1 89  ? -22.251 66.286  9.819   1.00 31.92  ?  89  GLU A C   1 
ATOM   711   O  O   . GLU A  1 89  ? -21.818 65.427  10.589  1.00 32.75  ?  89  GLU A O   1 
ATOM   712   C  CB  . GLU A  1 89  ? -21.153 66.330  7.681   1.00 33.22  ?  89  GLU A CB  1 
ATOM   713   C  CG  . GLU A  1 89  ? -20.709 65.306  6.669   1.00 39.75  ?  89  GLU A CG  1 
ATOM   714   C  CD  . GLU A  1 89  ? -21.726 65.150  5.530   1.00 47.72  ?  89  GLU A CD  1 
ATOM   715   O  OE1 . GLU A  1 89  ? -21.700 66.025  4.632   1.00 48.47  ?  89  GLU A OE1 1 
ATOM   716   O  OE2 . GLU A  1 89  ? -22.536 64.156  5.533   1.00 51.18  -1 89  GLU A OE2 1 
ATOM   717   N  N   . GLN A  1 90  ? -22.508 67.540  10.172  1.00 31.16  ?  90  GLN A N   1 
ATOM   718   C  CA  . GLN A  1 90  ? -22.326 67.944  11.550  1.00 30.60  ?  90  GLN A CA  1 
ATOM   719   C  C   . GLN A  1 90  ? -23.343 68.985  11.899  1.00 30.17  ?  90  GLN A C   1 
ATOM   720   O  O   . GLN A  1 90  ? -23.877 69.679  11.001  1.00 29.68  ?  90  GLN A O   1 
ATOM   721   C  CB  . GLN A  1 90  ? -20.880 68.358  11.900  1.00 29.70  ?  90  GLN A CB  1 
ATOM   722   C  CG  . GLN A  1 90  ? -20.230 69.417  11.024  1.00 32.36  ?  90  GLN A CG  1 
ATOM   723   C  CD  . GLN A  1 90  ? -18.691 69.600  11.281  1.00 35.49  ?  90  GLN A CD  1 
ATOM   724   O  OE1 . GLN A  1 90  ? -18.171 69.269  12.356  1.00 35.39  ?  90  GLN A OE1 1 
ATOM   725   N  NE2 . GLN A  1 90  ? -17.977 70.147  10.281  1.00 34.18  ?  90  GLN A NE2 1 
ATOM   726   N  N   . ILE A  1 91  ? -23.632 69.037  13.201  1.00 29.08  ?  91  ILE A N   1 
ATOM   727   C  CA  . ILE A  1 91  ? -24.485 70.052  13.764  1.00 28.74  ?  91  ILE A CA  1 
ATOM   728   C  C   . ILE A  1 91  ? -23.934 71.397  13.368  1.00 28.34  ?  91  ILE A C   1 
ATOM   729   O  O   . ILE A  1 91  ? -22.699 71.670  13.457  1.00 28.48  ?  91  ILE A O   1 
ATOM   730   C  CB  . ILE A  1 91  ? -24.603 69.915  15.305  1.00 29.51  ?  91  ILE A CB  1 
ATOM   731   C  CG1 . ILE A  1 91  ? -25.526 68.731  15.642  1.00 27.50  ?  91  ILE A CG1 1 
ATOM   732   C  CG2 . ILE A  1 91  ? -25.079 71.239  15.965  1.00 27.42  ?  91  ILE A CG2 1 
ATOM   733   C  CD1 . ILE A  1 91  ? -25.190 68.099  16.950  1.00 26.88  ?  91  ILE A CD1 1 
ATOM   734   N  N   . CYS A  1 92  ? -24.848 72.217  12.881  1.00 27.10  ?  92  CYS A N   1 
ATOM   735   C  CA  . CYS A  1 92  ? -24.462 73.485  12.330  1.00 27.38  ?  92  CYS A CA  1 
ATOM   736   C  C   . CYS A  1 92  ? -25.126 74.601  13.156  1.00 27.93  ?  92  CYS A C   1 
ATOM   737   O  O   . CYS A  1 92  ? -26.240 74.445  13.677  1.00 28.85  ?  92  CYS A O   1 
ATOM   738   C  CB  . CYS A  1 92  ? -24.889 73.549  10.882  1.00 26.60  ?  92  CYS A CB  1 
ATOM   739   S  SG  . CYS A  1 92  ? -26.656 73.494  10.832  1.00 26.38  ?  92  CYS A SG  1 
ATOM   740   N  N   . PRO A  1 93  ? -24.438 75.727  13.300  1.00 28.21  ?  93  PRO A N   1 
ATOM   741   C  CA  . PRO A  1 93  ? -25.007 76.888  13.984  1.00 28.30  ?  93  PRO A CA  1 
ATOM   742   C  C   . PRO A  1 93  ? -26.441 77.189  13.524  1.00 28.05  ?  93  PRO A C   1 
ATOM   743   O  O   . PRO A  1 93  ? -26.812 76.859  12.404  1.00 27.45  ?  93  PRO A O   1 
ATOM   744   C  CB  . PRO A  1 93  ? -24.060 78.018  13.556  1.00 28.59  ?  93  PRO A CB  1 
ATOM   745   C  CG  . PRO A  1 93  ? -23.250 77.450  12.404  1.00 28.39  ?  93  PRO A CG  1 
ATOM   746   C  CD  . PRO A  1 93  ? -23.114 76.020  12.733  1.00 28.08  ?  93  PRO A CD  1 
ATOM   747   N  N   . THR A  1 94  ? -27.254 77.777  14.391  1.00 28.33  ?  94  THR A N   1 
ATOM   748   C  CA  . THR A  1 94  ? -28.626 78.135  14.009  1.00 28.44  ?  94  THR A CA  1 
ATOM   749   C  C   . THR A  1 94  ? -29.038 79.538  14.517  1.00 29.69  ?  94  THR A C   1 
ATOM   750   O  O   . THR A  1 94  ? -28.579 80.010  15.581  1.00 29.22  ?  94  THR A O   1 
ATOM   751   C  CB  . THR A  1 94  ? -29.631 77.134  14.571  1.00 28.22  ?  94  THR A CB  1 
ATOM   752   O  OG1 . THR A  1 94  ? -29.561 77.177  15.989  1.00 28.31  ?  94  THR A OG1 1 
ATOM   753   C  CG2 . THR A  1 94  ? -29.320 75.729  14.142  1.00 27.99  ?  94  THR A CG2 1 
ATOM   754   N  N   . GLN A  1 95  ? -29.936 80.183  13.770  1.00 30.14  ?  95  GLN A N   1 
ATOM   755   C  CA  . GLN A  1 95  ? -30.419 81.499  14.106  1.00 30.62  ?  95  GLN A CA  1 
ATOM   756   C  C   . GLN A  1 95  ? -31.809 81.778  13.542  1.00 29.94  ?  95  GLN A C   1 
ATOM   757   O  O   . GLN A  1 95  ? -31.971 82.156  12.383  1.00 30.02  ?  95  GLN A O   1 
ATOM   758   C  CB  . GLN A  1 95  ? -29.442 82.543  13.606  1.00 30.93  ?  95  GLN A CB  1 
ATOM   759   C  CG  . GLN A  1 95  ? -29.911 83.977  13.812  1.00 36.47  ?  95  GLN A CG  1 
ATOM   760   C  CD  . GLN A  1 95  ? -28.722 84.896  13.952  1.00 45.65  ?  95  GLN A CD  1 
ATOM   761   O  OE1 . GLN A  1 95  ? -28.069 84.941  15.034  1.00 48.39  ?  95  GLN A OE1 1 
ATOM   762   N  NE2 . GLN A  1 95  ? -28.378 85.606  12.845  1.00 45.90  ?  95  GLN A NE2 1 
ATOM   763   N  N   . PRO A  1 96  ? -32.837 81.611  14.368  1.00 29.76  ?  96  PRO A N   1 
ATOM   764   C  CA  . PRO A  1 96  ? -34.189 81.897  13.866  1.00 29.47  ?  96  PRO A CA  1 
ATOM   765   C  C   . PRO A  1 96  ? -34.298 83.310  13.278  1.00 29.25  ?  96  PRO A C   1 
ATOM   766   O  O   . PRO A  1 96  ? -33.699 84.244  13.784  1.00 29.50  ?  96  PRO A O   1 
ATOM   767   C  CB  . PRO A  1 96  ? -35.036 81.776  15.118  1.00 29.51  ?  96  PRO A CB  1 
ATOM   768   C  CG  . PRO A  1 96  ? -34.283 80.786  15.942  1.00 29.92  ?  96  PRO A CG  1 
ATOM   769   C  CD  . PRO A  1 96  ? -32.835 81.068  15.734  1.00 28.94  ?  96  PRO A CD  1 
ATOM   770   N  N   . HIS A  1 97  ? -35.039 83.463  12.204  1.00 28.90  ?  97  HIS A N   1 
ATOM   771   C  CA  . HIS A  1 97  ? -35.249 84.784  11.664  1.00 28.91  ?  97  HIS A CA  1 
ATOM   772   C  C   . HIS A  1 97  ? -36.696 85.134  11.782  1.00 29.20  ?  97  HIS A C   1 
ATOM   773   O  O   . HIS A  1 97  ? -37.199 85.896  10.991  1.00 29.15  ?  97  HIS A O   1 
ATOM   774   C  CB  . HIS A  1 97  ? -34.776 84.888  10.205  1.00 29.05  ?  97  HIS A CB  1 
ATOM   775   C  CG  . HIS A  1 97  ? -33.304 84.672  10.055  1.00 30.08  ?  97  HIS A CG  1 
ATOM   776   N  ND1 . HIS A  1 97  ? -32.375 85.601  10.467  1.00 31.19  ?  97  HIS A ND1 1 
ATOM   777   C  CD2 . HIS A  1 97  ? -32.598 83.597  9.630   1.00 31.20  ?  97  HIS A CD2 1 
ATOM   778   C  CE1 . HIS A  1 97  ? -31.160 85.120  10.267  1.00 32.44  ?  97  HIS A CE1 1 
ATOM   779   N  NE2 . HIS A  1 97  ? -31.267 83.902  9.766   1.00 31.63  ?  97  HIS A NE2 1 
ATOM   780   N  N   . ASP A  1 98  ? -37.370 84.574  12.778  1.00 29.71  ?  98  ASP A N   1 
ATOM   781   C  CA  . ASP A  1 98  ? -38.783 84.805  12.928  1.00 30.49  ?  98  ASP A CA  1 
ATOM   782   C  C   . ASP A  1 98  ? -39.129 84.990  14.377  1.00 31.76  ?  98  ASP A C   1 
ATOM   783   O  O   . ASP A  1 98  ? -38.623 84.267  15.243  1.00 32.39  ?  98  ASP A O   1 
ATOM   784   C  CB  . ASP A  1 98  ? -39.607 83.658  12.353  1.00 30.39  ?  98  ASP A CB  1 
ATOM   785   C  CG  . ASP A  1 98  ? -41.119 83.957  12.358  1.00 30.86  ?  98  ASP A CG  1 
ATOM   786   O  OD1 . ASP A  1 98  ? -41.641 84.401  13.409  1.00 31.98  ?  98  ASP A OD1 1 
ATOM   787   O  OD2 . ASP A  1 98  ? -41.781 83.763  11.311  1.00 32.15  -1 98  ASP A OD2 1 
ATOM   788   N  N   . SER A  1 99  ? -40.011 85.954  14.643  1.00 32.69  ?  99  SER A N   1 
ATOM   789   C  CA  . SER A  1 99  ? -40.311 86.304  16.024  1.00 33.44  ?  99  SER A CA  1 
ATOM   790   C  C   . SER A  1 99  ? -41.005 85.134  16.699  1.00 33.07  ?  99  SER A C   1 
ATOM   791   O  O   . SER A  1 99  ? -40.867 84.961  17.903  1.00 33.61  ?  99  SER A O   1 
ATOM   792   C  CB  . SER A  1 99  ? -41.144 87.594  16.115  1.00 33.61  ?  99  SER A CB  1 
ATOM   793   O  OG  . SER A  1 99  ? -42.505 87.380  15.757  1.00 35.24  ?  99  SER A OG  1 
ATOM   794   N  N   . ASP A  1 100 ? -41.705 84.308  15.918  1.00 32.39  ?  100 ASP A N   1 
ATOM   795   C  CA  . ASP A  1 100 ? -42.458 83.156  16.469  1.00 32.15  ?  100 ASP A CA  1 
ATOM   796   C  C   . ASP A  1 100 ? -41.634 82.131  17.277  1.00 30.67  ?  100 ASP A C   1 
ATOM   797   O  O   . ASP A  1 100 ? -42.191 81.380  18.031  1.00 30.29  ?  100 ASP A O   1 
ATOM   798   C  CB  . ASP A  1 100 ? -43.190 82.401  15.341  1.00 33.07  ?  100 ASP A CB  1 
ATOM   799   C  CG  . ASP A  1 100 ? -44.332 83.223  14.687  1.00 36.22  ?  100 ASP A CG  1 
ATOM   800   O  OD1 . ASP A  1 100 ? -44.654 82.945  13.483  1.00 37.47  ?  100 ASP A OD1 1 
ATOM   801   O  OD2 . ASP A  1 100 ? -44.898 84.137  15.370  1.00 37.59  -1 100 ASP A OD2 1 
ATOM   802   N  N   . ILE A  1 101 ? -40.316 82.113  17.110  1.00 29.81  ?  101 ILE A N   1 
ATOM   803   C  CA  . ILE A  1 101 ? -39.481 80.975  17.465  1.00 28.75  ?  101 ILE A CA  1 
ATOM   804   C  C   . ILE A  1 101 ? -38.548 81.408  18.561  1.00 29.49  ?  101 ILE A C   1 
ATOM   805   O  O   . ILE A  1 101 ? -37.736 82.306  18.367  1.00 30.93  ?  101 ILE A O   1 
ATOM   806   C  CB  . ILE A  1 101 ? -38.645 80.509  16.214  1.00 28.22  ?  101 ILE A CB  1 
ATOM   807   C  CG1 . ILE A  1 101 ? -39.568 80.088  15.072  1.00 27.35  ?  101 ILE A CG1 1 
ATOM   808   C  CG2 . ILE A  1 101 ? -37.583 79.427  16.535  1.00 25.80  ?  101 ILE A CG2 1 
ATOM   809   C  CD1 . ILE A  1 101 ? -40.294 78.791  15.282  1.00 26.07  ?  101 ILE A CD1 1 
ATOM   810   N  N   . ASP A  1 102 ? -38.631 80.780  19.715  1.00 29.26  ?  102 ASP A N   1 
ATOM   811   C  CA  . ASP A  1 102 ? -37.785 81.208  20.802  1.00 29.88  ?  102 ASP A CA  1 
ATOM   812   C  C   . ASP A  1 102 ? -36.362 80.740  20.544  1.00 30.10  ?  102 ASP A C   1 
ATOM   813   O  O   . ASP A  1 102 ? -35.420 81.491  20.694  1.00 30.35  ?  102 ASP A O   1 
ATOM   814   C  CB  . ASP A  1 102 ? -38.390 80.799  22.160  1.00 29.24  ?  102 ASP A CB  1 
ATOM   815   C  CG  . ASP A  1 102 ? -39.804 81.382  22.345  1.00 31.13  ?  102 ASP A CG  1 
ATOM   816   O  OD1 . ASP A  1 102 ? -39.950 82.619  22.197  1.00 30.33  ?  102 ASP A OD1 1 
ATOM   817   O  OD2 . ASP A  1 102 ? -40.778 80.621  22.588  1.00 33.36  -1 102 ASP A OD2 1 
ATOM   818   N  N   . CYS A  1 103 ? -36.202 79.511  20.086  1.00 30.71  ?  103 CYS A N   1 
ATOM   819   C  CA  . CYS A  1 103 ? -34.861 79.004  19.795  1.00 30.21  ?  103 CYS A CA  1 
ATOM   820   C  C   . CYS A  1 103 ? -34.924 77.600  19.159  1.00 29.46  ?  103 CYS A C   1 
ATOM   821   O  O   . CYS A  1 103 ? -35.995 77.019  19.009  1.00 28.89  ?  103 CYS A O   1 
ATOM   822   C  CB  . CYS A  1 103 ? -34.010 79.002  21.076  1.00 29.83  ?  103 CYS A CB  1 
ATOM   823   S  SG  . CYS A  1 103 ? -34.600 77.854  22.327  1.00 31.99  ?  103 CYS A SG  1 
ATOM   824   N  N   . CYS A  1 104 ? -33.756 77.093  18.785  1.00 29.03  ?  104 CYS A N   1 
ATOM   825   C  CA  . CYS A  1 104 ? -33.593 75.783  18.224  1.00 28.57  ?  104 CYS A CA  1 
ATOM   826   C  C   . CYS A  1 104 ? -32.819 74.919  19.161  1.00 27.91  ?  104 CYS A C   1 
ATOM   827   O  O   . CYS A  1 104 ? -31.853 75.368  19.759  1.00 27.18  ?  104 CYS A O   1 
ATOM   828   C  CB  . CYS A  1 104 ? -32.808 75.897  16.952  1.00 29.10  ?  104 CYS A CB  1 
ATOM   829   S  SG  . CYS A  1 104 ? -33.644 76.939  15.836  1.00 32.53  ?  104 CYS A SG  1 
ATOM   830   N  N   . ARG A  1 105 ? -33.266 73.673  19.295  1.00 28.12  ?  105 ARG A N   1 
ATOM   831   C  CA  . ARG A  1 105 ? -32.600 72.695  20.127  1.00 28.21  ?  105 ARG A CA  1 
ATOM   832   C  C   . ARG A  1 105 ? -32.286 71.562  19.199  1.00 27.33  ?  105 ARG A C   1 
ATOM   833   O  O   . ARG A  1 105 ? -33.060 71.294  18.279  1.00 26.91  ?  105 ARG A O   1 
ATOM   834   C  CB  . ARG A  1 105 ? -33.511 72.171  21.244  1.00 29.36  ?  105 ARG A CB  1 
ATOM   835   C  CG  . ARG A  1 105 ? -34.603 73.124  21.842  1.00 32.56  ?  105 ARG A CG  1 
ATOM   836   C  CD  . ARG A  1 105 ? -34.103 74.069  22.942  1.00 39.48  ?  105 ARG A CD  1 
ATOM   837   N  NE  . ARG A  1 105 ? -33.511 73.341  24.063  1.00 45.01  ?  105 ARG A NE  1 
ATOM   838   C  CZ  . ARG A  1 105 ? -33.880 73.483  25.340  1.00 47.88  ?  105 ARG A CZ  1 
ATOM   839   N  NH1 . ARG A  1 105 ? -34.846 74.351  25.658  1.00 48.68  ?  105 ARG A NH1 1 
ATOM   840   N  NH2 . ARG A  1 105 ? -33.282 72.763  26.299  1.00 45.58  ?  105 ARG A NH2 1 
ATOM   841   N  N   . TRP A  1 106 ? -31.130 70.935  19.410  1.00 27.01  ?  106 TRP A N   1 
ATOM   842   C  CA  . TRP A  1 106 ? -30.775 69.667  18.770  1.00 26.35  ?  106 TRP A CA  1 
ATOM   843   C  C   . TRP A  1 106 ? -30.957 68.564  19.804  1.00 26.89  ?  106 TRP A C   1 
ATOM   844   O  O   . TRP A  1 106 ? -30.321 68.554  20.878  1.00 26.75  ?  106 TRP A O   1 
ATOM   845   C  CB  . TRP A  1 106 ? -29.322 69.665  18.290  1.00 26.00  ?  106 TRP A CB  1 
ATOM   846   C  CG  . TRP A  1 106 ? -29.061 70.577  17.149  1.00 25.98  ?  106 TRP A CG  1 
ATOM   847   C  CD1 . TRP A  1 106 ? -28.708 71.896  17.213  1.00 24.90  ?  106 TRP A CD1 1 
ATOM   848   C  CD2 . TRP A  1 106 ? -29.130 70.250  15.756  1.00 25.35  ?  106 TRP A CD2 1 
ATOM   849   N  NE1 . TRP A  1 106 ? -28.552 72.408  15.954  1.00 24.78  ?  106 TRP A NE1 1 
ATOM   850   C  CE2 . TRP A  1 106 ? -28.811 71.420  15.038  1.00 25.78  ?  106 TRP A CE2 1 
ATOM   851   C  CE3 . TRP A  1 106 ? -29.442 69.081  15.044  1.00 24.84  ?  106 TRP A CE3 1 
ATOM   852   C  CZ2 . TRP A  1 106 ? -28.789 71.455  13.642  1.00 25.12  ?  106 TRP A CZ2 1 
ATOM   853   C  CZ3 . TRP A  1 106 ? -29.427 69.111  13.656  1.00 21.60  ?  106 TRP A CZ3 1 
ATOM   854   C  CH2 . TRP A  1 106 ? -29.102 70.287  12.972  1.00 25.72  ?  106 TRP A CH2 1 
ATOM   855   N  N   . VAL A  1 107 ? -31.807 67.604  19.476  1.00 27.08  ?  107 VAL A N   1 
ATOM   856   C  CA  . VAL A  1 107 ? -32.332 66.714  20.506  1.00 26.56  ?  107 VAL A CA  1 
ATOM   857   C  C   . VAL A  1 107 ? -32.419 65.265  20.056  1.00 25.81  ?  107 VAL A C   1 
ATOM   858   O  O   . VAL A  1 107 ? -32.597 65.006  18.889  1.00 25.86  ?  107 VAL A O   1 
ATOM   859   C  CB  . VAL A  1 107 ? -33.681 67.279  20.928  1.00 26.48  ?  107 VAL A CB  1 
ATOM   860   C  CG1 . VAL A  1 107 ? -34.691 66.209  21.155  1.00 27.47  ?  107 VAL A CG1 1 
ATOM   861   C  CG2 . VAL A  1 107 ? -33.481 68.172  22.133  1.00 26.57  ?  107 VAL A CG2 1 
ATOM   862   N  N   . SER A  1 108 ? -32.275 64.324  20.979  1.00 25.62  ?  108 SER A N   1 
ATOM   863   C  CA  . SER A  1 108 ? -32.349 62.891  20.633  1.00 25.25  ?  108 SER A CA  1 
ATOM   864   C  C   . SER A  1 108 ? -33.758 62.416  20.245  1.00 25.31  ?  108 SER A C   1 
ATOM   865   O  O   . SER A  1 108 ? -34.779 62.991  20.640  1.00 25.28  ?  108 SER A O   1 
ATOM   866   C  CB  . SER A  1 108 ? -31.826 62.049  21.787  1.00 24.75  ?  108 SER A CB  1 
ATOM   867   O  OG  . SER A  1 108 ? -32.860 61.894  22.740  1.00 24.40  ?  108 SER A OG  1 
ATOM   868   N  N   . ALA A  1 109 ? -33.827 61.341  19.479  1.00 25.72  ?  109 ALA A N   1 
ATOM   869   C  CA  . ALA A  1 109 ? -35.139 60.870  19.024  1.00 26.20  ?  109 ALA A CA  1 
ATOM   870   C  C   . ALA A  1 109 ? -36.004 60.465  20.215  1.00 26.83  ?  109 ALA A C   1 
ATOM   871   O  O   . ALA A  1 109 ? -37.207 60.695  20.249  1.00 27.08  ?  109 ALA A O   1 
ATOM   872   C  CB  . ALA A  1 109 ? -34.973 59.744  18.097  1.00 25.16  ?  109 ALA A CB  1 
ATOM   873   N  N   . GLU A  1 110 ? -35.364 59.888  21.221  1.00 28.04  ?  110 GLU A N   1 
ATOM   874   C  CA  . GLU A  1 110 ? -36.071 59.389  22.402  1.00 28.80  ?  110 GLU A CA  1 
ATOM   875   C  C   . GLU A  1 110 ? -36.578 60.573  23.202  1.00 27.69  ?  110 GLU A C   1 
ATOM   876   O  O   . GLU A  1 110 ? -37.687 60.553  23.726  1.00 27.57  ?  110 GLU A O   1 
ATOM   877   C  CB  . GLU A  1 110 ? -35.225 58.357  23.188  1.00 29.90  ?  110 GLU A CB  1 
ATOM   878   C  CG  . GLU A  1 110 ? -33.674 58.195  22.712  1.00 34.87  ?  110 GLU A CG  1 
ATOM   879   C  CD  . GLU A  1 110 ? -33.450 57.710  21.219  1.00 40.57  ?  110 GLU A CD  1 
ATOM   880   O  OE1 . GLU A  1 110 ? -32.836 58.488  20.424  1.00 39.53  ?  110 GLU A OE1 1 
ATOM   881   O  OE2 . GLU A  1 110 ? -33.872 56.562  20.841  1.00 44.08  -1 110 GLU A OE2 1 
ATOM   882   N  N   . GLU A  1 111 ? -35.821 61.658  23.195  1.00 26.86  ?  111 GLU A N   1 
ATOM   883   C  CA  . GLU A  1 111 ? -36.304 62.873  23.811  1.00 26.51  ?  111 GLU A CA  1 
ATOM   884   C  C   . GLU A  1 111 ? -37.539 63.467  23.128  1.00 26.22  ?  111 GLU A C   1 
ATOM   885   O  O   . GLU A  1 111 ? -38.379 64.131  23.776  1.00 25.43  ?  111 GLU A O   1 
ATOM   886   C  CB  . GLU A  1 111 ? -35.231 63.910  23.794  1.00 26.68  ?  111 GLU A CB  1 
ATOM   887   C  CG  . GLU A  1 111 ? -34.390 63.925  24.988  1.00 28.86  ?  111 GLU A CG  1 
ATOM   888   C  CD  . GLU A  1 111 ? -33.436 65.049  24.915  1.00 34.64  ?  111 GLU A CD  1 
ATOM   889   O  OE1 . GLU A  1 111 ? -32.489 64.984  24.064  1.00 30.37  ?  111 GLU A OE1 1 
ATOM   890   O  OE2 . GLU A  1 111 ? -33.693 66.016  25.692  1.00 40.18  -1 111 GLU A OE2 1 
ATOM   891   N  N   . ILE A  1 112 ? -37.612 63.292  21.813  1.00 25.60  ?  112 ILE A N   1 
ATOM   892   C  CA  . ILE A  1 112 ? -38.748 63.787  21.106  1.00 25.26  ?  112 ILE A CA  1 
ATOM   893   C  C   . ILE A  1 112 ? -39.925 62.903  21.445  1.00 25.48  ?  112 ILE A C   1 
ATOM   894   O  O   . ILE A  1 112 ? -40.950 63.391  21.911  1.00 25.52  ?  112 ILE A O   1 
ATOM   895   C  CB  . ILE A  1 112 ? -38.495 63.963  19.590  1.00 25.18  ?  112 ILE A CB  1 
ATOM   896   C  CG1 . ILE A  1 112 ? -37.717 65.269  19.340  1.00 24.24  ?  112 ILE A CG1 1 
ATOM   897   C  CG2 . ILE A  1 112 ? -39.826 64.107  18.848  1.00 24.30  ?  112 ILE A CG2 1 
ATOM   898   C  CD1 . ILE A  1 112 ? -36.799 65.186  18.163  1.00 22.45  ?  112 ILE A CD1 1 
ATOM   899   N  N   . LEU A  1 113 ? -39.755 61.602  21.284  1.00 25.68  ?  113 LEU A N   1 
ATOM   900   C  CA  . LEU A  1 113 ? -40.842 60.698  21.538  1.00 26.87  ?  113 LEU A CA  1 
ATOM   901   C  C   . LEU A  1 113 ? -41.360 60.710  22.987  1.00 28.20  ?  113 LEU A C   1 
ATOM   902   O  O   . LEU A  1 113 ? -42.541 60.443  23.207  1.00 29.55  ?  113 LEU A O   1 
ATOM   903   C  CB  . LEU A  1 113 ? -40.388 59.299  21.208  1.00 26.89  ?  113 LEU A CB  1 
ATOM   904   C  CG  . LEU A  1 113 ? -40.512 58.637  19.848  1.00 26.28  ?  113 LEU A CG  1 
ATOM   905   C  CD1 . LEU A  1 113 ? -40.917 59.556  18.663  1.00 24.77  ?  113 LEU A CD1 1 
ATOM   906   C  CD2 . LEU A  1 113 ? -39.162 57.942  19.654  1.00 24.61  ?  113 LEU A CD2 1 
ATOM   907   N  N   . GLN A  1 114 ? -40.501 60.997  23.963  1.00 28.14  ?  114 GLN A N   1 
ATOM   908   C  CA  . GLN A  1 114 ? -40.914 61.039  25.374  1.00 29.22  ?  114 GLN A CA  1 
ATOM   909   C  C   . GLN A  1 114 ? -41.523 62.366  25.855  1.00 28.53  ?  114 GLN A C   1 
ATOM   910   O  O   . GLN A  1 114 ? -41.922 62.461  27.033  1.00 27.46  ?  114 GLN A O   1 
ATOM   911   C  CB  . GLN A  1 114 ? -39.708 60.769  26.285  1.00 29.47  ?  114 GLN A CB  1 
ATOM   912   C  CG  . GLN A  1 114 ? -39.315 59.300  26.401  1.00 35.08  ?  114 GLN A CG  1 
ATOM   913   C  CD  . GLN A  1 114 ? -38.185 59.081  27.405  1.00 41.08  ?  114 GLN A CD  1 
ATOM   914   O  OE1 . GLN A  1 114 ? -38.180 58.089  28.130  1.00 42.18  ?  114 GLN A OE1 1 
ATOM   915   N  NE2 . GLN A  1 114 ? -37.225 60.023  27.461  1.00 45.92  ?  114 GLN A NE2 1 
ATOM   916   N  N   . ALA A  1 115 ? -41.558 63.384  24.986  1.00 27.45  ?  115 ALA A N   1 
ATOM   917   C  CA  . ALA A  1 115 ? -41.727 64.765  25.445  1.00 27.07  ?  115 ALA A CA  1 
ATOM   918   C  C   . ALA A  1 115 ? -43.167 65.153  25.770  1.00 26.92  ?  115 ALA A C   1 
ATOM   919   O  O   . ALA A  1 115 ? -44.086 64.713  25.121  1.00 26.78  ?  115 ALA A O   1 
ATOM   920   C  CB  . ALA A  1 115 ? -41.145 65.718  24.438  1.00 26.77  ?  115 ALA A CB  1 
ATOM   921   N  N   . SER A  1 116 ? -43.378 66.001  26.757  1.00 27.18  ?  116 SER A N   1 
ATOM   922   C  CA  . SER A  1 116 ? -44.750 66.377  27.033  1.00 27.88  ?  116 SER A CA  1 
ATOM   923   C  C   . SER A  1 116 ? -45.108 67.735  26.437  1.00 27.86  ?  116 SER A C   1 
ATOM   924   O  O   . SER A  1 116 ? -46.201 68.287  26.730  1.00 29.02  ?  116 SER A O   1 
ATOM   925   C  CB  . SER A  1 116 ? -45.046 66.320  28.543  1.00 28.56  ?  116 SER A CB  1 
ATOM   926   O  OG  . SER A  1 116 ? -44.066 67.017  29.317  1.00 29.07  ?  116 SER A OG  1 
ATOM   927   N  N   . ASN A  1 117 ? -44.234 68.281  25.590  1.00 26.31  ?  117 ASN A N   1 
ATOM   928   C  CA  . ASN A  1 117 ? -44.502 69.622  25.097  1.00 26.07  ?  117 ASN A CA  1 
ATOM   929   C  C   . ASN A  1 117 ? -44.624 69.707  23.584  1.00 25.68  ?  117 ASN A C   1 
ATOM   930   O  O   . ASN A  1 117 ? -44.487 70.771  22.986  1.00 26.66  ?  117 ASN A O   1 
ATOM   931   C  CB  . ASN A  1 117 ? -43.449 70.603  25.597  1.00 25.55  ?  117 ASN A CB  1 
ATOM   932   C  CG  . ASN A  1 117 ? -42.074 70.225  25.143  1.00 27.16  ?  117 ASN A CG  1 
ATOM   933   O  OD1 . ASN A  1 117 ? -41.680 69.048  25.216  1.00 26.91  ?  117 ASN A OD1 1 
ATOM   934   N  ND2 . ASN A  1 117 ? -41.324 71.207  24.659  1.00 27.52  ?  117 ASN A ND2 1 
ATOM   935   N  N   . LEU A  1 118 ? -44.900 68.610  22.933  1.00 24.87  ?  118 LEU A N   1 
ATOM   936   C  CA  . LEU A  1 118 ? -44.887 68.683  21.495  1.00 24.30  ?  118 LEU A CA  1 
ATOM   937   C  C   . LEU A  1 118 ? -46.100 69.502  21.031  1.00 25.19  ?  118 LEU A C   1 
ATOM   938   O  O   . LEU A  1 118 ? -47.187 69.397  21.589  1.00 24.18  ?  118 LEU A O   1 
ATOM   939   C  CB  . LEU A  1 118 ? -44.843 67.281  20.883  1.00 24.10  ?  118 LEU A CB  1 
ATOM   940   C  CG  . LEU A  1 118 ? -43.737 66.334  21.383  1.00 21.91  ?  118 LEU A CG  1 
ATOM   941   C  CD1 . LEU A  1 118 ? -43.759 65.062  20.572  1.00 17.18  ?  118 LEU A CD1 1 
ATOM   942   C  CD2 . LEU A  1 118 ? -42.339 66.996  21.362  1.00 15.95  ?  118 LEU A CD2 1 
ATOM   943   N  N   . ARG A  1 119 ? -45.849 70.337  20.023  1.00 25.98  ?  119 ARG A N   1 
ATOM   944   C  CA  . ARG A  1 119 ? -46.795 71.209  19.370  1.00 26.05  ?  119 ARG A CA  1 
ATOM   945   C  C   . ARG A  1 119 ? -48.011 70.477  18.826  1.00 26.14  ?  119 ARG A C   1 
ATOM   946   O  O   . ARG A  1 119 ? -49.112 71.007  18.824  1.00 26.69  ?  119 ARG A O   1 
ATOM   947   C  CB  . ARG A  1 119 ? -46.066 71.883  18.216  1.00 26.20  ?  119 ARG A CB  1 
ATOM   948   C  CG  . ARG A  1 119 ? -46.898 72.872  17.447  1.00 28.77  ?  119 ARG A CG  1 
ATOM   949   C  CD  . ARG A  1 119 ? -47.086 74.178  18.236  1.00 32.46  ?  119 ARG A CD  1 
ATOM   950   N  NE  . ARG A  1 119 ? -47.833 75.161  17.456  1.00 37.37  ?  119 ARG A NE  1 
ATOM   951   C  CZ  . ARG A  1 119 ? -47.333 75.835  16.415  1.00 38.87  ?  119 ARG A CZ  1 
ATOM   952   N  NH1 . ARG A  1 119 ? -46.074 75.648  16.000  1.00 38.80  ?  119 ARG A NH1 1 
ATOM   953   N  NH2 . ARG A  1 119 ? -48.099 76.700  15.774  1.00 37.28  ?  119 ARG A NH2 1 
ATOM   954   N  N   . SER A  1 120 ? -47.810 69.267  18.334  1.00 26.03  ?  120 SER A N   1 
ATOM   955   C  CA  . SER A  1 120 ? -48.896 68.461  17.837  1.00 25.75  ?  120 SER A CA  1 
ATOM   956   C  C   . SER A  1 120 ? -48.375 67.065  17.930  1.00 25.63  ?  120 SER A C   1 
ATOM   957   O  O   . SER A  1 120 ? -47.171 66.855  17.993  1.00 26.21  ?  120 SER A O   1 
ATOM   958   C  CB  . SER A  1 120 ? -49.132 68.773  16.373  1.00 26.12  ?  120 SER A CB  1 
ATOM   959   O  OG  . SER A  1 120 ? -48.087 68.228  15.571  1.00 27.47  ?  120 SER A OG  1 
ATOM   960   N  N   . PRO A  1 121 ? -49.265 66.082  17.892  1.00 25.65  ?  121 PRO A N   1 
ATOM   961   C  CA  . PRO A  1 121 ? -48.766 64.715  17.937  1.00 25.20  ?  121 PRO A CA  1 
ATOM   962   C  C   . PRO A  1 121 ? -48.011 64.306  16.658  1.00 24.51  ?  121 PRO A C   1 
ATOM   963   O  O   . PRO A  1 121 ? -47.381 63.255  16.636  1.00 24.19  ?  121 PRO A O   1 
ATOM   964   C  CB  . PRO A  1 121 ? -50.056 63.901  18.089  1.00 25.46  ?  121 PRO A CB  1 
ATOM   965   C  CG  . PRO A  1 121 ? -51.078 64.713  17.377  1.00 25.82  ?  121 PRO A CG  1 
ATOM   966   C  CD  . PRO A  1 121 ? -50.736 66.128  17.772  1.00 25.84  ?  121 PRO A CD  1 
ATOM   967   N  N   . LEU A  1 122 ? -48.068 65.117  15.603  1.00 23.50  ?  122 LEU A N   1 
ATOM   968   C  CA  . LEU A  1 122 ? -47.321 64.773  14.392  1.00 23.10  ?  122 LEU A CA  1 
ATOM   969   C  C   . LEU A  1 122 ? -45.831 64.956  14.542  1.00 22.79  ?  122 LEU A C   1 
ATOM   970   O  O   . LEU A  1 122 ? -45.073 64.519  13.666  1.00 23.17  ?  122 LEU A O   1 
ATOM   971   C  CB  . LEU A  1 122 ? -47.801 65.547  13.165  1.00 22.86  ?  122 LEU A CB  1 
ATOM   972   C  CG  . LEU A  1 122 ? -49.187 65.099  12.673  1.00 24.54  ?  122 LEU A CG  1 
ATOM   973   C  CD1 . LEU A  1 122 ? -49.843 66.144  11.783  1.00 22.13  ?  122 LEU A CD1 1 
ATOM   974   C  CD2 . LEU A  1 122 ? -49.034 63.801  11.935  1.00 25.11  ?  122 LEU A CD2 1 
ATOM   975   N  N   . VAL A  1 123 ? -45.407 65.634  15.610  1.00 22.10  ?  123 VAL A N   1 
ATOM   976   C  CA  . VAL A  1 123 ? -43.978 65.921  15.803  1.00 21.83  ?  123 VAL A CA  1 
ATOM   977   C  C   . VAL A  1 123 ? -43.270 64.622  16.160  1.00 21.96  ?  123 VAL A C   1 
ATOM   978   O  O   . VAL A  1 123 ? -42.182 64.344  15.679  1.00 22.38  ?  123 VAL A O   1 
ATOM   979   C  CB  . VAL A  1 123 ? -43.741 67.012  16.892  1.00 21.59  ?  123 VAL A CB  1 
ATOM   980   C  CG1 . VAL A  1 123 ? -42.293 67.198  17.174  1.00 17.81  ?  123 VAL A CG1 1 
ATOM   981   C  CG2 . VAL A  1 123 ? -44.363 68.333  16.459  1.00 21.11  ?  123 VAL A CG2 1 
ATOM   982   N  N   . ALA A  1 124 ? -43.914 63.838  17.011  1.00 22.16  ?  124 ALA A N   1 
ATOM   983   C  CA  . ALA A  1 124 ? -43.405 62.527  17.429  1.00 22.79  ?  124 ALA A CA  1 
ATOM   984   C  C   . ALA A  1 124 ? -43.532 61.476  16.298  1.00 22.59  ?  124 ALA A C   1 
ATOM   985   O  O   . ALA A  1 124 ? -42.583 60.726  16.025  1.00 22.92  ?  124 ALA A O   1 
ATOM   986   C  CB  . ALA A  1 124 ? -44.121 62.046  18.709  1.00 21.96  ?  124 ALA A CB  1 
ATOM   987   N  N   . GLU A  1 125 ? -44.682 61.458  15.637  1.00 21.40  ?  125 GLU A N   1 
ATOM   988   C  CA  . GLU A  1 125 ? -44.882 60.577  14.497  1.00 21.05  ?  125 GLU A CA  1 
ATOM   989   C  C   . GLU A  1 125 ? -43.829 60.795  13.438  1.00 20.27  ?  125 GLU A C   1 
ATOM   990   O  O   . GLU A  1 125 ? -43.355 59.828  12.819  1.00 20.45  ?  125 GLU A O   1 
ATOM   991   C  CB  . GLU A  1 125 ? -46.240 60.803  13.871  1.00 20.32  ?  125 GLU A CB  1 
ATOM   992   C  CG  . GLU A  1 125 ? -46.544 59.792  12.819  1.00 24.90  ?  125 GLU A CG  1 
ATOM   993   C  CD  . GLU A  1 125 ? -46.624 58.367  13.369  1.00 31.31  ?  125 GLU A CD  1 
ATOM   994   O  OE1 . GLU A  1 125 ? -46.520 57.442  12.533  1.00 35.69  ?  125 GLU A OE1 1 
ATOM   995   O  OE2 . GLU A  1 125 ? -46.793 58.167  14.609  1.00 30.66  -1 125 GLU A OE2 1 
ATOM   996   N  N   . SER A  1 126 ? -43.492 62.065  13.209  1.00 19.03  ?  126 SER A N   1 
ATOM   997   C  CA  . SER A  1 126 ? -42.485 62.436  12.247  1.00 18.01  ?  126 SER A CA  1 
ATOM   998   C  C   . SER A  1 126 ? -41.179 61.705  12.525  1.00 17.90  ?  126 SER A C   1 
ATOM   999   O  O   . SER A  1 126 ? -40.477 61.304  11.588  1.00 17.34  ?  126 SER A O   1 
ATOM   1000  C  CB  . SER A  1 126 ? -42.255 63.947  12.261  1.00 18.33  ?  126 SER A CB  1 
ATOM   1001  O  OG  . SER A  1 126 ? -43.327 64.628  11.608  1.00 20.33  ?  126 SER A OG  1 
ATOM   1002  N  N   . ILE A  1 127 ? -40.855 61.517  13.805  1.00 17.32  ?  127 ILE A N   1 
ATOM   1003  C  CA  . ILE A  1 127 ? -39.609 60.868  14.153  1.00 17.20  ?  127 ILE A CA  1 
ATOM   1004  C  C   . ILE A  1 127 ? -39.769 59.363  13.825  1.00 17.59  ?  127 ILE A C   1 
ATOM   1005  O  O   . ILE A  1 127 ? -38.858 58.704  13.246  1.00 17.39  ?  127 ILE A O   1 
ATOM   1006  C  CB  . ILE A  1 127 ? -39.262 61.140  15.627  1.00 17.36  ?  127 ILE A CB  1 
ATOM   1007  C  CG1 . ILE A  1 127 ? -38.317 62.328  15.810  1.00 16.58  ?  127 ILE A CG1 1 
ATOM   1008  C  CG2 . ILE A  1 127 ? -38.466 60.032  16.184  1.00 19.30  ?  127 ILE A CG2 1 
ATOM   1009  C  CD1 . ILE A  1 127 ? -38.311 63.364  14.730  1.00 13.57  ?  127 ILE A CD1 1 
ATOM   1010  N  N   . ARG A  1 128 ? -40.936 58.822  14.165  1.00 16.91  ?  128 ARG A N   1 
ATOM   1011  C  CA  . ARG A  1 128 ? -41.215 57.428  13.874  1.00 16.74  ?  128 ARG A CA  1 
ATOM   1012  C  C   . ARG A  1 128 ? -41.095 57.128  12.368  1.00 16.78  ?  128 ARG A C   1 
ATOM   1013  O  O   . ARG A  1 128 ? -40.330 56.194  11.954  1.00 16.77  ?  128 ARG A O   1 
ATOM   1014  C  CB  . ARG A  1 128 ? -42.542 57.004  14.493  1.00 16.66  ?  128 ARG A CB  1 
ATOM   1015  C  CG  . ARG A  1 128 ? -42.430 57.003  16.042  1.00 18.58  ?  128 ARG A CG  1 
ATOM   1016  C  CD  . ARG A  1 128 ? -43.484 56.198  16.769  1.00 20.90  ?  128 ARG A CD  1 
ATOM   1017  N  NE  . ARG A  1 128 ? -44.635 57.067  16.871  1.00 27.96  ?  128 ARG A NE  1 
ATOM   1018  C  CZ  . ARG A  1 128 ? -44.976 57.771  17.945  1.00 27.62  ?  128 ARG A CZ  1 
ATOM   1019  N  NH1 . ARG A  1 128 ? -44.297 57.665  19.070  1.00 26.89  ?  128 ARG A NH1 1 
ATOM   1020  N  NH2 . ARG A  1 128 ? -46.036 58.559  17.873  1.00 29.05  ?  128 ARG A NH2 1 
ATOM   1021  N  N   . CYS A  1 129 ? -41.743 57.946  11.538  1.00 15.77  ?  129 CYS A N   1 
ATOM   1022  C  CA  . CYS A  1 129 ? -41.568 57.762  10.106  1.00 15.41  ?  129 CYS A CA  1 
ATOM   1023  C  C   . CYS A  1 129 ? -40.101 57.837  9.792   1.00 15.43  ?  129 CYS A C   1 
ATOM   1024  O  O   . CYS A  1 129 ? -39.566 56.956  9.168   1.00 14.61  ?  129 CYS A O   1 
ATOM   1025  C  CB  . CYS A  1 129 ? -42.336 58.783  9.305   1.00 15.11  ?  129 CYS A CB  1 
ATOM   1026  S  SG  . CYS A  1 129 ? -44.071 58.788  9.691   1.00 17.08  ?  129 CYS A SG  1 
ATOM   1027  N  N   . TYR A  1 130 ? -39.422 58.862  10.288  1.00 16.25  ?  130 TYR A N   1 
ATOM   1028  C  CA  . TYR A  1 130 ? -37.993 58.948  10.002  1.00 17.82  ?  130 TYR A CA  1 
ATOM   1029  C  C   . TYR A  1 130 ? -37.243 57.651  10.286  1.00 17.82  ?  130 TYR A C   1 
ATOM   1030  O  O   . TYR A  1 130 ? -36.479 57.190  9.444   1.00 17.96  ?  130 TYR A O   1 
ATOM   1031  C  CB  . TYR A  1 130 ? -37.274 60.083  10.752  1.00 17.94  ?  130 TYR A CB  1 
ATOM   1032  C  CG  . TYR A  1 130 ? -35.788 60.086  10.438  1.00 18.60  ?  130 TYR A CG  1 
ATOM   1033  C  CD1 . TYR A  1 130 ? -35.326 60.604  9.247   1.00 16.91  ?  130 TYR A CD1 1 
ATOM   1034  C  CD2 . TYR A  1 130 ? -34.860 59.550  11.322  1.00 19.91  ?  130 TYR A CD2 1 
ATOM   1035  C  CE1 . TYR A  1 130 ? -33.999 60.636  8.955   1.00 19.09  ?  130 TYR A CE1 1 
ATOM   1036  C  CE2 . TYR A  1 130 ? -33.514 59.568  11.021  1.00 20.36  ?  130 TYR A CE2 1 
ATOM   1037  C  CZ  . TYR A  1 130 ? -33.107 60.105  9.818   1.00 21.46  ?  130 TYR A CZ  1 
ATOM   1038  O  OH  . TYR A  1 130 ? -31.790 60.129  9.471   1.00 25.20  ?  130 TYR A OH  1 
ATOM   1039  N  N   . GLN A  1 131 ? -37.440 57.100  11.476  1.00 17.84  ?  131 GLN A N   1 
ATOM   1040  C  CA  . GLN A  1 131 ? -36.597 55.999  11.914  1.00 18.63  ?  131 GLN A CA  1 
ATOM   1041  C  C   . GLN A  1 131 ? -36.943 54.665  11.277  1.00 19.09  ?  131 GLN A C   1 
ATOM   1042  O  O   . GLN A  1 131 ? -36.251 53.703  11.487  1.00 19.12  ?  131 GLN A O   1 
ATOM   1043  C  CB  . GLN A  1 131 ? -36.628 55.857  13.425  1.00 18.49  ?  131 GLN A CB  1 
ATOM   1044  C  CG  . GLN A  1 131 ? -36.383 57.140  14.159  1.00 19.89  ?  131 GLN A CG  1 
ATOM   1045  C  CD  . GLN A  1 131 ? -35.978 56.908  15.588  1.00 22.42  ?  131 GLN A CD  1 
ATOM   1046  O  OE1 . GLN A  1 131 ? -36.830 56.544  16.439  1.00 22.47  ?  131 GLN A OE1 1 
ATOM   1047  N  NE2 . GLN A  1 131 ? -34.655 57.084  15.877  1.00 18.79  ?  131 GLN A NE2 1 
ATOM   1048  N  N   . SER A  1 132 ? -38.020 54.615  10.509  1.00 19.93  ?  132 SER A N   1 
ATOM   1049  C  CA  . SER A  1 132 ? -38.457 53.386  9.885   1.00 19.81  ?  132 SER A CA  1 
ATOM   1050  C  C   . SER A  1 132 ? -37.582 53.178  8.682   1.00 20.27  ?  132 SER A C   1 
ATOM   1051  O  O   . SER A  1 132 ? -37.476 52.059  8.168   1.00 20.31  ?  132 SER A O   1 
ATOM   1052  C  CB  . SER A  1 132 ? -39.945 53.471  9.478   1.00 20.87  ?  132 SER A CB  1 
ATOM   1053  O  OG  . SER A  1 132 ? -40.160 54.261  8.322   1.00 19.19  ?  132 SER A OG  1 
ATOM   1054  N  N   . GLY A  1 133 ? -36.935 54.258  8.245   1.00 20.12  ?  133 GLY A N   1 
ATOM   1055  C  CA  . GLY A  1 133 ? -35.975 54.193  7.151   1.00 19.47  ?  133 GLY A CA  1 
ATOM   1056  C  C   . GLY A  1 133 ? -36.612 54.615  5.848   1.00 20.04  ?  133 GLY A C   1 
ATOM   1057  O  O   . GLY A  1 133 ? -35.930 54.690  4.812   1.00 18.85  ?  133 GLY A O   1 
ATOM   1058  N  N   . GLN A  1 134 ? -37.919 54.902  5.940   1.00 20.40  ?  134 GLN A N   1 
ATOM   1059  C  CA  . GLN A  1 134 ? -38.786 55.369  4.850   1.00 21.22  ?  134 GLN A CA  1 
ATOM   1060  C  C   . GLN A  1 134 ? -38.271 56.717  4.319   1.00 20.81  ?  134 GLN A C   1 
ATOM   1061  O  O   . GLN A  1 134 ? -38.084 57.650  5.110   1.00 20.48  ?  134 GLN A O   1 
ATOM   1062  C  CB  . GLN A  1 134 ? -40.237 55.545  5.392   1.00 20.93  ?  134 GLN A CB  1 
ATOM   1063  C  CG  . GLN A  1 134 ? -41.174 56.440  4.563   1.00 23.13  ?  134 GLN A CG  1 
ATOM   1064  C  CD  . GLN A  1 134 ? -42.700 56.276  4.906   1.00 29.51  ?  134 GLN A CD  1 
ATOM   1065  O  OE1 . GLN A  1 134 ? -43.511 55.882  4.037   1.00 31.46  ?  134 GLN A OE1 1 
ATOM   1066  N  NE2 . GLN A  1 134 ? -43.082 56.571  6.170   1.00 29.32  ?  134 GLN A NE2 1 
ATOM   1067  N  N   . ARG A  1 135 ? -38.039 56.786  3.004   1.00 20.06  ?  135 ARG A N   1 
ATOM   1068  C  CA  . ARG A  1 135 ? -37.751 58.006  2.288   0.50 19.41  ?  135 ARG A CA  1 
ATOM   1069  C  C   . ARG A  1 135 ? -37.986 57.753  0.804   1.00 20.97  ?  135 ARG A C   1 
ATOM   1070  O  O   . ARG A  1 135 ? -38.013 56.597  0.355   1.00 21.83  ?  135 ARG A O   1 
ATOM   1071  C  CB  . ARG A  1 135 ? -36.325 58.438  2.534   0.50 18.49  ?  135 ARG A CB  1 
ATOM   1072  C  CG  . ARG A  1 135 ? -35.303 57.546  1.953   0.50 14.20  ?  135 ARG A CG  1 
ATOM   1073  C  CD  . ARG A  1 135 ? -34.038 57.834  2.635   0.50 8.24   ?  135 ARG A CD  1 
ATOM   1074  N  NE  . ARG A  1 135 ? -32.913 57.816  1.741   0.50 6.18   ?  135 ARG A NE  1 
ATOM   1075  C  CZ  . ARG A  1 135 ? -31.788 58.466  2.001   0.50 5.54   ?  135 ARG A CZ  1 
ATOM   1076  N  NH1 . ARG A  1 135 ? -31.693 59.179  3.110   0.50 2.00   ?  135 ARG A NH1 1 
ATOM   1077  N  NH2 . ARG A  1 135 ? -30.773 58.396  1.161   0.50 2.23   ?  135 ARG A NH2 1 
ATOM   1078  N  N   . TYR A  1 136 ? -38.161 58.830  0.044   1.00 21.11  ?  136 TYR A N   1 
ATOM   1079  C  CA  . TYR A  1 136 ? -38.538 58.754  -1.345  1.00 21.10  ?  136 TYR A CA  1 
ATOM   1080  C  C   . TYR A  1 136 ? -37.948 59.959  -2.049  1.00 21.74  ?  136 TYR A C   1 
ATOM   1081  O  O   . TYR A  1 136 ? -37.460 60.889  -1.413  1.00 20.36  ?  136 TYR A O   1 
ATOM   1082  C  CB  . TYR A  1 136 ? -40.043 58.830  -1.483  1.00 21.38  ?  136 TYR A CB  1 
ATOM   1083  C  CG  . TYR A  1 136 ? -40.737 57.714  -0.800  1.00 24.09  ?  136 TYR A CG  1 
ATOM   1084  C  CD1 . TYR A  1 136 ? -40.722 56.439  -1.332  1.00 27.01  ?  136 TYR A CD1 1 
ATOM   1085  C  CD2 . TYR A  1 136 ? -41.395 57.913  0.408   1.00 26.80  ?  136 TYR A CD2 1 
ATOM   1086  C  CE1 . TYR A  1 136 ? -41.360 55.373  -0.670  1.00 29.24  ?  136 TYR A CE1 1 
ATOM   1087  C  CE2 . TYR A  1 136 ? -42.038 56.853  1.071   1.00 26.24  ?  136 TYR A CE2 1 
ATOM   1088  C  CZ  . TYR A  1 136 ? -42.016 55.603  0.525   1.00 27.46  ?  136 TYR A CZ  1 
ATOM   1089  O  OH  . TYR A  1 136 ? -42.635 54.572  1.159   1.00 26.48  ?  136 TYR A OH  1 
ATOM   1090  N  N   . PRO A  1 137 ? -37.955 59.924  -3.383  1.00 22.19  ?  137 PRO A N   1 
ATOM   1091  C  CA  . PRO A  1 137 ? -37.460 61.070  -4.108  1.00 22.65  ?  137 PRO A CA  1 
ATOM   1092  C  C   . PRO A  1 137 ? -38.439 62.226  -3.986  1.00 22.81  ?  137 PRO A C   1 
ATOM   1093  O  O   . PRO A  1 137 ? -39.657 61.998  -4.111  1.00 22.05  ?  137 PRO A O   1 
ATOM   1094  C  CB  . PRO A  1 137 ? -37.454 60.579  -5.576  1.00 23.37  ?  137 PRO A CB  1 
ATOM   1095  C  CG  . PRO A  1 137 ? -37.636 59.067  -5.501  1.00 21.67  ?  137 PRO A CG  1 
ATOM   1096  C  CD  . PRO A  1 137 ? -38.371 58.816  -4.267  1.00 21.73  ?  137 PRO A CD  1 
ATOM   1097  N  N   . LEU A  1 138 ? -37.908 63.439  -3.746  1.00 22.71  ?  138 LEU A N   1 
ATOM   1098  C  CA  . LEU A  1 138 ? -38.640 64.719  -3.996  1.00 22.07  ?  138 LEU A CA  1 
ATOM   1099  C  C   . LEU A  1 138 ? -39.621 64.634  -5.166  1.00 23.37  ?  138 LEU A C   1 
ATOM   1100  O  O   . LEU A  1 138 ? -40.798 64.931  -5.016  1.00 23.55  ?  138 LEU A O   1 
ATOM   1101  C  CB  . LEU A  1 138 ? -37.656 65.855  -4.246  1.00 20.54  ?  138 LEU A CB  1 
ATOM   1102  C  CG  . LEU A  1 138 ? -36.708 66.126  -3.092  1.00 16.83  ?  138 LEU A CG  1 
ATOM   1103  C  CD1 . LEU A  1 138 ? -35.746 67.213  -3.423  1.00 16.08  ?  138 LEU A CD1 1 
ATOM   1104  C  CD2 . LEU A  1 138 ? -37.496 66.454  -1.834  1.00 12.71  ?  138 LEU A CD2 1 
ATOM   1105  N  N   . GLU A  1 139 ? -39.152 64.160  -6.318  1.00 25.19  ?  139 GLU A N   1 
ATOM   1106  C  CA  . GLU A  1 139 ? -39.983 64.094  -7.497  0.50 26.54  ?  139 GLU A CA  1 
ATOM   1107  C  C   . GLU A  1 139 ? -41.362 63.538  -7.224  1.00 27.85  ?  139 GLU A C   1 
ATOM   1108  O  O   . GLU A  1 139 ? -42.255 63.775  -8.015  1.00 29.15  ?  139 GLU A O   1 
ATOM   1109  C  CB  . GLU A  1 139 ? -39.284 63.332  -8.609  0.50 26.69  ?  139 GLU A CB  1 
ATOM   1110  C  CG  . GLU A  1 139 ? -38.232 64.172  -9.294  0.50 27.86  ?  139 GLU A CG  1 
ATOM   1111  C  CD  . GLU A  1 139 ? -37.450 63.414  -10.341 0.50 29.99  ?  139 GLU A CD  1 
ATOM   1112  O  OE1 . GLU A  1 139 ? -38.076 62.839  -11.271 0.50 27.93  ?  139 GLU A OE1 1 
ATOM   1113  O  OE2 . GLU A  1 139 ? -36.197 63.416  -10.222 0.50 31.78  -1 139 GLU A OE2 1 
ATOM   1114  N  N   . MET A  1 140 ? -41.560 62.842  -6.099  1.00 29.33  ?  140 MET A N   1 
ATOM   1115  C  CA  . MET A  1 140 ? -42.864 62.245  -5.693  1.00 30.91  ?  140 MET A CA  1 
ATOM   1116  C  C   . MET A  1 140 ? -44.060 63.220  -5.620  1.00 31.24  ?  140 MET A C   1 
ATOM   1117  O  O   . MET A  1 140 ? -45.203 62.865  -5.911  1.00 30.28  ?  140 MET A O   1 
ATOM   1118  C  CB  . MET A  1 140 ? -42.741 61.574  -4.302  1.00 31.65  ?  140 MET A CB  1 
ATOM   1119  C  CG  . MET A  1 140 ? -42.115 60.184  -4.280  1.00 35.07  ?  140 MET A CG  1 
ATOM   1120  S  SD  . MET A  1 140 ? -42.983 59.001  -5.355  1.00 41.71  ?  140 MET A SD  1 
ATOM   1121  C  CE  . MET A  1 140 ? -44.652 59.148  -4.677  1.00 40.44  ?  140 MET A CE  1 
ATOM   1122  N  N   . ILE A  1 141 ? -43.764 64.425  -5.154  1.00 32.64  ?  141 ILE A N   1 
ATOM   1123  C  CA  . ILE A  1 141 ? -44.732 65.492  -4.941  1.00 34.36  ?  141 ILE A CA  1 
ATOM   1124  C  C   . ILE A  1 141 ? -44.301 66.772  -5.704  1.00 35.55  ?  141 ILE A C   1 
ATOM   1125  O  O   . ILE A  1 141 ? -44.833 67.870  -5.465  1.00 35.79  ?  141 ILE A O   1 
ATOM   1126  C  CB  . ILE A  1 141 ? -44.931 65.790  -3.393  1.00 34.52  ?  141 ILE A CB  1 
ATOM   1127  C  CG1 . ILE A  1 141 ? -43.605 66.019  -2.655  1.00 34.38  ?  141 ILE A CG1 1 
ATOM   1128  C  CG2 . ILE A  1 141 ? -45.639 64.631  -2.701  1.00 33.79  ?  141 ILE A CG2 1 
ATOM   1129  C  CD1 . ILE A  1 141 ? -42.819 67.272  -3.052  1.00 34.09  ?  141 ILE A CD1 1 
ATOM   1130  N  N   . GLY A  1 142 ? -43.321 66.612  -6.597  1.00 36.50  ?  142 GLY A N   1 
ATOM   1131  C  CA  . GLY A  1 142 ? -42.784 67.691  -7.421  1.00 37.61  ?  142 GLY A CA  1 
ATOM   1132  C  C   . GLY A  1 142 ? -43.755 68.454  -8.330  1.00 38.18  ?  142 GLY A C   1 
ATOM   1133  O  O   . GLY A  1 142 ? -44.902 68.034  -8.582  1.00 37.17  ?  142 GLY A O   1 
ATOM   1134  N  N   . ASP A  1 143 ? -43.250 69.585  -8.812  1.00 39.12  ?  143 ASP A N   1 
ATOM   1135  C  CA  . ASP A  1 143 ? -43.954 70.499  -9.711  1.00 41.28  ?  143 ASP A CA  1 
ATOM   1136  C  C   . ASP A  1 143 ? -43.937 70.070  -11.186 1.00 41.94  ?  143 ASP A C   1 
ATOM   1137  O  O   . ASP A  1 143 ? -42.909 69.634  -11.718 1.00 41.48  ?  143 ASP A O   1 
ATOM   1138  C  CB  . ASP A  1 143 ? -43.309 71.876  -9.614  1.00 41.28  ?  143 ASP A CB  1 
ATOM   1139  C  CG  . ASP A  1 143 ? -41.791 71.789  -9.512  1.00 43.18  ?  143 ASP A CG  1 
ATOM   1140  O  OD1 . ASP A  1 143 ? -41.291 71.474  -8.399  1.00 44.79  ?  143 ASP A OD1 1 
ATOM   1141  O  OD2 . ASP A  1 143 ? -41.098 72.016  -10.536 1.00 44.61  -1 143 ASP A OD2 1 
ATOM   1142  N  N   . PHE A  1 144 ? -45.087 70.242  -11.832 1.00 43.38  ?  144 PHE A N   1 
ATOM   1143  C  CA  . PHE A  1 144 ? -45.246 70.012  -13.260 1.00 44.94  ?  144 PHE A CA  1 
ATOM   1144  C  C   . PHE A  1 144 ? -45.466 71.290  -14.106 1.00 46.22  ?  144 PHE A C   1 
ATOM   1145  O  O   . PHE A  1 144 ? -46.494 71.964  -13.950 1.00 46.78  ?  144 PHE A O   1 
ATOM   1146  C  CB  . PHE A  1 144 ? -46.400 69.041  -13.489 1.00 44.31  ?  144 PHE A CB  1 
ATOM   1147  C  CG  . PHE A  1 144 ? -46.564 68.655  -14.910 1.00 44.81  ?  144 PHE A CG  1 
ATOM   1148  C  CD1 . PHE A  1 144 ? -45.509 68.071  -15.611 1.00 44.36  ?  144 PHE A CD1 1 
ATOM   1149  C  CD2 . PHE A  1 144 ? -47.759 68.894  -15.569 1.00 45.64  ?  144 PHE A CD2 1 
ATOM   1150  C  CE1 . PHE A  1 144 ? -45.659 67.723  -16.948 1.00 46.25  ?  144 PHE A CE1 1 
ATOM   1151  C  CE2 . PHE A  1 144 ? -47.924 68.528  -16.915 1.00 45.18  ?  144 PHE A CE2 1 
ATOM   1152  C  CZ  . PHE A  1 144 ? -46.878 67.956  -17.602 1.00 45.00  ?  144 PHE A CZ  1 
ATOM   1153  N  N   . ASN A  1 145 ? -44.539 71.574  -15.030 1.00 47.53  ?  145 ASN A N   1 
ATOM   1154  C  CA  . ASN A  1 145 ? -44.676 72.695  -16.008 1.00 48.89  ?  145 ASN A CA  1 
ATOM   1155  C  C   . ASN A  1 145 ? -44.863 74.000  -15.243 1.00 48.40  ?  145 ASN A C   1 
ATOM   1156  O  O   . ASN A  1 145 ? -45.985 74.471  -15.055 1.00 48.57  ?  145 ASN A O   1 
ATOM   1157  C  CB  . ASN A  1 145 ? -45.855 72.482  -17.011 1.00 49.93  ?  145 ASN A CB  1 
ATOM   1158  C  CG  . ASN A  1 145 ? -45.424 71.815  -18.380 1.00 53.14  ?  145 ASN A CG  1 
ATOM   1159  O  OD1 . ASN A  1 145 ? -44.231 71.711  -18.717 1.00 56.40  ?  145 ASN A OD1 1 
ATOM   1160  N  ND2 . ASN A  1 145 ? -46.428 71.384  -19.168 1.00 53.82  ?  145 ASN A ND2 1 
ATOM   1161  N  N   . TRP A  1 146 ? -43.766 74.575  -14.782 1.00 47.81  ?  146 TRP A N   1 
ATOM   1162  C  CA  . TRP A  1 146 ? -43.862 75.537  -13.694 1.00 47.43  ?  146 TRP A CA  1 
ATOM   1163  C  C   . TRP A  1 146 ? -43.587 76.963  -14.175 1.00 47.98  ?  146 TRP A C   1 
ATOM   1164  O  O   . TRP A  1 146 ? -42.579 77.218  -14.844 1.00 47.97  ?  146 TRP A O   1 
ATOM   1165  C  CB  . TRP A  1 146 ? -42.938 75.102  -12.541 1.00 46.92  ?  146 TRP A CB  1 
ATOM   1166  C  CG  . TRP A  1 146 ? -43.073 75.861  -11.247 1.00 43.30  ?  146 TRP A CG  1 
ATOM   1167  C  CD1 . TRP A  1 146 ? -42.136 76.684  -10.678 1.00 41.15  ?  146 TRP A CD1 1 
ATOM   1168  C  CD2 . TRP A  1 146 ? -44.181 75.850  -10.358 1.00 39.33  ?  146 TRP A CD2 1 
ATOM   1169  N  NE1 . TRP A  1 146 ? -42.599 77.191  -9.492  1.00 39.10  ?  146 TRP A NE1 1 
ATOM   1170  C  CE2 . TRP A  1 146 ? -43.857 76.699  -9.271  1.00 39.19  ?  146 TRP A CE2 1 
ATOM   1171  C  CE3 . TRP A  1 146 ? -45.416 75.204  -10.363 1.00 38.36  ?  146 TRP A CE3 1 
ATOM   1172  C  CZ2 . TRP A  1 146 ? -44.726 76.920  -8.205  1.00 37.33  ?  146 TRP A CZ2 1 
ATOM   1173  C  CZ3 . TRP A  1 146 ? -46.288 75.427  -9.287  1.00 37.71  ?  146 TRP A CZ3 1 
ATOM   1174  C  CH2 . TRP A  1 146 ? -45.931 76.275  -8.226  1.00 37.08  ?  146 TRP A CH2 1 
ATOM   1175  N  N   . PRO A  1 147 ? -44.507 77.892  -13.866 1.00 48.20  ?  147 PRO A N   1 
ATOM   1176  C  CA  . PRO A  1 147 ? -44.336 79.231  -14.417 1.00 48.25  ?  147 PRO A CA  1 
ATOM   1177  C  C   . PRO A  1 147 ? -43.026 79.885  -14.027 1.00 48.61  ?  147 PRO A C   1 
ATOM   1178  O  O   . PRO A  1 147 ? -42.465 80.624  -14.821 1.00 48.91  ?  147 PRO A O   1 
ATOM   1179  C  CB  . PRO A  1 147 ? -45.519 79.989  -13.841 1.00 48.21  ?  147 PRO A CB  1 
ATOM   1180  C  CG  . PRO A  1 147 ? -46.613 78.937  -13.772 1.00 48.68  ?  147 PRO A CG  1 
ATOM   1181  C  CD  . PRO A  1 147 ? -45.891 77.649  -13.403 1.00 48.27  ?  147 PRO A CD  1 
ATOM   1182  N  N   . PHE A  1 148 ? -42.510 79.581  -12.848 1.00 48.89  ?  148 PHE A N   1 
ATOM   1183  C  CA  . PHE A  1 148 ? -41.440 80.387  -12.277 1.00 49.79  ?  148 PHE A CA  1 
ATOM   1184  C  C   . PHE A  1 148 ? -40.082 79.698  -12.249 1.00 51.24  ?  148 PHE A C   1 
ATOM   1185  O  O   . PHE A  1 148 ? -39.992 78.465  -12.195 1.00 51.45  ?  148 PHE A O   1 
ATOM   1186  C  CB  . PHE A  1 148 ? -41.845 80.870  -10.878 1.00 49.33  ?  148 PHE A CB  1 
ATOM   1187  C  CG  . PHE A  1 148 ? -43.288 81.332  -10.796 1.00 48.22  ?  148 PHE A CG  1 
ATOM   1188  C  CD1 . PHE A  1 148 ? -44.284 80.471  -10.336 1.00 45.18  ?  148 PHE A CD1 1 
ATOM   1189  C  CD2 . PHE A  1 148 ? -43.659 82.621  -11.220 1.00 47.42  ?  148 PHE A CD2 1 
ATOM   1190  C  CE1 . PHE A  1 148 ? -45.621 80.872  -10.284 1.00 44.43  ?  148 PHE A CE1 1 
ATOM   1191  C  CE2 . PHE A  1 148 ? -45.015 83.039  -11.170 1.00 45.25  ?  148 PHE A CE2 1 
ATOM   1192  C  CZ  . PHE A  1 148 ? -45.990 82.163  -10.699 1.00 44.27  ?  148 PHE A CZ  1 
ATOM   1193  N  N   . THR A  1 149 ? -39.032 80.515  -12.305 1.00 52.62  ?  149 THR A N   1 
ATOM   1194  C  CA  . THR A  1 149 ? -37.648 80.053  -12.208 1.00 54.65  ?  149 THR A CA  1 
ATOM   1195  C  C   . THR A  1 149 ? -37.380 79.373  -10.860 1.00 55.41  ?  149 THR A C   1 
ATOM   1196  O  O   . THR A  1 149 ? -37.667 79.957  -9.798  1.00 55.75  ?  149 THR A O   1 
ATOM   1197  C  CB  . THR A  1 149 ? -36.654 81.236  -12.342 1.00 54.64  ?  149 THR A CB  1 
ATOM   1198  O  OG1 . THR A  1 149 ? -37.201 82.206  -13.234 1.00 56.31  ?  149 THR A OG1 1 
ATOM   1199  C  CG2 . THR A  1 149 ? -35.291 80.772  -12.873 1.00 55.43  ?  149 THR A CG2 1 
ATOM   1200  N  N   . LYS A  1 150 ? -36.820 78.156  -10.912 1.00 55.98  ?  150 LYS A N   1 
ATOM   1201  C  CA  . LYS A  1 150 ? -36.438 77.398  -9.707  1.00 56.19  ?  150 LYS A CA  1 
ATOM   1202  C  C   . LYS A  1 150 ? -35.228 77.991  -8.934  1.00 56.35  ?  150 LYS A C   1 
ATOM   1203  O  O   . LYS A  1 150 ? -34.671 79.046  -9.283  1.00 55.98  ?  150 LYS A O   1 
ATOM   1204  C  CB  . LYS A  1 150 ? -36.178 75.923  -10.052 1.00 56.19  ?  150 LYS A CB  1 
ATOM   1205  C  CG  . LYS A  1 150 ? -37.284 74.947  -9.646  1.00 56.00  ?  150 LYS A CG  1 
ATOM   1206  C  CD  . LYS A  1 150 ? -36.757 73.491  -9.669  1.00 55.99  ?  150 LYS A CD  1 
ATOM   1207  C  CE  . LYS A  1 150 ? -37.899 72.460  -9.586  1.00 57.08  ?  150 LYS A CE  1 
ATOM   1208  N  NZ  . LYS A  1 150 ? -39.127 72.935  -10.338 1.00 53.17  ?  150 LYS A NZ  1 
ATOM   1209  N  N   . MET B  1 1   ? 9.835   21.455  10.255  1.00 49.12  ?  1   MET B N   1 
ATOM   1210  C  CA  . MET B  1 1   ? 9.543   20.049  10.691  1.00 49.17  ?  1   MET B CA  1 
ATOM   1211  C  C   . MET B  1 1   ? 8.383   19.526  9.877   1.00 48.17  ?  1   MET B C   1 
ATOM   1212  O  O   . MET B  1 1   ? 7.463   20.292  9.534   1.00 48.69  ?  1   MET B O   1 
ATOM   1213  C  CB  . MET B  1 1   ? 9.194   19.985  12.177  1.00 49.62  ?  1   MET B CB  1 
ATOM   1214  C  CG  . MET B  1 1   ? 7.975   20.803  12.595  1.00 52.12  ?  1   MET B CG  1 
ATOM   1215  S  SD  . MET B  1 1   ? 6.970   19.917  13.810  1.00 57.79  ?  1   MET B SD  1 
ATOM   1216  C  CE  . MET B  1 1   ? 8.237   19.333  14.954  1.00 55.85  ?  1   MET B CE  1 
ATOM   1217  N  N   . PHE B  1 2   ? 8.403   18.234  9.572   1.00 46.42  ?  2   PHE B N   1 
ATOM   1218  C  CA  . PHE B  1 2   ? 7.403   17.710  8.663   1.00 44.45  ?  2   PHE B CA  1 
ATOM   1219  C  C   . PHE B  1 2   ? 5.987   17.629  9.242   1.00 42.85  ?  2   PHE B C   1 
ATOM   1220  O  O   . PHE B  1 2   ? 5.720   16.829  10.116  1.00 42.84  ?  2   PHE B O   1 
ATOM   1221  C  CB  . PHE B  1 2   ? 7.796   16.368  8.135   1.00 44.67  ?  2   PHE B CB  1 
ATOM   1222  C  CG  . PHE B  1 2   ? 6.887   15.887  7.086   1.00 46.37  ?  2   PHE B CG  1 
ATOM   1223  C  CD1 . PHE B  1 2   ? 7.282   15.885  5.761   1.00 48.03  ?  2   PHE B CD1 1 
ATOM   1224  C  CD2 . PHE B  1 2   ? 5.603   15.479  7.406   1.00 47.35  ?  2   PHE B CD2 1 
ATOM   1225  C  CE1 . PHE B  1 2   ? 6.421   15.437  4.776   1.00 48.87  ?  2   PHE B CE1 1 
ATOM   1226  C  CE2 . PHE B  1 2   ? 4.736   15.034  6.439   1.00 47.38  ?  2   PHE B CE2 1 
ATOM   1227  C  CZ  . PHE B  1 2   ? 5.141   15.006  5.128   1.00 48.80  ?  2   PHE B CZ  1 
ATOM   1228  N  N   . LYS B  1 3   ? 5.112   18.486  8.739   1.00 40.29  ?  3   LYS B N   1 
ATOM   1229  C  CA  . LYS B  1 3   ? 3.690   18.369  8.881   1.00 38.33  ?  3   LYS B CA  1 
ATOM   1230  C  C   . LYS B  1 3   ? 3.199   18.116  7.432   1.00 36.61  ?  3   LYS B C   1 
ATOM   1231  O  O   . LYS B  1 3   ? 3.787   18.673  6.498   1.00 36.68  ?  3   LYS B O   1 
ATOM   1232  C  CB  . LYS B  1 3   ? 3.114   19.686  9.426   1.00 38.67  ?  3   LYS B CB  1 
ATOM   1233  C  CG  . LYS B  1 3   ? 4.011   20.434  10.437  1.00 40.80  ?  3   LYS B CG  1 
ATOM   1234  C  CD  . LYS B  1 3   ? 3.261   21.464  11.339  1.00 42.86  ?  3   LYS B CD  1 
ATOM   1235  C  CE  . LYS B  1 3   ? 3.388   22.980  10.844  1.00 46.68  ?  3   LYS B CE  1 
ATOM   1236  N  NZ  . LYS B  1 3   ? 4.742   23.682  10.929  1.00 45.17  ?  3   LYS B NZ  1 
ATOM   1237  N  N   . PRO B  1 4   ? 2.165   17.252  7.223   1.00 34.12  ?  4   PRO B N   1 
ATOM   1238  C  CA  . PRO B  1 4   ? 1.679   17.068  5.852   1.00 32.00  ?  4   PRO B CA  1 
ATOM   1239  C  C   . PRO B  1 4   ? 0.368   17.805  5.646   1.00 30.42  ?  4   PRO B C   1 
ATOM   1240  O  O   . PRO B  1 4   ? -0.200  18.315  6.610   1.00 29.88  ?  4   PRO B O   1 
ATOM   1241  C  CB  . PRO B  1 4   ? 1.418   15.559  5.786   1.00 31.70  ?  4   PRO B CB  1 
ATOM   1242  C  CG  . PRO B  1 4   ? 0.896   15.229  7.154   1.00 32.29  ?  4   PRO B CG  1 
ATOM   1243  C  CD  . PRO B  1 4   ? 1.602   16.221  8.123   1.00 33.80  ?  4   PRO B CD  1 
ATOM   1244  N  N   . HIS B  1 5   ? -0.128  17.836  4.415   1.00 28.25  ?  5   HIS B N   1 
ATOM   1245  C  CA  . HIS B  1 5   ? -1.428  18.429  4.178   1.00 27.37  ?  5   HIS B CA  1 
ATOM   1246  C  C   . HIS B  1 5   ? -2.536  17.535  4.725   1.00 25.57  ?  5   HIS B C   1 
ATOM   1247  O  O   . HIS B  1 5   ? -2.460  16.316  4.596   1.00 25.23  ?  5   HIS B O   1 
ATOM   1248  C  CB  . HIS B  1 5   ? -1.654  18.638  2.690   1.00 28.11  ?  5   HIS B CB  1 
ATOM   1249  C  CG  . HIS B  1 5   ? -0.851  19.755  2.107   1.00 29.89  ?  5   HIS B CG  1 
ATOM   1250  N  ND1 . HIS B  1 5   ? -1.427  20.806  1.431   1.00 31.74  ?  5   HIS B ND1 1 
ATOM   1251  C  CD2 . HIS B  1 5   ? 0.486   19.972  2.083   1.00 31.25  ?  5   HIS B CD2 1 
ATOM   1252  C  CE1 . HIS B  1 5   ? -0.475  21.616  1.006   1.00 34.86  ?  5   HIS B CE1 1 
ATOM   1253  N  NE2 . HIS B  1 5   ? 0.695   21.127  1.381   1.00 33.71  ?  5   HIS B NE2 1 
ATOM   1254  N  N   . VAL B  1 6   ? -3.551  18.133  5.331   1.00 22.81  ?  6   VAL B N   1 
ATOM   1255  C  CA  . VAL B  1 6   ? -4.659  17.339  5.808   1.00 21.32  ?  6   VAL B CA  1 
ATOM   1256  C  C   . VAL B  1 6   ? -5.934  17.838  5.142   1.00 21.50  ?  6   VAL B C   1 
ATOM   1257  O  O   . VAL B  1 6   ? -6.334  19.018  5.256   1.00 21.26  ?  6   VAL B O   1 
ATOM   1258  C  CB  . VAL B  1 6   ? -4.763  17.289  7.400   1.00 21.26  ?  6   VAL B CB  1 
ATOM   1259  C  CG1 . VAL B  1 6   ? -6.037  16.619  7.862   1.00 18.95  ?  6   VAL B CG1 1 
ATOM   1260  C  CG2 . VAL B  1 6   ? -3.582  16.555  8.008   1.00 19.22  ?  6   VAL B CG2 1 
ATOM   1261  N  N   . THR B  1 7   ? -6.562  16.931  4.416   1.00 21.20  ?  7   THR B N   1 
ATOM   1262  C  CA  . THR B  1 7   ? -7.799  17.252  3.715   1.00 20.79  ?  7   THR B CA  1 
ATOM   1263  C  C   . THR B  1 7   ? -8.912  16.317  4.106   1.00 20.48  ?  7   THR B C   1 
ATOM   1264  O  O   . THR B  1 7   ? -8.673  15.263  4.676   1.00 19.90  ?  7   THR B O   1 
ATOM   1265  C  CB  . THR B  1 7   ? -7.624  17.236  2.169   1.00 20.73  ?  7   THR B CB  1 
ATOM   1266  O  OG1 . THR B  1 7   ? -7.281  15.908  1.710   1.00 19.85  ?  7   THR B OG1 1 
ATOM   1267  C  CG2 . THR B  1 7   ? -6.559  18.242  1.768   1.00 19.50  ?  7   THR B CG2 1 
ATOM   1268  N  N   . VAL B  1 8   ? -10.132 16.725  3.780   1.00 21.01  ?  8   VAL B N   1 
ATOM   1269  C  CA  . VAL B  1 8   ? -11.315 15.945  4.082   1.00 21.42  ?  8   VAL B CA  1 
ATOM   1270  C  C   . VAL B  1 8   ? -12.178 15.942  2.831   1.00 21.70  ?  8   VAL B C   1 
ATOM   1271  O  O   . VAL B  1 8   ? -12.039 16.809  1.991   1.00 21.11  ?  8   VAL B O   1 
ATOM   1272  C  CB  . VAL B  1 8   ? -12.031 16.496  5.341   1.00 21.99  ?  8   VAL B CB  1 
ATOM   1273  C  CG1 . VAL B  1 8   ? -11.050 16.482  6.570   1.00 20.61  ?  8   VAL B CG1 1 
ATOM   1274  C  CG2 . VAL B  1 8   ? -12.526 17.916  5.112   1.00 22.49  ?  8   VAL B CG2 1 
ATOM   1275  N  N   . ALA B  1 9   ? -13.030 14.932  2.685   1.00 22.70  ?  9   ALA B N   1 
ATOM   1276  C  CA  . ALA B  1 9   ? -13.705 14.638  1.434   1.00 22.82  ?  9   ALA B CA  1 
ATOM   1277  C  C   . ALA B  1 9   ? -14.939 13.845  1.795   1.00 24.28  ?  9   ALA B C   1 
ATOM   1278  O  O   . ALA B  1 9   ? -14.895 13.065  2.759   1.00 25.09  ?  9   ALA B O   1 
ATOM   1279  C  CB  . ALA B  1 9   ? -12.818 13.801  0.591   1.00 22.47  ?  9   ALA B CB  1 
ATOM   1280  N  N   . CYS B  1 10  ? -16.029 14.039  1.043   1.00 24.43  ?  10  CYS B N   1 
ATOM   1281  C  CA  . CYS B  1 10  ? -17.275 13.340  1.293   1.00 24.88  ?  10  CYS B CA  1 
ATOM   1282  C  C   . CYS B  1 10  ? -17.861 12.678  0.067   1.00 24.69  ?  10  CYS B C   1 
ATOM   1283  O  O   . CYS B  1 10  ? -17.994 13.301  -1.009  1.00 25.87  ?  10  CYS B O   1 
ATOM   1284  C  CB  . CYS B  1 10  ? -18.329 14.299  1.782   1.00 24.99  ?  10  CYS B CB  1 
ATOM   1285  S  SG  . CYS B  1 10  ? -17.864 15.076  3.269   1.00 31.15  ?  10  CYS B SG  1 
ATOM   1286  N  N   . VAL B  1 11  ? -18.239 11.413  0.258   1.00 23.25  ?  11  VAL B N   1 
ATOM   1287  C  CA  . VAL B  1 11  ? -18.973 10.646  -0.707  1.00 21.07  ?  11  VAL B CA  1 
ATOM   1288  C  C   . VAL B  1 11  ? -20.404 11.018  -0.400  1.00 19.87  ?  11  VAL B C   1 
ATOM   1289  O  O   . VAL B  1 11  ? -20.991 10.600  0.577   1.00 19.38  ?  11  VAL B O   1 
ATOM   1290  C  CB  . VAL B  1 11  ? -18.667 9.148   -0.508  1.00 21.01  ?  11  VAL B CB  1 
ATOM   1291  C  CG1 . VAL B  1 11  ? -19.449 8.256   -1.446  1.00 20.41  ?  11  VAL B CG1 1 
ATOM   1292  C  CG2 . VAL B  1 11  ? -17.198 8.907   -0.692  1.00 21.48  ?  11  VAL B CG2 1 
ATOM   1293  N  N   . VAL B  1 12  ? -20.978 11.884  -1.196  1.00 19.62  ?  12  VAL B N   1 
ATOM   1294  C  CA  . VAL B  1 12  ? -22.392 12.166  -0.934  1.00 18.61  ?  12  VAL B CA  1 
ATOM   1295  C  C   . VAL B  1 12  ? -23.218 11.362  -1.915  1.00 18.18  ?  12  VAL B C   1 
ATOM   1296  O  O   . VAL B  1 12  ? -23.016 11.477  -3.117  1.00 17.64  ?  12  VAL B O   1 
ATOM   1297  C  CB  . VAL B  1 12  ? -22.669 13.676  -0.998  1.00 18.69  ?  12  VAL B CB  1 
ATOM   1298  C  CG1 . VAL B  1 12  ? -24.078 13.982  -0.524  1.00 17.87  ?  12  VAL B CG1 1 
ATOM   1299  C  CG2 . VAL B  1 12  ? -21.650 14.409  -0.144  1.00 16.53  ?  12  VAL B CG2 1 
ATOM   1300  N  N   . HIS B  1 13  ? -24.123 10.523  -1.408  1.00 18.14  ?  13  HIS B N   1 
ATOM   1301  C  CA  . HIS B  1 13  ? -24.843 9.507   -2.236  1.00 17.12  ?  13  HIS B CA  1 
ATOM   1302  C  C   . HIS B  1 13  ? -26.337 9.658   -2.083  1.00 17.89  ?  13  HIS B C   1 
ATOM   1303  O  O   . HIS B  1 13  ? -26.821 10.033  -1.047  1.00 17.76  ?  13  HIS B O   1 
ATOM   1304  C  CB  . HIS B  1 13  ? -24.390 8.128   -1.808  1.00 17.25  ?  13  HIS B CB  1 
ATOM   1305  C  CG  . HIS B  1 13  ? -25.142 7.000   -2.421  1.00 17.70  ?  13  HIS B CG  1 
ATOM   1306  N  ND1 . HIS B  1 13  ? -24.936 6.582   -3.717  1.00 17.99  ?  13  HIS B ND1 1 
ATOM   1307  C  CD2 . HIS B  1 13  ? -26.056 6.156   -1.889  1.00 19.02  ?  13  HIS B CD2 1 
ATOM   1308  C  CE1 . HIS B  1 13  ? -25.725 5.557   -3.974  1.00 19.54  ?  13  HIS B CE1 1 
ATOM   1309  N  NE2 . HIS B  1 13  ? -26.426 5.288   -2.881  1.00 21.35  ?  13  HIS B NE2 1 
ATOM   1310  N  N   . ALA B  1 14  ? -27.075 9.413   -3.149  1.00 19.56  ?  14  ALA B N   1 
ATOM   1311  C  CA  . ALA B  1 14  ? -28.489 9.743   -3.186  1.00 20.56  ?  14  ALA B CA  1 
ATOM   1312  C  C   . ALA B  1 14  ? -28.995 9.390   -4.565  1.00 21.25  ?  14  ALA B C   1 
ATOM   1313  O  O   . ALA B  1 14  ? -28.375 9.751   -5.587  1.00 21.54  ?  14  ALA B O   1 
ATOM   1314  C  CB  . ALA B  1 14  ? -28.695 11.233  -2.940  1.00 20.50  ?  14  ALA B CB  1 
ATOM   1315  N  N   . GLU B  1 15  ? -30.122 8.687   -4.583  1.00 21.67  ?  15  GLU B N   1 
ATOM   1316  C  CA  . GLU B  1 15  ? -30.790 8.255   -5.823  1.00 22.83  ?  15  GLU B CA  1 
ATOM   1317  C  C   . GLU B  1 15  ? -29.847 7.529   -6.780  1.00 22.43  ?  15  GLU B C   1 
ATOM   1318  O  O   . GLU B  1 15  ? -29.931 7.664   -7.987  1.00 23.98  ?  15  GLU B O   1 
ATOM   1319  C  CB  . GLU B  1 15  ? -31.570 9.410   -6.485  1.00 22.85  ?  15  GLU B CB  1 
ATOM   1320  C  CG  . GLU B  1 15  ? -32.706 9.932   -5.599  1.00 24.93  ?  15  GLU B CG  1 
ATOM   1321  C  CD  . GLU B  1 15  ? -33.486 11.091  -6.221  1.00 26.75  ?  15  GLU B CD  1 
ATOM   1322  O  OE1 . GLU B  1 15  ? -34.122 10.893  -7.288  1.00 23.94  ?  15  GLU B OE1 1 
ATOM   1323  O  OE2 . GLU B  1 15  ? -33.474 12.201  -5.620  1.00 29.77  -1 15  GLU B OE2 1 
ATOM   1324  N  N   . GLY B  1 16  ? -28.958 6.730   -6.210  1.00 22.69  ?  16  GLY B N   1 
ATOM   1325  C  CA  . GLY B  1 16  ? -28.066 5.864   -6.971  1.00 22.15  ?  16  GLY B CA  1 
ATOM   1326  C  C   . GLY B  1 16  ? -27.073 6.683   -7.728  1.00 22.15  ?  16  GLY B C   1 
ATOM   1327  O  O   . GLY B  1 16  ? -26.620 6.279   -8.796  1.00 22.98  ?  16  GLY B O   1 
ATOM   1328  N  N   . LYS B  1 17  ? -26.754 7.847   -7.178  1.00 21.95  ?  17  LYS B N   1 
ATOM   1329  C  CA  . LYS B  1 17  ? -25.859 8.789   -7.803  1.00 22.06  ?  17  LYS B CA  1 
ATOM   1330  C  C   . LYS B  1 17  ? -25.006 9.443   -6.721  1.00 21.41  ?  17  LYS B C   1 
ATOM   1331  O  O   . LYS B  1 17  ? -25.401 9.478   -5.546  1.00 20.91  ?  17  LYS B O   1 
ATOM   1332  C  CB  . LYS B  1 17  ? -26.648 9.853   -8.541  1.00 22.69  ?  17  LYS B CB  1 
ATOM   1333  C  CG  . LYS B  1 17  ? -27.560 9.329   -9.651  1.00 25.79  ?  17  LYS B CG  1 
ATOM   1334  C  CD  . LYS B  1 17  ? -26.936 9.354   -11.031 1.00 29.31  ?  17  LYS B CD  1 
ATOM   1335  C  CE  . LYS B  1 17  ? -27.979 8.952   -12.064 1.00 32.19  ?  17  LYS B CE  1 
ATOM   1336  N  NZ  . LYS B  1 17  ? -27.378 8.741   -13.436 1.00 35.30  ?  17  LYS B NZ  1 
ATOM   1337  N  N   . PHE B  1 18  ? -23.841 9.932   -7.129  1.00 19.84  ?  18  PHE B N   1 
ATOM   1338  C  CA  . PHE B  1 18  ? -22.911 10.581  -6.223  1.00 19.50  ?  18  PHE B CA  1 
ATOM   1339  C  C   . PHE B  1 18  ? -22.639 12.030  -6.633  1.00 19.69  ?  18  PHE B C   1 
ATOM   1340  O  O   . PHE B  1 18  ? -22.650 12.375  -7.834  1.00 20.43  ?  18  PHE B O   1 
ATOM   1341  C  CB  . PHE B  1 18  ? -21.587 9.824   -6.169  1.00 18.62  ?  18  PHE B CB  1 
ATOM   1342  C  CG  . PHE B  1 18  ? -21.726 8.409   -5.853  1.00 15.60  ?  18  PHE B CG  1 
ATOM   1343  C  CD1 . PHE B  1 18  ? -21.473 7.956   -4.557  1.00 15.49  ?  18  PHE B CD1 1 
ATOM   1344  C  CD2 . PHE B  1 18  ? -22.105 7.496   -6.839  1.00 13.21  ?  18  PHE B CD2 1 
ATOM   1345  C  CE1 . PHE B  1 18  ? -21.624 6.582   -4.242  1.00 13.83  ?  18  PHE B CE1 1 
ATOM   1346  C  CE2 . PHE B  1 18  ? -22.228 6.129   -6.552  1.00 11.62  ?  18  PHE B CE2 1 
ATOM   1347  C  CZ  . PHE B  1 18  ? -21.995 5.668   -5.238  1.00 9.27   ?  18  PHE B CZ  1 
ATOM   1348  N  N   . LEU B  1 19  ? -22.421 12.870  -5.635  1.00 19.83  ?  19  LEU B N   1 
ATOM   1349  C  CA  . LEU B  1 19  ? -22.160 14.283  -5.848  1.00 20.30  ?  19  LEU B CA  1 
ATOM   1350  C  C   . LEU B  1 19  ? -20.728 14.494  -6.203  1.00 20.35  ?  19  LEU B C   1 
ATOM   1351  O  O   . LEU B  1 19  ? -19.833 14.129  -5.481  1.00 21.28  ?  19  LEU B O   1 
ATOM   1352  C  CB  . LEU B  1 19  ? -22.472 15.130  -4.603  1.00 20.87  ?  19  LEU B CB  1 
ATOM   1353  C  CG  . LEU B  1 19  ? -22.417 16.685  -4.745  1.00 20.65  ?  19  LEU B CG  1 
ATOM   1354  C  CD1 . LEU B  1 19  ? -23.176 17.229  -5.974  1.00 17.68  ?  19  LEU B CD1 1 
ATOM   1355  C  CD2 . LEU B  1 19  ? -22.964 17.338  -3.520  1.00 19.38  ?  19  LEU B CD2 1 
ATOM   1356  N  N   . VAL B  1 20  ? -20.512 15.159  -7.307  1.00 20.46  ?  20  VAL B N   1 
ATOM   1357  C  CA  . VAL B  1 20  ? -19.167 15.494  -7.683  1.00 20.07  ?  20  VAL B CA  1 
ATOM   1358  C  C   . VAL B  1 20  ? -19.049 17.031  -7.889  1.00 19.57  ?  20  VAL B C   1 
ATOM   1359  O  O   . VAL B  1 20  ? -20.040 17.702  -8.168  1.00 18.47  ?  20  VAL B O   1 
ATOM   1360  C  CB  . VAL B  1 20  ? -18.864 14.622  -8.888  1.00 20.73  ?  20  VAL B CB  1 
ATOM   1361  C  CG1 . VAL B  1 20  ? -18.861 15.422  -10.260 1.00 21.38  ?  20  VAL B CG1 1 
ATOM   1362  C  CG2 . VAL B  1 20  ? -17.696 13.694  -8.594  1.00 19.03  ?  20  VAL B CG2 1 
ATOM   1363  N  N   . VAL B  1 21  ? -17.864 17.591  -7.672  1.00 19.91  ?  21  VAL B N   1 
ATOM   1364  C  CA  . VAL B  1 21  ? -17.649 19.020  -7.939  1.00 20.60  ?  21  VAL B CA  1 
ATOM   1365  C  C   . VAL B  1 21  ? -16.656 19.234  -9.089  1.00 21.85  ?  21  VAL B C   1 
ATOM   1366  O  O   . VAL B  1 21  ? -15.579 18.638  -9.114  1.00 22.36  ?  21  VAL B O   1 
ATOM   1367  C  CB  . VAL B  1 21  ? -17.219 19.838  -6.701  1.00 20.15  ?  21  VAL B CB  1 
ATOM   1368  C  CG1 . VAL B  1 21  ? -18.231 19.728  -5.623  1.00 20.37  ?  21  VAL B CG1 1 
ATOM   1369  C  CG2 . VAL B  1 21  ? -15.863 19.423  -6.188  1.00 20.61  ?  21  VAL B CG2 1 
ATOM   1370  N  N   . GLU B  1 22  ? -17.038 20.097  -10.032 1.00 23.09  ?  22  GLU B N   1 
ATOM   1371  C  CA  . GLU B  1 22  ? -16.263 20.426  -11.228 1.00 23.57  ?  22  GLU B CA  1 
ATOM   1372  C  C   . GLU B  1 22  ? -15.493 21.739  -11.032 1.00 23.98  ?  22  GLU B C   1 
ATOM   1373  O  O   . GLU B  1 22  ? -16.076 22.807  -10.803 1.00 22.92  ?  22  GLU B O   1 
ATOM   1374  C  CB  . GLU B  1 22  ? -17.228 20.586  -12.386 1.00 24.15  ?  22  GLU B CB  1 
ATOM   1375  C  CG  . GLU B  1 22  ? -16.789 19.963  -13.672 1.00 27.37  ?  22  GLU B CG  1 
ATOM   1376  C  CD  . GLU B  1 22  ? -17.786 20.226  -14.782 1.00 31.96  ?  22  GLU B CD  1 
ATOM   1377  O  OE1 . GLU B  1 22  ? -17.927 21.405  -15.212 1.00 27.88  ?  22  GLU B OE1 1 
ATOM   1378  O  OE2 . GLU B  1 22  ? -18.435 19.239  -15.207 1.00 35.41  -1 22  GLU B OE2 1 
ATOM   1379  N  N   . GLU B  1 23  ? -14.179 21.639  -11.160 1.00 24.21  ?  23  GLU B N   1 
ATOM   1380  C  CA  . GLU B  1 23  ? -13.269 22.692  -10.820 1.00 24.88  ?  23  GLU B CA  1 
ATOM   1381  C  C   . GLU B  1 23  ? -12.408 22.801  -12.075 1.00 25.79  ?  23  GLU B C   1 
ATOM   1382  O  O   . GLU B  1 23  ? -11.921 21.769  -12.557 1.00 26.39  ?  23  GLU B O   1 
ATOM   1383  C  CB  . GLU B  1 23  ? -12.433 22.170  -9.658  1.00 24.37  ?  23  GLU B CB  1 
ATOM   1384  C  CG  . GLU B  1 23  ? -12.156 23.117  -8.518  1.00 26.73  ?  23  GLU B CG  1 
ATOM   1385  C  CD  . GLU B  1 23  ? -11.809 22.401  -7.195  1.00 30.21  ?  23  GLU B CD  1 
ATOM   1386  O  OE1 . GLU B  1 23  ? -12.020 21.156  -7.091  1.00 27.77  ?  23  GLU B OE1 1 
ATOM   1387  O  OE2 . GLU B  1 23  ? -11.311 23.099  -6.262  1.00 30.75  -1 23  GLU B OE2 1 
ATOM   1388  N  N   . THR B  1 24  ? -12.215 23.987  -12.658 1.00 26.18  ?  24  THR B N   1 
ATOM   1389  C  CA  . THR B  1 24  ? -11.262 23.985  -13.752 1.00 26.64  ?  24  THR B CA  1 
ATOM   1390  C  C   . THR B  1 24  ? -9.834  24.196  -13.279 1.00 26.35  ?  24  THR B C   1 
ATOM   1391  O  O   . THR B  1 24  ? -9.536  25.133  -12.537 1.00 26.18  ?  24  THR B O   1 
ATOM   1392  C  CB  . THR B  1 24  ? -11.584 24.875  -14.959 1.00 27.20  ?  24  THR B CB  1 
ATOM   1393  O  OG1 . THR B  1 24  ? -10.900 26.099  -14.818 1.00 29.38  ?  24  THR B OG1 1 
ATOM   1394  C  CG2 . THR B  1 24  ? -13.042 25.120  -15.157 1.00 27.24  ?  24  THR B CG2 1 
ATOM   1395  N  N   . ILE B  1 25  ? -8.951  23.298  -13.698 1.00 26.00  ?  25  ILE B N   1 
ATOM   1396  C  CA  . ILE B  1 25  ? -7.538  23.370  -13.292 1.00 25.99  ?  25  ILE B CA  1 
ATOM   1397  C  C   . ILE B  1 25  ? -6.664  23.486  -14.505 1.00 25.70  ?  25  ILE B C   1 
ATOM   1398  O  O   . ILE B  1 25  ? -6.554  22.535  -15.264 1.00 25.81  ?  25  ILE B O   1 
ATOM   1399  C  CB  . ILE B  1 25  ? -7.065  22.118  -12.576 1.00 25.64  ?  25  ILE B CB  1 
ATOM   1400  C  CG1 . ILE B  1 25  ? -7.977  21.796  -11.387 1.00 26.29  ?  25  ILE B CG1 1 
ATOM   1401  C  CG2 . ILE B  1 25  ? -5.593  22.309  -12.152 1.00 25.81  ?  25  ILE B CG2 1 
ATOM   1402  C  CD1 . ILE B  1 25  ? -7.709  22.675  -10.133 1.00 26.69  ?  25  ILE B CD1 1 
ATOM   1403  N  N   . ASN B  1 26  ? -6.068  24.653  -14.684 1.00 25.34  ?  26  ASN B N   1 
ATOM   1404  C  CA  . ASN B  1 26  ? -5.281  24.944  -15.860 1.00 25.87  ?  26  ASN B CA  1 
ATOM   1405  C  C   . ASN B  1 26  ? -6.141  24.656  -17.080 1.00 25.61  ?  26  ASN B C   1 
ATOM   1406  O  O   . ASN B  1 26  ? -5.920  23.690  -17.817 1.00 26.54  ?  26  ASN B O   1 
ATOM   1407  C  CB  . ASN B  1 26  ? -3.981  24.128  -15.842 1.00 25.34  ?  26  ASN B CB  1 
ATOM   1408  C  CG  . ASN B  1 26  ? -3.044  24.577  -14.740 1.00 27.19  ?  26  ASN B CG  1 
ATOM   1409  O  OD1 . ASN B  1 26  ? -2.473  23.746  -14.014 1.00 30.09  ?  26  ASN B OD1 1 
ATOM   1410  N  ND2 . ASN B  1 26  ? -2.875  25.899  -14.602 1.00 23.87  ?  26  ASN B ND2 1 
ATOM   1411  N  N   . GLY B  1 27  ? -7.169  25.470  -17.245 1.00 25.27  ?  27  GLY B N   1 
ATOM   1412  C  CA  . GLY B  1 27  ? -8.136  25.305  -18.334 1.00 23.99  ?  27  GLY B CA  1 
ATOM   1413  C  C   . GLY B  1 27  ? -8.623  23.892  -18.621 1.00 23.77  ?  27  GLY B C   1 
ATOM   1414  O  O   . GLY B  1 27  ? -8.880  23.607  -19.757 1.00 24.46  ?  27  GLY B O   1 
ATOM   1415  N  N   . LYS B  1 28  ? -8.731  22.989  -17.641 1.00 23.15  ?  28  LYS B N   1 
ATOM   1416  C  CA  . LYS B  1 28  ? -9.603  21.795  -17.822 1.00 22.63  ?  28  LYS B CA  1 
ATOM   1417  C  C   . LYS B  1 28  ? -10.512 21.524  -16.624 1.00 22.49  ?  28  LYS B C   1 
ATOM   1418  O  O   . LYS B  1 28  ? -10.092 21.614  -15.484 1.00 23.30  ?  28  LYS B O   1 
ATOM   1419  C  CB  . LYS B  1 28  ? -8.816  20.509  -18.127 1.00 22.52  ?  28  LYS B CB  1 
ATOM   1420  C  CG  . LYS B  1 28  ? -9.495  19.659  -19.215 1.00 22.21  ?  28  LYS B CG  1 
ATOM   1421  C  CD  . LYS B  1 28  ? -9.773  18.200  -18.876 1.00 19.00  ?  28  LYS B CD  1 
ATOM   1422  C  CE  . LYS B  1 28  ? -8.553  17.287  -18.932 1.00 19.43  ?  28  LYS B CE  1 
ATOM   1423  N  NZ  . LYS B  1 28  ? -9.058  15.883  -19.243 1.00 20.70  ?  28  LYS B NZ  1 
ATOM   1424  N  N   . ALA B  1 29  ? -11.749 21.142  -16.890 1.00 22.58  ?  29  ALA B N   1 
ATOM   1425  C  CA  . ALA B  1 29  ? -12.697 20.859  -15.818 1.00 22.24  ?  29  ALA B CA  1 
ATOM   1426  C  C   . ALA B  1 29  ? -12.511 19.442  -15.303 1.00 22.39  ?  29  ALA B C   1 
ATOM   1427  O  O   . ALA B  1 29  ? -12.650 18.467  -16.033 1.00 22.82  ?  29  ALA B O   1 
ATOM   1428  C  CB  . ALA B  1 29  ? -14.145 21.105  -16.273 1.00 21.37  ?  29  ALA B CB  1 
ATOM   1429  N  N   . LEU B  1 30  ? -12.180 19.346  -14.024 1.00 23.16  ?  30  LEU B N   1 
ATOM   1430  C  CA  . LEU B  1 30  ? -11.887 18.080  -13.366 1.00 22.55  ?  30  LEU B CA  1 
ATOM   1431  C  C   . LEU B  1 30  ? -12.913 17.843  -12.301 1.00 22.77  ?  30  LEU B C   1 
ATOM   1432  O  O   . LEU B  1 30  ? -13.381 18.799  -11.694 1.00 23.83  ?  30  LEU B O   1 
ATOM   1433  C  CB  . LEU B  1 30  ? -10.503 18.150  -12.731 1.00 21.86  ?  30  LEU B CB  1 
ATOM   1434  C  CG  . LEU B  1 30  ? -9.264  17.863  -13.590 1.00 21.15  ?  30  LEU B CG  1 
ATOM   1435  C  CD1 . LEU B  1 30  ? -9.448  18.006  -15.096 1.00 21.05  ?  30  LEU B CD1 1 
ATOM   1436  C  CD2 . LEU B  1 30  ? -8.113  18.672  -13.129 1.00 16.26  ?  30  LEU B CD2 1 
ATOM   1437  N  N   . TRP B  1 31  ? -13.243 16.574  -12.066 1.00 22.26  ?  31  TRP B N   1 
ATOM   1438  C  CA  . TRP B  1 31  ? -14.141 16.174  -10.982 1.00 21.46  ?  31  TRP B CA  1 
ATOM   1439  C  C   . TRP B  1 31  ? -13.440 15.829  -9.656  1.00 21.64  ?  31  TRP B C   1 
ATOM   1440  O  O   . TRP B  1 31  ? -12.356 15.230  -9.629  1.00 21.39  ?  31  TRP B O   1 
ATOM   1441  C  CB  . TRP B  1 31  ? -14.993 14.989  -11.421 1.00 21.30  ?  31  TRP B CB  1 
ATOM   1442  C  CG  . TRP B  1 31  ? -15.937 15.324  -12.520 1.00 20.18  ?  31  TRP B CG  1 
ATOM   1443  C  CD1 . TRP B  1 31  ? -16.157 16.544  -13.043 1.00 16.40  ?  31  TRP B CD1 1 
ATOM   1444  C  CD2 . TRP B  1 31  ? -16.811 14.414  -13.219 1.00 20.76  ?  31  TRP B CD2 1 
ATOM   1445  N  NE1 . TRP B  1 31  ? -17.109 16.470  -14.018 1.00 19.63  ?  31  TRP B NE1 1 
ATOM   1446  C  CE2 . TRP B  1 31  ? -17.533 15.174  -14.148 1.00 19.98  ?  31  TRP B CE2 1 
ATOM   1447  C  CE3 . TRP B  1 31  ? -17.056 13.036  -13.138 1.00 20.41  ?  31  TRP B CE3 1 
ATOM   1448  C  CZ2 . TRP B  1 31  ? -18.486 14.604  -15.018 1.00 19.95  ?  31  TRP B CZ2 1 
ATOM   1449  C  CZ3 . TRP B  1 31  ? -18.018 12.465  -14.004 1.00 18.65  ?  31  TRP B CZ3 1 
ATOM   1450  C  CH2 . TRP B  1 31  ? -18.713 13.257  -14.922 1.00 19.07  ?  31  TRP B CH2 1 
ATOM   1451  N  N   . ASN B  1 32  ? -14.050 16.247  -8.553  1.00 21.30  ?  32  ASN B N   1 
ATOM   1452  C  CA  . ASN B  1 32  ? -13.581 15.852  -7.222  1.00 21.74  ?  32  ASN B CA  1 
ATOM   1453  C  C   . ASN B  1 32  ? -14.815 15.534  -6.388  1.00 21.40  ?  32  ASN B C   1 
ATOM   1454  O  O   . ASN B  1 32  ? -15.911 15.901  -6.783  1.00 23.11  ?  32  ASN B O   1 
ATOM   1455  C  CB  . ASN B  1 32  ? -12.705 16.934  -6.542  1.00 20.82  ?  32  ASN B CB  1 
ATOM   1456  C  CG  . ASN B  1 32  ? -11.853 16.356  -5.402  1.00 21.70  ?  32  ASN B CG  1 
ATOM   1457  O  OD1 . ASN B  1 32  ? -11.863 15.131  -5.157  1.00 24.15  ?  32  ASN B OD1 1 
ATOM   1458  N  ND2 . ASN B  1 32  ? -11.110 17.211  -4.712  1.00 19.54  ?  32  ASN B ND2 1 
ATOM   1459  N  N   . GLN B  1 33  ? -14.661 14.818  -5.286  1.00 20.55  ?  33  GLN B N   1 
ATOM   1460  C  CA  . GLN B  1 33  ? -15.658 14.868  -4.221  1.00 20.27  ?  33  GLN B CA  1 
ATOM   1461  C  C   . GLN B  1 33  ? -15.643 16.286  -3.631  1.00 20.09  ?  33  GLN B C   1 
ATOM   1462  O  O   . GLN B  1 33  ? -14.607 16.950  -3.684  1.00 20.87  ?  33  GLN B O   1 
ATOM   1463  C  CB  . GLN B  1 33  ? -15.287 13.881  -3.114  1.00 20.03  ?  33  GLN B CB  1 
ATOM   1464  C  CG  . GLN B  1 33  ? -15.772 12.449  -3.371  1.00 20.60  ?  33  GLN B CG  1 
ATOM   1465  C  CD  . GLN B  1 33  ? -14.750 11.597  -4.104  1.00 17.92  ?  33  GLN B CD  1 
ATOM   1466  O  OE1 . GLN B  1 33  ? -13.548 11.773  -3.938  1.00 13.36  ?  33  GLN B OE1 1 
ATOM   1467  N  NE2 . GLN B  1 33  ? -15.236 10.674  -4.923  1.00 18.29  ?  33  GLN B NE2 1 
ATOM   1468  N  N   . PRO B  1 34  ? -16.759 16.748  -3.043  1.00 19.62  ?  34  PRO B N   1 
ATOM   1469  C  CA  . PRO B  1 34  ? -16.672 17.998  -2.271  1.00 19.61  ?  34  PRO B CA  1 
ATOM   1470  C  C   . PRO B  1 34  ? -15.667 17.720  -1.201  1.00 19.59  ?  34  PRO B C   1 
ATOM   1471  O  O   . PRO B  1 34  ? -15.796 16.753  -0.444  1.00 19.67  ?  34  PRO B O   1 
ATOM   1472  C  CB  . PRO B  1 34  ? -18.065 18.150  -1.653  1.00 19.13  ?  34  PRO B CB  1 
ATOM   1473  C  CG  . PRO B  1 34  ? -18.951 17.371  -2.590  1.00 20.71  ?  34  PRO B CG  1 
ATOM   1474  C  CD  . PRO B  1 34  ? -18.126 16.226  -3.119  1.00 19.59  ?  34  PRO B CD  1 
ATOM   1475  N  N   . ALA B  1 35  ? -14.643 18.528  -1.160  1.00 19.31  ?  35  ALA B N   1 
ATOM   1476  C  CA  . ALA B  1 35  ? -13.473 18.122  -0.447  1.00 20.33  ?  35  ALA B CA  1 
ATOM   1477  C  C   . ALA B  1 35  ? -12.501 19.286  -0.416  1.00 21.09  ?  35  ALA B C   1 
ATOM   1478  O  O   . ALA B  1 35  ? -12.629 20.177  -1.237  1.00 21.18  ?  35  ALA B O   1 
ATOM   1479  C  CB  . ALA B  1 35  ? -12.866 16.944  -1.123  1.00 19.95  ?  35  ALA B CB  1 
ATOM   1480  N  N   . GLY B  1 36  ? -11.564 19.286  0.529   1.00 21.81  ?  36  GLY B N   1 
ATOM   1481  C  CA  . GLY B  1 36  ? -10.633 20.386  0.722   1.00 23.40  ?  36  GLY B CA  1 
ATOM   1482  C  C   . GLY B  1 36  ? -9.827  20.296  2.014   1.00 24.68  ?  36  GLY B C   1 
ATOM   1483  O  O   . GLY B  1 36  ? -9.782  19.241  2.664   1.00 24.56  ?  36  GLY B O   1 
ATOM   1484  N  N   . HIS B  1 37  ? -9.227  21.425  2.410   1.00 25.60  ?  37  HIS B N   1 
ATOM   1485  C  CA  . HIS B  1 37  ? -8.231  21.446  3.474   1.00 25.77  ?  37  HIS B CA  1 
ATOM   1486  C  C   . HIS B  1 37  ? -8.731  21.692  4.873   1.00 27.24  ?  37  HIS B C   1 
ATOM   1487  O  O   . HIS B  1 37  ? -9.754  22.358  5.088   1.00 27.50  ?  37  HIS B O   1 
ATOM   1488  C  CB  . HIS B  1 37  ? -7.160  22.453  3.158   1.00 25.14  ?  37  HIS B CB  1 
ATOM   1489  C  CG  . HIS B  1 37  ? -6.147  21.950  2.190   1.00 23.79  ?  37  HIS B CG  1 
ATOM   1490  N  ND1 . HIS B  1 37  ? -6.420  21.809  0.841   1.00 23.07  ?  37  HIS B ND1 1 
ATOM   1491  C  CD2 . HIS B  1 37  ? -4.865  21.549  2.368   1.00 20.60  ?  37  HIS B CD2 1 
ATOM   1492  C  CE1 . HIS B  1 37  ? -5.344  21.338  0.234   1.00 20.95  ?  37  HIS B CE1 1 
ATOM   1493  N  NE2 . HIS B  1 37  ? -4.391  21.168  1.135   1.00 18.67  ?  37  HIS B NE2 1 
ATOM   1494  N  N   . LEU B  1 38  ? -7.984  21.147  5.832   1.00 28.81  ?  38  LEU B N   1 
ATOM   1495  C  CA  . LEU B  1 38  ? -8.325  21.309  7.228   1.00 30.58  ?  38  LEU B CA  1 
ATOM   1496  C  C   . LEU B  1 38  ? -7.749  22.641  7.736   1.00 31.89  ?  38  LEU B C   1 
ATOM   1497  O  O   . LEU B  1 38  ? -6.541  22.912  7.590   1.00 32.21  ?  38  LEU B O   1 
ATOM   1498  C  CB  . LEU B  1 38  ? -7.818  20.124  8.049   1.00 30.00  ?  38  LEU B CB  1 
ATOM   1499  C  CG  . LEU B  1 38  ? -7.936  20.275  9.575   1.00 29.04  ?  38  LEU B CG  1 
ATOM   1500  C  CD1 . LEU B  1 38  ? -9.410  20.199  10.078  1.00 24.83  ?  38  LEU B CD1 1 
ATOM   1501  C  CD2 . LEU B  1 38  ? -7.033  19.250  10.245  1.00 27.71  ?  38  LEU B CD2 1 
ATOM   1502  N  N   . GLU B  1 39  ? -8.620  23.469  8.303   1.00 33.03  ?  39  GLU B N   1 
ATOM   1503  C  CA  . GLU B  1 39  ? -8.205  24.775  8.809   1.00 34.72  ?  39  GLU B CA  1 
ATOM   1504  C  C   . GLU B  1 39  ? -8.012  24.763  10.342  1.00 34.94  ?  39  GLU B C   1 
ATOM   1505  O  O   . GLU B  1 39  ? -8.424  23.797  11.020  1.00 36.21  ?  39  GLU B O   1 
ATOM   1506  C  CB  . GLU B  1 39  ? -9.199  25.850  8.364   1.00 34.95  ?  39  GLU B CB  1 
ATOM   1507  C  CG  . GLU B  1 39  ? -8.523  27.209  8.066   1.00 38.77  ?  39  GLU B CG  1 
ATOM   1508  C  CD  . GLU B  1 39  ? -7.565  27.127  6.885   1.00 41.21  ?  39  GLU B CD  1 
ATOM   1509  O  OE1 . GLU B  1 39  ? -8.071  26.783  5.790   1.00 41.45  ?  39  GLU B OE1 1 
ATOM   1510  O  OE2 . GLU B  1 39  ? -6.327  27.392  7.046   1.00 42.89  -1 39  GLU B OE2 1 
ATOM   1511  N  N   . ALA B  1 40  ? -7.368  25.801  10.883  1.00 34.90  ?  40  ALA B N   1 
ATOM   1512  C  CA  . ALA B  1 40  ? -7.079  25.906  12.352  1.00 34.28  ?  40  ALA B CA  1 
ATOM   1513  C  C   . ALA B  1 40  ? -8.300  25.814  13.243  1.00 34.11  ?  40  ALA B C   1 
ATOM   1514  O  O   . ALA B  1 40  ? -9.381  26.275  12.873  1.00 33.36  ?  40  ALA B O   1 
ATOM   1515  C  CB  . ALA B  1 40  ? -6.320  27.193  12.694  1.00 33.66  ?  40  ALA B CB  1 
ATOM   1516  N  N   . ASP B  1 41  ? -8.085  25.219  14.425  1.00 34.27  ?  41  ASP B N   1 
ATOM   1517  C  CA  . ASP B  1 41  ? -9.046  25.198  15.528  1.00 34.12  ?  41  ASP B CA  1 
ATOM   1518  C  C   . ASP B  1 41  ? -10.381 24.560  15.116  1.00 33.34  ?  41  ASP B C   1 
ATOM   1519  O  O   . ASP B  1 41  ? -11.465 24.960  15.584  1.00 33.82  ?  41  ASP B O   1 
ATOM   1520  C  CB  . ASP B  1 41  ? -9.202  26.610  16.156  1.00 34.60  ?  41  ASP B CB  1 
ATOM   1521  C  CG  . ASP B  1 41  ? -7.868  27.167  16.742  1.00 37.16  ?  41  ASP B CG  1 
ATOM   1522  O  OD1 . ASP B  1 41  ? -7.640  28.391  16.622  1.00 39.68  ?  41  ASP B OD1 1 
ATOM   1523  O  OD2 . ASP B  1 41  ? -7.039  26.400  17.308  1.00 40.53  -1 41  ASP B OD2 1 
ATOM   1524  N  N   . GLU B  1 42  ? -10.260 23.515  14.292  1.00 32.23  ?  42  GLU B N   1 
ATOM   1525  C  CA  . GLU B  1 42  ? -11.373 22.852  13.599  1.00 30.94  ?  42  GLU B CA  1 
ATOM   1526  C  C   . GLU B  1 42  ? -11.286 21.297  13.650  1.00 30.48  ?  42  GLU B C   1 
ATOM   1527  O  O   . GLU B  1 42  ? -10.214 20.702  13.432  1.00 29.50  ?  42  GLU B O   1 
ATOM   1528  C  CB  . GLU B  1 42  ? -11.335 23.292  12.150  1.00 30.66  ?  42  GLU B CB  1 
ATOM   1529  C  CG  . GLU B  1 42  ? -12.532 22.928  11.378  1.00 31.41  ?  42  GLU B CG  1 
ATOM   1530  C  CD  . GLU B  1 42  ? -12.424 23.373  9.940   1.00 31.84  ?  42  GLU B CD  1 
ATOM   1531  O  OE1 . GLU B  1 42  ? -13.421 23.986  9.495   1.00 28.22  ?  42  GLU B OE1 1 
ATOM   1532  O  OE2 . GLU B  1 42  ? -11.355 23.114  9.281   1.00 31.37  -1 42  GLU B OE2 1 
ATOM   1533  N  N   . THR B  1 43  ? -12.429 20.678  13.960  1.00 29.37  ?  43  THR B N   1 
ATOM   1534  C  CA  . THR B  1 43  ? -12.680 19.235  13.848  1.00 28.33  ?  43  THR B CA  1 
ATOM   1535  C  C   . THR B  1 43  ? -12.612 18.781  12.376  1.00 27.29  ?  43  THR B C   1 
ATOM   1536  O  O   . THR B  1 43  ? -13.141 19.454  11.452  1.00 26.65  ?  43  THR B O   1 
ATOM   1537  C  CB  . THR B  1 43  ? -14.113 18.934  14.399  1.00 28.51  ?  43  THR B CB  1 
ATOM   1538  O  OG1 . THR B  1 43  ? -14.134 19.099  15.827  1.00 30.56  ?  43  THR B OG1 1 
ATOM   1539  C  CG2 . THR B  1 43  ? -14.581 17.536  14.077  1.00 30.61  ?  43  THR B CG2 1 
ATOM   1540  N  N   . LEU B  1 44  ? -11.993 17.621  12.154  1.00 25.93  ?  44  LEU B N   1 
ATOM   1541  C  CA  . LEU B  1 44  ? -12.080 16.959  10.851  1.00 24.33  ?  44  LEU B CA  1 
ATOM   1542  C  C   . LEU B  1 44  ? -13.509 16.953  10.349  1.00 24.51  ?  44  LEU B C   1 
ATOM   1543  O  O   . LEU B  1 44  ? -13.748 17.336  9.205   1.00 25.51  ?  44  LEU B O   1 
ATOM   1544  C  CB  . LEU B  1 44  ? -11.610 15.530  10.922  1.00 23.56  ?  44  LEU B CB  1 
ATOM   1545  C  CG  . LEU B  1 44  ? -10.158 15.277  11.162  1.00 21.74  ?  44  LEU B CG  1 
ATOM   1546  C  CD1 . LEU B  1 44  ? -10.037 13.798  11.311  1.00 21.62  ?  44  LEU B CD1 1 
ATOM   1547  C  CD2 . LEU B  1 44  ? -9.421  15.751  9.981   1.00 21.32  ?  44  LEU B CD2 1 
ATOM   1548  N  N   . VAL B  1 45  ? -14.469 16.545  11.174  1.00 23.51  ?  45  VAL B N   1 
ATOM   1549  C  CA  . VAL B  1 45  ? -15.806 16.484  10.659  1.00 23.79  ?  45  VAL B CA  1 
ATOM   1550  C  C   . VAL B  1 45  ? -16.362 17.890  10.459  1.00 24.50  ?  45  VAL B C   1 
ATOM   1551  O  O   . VAL B  1 45  ? -17.081 18.148  9.501   1.00 24.68  ?  45  VAL B O   1 
ATOM   1552  C  CB  . VAL B  1 45  ? -16.739 15.462  11.433  1.00 24.42  ?  45  VAL B CB  1 
ATOM   1553  C  CG1 . VAL B  1 45  ? -15.887 14.436  12.204  1.00 23.41  ?  45  VAL B CG1 1 
ATOM   1554  C  CG2 . VAL B  1 45  ? -17.737 16.146  12.316  1.00 22.25  ?  45  VAL B CG2 1 
ATOM   1555  N  N   . GLU B  1 46  ? -15.987 18.822  11.329  1.00 25.48  ?  46  GLU B N   1 
ATOM   1556  C  CA  . GLU B  1 46  ? -16.322 20.229  11.100  1.00 25.90  ?  46  GLU B CA  1 
ATOM   1557  C  C   . GLU B  1 46  ? -15.850 20.662  9.711   1.00 25.07  ?  46  GLU B C   1 
ATOM   1558  O  O   . GLU B  1 46  ? -16.630 21.172  8.906   1.00 24.28  ?  46  GLU B O   1 
ATOM   1559  C  CB  . GLU B  1 46  ? -15.696 21.123  12.175  1.00 26.22  ?  46  GLU B CB  1 
ATOM   1560  C  CG  . GLU B  1 46  ? -16.720 21.730  13.128  1.00 27.79  ?  46  GLU B CG  1 
ATOM   1561  C  CD  . GLU B  1 46  ? -16.070 22.252  14.423  1.00 31.77  ?  46  GLU B CD  1 
ATOM   1562  O  OE1 . GLU B  1 46  ? -16.789 22.473  15.444  1.00 31.36  ?  46  GLU B OE1 1 
ATOM   1563  O  OE2 . GLU B  1 46  ? -14.824 22.411  14.411  1.00 34.37  -1 46  GLU B OE2 1 
ATOM   1564  N  N   . ALA B  1 47  ? -14.566 20.442  9.455   1.00 24.53  ?  47  ALA B N   1 
ATOM   1565  C  CA  . ALA B  1 47  ? -13.984 20.708  8.146   1.00 25.09  ?  47  ALA B CA  1 
ATOM   1566  C  C   . ALA B  1 47  ? -14.808 20.112  6.986   1.00 25.48  ?  47  ALA B C   1 
ATOM   1567  O  O   . ALA B  1 47  ? -15.228 20.824  6.065   1.00 25.51  ?  47  ALA B O   1 
ATOM   1568  C  CB  . ALA B  1 47  ? -12.589 20.187  8.116   1.00 24.55  ?  47  ALA B CB  1 
ATOM   1569  N  N   . ALA B  1 48  ? -15.050 18.808  7.064   1.00 25.39  ?  48  ALA B N   1 
ATOM   1570  C  CA  . ALA B  1 48  ? -15.769 18.104  6.040   1.00 25.99  ?  48  ALA B CA  1 
ATOM   1571  C  C   . ALA B  1 48  ? -17.108 18.764  5.799   1.00 26.12  ?  48  ALA B C   1 
ATOM   1572  O  O   . ALA B  1 48  ? -17.511 18.994  4.657   1.00 26.07  ?  48  ALA B O   1 
ATOM   1573  C  CB  . ALA B  1 48  ? -15.949 16.657  6.442   1.00 25.60  ?  48  ALA B CB  1 
ATOM   1574  N  N   . ALA B  1 49  ? -17.791 19.085  6.883   1.00 26.93  ?  49  ALA B N   1 
ATOM   1575  C  CA  . ALA B  1 49  ? -19.052 19.833  6.791   1.00 27.66  ?  49  ALA B CA  1 
ATOM   1576  C  C   . ALA B  1 49  ? -18.866 21.188  6.120   1.00 28.02  ?  49  ALA B C   1 
ATOM   1577  O  O   . ALA B  1 49  ? -19.643 21.575  5.218   1.00 28.97  ?  49  ALA B O   1 
ATOM   1578  C  CB  . ALA B  1 49  ? -19.661 20.016  8.164   1.00 27.61  ?  49  ALA B CB  1 
ATOM   1579  N  N   . ARG B  1 50  ? -17.849 21.917  6.567   1.00 27.36  ?  50  ARG B N   1 
ATOM   1580  C  CA  . ARG B  1 50  ? -17.614 23.256  6.050   1.00 26.95  ?  50  ARG B CA  1 
ATOM   1581  C  C   . ARG B  1 50  ? -17.334 23.206  4.521   1.00 26.95  ?  50  ARG B C   1 
ATOM   1582  O  O   . ARG B  1 50  ? -18.092 23.796  3.708   1.00 26.79  ?  50  ARG B O   1 
ATOM   1583  C  CB  . ARG B  1 50  ? -16.465 23.885  6.817   1.00 26.14  ?  50  ARG B CB  1 
ATOM   1584  C  CG  . ARG B  1 50  ? -16.442 25.349  6.732   1.00 24.88  ?  50  ARG B CG  1 
ATOM   1585  C  CD  . ARG B  1 50  ? -15.023 25.885  6.477   1.00 20.99  ?  50  ARG B CD  1 
ATOM   1586  N  NE  . ARG B  1 50  ? -13.967 24.971  6.885   1.00 17.97  ?  50  ARG B NE  1 
ATOM   1587  C  CZ  . ARG B  1 50  ? -12.991 24.529  6.097   1.00 17.24  ?  50  ARG B CZ  1 
ATOM   1588  N  NH1 . ARG B  1 50  ? -12.909 24.914  4.820   1.00 20.72  ?  50  ARG B NH1 1 
ATOM   1589  N  NH2 . ARG B  1 50  ? -12.086 23.691  6.585   1.00 16.32  ?  50  ARG B NH2 1 
ATOM   1590  N  N   . GLU B  1 51  ? -16.286 22.455  4.146   1.00 25.80  ?  51  GLU B N   1 
ATOM   1591  C  CA  . GLU B  1 51  ? -15.906 22.300  2.749   1.00 25.12  ?  51  GLU B CA  1 
ATOM   1592  C  C   . GLU B  1 51  ? -17.009 21.744  1.866   1.00 24.20  ?  51  GLU B C   1 
ATOM   1593  O  O   . GLU B  1 51  ? -17.082 22.076  0.684   1.00 24.25  ?  51  GLU B O   1 
ATOM   1594  C  CB  . GLU B  1 51  ? -14.645 21.463  2.615   1.00 25.16  ?  51  GLU B CB  1 
ATOM   1595  C  CG  . GLU B  1 51  ? -13.383 22.246  2.967   1.00 26.79  ?  51  GLU B CG  1 
ATOM   1596  C  CD  . GLU B  1 51  ? -12.846 23.099  1.843   1.00 29.19  ?  51  GLU B CD  1 
ATOM   1597  O  OE1 . GLU B  1 51  ? -13.348 22.974  0.707   1.00 29.85  ?  51  GLU B OE1 1 
ATOM   1598  O  OE2 . GLU B  1 51  ? -11.898 23.882  2.096   1.00 30.55  -1 51  GLU B OE2 1 
ATOM   1599  N  N   . LEU B  1 52  ? -17.874 20.914  2.426   1.00 22.93  ?  52  LEU B N   1 
ATOM   1600  C  CA  . LEU B  1 52  ? -19.046 20.512  1.700   1.00 22.10  ?  52  LEU B CA  1 
ATOM   1601  C  C   . LEU B  1 52  ? -19.897 21.731  1.386   1.00 22.17  ?  52  LEU B C   1 
ATOM   1602  O  O   . LEU B  1 52  ? -20.245 21.982  0.210   1.00 22.02  ?  52  LEU B O   1 
ATOM   1603  C  CB  . LEU B  1 52  ? -19.827 19.489  2.507   1.00 22.34  ?  52  LEU B CB  1 
ATOM   1604  C  CG  . LEU B  1 52  ? -20.934 18.599  1.930   1.00 21.74  ?  52  LEU B CG  1 
ATOM   1605  C  CD1 . LEU B  1 52  ? -22.293 19.018  2.419   1.00 24.89  ?  52  LEU B CD1 1 
ATOM   1606  C  CD2 . LEU B  1 52  ? -20.929 18.486  0.427   1.00 19.96  ?  52  LEU B CD2 1 
ATOM   1607  N  N   . TRP B  1 53  ? -20.228 22.492  2.424   1.00 22.83  ?  53  TRP B N   1 
ATOM   1608  C  CA  . TRP B  1 53  ? -21.167 23.645  2.277   1.00 23.51  ?  53  TRP B CA  1 
ATOM   1609  C  C   . TRP B  1 53  ? -20.586 24.633  1.274   1.00 23.31  ?  53  TRP B C   1 
ATOM   1610  O  O   . TRP B  1 53  ? -21.263 25.003  0.332   1.00 23.68  ?  53  TRP B O   1 
ATOM   1611  C  CB  . TRP B  1 53  ? -21.554 24.345  3.630   1.00 22.78  ?  53  TRP B CB  1 
ATOM   1612  C  CG  . TRP B  1 53  ? -22.451 25.561  3.392   1.00 23.81  ?  53  TRP B CG  1 
ATOM   1613  C  CD1 . TRP B  1 53  ? -23.811 25.564  3.237   1.00 24.42  ?  53  TRP B CD1 1 
ATOM   1614  C  CD2 . TRP B  1 53  ? -22.033 26.929  3.205   1.00 25.05  ?  53  TRP B CD2 1 
ATOM   1615  N  NE1 . TRP B  1 53  ? -24.265 26.836  2.973   1.00 22.95  ?  53  TRP B NE1 1 
ATOM   1616  C  CE2 . TRP B  1 53  ? -23.195 27.690  2.940   1.00 24.70  ?  53  TRP B CE2 1 
ATOM   1617  C  CE3 . TRP B  1 53  ? -20.789 27.584  3.243   1.00 26.12  ?  53  TRP B CE3 1 
ATOM   1618  C  CZ2 . TRP B  1 53  ? -23.153 29.082  2.736   1.00 26.26  ?  53  TRP B CZ2 1 
ATOM   1619  C  CZ3 . TRP B  1 53  ? -20.748 28.971  3.014   1.00 27.92  ?  53  TRP B CZ3 1 
ATOM   1620  C  CH2 . TRP B  1 53  ? -21.923 29.701  2.771   1.00 25.06  ?  53  TRP B CH2 1 
ATOM   1621  N  N   . GLU B  1 54  ? -19.324 25.011  1.461   1.00 23.00  ?  54  GLU B N   1 
ATOM   1622  C  CA  . GLU B  1 54  ? -18.682 25.973  0.578   1.00 23.42  ?  54  GLU B CA  1 
ATOM   1623  C  C   . GLU B  1 54  ? -18.682 25.504  -0.878  1.00 24.13  ?  54  GLU B C   1 
ATOM   1624  O  O   . GLU B  1 54  ? -18.935 26.276  -1.795  1.00 24.90  ?  54  GLU B O   1 
ATOM   1625  C  CB  . GLU B  1 54  ? -17.229 26.218  0.988   1.00 22.57  ?  54  GLU B CB  1 
ATOM   1626  C  CG  . GLU B  1 54  ? -16.928 26.792  2.374   1.00 22.87  ?  54  GLU B CG  1 
ATOM   1627  C  CD  . GLU B  1 54  ? -15.402 26.833  2.615   1.00 26.21  ?  54  GLU B CD  1 
ATOM   1628  O  OE1 . GLU B  1 54  ? -14.644 26.629  1.627   1.00 29.86  ?  54  GLU B OE1 1 
ATOM   1629  O  OE2 . GLU B  1 54  ? -14.932 27.029  3.762   1.00 26.01  -1 54  GLU B OE2 1 
ATOM   1630  N  N   . GLU B  1 55  ? -18.363 24.242  -1.109  1.00 24.01  ?  55  GLU B N   1 
ATOM   1631  C  CA  . GLU B  1 55  ? -18.195 23.804  -2.468  1.00 24.12  ?  55  GLU B CA  1 
ATOM   1632  C  C   . GLU B  1 55  ? -19.482 23.469  -3.132  1.00 24.59  ?  55  GLU B C   1 
ATOM   1633  O  O   . GLU B  1 55  ? -19.523 23.468  -4.348  1.00 25.67  ?  55  GLU B O   1 
ATOM   1634  C  CB  . GLU B  1 55  ? -17.266 22.633  -2.526  1.00 24.00  ?  55  GLU B CB  1 
ATOM   1635  C  CG  . GLU B  1 55  ? -15.863 23.100  -2.223  1.00 26.24  ?  55  GLU B CG  1 
ATOM   1636  C  CD  . GLU B  1 55  ? -14.807 22.098  -2.596  1.00 25.77  ?  55  GLU B CD  1 
ATOM   1637  O  OE1 . GLU B  1 55  ? -15.153 21.066  -3.213  1.00 27.50  ?  55  GLU B OE1 1 
ATOM   1638  O  OE2 . GLU B  1 55  ? -13.637 22.350  -2.243  1.00 23.88  -1 55  GLU B OE2 1 
ATOM   1639  N  N   . THR B  1 56  ? -20.526 23.175  -2.354  1.00 24.11  ?  56  THR B N   1 
ATOM   1640  C  CA  . THR B  1 56  ? -21.772 22.701  -2.912  1.00 24.49  ?  56  THR B CA  1 
ATOM   1641  C  C   . THR B  1 56  ? -22.954 23.420  -2.319  1.00 25.07  ?  56  THR B C   1 
ATOM   1642  O  O   . THR B  1 56  ? -24.055 23.333  -2.855  1.00 24.27  ?  56  THR B O   1 
ATOM   1643  C  CB  . THR B  1 56  ? -22.030 21.207  -2.572  1.00 25.16  ?  56  THR B CB  1 
ATOM   1644  O  OG1 . THR B  1 56  ? -22.430 21.101  -1.198  1.00 26.20  ?  56  THR B OG1 1 
ATOM   1645  C  CG2 . THR B  1 56  ? -20.810 20.363  -2.819  1.00 24.79  ?  56  THR B CG2 1 
ATOM   1646  N  N   . GLY B  1 57  ? -22.726 24.072  -1.174  1.00 25.75  ?  57  GLY B N   1 
ATOM   1647  C  CA  . GLY B  1 57  ? -23.753 24.797  -0.450  1.00 26.18  ?  57  GLY B CA  1 
ATOM   1648  C  C   . GLY B  1 57  ? -24.816 23.870  0.103   1.00 27.02  ?  57  GLY B C   1 
ATOM   1649  O  O   . GLY B  1 57  ? -25.985 24.257  0.241   1.00 27.14  ?  57  GLY B O   1 
ATOM   1650  N  N   . ILE B  1 58  ? -24.412 22.634  0.395   1.00 27.31  ?  58  ILE B N   1 
ATOM   1651  C  CA  . ILE B  1 58  ? -25.301 21.669  0.964   1.00 26.85  ?  58  ILE B CA  1 
ATOM   1652  C  C   . ILE B  1 58  ? -25.057 21.716  2.448   1.00 27.76  ?  58  ILE B C   1 
ATOM   1653  O  O   . ILE B  1 58  ? -23.923 21.737  2.893   1.00 27.22  ?  58  ILE B O   1 
ATOM   1654  C  CB  . ILE B  1 58  ? -25.042 20.276  0.403   1.00 26.68  ?  58  ILE B CB  1 
ATOM   1655  C  CG1 . ILE B  1 58  ? -25.343 20.260  -1.075  1.00 25.78  ?  58  ILE B CG1 1 
ATOM   1656  C  CG2 . ILE B  1 58  ? -25.942 19.236  1.055   1.00 26.18  ?  58  ILE B CG2 1 
ATOM   1657  C  CD1 . ILE B  1 58  ? -25.574 18.878  -1.567  1.00 29.27  ?  58  ILE B CD1 1 
ATOM   1658  N  N   . SER B  1 59  ? -26.145 21.742  3.211   1.00 28.98  ?  59  SER B N   1 
ATOM   1659  C  CA  . SER B  1 59  ? -26.057 21.665  4.654   1.00 29.74  ?  59  SER B CA  1 
ATOM   1660  C  C   . SER B  1 59  ? -26.364 20.288  5.192   1.00 29.21  ?  59  SER B C   1 
ATOM   1661  O  O   . SER B  1 59  ? -27.538 19.879  5.299   1.00 29.45  ?  59  SER B O   1 
ATOM   1662  C  CB  . SER B  1 59  ? -26.915 22.748  5.314   1.00 30.22  ?  59  SER B CB  1 
ATOM   1663  O  OG  . SER B  1 59  ? -26.077 23.902  5.484   1.00 33.72  ?  59  SER B OG  1 
ATOM   1664  N  N   . ALA B  1 60  ? -25.275 19.592  5.537   1.00 28.57  ?  60  ALA B N   1 
ATOM   1665  C  CA  . ALA B  1 60  ? -25.292 18.207  6.016   1.00 27.63  ?  60  ALA B CA  1 
ATOM   1666  C  C   . ALA B  1 60  ? -24.021 17.886  6.744   1.00 27.30  ?  60  ALA B C   1 
ATOM   1667  O  O   . ALA B  1 60  ? -22.959 18.455  6.506   1.00 27.46  ?  60  ALA B O   1 
ATOM   1668  C  CB  . ALA B  1 60  ? -25.483 17.209  4.862   1.00 27.95  ?  60  ALA B CB  1 
ATOM   1669  N  N   . GLN B  1 61  ? -24.133 16.926  7.636   1.00 26.63  ?  61  GLN B N   1 
ATOM   1670  C  CA  . GLN B  1 61  ? -23.051 16.578  8.533   1.00 25.45  ?  61  GLN B CA  1 
ATOM   1671  C  C   . GLN B  1 61  ? -22.529 15.181  8.100   1.00 23.87  ?  61  GLN B C   1 
ATOM   1672  O  O   . GLN B  1 61  ? -23.304 14.292  7.700   1.00 23.39  ?  61  GLN B O   1 
ATOM   1673  C  CB  . GLN B  1 61  ? -23.649 16.628  9.957   1.00 25.21  ?  61  GLN B CB  1 
ATOM   1674  C  CG  . GLN B  1 61  ? -22.690 16.894  11.115  1.00 28.58  ?  61  GLN B CG  1 
ATOM   1675  C  CD  . GLN B  1 61  ? -22.113 18.318  11.146  1.00 31.45  ?  61  GLN B CD  1 
ATOM   1676  O  OE1 . GLN B  1 61  ? -21.002 18.520  11.664  1.00 30.88  ?  61  GLN B OE1 1 
ATOM   1677  N  NE2 . GLN B  1 61  ? -22.860 19.305  10.601  1.00 29.13  ?  61  GLN B NE2 1 
ATOM   1678  N  N   . PRO B  1 62  ? -21.218 14.983  8.136   1.00 22.93  ?  62  PRO B N   1 
ATOM   1679  C  CA  . PRO B  1 62  ? -20.727 13.660  7.798   1.00 22.73  ?  62  PRO B CA  1 
ATOM   1680  C  C   . PRO B  1 62  ? -21.515 12.594  8.558   1.00 22.89  ?  62  PRO B C   1 
ATOM   1681  O  O   . PRO B  1 62  ? -21.811 12.799  9.719   1.00 24.04  ?  62  PRO B O   1 
ATOM   1682  C  CB  . PRO B  1 62  ? -19.290 13.699  8.333   1.00 22.72  ?  62  PRO B CB  1 
ATOM   1683  C  CG  . PRO B  1 62  ? -18.876 15.073  8.243   1.00 20.57  ?  62  PRO B CG  1 
ATOM   1684  C  CD  . PRO B  1 62  ? -20.119 15.954  8.238   1.00 22.58  ?  62  PRO B CD  1 
ATOM   1685  N  N   . GLN B  1 63  ? -21.861 11.472  7.931   1.00 22.17  ?  63  GLN B N   1 
ATOM   1686  C  CA  . GLN B  1 63  ? -22.460 10.374  8.670   1.00 21.04  ?  63  GLN B CA  1 
ATOM   1687  C  C   . GLN B  1 63  ? -21.496 9.329   9.147   1.00 21.03  ?  63  GLN B C   1 
ATOM   1688  O  O   . GLN B  1 63  ? -21.639 8.864   10.260  1.00 22.10  ?  63  GLN B O   1 
ATOM   1689  C  CB  . GLN B  1 63  ? -23.585 9.742   7.896   1.00 21.01  ?  63  GLN B CB  1 
ATOM   1690  C  CG  . GLN B  1 63  ? -24.776 10.687  7.812   1.00 21.11  ?  63  GLN B CG  1 
ATOM   1691  C  CD  . GLN B  1 63  ? -25.712 10.370  6.664   1.00 23.00  ?  63  GLN B CD  1 
ATOM   1692  O  OE1 . GLN B  1 63  ? -26.612 11.133  6.382   1.00 22.71  ?  63  GLN B OE1 1 
ATOM   1693  N  NE2 . GLN B  1 63  ? -25.511 9.231   6.008   1.00 25.28  ?  63  GLN B NE2 1 
ATOM   1694  N  N   . HIS B  1 64  ? -20.502 8.958   8.353   1.00 20.47  ?  64  HIS B N   1 
ATOM   1695  C  CA  . HIS B  1 64  ? -19.616 7.870   8.748   1.00 20.50  ?  64  HIS B CA  1 
ATOM   1696  C  C   . HIS B  1 64  ? -18.256 8.112   8.203   1.00 21.46  ?  64  HIS B C   1 
ATOM   1697  O  O   . HIS B  1 64  ? -18.113 8.639   7.113   1.00 22.48  ?  64  HIS B O   1 
ATOM   1698  C  CB  . HIS B  1 64  ? -20.081 6.518   8.162   1.00 20.63  ?  64  HIS B CB  1 
ATOM   1699  C  CG  . HIS B  1 64  ? -21.394 6.042   8.695   1.00 19.97  ?  64  HIS B CG  1 
ATOM   1700  N  ND1 . HIS B  1 64  ? -22.603 6.436   8.159   1.00 20.00  ?  64  HIS B ND1 1 
ATOM   1701  C  CD2 . HIS B  1 64  ? -21.689 5.219   9.732   1.00 20.06  ?  64  HIS B CD2 1 
ATOM   1702  C  CE1 . HIS B  1 64  ? -23.585 5.880   8.849   1.00 20.45  ?  64  HIS B CE1 1 
ATOM   1703  N  NE2 . HIS B  1 64  ? -23.059 5.149   9.817   1.00 18.82  ?  64  HIS B NE2 1 
ATOM   1704  N  N   . PHE B  1 65  ? -17.244 7.699   8.947   1.00 22.33  ?  65  PHE B N   1 
ATOM   1705  C  CA  . PHE B  1 65  ? -15.905 7.657   8.432   1.00 22.01  ?  65  PHE B CA  1 
ATOM   1706  C  C   . PHE B  1 65  ? -15.851 6.501   7.487   1.00 22.59  ?  65  PHE B C   1 
ATOM   1707  O  O   . PHE B  1 65  ? -16.105 5.376   7.894   1.00 23.20  ?  65  PHE B O   1 
ATOM   1708  C  CB  . PHE B  1 65  ? -14.931 7.362   9.558   1.00 21.51  ?  65  PHE B CB  1 
ATOM   1709  C  CG  . PHE B  1 65  ? -13.497 7.489   9.144   1.00 21.50  ?  65  PHE B CG  1 
ATOM   1710  C  CD1 . PHE B  1 65  ? -13.071 8.595   8.399   1.00 19.91  ?  65  PHE B CD1 1 
ATOM   1711  C  CD2 . PHE B  1 65  ? -12.555 6.524   9.505   1.00 17.77  ?  65  PHE B CD2 1 
ATOM   1712  C  CE1 . PHE B  1 65  ? -11.725 8.718   8.009   1.00 17.75  ?  65  PHE B CE1 1 
ATOM   1713  C  CE2 . PHE B  1 65  ? -11.204 6.647   9.113   1.00 16.50  ?  65  PHE B CE2 1 
ATOM   1714  C  CZ  . PHE B  1 65  ? -10.799 7.731   8.367   1.00 17.32  ?  65  PHE B CZ  1 
ATOM   1715  N  N   . ILE B  1 66  ? -15.495 6.744   6.231   1.00 22.77  ?  66  ILE B N   1 
ATOM   1716  C  CA  . ILE B  1 66  ? -15.184 5.618   5.345   1.00 22.09  ?  66  ILE B CA  1 
ATOM   1717  C  C   . ILE B  1 66  ? -13.777 5.127   5.588   1.00 22.77  ?  66  ILE B C   1 
ATOM   1718  O  O   . ILE B  1 66  ? -13.571 3.941   5.814   1.00 23.51  ?  66  ILE B O   1 
ATOM   1719  C  CB  . ILE B  1 66  ? -15.313 5.973   3.893   1.00 21.81  ?  66  ILE B CB  1 
ATOM   1720  C  CG1 . ILE B  1 66  ? -16.762 5.920   3.479   1.00 20.90  ?  66  ILE B CG1 1 
ATOM   1721  C  CG2 . ILE B  1 66  ? -14.635 4.968   3.032   1.00 20.05  ?  66  ILE B CG2 1 
ATOM   1722  C  CD1 . ILE B  1 66  ? -16.958 6.506   2.118   1.00 21.18  ?  66  ILE B CD1 1 
ATOM   1723  N  N   . ARG B  1 67  ? -12.805 6.033   5.595   1.00 23.11  ?  67  ARG B N   1 
ATOM   1724  C  CA  . ARG B  1 67  ? -11.422 5.608   5.524   1.00 23.21  ?  67  ARG B CA  1 
ATOM   1725  C  C   . ARG B  1 67  ? -10.512 6.832   5.228   1.00 23.79  ?  67  ARG B C   1 
ATOM   1726  O  O   . ARG B  1 67  ? -11.006 7.931   4.943   1.00 23.29  ?  67  ARG B O   1 
ATOM   1727  C  CB  . ARG B  1 67  ? -11.348 4.583   4.388   1.00 23.43  ?  67  ARG B CB  1 
ATOM   1728  C  CG  . ARG B  1 67  ? -10.150 3.716   4.356   1.00 23.88  ?  67  ARG B CG  1 
ATOM   1729  C  CD  . ARG B  1 67  ? -9.488  3.777   3.001   1.00 21.01  ?  67  ARG B CD  1 
ATOM   1730  N  NE  . ARG B  1 67  ? -8.049  3.953   3.213   1.00 24.51  ?  67  ARG B NE  1 
ATOM   1731  C  CZ  . ARG B  1 67  ? -7.087  3.185   2.704   1.00 22.77  ?  67  ARG B CZ  1 
ATOM   1732  N  NH1 . ARG B  1 67  ? -7.376  2.167   1.920   1.00 22.29  ?  67  ARG B NH1 1 
ATOM   1733  N  NH2 . ARG B  1 67  ? -5.825  3.455   2.972   1.00 24.27  ?  67  ARG B NH2 1 
ATOM   1734  N  N   . MET B  1 68  ? -9.190  6.644   5.301   1.00 24.09  ?  68  MET B N   1 
ATOM   1735  C  CA  . MET B  1 68  ? -8.248  7.727   5.104   1.00 24.30  ?  68  MET B CA  1 
ATOM   1736  C  C   . MET B  1 68  ? -7.141  7.260   4.175   1.00 25.18  ?  68  MET B C   1 
ATOM   1737  O  O   . MET B  1 68  ? -6.654  6.128   4.257   1.00 24.95  ?  68  MET B O   1 
ATOM   1738  C  CB  . MET B  1 68  ? -7.628  8.205   6.413   1.00 23.75  ?  68  MET B CB  1 
ATOM   1739  C  CG  . MET B  1 68  ? -6.660  9.338   6.169   1.00 24.38  ?  68  MET B CG  1 
ATOM   1740  S  SD  . MET B  1 68  ? -5.171  9.322   7.176   1.00 27.65  ?  68  MET B SD  1 
ATOM   1741  C  CE  . MET B  1 68  ? -4.172  8.062   6.389   1.00 25.07  ?  68  MET B CE  1 
ATOM   1742  N  N   . HIS B  1 69  ? -6.731  8.155   3.294   1.00 25.46  ?  69  HIS B N   1 
ATOM   1743  C  CA  . HIS B  1 69  ? -5.736  7.798   2.327   1.00 25.55  ?  69  HIS B CA  1 
ATOM   1744  C  C   . HIS B  1 69  ? -4.531  8.722   2.529   1.00 26.08  ?  69  HIS B C   1 
ATOM   1745  O  O   . HIS B  1 69  ? -4.675  9.960   2.494   1.00 25.53  ?  69  HIS B O   1 
ATOM   1746  C  CB  . HIS B  1 69  ? -6.335  7.990   0.936   1.00 25.67  ?  69  HIS B CB  1 
ATOM   1747  C  CG  . HIS B  1 69  ? -7.256  6.893   0.490   1.00 23.58  ?  69  HIS B CG  1 
ATOM   1748  N  ND1 . HIS B  1 69  ? -8.629  7.037   0.473   1.00 20.49  ?  69  HIS B ND1 1 
ATOM   1749  C  CD2 . HIS B  1 69  ? -6.997  5.670   -0.034  1.00 21.84  ?  69  HIS B CD2 1 
ATOM   1750  C  CE1 . HIS B  1 69  ? -9.181  5.933   0.004   1.00 20.75  ?  69  HIS B CE1 1 
ATOM   1751  N  NE2 . HIS B  1 69  ? -8.212  5.087   -0.312  1.00 23.01  ?  69  HIS B NE2 1 
ATOM   1752  N  N   . GLN B  1 70  ? -3.360  8.145   2.793   1.00 26.66  ?  70  GLN B N   1 
ATOM   1753  C  CA  . GLN B  1 70  ? -2.143  8.936   2.773   1.00 28.41  ?  70  GLN B CA  1 
ATOM   1754  C  C   . GLN B  1 70  ? -1.569  8.795   1.374   1.00 29.05  ?  70  GLN B C   1 
ATOM   1755  O  O   . GLN B  1 70  ? -1.576  7.697   0.818   1.00 30.01  ?  70  GLN B O   1 
ATOM   1756  C  CB  . GLN B  1 70  ? -1.166  8.458   3.827   1.00 29.06  ?  70  GLN B CB  1 
ATOM   1757  C  CG  . GLN B  1 70  ? 0.243   8.998   3.709   1.00 29.23  ?  70  GLN B CG  1 
ATOM   1758  C  CD  . GLN B  1 70  ? 1.173   8.362   4.728   1.00 32.96  ?  70  GLN B CD  1 
ATOM   1759  O  OE1 . GLN B  1 70  ? 1.179   7.135   4.926   1.00 36.56  ?  70  GLN B OE1 1 
ATOM   1760  N  NE2 . GLN B  1 70  ? 1.966   9.185   5.383   1.00 31.68  ?  70  GLN B NE2 1 
ATOM   1761  N  N   . TRP B  1 71  ? -1.113  9.898   0.789   1.00 29.10  ?  71  TRP B N   1 
ATOM   1762  C  CA  . TRP B  1 71  ? -0.816  9.924   -0.629  1.00 29.57  ?  71  TRP B CA  1 
ATOM   1763  C  C   . TRP B  1 71  ? 0.211   10.984  -0.992  1.00 30.63  ?  71  TRP B C   1 
ATOM   1764  O  O   . TRP B  1 71  ? 0.248   12.056  -0.374  1.00 30.79  ?  71  TRP B O   1 
ATOM   1765  C  CB  . TRP B  1 71  ? -2.107  10.182  -1.378  1.00 29.51  ?  71  TRP B CB  1 
ATOM   1766  C  CG  . TRP B  1 71  ? -1.971  10.350  -2.872  1.00 29.30  ?  71  TRP B CG  1 
ATOM   1767  C  CD1 . TRP B  1 71  ? -1.517  9.435   -3.765  1.00 29.92  ?  71  TRP B CD1 1 
ATOM   1768  C  CD2 . TRP B  1 71  ? -2.324  11.508  -3.631  1.00 29.37  ?  71  TRP B CD2 1 
ATOM   1769  N  NE1 . TRP B  1 71  ? -1.554  9.953   -5.040  1.00 28.60  ?  71  TRP B NE1 1 
ATOM   1770  C  CE2 . TRP B  1 71  ? -2.051  11.224  -4.981  1.00 29.68  ?  71  TRP B CE2 1 
ATOM   1771  C  CE3 . TRP B  1 71  ? -2.854  12.754  -3.300  1.00 30.39  ?  71  TRP B CE3 1 
ATOM   1772  C  CZ2 . TRP B  1 71  ? -2.292  12.141  -6.002  1.00 30.61  ?  71  TRP B CZ2 1 
ATOM   1773  C  CZ3 . TRP B  1 71  ? -3.086  13.668  -4.315  1.00 32.21  ?  71  TRP B CZ3 1 
ATOM   1774  C  CH2 . TRP B  1 71  ? -2.801  13.357  -5.647  1.00 30.37  ?  71  TRP B CH2 1 
ATOM   1775  N  N   . ILE B  1 72  ? 1.045   10.704  -1.993  1.00 31.75  ?  72  ILE B N   1 
ATOM   1776  C  CA  . ILE B  1 72  ? 1.953   11.750  -2.412  1.00 33.26  ?  72  ILE B CA  1 
ATOM   1777  C  C   . ILE B  1 72  ? 1.432   12.679  -3.464  1.00 34.16  ?  72  ILE B C   1 
ATOM   1778  O  O   . ILE B  1 72  ? 1.110   13.788  -3.119  1.00 36.09  ?  72  ILE B O   1 
ATOM   1779  C  CB  . ILE B  1 72  ? 3.419   11.351  -2.679  1.00 33.61  ?  72  ILE B CB  1 
ATOM   1780  C  CG1 . ILE B  1 72  ? 4.003   10.607  -1.466  1.00 33.74  ?  72  ILE B CG1 1 
ATOM   1781  C  CG2 . ILE B  1 72  ? 4.256   12.621  -2.930  1.00 32.55  ?  72  ILE B CG2 1 
ATOM   1782  C  CD1 . ILE B  1 72  ? 3.948   11.387  -0.180  1.00 33.56  ?  72  ILE B CD1 1 
ATOM   1783  N  N   . ALA B  1 73  ? 1.360   12.323  -4.729  1.00 34.39  ?  73  ALA B N   1 
ATOM   1784  C  CA  . ALA B  1 73  ? 0.964   13.391  -5.692  1.00 35.49  ?  73  ALA B CA  1 
ATOM   1785  C  C   . ALA B  1 73  ? 2.103   13.961  -6.444  1.00 36.11  ?  73  ALA B C   1 
ATOM   1786  O  O   . ALA B  1 73  ? 3.119   14.290  -5.843  1.00 36.06  ?  73  ALA B O   1 
ATOM   1787  C  CB  . ALA B  1 73  ? 0.215   14.583  -5.030  1.00 34.10  ?  73  ALA B CB  1 
ATOM   1788  N  N   . PRO B  1 74  ? 1.894   14.145  -7.762  1.00 37.16  ?  74  PRO B N   1 
ATOM   1789  C  CA  . PRO B  1 74  ? 2.813   14.612  -8.780  1.00 37.75  ?  74  PRO B CA  1 
ATOM   1790  C  C   . PRO B  1 74  ? 3.691   15.745  -8.275  1.00 38.51  ?  74  PRO B C   1 
ATOM   1791  O  O   . PRO B  1 74  ? 4.919   15.669  -8.361  1.00 38.82  ?  74  PRO B O   1 
ATOM   1792  C  CB  . PRO B  1 74  ? 1.869   15.112  -9.874  1.00 37.93  ?  74  PRO B CB  1 
ATOM   1793  C  CG  . PRO B  1 74  ? 0.464   14.812  -9.381  1.00 37.57  ?  74  PRO B CG  1 
ATOM   1794  C  CD  . PRO B  1 74  ? 0.592   13.808  -8.359  1.00 37.08  ?  74  PRO B CD  1 
ATOM   1795  N  N   . ASP B  1 75  ? 3.046   16.781  -7.750  1.00 39.02  ?  75  ASP B N   1 
ATOM   1796  C  CA  . ASP B  1 75  ? 3.691   17.859  -7.015  1.00 38.85  ?  75  ASP B CA  1 
ATOM   1797  C  C   . ASP B  1 75  ? 4.850   17.409  -6.134  1.00 38.70  ?  75  ASP B C   1 
ATOM   1798  O  O   . ASP B  1 75  ? 5.822   18.147  -5.950  1.00 38.48  ?  75  ASP B O   1 
ATOM   1799  C  CB  . ASP B  1 75  ? 2.643   18.416  -6.091  1.00 38.99  ?  75  ASP B CB  1 
ATOM   1800  C  CG  . ASP B  1 75  ? 2.532   19.868  -6.194  1.00 40.64  ?  75  ASP B CG  1 
ATOM   1801  O  OD1 . ASP B  1 75  ? 3.572   20.457  -6.515  1.00 42.36  ?  75  ASP B OD1 1 
ATOM   1802  O  OD2 . ASP B  1 75  ? 1.421   20.413  -5.956  1.00 41.78  -1 75  ASP B OD2 1 
ATOM   1803  N  N   . LYS B  1 76  ? 4.734   16.186  -5.606  1.00 38.21  ?  76  LYS B N   1 
ATOM   1804  C  CA  . LYS B  1 76  ? 5.465   15.701  -4.399  1.00 38.45  ?  76  LYS B CA  1 
ATOM   1805  C  C   . LYS B  1 76  ? 4.850   16.270  -3.068  1.00 37.29  ?  76  LYS B C   1 
ATOM   1806  O  O   . LYS B  1 76  ? 5.404   16.087  -1.971  1.00 37.42  ?  76  LYS B O   1 
ATOM   1807  C  CB  . LYS B  1 76  ? 7.009   15.872  -4.475  1.00 38.32  ?  76  LYS B CB  1 
ATOM   1808  C  CG  . LYS B  1 76  ? 7.735   15.389  -5.782  1.00 41.23  ?  76  LYS B CG  1 
ATOM   1809  C  CD  . LYS B  1 76  ? 7.425   13.930  -6.229  1.00 46.68  ?  76  LYS B CD  1 
ATOM   1810  C  CE  . LYS B  1 76  ? 8.140   12.828  -5.395  1.00 49.59  ?  76  LYS B CE  1 
ATOM   1811  N  NZ  . LYS B  1 76  ? 7.372   11.518  -5.301  1.00 49.32  ?  76  LYS B NZ  1 
ATOM   1812  N  N   . THR B  1 77  ? 3.707   16.945  -3.177  1.00 36.01  ?  77  THR B N   1 
ATOM   1813  C  CA  . THR B  1 77  ? 2.988   17.463  -2.007  1.00 35.66  ?  77  THR B CA  1 
ATOM   1814  C  C   . THR B  1 77  ? 2.381   16.298  -1.221  1.00 35.33  ?  77  THR B C   1 
ATOM   1815  O  O   . THR B  1 77  ? 1.540   15.571  -1.758  1.00 35.42  ?  77  THR B O   1 
ATOM   1816  C  CB  . THR B  1 77  ? 1.806   18.356  -2.409  1.00 35.48  ?  77  THR B CB  1 
ATOM   1817  O  OG1 . THR B  1 77  ? 2.253   19.383  -3.297  1.00 37.36  ?  77  THR B OG1 1 
ATOM   1818  C  CG2 . THR B  1 77  ? 1.158   18.973  -1.191  1.00 33.80  ?  77  THR B CG2 1 
ATOM   1819  N  N   . PRO B  1 78  ? 2.754   16.144  0.065   1.00 34.40  ?  78  PRO B N   1 
ATOM   1820  C  CA  . PRO B  1 78  ? 2.196   15.036  0.891   1.00 33.01  ?  78  PRO B CA  1 
ATOM   1821  C  C   . PRO B  1 78  ? 0.770   15.304  1.443   1.00 31.79  ?  78  PRO B C   1 
ATOM   1822  O  O   . PRO B  1 78  ? 0.525   16.372  2.046   1.00 30.58  ?  78  PRO B O   1 
ATOM   1823  C  CB  . PRO B  1 78  ? 3.199   14.941  2.034   1.00 32.86  ?  78  PRO B CB  1 
ATOM   1824  C  CG  . PRO B  1 78  ? 3.639   16.434  2.243   1.00 33.91  ?  78  PRO B CG  1 
ATOM   1825  C  CD  . PRO B  1 78  ? 3.627   17.053  0.844   1.00 34.43  ?  78  PRO B CD  1 
ATOM   1826  N  N   . PHE B  1 79  ? -0.145  14.342  1.241   1.00 30.45  ?  79  PHE B N   1 
ATOM   1827  C  CA  . PHE B  1 79  ? -1.507  14.439  1.788   1.00 29.35  ?  79  PHE B CA  1 
ATOM   1828  C  C   . PHE B  1 79  ? -1.929  13.345  2.776   1.00 28.98  ?  79  PHE B C   1 
ATOM   1829  O  O   . PHE B  1 79  ? -1.495  12.168  2.705   1.00 29.42  ?  79  PHE B O   1 
ATOM   1830  C  CB  . PHE B  1 79  ? -2.559  14.477  0.667   1.00 30.16  ?  79  PHE B CB  1 
ATOM   1831  C  CG  . PHE B  1 79  ? -2.617  15.777  -0.082  1.00 29.03  ?  79  PHE B CG  1 
ATOM   1832  C  CD1 . PHE B  1 79  ? -3.517  16.757  0.287   1.00 29.86  ?  79  PHE B CD1 1 
ATOM   1833  C  CD2 . PHE B  1 79  ? -1.767  16.009  -1.168  1.00 29.24  ?  79  PHE B CD2 1 
ATOM   1834  C  CE1 . PHE B  1 79  ? -3.583  17.988  -0.400  1.00 31.44  ?  79  PHE B CE1 1 
ATOM   1835  C  CE2 . PHE B  1 79  ? -1.812  17.209  -1.864  1.00 29.77  ?  79  PHE B CE2 1 
ATOM   1836  C  CZ  . PHE B  1 79  ? -2.728  18.219  -1.470  1.00 31.84  ?  79  PHE B CZ  1 
ATOM   1837  N  N   . LEU B  1 80  ? -2.803  13.747  3.696   1.00 27.53  ?  80  LEU B N   1 
ATOM   1838  C  CA  . LEU B  1 80  ? -3.576  12.849  4.517   1.00 25.55  ?  80  LEU B CA  1 
ATOM   1839  C  C   . LEU B  1 80  ? -4.980  13.315  4.302   1.00 24.88  ?  80  LEU B C   1 
ATOM   1840  O  O   . LEU B  1 80  ? -5.339  14.396  4.740   1.00 24.49  ?  80  LEU B O   1 
ATOM   1841  C  CB  . LEU B  1 80  ? -3.171  12.995  5.980   1.00 25.77  ?  80  LEU B CB  1 
ATOM   1842  C  CG  . LEU B  1 80  ? -2.289  11.920  6.643   1.00 24.05  ?  80  LEU B CG  1 
ATOM   1843  C  CD1 . LEU B  1 80  ? -1.079  11.508  5.832   1.00 23.27  ?  80  LEU B CD1 1 
ATOM   1844  C  CD2 . LEU B  1 80  ? -1.846  12.344  7.996   1.00 23.77  ?  80  LEU B CD2 1 
ATOM   1845  N  N   . ARG B  1 81  ? -5.760  12.497  3.596   1.00 24.68  ?  81  ARG B N   1 
ATOM   1846  C  CA  . ARG B  1 81  ? -7.134  12.817  3.118   1.00 23.64  ?  81  ARG B CA  1 
ATOM   1847  C  C   . ARG B  1 81  ? -8.154  11.891  3.742   1.00 23.72  ?  81  ARG B C   1 
ATOM   1848  O  O   . ARG B  1 81  ? -8.187  10.705  3.406   1.00 25.19  ?  81  ARG B O   1 
ATOM   1849  C  CB  . ARG B  1 81  ? -7.184  12.576  1.600   1.00 22.75  ?  81  ARG B CB  1 
ATOM   1850  C  CG  . ARG B  1 81  ? -8.491  12.906  0.917   1.00 20.15  ?  81  ARG B CG  1 
ATOM   1851  C  CD  . ARG B  1 81  ? -8.293  12.821  -0.595  1.00 14.74  ?  81  ARG B CD  1 
ATOM   1852  N  NE  . ARG B  1 81  ? -9.441  13.229  -1.403  1.00 12.75  ?  81  ARG B NE  1 
ATOM   1853  C  CZ  . ARG B  1 81  ? -10.410 12.404  -1.810  1.00 14.32  ?  81  ARG B CZ  1 
ATOM   1854  N  NH1 . ARG B  1 81  ? -10.403 11.116  -1.434  1.00 13.84  ?  81  ARG B NH1 1 
ATOM   1855  N  NH2 . ARG B  1 81  ? -11.383 12.857  -2.605  1.00 10.96  ?  81  ARG B NH2 1 
ATOM   1856  N  N   . PHE B  1 82  ? -8.979  12.407  4.641   1.00 23.64  ?  82  PHE B N   1 
ATOM   1857  C  CA  . PHE B  1 82  ? -10.017 11.592  5.294   1.00 22.61  ?  82  PHE B CA  1 
ATOM   1858  C  C   . PHE B  1 82  ? -11.286 11.643  4.521   1.00 21.79  ?  82  PHE B C   1 
ATOM   1859  O  O   . PHE B  1 82  ? -11.791 12.731  4.213   1.00 22.26  ?  82  PHE B O   1 
ATOM   1860  C  CB  . PHE B  1 82  ? -10.319 12.047  6.735   1.00 22.83  ?  82  PHE B CB  1 
ATOM   1861  C  CG  . PHE B  1 82  ? -9.138  11.984  7.644   1.00 23.93  ?  82  PHE B CG  1 
ATOM   1862  C  CD1 . PHE B  1 82  ? -7.981  12.748  7.369   1.00 23.58  ?  82  PHE B CD1 1 
ATOM   1863  C  CD2 . PHE B  1 82  ? -9.165  11.167  8.783   1.00 23.68  ?  82  PHE B CD2 1 
ATOM   1864  C  CE1 . PHE B  1 82  ? -6.861  12.684  8.220   1.00 25.24  ?  82  PHE B CE1 1 
ATOM   1865  C  CE2 . PHE B  1 82  ? -8.052  11.102  9.643   1.00 23.44  ?  82  PHE B CE2 1 
ATOM   1866  C  CZ  . PHE B  1 82  ? -6.899  11.850  9.368   1.00 23.16  ?  82  PHE B CZ  1 
ATOM   1867  N  N   . LEU B  1 83  ? -11.824 10.445  4.288   1.00 20.79  ?  83  LEU B N   1 
ATOM   1868  C  CA  . LEU B  1 83  ? -13.067 10.201  3.560   1.00 18.91  ?  83  LEU B CA  1 
ATOM   1869  C  C   . LEU B  1 83  ? -14.255 9.864   4.459   1.00 18.66  ?  83  LEU B C   1 
ATOM   1870  O  O   . LEU B  1 83  ? -14.169 9.007   5.347   1.00 18.86  ?  83  LEU B O   1 
ATOM   1871  C  CB  . LEU B  1 83  ? -12.817 9.042   2.587   1.00 18.66  ?  83  LEU B CB  1 
ATOM   1872  C  CG  . LEU B  1 83  ? -13.765 8.859   1.405   1.00 16.84  ?  83  LEU B CG  1 
ATOM   1873  C  CD1 . LEU B  1 83  ? -13.931 10.149  0.603   1.00 13.52  ?  83  LEU B CD1 1 
ATOM   1874  C  CD2 . LEU B  1 83  ? -13.274 7.706   0.560   1.00 12.10  ?  83  LEU B CD2 1 
ATOM   1875  N  N   . PHE B  1 84  ? -15.374 10.509  4.165   1.00 17.96  ?  84  PHE B N   1 
ATOM   1876  C  CA  . PHE B  1 84  ? -16.565 10.472  4.958   1.00 17.92  ?  84  PHE B CA  1 
ATOM   1877  C  C   . PHE B  1 84  ? -17.752 10.092  4.087   1.00 18.39  ?  84  PHE B C   1 
ATOM   1878  O  O   . PHE B  1 84  ? -17.690 10.249  2.868   1.00 19.88  ?  84  PHE B O   1 
ATOM   1879  C  CB  . PHE B  1 84  ? -16.804 11.859  5.559   1.00 18.32  ?  84  PHE B CB  1 
ATOM   1880  C  CG  . PHE B  1 84  ? -15.828 12.225  6.612   1.00 17.80  ?  84  PHE B CG  1 
ATOM   1881  C  CD1 . PHE B  1 84  ? -14.764 13.081  6.315   1.00 16.05  ?  84  PHE B CD1 1 
ATOM   1882  C  CD2 . PHE B  1 84  ? -15.969 11.714  7.903   1.00 18.35  ?  84  PHE B CD2 1 
ATOM   1883  C  CE1 . PHE B  1 84  ? -13.833 13.424  7.274   1.00 17.97  ?  84  PHE B CE1 1 
ATOM   1884  C  CE2 . PHE B  1 84  ? -15.025 12.023  8.887   1.00 21.14  ?  84  PHE B CE2 1 
ATOM   1885  C  CZ  . PHE B  1 84  ? -13.945 12.879  8.576   1.00 21.64  ?  84  PHE B CZ  1 
ATOM   1886  N  N   . ALA B  1 85  ? -18.840 9.608   4.674   1.00 17.53  ?  85  ALA B N   1 
ATOM   1887  C  CA  . ALA B  1 85  ? -19.980 9.218   3.839   1.00 18.31  ?  85  ALA B CA  1 
ATOM   1888  C  C   . ALA B  1 85  ? -21.221 9.861   4.366   1.00 18.36  ?  85  ALA B C   1 
ATOM   1889  O  O   . ALA B  1 85  ? -21.381 10.011  5.562   1.00 18.66  ?  85  ALA B O   1 
ATOM   1890  C  CB  . ALA B  1 85  ? -20.143 7.672   3.779   1.00 17.93  ?  85  ALA B CB  1 
ATOM   1891  N  N   . ILE B  1 86  ? -22.089 10.272  3.456   1.00 18.95  ?  86  ILE B N   1 
ATOM   1892  C  CA  . ILE B  1 86  ? -23.363 10.942  3.774   1.00 18.01  ?  86  ILE B CA  1 
ATOM   1893  C  C   . ILE B  1 86  ? -24.429 10.370  2.826   1.00 18.11  ?  86  ILE B C   1 
ATOM   1894  O  O   . ILE B  1 86  ? -24.285 10.456  1.595   1.00 17.63  ?  86  ILE B O   1 
ATOM   1895  C  CB  . ILE B  1 86  ? -23.272 12.460  3.499   1.00 17.60  ?  86  ILE B CB  1 
ATOM   1896  C  CG1 . ILE B  1 86  ? -22.080 13.097  4.231   1.00 17.32  ?  86  ILE B CG1 1 
ATOM   1897  C  CG2 . ILE B  1 86  ? -24.591 13.152  3.811   1.00 16.57  ?  86  ILE B CG2 1 
ATOM   1898  C  CD1 . ILE B  1 86  ? -22.135 14.660  4.324   1.00 10.31  ?  86  ILE B CD1 1 
ATOM   1899  N  N   . GLU B  1 87  ? -25.483 9.772   3.376   1.00 18.53  ?  87  GLU B N   1 
ATOM   1900  C  CA  . GLU B  1 87  ? -26.583 9.316   2.531   1.00 19.05  ?  87  GLU B CA  1 
ATOM   1901  C  C   . GLU B  1 87  ? -27.625 10.384  2.631   1.00 20.46  ?  87  GLU B C   1 
ATOM   1902  O  O   . GLU B  1 87  ? -27.768 10.961  3.702   1.00 20.93  ?  87  GLU B O   1 
ATOM   1903  C  CB  . GLU B  1 87  ? -27.178 8.017   3.059   1.00 18.18  ?  87  GLU B CB  1 
ATOM   1904  C  CG  . GLU B  1 87  ? -26.233 6.846   3.049   1.00 17.08  ?  87  GLU B CG  1 
ATOM   1905  C  CD  . GLU B  1 87  ? -25.946 6.392   1.642   1.00 20.30  ?  87  GLU B CD  1 
ATOM   1906  O  OE1 . GLU B  1 87  ? -24.884 5.740   1.430   1.00 21.42  ?  87  GLU B OE1 1 
ATOM   1907  O  OE2 . GLU B  1 87  ? -26.777 6.719   0.754   1.00 17.04  -1 87  GLU B OE2 1 
ATOM   1908  N  N   . LEU B  1 88  ? -28.337 10.678  1.547   1.00 21.77  ?  88  LEU B N   1 
ATOM   1909  C  CA  . LEU B  1 88  ? -29.539 11.503  1.642   1.00 23.93  ?  88  LEU B CA  1 
ATOM   1910  C  C   . LEU B  1 88  ? -30.620 10.793  0.860   1.00 26.24  ?  88  LEU B C   1 
ATOM   1911  O  O   . LEU B  1 88  ? -30.325 10.055  -0.073  1.00 27.51  ?  88  LEU B O   1 
ATOM   1912  C  CB  . LEU B  1 88  ? -29.327 12.893  1.051   1.00 23.13  ?  88  LEU B CB  1 
ATOM   1913  C  CG  . LEU B  1 88  ? -27.987 13.629  1.204   1.00 21.42  ?  88  LEU B CG  1 
ATOM   1914  C  CD1 . LEU B  1 88  ? -27.909 14.854  0.237   1.00 19.46  ?  88  LEU B CD1 1 
ATOM   1915  C  CD2 . LEU B  1 88  ? -27.771 14.063  2.636   1.00 16.41  ?  88  LEU B CD2 1 
ATOM   1916  N  N   . GLU B  1 89  ? -31.871 11.041  1.216   1.00 29.14  ?  89  GLU B N   1 
ATOM   1917  C  CA  . GLU B  1 89  ? -32.978 10.301  0.663   1.00 31.67  ?  89  GLU B CA  1 
ATOM   1918  C  C   . GLU B  1 89  ? -33.295 10.771  -0.702  1.00 32.52  ?  89  GLU B C   1 
ATOM   1919  O  O   . GLU B  1 89  ? -33.940 10.033  -1.481  1.00 33.43  ?  89  GLU B O   1 
ATOM   1920  C  CB  . GLU B  1 89  ? -34.209 10.449  1.511   1.00 32.16  ?  89  GLU B CB  1 
ATOM   1921  C  CG  . GLU B  1 89  ? -34.354 9.293   2.444   1.00 39.56  ?  89  GLU B CG  1 
ATOM   1922  C  CD  . GLU B  1 89  ? -33.674 9.559   3.795   1.00 47.36  ?  89  GLU B CD  1 
ATOM   1923  O  OE1 . GLU B  1 89  ? -34.290 10.350  4.562   1.00 49.66  ?  89  GLU B OE1 1 
ATOM   1924  O  OE2 . GLU B  1 89  ? -32.566 8.974   4.083   1.00 48.77  -1 89  GLU B OE2 1 
ATOM   1925  N  N   . GLN B  1 90  ? -32.893 12.014  -0.987  1.00 32.15  ?  90  GLN B N   1 
ATOM   1926  C  CA  . GLN B  1 90  ? -33.080 12.543  -2.324  1.00 32.01  ?  90  GLN B CA  1 
ATOM   1927  C  C   . GLN B  1 90  ? -32.072 13.569  -2.737  1.00 31.35  ?  90  GLN B C   1 
ATOM   1928  O  O   . GLN B  1 90  ? -31.454 14.262  -1.900  1.00 31.62  ?  90  GLN B O   1 
ATOM   1929  C  CB  . GLN B  1 90  ? -34.524 12.997  -2.610  1.00 31.96  ?  90  GLN B CB  1 
ATOM   1930  C  CG  . GLN B  1 90  ? -35.207 13.825  -1.557  1.00 34.39  ?  90  GLN B CG  1 
ATOM   1931  C  CD  . GLN B  1 90  ? -36.720 13.996  -1.850  1.00 38.29  ?  90  GLN B CD  1 
ATOM   1932  O  OE1 . GLN B  1 90  ? -37.213 13.570  -2.899  1.00 39.57  ?  90  GLN B OE1 1 
ATOM   1933  N  NE2 . GLN B  1 90  ? -37.452 14.601  -0.912  1.00 38.10  ?  90  GLN B NE2 1 
ATOM   1934  N  N   . ILE B  1 91  ? -31.917 13.656  -4.051  1.00 30.17  ?  91  ILE B N   1 
ATOM   1935  C  CA  . ILE B  1 91  ? -31.032 14.611  -4.649  1.00 29.01  ?  91  ILE B CA  1 
ATOM   1936  C  C   . ILE B  1 91  ? -31.522 15.968  -4.166  1.00 29.29  ?  91  ILE B C   1 
ATOM   1937  O  O   . ILE B  1 91  ? -32.740 16.297  -4.239  1.00 29.09  ?  91  ILE B O   1 
ATOM   1938  C  CB  . ILE B  1 91  ? -31.052 14.461  -6.199  1.00 29.61  ?  91  ILE B CB  1 
ATOM   1939  C  CG1 . ILE B  1 91  ? -30.302 13.167  -6.613  1.00 27.49  ?  91  ILE B CG1 1 
ATOM   1940  C  CG2 . ILE B  1 91  ? -30.517 15.733  -6.921  1.00 26.35  ?  91  ILE B CG2 1 
ATOM   1941  C  CD1 . ILE B  1 91  ? -30.350 12.831  -8.152  1.00 27.21  ?  91  ILE B CD1 1 
ATOM   1942  N  N   . CYS B  1 92  ? -30.595 16.734  -3.619  1.00 28.35  ?  92  CYS B N   1 
ATOM   1943  C  CA  . CYS B  1 92  ? -30.961 18.005  -3.088  1.00 28.96  ?  92  CYS B CA  1 
ATOM   1944  C  C   . CYS B  1 92  ? -30.363 19.141  -3.915  1.00 29.49  ?  92  CYS B C   1 
ATOM   1945  O  O   . CYS B  1 92  ? -29.268 19.022  -4.471  1.00 30.14  ?  92  CYS B O   1 
ATOM   1946  C  CB  . CYS B  1 92  ? -30.498 18.091  -1.658  1.00 28.57  ?  92  CYS B CB  1 
ATOM   1947  S  SG  . CYS B  1 92  ? -28.735 17.998  -1.628  1.00 30.18  ?  92  CYS B SG  1 
ATOM   1948  N  N   . PRO B  1 93  ? -31.081 20.259  -3.997  1.00 29.69  ?  93  PRO B N   1 
ATOM   1949  C  CA  . PRO B  1 93  ? -30.563 21.503  -4.544  1.00 29.90  ?  93  PRO B CA  1 
ATOM   1950  C  C   . PRO B  1 93  ? -29.094 21.711  -4.219  1.00 29.93  ?  93  PRO B C   1 
ATOM   1951  O  O   . PRO B  1 93  ? -28.694 21.446  -3.106  1.00 30.29  ?  93  PRO B O   1 
ATOM   1952  C  CB  . PRO B  1 93  ? -31.379 22.543  -3.789  1.00 29.34  ?  93  PRO B CB  1 
ATOM   1953  C  CG  . PRO B  1 93  ? -32.668 21.901  -3.601  1.00 29.55  ?  93  PRO B CG  1 
ATOM   1954  C  CD  . PRO B  1 93  ? -32.474 20.413  -3.548  1.00 29.80  ?  93  PRO B CD  1 
ATOM   1955  N  N   . THR B  1 94  ? -28.290 22.164  -5.168  1.00 30.33  ?  94  THR B N   1 
ATOM   1956  C  CA  . THR B  1 94  ? -26.938 22.595  -4.811  1.00 30.86  ?  94  THR B CA  1 
ATOM   1957  C  C   . THR B  1 94  ? -26.618 23.978  -5.392  1.00 31.65  ?  94  THR B C   1 
ATOM   1958  O  O   . THR B  1 94  ? -27.192 24.395  -6.400  1.00 32.41  ?  94  THR B O   1 
ATOM   1959  C  CB  . THR B  1 94  ? -25.861 21.581  -5.262  1.00 31.01  ?  94  THR B CB  1 
ATOM   1960  O  OG1 . THR B  1 94  ? -25.811 21.544  -6.692  1.00 31.35  ?  94  THR B OG1 1 
ATOM   1961  C  CG2 . THR B  1 94  ? -26.179 20.186  -4.751  1.00 30.64  ?  94  THR B CG2 1 
ATOM   1962  N  N   . GLN B  1 95  ? -25.665 24.661  -4.765  1.00 32.18  ?  95  GLN B N   1 
ATOM   1963  C  CA  . GLN B  1 95  ? -25.306 26.027  -5.066  1.00 32.16  ?  95  GLN B CA  1 
ATOM   1964  C  C   . GLN B  1 95  ? -23.954 26.308  -4.422  1.00 31.34  ?  95  GLN B C   1 
ATOM   1965  O  O   . GLN B  1 95  ? -23.903 26.661  -3.265  1.00 31.63  ?  95  GLN B O   1 
ATOM   1966  C  CB  . GLN B  1 95  ? -26.352 26.951  -4.454  1.00 32.96  ?  95  GLN B CB  1 
ATOM   1967  C  CG  . GLN B  1 95  ? -26.172 28.446  -4.751  1.00 37.44  ?  95  GLN B CG  1 
ATOM   1968  C  CD  . GLN B  1 95  ? -26.793 28.864  -6.086  1.00 43.49  ?  95  GLN B CD  1 
ATOM   1969  O  OE1 . GLN B  1 95  ? -26.196 28.684  -7.161  1.00 43.51  ?  95  GLN B OE1 1 
ATOM   1970  N  NE2 . GLN B  1 95  ? -28.009 29.436  -6.020  1.00 47.31  ?  95  GLN B NE2 1 
ATOM   1971  N  N   . PRO B  1 96  ? -22.844 26.152  -5.166  1.00 30.87  ?  96  PRO B N   1 
ATOM   1972  C  CA  . PRO B  1 96  ? -21.514 26.446  -4.595  1.00 30.32  ?  96  PRO B CA  1 
ATOM   1973  C  C   . PRO B  1 96  ? -21.333 27.877  -4.090  1.00 29.56  ?  96  PRO B C   1 
ATOM   1974  O  O   . PRO B  1 96  ? -21.896 28.823  -4.632  1.00 29.72  ?  96  PRO B O   1 
ATOM   1975  C  CB  . PRO B  1 96  ? -20.567 26.199  -5.777  1.00 30.88  ?  96  PRO B CB  1 
ATOM   1976  C  CG  . PRO B  1 96  ? -21.343 25.303  -6.711  1.00 30.97  ?  96  PRO B CG  1 
ATOM   1977  C  CD  . PRO B  1 96  ? -22.760 25.749  -6.581  1.00 30.50  ?  96  PRO B CD  1 
ATOM   1978  N  N   . HIS B  1 97  ? -20.535 28.027  -3.064  1.00 28.67  ?  97  HIS B N   1 
ATOM   1979  C  CA  . HIS B  1 97  ? -20.294 29.331  -2.495  1.00 29.21  ?  97  HIS B CA  1 
ATOM   1980  C  C   . HIS B  1 97  ? -18.816 29.631  -2.554  1.00 29.27  ?  97  HIS B C   1 
ATOM   1981  O  O   . HIS B  1 97  ? -18.271 30.166  -1.620  1.00 29.47  ?  97  HIS B O   1 
ATOM   1982  C  CB  . HIS B  1 97  ? -20.858 29.432  -1.055  1.00 29.01  ?  97  HIS B CB  1 
ATOM   1983  C  CG  . HIS B  1 97  ? -22.340 29.202  -0.996  1.00 31.64  ?  97  HIS B CG  1 
ATOM   1984  N  ND1 . HIS B  1 97  ? -23.254 30.090  -1.532  1.00 34.49  ?  97  HIS B ND1 1 
ATOM   1985  C  CD2 . HIS B  1 97  ? -23.063 28.144  -0.558  1.00 33.23  ?  97  HIS B CD2 1 
ATOM   1986  C  CE1 . HIS B  1 97  ? -24.474 29.595  -1.413  1.00 34.73  ?  97  HIS B CE1 1 
ATOM   1987  N  NE2 . HIS B  1 97  ? -24.388 28.419  -0.817  1.00 35.24  ?  97  HIS B NE2 1 
ATOM   1988  N  N   . ASP B  1 98  ? -18.168 29.264  -3.649  1.00 29.28  ?  98  ASP B N   1 
ATOM   1989  C  CA  . ASP B  1 98  ? -16.725 29.388  -3.753  1.00 30.64  ?  98  ASP B CA  1 
ATOM   1990  C  C   . ASP B  1 98  ? -16.413 29.488  -5.240  1.00 31.70  ?  98  ASP B C   1 
ATOM   1991  O  O   . ASP B  1 98  ? -16.813 28.614  -6.032  1.00 32.40  ?  98  ASP B O   1 
ATOM   1992  C  CB  . ASP B  1 98  ? -16.025 28.177  -3.108  1.00 30.13  ?  98  ASP B CB  1 
ATOM   1993  C  CG  . ASP B  1 98  ? -14.473 28.259  -3.138  1.00 32.91  ?  98  ASP B CG  1 
ATOM   1994  O  OD1 . ASP B  1 98  ? -13.863 28.569  -4.204  1.00 33.81  ?  98  ASP B OD1 1 
ATOM   1995  O  OD2 . ASP B  1 98  ? -13.845 27.964  -2.083  1.00 36.04  -1 98  ASP B OD2 1 
ATOM   1996  N  N   . SER B  1 99  ? -15.728 30.561  -5.635  1.00 32.10  ?  99  SER B N   1 
ATOM   1997  C  CA  . SER B  1 99  ? -15.363 30.730  -7.055  1.00 32.52  ?  99  SER B CA  1 
ATOM   1998  C  C   . SER B  1 99  ? -14.659 29.493  -7.639  1.00 32.22  ?  99  SER B C   1 
ATOM   1999  O  O   . SER B  1 99  ? -14.895 29.121  -8.788  1.00 31.75  ?  99  SER B O   1 
ATOM   2000  C  CB  . SER B  1 99  ? -14.487 31.977  -7.239  1.00 32.63  ?  99  SER B CB  1 
ATOM   2001  O  OG  . SER B  1 99  ? -13.780 32.285  -6.042  1.00 32.95  ?  99  SER B OG  1 
ATOM   2002  N  N   . ASP B  1 100 ? -13.806 28.857  -6.832  1.00 32.32  ?  100 ASP B N   1 
ATOM   2003  C  CA  . ASP B  1 100 ? -13.082 27.646  -7.238  1.00 32.32  ?  100 ASP B CA  1 
ATOM   2004  C  C   . ASP B  1 100 ? -13.948 26.570  -7.966  1.00 31.61  ?  100 ASP B C   1 
ATOM   2005  O  O   . ASP B  1 100 ? -13.430 25.798  -8.745  1.00 32.00  ?  100 ASP B O   1 
ATOM   2006  C  CB  . ASP B  1 100 ? -12.452 26.992  -6.002  1.00 33.18  ?  100 ASP B CB  1 
ATOM   2007  C  CG  . ASP B  1 100 ? -11.078 27.610  -5.569  1.00 36.07  ?  100 ASP B CG  1 
ATOM   2008  O  OD1 . ASP B  1 100 ? -10.484 26.994  -4.609  1.00 35.11  ?  100 ASP B OD1 1 
ATOM   2009  O  OD2 . ASP B  1 100 ? -10.607 28.654  -6.159  1.00 34.15  -1 100 ASP B OD2 1 
ATOM   2010  N  N   . ILE B  1 101 ? -15.255 26.517  -7.725  1.00 30.49  ?  101 ILE B N   1 
ATOM   2011  C  CA  . ILE B  1 101 ? -16.074 25.399  -8.182  1.00 29.14  ?  101 ILE B CA  1 
ATOM   2012  C  C   . ILE B  1 101 ? -16.956 25.886  -9.280  1.00 29.82  ?  101 ILE B C   1 
ATOM   2013  O  O   . ILE B  1 101 ? -17.733 26.813  -9.056  1.00 30.94  ?  101 ILE B O   1 
ATOM   2014  C  CB  . ILE B  1 101 ? -16.992 24.885  -7.023  1.00 28.59  ?  101 ILE B CB  1 
ATOM   2015  C  CG1 . ILE B  1 101 ? -16.201 24.384  -5.794  1.00 26.49  ?  101 ILE B CG1 1 
ATOM   2016  C  CG2 . ILE B  1 101 ? -18.052 23.922  -7.502  1.00 28.12  ?  101 ILE B CG2 1 
ATOM   2017  C  CD1 . ILE B  1 101 ? -14.920 23.666  -6.041  1.00 26.18  ?  101 ILE B CD1 1 
ATOM   2018  N  N   . ASP B  1 102 ? -16.879 25.292  -10.466 1.00 29.83  ?  102 ASP B N   1 
ATOM   2019  C  CA  . ASP B  1 102 ? -17.734 25.768  -11.550 1.00 30.21  ?  102 ASP B CA  1 
ATOM   2020  C  C   . ASP B  1 102 ? -19.165 25.342  -11.341 1.00 30.27  ?  102 ASP B C   1 
ATOM   2021  O  O   . ASP B  1 102 ? -20.050 26.136  -11.458 1.00 31.05  ?  102 ASP B O   1 
ATOM   2022  C  CB  . ASP B  1 102 ? -17.243 25.362  -12.946 1.00 29.92  ?  102 ASP B CB  1 
ATOM   2023  C  CG  . ASP B  1 102 ? -15.805 25.804  -13.221 1.00 31.64  ?  102 ASP B CG  1 
ATOM   2024  O  OD1 . ASP B  1 102 ? -15.440 26.947  -12.887 1.00 31.09  ?  102 ASP B OD1 1 
ATOM   2025  O  OD2 . ASP B  1 102 ? -15.028 24.978  -13.770 1.00 32.85  -1 102 ASP B OD2 1 
ATOM   2026  N  N   . CYS B  1 103 ? -19.389 24.078  -11.041 1.00 30.82  ?  103 CYS B N   1 
ATOM   2027  C  CA  . CYS B  1 103 ? -20.744 23.556  -10.859 1.00 30.48  ?  103 CYS B CA  1 
ATOM   2028  C  C   . CYS B  1 103 ? -20.692 22.173  -10.160 1.00 30.18  ?  103 CYS B C   1 
ATOM   2029  O  O   . CYS B  1 103 ? -19.598 21.583  -10.011 1.00 29.69  ?  103 CYS B O   1 
ATOM   2030  C  CB  . CYS B  1 103 ? -21.510 23.506  -12.182 1.00 29.76  ?  103 CYS B CB  1 
ATOM   2031  S  SG  . CYS B  1 103 ? -20.975 22.236  -13.329 1.00 32.30  ?  103 CYS B SG  1 
ATOM   2032  N  N   . CYS B  1 104 ? -21.860 21.707  -9.698  1.00 29.12  ?  104 CYS B N   1 
ATOM   2033  C  CA  . CYS B  1 104 ? -22.020 20.380  -9.111  1.00 28.46  ?  104 CYS B CA  1 
ATOM   2034  C  C   . CYS B  1 104 ? -22.775 19.504  -10.006 1.00 27.12  ?  104 CYS B C   1 
ATOM   2035  O  O   . CYS B  1 104 ? -23.668 19.942  -10.686 1.00 27.05  ?  104 CYS B O   1 
ATOM   2036  C  CB  . CYS B  1 104 ? -22.870 20.484  -7.892  1.00 28.95  ?  104 CYS B CB  1 
ATOM   2037  S  SG  . CYS B  1 104 ? -22.000 21.322  -6.695  1.00 32.45  ?  104 CYS B SG  1 
ATOM   2038  N  N   . ARG B  1 105 ? -22.451 18.238  -10.004 1.00 26.88  ?  105 ARG B N   1 
ATOM   2039  C  CA  . ARG B  1 105 ? -23.345 17.307  -10.681 1.00 26.92  ?  105 ARG B CA  1 
ATOM   2040  C  C   . ARG B  1 105 ? -23.417 16.041  -9.925  1.00 25.08  ?  105 ARG B C   1 
ATOM   2041  O  O   . ARG B  1 105 ? -22.575 15.787  -9.082  1.00 24.59  ?  105 ARG B O   1 
ATOM   2042  C  CB  . ARG B  1 105 ? -22.947 17.082  -12.144 1.00 27.61  ?  105 ARG B CB  1 
ATOM   2043  C  CG  . ARG B  1 105 ? -21.500 16.748  -12.337 1.00 30.27  ?  105 ARG B CG  1 
ATOM   2044  C  CD  . ARG B  1 105 ? -20.917 17.598  -13.456 1.00 35.40  ?  105 ARG B CD  1 
ATOM   2045  N  NE  . ARG B  1 105 ? -21.689 17.516  -14.679 1.00 38.29  ?  105 ARG B NE  1 
ATOM   2046  C  CZ  . ARG B  1 105 ? -21.827 18.519  -15.534 1.00 42.27  ?  105 ARG B CZ  1 
ATOM   2047  N  NH1 . ARG B  1 105 ? -21.247 19.703  -15.290 1.00 42.60  ?  105 ARG B NH1 1 
ATOM   2048  N  NH2 . ARG B  1 105 ? -22.547 18.332  -16.640 1.00 42.80  ?  105 ARG B NH2 1 
ATOM   2049  N  N   . TRP B  1 106 ? -24.474 15.308  -10.222 1.00 24.86  ?  106 TRP B N   1 
ATOM   2050  C  CA  . TRP B  1 106 ? -24.827 14.016  -9.647  1.00 25.27  ?  106 TRP B CA  1 
ATOM   2051  C  C   . TRP B  1 106 ? -24.632 12.920  -10.700 1.00 25.90  ?  106 TRP B C   1 
ATOM   2052  O  O   . TRP B  1 106 ? -25.287 12.894  -11.760 1.00 25.79  ?  106 TRP B O   1 
ATOM   2053  C  CB  . TRP B  1 106 ? -26.290 14.022  -9.238  1.00 24.75  ?  106 TRP B CB  1 
ATOM   2054  C  CG  . TRP B  1 106 ? -26.582 14.972  -8.125  1.00 26.18  ?  106 TRP B CG  1 
ATOM   2055  C  CD1 . TRP B  1 106 ? -27.083 16.247  -8.236  1.00 25.38  ?  106 TRP B CD1 1 
ATOM   2056  C  CD2 . TRP B  1 106 ? -26.417 14.730  -6.719  1.00 25.90  ?  106 TRP B CD2 1 
ATOM   2057  N  NE1 . TRP B  1 106 ? -27.218 16.819  -6.992  1.00 24.60  ?  106 TRP B NE1 1 
ATOM   2058  C  CE2 . TRP B  1 106 ? -26.831 15.913  -6.040  1.00 25.95  ?  106 TRP B CE2 1 
ATOM   2059  C  CE3 . TRP B  1 106 ? -25.981 13.633  -5.965  1.00 23.90  ?  106 TRP B CE3 1 
ATOM   2060  C  CZ2 . TRP B  1 106 ? -26.806 16.027  -4.646  1.00 23.50  ?  106 TRP B CZ2 1 
ATOM   2061  C  CZ3 . TRP B  1 106 ? -25.959 13.745  -4.581  1.00 23.79  ?  106 TRP B CZ3 1 
ATOM   2062  C  CH2 . TRP B  1 106 ? -26.375 14.939  -3.937  1.00 24.55  ?  106 TRP B CH2 1 
ATOM   2063  N  N   . VAL B  1 107 ? -23.761 11.984  -10.391 1.00 25.82  ?  107 VAL B N   1 
ATOM   2064  C  CA  . VAL B  1 107 ? -23.145 11.203  -11.429 1.00 25.78  ?  107 VAL B CA  1 
ATOM   2065  C  C   . VAL B  1 107 ? -23.126 9.765   -10.934 1.00 26.18  ?  107 VAL B C   1 
ATOM   2066  O  O   . VAL B  1 107 ? -23.040 9.546   -9.731  1.00 26.53  ?  107 VAL B O   1 
ATOM   2067  C  CB  . VAL B  1 107 ? -21.754 11.861  -11.619 1.00 26.41  ?  107 VAL B CB  1 
ATOM   2068  C  CG1 . VAL B  1 107 ? -20.616 10.943  -11.402 1.00 24.68  ?  107 VAL B CG1 1 
ATOM   2069  C  CG2 . VAL B  1 107 ? -21.665 12.708  -12.946 1.00 27.45  ?  107 VAL B CG2 1 
ATOM   2070  N  N   . SER B  1 108 ? -23.245 8.780   -11.817 1.00 26.44  ?  108 SER B N   1 
ATOM   2071  C  CA  . SER B  1 108 ? -23.173 7.381   -11.374 1.00 26.79  ?  108 SER B CA  1 
ATOM   2072  C  C   . SER B  1 108 ? -21.776 6.965   -10.925 1.00 26.82  ?  108 SER B C   1 
ATOM   2073  O  O   . SER B  1 108 ? -20.777 7.629   -11.205 1.00 26.08  ?  108 SER B O   1 
ATOM   2074  C  CB  . SER B  1 108 ? -23.608 6.441   -12.476 1.00 26.94  ?  108 SER B CB  1 
ATOM   2075  O  OG  . SER B  1 108 ? -22.590 6.400   -13.463 1.00 29.24  ?  108 SER B OG  1 
ATOM   2076  N  N   . ALA B  1 109 ? -21.703 5.833   -10.228 1.00 27.55  ?  109 ALA B N   1 
ATOM   2077  C  CA  . ALA B  1 109 ? -20.405 5.319   -9.797  1.00 27.19  ?  109 ALA B CA  1 
ATOM   2078  C  C   . ALA B  1 109 ? -19.616 5.032   -11.049 1.00 27.45  ?  109 ALA B C   1 
ATOM   2079  O  O   . ALA B  1 109 ? -18.452 5.370   -11.155 1.00 27.99  ?  109 ALA B O   1 
ATOM   2080  C  CB  . ALA B  1 109 ? -20.577 4.102   -8.993  1.00 26.38  ?  109 ALA B CB  1 
ATOM   2081  N  N   . GLU B  1 110 ? -20.291 4.438   -12.021 1.00 28.42  ?  110 GLU B N   1 
ATOM   2082  C  CA  . GLU B  1 110 ? -19.659 4.024   -13.277 1.00 28.94  ?  110 GLU B CA  1 
ATOM   2083  C  C   . GLU B  1 110 ? -19.075 5.237   -14.010 1.00 27.49  ?  110 GLU B C   1 
ATOM   2084  O  O   . GLU B  1 110 ? -17.891 5.214   -14.388 1.00 26.47  ?  110 GLU B O   1 
ATOM   2085  C  CB  . GLU B  1 110 ? -20.583 3.117   -14.122 1.00 29.23  ?  110 GLU B CB  1 
ATOM   2086  C  CG  . GLU B  1 110 ? -22.099 3.089   -13.662 1.00 35.54  ?  110 GLU B CG  1 
ATOM   2087  C  CD  . GLU B  1 110 ? -22.362 2.419   -12.267 1.00 41.59  ?  110 GLU B CD  1 
ATOM   2088  O  OE1 . GLU B  1 110 ? -23.270 2.871   -11.508 1.00 42.03  ?  110 GLU B OE1 1 
ATOM   2089  O  OE2 . GLU B  1 110 ? -21.677 1.418   -11.942 1.00 45.42  -1 110 GLU B OE2 1 
ATOM   2090  N  N   . GLU B  1 111 ? -19.841 6.318   -14.145 1.00 26.27  ?  111 GLU B N   1 
ATOM   2091  C  CA  . GLU B  1 111 ? -19.231 7.535   -14.716 1.00 26.11  ?  111 GLU B CA  1 
ATOM   2092  C  C   . GLU B  1 111 ? -17.969 7.962   -13.976 1.00 25.17  ?  111 GLU B C   1 
ATOM   2093  O  O   . GLU B  1 111 ? -17.039 8.482   -14.568 1.00 25.23  ?  111 GLU B O   1 
ATOM   2094  C  CB  . GLU B  1 111 ? -20.189 8.712   -14.775 1.00 25.91  ?  111 GLU B CB  1 
ATOM   2095  C  CG  . GLU B  1 111 ? -21.339 8.477   -15.684 1.00 30.14  ?  111 GLU B CG  1 
ATOM   2096  C  CD  . GLU B  1 111 ? -22.347 9.560   -15.579 1.00 34.53  ?  111 GLU B CD  1 
ATOM   2097  O  OE1 . GLU B  1 111 ? -23.359 9.381   -14.836 1.00 33.44  ?  111 GLU B OE1 1 
ATOM   2098  O  OE2 . GLU B  1 111 ? -22.078 10.599  -16.225 1.00 37.83  -1 111 GLU B OE2 1 
ATOM   2099  N  N   . ILE B  1 112 ? -17.927 7.751   -12.676 1.00 24.72  ?  112 ILE B N   1 
ATOM   2100  C  CA  . ILE B  1 112 ? -16.756 8.173   -11.967 1.00 24.83  ?  112 ILE B CA  1 
ATOM   2101  C  C   . ILE B  1 112 ? -15.574 7.252   -12.259 1.00 25.25  ?  112 ILE B C   1 
ATOM   2102  O  O   . ILE B  1 112 ? -14.538 7.680   -12.746 1.00 24.76  ?  112 ILE B O   1 
ATOM   2103  C  CB  . ILE B  1 112 ? -17.031 8.423   -10.475 1.00 25.04  ?  112 ILE B CB  1 
ATOM   2104  C  CG1 . ILE B  1 112 ? -18.093 9.521   -10.335 1.00 23.46  ?  112 ILE B CG1 1 
ATOM   2105  C  CG2 . ILE B  1 112 ? -15.811 9.021   -9.829  1.00 24.04  ?  112 ILE B CG2 1 
ATOM   2106  C  CD1 . ILE B  1 112 ? -18.503 9.828   -8.892  1.00 21.70  ?  112 ILE B CD1 1 
ATOM   2107  N  N   . LEU B  1 113 ? -15.756 5.972   -12.021 1.00 25.92  ?  113 LEU B N   1 
ATOM   2108  C  CA  . LEU B  1 113 ? -14.730 5.016   -12.309 1.00 26.90  ?  113 LEU B CA  1 
ATOM   2109  C  C   . LEU B  1 113 ? -14.153 5.025   -13.760 1.00 28.44  ?  113 LEU B C   1 
ATOM   2110  O  O   . LEU B  1 113 ? -12.931 4.828   -13.941 1.00 28.43  ?  113 LEU B O   1 
ATOM   2111  C  CB  . LEU B  1 113 ? -15.299 3.657   -11.982 1.00 26.94  ?  113 LEU B CB  1 
ATOM   2112  C  CG  . LEU B  1 113 ? -15.111 3.047   -10.606 1.00 27.00  ?  113 LEU B CG  1 
ATOM   2113  C  CD1 . LEU B  1 113 ? -14.907 4.059   -9.493  1.00 25.91  ?  113 LEU B CD1 1 
ATOM   2114  C  CD2 . LEU B  1 113 ? -16.332 2.171   -10.343 1.00 26.34  ?  113 LEU B CD2 1 
ATOM   2115  N  N   . GLN B  1 114 ? -15.009 5.218   -14.774 1.00 28.80  ?  114 GLN B N   1 
ATOM   2116  C  CA  . GLN B  1 114 ? -14.552 5.294   -16.168 1.00 30.06  ?  114 GLN B CA  1 
ATOM   2117  C  C   . GLN B  1 114 ? -13.950 6.655   -16.554 1.00 29.62  ?  114 GLN B C   1 
ATOM   2118  O  O   . GLN B  1 114 ? -13.449 6.792   -17.685 1.00 29.60  ?  114 GLN B O   1 
ATOM   2119  C  CB  . GLN B  1 114 ? -15.692 5.057   -17.188 1.00 30.74  ?  114 GLN B CB  1 
ATOM   2120  C  CG  . GLN B  1 114 ? -16.911 4.239   -16.735 1.00 36.59  ?  114 GLN B CG  1 
ATOM   2121  C  CD  . GLN B  1 114 ? -16.900 2.767   -17.221 1.00 42.28  ?  114 GLN B CD  1 
ATOM   2122  O  OE1 . GLN B  1 114 ? -16.667 1.814   -16.434 1.00 44.64  ?  114 GLN B OE1 1 
ATOM   2123  N  NE2 . GLN B  1 114 ? -17.151 2.585   -18.518 1.00 43.13  ?  114 GLN B NE2 1 
ATOM   2124  N  N   . ALA B  1 115 ? -14.063 7.667   -15.690 1.00 28.06  ?  115 ALA B N   1 
ATOM   2125  C  CA  . ALA B  1 115 ? -13.857 9.064   -16.122 1.00 27.30  ?  115 ALA B CA  1 
ATOM   2126  C  C   . ALA B  1 115 ? -12.401 9.477   -16.412 1.00 27.24  ?  115 ALA B C   1 
ATOM   2127  O  O   . ALA B  1 115 ? -11.488 9.014   -15.780 1.00 27.65  ?  115 ALA B O   1 
ATOM   2128  C  CB  . ALA B  1 115 ? -14.498 10.033  -15.114 1.00 26.56  ?  115 ALA B CB  1 
ATOM   2129  N  N   . SER B  1 116 ? -12.176 10.371  -17.361 1.00 27.68  ?  116 SER B N   1 
ATOM   2130  C  CA  . SER B  1 116 ? -10.817 10.772  -17.662 1.00 28.15  ?  116 SER B CA  1 
ATOM   2131  C  C   . SER B  1 116 ? -10.478 12.156  -17.120 1.00 28.25  ?  116 SER B C   1 
ATOM   2132  O  O   . SER B  1 116 ? -9.386  12.699  -17.393 1.00 28.35  ?  116 SER B O   1 
ATOM   2133  C  CB  . SER B  1 116 ? -10.592 10.741  -19.168 1.00 28.94  ?  116 SER B CB  1 
ATOM   2134  O  OG  . SER B  1 116 ? -11.689 11.360  -19.822 1.00 30.98  ?  116 SER B OG  1 
ATOM   2135  N  N   . ASN B  1 117 ? -11.389 12.743  -16.349 1.00 27.55  ?  117 ASN B N   1 
ATOM   2136  C  CA  . ASN B  1 117 ? -11.135 14.088  -15.908 1.00 27.39  ?  117 ASN B CA  1 
ATOM   2137  C  C   . ASN B  1 117 ? -11.080 14.203  -14.402 1.00 27.70  ?  117 ASN B C   1 
ATOM   2138  O  O   . ASN B  1 117 ? -11.429 15.232  -13.837 1.00 28.87  ?  117 ASN B O   1 
ATOM   2139  C  CB  . ASN B  1 117 ? -12.152 15.043  -16.504 1.00 26.90  ?  117 ASN B CB  1 
ATOM   2140  C  CG  . ASN B  1 117 ? -13.563 14.747  -16.056 1.00 28.99  ?  117 ASN B CG  1 
ATOM   2141  O  OD1 . ASN B  1 117 ? -13.956 13.585  -15.871 1.00 31.11  ?  117 ASN B OD1 1 
ATOM   2142  N  ND2 . ASN B  1 117 ? -14.340 15.803  -15.863 1.00 26.31  ?  117 ASN B ND2 1 
ATOM   2143  N  N   . LEU B  1 118 ? -10.625 13.155  -13.740 1.00 27.26  ?  118 LEU B N   1 
ATOM   2144  C  CA  . LEU B  1 118 ? -10.697 13.137  -12.308 1.00 26.94  ?  118 LEU B CA  1 
ATOM   2145  C  C   . LEU B  1 118 ? -9.531  13.944  -11.805 1.00 27.27  ?  118 LEU B C   1 
ATOM   2146  O  O   . LEU B  1 118 ? -8.455  13.926  -12.405 1.00 27.19  ?  118 LEU B O   1 
ATOM   2147  C  CB  . LEU B  1 118 ? -10.649 11.709  -11.779 1.00 27.55  ?  118 LEU B CB  1 
ATOM   2148  C  CG  . LEU B  1 118 ? -11.690 10.680  -12.249 1.00 28.61  ?  118 LEU B CG  1 
ATOM   2149  C  CD1 . LEU B  1 118 ? -11.347 9.334   -11.634 1.00 29.35  ?  118 LEU B CD1 1 
ATOM   2150  C  CD2 . LEU B  1 118 ? -13.145 11.098  -11.923 1.00 25.68  ?  118 LEU B CD2 1 
ATOM   2151  N  N   . ARG B  1 119 ? -9.768  14.656  -10.703 1.00 26.68  ?  119 ARG B N   1 
ATOM   2152  C  CA  . ARG B  1 119 ? -8.848  15.623  -10.151 1.00 25.78  ?  119 ARG B CA  1 
ATOM   2153  C  C   . ARG B  1 119 ? -7.632  14.928  -9.567  1.00 25.66  ?  119 ARG B C   1 
ATOM   2154  O  O   . ARG B  1 119 ? -6.552  15.510  -9.457  1.00 25.26  ?  119 ARG B O   1 
ATOM   2155  C  CB  . ARG B  1 119 ? -9.584  16.387  -9.061  1.00 25.65  ?  119 ARG B CB  1 
ATOM   2156  C  CG  . ARG B  1 119 ? -8.744  17.381  -8.297  1.00 27.36  ?  119 ARG B CG  1 
ATOM   2157  C  CD  . ARG B  1 119 ? -8.477  18.627  -9.065  1.00 30.52  ?  119 ARG B CD  1 
ATOM   2158  N  NE  . ARG B  1 119 ? -7.738  19.592  -8.252  1.00 36.98  ?  119 ARG B NE  1 
ATOM   2159  C  CZ  . ARG B  1 119 ? -8.259  20.325  -7.248  1.00 39.51  ?  119 ARG B CZ  1 
ATOM   2160  N  NH1 . ARG B  1 119 ? -9.541  20.210  -6.872  1.00 39.43  ?  119 ARG B NH1 1 
ATOM   2161  N  NH2 . ARG B  1 119 ? -7.478  21.171  -6.586  1.00 38.71  ?  119 ARG B NH2 1 
ATOM   2162  N  N   . SER B  1 120 ? -7.836  13.677  -9.160  1.00 25.70  ?  120 SER B N   1 
ATOM   2163  C  CA  . SER B  1 120 ? -6.801  12.868  -8.535  1.00 25.13  ?  120 SER B CA  1 
ATOM   2164  C  C   . SER B  1 120 ? -7.291  11.458  -8.648  1.00 25.29  ?  120 SER B C   1 
ATOM   2165  O  O   . SER B  1 120 ? -8.495  11.202  -8.713  1.00 25.33  ?  120 SER B O   1 
ATOM   2166  C  CB  . SER B  1 120 ? -6.645  13.183  -7.037  1.00 25.42  ?  120 SER B CB  1 
ATOM   2167  O  OG  . SER B  1 120 ? -7.553  12.431  -6.227  1.00 23.70  ?  120 SER B OG  1 
ATOM   2168  N  N   . PRO B  1 121 ? -6.358  10.520  -8.617  1.00 25.19  ?  121 PRO B N   1 
ATOM   2169  C  CA  . PRO B  1 121 ? -6.702  9.090   -8.687  1.00 24.51  ?  121 PRO B CA  1 
ATOM   2170  C  C   . PRO B  1 121 ? -7.540  8.634   -7.476  1.00 23.91  ?  121 PRO B C   1 
ATOM   2171  O  O   . PRO B  1 121 ? -8.155  7.567   -7.545  1.00 24.37  ?  121 PRO B O   1 
ATOM   2172  C  CB  . PRO B  1 121 ? -5.329  8.409   -8.700  1.00 24.50  ?  121 PRO B CB  1 
ATOM   2173  C  CG  . PRO B  1 121 ? -4.364  9.537   -9.157  1.00 25.66  ?  121 PRO B CG  1 
ATOM   2174  C  CD  . PRO B  1 121 ? -4.911  10.752  -8.470  1.00 24.65  ?  121 PRO B CD  1 
ATOM   2175  N  N   . LEU B  1 122 ? -7.584  9.458   -6.420  1.00 22.11  ?  122 LEU B N   1 
ATOM   2176  C  CA  . LEU B  1 122 ? -8.303  9.175   -5.185  1.00 21.83  ?  122 LEU B CA  1 
ATOM   2177  C  C   . LEU B  1 122 ? -9.784  9.402   -5.232  1.00 21.45  ?  122 LEU B C   1 
ATOM   2178  O  O   . LEU B  1 122 ? -10.474 9.129   -4.265  1.00 21.20  ?  122 LEU B O   1 
ATOM   2179  C  CB  . LEU B  1 122 ? -7.772  10.059  -4.057  1.00 22.12  ?  122 LEU B CB  1 
ATOM   2180  C  CG  . LEU B  1 122 ? -6.458  9.496   -3.542  1.00 23.40  ?  122 LEU B CG  1 
ATOM   2181  C  CD1 . LEU B  1 122 ? -5.858  10.411  -2.509  1.00 21.91  ?  122 LEU B CD1 1 
ATOM   2182  C  CD2 . LEU B  1 122 ? -6.778  8.092   -2.971  1.00 23.47  ?  122 LEU B CD2 1 
ATOM   2183  N  N   . VAL B  1 123 ? -10.247 9.979   -6.336  1.00 21.47  ?  123 VAL B N   1 
ATOM   2184  C  CA  . VAL B  1 123 ? -11.634 10.303  -6.553  1.00 20.12  ?  123 VAL B CA  1 
ATOM   2185  C  C   . VAL B  1 123 ? -12.260 9.001   -6.995  1.00 20.50  ?  123 VAL B C   1 
ATOM   2186  O  O   . VAL B  1 123 ? -13.312 8.618   -6.535  1.00 20.83  ?  123 VAL B O   1 
ATOM   2187  C  CB  . VAL B  1 123 ? -11.743 11.396  -7.637  1.00 19.59  ?  123 VAL B CB  1 
ATOM   2188  C  CG1 . VAL B  1 123 ? -13.176 11.634  -8.071  1.00 18.24  ?  123 VAL B CG1 1 
ATOM   2189  C  CG2 . VAL B  1 123 ? -11.096 12.691  -7.126  1.00 18.99  ?  123 VAL B CG2 1 
ATOM   2190  N  N   . ALA B  1 124 ? -11.595 8.283   -7.873  1.00 20.89  ?  124 ALA B N   1 
ATOM   2191  C  CA  . ALA B  1 124 ? -12.150 6.985   -8.270  1.00 21.50  ?  124 ALA B CA  1 
ATOM   2192  C  C   . ALA B  1 124 ? -11.983 6.013   -7.094  1.00 21.33  ?  124 ALA B C   1 
ATOM   2193  O  O   . ALA B  1 124 ? -12.916 5.297   -6.776  1.00 20.88  ?  124 ALA B O   1 
ATOM   2194  C  CB  . ALA B  1 124 ? -11.499 6.445   -9.562  1.00 20.59  ?  124 ALA B CB  1 
ATOM   2195  N  N   . GLU B  1 125 ? -10.827 6.067   -6.413  1.00 21.43  ?  125 GLU B N   1 
ATOM   2196  C  CA  . GLU B  1 125 ? -10.549 5.169   -5.288  1.00 21.42  ?  125 GLU B CA  1 
ATOM   2197  C  C   . GLU B  1 125 ? -11.548 5.350   -4.158  1.00 21.23  ?  125 GLU B C   1 
ATOM   2198  O  O   . GLU B  1 125 ? -11.975 4.356   -3.548  1.00 21.31  ?  125 GLU B O   1 
ATOM   2199  C  CB  . GLU B  1 125 ? -9.129  5.328   -4.753  1.00 21.43  ?  125 GLU B CB  1 
ATOM   2200  C  CG  . GLU B  1 125 ? -8.763  4.260   -3.723  1.00 23.92  ?  125 GLU B CG  1 
ATOM   2201  C  CD  . GLU B  1 125 ? -8.784  2.845   -4.314  1.00 27.42  ?  125 GLU B CD  1 
ATOM   2202  O  OE1 . GLU B  1 125 ? -9.127  1.894   -3.570  1.00 29.27  ?  125 GLU B OE1 1 
ATOM   2203  O  OE2 . GLU B  1 125 ? -8.463  2.694   -5.531  1.00 28.78  -1 125 GLU B OE2 1 
ATOM   2204  N  N   . SER B  1 126 ? -11.927 6.607   -3.897  1.00 20.29  ?  126 SER B N   1 
ATOM   2205  C  CA  . SER B  1 126 ? -13.048 6.922   -3.013  1.00 19.75  ?  126 SER B CA  1 
ATOM   2206  C  C   . SER B  1 126 ? -14.307 6.101   -3.305  1.00 20.18  ?  126 SER B C   1 
ATOM   2207  O  O   . SER B  1 126 ? -14.967 5.627   -2.394  1.00 20.61  ?  126 SER B O   1 
ATOM   2208  C  CB  . SER B  1 126 ? -13.353 8.424   -3.044  1.00 19.26  ?  126 SER B CB  1 
ATOM   2209  O  OG  . SER B  1 126 ? -12.293 9.147   -2.406  1.00 17.98  ?  126 SER B OG  1 
ATOM   2210  N  N   . ILE B  1 127 ? -14.629 5.903   -4.581  1.00 20.42  ?  127 ILE B N   1 
ATOM   2211  C  CA  . ILE B  1 127 ? -15.882 5.292   -4.945  1.00 19.90  ?  127 ILE B CA  1 
ATOM   2212  C  C   . ILE B  1 127 ? -15.765 3.792   -4.692  1.00 20.98  ?  127 ILE B C   1 
ATOM   2213  O  O   . ILE B  1 127 ? -16.695 3.129   -4.176  1.00 21.20  ?  127 ILE B O   1 
ATOM   2214  C  CB  . ILE B  1 127 ? -16.198 5.641   -6.375  1.00 20.20  ?  127 ILE B CB  1 
ATOM   2215  C  CG1 . ILE B  1 127 ? -16.390 7.168   -6.493  1.00 19.36  ?  127 ILE B CG1 1 
ATOM   2216  C  CG2 . ILE B  1 127 ? -17.445 4.945   -6.851  1.00 20.63  ?  127 ILE B CG2 1 
ATOM   2217  C  CD1 . ILE B  1 127 ? -17.471 7.753   -5.561  1.00 15.29  ?  127 ILE B CD1 1 
ATOM   2218  N  N   . ARG B  1 128 ? -14.588 3.256   -4.986  1.00 20.54  ?  128 ARG B N   1 
ATOM   2219  C  CA  . ARG B  1 128 ? -14.363 1.872   -4.699  1.00 20.33  ?  128 ARG B CA  1 
ATOM   2220  C  C   . ARG B  1 128 ? -14.508 1.653   -3.200  1.00 20.40  ?  128 ARG B C   1 
ATOM   2221  O  O   . ARG B  1 128 ? -15.247 0.752   -2.779  1.00 20.98  ?  128 ARG B O   1 
ATOM   2222  C  CB  . ARG B  1 128 ? -13.012 1.436   -5.232  1.00 20.11  ?  128 ARG B CB  1 
ATOM   2223  C  CG  . ARG B  1 128 ? -13.057 1.317   -6.715  1.00 21.23  ?  128 ARG B CG  1 
ATOM   2224  C  CD  . ARG B  1 128 ? -11.822 0.694   -7.261  1.00 24.01  ?  128 ARG B CD  1 
ATOM   2225  N  NE  . ARG B  1 128 ? -11.024 1.664   -8.015  1.00 26.34  ?  128 ARG B NE  1 
ATOM   2226  C  CZ  . ARG B  1 128 ? -11.095 1.780   -9.331  1.00 25.93  ?  128 ARG B CZ  1 
ATOM   2227  N  NH1 . ARG B  1 128 ? -11.933 1.003   -10.000 1.00 29.75  ?  128 ARG B NH1 1 
ATOM   2228  N  NH2 . ARG B  1 128 ? -10.334 2.644   -9.969  1.00 24.18  ?  128 ARG B NH2 1 
ATOM   2229  N  N   . CYS B  1 129 ? -13.870 2.498   -2.389  1.00 19.49  ?  129 CYS B N   1 
ATOM   2230  C  CA  . CYS B  1 129 ? -13.987 2.330   -0.931  1.00 18.89  ?  129 CYS B CA  1 
ATOM   2231  C  C   . CYS B  1 129 ? -15.436 2.341   -0.558  1.00 18.70  ?  129 CYS B C   1 
ATOM   2232  O  O   . CYS B  1 129 ? -15.903 1.392   0.026   1.00 18.63  ?  129 CYS B O   1 
ATOM   2233  C  CB  . CYS B  1 129 ? -13.216 3.389   -0.177  1.00 17.98  ?  129 CYS B CB  1 
ATOM   2234  S  SG  . CYS B  1 129 ? -11.451 3.162   -0.348  1.00 23.12  ?  129 CYS B SG  1 
ATOM   2235  N  N   . TYR B  1 130 ? -16.181 3.362   -0.985  1.00 18.50  ?  130 TYR B N   1 
ATOM   2236  C  CA  . TYR B  1 130 ? -17.587 3.427   -0.624  1.00 18.85  ?  130 TYR B CA  1 
ATOM   2237  C  C   . TYR B  1 130 ? -18.337 2.166   -0.953  1.00 19.66  ?  130 TYR B C   1 
ATOM   2238  O  O   . TYR B  1 130 ? -19.152 1.711   -0.172  1.00 19.95  ?  130 TYR B O   1 
ATOM   2239  C  CB  . TYR B  1 130 ? -18.308 4.585   -1.315  1.00 18.72  ?  130 TYR B CB  1 
ATOM   2240  C  CG  . TYR B  1 130 ? -19.799 4.553   -1.090  1.00 17.29  ?  130 TYR B CG  1 
ATOM   2241  C  CD1 . TYR B  1 130 ? -20.374 5.123   0.042   1.00 15.36  ?  130 TYR B CD1 1 
ATOM   2242  C  CD2 . TYR B  1 130 ? -20.628 3.910   -1.978  1.00 15.70  ?  130 TYR B CD2 1 
ATOM   2243  C  CE1 . TYR B  1 130 ? -21.723 5.080   0.244   1.00 13.63  ?  130 TYR B CE1 1 
ATOM   2244  C  CE2 . TYR B  1 130 ? -21.965 3.868   -1.776  1.00 14.92  ?  130 TYR B CE2 1 
ATOM   2245  C  CZ  . TYR B  1 130 ? -22.510 4.438   -0.653  1.00 16.63  ?  130 TYR B CZ  1 
ATOM   2246  O  OH  . TYR B  1 130 ? -23.892 4.372   -0.478  1.00 22.46  ?  130 TYR B OH  1 
ATOM   2247  N  N   . GLN B  1 131 ? -18.101 1.634   -2.140  1.00 20.87  ?  131 GLN B N   1 
ATOM   2248  C  CA  . GLN B  1 131 ? -18.901 0.526   -2.639  1.00 21.48  ?  131 GLN B CA  1 
ATOM   2249  C  C   . GLN B  1 131 ? -18.500 -0.781  -2.002  1.00 22.42  ?  131 GLN B C   1 
ATOM   2250  O  O   . GLN B  1 131 ? -19.234 -1.777  -2.097  1.00 22.92  ?  131 GLN B O   1 
ATOM   2251  C  CB  . GLN B  1 131 ? -18.766 0.419   -4.148  1.00 21.37  ?  131 GLN B CB  1 
ATOM   2252  C  CG  . GLN B  1 131 ? -19.326 1.623   -4.870  1.00 22.99  ?  131 GLN B CG  1 
ATOM   2253  C  CD  . GLN B  1 131 ? -19.713 1.327   -6.312  1.00 27.42  ?  131 GLN B CD  1 
ATOM   2254  O  OE1 . GLN B  1 131 ? -18.824 1.007   -7.136  1.00 25.32  ?  131 GLN B OE1 1 
ATOM   2255  N  NE2 . GLN B  1 131 ? -21.058 1.436   -6.640  1.00 24.23  ?  131 GLN B NE2 1 
ATOM   2256  N  N   . SER B  1 132 ? -17.348 -0.795  -1.332  1.00 22.13  ?  132 SER B N   1 
ATOM   2257  C  CA  . SER B  1 132 ? -16.903 -2.045  -0.756  1.00 21.84  ?  132 SER B CA  1 
ATOM   2258  C  C   . SER B  1 132 ? -17.785 -2.340  0.445   1.00 21.45  ?  132 SER B C   1 
ATOM   2259  O  O   . SER B  1 132 ? -17.857 -3.476  0.874   1.00 20.97  ?  132 SER B O   1 
ATOM   2260  C  CB  . SER B  1 132 ? -15.394 -2.046  -0.424  1.00 21.53  ?  132 SER B CB  1 
ATOM   2261  O  OG  . SER B  1 132 ? -15.154 -1.444  0.835   1.00 22.64  ?  132 SER B OG  1 
ATOM   2262  N  N   . GLY B  1 133 ? -18.483 -1.311  0.928   1.00 21.51  ?  133 GLY B N   1 
ATOM   2263  C  CA  . GLY B  1 133 ? -19.417 -1.393  2.063   1.00 21.38  ?  133 GLY B CA  1 
ATOM   2264  C  C   . GLY B  1 133 ? -18.783 -0.894  3.352   1.00 22.26  ?  133 GLY B C   1 
ATOM   2265  O  O   . GLY B  1 133 ? -19.462 -0.736  4.380   1.00 22.19  ?  133 GLY B O   1 
ATOM   2266  N  N   . GLN B  1 134 ? -17.471 -0.639  3.288   1.00 22.72  ?  134 GLN B N   1 
ATOM   2267  C  CA  . GLN B  1 134 ? -16.648 -0.208  4.410   1.00 23.04  ?  134 GLN B CA  1 
ATOM   2268  C  C   . GLN B  1 134 ? -17.177 1.113   4.906   1.00 22.86  ?  134 GLN B C   1 
ATOM   2269  O  O   . GLN B  1 134 ? -17.506 1.941   4.077   1.00 23.76  ?  134 GLN B O   1 
ATOM   2270  C  CB  . GLN B  1 134 ? -15.217 -0.023  3.896   1.00 23.95  ?  134 GLN B CB  1 
ATOM   2271  C  CG  . GLN B  1 134 ? -14.340 1.089   4.516   1.00 24.69  ?  134 GLN B CG  1 
ATOM   2272  C  CD  . GLN B  1 134 ? -12.868 0.931   4.085   1.00 26.99  ?  134 GLN B CD  1 
ATOM   2273  O  OE1 . GLN B  1 134 ? -12.006 0.431   4.841   1.00 25.60  ?  134 GLN B OE1 1 
ATOM   2274  N  NE2 . GLN B  1 134 ? -12.590 1.315   2.845   1.00 28.67  ?  134 GLN B NE2 1 
ATOM   2275  N  N   . ARG B  1 135 ? -17.270 1.276   6.233   1.00 22.14  ?  135 ARG B N   1 
ATOM   2276  C  CA  . ARG B  1 135 ? -17.693 2.487   6.922   0.50 21.13  ?  135 ARG B CA  1 
ATOM   2277  C  C   . ARG B  1 135 ? -17.608 2.295   8.449   1.00 22.80  ?  135 ARG B C   1 
ATOM   2278  O  O   . ARG B  1 135 ? -18.007 1.263   8.985   1.00 24.33  ?  135 ARG B O   1 
ATOM   2279  C  CB  . ARG B  1 135 ? -19.109 2.832   6.542   0.50 19.80  ?  135 ARG B CB  1 
ATOM   2280  C  CG  . ARG B  1 135 ? -20.122 1.848   6.997   0.50 14.74  ?  135 ARG B CG  1 
ATOM   2281  C  CD  . ARG B  1 135 ? -21.408 2.327   6.493   0.50 10.26  ?  135 ARG B CD  1 
ATOM   2282  N  NE  . ARG B  1 135 ? -22.459 2.173   7.458   0.50 7.12   ?  135 ARG B NE  1 
ATOM   2283  C  CZ  . ARG B  1 135 ? -23.640 2.748   7.330   0.50 6.21   ?  135 ARG B CZ  1 
ATOM   2284  N  NH1 . ARG B  1 135 ? -23.882 3.518   6.279   0.50 2.00   ?  135 ARG B NH1 1 
ATOM   2285  N  NH2 . ARG B  1 135 ? -24.566 2.554   8.254   0.50 4.62   ?  135 ARG B NH2 1 
ATOM   2286  N  N   . TYR B  1 136 ? -17.135 3.312   9.149   1.00 23.17  ?  136 TYR B N   1 
ATOM   2287  C  CA  . TYR B  1 136 ? -16.824 3.223   10.556  1.00 23.58  ?  136 TYR B CA  1 
ATOM   2288  C  C   . TYR B  1 136 ? -17.425 4.398   11.257  1.00 23.90  ?  136 TYR B C   1 
ATOM   2289  O  O   . TYR B  1 136 ? -17.774 5.379   10.627  1.00 24.59  ?  136 TYR B O   1 
ATOM   2290  C  CB  . TYR B  1 136 ? -15.323 3.280   10.738  1.00 23.61  ?  136 TYR B CB  1 
ATOM   2291  C  CG  . TYR B  1 136 ? -14.631 2.189   10.020  1.00 25.44  ?  136 TYR B CG  1 
ATOM   2292  C  CD1 . TYR B  1 136 ? -14.651 0.906   10.504  1.00 28.87  ?  136 TYR B CD1 1 
ATOM   2293  C  CD2 . TYR B  1 136 ? -13.964 2.427   8.837   1.00 30.42  ?  136 TYR B CD2 1 
ATOM   2294  C  CE1 . TYR B  1 136 ? -14.011 -0.128  9.837   1.00 29.97  ?  136 TYR B CE1 1 
ATOM   2295  C  CE2 . TYR B  1 136 ? -13.313 1.384   8.144   1.00 29.85  ?  136 TYR B CE2 1 
ATOM   2296  C  CZ  . TYR B  1 136 ? -13.345 0.123   8.663   1.00 29.72  ?  136 TYR B CZ  1 
ATOM   2297  O  OH  . TYR B  1 136 ? -12.698 -0.898  8.029   1.00 31.12  ?  136 TYR B OH  1 
ATOM   2298  N  N   . PRO B  1 137 ? -17.571 4.308   12.580  1.00 24.26  ?  137 PRO B N   1 
ATOM   2299  C  CA  . PRO B  1 137 ? -18.176 5.437   13.274  1.00 24.64  ?  137 PRO B CA  1 
ATOM   2300  C  C   . PRO B  1 137 ? -17.269 6.665   13.249  1.00 24.55  ?  137 PRO B C   1 
ATOM   2301  O  O   . PRO B  1 137 ? -16.048 6.520   13.418  1.00 25.15  ?  137 PRO B O   1 
ATOM   2302  C  CB  . PRO B  1 137 ? -18.316 4.892   14.706  1.00 25.55  ?  137 PRO B CB  1 
ATOM   2303  C  CG  . PRO B  1 137 ? -17.320 3.736   14.773  1.00 23.41  ?  137 PRO B CG  1 
ATOM   2304  C  CD  . PRO B  1 137 ? -17.476 3.128   13.457  1.00 23.66  ?  137 PRO B CD  1 
ATOM   2305  N  N   . LEU B  1 138 ? -17.849 7.843   13.014  1.00 23.97  ?  138 LEU B N   1 
ATOM   2306  C  CA  . LEU B  1 138 ? -17.143 9.159   13.068  1.00 22.77  ?  138 LEU B CA  1 
ATOM   2307  C  C   . LEU B  1 138 ? -16.203 9.253   14.216  1.00 23.30  ?  138 LEU B C   1 
ATOM   2308  O  O   . LEU B  1 138 ? -15.083 9.684   14.043  1.00 23.36  ?  138 LEU B O   1 
ATOM   2309  C  CB  . LEU B  1 138 ? -18.114 10.319  13.242  1.00 21.52  ?  138 LEU B CB  1 
ATOM   2310  C  CG  . LEU B  1 138 ? -19.004 10.512  12.042  1.00 21.82  ?  138 LEU B CG  1 
ATOM   2311  C  CD1 . LEU B  1 138 ? -20.146 11.536  12.286  1.00 20.36  ?  138 LEU B CD1 1 
ATOM   2312  C  CD2 . LEU B  1 138 ? -18.069 10.862  10.870  1.00 20.59  ?  138 LEU B CD2 1 
ATOM   2313  N  N   . GLU B  1 139 ? -16.684 8.854   15.393  1.00 24.41  ?  139 GLU B N   1 
ATOM   2314  C  CA  . GLU B  1 139 ? -15.937 8.928   16.614  0.50 25.44  ?  139 GLU B CA  1 
ATOM   2315  C  C   . GLU B  1 139 ? -14.579 8.280   16.428  1.00 26.46  ?  139 GLU B C   1 
ATOM   2316  O  O   . GLU B  1 139 ? -13.693 8.464   17.240  1.00 27.22  ?  139 GLU B O   1 
ATOM   2317  C  CB  . GLU B  1 139 ? -16.731 8.249   17.711  0.50 25.42  ?  139 GLU B CB  1 
ATOM   2318  C  CG  . GLU B  1 139 ? -17.727 7.259   17.164  0.50 26.43  ?  139 GLU B CG  1 
ATOM   2319  C  CD  . GLU B  1 139 ? -19.147 7.834   16.961  0.50 28.00  ?  139 GLU B CD  1 
ATOM   2320  O  OE1 . GLU B  1 139 ? -19.557 8.056   15.771  0.50 25.94  ?  139 GLU B OE1 1 
ATOM   2321  O  OE2 . GLU B  1 139 ? -19.847 8.017   18.001  0.50 25.42  -1 139 GLU B OE2 1 
ATOM   2322  N  N   . MET B  1 140 ? -14.371 7.589   15.317  1.00 27.58  ?  140 MET B N   1 
ATOM   2323  C  CA  . MET B  1 140 ? -13.122 6.826   15.115  1.00 29.16  ?  140 MET B CA  1 
ATOM   2324  C  C   . MET B  1 140 ? -11.891 7.627   14.755  1.00 28.66  ?  140 MET B C   1 
ATOM   2325  O  O   . MET B  1 140 ? -10.775 7.103   14.824  1.00 28.26  ?  140 MET B O   1 
ATOM   2326  C  CB  . MET B  1 140 ? -13.325 5.710   14.069  1.00 30.27  ?  140 MET B CB  1 
ATOM   2327  C  CG  . MET B  1 140 ? -13.397 4.296   14.692  1.00 32.82  ?  140 MET B CG  1 
ATOM   2328  S  SD  . MET B  1 140 ? -11.863 3.420   14.279  1.00 38.55  ?  140 MET B SD  1 
ATOM   2329  C  CE  . MET B  1 140 ? -11.546 4.155   12.649  1.00 34.43  ?  140 MET B CE  1 
ATOM   2330  N  N   . ILE B  1 141 ? -12.110 8.875   14.331  1.00 28.97  ?  141 ILE B N   1 
ATOM   2331  C  CA  . ILE B  1 141 ? -11.043 9.823   14.056  1.00 29.29  ?  141 ILE B CA  1 
ATOM   2332  C  C   . ILE B  1 141 ? -11.323 11.147  14.795  1.00 29.82  ?  141 ILE B C   1 
ATOM   2333  O  O   . ILE B  1 141 ? -10.808 12.231  14.405  1.00 28.95  ?  141 ILE B O   1 
ATOM   2334  C  CB  . ILE B  1 141 ? -10.855 10.105  12.518  1.00 30.02  ?  141 ILE B CB  1 
ATOM   2335  C  CG1 . ILE B  1 141 ? -12.184 10.351  11.787  1.00 30.92  ?  141 ILE B CG1 1 
ATOM   2336  C  CG2 . ILE B  1 141 ? -10.110 8.989   11.831  1.00 28.34  ?  141 ILE B CG2 1 
ATOM   2337  C  CD1 . ILE B  1 141 ? -12.945 11.616  12.186  1.00 32.93  ?  141 ILE B CD1 1 
ATOM   2338  N  N   . GLY B  1 142 ? -12.114 11.030  15.867  1.00 29.88  ?  142 GLY B N   1 
ATOM   2339  C  CA  . GLY B  1 142 ? -12.608 12.153  16.655  1.00 30.79  ?  142 GLY B CA  1 
ATOM   2340  C  C   . GLY B  1 142 ? -11.664 12.993  17.524  1.00 31.62  ?  142 GLY B C   1 
ATOM   2341  O  O   . GLY B  1 142 ? -10.475 12.679  17.765  1.00 30.40  ?  142 GLY B O   1 
ATOM   2342  N  N   . ASP B  1 143 ? -12.231 14.091  17.991  1.00 32.84  ?  143 ASP B N   1 
ATOM   2343  C  CA  . ASP B  1 143 ? -11.526 15.012  18.843  1.00 35.50  ?  143 ASP B CA  1 
ATOM   2344  C  C   . ASP B  1 143 ? -11.478 14.547  20.310  1.00 36.80  ?  143 ASP B C   1 
ATOM   2345  O  O   . ASP B  1 143 ? -12.431 13.942  20.821  1.00 37.09  ?  143 ASP B O   1 
ATOM   2346  C  CB  . ASP B  1 143 ? -12.187 16.388  18.735  1.00 35.90  ?  143 ASP B CB  1 
ATOM   2347  C  CG  . ASP B  1 143 ? -13.655 16.361  19.124  1.00 36.59  ?  143 ASP B CG  1 
ATOM   2348  O  OD1 . ASP B  1 143 ? -14.487 16.071  18.259  1.00 38.43  ?  143 ASP B OD1 1 
ATOM   2349  O  OD2 . ASP B  1 143 ? -13.977 16.630  20.300  1.00 40.07  -1 143 ASP B OD2 1 
ATOM   2350  N  N   . PHE B  1 144 ? -10.368 14.837  20.978  1.00 38.10  ?  144 PHE B N   1 
ATOM   2351  C  CA  . PHE B  1 144 ? -10.250 14.607  22.411  1.00 39.72  ?  144 PHE B CA  1 
ATOM   2352  C  C   . PHE B  1 144 ? -10.057 15.903  23.177  1.00 40.67  ?  144 PHE B C   1 
ATOM   2353  O  O   . PHE B  1 144 ? -9.015  16.552  23.046  1.00 41.14  ?  144 PHE B O   1 
ATOM   2354  C  CB  . PHE B  1 144 ? -9.073  13.678  22.704  1.00 39.68  ?  144 PHE B CB  1 
ATOM   2355  C  CG  . PHE B  1 144 ? -9.037  13.168  24.111  1.00 40.75  ?  144 PHE B CG  1 
ATOM   2356  C  CD1 . PHE B  1 144 ? -10.147 12.534  24.669  1.00 41.46  ?  144 PHE B CD1 1 
ATOM   2357  C  CD2 . PHE B  1 144 ? -7.886  13.298  24.881  1.00 41.75  ?  144 PHE B CD2 1 
ATOM   2358  C  CE1 . PHE B  1 144 ? -10.089 12.046  25.973  1.00 42.00  ?  144 PHE B CE1 1 
ATOM   2359  C  CE2 . PHE B  1 144 ? -7.830  12.800  26.185  1.00 39.38  ?  144 PHE B CE2 1 
ATOM   2360  C  CZ  . PHE B  1 144 ? -8.923  12.181  26.723  1.00 39.34  ?  144 PHE B CZ  1 
ATOM   2361  N  N   . ASN B  1 145 ? -11.049 16.244  24.001  1.00 41.97  ?  145 ASN B N   1 
ATOM   2362  C  CA  . ASN B  1 145 ? -10.963 17.376  24.952  1.00 43.08  ?  145 ASN B CA  1 
ATOM   2363  C  C   . ASN B  1 145 ? -10.814 18.697  24.208  1.00 42.36  ?  145 ASN B C   1 
ATOM   2364  O  O   . ASN B  1 145 ? -9.738  19.324  24.190  1.00 41.61  ?  145 ASN B O   1 
ATOM   2365  C  CB  . ASN B  1 145 ? -9.857  17.164  26.015  1.00 44.38  ?  145 ASN B CB  1 
ATOM   2366  C  CG  . ASN B  1 145 ? -10.420 16.658  27.380  1.00 48.97  ?  145 ASN B CG  1 
ATOM   2367  O  OD1 . ASN B  1 145 ? -11.323 17.292  27.971  1.00 52.85  ?  145 ASN B OD1 1 
ATOM   2368  N  ND2 . ASN B  1 145 ? -9.879  15.521  27.882  1.00 50.11  ?  145 ASN B ND2 1 
ATOM   2369  N  N   . TRP B  1 146 ? -11.928 19.092  23.586  1.00 41.94  ?  146 TRP B N   1 
ATOM   2370  C  CA  . TRP B  1 146 ? -11.918 20.145  22.582  1.00 41.40  ?  146 TRP B CA  1 
ATOM   2371  C  C   . TRP B  1 146 ? -12.073 21.482  23.251  1.00 41.55  ?  146 TRP B C   1 
ATOM   2372  O  O   . TRP B  1 146 ? -13.045 21.696  23.979  1.00 41.15  ?  146 TRP B O   1 
ATOM   2373  C  CB  . TRP B  1 146 ? -13.005 19.934  21.525  1.00 41.12  ?  146 TRP B CB  1 
ATOM   2374  C  CG  . TRP B  1 146 ? -12.638 20.539  20.212  1.00 37.81  ?  146 TRP B CG  1 
ATOM   2375  C  CD1 . TRP B  1 146 ? -13.376 21.430  19.472  1.00 35.69  ?  146 TRP B CD1 1 
ATOM   2376  C  CD2 . TRP B  1 146 ? -11.424 20.338  19.505  1.00 34.05  ?  146 TRP B CD2 1 
ATOM   2377  N  NE1 . TRP B  1 146 ? -12.687 21.780  18.337  1.00 33.48  ?  146 TRP B NE1 1 
ATOM   2378  C  CE2 . TRP B  1 146 ? -11.485 21.120  18.335  1.00 33.38  ?  146 TRP B CE2 1 
ATOM   2379  C  CE3 . TRP B  1 146 ? -10.298 19.552  19.730  1.00 35.05  ?  146 TRP B CE3 1 
ATOM   2380  C  CZ2 . TRP B  1 146 ? -10.469 21.124  17.386  1.00 31.61  ?  146 TRP B CZ2 1 
ATOM   2381  C  CZ3 . TRP B  1 146 ? -9.273  19.568  18.776  1.00 33.24  ?  146 TRP B CZ3 1 
ATOM   2382  C  CH2 . TRP B  1 146 ? -9.375  20.345  17.623  1.00 31.19  ?  146 TRP B CH2 1 
ATOM   2383  N  N   . PRO B  1 147 ? -11.092 22.378  23.037  1.00 41.83  ?  147 PRO B N   1 
ATOM   2384  C  CA  . PRO B  1 147 ? -11.128 23.651  23.748  1.00 42.09  ?  147 PRO B CA  1 
ATOM   2385  C  C   . PRO B  1 147 ? -12.373 24.435  23.396  1.00 42.44  ?  147 PRO B C   1 
ATOM   2386  O  O   . PRO B  1 147 ? -12.814 25.240  24.190  1.00 42.42  ?  147 PRO B O   1 
ATOM   2387  C  CB  . PRO B  1 147 ? -9.873  24.360  23.242  1.00 42.17  ?  147 PRO B CB  1 
ATOM   2388  C  CG  . PRO B  1 147 ? -8.928  23.231  22.954  1.00 41.59  ?  147 PRO B CG  1 
ATOM   2389  C  CD  . PRO B  1 147 ? -9.798  22.165  22.364  1.00 41.45  ?  147 PRO B CD  1 
ATOM   2390  N  N   . PHE B  1 148 ? -12.969 24.148  22.244  1.00 43.12  ?  148 PHE B N   1 
ATOM   2391  C  CA  . PHE B  1 148 ? -14.068 24.971  21.706  1.00 44.46  ?  148 PHE B CA  1 
ATOM   2392  C  C   . PHE B  1 148 ? -15.424 24.299  21.779  1.00 45.15  ?  148 PHE B C   1 
ATOM   2393  O  O   . PHE B  1 148 ? -15.519 23.065  21.717  1.00 45.80  ?  148 PHE B O   1 
ATOM   2394  C  CB  . PHE B  1 148 ? -13.737 25.424  20.266  1.00 44.18  ?  148 PHE B CB  1 
ATOM   2395  C  CG  . PHE B  1 148 ? -12.321 25.896  20.119  1.00 44.80  ?  148 PHE B CG  1 
ATOM   2396  C  CD1 . PHE B  1 148 ? -11.341 25.044  19.610  1.00 41.73  ?  148 PHE B CD1 1 
ATOM   2397  C  CD2 . PHE B  1 148 ? -11.945 27.181  20.568  1.00 45.83  ?  148 PHE B CD2 1 
ATOM   2398  C  CE1 . PHE B  1 148 ? -10.013 25.449  19.523  1.00 42.99  ?  148 PHE B CE1 1 
ATOM   2399  C  CE2 . PHE B  1 148 ? -10.593 27.607  20.476  1.00 45.37  ?  148 PHE B CE2 1 
ATOM   2400  C  CZ  . PHE B  1 148 ? -9.626  26.733  19.954  1.00 43.15  ?  148 PHE B CZ  1 
ATOM   2401  N  N   . THR B  1 149 ? -16.470 25.112  21.927  1.00 46.17  ?  149 THR B N   1 
ATOM   2402  C  CA  . THR B  1 149 ? -17.847 24.613  21.946  1.00 47.27  ?  149 THR B CA  1 
ATOM   2403  C  C   . THR B  1 149 ? -18.111 23.924  20.621  1.00 48.39  ?  149 THR B C   1 
ATOM   2404  O  O   . THR B  1 149 ? -17.366 24.129  19.652  1.00 48.62  ?  149 THR B O   1 
ATOM   2405  C  CB  . THR B  1 149 ? -18.902 25.753  22.049  1.00 47.47  ?  149 THR B CB  1 
ATOM   2406  O  OG1 . THR B  1 149 ? -18.709 26.682  20.968  1.00 47.06  ?  149 THR B OG1 1 
ATOM   2407  C  CG2 . THR B  1 149 ? -18.861 26.479  23.418  1.00 46.49  ?  149 THR B CG2 1 
ATOM   2408  N  N   . LYS B  1 150 ? -19.170 23.114  20.570  1.00 49.43  ?  150 LYS B N   1 
ATOM   2409  C  CA  . LYS B  1 150 ? -19.617 22.526  19.307  1.00 49.85  ?  150 LYS B CA  1 
ATOM   2410  C  C   . LYS B  1 150 ? -21.097 22.813  19.037  1.00 50.42  ?  150 LYS B C   1 
ATOM   2411  O  O   . LYS B  1 150 ? -21.423 23.781  18.330  1.00 50.62  ?  150 LYS B O   1 
ATOM   2412  C  CB  . LYS B  1 150 ? -19.307 21.038  19.262  1.00 49.78  ?  150 LYS B CB  1 
ATOM   2413  C  CG  . LYS B  1 150 ? -17.852 20.731  19.513  1.00 49.71  ?  150 LYS B CG  1 
ATOM   2414  C  CD  . LYS B  1 150 ? -17.500 19.342  19.063  1.00 48.93  ?  150 LYS B CD  1 
ATOM   2415  C  CE  . LYS B  1 150 ? -16.570 18.694  20.067  1.00 48.34  ?  150 LYS B CE  1 
ATOM   2416  N  NZ  . LYS B  1 150 ? -16.241 17.319  19.624  1.00 47.27  ?  150 LYS B NZ  1 
ATOM   2417  N  N   . MET C  1 1   ? -46.254 11.016  31.324  1.00 44.43  ?  1   MET C N   1 
ATOM   2418  C  CA  . MET C  1 1   ? -44.806 11.342  31.155  1.00 43.97  ?  1   MET C CA  1 
ATOM   2419  C  C   . MET C  1 1   ? -44.274 10.812  29.817  1.00 42.79  ?  1   MET C C   1 
ATOM   2420  O  O   . MET C  1 1   ? -44.913 9.948   29.183  1.00 42.42  ?  1   MET C O   1 
ATOM   2421  C  CB  . MET C  1 1   ? -44.020 10.750  32.308  1.00 44.40  ?  1   MET C CB  1 
ATOM   2422  C  CG  . MET C  1 1   ? -44.238 9.246   32.451  1.00 47.08  ?  1   MET C CG  1 
ATOM   2423  S  SD  . MET C  1 1   ? -42.763 8.470   33.124  1.00 50.90  ?  1   MET C SD  1 
ATOM   2424  C  CE  . MET C  1 1   ? -41.504 9.700   32.718  1.00 49.97  ?  1   MET C CE  1 
ATOM   2425  N  N   . PHE C  1 2   ? -43.110 11.316  29.386  1.00 41.19  ?  2   PHE C N   1 
ATOM   2426  C  CA  . PHE C  1 2   ? -42.597 10.913  28.081  1.00 38.87  ?  2   PHE C CA  1 
ATOM   2427  C  C   . PHE C  1 2   ? -42.023 9.502   28.033  1.00 37.60  ?  2   PHE C C   1 
ATOM   2428  O  O   . PHE C  1 2   ? -41.152 9.125   28.837  1.00 37.08  ?  2   PHE C O   1 
ATOM   2429  C  CB  . PHE C  1 2   ? -41.594 11.895  27.497  1.00 39.03  ?  2   PHE C CB  1 
ATOM   2430  C  CG  . PHE C  1 2   ? -41.022 11.439  26.162  1.00 39.25  ?  2   PHE C CG  1 
ATOM   2431  C  CD1 . PHE C  1 2   ? -41.843 11.336  25.037  1.00 39.35  ?  2   PHE C CD1 1 
ATOM   2432  C  CD2 . PHE C  1 2   ? -39.668 11.070  26.045  1.00 38.22  ?  2   PHE C CD2 1 
ATOM   2433  C  CE1 . PHE C  1 2   ? -41.317 10.910  23.800  1.00 39.25  ?  2   PHE C CE1 1 
ATOM   2434  C  CE2 . PHE C  1 2   ? -39.129 10.654  24.830  1.00 37.16  ?  2   PHE C CE2 1 
ATOM   2435  C  CZ  . PHE C  1 2   ? -39.955 10.570  23.698  1.00 39.37  ?  2   PHE C CZ  1 
ATOM   2436  N  N   . LYS C  1 3   ? -42.516 8.762   27.038  1.00 35.68  ?  3   LYS C N   1 
ATOM   2437  C  CA  . LYS C  1 3   ? -42.091 7.415   26.723  1.00 33.52  ?  3   LYS C CA  1 
ATOM   2438  C  C   . LYS C  1 3   ? -42.113 7.145   25.198  1.00 32.02  ?  3   LYS C C   1 
ATOM   2439  O  O   . LYS C  1 3   ? -43.171 7.183   24.551  1.00 31.62  ?  3   LYS C O   1 
ATOM   2440  C  CB  . LYS C  1 3   ? -43.000 6.419   27.443  1.00 33.99  ?  3   LYS C CB  1 
ATOM   2441  C  CG  . LYS C  1 3   ? -42.896 6.402   28.978  1.00 33.76  ?  3   LYS C CG  1 
ATOM   2442  C  CD  . LYS C  1 3   ? -43.793 5.296   29.519  1.00 35.40  ?  3   LYS C CD  1 
ATOM   2443  C  CE  . LYS C  1 3   ? -44.282 5.523   30.955  1.00 36.44  ?  3   LYS C CE  1 
ATOM   2444  N  NZ  . LYS C  1 3   ? -45.341 4.496   31.300  1.00 36.97  ?  3   LYS C NZ  1 
ATOM   2445  N  N   . PRO C  1 4   ? -40.943 6.848   24.613  1.00 30.51  ?  4   PRO C N   1 
ATOM   2446  C  CA  . PRO C  1 4   ? -40.837 6.519   23.194  1.00 29.36  ?  4   PRO C CA  1 
ATOM   2447  C  C   . PRO C  1 4   ? -41.331 5.137   22.886  1.00 28.74  ?  4   PRO C C   1 
ATOM   2448  O  O   . PRO C  1 4   ? -41.307 4.257   23.767  1.00 29.08  ?  4   PRO C O   1 
ATOM   2449  C  CB  . PRO C  1 4   ? -39.331 6.509   22.964  1.00 30.03  ?  4   PRO C CB  1 
ATOM   2450  C  CG  . PRO C  1 4   ? -38.763 6.089   24.261  1.00 29.98  ?  4   PRO C CG  1 
ATOM   2451  C  CD  . PRO C  1 4   ? -39.627 6.823   25.271  1.00 30.33  ?  4   PRO C CD  1 
ATOM   2452  N  N   . HIS C  1 5   ? -41.759 4.935   21.644  1.00 27.34  ?  5   HIS C N   1 
ATOM   2453  C  CA  . HIS C  1 5   ? -42.005 3.603   21.132  1.00 26.37  ?  5   HIS C CA  1 
ATOM   2454  C  C   . HIS C  1 5   ? -40.677 2.855   20.991  1.00 25.58  ?  5   HIS C C   1 
ATOM   2455  O  O   . HIS C  1 5   ? -39.690 3.399   20.526  1.00 24.74  ?  5   HIS C O   1 
ATOM   2456  C  CB  . HIS C  1 5   ? -42.692 3.651   19.783  1.00 26.24  ?  5   HIS C CB  1 
ATOM   2457  C  CG  . HIS C  1 5   ? -44.034 4.296   19.810  1.00 27.72  ?  5   HIS C CG  1 
ATOM   2458  N  ND1 . HIS C  1 5   ? -45.150 3.718   19.230  1.00 29.13  ?  5   HIS C ND1 1 
ATOM   2459  C  CD2 . HIS C  1 5   ? -44.443 5.483   20.319  1.00 26.66  ?  5   HIS C CD2 1 
ATOM   2460  C  CE1 . HIS C  1 5   ? -46.189 4.516   19.397  1.00 26.46  ?  5   HIS C CE1 1 
ATOM   2461  N  NE2 . HIS C  1 5   ? -45.789 5.586   20.065  1.00 27.14  ?  5   HIS C NE2 1 
ATOM   2462  N  N   . VAL C  1 6   ? -40.656 1.599   21.422  1.00 25.56  ?  6   VAL C N   1 
ATOM   2463  C  CA  . VAL C  1 6   ? -39.448 0.793   21.296  1.00 24.75  ?  6   VAL C CA  1 
ATOM   2464  C  C   . VAL C  1 6   ? -39.865 -0.356  20.421  1.00 24.02  ?  6   VAL C C   1 
ATOM   2465  O  O   . VAL C  1 6   ? -40.825 -1.060  20.726  1.00 24.52  ?  6   VAL C O   1 
ATOM   2466  C  CB  . VAL C  1 6   ? -38.846 0.340   22.667  1.00 24.54  ?  6   VAL C CB  1 
ATOM   2467  C  CG1 . VAL C  1 6   ? -37.512 -0.310  22.481  1.00 23.48  ?  6   VAL C CG1 1 
ATOM   2468  C  CG2 . VAL C  1 6   ? -38.646 1.540   23.573  1.00 24.57  ?  6   VAL C CG2 1 
ATOM   2469  N  N   . THR C  1 7   ? -39.185 -0.484  19.294  1.00 22.71  ?  7   THR C N   1 
ATOM   2470  C  CA  . THR C  1 7   ? -39.412 -1.593  18.422  1.00 22.06  ?  7   THR C CA  1 
ATOM   2471  C  C   . THR C  1 7   ? -38.080 -2.306  18.205  1.00 21.32  ?  7   THR C C   1 
ATOM   2472  O  O   . THR C  1 7   ? -37.023 -1.846  18.656  1.00 20.55  ?  7   THR C O   1 
ATOM   2473  C  CB  . THR C  1 7   ? -39.979 -1.154  17.053  1.00 22.30  ?  7   THR C CB  1 
ATOM   2474  O  OG1 . THR C  1 7   ? -39.149 -0.126  16.503  1.00 24.91  ?  7   THR C OG1 1 
ATOM   2475  C  CG2 . THR C  1 7   ? -41.384 -0.636  17.154  1.00 22.82  ?  7   THR C CG2 1 
ATOM   2476  N  N   . VAL C  1 8   ? -38.155 -3.430  17.496  1.00 20.64  ?  8   VAL C N   1 
ATOM   2477  C  CA  . VAL C  1 8   ? -37.020 -4.285  17.218  1.00 19.34  ?  8   VAL C CA  1 
ATOM   2478  C  C   . VAL C  1 8   ? -37.108 -4.744  15.785  1.00 19.82  ?  8   VAL C C   1 
ATOM   2479  O  O   . VAL C  1 8   ? -38.195 -4.913  15.209  1.00 19.40  ?  8   VAL C O   1 
ATOM   2480  C  CB  . VAL C  1 8   ? -36.999 -5.531  18.122  1.00 19.69  ?  8   VAL C CB  1 
ATOM   2481  C  CG1 . VAL C  1 8   ? -36.737 -5.154  19.602  1.00 17.03  ?  8   VAL C CG1 1 
ATOM   2482  C  CG2 . VAL C  1 8   ? -38.270 -6.306  17.979  1.00 17.13  ?  8   VAL C CG2 1 
ATOM   2483  N  N   . ALA C  1 9   ? -35.948 -4.950  15.194  1.00 20.20  ?  9   ALA C N   1 
ATOM   2484  C  CA  . ALA C  1 9   ? -35.894 -5.338  13.798  1.00 21.44  ?  9   ALA C CA  1 
ATOM   2485  C  C   . ALA C  1 9   ? -34.780 -6.327  13.580  1.00 22.00  ?  9   ALA C C   1 
ATOM   2486  O  O   . ALA C  1 9   ? -33.755 -6.285  14.293  1.00 22.26  ?  9   ALA C O   1 
ATOM   2487  C  CB  . ALA C  1 9   ? -35.697 -4.140  12.930  1.00 21.65  ?  9   ALA C CB  1 
ATOM   2488  N  N   . CYS C  1 10  ? -34.988 -7.214  12.602  1.00 22.44  ?  10  CYS C N   1 
ATOM   2489  C  CA  . CYS C  1 10  ? -33.965 -8.218  12.271  1.00 23.42  ?  10  CYS C CA  1 
ATOM   2490  C  C   . CYS C  1 10  ? -33.476 -8.106  10.860  1.00 22.79  ?  10  CYS C C   1 
ATOM   2491  O  O   . CYS C  1 10  ? -34.287 -7.975  9.940   1.00 23.23  ?  10  CYS C O   1 
ATOM   2492  C  CB  . CYS C  1 10  ? -34.508 -9.635  12.475  1.00 23.21  ?  10  CYS C CB  1 
ATOM   2493  S  SG  . CYS C  1 10  ? -34.792 -9.949  14.180  1.00 26.78  ?  10  CYS C SG  1 
ATOM   2494  N  N   . VAL C  1 11  ? -32.162 -8.203  10.681  1.00 22.02  ?  11  VAL C N   1 
ATOM   2495  C  CA  . VAL C  1 11  ? -31.686 -8.397  9.345   1.00 22.08  ?  11  VAL C CA  1 
ATOM   2496  C  C   . VAL C  1 11  ? -31.431 -9.879  9.150   1.00 22.49  ?  11  VAL C C   1 
ATOM   2497  O  O   . VAL C  1 11  ? -30.575 -10.479 9.789   1.00 22.32  ?  11  VAL C O   1 
ATOM   2498  C  CB  . VAL C  1 11  ? -30.507 -7.512  9.006   1.00 21.73  ?  11  VAL C CB  1 
ATOM   2499  C  CG1 . VAL C  1 11  ? -29.984 -7.861  7.659   1.00 22.70  ?  11  VAL C CG1 1 
ATOM   2500  C  CG2 . VAL C  1 11  ? -30.955 -6.095  8.961   1.00 20.18  ?  11  VAL C CG2 1 
ATOM   2501  N  N   . VAL C  1 12  ? -32.222 -10.472 8.283   1.00 22.91  ?  12  VAL C N   1 
ATOM   2502  C  CA  . VAL C  1 12  ? -32.115 -11.890 8.068   1.00 23.66  ?  12  VAL C CA  1 
ATOM   2503  C  C   . VAL C  1 12  ? -31.537 -12.190 6.691   1.00 24.54  ?  12  VAL C C   1 
ATOM   2504  O  O   . VAL C  1 12  ? -32.114 -11.811 5.650   1.00 24.39  ?  12  VAL C O   1 
ATOM   2505  C  CB  . VAL C  1 12  ? -33.454 -12.577 8.288   1.00 23.23  ?  12  VAL C CB  1 
ATOM   2506  C  CG1 . VAL C  1 12  ? -33.283 -14.069 8.267   1.00 23.98  ?  12  VAL C CG1 1 
ATOM   2507  C  CG2 . VAL C  1 12  ? -33.989 -12.178 9.630   1.00 23.67  ?  12  VAL C CG2 1 
ATOM   2508  N  N   . HIS C  1 13  ? -30.399 -12.890 6.716   1.00 25.16  ?  13  HIS C N   1 
ATOM   2509  C  CA  . HIS C  1 13  ? -29.588 -13.147 5.555   1.00 26.38  ?  13  HIS C CA  1 
ATOM   2510  C  C   . HIS C  1 13  ? -29.452 -14.656 5.383   1.00 27.52  ?  13  HIS C C   1 
ATOM   2511  O  O   . HIS C  1 13  ? -29.060 -15.390 6.309   1.00 27.91  ?  13  HIS C O   1 
ATOM   2512  C  CB  . HIS C  1 13  ? -28.201 -12.490 5.736   1.00 26.76  ?  13  HIS C CB  1 
ATOM   2513  C  CG  . HIS C  1 13  ? -27.292 -12.620 4.543   1.00 27.04  ?  13  HIS C CG  1 
ATOM   2514  N  ND1 . HIS C  1 13  ? -27.470 -11.897 3.380   1.00 26.04  ?  13  HIS C ND1 1 
ATOM   2515  C  CD2 . HIS C  1 13  ? -26.210 -13.406 4.331   1.00 26.60  ?  13  HIS C CD2 1 
ATOM   2516  C  CE1 . HIS C  1 13  ? -26.532 -12.225 2.511   1.00 24.00  ?  13  HIS C CE1 1 
ATOM   2517  N  NE2 . HIS C  1 13  ? -25.752 -13.137 3.063   1.00 22.88  ?  13  HIS C NE2 1 
ATOM   2518  N  N   . ALA C  1 14  ? -29.815 -15.124 4.202   1.00 28.42  ?  14  ALA C N   1 
ATOM   2519  C  CA  . ALA C  1 14  ? -29.451 -16.463 3.796   1.00 29.69  ?  14  ALA C CA  1 
ATOM   2520  C  C   . ALA C  1 14  ? -29.165 -16.443 2.309   1.00 30.43  ?  14  ALA C C   1 
ATOM   2521  O  O   . ALA C  1 14  ? -29.940 -15.856 1.539   1.00 30.60  ?  14  ALA C O   1 
ATOM   2522  C  CB  . ALA C  1 14  ? -30.554 -17.439 4.127   1.00 29.99  ?  14  ALA C CB  1 
ATOM   2523  N  N   . GLU C  1 15  ? -28.030 -17.022 1.906   1.00 31.04  ?  15  GLU C N   1 
ATOM   2524  C  CA  . GLU C  1 15  ? -27.730 -17.187 0.467   1.00 32.33  ?  15  GLU C CA  1 
ATOM   2525  C  C   . GLU C  1 15  ? -27.833 -15.884 -0.311  1.00 32.46  ?  15  GLU C C   1 
ATOM   2526  O  O   . GLU C  1 15  ? -28.659 -15.772 -1.250  1.00 33.03  ?  15  GLU C O   1 
ATOM   2527  C  CB  . GLU C  1 15  ? -28.679 -18.217 -0.171  1.00 32.10  ?  15  GLU C CB  1 
ATOM   2528  C  CG  . GLU C  1 15  ? -28.249 -19.630 0.090   1.00 35.18  ?  15  GLU C CG  1 
ATOM   2529  C  CD  . GLU C  1 15  ? -29.401 -20.608 0.140   1.00 39.69  ?  15  GLU C CD  1 
ATOM   2530  O  OE1 . GLU C  1 15  ? -29.109 -21.817 -0.009  1.00 41.34  ?  15  GLU C OE1 1 
ATOM   2531  O  OE2 . GLU C  1 15  ? -30.577 -20.186 0.337   1.00 41.02  -1 15  GLU C OE2 1 
ATOM   2532  N  N   . GLY C  1 16  ? -27.021 -14.907 0.095   1.00 31.83  ?  16  GLY C N   1 
ATOM   2533  C  CA  . GLY C  1 16  ? -26.918 -13.616 -0.590  1.00 31.31  ?  16  GLY C CA  1 
ATOM   2534  C  C   . GLY C  1 16  ? -28.234 -12.856 -0.731  1.00 30.79  ?  16  GLY C C   1 
ATOM   2535  O  O   . GLY C  1 16  ? -28.283 -11.800 -1.388  1.00 30.21  ?  16  GLY C O   1 
ATOM   2536  N  N   . LYS C  1 17  ? -29.295 -13.391 -0.124  1.00 30.21  ?  17  LYS C N   1 
ATOM   2537  C  CA  . LYS C  1 17  ? -30.565 -12.670 -0.076  1.00 30.27  ?  17  LYS C CA  1 
ATOM   2538  C  C   . LYS C  1 17  ? -30.985 -12.222 1.352   1.00 29.41  ?  17  LYS C C   1 
ATOM   2539  O  O   . LYS C  1 17  ? -30.392 -12.643 2.354   1.00 29.53  ?  17  LYS C O   1 
ATOM   2540  C  CB  . LYS C  1 17  ? -31.647 -13.438 -0.817  1.00 30.75  ?  17  LYS C CB  1 
ATOM   2541  C  CG  . LYS C  1 17  ? -31.463 -13.410 -2.317  1.00 32.91  ?  17  LYS C CG  1 
ATOM   2542  C  CD  . LYS C  1 17  ? -32.704 -13.986 -3.015  1.00 40.14  ?  17  LYS C CD  1 
ATOM   2543  C  CE  . LYS C  1 17  ? -32.950 -13.432 -4.440  1.00 42.93  ?  17  LYS C CE  1 
ATOM   2544  N  NZ  . LYS C  1 17  ? -31.835 -13.714 -5.378  1.00 43.29  ?  17  LYS C NZ  1 
ATOM   2545  N  N   . PHE C  1 18  ? -31.951 -11.319 1.423   1.00 28.91  ?  18  PHE C N   1 
ATOM   2546  C  CA  . PHE C  1 18  ? -32.355 -10.704 2.683   1.00 29.42  ?  18  PHE C CA  1 
ATOM   2547  C  C   . PHE C  1 18  ? -33.833 -10.819 2.798   1.00 29.97  ?  18  PHE C C   1 
ATOM   2548  O  O   . PHE C  1 18  ? -34.553 -10.598 1.823   1.00 29.67  ?  18  PHE C O   1 
ATOM   2549  C  CB  . PHE C  1 18  ? -31.974 -9.197  2.786   1.00 29.47  ?  18  PHE C CB  1 
ATOM   2550  C  CG  . PHE C  1 18  ? -30.493 -8.952  2.860   1.00 28.20  ?  18  PHE C CG  1 
ATOM   2551  C  CD1 . PHE C  1 18  ? -29.837 -8.953  4.080   1.00 26.07  ?  18  PHE C CD1 1 
ATOM   2552  C  CD2 . PHE C  1 18  ? -29.749 -8.751  1.698   1.00 28.13  ?  18  PHE C CD2 1 
ATOM   2553  C  CE1 . PHE C  1 18  ? -28.473 -8.748  4.151   1.00 24.84  ?  18  PHE C CE1 1 
ATOM   2554  C  CE2 . PHE C  1 18  ? -28.359 -8.569  1.755   1.00 26.71  ?  18  PHE C CE2 1 
ATOM   2555  C  CZ  . PHE C  1 18  ? -27.726 -8.569  2.998   1.00 25.63  ?  18  PHE C CZ  1 
ATOM   2556  N  N   . LEU C  1 19  ? -34.288 -11.149 4.002   1.00 30.91  ?  19  LEU C N   1 
ATOM   2557  C  CA  . LEU C  1 19  ? -35.710 -11.357 4.219   1.00 31.52  ?  19  LEU C CA  1 
ATOM   2558  C  C   . LEU C  1 19  ? -36.422 -10.037 4.406   1.00 31.97  ?  19  LEU C C   1 
ATOM   2559  O  O   . LEU C  1 19  ? -36.087 -9.247  5.272   1.00 32.89  ?  19  LEU C O   1 
ATOM   2560  C  CB  . LEU C  1 19  ? -35.975 -12.294 5.409   1.00 31.01  ?  19  LEU C CB  1 
ATOM   2561  C  CG  . LEU C  1 19  ? -37.459 -12.645 5.623   1.00 30.36  ?  19  LEU C CG  1 
ATOM   2562  C  CD1 . LEU C  1 19  ? -38.102 -13.190 4.300   1.00 29.32  ?  19  LEU C CD1 1 
ATOM   2563  C  CD2 . LEU C  1 19  ? -37.635 -13.621 6.792   1.00 26.52  ?  19  LEU C CD2 1 
ATOM   2564  N  N   . VAL C  1 20  ? -37.426 -9.798  3.593   1.00 33.20  ?  20  VAL C N   1 
ATOM   2565  C  CA  . VAL C  1 20  ? -38.179 -8.567  3.710   1.00 33.73  ?  20  VAL C CA  1 
ATOM   2566  C  C   . VAL C  1 20  ? -39.645 -8.932  3.864   1.00 35.06  ?  20  VAL C C   1 
ATOM   2567  O  O   . VAL C  1 20  ? -40.055 -9.991  3.432   1.00 35.82  ?  20  VAL C O   1 
ATOM   2568  C  CB  . VAL C  1 20  ? -37.856 -7.648  2.510   1.00 33.21  ?  20  VAL C CB  1 
ATOM   2569  C  CG1 . VAL C  1 20  ? -39.009 -7.544  1.517   1.00 31.57  ?  20  VAL C CG1 1 
ATOM   2570  C  CG2 . VAL C  1 20  ? -37.386 -6.293  3.019   1.00 32.46  ?  20  VAL C CG2 1 
ATOM   2571  N  N   . VAL C  1 21  ? -40.429 -8.084  4.508   1.00 36.84  ?  21  VAL C N   1 
ATOM   2572  C  CA  . VAL C  1 21  ? -41.853 -8.351  4.689   1.00 38.17  ?  21  VAL C CA  1 
ATOM   2573  C  C   . VAL C  1 21  ? -42.685 -7.276  3.983   1.00 39.84  ?  21  VAL C C   1 
ATOM   2574  O  O   . VAL C  1 21  ? -42.459 -6.099  4.188   1.00 40.63  ?  21  VAL C O   1 
ATOM   2575  C  CB  . VAL C  1 21  ? -42.225 -8.475  6.208   1.00 38.30  ?  21  VAL C CB  1 
ATOM   2576  C  CG1 . VAL C  1 21  ? -41.401 -9.562  6.881   1.00 37.30  ?  21  VAL C CG1 1 
ATOM   2577  C  CG2 . VAL C  1 21  ? -42.040 -7.157  6.955   1.00 37.23  ?  21  VAL C CG2 1 
ATOM   2578  N  N   . GLU C  1 22  ? -43.629 -7.683  3.146   1.00 41.99  ?  22  GLU C N   1 
ATOM   2579  C  CA  . GLU C  1 22  ? -44.438 -6.756  2.358   1.00 44.48  ?  22  GLU C CA  1 
ATOM   2580  C  C   . GLU C  1 22  ? -45.697 -6.381  3.120   1.00 45.71  ?  22  GLU C C   1 
ATOM   2581  O  O   . GLU C  1 22  ? -46.440 -7.237  3.548   1.00 46.04  ?  22  GLU C O   1 
ATOM   2582  C  CB  . GLU C  1 22  ? -44.812 -7.389  1.024   1.00 44.65  ?  22  GLU C CB  1 
ATOM   2583  C  CG  . GLU C  1 22  ? -45.147 -6.423  -0.126  1.00 47.52  ?  22  GLU C CG  1 
ATOM   2584  C  CD  . GLU C  1 22  ? -45.023 -7.128  -1.492  1.00 52.29  ?  22  GLU C CD  1 
ATOM   2585  O  OE1 . GLU C  1 22  ? -46.097 -7.409  -2.089  1.00 53.01  ?  22  GLU C OE1 1 
ATOM   2586  O  OE2 . GLU C  1 22  ? -43.864 -7.450  -1.936  1.00 52.52  -1 22  GLU C OE2 1 
ATOM   2587  N  N   . GLU C  1 23  ? -45.962 -5.094  3.244   1.00 47.60  ?  23  GLU C N   1 
ATOM   2588  C  CA  . GLU C  1 23  ? -46.952 -4.625  4.192   1.00 49.19  ?  23  GLU C CA  1 
ATOM   2589  C  C   . GLU C  1 23  ? -47.760 -3.453  3.621   1.00 50.59  ?  23  GLU C C   1 
ATOM   2590  O  O   . GLU C  1 23  ? -47.233 -2.343  3.461   1.00 51.26  ?  23  GLU C O   1 
ATOM   2591  C  CB  . GLU C  1 23  ? -46.206 -4.204  5.449   1.00 48.97  ?  23  GLU C CB  1 
ATOM   2592  C  CG  . GLU C  1 23  ? -46.978 -4.278  6.713   1.00 48.02  ?  23  GLU C CG  1 
ATOM   2593  C  CD  . GLU C  1 23  ? -46.098 -4.044  7.950   1.00 49.20  ?  23  GLU C CD  1 
ATOM   2594  O  OE1 . GLU C  1 23  ? -44.822 -4.040  7.884   1.00 44.35  ?  23  GLU C OE1 1 
ATOM   2595  O  OE2 . GLU C  1 23  ? -46.731 -3.866  9.016   1.00 52.21  -1 23  GLU C OE2 1 
ATOM   2596  N  N   . THR C  1 24  ? -49.029 -3.698  3.294   1.00 52.18  ?  24  THR C N   1 
ATOM   2597  C  CA  . THR C  1 24  ? -49.917 -2.638  2.771   1.00 53.09  ?  24  THR C CA  1 
ATOM   2598  C  C   . THR C  1 24  ? -50.141 -1.569  3.844   1.00 54.17  ?  24  THR C C   1 
ATOM   2599  O  O   . THR C  1 24  ? -50.476 -1.867  4.990   1.00 53.99  ?  24  THR C O   1 
ATOM   2600  C  CB  . THR C  1 24  ? -51.248 -3.217  2.216   1.00 52.89  ?  24  THR C CB  1 
ATOM   2601  O  OG1 . THR C  1 24  ? -51.024 -3.732  0.901   1.00 50.56  ?  24  THR C OG1 1 
ATOM   2602  C  CG2 . THR C  1 24  ? -52.347 -2.159  2.159   1.00 53.22  ?  24  THR C CG2 1 
ATOM   2603  N  N   . ILE C  1 25  ? -49.885 -0.325  3.490   1.00 55.68  ?  25  ILE C N   1 
ATOM   2604  C  CA  . ILE C  1 25  ? -49.952 0.715   4.499   1.00 57.58  ?  25  ILE C CA  1 
ATOM   2605  C  C   . ILE C  1 25  ? -51.213 1.553   4.313   1.00 58.40  ?  25  ILE C C   1 
ATOM   2606  O  O   . ILE C  1 25  ? -51.929 1.871   5.283   1.00 59.16  ?  25  ILE C O   1 
ATOM   2607  C  CB  . ILE C  1 25  ? -48.677 1.558   4.515   1.00 57.48  ?  25  ILE C CB  1 
ATOM   2608  C  CG1 . ILE C  1 25  ? -48.263 1.825   5.966   1.00 58.13  ?  25  ILE C CG1 1 
ATOM   2609  C  CG2 . ILE C  1 25  ? -48.822 2.796   3.597   1.00 58.36  ?  25  ILE C CG2 1 
ATOM   2610  C  CD1 . ILE C  1 25  ? -48.136 0.529   6.801   1.00 57.84  ?  25  ILE C CD1 1 
ATOM   2611  N  N   . ASN C  1 26  ? -51.446 1.912   3.054   1.00 58.60  ?  26  ASN C N   1 
ATOM   2612  C  CA  . ASN C  1 26  ? -52.730 2.346   2.529   1.00 58.58  ?  26  ASN C CA  1 
ATOM   2613  C  C   . ASN C  1 26  ? -52.440 2.605   1.067   1.00 58.44  ?  26  ASN C C   1 
ATOM   2614  O  O   . ASN C  1 26  ? -51.642 3.469   0.736   1.00 58.92  ?  26  ASN C O   1 
ATOM   2615  C  CB  . ASN C  1 26  ? -53.295 3.592   3.238   1.00 58.59  ?  26  ASN C CB  1 
ATOM   2616  C  CG  . ASN C  1 26  ? -52.209 4.533   3.735   1.00 57.98  ?  26  ASN C CG  1 
ATOM   2617  O  OD1 . ASN C  1 26  ? -52.068 4.741   4.944   1.00 57.39  ?  26  ASN C OD1 1 
ATOM   2618  N  ND2 . ASN C  1 26  ? -51.430 5.092   2.811   1.00 55.86  ?  26  ASN C ND2 1 
ATOM   2619  N  N   . GLY C  1 27  ? -53.042 1.809   0.197   1.00 58.21  ?  27  GLY C N   1 
ATOM   2620  C  CA  . GLY C  1 27  ? -52.785 1.924   -1.227  1.00 57.52  ?  27  GLY C CA  1 
ATOM   2621  C  C   . GLY C  1 27  ? -51.524 1.173   -1.599  1.00 57.08  ?  27  GLY C C   1 
ATOM   2622  O  O   . GLY C  1 27  ? -51.561 0.232   -2.416  1.00 57.19  ?  27  GLY C O   1 
ATOM   2623  N  N   . LYS C  1 28  ? -50.391 1.575   -1.020  1.00 56.17  ?  28  LYS C N   1 
ATOM   2624  C  CA  . LYS C  1 28  ? -49.139 0.944   -1.434  1.00 55.12  ?  28  LYS C CA  1 
ATOM   2625  C  C   . LYS C  1 28  ? -48.630 -0.087  -0.445  1.00 53.45  ?  28  LYS C C   1 
ATOM   2626  O  O   . LYS C  1 28  ? -48.767 0.078   0.778   1.00 53.14  ?  28  LYS C O   1 
ATOM   2627  C  CB  . LYS C  1 28  ? -48.036 1.952   -1.840  1.00 55.62  ?  28  LYS C CB  1 
ATOM   2628  C  CG  . LYS C  1 28  ? -47.114 1.379   -2.969  1.00 56.77  ?  28  LYS C CG  1 
ATOM   2629  C  CD  . LYS C  1 28  ? -45.669 1.925   -2.971  1.00 57.74  ?  28  LYS C CD  1 
ATOM   2630  C  CE  . LYS C  1 28  ? -45.389 2.869   -4.162  1.00 58.29  ?  28  LYS C CE  1 
ATOM   2631  N  NZ  . LYS C  1 28  ? -43.941 2.883   -4.573  1.00 56.78  ?  28  LYS C NZ  1 
ATOM   2632  N  N   . ALA C  1 29  ? -48.076 -1.156  -1.024  1.00 51.49  ?  29  ALA C N   1 
ATOM   2633  C  CA  . ALA C  1 29  ? -47.395 -2.208  -0.299  1.00 49.70  ?  29  ALA C CA  1 
ATOM   2634  C  C   . ALA C  1 29  ? -45.932 -1.837  -0.086  1.00 48.68  ?  29  ALA C C   1 
ATOM   2635  O  O   . ALA C  1 29  ? -45.149 -1.667  -1.040  1.00 48.40  ?  29  ALA C O   1 
ATOM   2636  C  CB  . ALA C  1 29  ? -47.517 -3.527  -1.044  1.00 49.86  ?  29  ALA C CB  1 
ATOM   2637  N  N   . LEU C  1 30  ? -45.574 -1.700  1.183   1.00 47.07  ?  30  LEU C N   1 
ATOM   2638  C  CA  . LEU C  1 30  ? -44.203 -1.377  1.552   1.00 45.93  ?  30  LEU C CA  1 
ATOM   2639  C  C   . LEU C  1 30  ? -43.388 -2.554  2.081   1.00 44.48  ?  30  LEU C C   1 
ATOM   2640  O  O   . LEU C  1 30  ? -43.945 -3.604  2.422   1.00 43.99  ?  30  LEU C O   1 
ATOM   2641  C  CB  . LEU C  1 30  ? -44.181 -0.236  2.562   1.00 46.29  ?  30  LEU C CB  1 
ATOM   2642  C  CG  . LEU C  1 30  ? -44.721 1.089   2.023   1.00 46.59  ?  30  LEU C CG  1 
ATOM   2643  C  CD1 . LEU C  1 30  ? -44.564 1.175   0.521   1.00 46.81  ?  30  LEU C CD1 1 
ATOM   2644  C  CD2 . LEU C  1 30  ? -46.152 1.238   2.387   1.00 48.50  ?  30  LEU C CD2 1 
ATOM   2645  N  N   . TRP C  1 31  ? -42.067 -2.367  2.126   1.00 42.59  ?  31  TRP C N   1 
ATOM   2646  C  CA  . TRP C  1 31  ? -41.152 -3.386  2.640   1.00 40.33  ?  31  TRP C CA  1 
ATOM   2647  C  C   . TRP C  1 31  ? -40.483 -2.937  3.910   1.00 38.67  ?  31  TRP C C   1 
ATOM   2648  O  O   . TRP C  1 31  ? -40.188 -1.755  4.070   1.00 38.91  ?  31  TRP C O   1 
ATOM   2649  C  CB  . TRP C  1 31  ? -40.081 -3.754  1.621   1.00 40.09  ?  31  TRP C CB  1 
ATOM   2650  C  CG  . TRP C  1 31  ? -40.613 -4.352  0.382   1.00 39.47  ?  31  TRP C CG  1 
ATOM   2651  C  CD1 . TRP C  1 31  ? -41.897 -4.699  0.137   1.00 38.86  ?  31  TRP C CD1 1 
ATOM   2652  C  CD2 . TRP C  1 31  ? -39.864 -4.717  -0.787  1.00 38.86  ?  31  TRP C CD2 1 
ATOM   2653  N  NE1 . TRP C  1 31  ? -42.009 -5.230  -1.123  1.00 39.87  ?  31  TRP C NE1 1 
ATOM   2654  C  CE2 . TRP C  1 31  ? -40.774 -5.252  -1.711  1.00 39.23  ?  31  TRP C CE2 1 
ATOM   2655  C  CE3 . TRP C  1 31  ? -38.516 -4.631  -1.143  1.00 39.75  ?  31  TRP C CE3 1 
ATOM   2656  C  CZ2 . TRP C  1 31  ? -40.383 -5.705  -2.977  1.00 41.48  ?  31  TRP C CZ2 1 
ATOM   2657  C  CZ3 . TRP C  1 31  ? -38.119 -5.084  -2.411  1.00 41.21  ?  31  TRP C CZ3 1 
ATOM   2658  C  CH2 . TRP C  1 31  ? -39.052 -5.605  -3.309  1.00 41.71  ?  31  TRP C CH2 1 
ATOM   2659  N  N   . ASN C  1 32  ? -40.267 -3.889  4.815   1.00 37.02  ?  32  ASN C N   1 
ATOM   2660  C  CA  . ASN C  1 32  ? -39.544 -3.659  6.092   1.00 35.15  ?  32  ASN C CA  1 
ATOM   2661  C  C   . ASN C  1 32  ? -38.692 -4.891  6.411   1.00 33.41  ?  32  ASN C C   1 
ATOM   2662  O  O   . ASN C  1 32  ? -38.962 -5.970  5.886   1.00 33.55  ?  32  ASN C O   1 
ATOM   2663  C  CB  . ASN C  1 32  ? -40.542 -3.366  7.241   1.00 34.57  ?  32  ASN C CB  1 
ATOM   2664  C  CG  . ASN C  1 32  ? -39.875 -2.745  8.499   1.00 35.40  ?  32  ASN C CG  1 
ATOM   2665  O  OD1 . ASN C  1 32  ? -38.659 -2.872  8.726   1.00 35.08  ?  32  ASN C OD1 1 
ATOM   2666  N  ND2 . ASN C  1 32  ? -40.689 -2.083  9.328   1.00 33.83  ?  32  ASN C ND2 1 
ATOM   2667  N  N   . GLN C  1 33  ? -37.663 -4.746  7.242   1.00 31.16  ?  33  GLN C N   1 
ATOM   2668  C  CA  . GLN C  1 33  ? -37.154 -5.922  7.943   1.00 29.28  ?  33  GLN C CA  1 
ATOM   2669  C  C   . GLN C  1 33  ? -38.329 -6.428  8.788   1.00 28.56  ?  33  GLN C C   1 
ATOM   2670  O  O   . GLN C  1 33  ? -39.140 -5.621  9.242   1.00 27.80  ?  33  GLN C O   1 
ATOM   2671  C  CB  . GLN C  1 33  ? -35.966 -5.595  8.855   1.00 28.87  ?  33  GLN C CB  1 
ATOM   2672  C  CG  . GLN C  1 33  ? -34.665 -5.265  8.129   1.00 27.94  ?  33  GLN C CG  1 
ATOM   2673  C  CD  . GLN C  1 33  ? -34.747 -3.909  7.459   1.00 25.99  ?  33  GLN C CD  1 
ATOM   2674  O  OE1 . GLN C  1 33  ? -35.145 -2.938  8.083   1.00 25.35  ?  33  GLN C OE1 1 
ATOM   2675  N  NE2 . GLN C  1 33  ? -34.403 -3.847  6.187   1.00 24.45  ?  33  GLN C NE2 1 
ATOM   2676  N  N   . PRO C  1 34  ? -38.452 -7.759  8.960   1.00 27.60  ?  34  PRO C N   1 
ATOM   2677  C  CA  . PRO C  1 34  ? -39.305 -8.281  9.989   1.00 27.23  ?  34  PRO C CA  1 
ATOM   2678  C  C   . PRO C  1 34  ? -38.988 -7.511  11.254  1.00 26.78  ?  34  PRO C C   1 
ATOM   2679  O  O   . PRO C  1 34  ? -37.848 -7.510  11.715  1.00 26.67  ?  34  PRO C O   1 
ATOM   2680  C  CB  . PRO C  1 34  ? -38.805 -9.696  10.138  1.00 27.53  ?  34  PRO C CB  1 
ATOM   2681  C  CG  . PRO C  1 34  ? -38.316 -10.045 8.803   1.00 27.12  ?  34  PRO C CG  1 
ATOM   2682  C  CD  . PRO C  1 34  ? -37.737 -8.827  8.249   1.00 27.70  ?  34  PRO C CD  1 
ATOM   2683  N  N   . ALA C  1 35  ? -39.972 -6.815  11.786  1.00 26.82  ?  35  ALA C N   1 
ATOM   2684  C  CA  . ALA C  1 35  ? -39.727 -5.990  12.943  1.00 27.47  ?  35  ALA C CA  1 
ATOM   2685  C  C   . ALA C  1 35  ? -41.031 -5.564  13.560  1.00 27.62  ?  35  ALA C C   1 
ATOM   2686  O  O   . ALA C  1 35  ? -42.030 -5.533  12.866  1.00 27.02  ?  35  ALA C O   1 
ATOM   2687  C  CB  . ALA C  1 35  ? -38.962 -4.798  12.526  1.00 28.58  ?  35  ALA C CB  1 
ATOM   2688  N  N   . GLY C  1 36  ? -41.009 -5.222  14.847  1.00 27.75  ?  36  GLY C N   1 
ATOM   2689  C  CA  . GLY C  1 36  ? -42.207 -4.780  15.553  1.00 28.28  ?  36  GLY C CA  1 
ATOM   2690  C  C   . GLY C  1 36  ? -41.923 -4.219  16.948  1.00 28.98  ?  36  GLY C C   1 
ATOM   2691  O  O   . GLY C  1 36  ? -40.786 -4.256  17.425  1.00 28.23  ?  36  GLY C O   1 
ATOM   2692  N  N   . HIS C  1 37  ? -42.987 -3.703  17.582  1.00 29.62  ?  37  HIS C N   1 
ATOM   2693  C  CA  . HIS C  1 37  ? -43.011 -3.130  18.932  1.00 30.07  ?  37  HIS C CA  1 
ATOM   2694  C  C   . HIS C  1 37  ? -42.654 -4.056  20.103  1.00 30.18  ?  37  HIS C C   1 
ATOM   2695  O  O   . HIS C  1 37  ? -43.113 -5.202  20.202  1.00 30.24  ?  37  HIS C O   1 
ATOM   2696  C  CB  . HIS C  1 37  ? -44.402 -2.533  19.164  1.00 30.17  ?  37  HIS C CB  1 
ATOM   2697  C  CG  . HIS C  1 37  ? -44.616 -1.242  18.443  1.00 32.86  ?  37  HIS C CG  1 
ATOM   2698  N  ND1 . HIS C  1 37  ? -44.801 -1.174  17.078  1.00 36.03  ?  37  HIS C ND1 1 
ATOM   2699  C  CD2 . HIS C  1 37  ? -44.606 0.040   18.886  1.00 34.18  ?  37  HIS C CD2 1 
ATOM   2700  C  CE1 . HIS C  1 37  ? -44.934 0.094   16.718  1.00 36.76  ?  37  HIS C CE1 1 
ATOM   2701  N  NE2 . HIS C  1 37  ? -44.817 0.851   17.796  1.00 35.53  ?  37  HIS C NE2 1 
ATOM   2702  N  N   . LEU C  1 38  ? -41.859 -3.547  21.017  1.00 30.36  ?  38  LEU C N   1 
ATOM   2703  C  CA  . LEU C  1 38  ? -41.654 -4.252  22.266  1.00 31.87  ?  38  LEU C CA  1 
ATOM   2704  C  C   . LEU C  1 38  ? -42.995 -4.491  22.952  1.00 33.22  ?  38  LEU C C   1 
ATOM   2705  O  O   . LEU C  1 38  ? -43.872 -3.609  22.994  1.00 33.77  ?  38  LEU C O   1 
ATOM   2706  C  CB  . LEU C  1 38  ? -40.749 -3.449  23.185  1.00 31.21  ?  38  LEU C CB  1 
ATOM   2707  C  CG  . LEU C  1 38  ? -40.379 -4.026  24.533  1.00 31.10  ?  38  LEU C CG  1 
ATOM   2708  C  CD1 . LEU C  1 38  ? -39.884 -5.467  24.423  1.00 32.50  ?  38  LEU C CD1 1 
ATOM   2709  C  CD2 . LEU C  1 38  ? -39.278 -3.128  25.075  1.00 31.08  ?  38  LEU C CD2 1 
ATOM   2710  N  N   . GLU C  1 39  ? -43.165 -5.700  23.466  1.00 34.73  ?  39  GLU C N   1 
ATOM   2711  C  CA  . GLU C  1 39  ? -44.352 -6.045  24.238  1.00 35.23  ?  39  GLU C CA  1 
ATOM   2712  C  C   . GLU C  1 39  ? -43.980 -6.138  25.749  1.00 34.67  ?  39  GLU C C   1 
ATOM   2713  O  O   . GLU C  1 39  ? -42.812 -6.253  26.108  1.00 34.72  ?  39  GLU C O   1 
ATOM   2714  C  CB  . GLU C  1 39  ? -44.907 -7.350  23.683  1.00 35.55  ?  39  GLU C CB  1 
ATOM   2715  C  CG  . GLU C  1 39  ? -46.419 -7.392  23.502  1.00 39.08  ?  39  GLU C CG  1 
ATOM   2716  C  CD  . GLU C  1 39  ? -46.941 -6.346  22.517  1.00 42.67  ?  39  GLU C CD  1 
ATOM   2717  O  OE1 . GLU C  1 39  ? -46.663 -6.488  21.291  1.00 45.50  ?  39  GLU C OE1 1 
ATOM   2718  O  OE2 . GLU C  1 39  ? -47.653 -5.409  22.973  1.00 41.09  -1 39  GLU C OE2 1 
ATOM   2719  N  N   . ALA C  1 40  ? -44.961 -6.074  26.638  1.00 34.37  ?  40  ALA C N   1 
ATOM   2720  C  CA  . ALA C  1 40  ? -44.653 -6.132  28.080  1.00 33.81  ?  40  ALA C CA  1 
ATOM   2721  C  C   . ALA C  1 40  ? -43.991 -7.454  28.554  1.00 33.32  ?  40  ALA C C   1 
ATOM   2722  O  O   . ALA C  1 40  ? -44.222 -8.531  27.969  1.00 32.41  ?  40  ALA C O   1 
ATOM   2723  C  CB  . ALA C  1 40  ? -45.918 -5.835  28.890  1.00 33.61  ?  40  ALA C CB  1 
ATOM   2724  N  N   . ASP C  1 41  ? -43.190 -7.371  29.623  1.00 32.99  ?  41  ASP C N   1 
ATOM   2725  C  CA  . ASP C  1 41  ? -42.621 -8.580  30.263  1.00 33.06  ?  41  ASP C CA  1 
ATOM   2726  C  C   . ASP C  1 41  ? -41.790 -9.420  29.290  1.00 31.94  ?  41  ASP C C   1 
ATOM   2727  O  O   . ASP C  1 41  ? -41.784 -10.641 29.355  1.00 32.36  ?  41  ASP C O   1 
ATOM   2728  C  CB  . ASP C  1 41  ? -43.739 -9.494  30.816  1.00 33.45  ?  41  ASP C CB  1 
ATOM   2729  C  CG  . ASP C  1 41  ? -44.697 -8.786  31.802  1.00 35.24  ?  41  ASP C CG  1 
ATOM   2730  O  OD1 . ASP C  1 41  ? -45.881 -9.211  31.810  1.00 36.24  ?  41  ASP C OD1 1 
ATOM   2731  O  OD2 . ASP C  1 41  ? -44.288 -7.850  32.558  1.00 36.11  -1 41  ASP C OD2 1 
ATOM   2732  N  N   . GLU C  1 42  ? -41.109 -8.751  28.377  1.00 30.92  ?  42  GLU C N   1 
ATOM   2733  C  CA  . GLU C  1 42  ? -40.438 -9.371  27.253  1.00 28.50  ?  42  GLU C CA  1 
ATOM   2734  C  C   . GLU C  1 42  ? -39.066 -8.725  27.163  1.00 27.83  ?  42  GLU C C   1 
ATOM   2735  O  O   . GLU C  1 42  ? -38.891 -7.531  27.436  1.00 26.96  ?  42  GLU C O   1 
ATOM   2736  C  CB  . GLU C  1 42  ? -41.236 -9.016  26.033  1.00 29.09  ?  42  GLU C CB  1 
ATOM   2737  C  CG  . GLU C  1 42  ? -40.890 -9.687  24.750  1.00 28.55  ?  42  GLU C CG  1 
ATOM   2738  C  CD  . GLU C  1 42  ? -41.863 -9.232  23.667  1.00 30.22  ?  42  GLU C CD  1 
ATOM   2739  O  OE1 . GLU C  1 42  ? -42.598 -10.122 23.133  1.00 29.27  ?  42  GLU C OE1 1 
ATOM   2740  O  OE2 . GLU C  1 42  ? -41.914 -7.983  23.387  1.00 25.69  -1 42  GLU C OE2 1 
ATOM   2741  N  N   . THR C  1 43  ? -38.085 -9.543  26.819  1.00 26.80  ?  43  THR C N   1 
ATOM   2742  C  CA  . THR C  1 43  ? -36.754 -9.089  26.493  1.00 25.67  ?  43  THR C CA  1 
ATOM   2743  C  C   . THR C  1 43  ? -36.745 -8.524  25.057  1.00 24.84  ?  43  THR C C   1 
ATOM   2744  O  O   . THR C  1 43  ? -37.637 -8.880  24.227  1.00 23.79  ?  43  THR C O   1 
ATOM   2745  C  CB  . THR C  1 43  ? -35.826 -10.270 26.678  1.00 25.55  ?  43  THR C CB  1 
ATOM   2746  O  OG1 . THR C  1 43  ? -35.408 -10.263 28.047  1.00 28.47  ?  43  THR C OG1 1 
ATOM   2747  C  CG2 . THR C  1 43  ? -34.621 -10.199 25.822  1.00 26.04  ?  43  THR C CG2 1 
ATOM   2748  N  N   . LEU C  1 44  ? -35.774 -7.647  24.754  1.00 22.83  ?  44  LEU C N   1 
ATOM   2749  C  CA  . LEU C  1 44  ? -35.621 -7.228  23.368  1.00 21.83  ?  44  LEU C CA  1 
ATOM   2750  C  C   . LEU C  1 44  ? -35.426 -8.409  22.401  1.00 22.14  ?  44  LEU C C   1 
ATOM   2751  O  O   . LEU C  1 44  ? -36.122 -8.475  21.368  1.00 21.76  ?  44  LEU C O   1 
ATOM   2752  C  CB  . LEU C  1 44  ? -34.534 -6.188  23.195  1.00 21.52  ?  44  LEU C CB  1 
ATOM   2753  C  CG  . LEU C  1 44  ? -34.892 -4.786  23.723  1.00 22.45  ?  44  LEU C CG  1 
ATOM   2754  C  CD1 . LEU C  1 44  ? -33.661 -3.882  23.790  1.00 21.64  ?  44  LEU C CD1 1 
ATOM   2755  C  CD2 . LEU C  1 44  ? -35.999 -4.106  22.919  1.00 22.53  ?  44  LEU C CD2 1 
ATOM   2756  N  N   . VAL C  1 45  ? -34.544 -9.364  22.729  1.00 22.04  ?  45  VAL C N   1 
ATOM   2757  C  CA  . VAL C  1 45  ? -34.372 -10.487 21.807  1.00 23.69  ?  45  VAL C CA  1 
ATOM   2758  C  C   . VAL C  1 45  ? -35.669 -11.301 21.682  1.00 24.36  ?  45  VAL C C   1 
ATOM   2759  O  O   . VAL C  1 45  ? -36.078 -11.675 20.572  1.00 23.98  ?  45  VAL C O   1 
ATOM   2760  C  CB  . VAL C  1 45  ? -33.194 -11.428 22.105  1.00 23.08  ?  45  VAL C CB  1 
ATOM   2761  C  CG1 . VAL C  1 45  ? -31.972 -10.645 22.588  1.00 24.36  ?  45  VAL C CG1 1 
ATOM   2762  C  CG2 . VAL C  1 45  ? -33.611 -12.486 23.062  1.00 24.32  ?  45  VAL C CG2 1 
ATOM   2763  N  N   . GLU C  1 46  ? -36.312 -11.556 22.817  1.00 24.91  ?  46  GLU C N   1 
ATOM   2764  C  CA  . GLU C  1 46  ? -37.592 -12.233 22.781  1.00 25.80  ?  46  GLU C CA  1 
ATOM   2765  C  C   . GLU C  1 46  ? -38.552 -11.509 21.854  1.00 25.36  ?  46  GLU C C   1 
ATOM   2766  O  O   . GLU C  1 46  ? -39.273 -12.172 21.101  1.00 25.83  ?  46  GLU C O   1 
ATOM   2767  C  CB  . GLU C  1 46  ? -38.199 -12.394 24.179  1.00 26.38  ?  46  GLU C CB  1 
ATOM   2768  C  CG  . GLU C  1 46  ? -37.825 -13.699 24.890  1.00 28.99  ?  46  GLU C CG  1 
ATOM   2769  C  CD  . GLU C  1 46  ? -37.929 -13.579 26.407  1.00 35.87  ?  46  GLU C CD  1 
ATOM   2770  O  OE1 . GLU C  1 46  ? -37.403 -14.467 27.118  1.00 39.83  ?  46  GLU C OE1 1 
ATOM   2771  O  OE2 . GLU C  1 46  ? -38.518 -12.587 26.900  1.00 37.10  -1 46  GLU C OE2 1 
ATOM   2772  N  N   . ALA C  1 47  ? -38.565 -10.167 21.896  1.00 24.73  ?  47  ALA C N   1 
ATOM   2773  C  CA  . ALA C  1 47  ? -39.426 -9.367  20.999  1.00 23.40  ?  47  ALA C CA  1 
ATOM   2774  C  C   . ALA C  1 47  ? -39.016 -9.625  19.557  1.00 23.18  ?  47  ALA C C   1 
ATOM   2775  O  O   . ALA C  1 47  ? -39.849 -9.867  18.667  1.00 22.37  ?  47  ALA C O   1 
ATOM   2776  C  CB  . ALA C  1 47  ? -39.268 -7.898  21.313  1.00 23.26  ?  47  ALA C CB  1 
ATOM   2777  N  N   . ALA C  1 48  ? -37.699 -9.588  19.342  1.00 22.93  ?  48  ALA C N   1 
ATOM   2778  C  CA  . ALA C  1 48  ? -37.170 -9.717  18.009  1.00 22.82  ?  48  ALA C CA  1 
ATOM   2779  C  C   . ALA C  1 48  ? -37.552 -11.085 17.461  1.00 22.83  ?  48  ALA C C   1 
ATOM   2780  O  O   . ALA C  1 48  ? -38.088 -11.199 16.349  1.00 22.94  ?  48  ALA C O   1 
ATOM   2781  C  CB  . ALA C  1 48  ? -35.668 -9.498  18.013  1.00 22.78  ?  48  ALA C CB  1 
ATOM   2782  N  N   . ALA C  1 49  ? -37.320 -12.117 18.267  1.00 23.22  ?  49  ALA C N   1 
ATOM   2783  C  CA  . ALA C  1 49  ? -37.721 -13.494 17.911  1.00 23.74  ?  49  ALA C CA  1 
ATOM   2784  C  C   . ALA C  1 49  ? -39.246 -13.598 17.682  1.00 23.88  ?  49  ALA C C   1 
ATOM   2785  O  O   . ALA C  1 49  ? -39.704 -14.159 16.686  1.00 24.10  ?  49  ALA C O   1 
ATOM   2786  C  CB  . ALA C  1 49  ? -37.228 -14.492 18.960  1.00 22.40  ?  49  ALA C CB  1 
ATOM   2787  N  N   . ARG C  1 50  ? -40.024 -12.998 18.551  1.00 24.21  ?  50  ARG C N   1 
ATOM   2788  C  CA  . ARG C  1 50  ? -41.463 -13.087 18.381  1.00 25.99  ?  50  ARG C CA  1 
ATOM   2789  C  C   . ARG C  1 50  ? -41.919 -12.434 17.065  1.00 26.80  ?  50  ARG C C   1 
ATOM   2790  O  O   . ARG C  1 50  ? -42.577 -13.097 16.228  1.00 26.43  ?  50  ARG C O   1 
ATOM   2791  C  CB  . ARG C  1 50  ? -42.213 -12.496 19.592  1.00 25.92  ?  50  ARG C CB  1 
ATOM   2792  C  CG  . ARG C  1 50  ? -43.719 -12.740 19.561  1.00 25.80  ?  50  ARG C CG  1 
ATOM   2793  C  CD  . ARG C  1 50  ? -44.470 -11.919 20.582  1.00 23.31  ?  50  ARG C CD  1 
ATOM   2794  N  NE  . ARG C  1 50  ? -43.829 -10.638 20.882  1.00 26.16  ?  50  ARG C NE  1 
ATOM   2795  C  CZ  . ARG C  1 50  ? -44.011 -9.505  20.206  1.00 26.72  ?  50  ARG C CZ  1 
ATOM   2796  N  NH1 . ARG C  1 50  ? -44.823 -9.474  19.158  1.00 28.51  ?  50  ARG C NH1 1 
ATOM   2797  N  NH2 . ARG C  1 50  ? -43.370 -8.399  20.576  1.00 27.53  ?  50  ARG C NH2 1 
ATOM   2798  N  N   . GLU C  1 51  ? -41.560 -11.163 16.861  1.00 27.32  ?  51  GLU C N   1 
ATOM   2799  C  CA  . GLU C  1 51  ? -42.021 -10.479 15.639  1.00 28.40  ?  51  GLU C CA  1 
ATOM   2800  C  C   . GLU C  1 51  ? -41.515 -11.167 14.361  1.00 28.16  ?  51  GLU C C   1 
ATOM   2801  O  O   . GLU C  1 51  ? -42.267 -11.253 13.371  1.00 27.40  ?  51  GLU C O   1 
ATOM   2802  C  CB  . GLU C  1 51  ? -41.684 -8.984  15.626  1.00 28.78  ?  51  GLU C CB  1 
ATOM   2803  C  CG  . GLU C  1 51  ? -42.493 -8.148  16.603  1.00 30.97  ?  51  GLU C CG  1 
ATOM   2804  C  CD  . GLU C  1 51  ? -43.917 -7.831  16.125  1.00 33.71  ?  51  GLU C CD  1 
ATOM   2805  O  OE1 . GLU C  1 51  ? -44.243 -8.068  14.932  1.00 31.11  ?  51  GLU C OE1 1 
ATOM   2806  O  OE2 . GLU C  1 51  ? -44.698 -7.314  16.967  1.00 34.59  -1 51  GLU C OE2 1 
ATOM   2807  N  N   . LEU C  1 52  ? -40.273 -11.663 14.375  1.00 27.64  ?  52  LEU C N   1 
ATOM   2808  C  CA  . LEU C  1 52  ? -39.823 -12.460 13.252  1.00 28.56  ?  52  LEU C CA  1 
ATOM   2809  C  C   . LEU C  1 52  ? -40.902 -13.502 12.949  1.00 29.84  ?  52  LEU C C   1 
ATOM   2810  O  O   . LEU C  1 52  ? -41.549 -13.469 11.882  1.00 29.83  ?  52  LEU C O   1 
ATOM   2811  C  CB  . LEU C  1 52  ? -38.525 -13.182 13.562  1.00 28.62  ?  52  LEU C CB  1 
ATOM   2812  C  CG  . LEU C  1 52  ? -37.509 -13.315 12.410  1.00 28.72  ?  52  LEU C CG  1 
ATOM   2813  C  CD1 . LEU C  1 52  ? -36.599 -14.532 12.548  1.00 27.39  ?  52  LEU C CD1 1 
ATOM   2814  C  CD2 . LEU C  1 52  ? -38.147 -13.228 11.001  1.00 27.77  ?  52  LEU C CD2 1 
ATOM   2815  N  N   . TRP C  1 53  ? -41.121 -14.389 13.918  1.00 30.58  ?  53  TRP C N   1 
ATOM   2816  C  CA  . TRP C  1 53  ? -42.064 -15.468 13.769  1.00 31.77  ?  53  TRP C CA  1 
ATOM   2817  C  C   . TRP C  1 53  ? -43.407 -14.941 13.332  1.00 32.26  ?  53  TRP C C   1 
ATOM   2818  O  O   . TRP C  1 53  ? -43.971 -15.434 12.374  1.00 32.24  ?  53  TRP C O   1 
ATOM   2819  C  CB  . TRP C  1 53  ? -42.229 -16.260 15.082  1.00 32.48  ?  53  TRP C CB  1 
ATOM   2820  C  CG  . TRP C  1 53  ? -43.159 -17.384 14.884  1.00 33.23  ?  53  TRP C CG  1 
ATOM   2821  C  CD1 . TRP C  1 53  ? -42.864 -18.600 14.330  1.00 32.58  ?  53  TRP C CD1 1 
ATOM   2822  C  CD2 . TRP C  1 53  ? -44.564 -17.386 15.147  1.00 34.51  ?  53  TRP C CD2 1 
ATOM   2823  N  NE1 . TRP C  1 53  ? -44.000 -19.369 14.260  1.00 34.82  ?  53  TRP C NE1 1 
ATOM   2824  C  CE2 . TRP C  1 53  ? -45.060 -18.650 14.755  1.00 34.70  ?  53  TRP C CE2 1 
ATOM   2825  C  CE3 . TRP C  1 53  ? -45.453 -16.453 15.701  1.00 36.26  ?  53  TRP C CE3 1 
ATOM   2826  C  CZ2 . TRP C  1 53  ? -46.410 -19.009 14.899  1.00 35.60  ?  53  TRP C CZ2 1 
ATOM   2827  C  CZ3 . TRP C  1 53  ? -46.821 -16.809 15.835  1.00 36.90  ?  53  TRP C CZ3 1 
ATOM   2828  C  CH2 . TRP C  1 53  ? -47.274 -18.075 15.442  1.00 35.38  ?  53  TRP C CH2 1 
ATOM   2829  N  N   . GLU C  1 54  ? -43.903 -13.921 14.037  1.00 33.33  ?  54  GLU C N   1 
ATOM   2830  C  CA  . GLU C  1 54  ? -45.226 -13.327 13.774  1.00 34.07  ?  54  GLU C CA  1 
ATOM   2831  C  C   . GLU C  1 54  ? -45.441 -12.872 12.333  1.00 34.42  ?  54  GLU C C   1 
ATOM   2832  O  O   . GLU C  1 54  ? -46.603 -12.847 11.871  1.00 34.44  ?  54  GLU C O   1 
ATOM   2833  C  CB  . GLU C  1 54  ? -45.505 -12.140 14.708  1.00 34.67  ?  54  GLU C CB  1 
ATOM   2834  C  CG  . GLU C  1 54  ? -46.023 -12.504 16.115  1.00 36.99  ?  54  GLU C CG  1 
ATOM   2835  C  CD  . GLU C  1 54  ? -46.625 -11.321 16.887  1.00 40.13  ?  54  GLU C CD  1 
ATOM   2836  O  OE1 . GLU C  1 54  ? -46.719 -10.213 16.302  1.00 43.75  ?  54  GLU C OE1 1 
ATOM   2837  O  OE2 . GLU C  1 54  ? -47.011 -11.496 18.079  1.00 41.86  -1 54  GLU C OE2 1 
ATOM   2838  N  N   . GLU C  1 55  ? -44.345 -12.531 11.636  1.00 34.22  ?  55  GLU C N   1 
ATOM   2839  C  CA  . GLU C  1 55  ? -44.418 -11.880 10.316  1.00 34.48  ?  55  GLU C CA  1 
ATOM   2840  C  C   . GLU C  1 55  ? -43.912 -12.696 9.126   1.00 34.36  ?  55  GLU C C   1 
ATOM   2841  O  O   . GLU C  1 55  ? -44.064 -12.277 7.969   1.00 34.72  ?  55  GLU C O   1 
ATOM   2842  C  CB  . GLU C  1 55  ? -43.655 -10.557 10.324  1.00 34.57  ?  55  GLU C CB  1 
ATOM   2843  C  CG  . GLU C  1 55  ? -43.922 -9.720  11.535  1.00 36.81  ?  55  GLU C CG  1 
ATOM   2844  C  CD  . GLU C  1 55  ? -43.911 -8.254  11.258  1.00 37.41  ?  55  GLU C CD  1 
ATOM   2845  O  OE1 . GLU C  1 55  ? -42.884 -7.702  10.799  1.00 38.14  ?  55  GLU C OE1 1 
ATOM   2846  O  OE2 . GLU C  1 55  ? -44.955 -7.650  11.549  1.00 40.60  -1 55  GLU C OE2 1 
ATOM   2847  N  N   . THR C  1 56  ? -43.302 -13.844 9.406   1.00 33.89  ?  56  THR C N   1 
ATOM   2848  C  CA  . THR C  1 56  ? -42.527 -14.568 8.424   1.00 32.65  ?  56  THR C CA  1 
ATOM   2849  C  C   . THR C  1 56  ? -42.584 -16.026 8.788   1.00 33.13  ?  56  THR C C   1 
ATOM   2850  O  O   . THR C  1 56  ? -42.221 -16.906 7.987   1.00 34.03  ?  56  THR C O   1 
ATOM   2851  C  CB  . THR C  1 56  ? -41.071 -14.179 8.533   1.00 32.53  ?  56  THR C CB  1 
ATOM   2852  O  OG1 . THR C  1 56  ? -40.589 -14.578 9.823   1.00 30.65  ?  56  THR C OG1 1 
ATOM   2853  C  CG2 . THR C  1 56  ? -40.918 -12.680 8.395   1.00 32.20  ?  56  THR C CG2 1 
ATOM   2854  N  N   . GLY C  1 57  ? -42.990 -16.288 10.025  1.00 32.42  ?  57  GLY C N   1 
ATOM   2855  C  CA  . GLY C  1 57  ? -43.166 -17.653 10.483  1.00 31.96  ?  57  GLY C CA  1 
ATOM   2856  C  C   . GLY C  1 57  ? -41.875 -18.431 10.613  1.00 31.18  ?  57  GLY C C   1 
ATOM   2857  O  O   . GLY C  1 57  ? -41.900 -19.654 10.679  1.00 30.79  ?  57  GLY C O   1 
ATOM   2858  N  N   . ILE C  1 58  ? -40.749 -17.726 10.641  1.00 30.36  ?  58  ILE C N   1 
ATOM   2859  C  CA  . ILE C  1 58  ? -39.478 -18.372 10.933  1.00 29.60  ?  58  ILE C CA  1 
ATOM   2860  C  C   . ILE C  1 58  ? -39.149 -18.287 12.415  1.00 28.82  ?  58  ILE C C   1 
ATOM   2861  O  O   . ILE C  1 58  ? -39.342 -17.243 13.063  1.00 29.31  ?  58  ILE C O   1 
ATOM   2862  C  CB  . ILE C  1 58  ? -38.336 -17.792 10.094  1.00 29.85  ?  58  ILE C CB  1 
ATOM   2863  C  CG1 . ILE C  1 58  ? -38.729 -17.813 8.616   1.00 29.93  ?  58  ILE C CG1 1 
ATOM   2864  C  CG2 . ILE C  1 58  ? -36.992 -18.537 10.382  1.00 29.67  ?  58  ILE C CG2 1 
ATOM   2865  C  CD1 . ILE C  1 58  ? -37.718 -17.172 7.679   1.00 31.24  ?  58  ILE C CD1 1 
ATOM   2866  N  N   . SER C  1 59  ? -38.668 -19.405 12.940  1.00 27.81  ?  59  SER C N   1 
ATOM   2867  C  CA  . SER C  1 59  ? -38.170 -19.476 14.295  1.00 27.43  ?  59  SER C CA  1 
ATOM   2868  C  C   . SER C  1 59  ? -36.668 -19.397 14.337  1.00 26.54  ?  59  SER C C   1 
ATOM   2869  O  O   . SER C  1 59  ? -35.958 -20.366 14.109  1.00 26.47  ?  59  SER C O   1 
ATOM   2870  C  CB  . SER C  1 59  ? -38.656 -20.731 14.987  1.00 27.52  ?  59  SER C CB  1 
ATOM   2871  O  OG  . SER C  1 59  ? -40.067 -20.690 14.949  1.00 30.98  ?  59  SER C OG  1 
ATOM   2872  N  N   . ALA C  1 60  ? -36.184 -18.207 14.623  1.00 26.05  ?  60  ALA C N   1 
ATOM   2873  C  CA  . ALA C  1 60  ? -34.772 -18.023 14.757  1.00 25.76  ?  60  ALA C CA  1 
ATOM   2874  C  C   . ALA C  1 60  ? -34.601 -17.000 15.814  1.00 25.72  ?  60  ALA C C   1 
ATOM   2875  O  O   . ALA C  1 60  ? -35.410 -16.109 15.976  1.00 25.78  ?  60  ALA C O   1 
ATOM   2876  C  CB  . ALA C  1 60  ? -34.159 -17.560 13.463  1.00 25.63  ?  60  ALA C CB  1 
ATOM   2877  N  N   . GLN C  1 61  ? -33.526 -17.172 16.540  1.00 26.20  ?  61  GLN C N   1 
ATOM   2878  C  CA  . GLN C  1 61  ? -33.138 -16.315 17.600  1.00 27.08  ?  61  GLN C CA  1 
ATOM   2879  C  C   . GLN C  1 61  ? -32.116 -15.321 17.023  1.00 26.62  ?  61  GLN C C   1 
ATOM   2880  O  O   . GLN C  1 61  ? -31.289 -15.701 16.197  1.00 26.58  ?  61  GLN C O   1 
ATOM   2881  C  CB  . GLN C  1 61  ? -32.458 -17.196 18.644  1.00 27.22  ?  61  GLN C CB  1 
ATOM   2882  C  CG  . GLN C  1 61  ? -32.604 -16.685 20.055  1.00 31.46  ?  61  GLN C CG  1 
ATOM   2883  C  CD  . GLN C  1 61  ? -34.046 -16.681 20.519  1.00 33.41  ?  61  GLN C CD  1 
ATOM   2884  O  OE1 . GLN C  1 61  ? -34.334 -16.203 21.619  1.00 35.29  ?  61  GLN C OE1 1 
ATOM   2885  N  NE2 . GLN C  1 61  ? -34.966 -17.194 19.680  1.00 32.37  ?  61  GLN C NE2 1 
ATOM   2886  N  N   . PRO C  1 62  ? -32.171 -14.046 17.447  1.00 26.03  ?  62  PRO C N   1 
ATOM   2887  C  CA  . PRO C  1 62  ? -31.158 -13.047 17.141  1.00 24.92  ?  62  PRO C CA  1 
ATOM   2888  C  C   . PRO C  1 62  ? -29.737 -13.512 17.429  1.00 24.88  ?  62  PRO C C   1 
ATOM   2889  O  O   . PRO C  1 62  ? -29.479 -14.113 18.453  1.00 25.33  ?  62  PRO C O   1 
ATOM   2890  C  CB  . PRO C  1 62  ? -31.540 -11.935 18.069  1.00 24.32  ?  62  PRO C CB  1 
ATOM   2891  C  CG  . PRO C  1 62  ? -33.020 -11.948 17.967  1.00 24.91  ?  62  PRO C CG  1 
ATOM   2892  C  CD  . PRO C  1 62  ? -33.377 -13.411 18.003  1.00 26.24  ?  62  PRO C CD  1 
ATOM   2893  N  N   . GLN C  1 63  ? -28.813 -13.245 16.527  1.00 24.82  ?  63  GLN C N   1 
ATOM   2894  C  CA  . GLN C  1 63  ? -27.454 -13.695 16.745  1.00 24.96  ?  63  GLN C CA  1 
ATOM   2895  C  C   . GLN C  1 63  ? -26.547 -12.574 17.268  1.00 24.36  ?  63  GLN C C   1 
ATOM   2896  O  O   . GLN C  1 63  ? -25.712 -12.800 18.165  1.00 24.29  ?  63  GLN C O   1 
ATOM   2897  C  CB  . GLN C  1 63  ? -26.862 -14.237 15.456  1.00 25.76  ?  63  GLN C CB  1 
ATOM   2898  C  CG  . GLN C  1 63  ? -27.552 -15.461 14.871  1.00 27.96  ?  63  GLN C CG  1 
ATOM   2899  C  CD  . GLN C  1 63  ? -26.824 -15.954 13.671  1.00 30.27  ?  63  GLN C CD  1 
ATOM   2900  O  OE1 . GLN C  1 63  ? -26.373 -17.082 13.647  1.00 34.46  ?  63  GLN C OE1 1 
ATOM   2901  N  NE2 . GLN C  1 63  ? -26.632 -15.085 12.687  1.00 31.45  ?  63  GLN C NE2 1 
ATOM   2902  N  N   . HIS C  1 64  ? -26.721 -11.382 16.698  1.00 23.20  ?  64  HIS C N   1 
ATOM   2903  C  CA  . HIS C  1 64  ? -25.885 -10.231 17.000  1.00 22.13  ?  64  HIS C CA  1 
ATOM   2904  C  C   . HIS C  1 64  ? -26.723 -8.987  17.095  1.00 21.40  ?  64  HIS C C   1 
ATOM   2905  O  O   . HIS C  1 64  ? -27.785 -8.889  16.458  1.00 22.54  ?  64  HIS C O   1 
ATOM   2906  C  CB  . HIS C  1 64  ? -24.898 -10.008 15.868  1.00 22.10  ?  64  HIS C CB  1 
ATOM   2907  C  CG  . HIS C  1 64  ? -23.825 -11.039 15.773  1.00 21.94  ?  64  HIS C CG  1 
ATOM   2908  N  ND1 . HIS C  1 64  ? -23.705 -11.886 14.695  1.00 24.29  ?  64  HIS C ND1 1 
ATOM   2909  C  CD2 . HIS C  1 64  ? -22.788 -11.326 16.595  1.00 23.18  ?  64  HIS C CD2 1 
ATOM   2910  C  CE1 . HIS C  1 64  ? -22.647 -12.659 14.859  1.00 26.08  ?  64  HIS C CE1 1 
ATOM   2911  N  NE2 . HIS C  1 64  ? -22.077 -12.346 16.009  1.00 25.45  ?  64  HIS C NE2 1 
ATOM   2912  N  N   . PHE C  1 65  ? -26.236 -8.025  17.863  1.00 20.15  ?  65  PHE C N   1 
ATOM   2913  C  CA  . PHE C  1 65  ? -26.792 -6.673  17.887  1.00 19.18  ?  65  PHE C CA  1 
ATOM   2914  C  C   . PHE C  1 65  ? -26.061 -5.805  16.883  1.00 19.01  ?  65  PHE C C   1 
ATOM   2915  O  O   . PHE C  1 65  ? -24.826 -5.832  16.824  1.00 19.20  ?  65  PHE C O   1 
ATOM   2916  C  CB  . PHE C  1 65  ? -26.612 -6.099  19.281  1.00 19.04  ?  65  PHE C CB  1 
ATOM   2917  C  CG  . PHE C  1 65  ? -27.075 -4.677  19.424  1.00 17.67  ?  65  PHE C CG  1 
ATOM   2918  C  CD1 . PHE C  1 65  ? -28.375 -4.318  19.108  1.00 16.51  ?  65  PHE C CD1 1 
ATOM   2919  C  CD2 . PHE C  1 65  ? -26.211 -3.709  19.885  1.00 12.66  ?  65  PHE C CD2 1 
ATOM   2920  C  CE1 . PHE C  1 65  ? -28.791 -3.030  19.247  1.00 16.93  ?  65  PHE C CE1 1 
ATOM   2921  C  CE2 . PHE C  1 65  ? -26.635 -2.437  20.019  1.00 14.45  ?  65  PHE C CE2 1 
ATOM   2922  C  CZ  . PHE C  1 65  ? -27.914 -2.089  19.711  1.00 15.74  ?  65  PHE C CZ  1 
ATOM   2923  N  N   . ILE C  1 66  ? -26.794 -5.060  16.062  1.00 19.00  ?  66  ILE C N   1 
ATOM   2924  C  CA  . ILE C  1 66  ? -26.129 -4.193  15.046  1.00 18.84  ?  66  ILE C CA  1 
ATOM   2925  C  C   . ILE C  1 66  ? -25.925 -2.804  15.593  1.00 19.06  ?  66  ILE C C   1 
ATOM   2926  O  O   . ILE C  1 66  ? -24.797 -2.336  15.691  1.00 19.86  ?  66  ILE C O   1 
ATOM   2927  C  CB  . ILE C  1 66  ? -26.843 -4.193  13.655  1.00 18.85  ?  66  ILE C CB  1 
ATOM   2928  C  CG1 . ILE C  1 66  ? -26.760 -5.584  13.007  1.00 17.78  ?  66  ILE C CG1 1 
ATOM   2929  C  CG2 . ILE C  1 66  ? -26.213 -3.217  12.732  1.00 18.14  ?  66  ILE C CG2 1 
ATOM   2930  C  CD1 . ILE C  1 66  ? -27.773 -5.878  11.933  1.00 11.83  ?  66  ILE C CD1 1 
ATOM   2931  N  N   . ARG C  1 67  ? -26.994 -2.205  16.087  1.00 20.35  ?  67  ARG C N   1 
ATOM   2932  C  CA  . ARG C  1 67  ? -27.000 -0.819  16.455  1.00 21.17  ?  67  ARG C CA  1 
ATOM   2933  C  C   . ARG C  1 67  ? -28.469 -0.540  16.749  1.00 22.10  ?  67  ARG C C   1 
ATOM   2934  O  O   . ARG C  1 67  ? -29.344 -1.291  16.301  1.00 20.87  ?  67  ARG C O   1 
ATOM   2935  C  CB  . ARG C  1 67  ? -26.690 -0.099  15.184  1.00 22.03  ?  67  ARG C CB  1 
ATOM   2936  C  CG  . ARG C  1 67  ? -25.945 1.127   15.276  1.00 24.99  ?  67  ARG C CG  1 
ATOM   2937  C  CD  . ARG C  1 67  ? -26.568 1.999   14.225  1.00 26.68  ?  67  ARG C CD  1 
ATOM   2938  N  NE  . ARG C  1 67  ? -27.338 3.043   14.877  1.00 24.45  ?  67  ARG C NE  1 
ATOM   2939  C  CZ  . ARG C  1 67  ? -27.122 4.314   14.659  1.00 20.46  ?  67  ARG C CZ  1 
ATOM   2940  N  NH1 . ARG C  1 67  ? -26.207 4.654   13.792  1.00 20.82  ?  67  ARG C NH1 1 
ATOM   2941  N  NH2 . ARG C  1 67  ? -27.826 5.216   15.282  1.00 20.85  ?  67  ARG C NH2 1 
ATOM   2942  N  N   . MET C  1 68  ? -28.756 0.544   17.473  1.00 22.94  ?  68  MET C N   1 
ATOM   2943  C  CA  . MET C  1 68  ? -30.137 1.020   17.620  1.00 23.99  ?  68  MET C CA  1 
ATOM   2944  C  C   . MET C  1 68  ? -30.234 2.364   16.910  1.00 24.20  ?  68  MET C C   1 
ATOM   2945  O  O   . MET C  1 68  ? -29.237 3.047   16.742  1.00 24.33  ?  68  MET C O   1 
ATOM   2946  C  CB  . MET C  1 68  ? -30.518 1.140   19.114  1.00 24.78  ?  68  MET C CB  1 
ATOM   2947  C  CG  . MET C  1 68  ? -31.938 1.626   19.430  1.00 25.00  ?  68  MET C CG  1 
ATOM   2948  S  SD  . MET C  1 68  ? -31.931 2.768   20.848  1.00 32.92  ?  68  MET C SD  1 
ATOM   2949  C  CE  . MET C  1 68  ? -31.314 4.252   20.036  1.00 29.21  ?  68  MET C CE  1 
ATOM   2950  N  N   . HIS C  1 69  ? -31.423 2.735   16.471  1.00 24.72  ?  69  HIS C N   1 
ATOM   2951  C  CA  . HIS C  1 69  ? -31.579 4.009   15.820  1.00 25.53  ?  69  HIS C CA  1 
ATOM   2952  C  C   . HIS C  1 69  ? -32.658 4.747   16.523  1.00 26.19  ?  69  HIS C C   1 
ATOM   2953  O  O   . HIS C  1 69  ? -33.767 4.223   16.669  1.00 25.74  ?  69  HIS C O   1 
ATOM   2954  C  CB  . HIS C  1 69  ? -31.976 3.867   14.336  1.00 25.94  ?  69  HIS C CB  1 
ATOM   2955  C  CG  . HIS C  1 69  ? -30.860 3.393   13.446  1.00 25.99  ?  69  HIS C CG  1 
ATOM   2956  N  ND1 . HIS C  1 69  ? -30.680 2.064   13.118  1.00 22.71  ?  69  HIS C ND1 1 
ATOM   2957  C  CD2 . HIS C  1 69  ? -29.870 4.072   12.826  1.00 24.43  ?  69  HIS C CD2 1 
ATOM   2958  C  CE1 . HIS C  1 69  ? -29.624 1.944   12.338  1.00 23.34  ?  69  HIS C CE1 1 
ATOM   2959  N  NE2 . HIS C  1 69  ? -29.113 3.147   12.146  1.00 25.73  ?  69  HIS C NE2 1 
ATOM   2960  N  N   . GLN C  1 70  ? -32.353 5.977   16.940  1.00 26.73  ?  70  GLN C N   1 
ATOM   2961  C  CA  . GLN C  1 70  ? -33.418 6.816   17.446  1.00 27.74  ?  70  GLN C CA  1 
ATOM   2962  C  C   . GLN C  1 70  ? -33.946 7.687   16.330  1.00 27.75  ?  70  GLN C C   1 
ATOM   2963  O  O   . GLN C  1 70  ? -33.186 8.456   15.710  1.00 28.40  ?  70  GLN C O   1 
ATOM   2964  C  CB  . GLN C  1 70  ? -32.928 7.672   18.590  1.00 27.94  ?  70  GLN C CB  1 
ATOM   2965  C  CG  . GLN C  1 70  ? -34.036 8.482   19.250  1.00 29.07  ?  70  GLN C CG  1 
ATOM   2966  C  CD  . GLN C  1 70  ? -33.487 9.311   20.378  1.00 31.80  ?  70  GLN C CD  1 
ATOM   2967  O  OE1 . GLN C  1 70  ? -32.245 9.381   20.588  1.00 35.49  ?  70  GLN C OE1 1 
ATOM   2968  N  NE2 . GLN C  1 70  ? -34.372 9.975   21.088  1.00 28.88  ?  70  GLN C NE2 1 
ATOM   2969  N  N   . TRP C  1 71  ? -35.239 7.581   16.087  1.00 27.27  ?  71  TRP C N   1 
ATOM   2970  C  CA  . TRP C  1 71  ? -35.813 8.202   14.938  1.00 28.06  ?  71  TRP C CA  1 
ATOM   2971  C  C   . TRP C  1 71  ? -37.192 8.766   15.177  1.00 29.38  ?  71  TRP C C   1 
ATOM   2972  O  O   . TRP C  1 71  ? -37.921 8.317   16.046  1.00 30.13  ?  71  TRP C O   1 
ATOM   2973  C  CB  . TRP C  1 71  ? -35.829 7.164   13.861  1.00 28.13  ?  71  TRP C CB  1 
ATOM   2974  C  CG  . TRP C  1 71  ? -36.385 7.539   12.574  1.00 28.40  ?  71  TRP C CG  1 
ATOM   2975  C  CD1 . TRP C  1 71  ? -35.831 8.387   11.630  1.00 28.86  ?  71  TRP C CD1 1 
ATOM   2976  C  CD2 . TRP C  1 71  ? -37.595 7.042   12.008  1.00 26.03  ?  71  TRP C CD2 1 
ATOM   2977  N  NE1 . TRP C  1 71  ? -36.645 8.448   10.514  1.00 25.74  ?  71  TRP C NE1 1 
ATOM   2978  C  CE2 . TRP C  1 71  ? -37.737 7.633   10.727  1.00 26.59  ?  71  TRP C CE2 1 
ATOM   2979  C  CE3 . TRP C  1 71  ? -38.573 6.171   12.459  1.00 24.82  ?  71  TRP C CE3 1 
ATOM   2980  C  CZ2 . TRP C  1 71  ? -38.829 7.367   9.902   1.00 23.64  ?  71  TRP C CZ2 1 
ATOM   2981  C  CZ3 . TRP C  1 71  ? -39.656 5.908   11.632  1.00 26.61  ?  71  TRP C CZ3 1 
ATOM   2982  C  CH2 . TRP C  1 71  ? -39.772 6.505   10.374  1.00 24.88  ?  71  TRP C CH2 1 
ATOM   2983  N  N   . ILE C  1 72  ? -37.553 9.808   14.444  1.00 31.11  ?  72  ILE C N   1 
ATOM   2984  C  CA  . ILE C  1 72  ? -38.949 10.196  14.449  1.00 31.66  ?  72  ILE C CA  1 
ATOM   2985  C  C   . ILE C  1 72  ? -39.556 9.999   13.083  1.00 33.23  ?  72  ILE C C   1 
ATOM   2986  O  O   . ILE C  1 72  ? -38.942 10.339  12.066  1.00 33.00  ?  72  ILE C O   1 
ATOM   2987  C  CB  . ILE C  1 72  ? -39.167 11.601  14.916  1.00 31.10  ?  72  ILE C CB  1 
ATOM   2988  C  CG1 . ILE C  1 72  ? -38.326 11.838  16.164  1.00 29.38  ?  72  ILE C CG1 1 
ATOM   2989  C  CG2 . ILE C  1 72  ? -40.680 11.809  15.154  1.00 31.08  ?  72  ILE C CG2 1 
ATOM   2990  C  CD1 . ILE C  1 72  ? -38.740 13.010  16.996  1.00 26.15  ?  72  ILE C CD1 1 
ATOM   2991  N  N   . ALA C  1 73  ? -40.766 9.431   13.095  1.00 35.28  ?  73  ALA C N   1 
ATOM   2992  C  CA  . ALA C  1 73  ? -41.592 9.165   11.905  1.00 36.57  ?  73  ALA C CA  1 
ATOM   2993  C  C   . ALA C  1 73  ? -42.169 10.446  11.319  1.00 38.20  ?  73  ALA C C   1 
ATOM   2994  O  O   . ALA C  1 73  ? -42.263 11.474  12.007  1.00 38.89  ?  73  ALA C O   1 
ATOM   2995  C  CB  . ALA C  1 73  ? -42.715 8.215   12.256  1.00 36.40  ?  73  ALA C CB  1 
ATOM   2996  N  N   . PRO C  1 74  ? -42.539 10.407  10.030  1.00 39.04  ?  74  PRO C N   1 
ATOM   2997  C  CA  . PRO C  1 74  ? -43.172 11.568  9.463   1.00 38.96  ?  74  PRO C CA  1 
ATOM   2998  C  C   . PRO C  1 74  ? -44.436 11.940  10.258  1.00 39.26  ?  74  PRO C C   1 
ATOM   2999  O  O   . PRO C  1 74  ? -44.738 13.139  10.416  1.00 39.21  ?  74  PRO C O   1 
ATOM   3000  C  CB  . PRO C  1 74  ? -43.509 11.114  8.033   1.00 39.21  ?  74  PRO C CB  1 
ATOM   3001  C  CG  . PRO C  1 74  ? -43.384 9.638   8.020   1.00 39.24  ?  74  PRO C CG  1 
ATOM   3002  C  CD  . PRO C  1 74  ? -42.306 9.368   9.010   1.00 39.70  ?  74  PRO C CD  1 
ATOM   3003  N  N   . ASP C  1 75  ? -45.151 10.944  10.785  1.00 39.04  ?  75  ASP C N   1 
ATOM   3004  C  CA  . ASP C  1 75  ? -46.358 11.244  11.581  1.00 38.97  ?  75  ASP C CA  1 
ATOM   3005  C  C   . ASP C  1 75  ? -46.042 11.663  13.023  1.00 38.23  ?  75  ASP C C   1 
ATOM   3006  O  O   . ASP C  1 75  ? -46.953 11.862  13.829  1.00 38.27  ?  75  ASP C O   1 
ATOM   3007  C  CB  . ASP C  1 75  ? -47.359 10.088  11.565  1.00 39.23  ?  75  ASP C CB  1 
ATOM   3008  C  CG  . ASP C  1 75  ? -47.074 9.030   12.627  1.00 40.77  ?  75  ASP C CG  1 
ATOM   3009  O  OD1 . ASP C  1 75  ? -45.963 8.931   13.186  1.00 41.31  ?  75  ASP C OD1 1 
ATOM   3010  O  OD2 . ASP C  1 75  ? -47.995 8.256   12.900  1.00 46.01  -1 75  ASP C OD2 1 
ATOM   3011  N  N   . LYS C  1 76  ? -44.750 11.784  13.331  1.00 37.29  ?  76  LYS C N   1 
ATOM   3012  C  CA  . LYS C  1 76  ? -44.257 12.388  14.592  1.00 36.69  ?  76  LYS C CA  1 
ATOM   3013  C  C   . LYS C  1 76  ? -44.338 11.393  15.779  1.00 35.66  ?  76  LYS C C   1 
ATOM   3014  O  O   . LYS C  1 76  ? -44.257 11.779  16.936  1.00 35.21  ?  76  LYS C O   1 
ATOM   3015  C  CB  . LYS C  1 76  ? -44.903 13.781  14.875  1.00 36.71  ?  76  LYS C CB  1 
ATOM   3016  C  CG  . LYS C  1 76  ? -44.866 14.795  13.680  1.00 38.91  ?  76  LYS C CG  1 
ATOM   3017  C  CD  . LYS C  1 76  ? -43.782 15.935  13.776  1.00 43.94  ?  76  LYS C CD  1 
ATOM   3018  C  CE  . LYS C  1 76  ? -42.332 15.475  13.358  1.00 47.87  ?  76  LYS C CE  1 
ATOM   3019  N  NZ  . LYS C  1 76  ? -41.162 16.388  13.765  1.00 46.03  ?  76  LYS C NZ  1 
ATOM   3020  N  N   . THR C  1 77  ? -44.467 10.101  15.457  1.00 34.51  ?  77  THR C N   1 
ATOM   3021  C  CA  . THR C  1 77  ? -44.228 9.013   16.409  1.00 32.85  ?  77  THR C CA  1 
ATOM   3022  C  C   . THR C  1 77  ? -42.720 8.817   16.613  1.00 31.92  ?  77  THR C C   1 
ATOM   3023  O  O   . THR C  1 77  ? -41.991 8.634   15.652  1.00 31.98  ?  77  THR C O   1 
ATOM   3024  C  CB  . THR C  1 77  ? -44.790 7.662   15.907  1.00 33.07  ?  77  THR C CB  1 
ATOM   3025  O  OG1 . THR C  1 77  ? -46.125 7.815   15.386  1.00 32.12  ?  77  THR C OG1 1 
ATOM   3026  C  CG2 . THR C  1 77  ? -44.769 6.646   17.037  1.00 32.28  ?  77  THR C CG2 1 
ATOM   3027  N  N   . PRO C  1 78  ? -42.245 8.846   17.866  1.00 31.06  ?  78  PRO C N   1 
ATOM   3028  C  CA  . PRO C  1 78  ? -40.805 8.646   18.063  1.00 30.52  ?  78  PRO C CA  1 
ATOM   3029  C  C   . PRO C  1 78  ? -40.507 7.199   18.419  1.00 29.73  ?  78  PRO C C   1 
ATOM   3030  O  O   . PRO C  1 78  ? -41.310 6.568   19.098  1.00 29.11  ?  78  PRO C O   1 
ATOM   3031  C  CB  . PRO C  1 78  ? -40.495 9.541   19.269  1.00 29.94  ?  78  PRO C CB  1 
ATOM   3032  C  CG  . PRO C  1 78  ? -41.787 9.478   20.101  1.00 30.82  ?  78  PRO C CG  1 
ATOM   3033  C  CD  . PRO C  1 78  ? -42.943 9.086   19.147  1.00 30.89  ?  78  PRO C CD  1 
ATOM   3034  N  N   . PHE C  1 79  ? -39.338 6.714   18.005  1.00 29.35  ?  79  PHE C N   1 
ATOM   3035  C  CA  . PHE C  1 79  ? -38.947 5.325   18.193  1.00 28.85  ?  79  PHE C CA  1 
ATOM   3036  C  C   . PHE C  1 79  ? -37.530 5.178   18.631  1.00 28.66  ?  79  PHE C C   1 
ATOM   3037  O  O   . PHE C  1 79  ? -36.682 5.988   18.243  1.00 29.24  ?  79  PHE C O   1 
ATOM   3038  C  CB  . PHE C  1 79  ? -38.970 4.597   16.879  1.00 28.71  ?  79  PHE C CB  1 
ATOM   3039  C  CG  . PHE C  1 79  ? -40.310 4.402   16.318  1.00 28.39  ?  79  PHE C CG  1 
ATOM   3040  C  CD1 . PHE C  1 79  ? -41.013 3.220   16.576  1.00 28.60  ?  79  PHE C CD1 1 
ATOM   3041  C  CD2 . PHE C  1 79  ? -40.860 5.357   15.478  1.00 28.82  ?  79  PHE C CD2 1 
ATOM   3042  C  CE1 . PHE C  1 79  ? -42.250 3.004   16.027  1.00 28.32  ?  79  PHE C CE1 1 
ATOM   3043  C  CE2 . PHE C  1 79  ? -42.125 5.152   14.907  1.00 30.37  ?  79  PHE C CE2 1 
ATOM   3044  C  CZ  . PHE C  1 79  ? -42.821 3.968   15.185  1.00 28.67  ?  79  PHE C CZ  1 
ATOM   3045  N  N   . LEU C  1 80  ? -37.280 4.136   19.430  1.00 27.73  ?  80  LEU C N   1 
ATOM   3046  C  CA  . LEU C  1 80  ? -35.969 3.488   19.533  1.00 26.24  ?  80  LEU C CA  1 
ATOM   3047  C  C   . LEU C  1 80  ? -36.157 2.122   18.851  1.00 25.42  ?  80  LEU C C   1 
ATOM   3048  O  O   . LEU C  1 80  ? -37.091 1.319   19.202  1.00 25.53  ?  80  LEU C O   1 
ATOM   3049  C  CB  . LEU C  1 80  ? -35.553 3.312   20.979  1.00 25.87  ?  80  LEU C CB  1 
ATOM   3050  C  CG  . LEU C  1 80  ? -34.962 4.412   21.871  1.00 27.27  ?  80  LEU C CG  1 
ATOM   3051  C  CD1 . LEU C  1 80  ? -35.388 5.815   21.522  1.00 24.79  ?  80  LEU C CD1 1 
ATOM   3052  C  CD2 . LEU C  1 80  ? -35.236 4.135   23.382  1.00 25.30  ?  80  LEU C CD2 1 
ATOM   3053  N  N   . ARG C  1 81  ? -35.335 1.882   17.837  1.00 23.31  ?  81  ARG C N   1 
ATOM   3054  C  CA  . ARG C  1 81  ? -35.488 0.701   16.982  1.00 21.56  ?  81  ARG C CA  1 
ATOM   3055  C  C   . ARG C  1 81  ? -34.201 -0.061  17.030  1.00 20.45  ?  81  ARG C C   1 
ATOM   3056  O  O   . ARG C  1 81  ? -33.244 0.315   16.355  1.00 19.28  ?  81  ARG C O   1 
ATOM   3057  C  CB  . ARG C  1 81  ? -35.770 1.103   15.536  1.00 21.19  ?  81  ARG C CB  1 
ATOM   3058  C  CG  . ARG C  1 81  ? -35.866 -0.079  14.519  1.00 21.47  ?  81  ARG C CG  1 
ATOM   3059  C  CD  . ARG C  1 81  ? -36.459 0.456   13.210  1.00 18.81  ?  81  ARG C CD  1 
ATOM   3060  N  NE  . ARG C  1 81  ? -36.664 -0.487  12.111  1.00 18.18  ?  81  ARG C NE  1 
ATOM   3061  C  CZ  . ARG C  1 81  ? -35.708 -0.998  11.343  1.00 16.06  ?  81  ARG C CZ  1 
ATOM   3062  N  NH1 . ARG C  1 81  ? -34.439 -0.753  11.603  1.00 17.89  ?  81  ARG C NH1 1 
ATOM   3063  N  NH2 . ARG C  1 81  ? -36.011 -1.782  10.331  1.00 14.96  ?  81  ARG C NH2 1 
ATOM   3064  N  N   . PHE C  1 82  ? -34.167 -1.114  17.844  1.00 19.85  ?  82  PHE C N   1 
ATOM   3065  C  CA  . PHE C  1 82  ? -32.944 -1.900  17.972  1.00 19.66  ?  82  PHE C CA  1 
ATOM   3066  C  C   . PHE C  1 82  ? -32.929 -2.831  16.789  1.00 19.42  ?  82  PHE C C   1 
ATOM   3067  O  O   . PHE C  1 82  ? -33.987 -3.337  16.405  1.00 20.13  ?  82  PHE C O   1 
ATOM   3068  C  CB  . PHE C  1 82  ? -32.931 -2.691  19.261  1.00 19.82  ?  82  PHE C CB  1 
ATOM   3069  C  CG  . PHE C  1 82  ? -33.012 -1.845  20.490  1.00 19.34  ?  82  PHE C CG  1 
ATOM   3070  C  CD1 . PHE C  1 82  ? -34.157 -1.133  20.783  1.00 16.36  ?  82  PHE C CD1 1 
ATOM   3071  C  CD2 . PHE C  1 82  ? -31.937 -1.803  21.386  1.00 20.17  ?  82  PHE C CD2 1 
ATOM   3072  C  CE1 . PHE C  1 82  ? -34.229 -0.349  21.915  1.00 14.86  ?  82  PHE C CE1 1 
ATOM   3073  C  CE2 . PHE C  1 82  ? -32.013 -1.051  22.534  1.00 18.69  ?  82  PHE C CE2 1 
ATOM   3074  C  CZ  . PHE C  1 82  ? -33.181 -0.307  22.783  1.00 18.60  ?  82  PHE C CZ  1 
ATOM   3075  N  N   . LEU C  1 83  ? -31.751 -3.008  16.202  1.00 17.97  ?  83  LEU C N   1 
ATOM   3076  C  CA  . LEU C  1 83  ? -31.561 -3.821  15.030  1.00 16.92  ?  83  LEU C CA  1 
ATOM   3077  C  C   . LEU C  1 83  ? -30.621 -4.968  15.324  1.00 16.53  ?  83  LEU C C   1 
ATOM   3078  O  O   . LEU C  1 83  ? -29.483 -4.719  15.763  1.00 14.59  ?  83  LEU C O   1 
ATOM   3079  C  CB  . LEU C  1 83  ? -30.916 -2.983  13.894  1.00 17.39  ?  83  LEU C CB  1 
ATOM   3080  C  CG  . LEU C  1 83  ? -30.940 -3.606  12.473  1.00 15.92  ?  83  LEU C CG  1 
ATOM   3081  C  CD1 . LEU C  1 83  ? -32.341 -3.595  11.833  1.00 14.81  ?  83  LEU C CD1 1 
ATOM   3082  C  CD2 . LEU C  1 83  ? -30.045 -2.846  11.651  1.00 15.71  ?  83  LEU C CD2 1 
ATOM   3083  N  N   . PHE C  1 84  ? -31.086 -6.196  15.034  1.00 16.07  ?  84  PHE C N   1 
ATOM   3084  C  CA  . PHE C  1 84  ? -30.267 -7.409  15.175  1.00 16.67  ?  84  PHE C CA  1 
ATOM   3085  C  C   . PHE C  1 84  ? -30.018 -8.137  13.841  1.00 17.20  ?  84  PHE C C   1 
ATOM   3086  O  O   . PHE C  1 84  ? -30.780 -7.964  12.869  1.00 17.93  ?  84  PHE C O   1 
ATOM   3087  C  CB  . PHE C  1 84  ? -30.873 -8.392  16.157  1.00 17.04  ?  84  PHE C CB  1 
ATOM   3088  C  CG  . PHE C  1 84  ? -31.426 -7.763  17.387  1.00 17.45  ?  84  PHE C CG  1 
ATOM   3089  C  CD1 . PHE C  1 84  ? -32.752 -7.299  17.413  1.00 18.79  ?  84  PHE C CD1 1 
ATOM   3090  C  CD2 . PHE C  1 84  ? -30.644 -7.632  18.516  1.00 15.55  ?  84  PHE C CD2 1 
ATOM   3091  C  CE1 . PHE C  1 84  ? -33.286 -6.691  18.570  1.00 17.82  ?  84  PHE C CE1 1 
ATOM   3092  C  CE2 . PHE C  1 84  ? -31.141 -7.034  19.652  1.00 14.05  ?  84  PHE C CE2 1 
ATOM   3093  C  CZ  . PHE C  1 84  ? -32.475 -6.564  19.688  1.00 16.38  ?  84  PHE C CZ  1 
ATOM   3094  N  N   . ALA C  1 85  ? -28.945 -8.939  13.800  1.00 17.30  ?  85  ALA C N   1 
ATOM   3095  C  CA  . ALA C  1 85  ? -28.575 -9.728  12.614  1.00 17.72  ?  85  ALA C CA  1 
ATOM   3096  C  C   . ALA C  1 85  ? -28.868 -11.211 12.837  1.00 19.13  ?  85  ALA C C   1 
ATOM   3097  O  O   . ALA C  1 85  ? -28.690 -11.745 13.947  1.00 19.21  ?  85  ALA C O   1 
ATOM   3098  C  CB  . ALA C  1 85  ? -27.141 -9.542  12.332  1.00 15.88  ?  85  ALA C CB  1 
ATOM   3099  N  N   . ILE C  1 86  ? -29.290 -11.895 11.784  1.00 21.23  ?  86  ILE C N   1 
ATOM   3100  C  CA  . ILE C  1 86  ? -29.451 -13.352 11.845  1.00 22.86  ?  86  ILE C CA  1 
ATOM   3101  C  C   . ILE C  1 86  ? -29.040 -13.927 10.534  1.00 24.14  ?  86  ILE C C   1 
ATOM   3102  O  O   . ILE C  1 86  ? -29.662 -13.619 9.528   1.00 25.22  ?  86  ILE C O   1 
ATOM   3103  C  CB  . ILE C  1 86  ? -30.910 -13.760 12.090  1.00 22.55  ?  86  ILE C CB  1 
ATOM   3104  C  CG1 . ILE C  1 86  ? -31.302 -13.571 13.530  1.00 21.71  ?  86  ILE C CG1 1 
ATOM   3105  C  CG2 . ILE C  1 86  ? -31.119 -15.233 11.822  1.00 24.69  ?  86  ILE C CG2 1 
ATOM   3106  C  CD1 . ILE C  1 86  ? -32.787 -13.507 13.691  1.00 17.34  ?  86  ILE C CD1 1 
ATOM   3107  N  N   . GLU C  1 87  ? -28.020 -14.769 10.544  1.00 26.59  ?  87  GLU C N   1 
ATOM   3108  C  CA  . GLU C  1 87  ? -27.644 -15.583 9.389   1.00 29.90  ?  87  GLU C CA  1 
ATOM   3109  C  C   . GLU C  1 87  ? -28.326 -16.947 9.421   1.00 31.38  ?  87  GLU C C   1 
ATOM   3110  O  O   . GLU C  1 87  ? -28.051 -17.751 10.309  1.00 32.11  ?  87  GLU C O   1 
ATOM   3111  C  CB  . GLU C  1 87  ? -26.138 -15.885 9.398   1.00 30.69  ?  87  GLU C CB  1 
ATOM   3112  C  CG  . GLU C  1 87  ? -25.189 -14.701 9.457   1.00 33.76  ?  87  GLU C CG  1 
ATOM   3113  C  CD  . GLU C  1 87  ? -25.386 -13.695 8.326   1.00 38.33  ?  87  GLU C CD  1 
ATOM   3114  O  OE1 . GLU C  1 87  ? -25.118 -12.496 8.621   1.00 39.58  ?  87  GLU C OE1 1 
ATOM   3115  O  OE2 . GLU C  1 87  ? -25.814 -14.095 7.188   1.00 39.48  -1 87  GLU C OE2 1 
ATOM   3116  N  N   . LEU C  1 88  ? -29.168 -17.243 8.441   1.00 32.90  ?  88  LEU C N   1 
ATOM   3117  C  CA  . LEU C  1 88  ? -29.649 -18.616 8.300   1.00 33.91  ?  88  LEU C CA  1 
ATOM   3118  C  C   . LEU C  1 88  ? -28.819 -19.464 7.297   1.00 35.30  ?  88  LEU C C   1 
ATOM   3119  O  O   . LEU C  1 88  ? -28.160 -18.906 6.395   1.00 33.88  ?  88  LEU C O   1 
ATOM   3120  C  CB  . LEU C  1 88  ? -31.112 -18.605 7.899   1.00 33.16  ?  88  LEU C CB  1 
ATOM   3121  C  CG  . LEU C  1 88  ? -31.995 -17.757 8.791   1.00 32.87  ?  88  LEU C CG  1 
ATOM   3122  C  CD1 . LEU C  1 88  ? -33.198 -17.355 8.026   1.00 30.64  ?  88  LEU C CD1 1 
ATOM   3123  C  CD2 . LEU C  1 88  ? -32.400 -18.514 10.047  1.00 32.91  ?  88  LEU C CD2 1 
ATOM   3124  N  N   . GLU C  1 89  ? -28.884 -20.799 7.487   1.00 37.35  ?  89  GLU C N   1 
ATOM   3125  C  CA  . GLU C  1 89  ? -28.247 -21.843 6.644   1.00 39.69  ?  89  GLU C CA  1 
ATOM   3126  C  C   . GLU C  1 89  ? -28.668 -21.812 5.178   1.00 39.99  ?  89  GLU C C   1 
ATOM   3127  O  O   . GLU C  1 89  ? -27.825 -21.842 4.261   1.00 40.02  ?  89  GLU C O   1 
ATOM   3128  C  CB  . GLU C  1 89  ? -28.624 -23.234 7.166   1.00 40.74  ?  89  GLU C CB  1 
ATOM   3129  C  CG  . GLU C  1 89  ? -27.508 -24.033 7.845   1.00 46.16  ?  89  GLU C CG  1 
ATOM   3130  C  CD  . GLU C  1 89  ? -27.555 -23.931 9.370   1.00 51.96  ?  89  GLU C CD  1 
ATOM   3131  O  OE1 . GLU C  1 89  ? -27.482 -25.012 10.024  1.00 52.82  ?  89  GLU C OE1 1 
ATOM   3132  O  OE2 . GLU C  1 89  ? -27.677 -22.778 9.892   1.00 52.98  -1 89  GLU C OE2 1 
ATOM   3133  N  N   . GLN C  1 90  ? -29.986 -21.805 4.974   1.00 40.29  ?  90  GLN C N   1 
ATOM   3134  C  CA  . GLN C  1 90  ? -30.555 -21.579 3.680   1.00 40.53  ?  90  GLN C CA  1 
ATOM   3135  C  C   . GLN C  1 90  ? -31.835 -20.836 3.756   1.00 40.55  ?  90  GLN C C   1 
ATOM   3136  O  O   . GLN C  1 90  ? -32.364 -20.619 4.817   1.00 40.02  ?  90  GLN C O   1 
ATOM   3137  C  CB  . GLN C  1 90  ? -30.793 -22.875 2.965   1.00 41.00  ?  90  GLN C CB  1 
ATOM   3138  C  CG  . GLN C  1 90  ? -31.210 -24.036 3.814   1.00 42.68  ?  90  GLN C CG  1 
ATOM   3139  C  CD  . GLN C  1 90  ? -30.872 -25.339 3.085   1.00 46.06  ?  90  GLN C CD  1 
ATOM   3140  O  OE1 . GLN C  1 90  ? -31.757 -25.996 2.513   1.00 46.95  ?  90  GLN C OE1 1 
ATOM   3141  N  NE2 . GLN C  1 90  ? -29.576 -25.685 3.050   1.00 44.55  ?  90  GLN C NE2 1 
ATOM   3142  N  N   . ILE C  1 91  ? -32.339 -20.475 2.592   1.00 41.78  ?  91  ILE C N   1 
ATOM   3143  C  CA  . ILE C  1 91  ? -33.584 -19.760 2.488   1.00 43.28  ?  91  ILE C CA  1 
ATOM   3144  C  C   . ILE C  1 91  ? -34.809 -20.643 2.790   1.00 44.58  ?  91  ILE C C   1 
ATOM   3145  O  O   . ILE C  1 91  ? -35.128 -21.578 2.068   1.00 44.07  ?  91  ILE C O   1 
ATOM   3146  C  CB  . ILE C  1 91  ? -33.680 -19.028 1.131   1.00 43.11  ?  91  ILE C CB  1 
ATOM   3147  C  CG1 . ILE C  1 91  ? -32.723 -17.839 1.144   1.00 42.64  ?  91  ILE C CG1 1 
ATOM   3148  C  CG2 . ILE C  1 91  ? -35.104 -18.563 0.867   1.00 42.69  ?  91  ILE C CG2 1 
ATOM   3149  C  CD1 . ILE C  1 91  ? -32.262 -17.370 -0.215  1.00 43.78  ?  91  ILE C CD1 1 
ATOM   3150  N  N   . CYS C  1 92  ? -35.465 -20.316 3.898   1.00 47.08  ?  92  CYS C N   1 
ATOM   3151  C  CA  . CYS C  1 92  ? -36.693 -20.969 4.350   1.00 49.54  ?  92  CYS C CA  1 
ATOM   3152  C  C   . CYS C  1 92  ? -37.954 -20.481 3.614   1.00 50.67  ?  92  CYS C C   1 
ATOM   3153  O  O   . CYS C  1 92  ? -38.107 -19.270 3.367   1.00 50.79  ?  92  CYS C O   1 
ATOM   3154  C  CB  . CYS C  1 92  ? -36.865 -20.715 5.846   1.00 49.31  ?  92  CYS C CB  1 
ATOM   3155  S  SG  . CYS C  1 92  ? -35.367 -20.997 6.799   1.00 52.95  ?  92  CYS C SG  1 
ATOM   3156  N  N   . PRO C  1 93  ? -38.857 -21.419 3.246   1.00 52.04  ?  93  PRO C N   1 
ATOM   3157  C  CA  . PRO C  1 93  ? -40.233 -21.012 2.911   1.00 52.91  ?  93  PRO C CA  1 
ATOM   3158  C  C   . PRO C  1 93  ? -40.821 -20.229 4.078   1.00 53.80  ?  93  PRO C C   1 
ATOM   3159  O  O   . PRO C  1 93  ? -40.580 -20.564 5.250   1.00 54.00  ?  93  PRO C O   1 
ATOM   3160  C  CB  . PRO C  1 93  ? -40.981 -22.333 2.748   1.00 52.71  ?  93  PRO C CB  1 
ATOM   3161  C  CG  . PRO C  1 93  ? -39.920 -23.354 2.393   1.00 53.01  ?  93  PRO C CG  1 
ATOM   3162  C  CD  . PRO C  1 93  ? -38.565 -22.812 2.846   1.00 52.52  ?  93  PRO C CD  1 
ATOM   3163  N  N   . THR C  1 94  ? -41.550 -19.172 3.753   1.00 54.54  ?  94  THR C N   1 
ATOM   3164  C  CA  . THR C  1 94  ? -42.052 -18.257 4.763   1.00 55.37  ?  94  THR C CA  1 
ATOM   3165  C  C   . THR C  1 94  ? -43.578 -18.314 4.827   1.00 55.76  ?  94  THR C C   1 
ATOM   3166  O  O   . THR C  1 94  ? -44.235 -18.756 3.888   1.00 55.51  ?  94  THR C O   1 
ATOM   3167  C  CB  . THR C  1 94  ? -41.548 -16.791 4.528   1.00 55.71  ?  94  THR C CB  1 
ATOM   3168  O  OG1 . THR C  1 94  ? -42.551 -16.013 3.852   1.00 54.71  ?  94  THR C OG1 1 
ATOM   3169  C  CG2 . THR C  1 94  ? -40.211 -16.778 3.739   1.00 55.77  ?  94  THR C CG2 1 
ATOM   3170  N  N   . GLN C  1 95  ? -44.129 -17.840 5.938   1.00 56.36  ?  95  GLN C N   1 
ATOM   3171  C  CA  . GLN C  1 95  ? -45.511 -18.086 6.276   1.00 57.11  ?  95  GLN C CA  1 
ATOM   3172  C  C   . GLN C  1 95  ? -45.898 -17.115 7.393   1.00 57.14  ?  95  GLN C C   1 
ATOM   3173  O  O   . GLN C  1 95  ? -45.701 -17.408 8.583   1.00 57.31  ?  95  GLN C O   1 
ATOM   3174  C  CB  . GLN C  1 95  ? -45.647 -19.547 6.741   1.00 57.46  ?  95  GLN C CB  1 
ATOM   3175  C  CG  . GLN C  1 95  ? -47.059 -20.143 6.694   1.00 59.70  ?  95  GLN C CG  1 
ATOM   3176  C  CD  . GLN C  1 95  ? -47.222 -21.320 7.663   1.00 62.20  ?  95  GLN C CD  1 
ATOM   3177  O  OE1 . GLN C  1 95  ? -48.003 -21.242 8.624   1.00 64.06  ?  95  GLN C OE1 1 
ATOM   3178  N  NE2 . GLN C  1 95  ? -46.469 -22.401 7.430   1.00 61.14  ?  95  GLN C NE2 1 
ATOM   3179  N  N   . PRO C  1 96  ? -46.427 -15.938 7.029   1.00 57.03  ?  96  PRO C N   1 
ATOM   3180  C  CA  . PRO C  1 96  ? -46.816 -14.997 8.090   1.00 57.17  ?  96  PRO C CA  1 
ATOM   3181  C  C   . PRO C  1 96  ? -47.899 -15.566 9.022   1.00 57.54  ?  96  PRO C C   1 
ATOM   3182  O  O   . PRO C  1 96  ? -48.633 -16.469 8.618   1.00 57.69  ?  96  PRO C O   1 
ATOM   3183  C  CB  . PRO C  1 96  ? -47.341 -13.789 7.318   1.00 56.88  ?  96  PRO C CB  1 
ATOM   3184  C  CG  . PRO C  1 96  ? -46.718 -13.907 5.976   1.00 56.89  ?  96  PRO C CG  1 
ATOM   3185  C  CD  . PRO C  1 96  ? -46.550 -15.356 5.683   1.00 56.88  ?  96  PRO C CD  1 
ATOM   3186  N  N   . HIS C  1 97  ? -47.956 -15.063 10.260  1.00 58.02  ?  97  HIS C N   1 
ATOM   3187  C  CA  . HIS C  1 97  ? -49.012 -15.393 11.246  1.00 58.26  ?  97  HIS C CA  1 
ATOM   3188  C  C   . HIS C  1 97  ? -49.660 -14.096 11.785  1.00 58.65  ?  97  HIS C C   1 
ATOM   3189  O  O   . HIS C  1 97  ? -50.070 -14.032 12.952  1.00 58.71  ?  97  HIS C O   1 
ATOM   3190  C  CB  . HIS C  1 97  ? -48.454 -16.223 12.421  1.00 57.81  ?  97  HIS C CB  1 
ATOM   3191  C  CG  . HIS C  1 97  ? -47.959 -17.584 12.033  1.00 58.64  ?  97  HIS C CG  1 
ATOM   3192  N  ND1 . HIS C  1 97  ? -48.783 -18.688 11.962  1.00 60.41  ?  97  HIS C ND1 1 
ATOM   3193  C  CD2 . HIS C  1 97  ? -46.721 -18.022 11.701  1.00 59.26  ?  97  HIS C CD2 1 
ATOM   3194  C  CE1 . HIS C  1 97  ? -48.076 -19.743 11.594  1.00 59.67  ?  97  HIS C CE1 1 
ATOM   3195  N  NE2 . HIS C  1 97  ? -46.822 -19.367 11.429  1.00 58.05  ?  97  HIS C NE2 1 
ATOM   3196  N  N   . ASP C  1 98  ? -49.730 -13.067 10.939  1.00 58.81  ?  98  ASP C N   1 
ATOM   3197  C  CA  . ASP C  1 98  ? -50.329 -11.778 11.302  1.00 59.27  ?  98  ASP C CA  1 
ATOM   3198  C  C   . ASP C  1 98  ? -51.123 -11.286 10.096  1.00 59.50  ?  98  ASP C C   1 
ATOM   3199  O  O   . ASP C  1 98  ? -50.571 -11.121 8.998   1.00 59.56  ?  98  ASP C O   1 
ATOM   3200  C  CB  . ASP C  1 98  ? -49.231 -10.763 11.695  1.00 59.30  ?  98  ASP C CB  1 
ATOM   3201  C  CG  . ASP C  1 98  ? -49.766 -9.533  12.458  1.00 60.35  ?  98  ASP C CG  1 
ATOM   3202  O  OD1 . ASP C  1 98  ? -50.735 -8.902  11.991  1.00 62.38  ?  98  ASP C OD1 1 
ATOM   3203  O  OD2 . ASP C  1 98  ? -49.195 -9.170  13.521  1.00 61.02  -1 98  ASP C OD2 1 
ATOM   3204  N  N   . SER C  1 99  ? -52.421 -11.067 10.293  1.00 59.61  ?  99  SER C N   1 
ATOM   3205  C  CA  . SER C  1 99  ? -53.279 -10.509 9.238   1.00 59.61  ?  99  SER C CA  1 
ATOM   3206  C  C   . SER C  1 99  ? -52.700 -9.250  8.556   1.00 59.29  ?  99  SER C C   1 
ATOM   3207  O  O   . SER C  1 99  ? -52.991 -8.999  7.386   1.00 59.48  ?  99  SER C O   1 
ATOM   3208  C  CB  . SER C  1 99  ? -54.694 -10.233 9.770   1.00 59.88  ?  99  SER C CB  1 
ATOM   3209  O  OG  . SER C  1 99  ? -55.362 -11.442 10.110  1.00 60.21  ?  99  SER C OG  1 
ATOM   3210  N  N   . ASP C  1 100 ? -51.862 -8.493  9.268   1.00 58.51  ?  100 ASP C N   1 
ATOM   3211  C  CA  . ASP C  1 100 ? -51.231 -7.260  8.729   1.00 57.86  ?  100 ASP C CA  1 
ATOM   3212  C  C   . ASP C  1 100 ? -50.133 -7.416  7.644   1.00 57.04  ?  100 ASP C C   1 
ATOM   3213  O  O   . ASP C  1 100 ? -49.721 -6.416  7.028   1.00 57.23  ?  100 ASP C O   1 
ATOM   3214  C  CB  . ASP C  1 100 ? -50.676 -6.413  9.875   1.00 57.78  ?  100 ASP C CB  1 
ATOM   3215  C  CG  . ASP C  1 100 ? -51.761 -5.910  10.792  1.00 58.91  ?  100 ASP C CG  1 
ATOM   3216  O  OD1 . ASP C  1 100 ? -51.427 -5.278  11.824  1.00 59.46  ?  100 ASP C OD1 1 
ATOM   3217  O  OD2 . ASP C  1 100 ? -52.949 -6.148  10.470  1.00 60.27  -1 100 ASP C OD2 1 
ATOM   3218  N  N   . ILE C  1 101 ? -49.679 -8.649  7.415   1.00 55.36  ?  101 ILE C N   1 
ATOM   3219  C  CA  . ILE C  1 101 ? -48.546 -8.926  6.533   1.00 53.85  ?  101 ILE C CA  1 
ATOM   3220  C  C   . ILE C  1 101 ? -49.025 -9.640  5.268   1.00 53.73  ?  101 ILE C C   1 
ATOM   3221  O  O   . ILE C  1 101 ? -49.760 -10.628 5.320   1.00 53.36  ?  101 ILE C O   1 
ATOM   3222  C  CB  . ILE C  1 101 ? -47.451 -9.777  7.278   1.00 53.79  ?  101 ILE C CB  1 
ATOM   3223  C  CG1 . ILE C  1 101 ? -46.958 -9.060  8.538   1.00 52.17  ?  101 ILE C CG1 1 
ATOM   3224  C  CG2 . ILE C  1 101 ? -46.286 -10.197 6.357   1.00 52.38  ?  101 ILE C CG2 1 
ATOM   3225  C  CD1 . ILE C  1 101 ? -46.530 -7.627  8.340   1.00 50.16  ?  101 ILE C CD1 1 
ATOM   3226  N  N   . ASP C  1 102 ? -48.588 -9.140  4.126   1.00 53.25  ?  102 ASP C N   1 
ATOM   3227  C  CA  . ASP C  1 102 ? -49.100 -9.615  2.858   1.00 53.03  ?  102 ASP C CA  1 
ATOM   3228  C  C   . ASP C  1 102 ? -48.345 -10.848 2.335   1.00 52.38  ?  102 ASP C C   1 
ATOM   3229  O  O   . ASP C  1 102 ? -48.971 -11.807 1.850   1.00 52.67  ?  102 ASP C O   1 
ATOM   3230  C  CB  . ASP C  1 102 ? -49.145 -8.446  1.876   1.00 53.43  ?  102 ASP C CB  1 
ATOM   3231  C  CG  . ASP C  1 102 ? -49.883 -7.206  2.469   1.00 55.38  ?  102 ASP C CG  1 
ATOM   3232  O  OD1 . ASP C  1 102 ? -50.477 -7.289  3.589   1.00 55.82  ?  102 ASP C OD1 1 
ATOM   3233  O  OD2 . ASP C  1 102 ? -49.851 -6.132  1.820   1.00 57.29  -1 102 ASP C OD2 1 
ATOM   3234  N  N   . CYS C  1 103 ? -47.016 -10.822 2.456   1.00 51.13  ?  103 CYS C N   1 
ATOM   3235  C  CA  . CYS C  1 103 ? -46.145 -11.963 2.172   1.00 49.99  ?  103 CYS C CA  1 
ATOM   3236  C  C   . CYS C  1 103 ? -44.732 -11.565 2.561   1.00 48.84  ?  103 CYS C C   1 
ATOM   3237  O  O   . CYS C  1 103 ? -44.521 -10.498 3.132   1.00 48.38  ?  103 CYS C O   1 
ATOM   3238  C  CB  . CYS C  1 103 ? -46.194 -12.351 0.687   1.00 50.59  ?  103 CYS C CB  1 
ATOM   3239  S  SG  . CYS C  1 103 ? -45.704 -11.020 -0.508  1.00 53.18  ?  103 CYS C SG  1 
ATOM   3240  N  N   . CYS C  1 104 ? -43.763 -12.426 2.263   1.00 47.47  ?  104 CYS C N   1 
ATOM   3241  C  CA  . CYS C  1 104 ? -42.355 -12.074 2.420   1.00 46.47  ?  104 CYS C CA  1 
ATOM   3242  C  C   . CYS C  1 104 ? -41.674 -12.409 1.126   1.00 45.21  ?  104 CYS C C   1 
ATOM   3243  O  O   . CYS C  1 104 ? -42.237 -13.126 0.311   1.00 45.09  ?  104 CYS C O   1 
ATOM   3244  C  CB  . CYS C  1 104 ? -41.707 -12.868 3.539   1.00 46.19  ?  104 CYS C CB  1 
ATOM   3245  S  SG  . CYS C  1 104 ? -42.825 -13.142 4.893   1.00 48.98  ?  104 CYS C SG  1 
ATOM   3246  N  N   . ARG C  1 105 ? -40.480 -11.861 0.927   1.00 43.93  ?  105 ARG C N   1 
ATOM   3247  C  CA  . ARG C  1 105 ? -39.663 -12.182 -0.224  1.00 42.71  ?  105 ARG C CA  1 
ATOM   3248  C  C   . ARG C  1 105 ? -38.229 -12.181 0.245   1.00 41.41  ?  105 ARG C C   1 
ATOM   3249  O  O   . ARG C  1 105 ? -37.867 -11.462 1.178   1.00 41.00  ?  105 ARG C O   1 
ATOM   3250  C  CB  . ARG C  1 105 ? -39.844 -11.182 -1.382  1.00 43.14  ?  105 ARG C CB  1 
ATOM   3251  C  CG  . ARG C  1 105 ? -41.103 -10.266 -1.334  1.00 45.53  ?  105 ARG C CG  1 
ATOM   3252  C  CD  . ARG C  1 105 ? -41.418 -9.569  -2.676  1.00 49.94  ?  105 ARG C CD  1 
ATOM   3253  N  NE  . ARG C  1 105 ? -41.874 -10.546 -3.669  1.00 54.63  ?  105 ARG C NE  1 
ATOM   3254  C  CZ  . ARG C  1 105 ? -43.154 -10.848 -3.900  1.00 56.95  ?  105 ARG C CZ  1 
ATOM   3255  N  NH1 . ARG C  1 105 ? -44.134 -10.232 -3.225  1.00 56.97  ?  105 ARG C NH1 1 
ATOM   3256  N  NH2 . ARG C  1 105 ? -43.453 -11.776 -4.808  1.00 57.69  ?  105 ARG C NH2 1 
ATOM   3257  N  N   . TRP C  1 106 ? -37.425 -13.022 -0.386  1.00 39.69  ?  106 TRP C N   1 
ATOM   3258  C  CA  . TRP C  1 106 ? -36.001 -13.002 -0.188  1.00 38.11  ?  106 TRP C CA  1 
ATOM   3259  C  C   . TRP C  1 106 ? -35.457 -12.271 -1.361  1.00 37.50  ?  106 TRP C C   1 
ATOM   3260  O  O   . TRP C  1 106 ? -35.854 -12.518 -2.506  1.00 37.92  ?  106 TRP C O   1 
ATOM   3261  C  CB  . TRP C  1 106 ? -35.422 -14.419 -0.118  1.00 38.53  ?  106 TRP C CB  1 
ATOM   3262  C  CG  . TRP C  1 106 ? -35.778 -15.120 1.134   1.00 37.35  ?  106 TRP C CG  1 
ATOM   3263  C  CD1 . TRP C  1 106 ? -36.927 -15.815 1.388   1.00 37.64  ?  106 TRP C CD1 1 
ATOM   3264  C  CD2 . TRP C  1 106 ? -35.008 -15.157 2.331   1.00 36.21  ?  106 TRP C CD2 1 
ATOM   3265  N  NE1 . TRP C  1 106 ? -36.914 -16.306 2.678   1.00 38.89  ?  106 TRP C NE1 1 
ATOM   3266  C  CE2 . TRP C  1 106 ? -35.746 -15.918 3.282   1.00 36.93  ?  106 TRP C CE2 1 
ATOM   3267  C  CE3 . TRP C  1 106 ? -33.765 -14.633 2.696   1.00 34.37  ?  106 TRP C CE3 1 
ATOM   3268  C  CZ2 . TRP C  1 106 ? -35.279 -16.168 4.573   1.00 33.96  ?  106 TRP C CZ2 1 
ATOM   3269  C  CZ3 . TRP C  1 106 ? -33.292 -14.887 3.989   1.00 34.45  ?  106 TRP C CZ3 1 
ATOM   3270  C  CH2 . TRP C  1 106 ? -34.056 -15.644 4.911   1.00 34.04  ?  106 TRP C CH2 1 
ATOM   3271  N  N   . VAL C  1 107 ? -34.515 -11.389 -1.078  1.00 36.71  ?  107 VAL C N   1 
ATOM   3272  C  CA  . VAL C  1 107 ? -34.271 -10.221 -1.923  1.00 35.26  ?  107 VAL C CA  1 
ATOM   3273  C  C   . VAL C  1 107 ? -32.807 -9.803  -1.794  1.00 34.43  ?  107 VAL C C   1 
ATOM   3274  O  O   . VAL C  1 107 ? -32.249 -9.886  -0.708  1.00 34.32  ?  107 VAL C O   1 
ATOM   3275  C  CB  . VAL C  1 107 ? -35.268 -9.118  -1.499  1.00 34.42  ?  107 VAL C CB  1 
ATOM   3276  C  CG1 . VAL C  1 107 ? -34.640 -7.810  -1.473  1.00 35.45  ?  107 VAL C CG1 1 
ATOM   3277  C  CG2 . VAL C  1 107 ? -36.469 -9.107  -2.417  1.00 33.42  ?  107 VAL C CG2 1 
ATOM   3278  N  N   . SER C  1 108 ? -32.168 -9.414  -2.893  1.00 33.80  ?  108 SER C N   1 
ATOM   3279  C  CA  . SER C  1 108 ? -30.752 -8.980  -2.849  1.00 33.61  ?  108 SER C CA  1 
ATOM   3280  C  C   . SER C  1 108 ? -30.608 -7.682  -2.057  1.00 33.50  ?  108 SER C C   1 
ATOM   3281  O  O   . SER C  1 108 ? -31.553 -6.903  -1.958  1.00 32.87  ?  108 SER C O   1 
ATOM   3282  C  CB  . SER C  1 108 ? -30.209 -8.724  -4.262  1.00 33.29  ?  108 SER C CB  1 
ATOM   3283  O  OG  . SER C  1 108 ? -30.640 -7.464  -4.746  1.00 31.98  ?  108 SER C OG  1 
ATOM   3284  N  N   . ALA C  1 109 ? -29.417 -7.439  -1.529  1.00 33.79  ?  109 ALA C N   1 
ATOM   3285  C  CA  . ALA C  1 109 ? -29.108 -6.155  -0.872  1.00 34.26  ?  109 ALA C CA  1 
ATOM   3286  C  C   . ALA C  1 109 ? -29.617 -4.987  -1.694  1.00 34.49  ?  109 ALA C C   1 
ATOM   3287  O  O   . ALA C  1 109 ? -30.475 -4.216  -1.267  1.00 34.50  ?  109 ALA C O   1 
ATOM   3288  C  CB  . ALA C  1 109 ? -27.605 -6.011  -0.673  1.00 34.10  ?  109 ALA C CB  1 
ATOM   3289  N  N   . GLU C  1 110 ? -29.098 -4.920  -2.907  1.00 34.88  ?  110 GLU C N   1 
ATOM   3290  C  CA  . GLU C  1 110 ? -29.343 -3.838  -3.818  1.00 36.11  ?  110 GLU C CA  1 
ATOM   3291  C  C   . GLU C  1 110 ? -30.833 -3.600  -4.214  1.00 34.89  ?  110 GLU C C   1 
ATOM   3292  O  O   . GLU C  1 110 ? -31.265 -2.439  -4.297  1.00 33.89  ?  110 GLU C O   1 
ATOM   3293  C  CB  . GLU C  1 110 ? -28.349 -3.906  -4.999  1.00 36.72  ?  110 GLU C CB  1 
ATOM   3294  C  CG  . GLU C  1 110 ? -27.900 -5.359  -5.482  1.00 43.90  ?  110 GLU C CG  1 
ATOM   3295  C  CD  . GLU C  1 110 ? -27.041 -6.233  -4.463  1.00 50.76  ?  110 GLU C CD  1 
ATOM   3296  O  OE1 . GLU C  1 110 ? -26.501 -5.704  -3.461  1.00 52.39  ?  110 GLU C OE1 1 
ATOM   3297  O  OE2 . GLU C  1 110 ? -26.905 -7.479  -4.676  1.00 54.71  -1 110 GLU C OE2 1 
ATOM   3298  N  N   . GLU C  1 111 ? -31.626 -4.656  -4.399  1.00 34.45  ?  111 GLU C N   1 
ATOM   3299  C  CA  . GLU C  1 111 ? -33.070 -4.425  -4.647  1.00 34.65  ?  111 GLU C CA  1 
ATOM   3300  C  C   . GLU C  1 111 ? -33.677 -3.558  -3.519  1.00 33.69  ?  111 GLU C C   1 
ATOM   3301  O  O   . GLU C  1 111 ? -34.410 -2.595  -3.804  1.00 34.12  ?  111 GLU C O   1 
ATOM   3302  C  CB  . GLU C  1 111 ? -33.906 -5.709  -4.810  1.00 35.41  ?  111 GLU C CB  1 
ATOM   3303  C  CG  . GLU C  1 111 ? -33.212 -6.977  -5.347  1.00 39.47  ?  111 GLU C CG  1 
ATOM   3304  C  CD  . GLU C  1 111 ? -34.208 -8.151  -5.626  1.00 43.65  ?  111 GLU C CD  1 
ATOM   3305  O  OE1 . GLU C  1 111 ? -33.868 -9.359  -5.424  1.00 42.73  ?  111 GLU C OE1 1 
ATOM   3306  O  OE2 . GLU C  1 111 ? -35.346 -7.854  -6.048  1.00 46.39  -1 111 GLU C OE2 1 
ATOM   3307  N  N   . ILE C  1 112 ? -33.365 -3.896  -2.257  1.00 31.67  ?  112 ILE C N   1 
ATOM   3308  C  CA  . ILE C  1 112 ? -33.779 -3.100  -1.088  1.00 30.40  ?  112 ILE C CA  1 
ATOM   3309  C  C   . ILE C  1 112 ? -33.208 -1.680  -1.144  1.00 29.67  ?  112 ILE C C   1 
ATOM   3310  O  O   . ILE C  1 112 ? -33.946 -0.695  -1.071  1.00 28.54  ?  112 ILE C O   1 
ATOM   3311  C  CB  . ILE C  1 112 ? -33.360 -3.756  0.290   1.00 30.46  ?  112 ILE C CB  1 
ATOM   3312  C  CG1 . ILE C  1 112 ? -34.201 -4.996  0.581   1.00 30.24  ?  112 ILE C CG1 1 
ATOM   3313  C  CG2 . ILE C  1 112 ? -33.535 -2.789  1.455   1.00 28.42  ?  112 ILE C CG2 1 
ATOM   3314  C  CD1 . ILE C  1 112 ? -33.503 -6.003  1.453   1.00 28.14  ?  112 ILE C CD1 1 
ATOM   3315  N  N   . LEU C  1 113 ? -31.884 -1.610  -1.228  1.00 29.00  ?  113 LEU C N   1 
ATOM   3316  C  CA  . LEU C  1 113 ? -31.174 -0.368  -1.358  1.00 29.36  ?  113 LEU C CA  1 
ATOM   3317  C  C   . LEU C  1 113 ? -31.756 0.594   -2.412  1.00 30.33  ?  113 LEU C C   1 
ATOM   3318  O  O   . LEU C  1 113 ? -31.940 1.782   -2.122  1.00 29.48  ?  113 LEU C O   1 
ATOM   3319  C  CB  . LEU C  1 113 ? -29.722 -0.678  -1.663  1.00 28.76  ?  113 LEU C CB  1 
ATOM   3320  C  CG  . LEU C  1 113 ? -28.754 -0.333  -0.562  1.00 27.82  ?  113 LEU C CG  1 
ATOM   3321  C  CD1 . LEU C  1 113 ? -29.391 -0.167  0.811   1.00 27.71  ?  113 LEU C CD1 1 
ATOM   3322  C  CD2 . LEU C  1 113 ? -27.710 -1.369  -0.546  1.00 27.35  ?  113 LEU C CD2 1 
ATOM   3323  N  N   . GLN C  1 114 ? -32.042 0.067   -3.613  1.00 31.27  ?  114 GLN C N   1 
ATOM   3324  C  CA  . GLN C  1 114 ? -32.561 0.861   -4.746  1.00 32.55  ?  114 GLN C CA  1 
ATOM   3325  C  C   . GLN C  1 114 ? -34.080 1.116   -4.806  1.00 32.64  ?  114 GLN C C   1 
ATOM   3326  O  O   . GLN C  1 114 ? -34.558 1.582   -5.835  1.00 33.27  ?  114 GLN C O   1 
ATOM   3327  C  CB  . GLN C  1 114 ? -32.139 0.220   -6.077  1.00 32.61  ?  114 GLN C CB  1 
ATOM   3328  C  CG  . GLN C  1 114 ? -30.617 0.321   -6.397  1.00 36.04  ?  114 GLN C CG  1 
ATOM   3329  C  CD  . GLN C  1 114 ? -30.174 -0.543  -7.601  1.00 39.45  ?  114 GLN C CD  1 
ATOM   3330  O  OE1 . GLN C  1 114 ? -29.146 -1.242  -7.540  1.00 40.01  ?  114 GLN C OE1 1 
ATOM   3331  N  NE2 . GLN C  1 114 ? -30.956 -0.497  -8.696  1.00 40.29  ?  114 GLN C NE2 1 
ATOM   3332  N  N   . ALA C  1 115 ? -34.829 0.849   -3.739  1.00 32.22  ?  115 ALA C N   1 
ATOM   3333  C  CA  . ALA C  1 115 ? -36.275 0.640   -3.874  1.00 32.68  ?  115 ALA C CA  1 
ATOM   3334  C  C   . ALA C  1 115 ? -37.239 1.802   -3.492  1.00 33.40  ?  115 ALA C C   1 
ATOM   3335  O  O   . ALA C  1 115 ? -37.055 2.505   -2.490  1.00 33.16  ?  115 ALA C O   1 
ATOM   3336  C  CB  . ALA C  1 115 ? -36.677 -0.668  -3.168  1.00 32.51  ?  115 ALA C CB  1 
ATOM   3337  N  N   . SER C  1 116 ? -38.297 1.966   -4.276  1.00 33.95  ?  116 SER C N   1 
ATOM   3338  C  CA  . SER C  1 116 ? -39.172 3.108   -4.096  1.00 35.05  ?  116 SER C CA  1 
ATOM   3339  C  C   . SER C  1 116 ? -40.337 2.861   -3.114  1.00 35.48  ?  116 SER C C   1 
ATOM   3340  O  O   . SER C  1 116 ? -41.134 3.775   -2.837  1.00 35.36  ?  116 SER C O   1 
ATOM   3341  C  CB  . SER C  1 116 ? -39.722 3.513   -5.448  1.00 35.05  ?  116 SER C CB  1 
ATOM   3342  O  OG  . SER C  1 116 ? -40.568 2.474   -5.928  1.00 37.59  ?  116 SER C OG  1 
ATOM   3343  N  N   . ASN C  1 117 ? -40.439 1.625   -2.603  1.00 35.63  ?  117 ASN C N   1 
ATOM   3344  C  CA  . ASN C  1 117 ? -41.526 1.229   -1.695  1.00 35.38  ?  117 ASN C CA  1 
ATOM   3345  C  C   . ASN C  1 117 ? -41.094 0.763   -0.251  1.00 35.71  ?  117 ASN C C   1 
ATOM   3346  O  O   . ASN C  1 117 ? -41.698 -0.152  0.341   1.00 35.62  ?  117 ASN C O   1 
ATOM   3347  C  CB  . ASN C  1 117 ? -42.368 0.150   -2.385  1.00 35.08  ?  117 ASN C CB  1 
ATOM   3348  C  CG  . ASN C  1 117 ? -41.674 -1.208  -2.407  1.00 34.28  ?  117 ASN C CG  1 
ATOM   3349  O  OD1 . ASN C  1 117 ? -40.432 -1.292  -2.486  1.00 31.62  ?  117 ASN C OD1 1 
ATOM   3350  N  ND2 . ASN C  1 117 ? -42.473 -2.282  -2.310  1.00 31.65  ?  117 ASN C ND2 1 
ATOM   3351  N  N   . LEU C  1 118 ? -40.056 1.388   0.305   1.00 35.53  ?  118 LEU C N   1 
ATOM   3352  C  CA  . LEU C  1 118 ? -39.527 0.981   1.606   1.00 35.14  ?  118 LEU C CA  1 
ATOM   3353  C  C   . LEU C  1 118 ? -40.352 1.702   2.603   1.00 34.69  ?  118 LEU C C   1 
ATOM   3354  O  O   . LEU C  1 118 ? -40.751 2.809   2.345   1.00 34.83  ?  118 LEU C O   1 
ATOM   3355  C  CB  . LEU C  1 118 ? -38.068 1.386   1.775   1.00 35.06  ?  118 LEU C CB  1 
ATOM   3356  C  CG  . LEU C  1 118 ? -37.010 0.704   0.909   1.00 35.43  ?  118 LEU C CG  1 
ATOM   3357  C  CD1 . LEU C  1 118 ? -35.649 1.131   1.398   1.00 35.05  ?  118 LEU C CD1 1 
ATOM   3358  C  CD2 . LEU C  1 118 ? -37.119 -0.822  0.938   1.00 35.25  ?  118 LEU C CD2 1 
ATOM   3359  N  N   . ARG C  1 119 ? -40.624 1.073   3.740   1.00 34.47  ?  119 ARG C N   1 
ATOM   3360  C  CA  . ARG C  1 119 ? -41.537 1.644   4.713   1.00 33.63  ?  119 ARG C CA  1 
ATOM   3361  C  C   . ARG C  1 119 ? -40.951 2.923   5.319   1.00 32.45  ?  119 ARG C C   1 
ATOM   3362  O  O   . ARG C  1 119 ? -41.686 3.800   5.777   1.00 32.14  ?  119 ARG C O   1 
ATOM   3363  C  CB  . ARG C  1 119 ? -41.876 0.594   5.759   1.00 33.91  ?  119 ARG C CB  1 
ATOM   3364  C  CG  . ARG C  1 119 ? -42.612 1.109   6.959   1.00 37.99  ?  119 ARG C CG  1 
ATOM   3365  C  CD  . ARG C  1 119 ? -44.124 0.912   6.887   1.00 44.81  ?  119 ARG C CD  1 
ATOM   3366  N  NE  . ARG C  1 119 ? -44.723 1.176   8.208   1.00 49.17  ?  119 ARG C NE  1 
ATOM   3367  C  CZ  . ARG C  1 119 ? -44.667 0.350   9.265   1.00 51.39  ?  119 ARG C CZ  1 
ATOM   3368  N  NH1 . ARG C  1 119 ? -44.052 -0.844  9.212   1.00 49.67  ?  119 ARG C NH1 1 
ATOM   3369  N  NH2 . ARG C  1 119 ? -45.236 0.732   10.399  1.00 52.98  ?  119 ARG C NH2 1 
ATOM   3370  N  N   . SER C  1 120 ? -39.626 3.022   5.286   1.00 31.51  ?  120 SER C N   1 
ATOM   3371  C  CA  . SER C  1 120 ? -38.896 4.189   5.760   1.00 30.98  ?  120 SER C CA  1 
ATOM   3372  C  C   . SER C  1 120 ? -37.473 4.068   5.326   1.00 30.03  ?  120 SER C C   1 
ATOM   3373  O  O   . SER C  1 120 ? -37.026 2.987   4.955   1.00 30.42  ?  120 SER C O   1 
ATOM   3374  C  CB  . SER C  1 120 ? -38.888 4.263   7.281   1.00 30.89  ?  120 SER C CB  1 
ATOM   3375  O  OG  . SER C  1 120 ? -37.834 3.458   7.777   1.00 33.90  ?  120 SER C OG  1 
ATOM   3376  N  N   . PRO C  1 121 ? -36.732 5.177   5.392   1.00 29.76  ?  121 PRO C N   1 
ATOM   3377  C  CA  . PRO C  1 121 ? -35.310 5.144   5.034   1.00 28.96  ?  121 PRO C CA  1 
ATOM   3378  C  C   . PRO C  1 121 ? -34.476 4.330   5.990   1.00 27.86  ?  121 PRO C C   1 
ATOM   3379  O  O   . PRO C  1 121 ? -33.421 3.814   5.607   1.00 27.99  ?  121 PRO C O   1 
ATOM   3380  C  CB  . PRO C  1 121 ? -34.930 6.618   5.045   1.00 29.34  ?  121 PRO C CB  1 
ATOM   3381  C  CG  . PRO C  1 121 ? -36.196 7.275   4.581   1.00 29.32  ?  121 PRO C CG  1 
ATOM   3382  C  CD  . PRO C  1 121 ? -37.256 6.558   5.348   1.00 29.81  ?  121 PRO C CD  1 
ATOM   3383  N  N   . LEU C  1 122 ? -34.962 4.149   7.207   1.00 26.23  ?  122 LEU C N   1 
ATOM   3384  C  CA  . LEU C  1 122 ? -34.271 3.221   8.088   1.00 25.26  ?  122 LEU C CA  1 
ATOM   3385  C  C   . LEU C  1 122 ? -34.108 1.869   7.423   1.00 24.53  ?  122 LEU C C   1 
ATOM   3386  O  O   . LEU C  1 122 ? -33.077 1.223   7.578   1.00 23.99  ?  122 LEU C O   1 
ATOM   3387  C  CB  . LEU C  1 122 ? -34.992 3.051   9.432   1.00 25.53  ?  122 LEU C CB  1 
ATOM   3388  C  CG  . LEU C  1 122 ? -34.433 3.896   10.568  1.00 23.22  ?  122 LEU C CG  1 
ATOM   3389  C  CD1 . LEU C  1 122 ? -35.082 3.490   11.827  1.00 21.33  ?  122 LEU C CD1 1 
ATOM   3390  C  CD2 . LEU C  1 122 ? -32.942 3.717   10.659  1.00 23.32  ?  122 LEU C CD2 1 
ATOM   3391  N  N   . VAL C  1 123 ? -35.136 1.453   6.681   1.00 23.75  ?  123 VAL C N   1 
ATOM   3392  C  CA  . VAL C  1 123 ? -35.174 0.106   6.147   1.00 23.38  ?  123 VAL C CA  1 
ATOM   3393  C  C   . VAL C  1 123 ? -33.945 -0.192  5.306   1.00 23.13  ?  123 VAL C C   1 
ATOM   3394  O  O   . VAL C  1 123 ? -33.265 -1.193  5.522   1.00 22.85  ?  123 VAL C O   1 
ATOM   3395  C  CB  . VAL C  1 123 ? -36.388 -0.095  5.329   1.00 23.54  ?  123 VAL C CB  1 
ATOM   3396  C  CG1 . VAL C  1 123 ? -36.329 -1.448  4.666   1.00 25.70  ?  123 VAL C CG1 1 
ATOM   3397  C  CG2 . VAL C  1 123 ? -37.605 -0.004  6.202   1.00 24.01  ?  123 VAL C CG2 1 
ATOM   3398  N  N   . ALA C  1 124 ? -33.629 0.722   4.394   1.00 22.99  ?  124 ALA C N   1 
ATOM   3399  C  CA  . ALA C  1 124 ? -32.431 0.581   3.568   1.00 22.88  ?  124 ALA C CA  1 
ATOM   3400  C  C   . ALA C  1 124 ? -31.152 0.764   4.377   1.00 22.75  ?  124 ALA C C   1 
ATOM   3401  O  O   . ALA C  1 124 ? -30.171 0.056   4.146   1.00 23.06  ?  124 ALA C O   1 
ATOM   3402  C  CB  . ALA C  1 124 ? -32.468 1.529   2.400   1.00 22.71  ?  124 ALA C CB  1 
ATOM   3403  N  N   . GLU C  1 125 ? -31.169 1.713   5.320   1.00 22.92  ?  125 GLU C N   1 
ATOM   3404  C  CA  . GLU C  1 125 ? -30.019 1.984   6.172   1.00 22.34  ?  125 GLU C CA  1 
ATOM   3405  C  C   . GLU C  1 125 ? -29.773 0.785   7.066   1.00 22.54  ?  125 GLU C C   1 
ATOM   3406  O  O   . GLU C  1 125 ? -28.626 0.513   7.436   1.00 22.79  ?  125 GLU C O   1 
ATOM   3407  C  CB  . GLU C  1 125 ? -30.245 3.227   7.001   1.00 22.12  ?  125 GLU C CB  1 
ATOM   3408  C  CG  . GLU C  1 125 ? -29.179 3.547   8.025   1.00 24.19  ?  125 GLU C CG  1 
ATOM   3409  C  CD  . GLU C  1 125 ? -27.850 3.950   7.379   1.00 31.30  ?  125 GLU C CD  1 
ATOM   3410  O  OE1 . GLU C  1 125 ? -26.824 4.036   8.118   1.00 32.49  ?  125 GLU C OE1 1 
ATOM   3411  O  OE2 . GLU C  1 125 ? -27.822 4.155   6.125   1.00 34.01  -1 125 GLU C OE2 1 
ATOM   3412  N  N   . SER C  1 126 ? -30.826 0.043   7.401   1.00 22.48  ?  126 SER C N   1 
ATOM   3413  C  CA  . SER C  1 126 ? -30.629 -1.197  8.158   1.00 23.31  ?  126 SER C CA  1 
ATOM   3414  C  C   . SER C  1 126 ? -29.692 -2.111  7.395   1.00 23.08  ?  126 SER C C   1 
ATOM   3415  O  O   . SER C  1 126 ? -28.852 -2.779  7.990   1.00 23.75  ?  126 SER C O   1 
ATOM   3416  C  CB  . SER C  1 126 ? -31.943 -1.911  8.451   1.00 23.81  ?  126 SER C CB  1 
ATOM   3417  O  OG  . SER C  1 126 ? -32.674 -1.250  9.474   1.00 25.22  ?  126 SER C OG  1 
ATOM   3418  N  N   . ILE C  1 127 ? -29.793 -2.073  6.067   1.00 22.88  ?  127 ILE C N   1 
ATOM   3419  C  CA  . ILE C  1 127 ? -28.902 -2.848  5.213   1.00 22.59  ?  127 ILE C CA  1 
ATOM   3420  C  C   . ILE C  1 127 ? -27.475 -2.320  5.148   1.00 22.81  ?  127 ILE C C   1 
ATOM   3421  O  O   . ILE C  1 127 ? -26.503 -3.085  5.287   1.00 23.20  ?  127 ILE C O   1 
ATOM   3422  C  CB  . ILE C  1 127 ? -29.521 -3.064  3.833   1.00 22.59  ?  127 ILE C CB  1 
ATOM   3423  C  CG1 . ILE C  1 127 ? -30.313 -4.359  3.883   1.00 21.43  ?  127 ILE C CG1 1 
ATOM   3424  C  CG2 . ILE C  1 127 ? -28.466 -3.215  2.740   1.00 21.64  ?  127 ILE C CG2 1 
ATOM   3425  C  CD1 . ILE C  1 127 ? -31.643 -4.164  4.406   1.00 23.80  ?  127 ILE C CD1 1 
ATOM   3426  N  N   . ARG C  1 128 ? -27.337 -1.014  4.963   1.00 22.75  ?  128 ARG C N   1 
ATOM   3427  C  CA  . ARG C  1 128 ? -26.009 -0.437  4.921   1.00 22.79  ?  128 ARG C CA  1 
ATOM   3428  C  C   . ARG C  1 128 ? -25.265 -0.831  6.199   1.00 23.02  ?  128 ARG C C   1 
ATOM   3429  O  O   . ARG C  1 128 ? -24.123 -1.269  6.133   1.00 23.63  ?  128 ARG C O   1 
ATOM   3430  C  CB  . ARG C  1 128 ? -26.049 1.084   4.615   1.00 22.19  ?  128 ARG C CB  1 
ATOM   3431  C  CG  . ARG C  1 128 ? -26.221 1.363   3.108   1.00 23.00  ?  128 ARG C CG  1 
ATOM   3432  C  CD  . ARG C  1 128 ? -26.234 2.846   2.649   1.00 23.49  ?  128 ARG C CD  1 
ATOM   3433  N  NE  . ARG C  1 128 ? -27.429 3.523   3.146   1.00 26.78  ?  128 ARG C NE  1 
ATOM   3434  C  CZ  . ARG C  1 128 ? -28.499 3.798   2.422   1.00 27.32  ?  128 ARG C CZ  1 
ATOM   3435  N  NH1 . ARG C  1 128 ? -28.524 3.477   1.142   1.00 26.48  ?  128 ARG C NH1 1 
ATOM   3436  N  NH2 . ARG C  1 128 ? -29.548 4.402   2.986   1.00 28.78  ?  128 ARG C NH2 1 
ATOM   3437  N  N   . CYS C  1 129 ? -25.939 -0.726  7.347   1.00 22.87  ?  129 CYS C N   1 
ATOM   3438  C  CA  . CYS C  1 129 ? -25.399 -1.146  8.639   1.00 22.66  ?  129 CYS C CA  1 
ATOM   3439  C  C   . CYS C  1 129 ? -25.020 -2.622  8.669   1.00 22.92  ?  129 CYS C C   1 
ATOM   3440  O  O   . CYS C  1 129 ? -23.913 -2.942  9.088   1.00 22.09  ?  129 CYS C O   1 
ATOM   3441  C  CB  . CYS C  1 129 ? -26.444 -0.932  9.734   1.00 23.13  ?  129 CYS C CB  1 
ATOM   3442  S  SG  . CYS C  1 129 ? -26.588 0.716   10.272  1.00 23.35  ?  129 CYS C SG  1 
ATOM   3443  N  N   . TYR C  1 130 ? -25.950 -3.517  8.273   1.00 22.57  ?  130 TYR C N   1 
ATOM   3444  C  CA  . TYR C  1 130 ? -25.587 -4.912  8.115   1.00 23.31  ?  130 TYR C CA  1 
ATOM   3445  C  C   . TYR C  1 130 ? -24.314 -5.040  7.298   1.00 23.82  ?  130 TYR C C   1 
ATOM   3446  O  O   . TYR C  1 130 ? -23.397 -5.758  7.702   1.00 23.97  ?  130 TYR C O   1 
ATOM   3447  C  CB  . TYR C  1 130 ? -26.692 -5.742  7.464   1.00 23.40  ?  130 TYR C CB  1 
ATOM   3448  C  CG  . TYR C  1 130 ? -26.298 -7.200  7.200   1.00 24.03  ?  130 TYR C CG  1 
ATOM   3449  C  CD1 . TYR C  1 130 ? -26.698 -8.237  8.062   1.00 24.11  ?  130 TYR C CD1 1 
ATOM   3450  C  CD2 . TYR C  1 130 ? -25.520 -7.551  6.074   1.00 24.97  ?  130 TYR C CD2 1 
ATOM   3451  C  CE1 . TYR C  1 130 ? -26.313 -9.583  7.804   1.00 23.24  ?  130 TYR C CE1 1 
ATOM   3452  C  CE2 . TYR C  1 130 ? -25.142 -8.868  5.823   1.00 23.99  ?  130 TYR C CE2 1 
ATOM   3453  C  CZ  . TYR C  1 130 ? -25.547 -9.885  6.680   1.00 25.19  ?  130 TYR C CZ  1 
ATOM   3454  O  OH  . TYR C  1 130 ? -25.184 -11.205 6.379   1.00 26.53  ?  130 TYR C OH  1 
ATOM   3455  N  N   . GLN C  1 131 ? -24.266 -4.342  6.167   1.00 24.60  ?  131 GLN C N   1 
ATOM   3456  C  CA  . GLN C  1 131 ? -23.184 -4.524  5.205   1.00 27.27  ?  131 GLN C CA  1 
ATOM   3457  C  C   . GLN C  1 131 ? -21.798 -4.023  5.661   1.00 27.72  ?  131 GLN C C   1 
ATOM   3458  O  O   . GLN C  1 131 ? -20.774 -4.438  5.091   1.00 27.46  ?  131 GLN C O   1 
ATOM   3459  C  CB  . GLN C  1 131 ? -23.545 -3.903  3.862   1.00 27.90  ?  131 GLN C CB  1 
ATOM   3460  C  CG  . GLN C  1 131 ? -24.685 -4.594  3.166   1.00 31.44  ?  131 GLN C CG  1 
ATOM   3461  C  CD  . GLN C  1 131 ? -24.727 -4.316  1.669   1.00 36.19  ?  131 GLN C CD  1 
ATOM   3462  O  OE1 . GLN C  1 131 ? -24.694 -3.167  1.244   1.00 37.24  ?  131 GLN C OE1 1 
ATOM   3463  N  NE2 . GLN C  1 131 ? -24.816 -5.389  0.860   1.00 40.37  ?  131 GLN C NE2 1 
ATOM   3464  N  N   . SER C  1 132 ? -21.765 -3.147  6.679   1.00 28.21  ?  132 SER C N   1 
ATOM   3465  C  CA  . SER C  1 132 ? -20.493 -2.693  7.249   1.00 28.56  ?  132 SER C CA  1 
ATOM   3466  C  C   . SER C  1 132 ? -19.693 -3.783  8.012   1.00 29.15  ?  132 SER C C   1 
ATOM   3467  O  O   . SER C  1 132 ? -18.576 -3.514  8.421   1.00 29.07  ?  132 SER C O   1 
ATOM   3468  C  CB  . SER C  1 132 ? -20.715 -1.564  8.223   1.00 28.42  ?  132 SER C CB  1 
ATOM   3469  O  OG  . SER C  1 132 ? -20.668 -2.083  9.548   1.00 28.00  ?  132 SER C OG  1 
ATOM   3470  N  N   . GLY C  1 133 ? -20.265 -4.959  8.270   1.00 29.00  ?  133 GLY C N   1 
ATOM   3471  C  CA  . GLY C  1 133 ? -19.483 -6.040  8.885   1.00 29.68  ?  133 GLY C CA  1 
ATOM   3472  C  C   . GLY C  1 133 ? -19.352 -6.008  10.415  1.00 30.37  ?  133 GLY C C   1 
ATOM   3473  O  O   . GLY C  1 133 ? -18.824 -6.956  11.021  1.00 30.65  ?  133 GLY C O   1 
ATOM   3474  N  N   . GLN C  1 134 ? -19.808 -4.931  11.054  1.00 29.36  ?  134 GLN C N   1 
ATOM   3475  C  CA  . GLN C  1 134 ? -19.565 -4.770  12.462  1.00 28.66  ?  134 GLN C CA  1 
ATOM   3476  C  C   . GLN C  1 134 ? -20.709 -5.376  13.248  1.00 28.03  ?  134 GLN C C   1 
ATOM   3477  O  O   . GLN C  1 134 ? -21.858 -5.112  12.939  1.00 28.43  ?  134 GLN C O   1 
ATOM   3478  C  CB  . GLN C  1 134 ? -19.392 -3.312  12.801  1.00 29.04  ?  134 GLN C CB  1 
ATOM   3479  C  CG  . GLN C  1 134 ? -18.718 -3.090  14.131  1.00 31.04  ?  134 GLN C CG  1 
ATOM   3480  C  CD  . GLN C  1 134 ? -17.242 -3.438  14.101  1.00 35.77  ?  134 GLN C CD  1 
ATOM   3481  O  OE1 . GLN C  1 134 ? -16.585 -3.406  13.036  1.00 39.76  ?  134 GLN C OE1 1 
ATOM   3482  N  NE2 . GLN C  1 134 ? -16.705 -3.775  15.267  1.00 34.86  ?  134 GLN C NE2 1 
ATOM   3483  N  N   . ARG C  1 135 ? -20.374 -6.206  14.242  1.00 26.65  ?  135 ARG C N   1 
ATOM   3484  C  CA  . ARG C  1 135 ? -21.312 -7.066  14.944  0.50 25.01  ?  135 ARG C CA  1 
ATOM   3485  C  C   . ARG C  1 135 ? -21.050 -6.941  16.428  1.00 25.47  ?  135 ARG C C   1 
ATOM   3486  O  O   . ARG C  1 135 ? -19.898 -6.908  16.851  1.00 25.16  ?  135 ARG C O   1 
ATOM   3487  C  CB  . ARG C  1 135 ? -21.078 -8.496  14.531  0.50 23.86  ?  135 ARG C CB  1 
ATOM   3488  C  CG  . ARG C  1 135 ? -21.459 -8.738  13.132  0.50 20.89  ?  135 ARG C CG  1 
ATOM   3489  C  CD  . ARG C  1 135 ? -22.934 -8.519  12.967  0.50 15.21  ?  135 ARG C CD  1 
ATOM   3490  N  NE  . ARG C  1 135 ? -23.320 -8.900  11.623  0.50 11.10  ?  135 ARG C NE  1 
ATOM   3491  C  CZ  . ARG C  1 135 ? -23.236 -8.056  10.620  0.50 10.27  ?  135 ARG C CZ  1 
ATOM   3492  N  NH1 . ARG C  1 135 ? -22.809 -6.811  10.868  0.50 9.18   ?  135 ARG C NH1 1 
ATOM   3493  N  NH2 . ARG C  1 135 ? -23.593 -8.429  9.407   0.50 8.30   ?  135 ARG C NH2 1 
ATOM   3494  N  N   . TYR C  1 136 ? -22.111 -6.879  17.226  1.00 25.14  ?  136 TYR C N   1 
ATOM   3495  C  CA  . TYR C  1 136 ? -21.949 -6.512  18.630  1.00 25.54  ?  136 TYR C CA  1 
ATOM   3496  C  C   . TYR C  1 136 ? -22.696 -7.488  19.500  1.00 24.50  ?  136 TYR C C   1 
ATOM   3497  O  O   . TYR C  1 136 ? -23.762 -7.932  19.104  1.00 24.51  ?  136 TYR C O   1 
ATOM   3498  C  CB  . TYR C  1 136 ? -22.429 -5.077  18.882  1.00 25.00  ?  136 TYR C CB  1 
ATOM   3499  C  CG  . TYR C  1 136 ? -21.523 -3.991  18.304  1.00 28.29  ?  136 TYR C CG  1 
ATOM   3500  C  CD1 . TYR C  1 136 ? -20.462 -3.461  19.042  1.00 29.05  ?  136 TYR C CD1 1 
ATOM   3501  C  CD2 . TYR C  1 136 ? -21.741 -3.480  17.034  1.00 30.61  ?  136 TYR C CD2 1 
ATOM   3502  C  CE1 . TYR C  1 136 ? -19.648 -2.483  18.525  1.00 29.97  ?  136 TYR C CE1 1 
ATOM   3503  C  CE2 . TYR C  1 136 ? -20.939 -2.489  16.518  1.00 31.05  ?  136 TYR C CE2 1 
ATOM   3504  C  CZ  . TYR C  1 136 ? -19.884 -1.991  17.261  1.00 32.97  ?  136 TYR C CZ  1 
ATOM   3505  O  OH  . TYR C  1 136 ? -19.082 -0.965  16.736  1.00 34.93  ?  136 TYR C OH  1 
ATOM   3506  N  N   . PRO C  1 137 ? -22.140 -7.825  20.677  1.00 24.11  ?  137 PRO C N   1 
ATOM   3507  C  CA  . PRO C  1 137 ? -22.788 -8.762  21.633  1.00 23.76  ?  137 PRO C CA  1 
ATOM   3508  C  C   . PRO C  1 137 ? -24.172 -8.321  21.964  1.00 23.49  ?  137 PRO C C   1 
ATOM   3509  O  O   . PRO C  1 137 ? -24.417 -7.134  22.172  1.00 23.68  ?  137 PRO C O   1 
ATOM   3510  C  CB  . PRO C  1 137 ? -21.923 -8.696  22.888  1.00 22.99  ?  137 PRO C CB  1 
ATOM   3511  C  CG  . PRO C  1 137 ? -20.822 -7.685  22.600  1.00 24.19  ?  137 PRO C CG  1 
ATOM   3512  C  CD  . PRO C  1 137 ? -20.794 -7.424  21.108  1.00 24.44  ?  137 PRO C CD  1 
ATOM   3513  N  N   . LEU C  1 138 ? -25.093 -9.259  21.968  1.00 23.85  ?  138 LEU C N   1 
ATOM   3514  C  CA  . LEU C  1 138 ? -26.425 -8.971  22.473  1.00 24.61  ?  138 LEU C CA  1 
ATOM   3515  C  C   . LEU C  1 138 ? -26.410 -8.512  23.937  1.00 24.88  ?  138 LEU C C   1 
ATOM   3516  O  O   . LEU C  1 138 ? -27.267 -7.728  24.316  1.00 26.31  ?  138 LEU C O   1 
ATOM   3517  C  CB  . LEU C  1 138 ? -27.311 -10.205 22.349  1.00 24.87  ?  138 LEU C CB  1 
ATOM   3518  C  CG  . LEU C  1 138 ? -27.392 -10.853 20.963  1.00 25.10  ?  138 LEU C CG  1 
ATOM   3519  C  CD1 . LEU C  1 138 ? -27.839 -12.310 21.085  1.00 26.41  ?  138 LEU C CD1 1 
ATOM   3520  C  CD2 . LEU C  1 138 ? -28.340 -10.066 20.058  1.00 23.29  ?  138 LEU C CD2 1 
ATOM   3521  N  N   . GLU C  1 139 ? -25.464 -8.987  24.756  1.00 24.67  ?  139 GLU C N   1 
ATOM   3522  C  CA  . GLU C  1 139 ? -25.399 -8.556  26.163  0.50 24.75  ?  139 GLU C CA  1 
ATOM   3523  C  C   . GLU C  1 139 ? -25.277 -7.040  26.253  1.00 25.11  ?  139 GLU C C   1 
ATOM   3524  O  O   . GLU C  1 139 ? -25.348 -6.468  27.332  1.00 25.59  ?  139 GLU C O   1 
ATOM   3525  C  CB  . GLU C  1 139 ? -24.247 -9.221  26.951  0.50 24.06  ?  139 GLU C CB  1 
ATOM   3526  C  CG  . GLU C  1 139 ? -24.671 -10.240 28.062  0.50 24.08  ?  139 GLU C CG  1 
ATOM   3527  C  CD  . GLU C  1 139 ? -24.851 -9.647  29.495  0.50 23.88  ?  139 GLU C CD  1 
ATOM   3528  O  OE1 . GLU C  1 139 ? -26.015 -9.463  29.918  0.50 20.11  ?  139 GLU C OE1 1 
ATOM   3529  O  OE2 . GLU C  1 139 ? -23.844 -9.383  30.212  0.50 24.03  -1 139 GLU C OE2 1 
ATOM   3530  N  N   . MET C  1 140 ? -25.086 -6.376  25.132  1.00 25.54  ?  140 MET C N   1 
ATOM   3531  C  CA  . MET C  1 140 ? -24.795 -4.943  25.171  1.00 26.53  ?  140 MET C CA  1 
ATOM   3532  C  C   . MET C  1 140 ? -26.054 -4.144  25.554  1.00 26.78  ?  140 MET C C   1 
ATOM   3533  O  O   . MET C  1 140 ? -25.971 -2.989  25.994  1.00 26.73  ?  140 MET C O   1 
ATOM   3534  C  CB  . MET C  1 140 ? -24.246 -4.475  23.824  1.00 26.62  ?  140 MET C CB  1 
ATOM   3535  C  CG  . MET C  1 140 ? -23.187 -3.393  23.940  1.00 29.65  ?  140 MET C CG  1 
ATOM   3536  S  SD  . MET C  1 140 ? -22.959 -2.386  22.459  1.00 31.07  ?  140 MET C SD  1 
ATOM   3537  C  CE  . MET C  1 140 ? -24.583 -1.703  22.368  1.00 28.08  ?  140 MET C CE  1 
ATOM   3538  N  N   . ILE C  1 141 ? -27.215 -4.768  25.393  1.00 26.41  ?  141 ILE C N   1 
ATOM   3539  C  CA  . ILE C  1 141 ? -28.469 -4.117  25.706  1.00 27.24  ?  141 ILE C CA  1 
ATOM   3540  C  C   . ILE C  1 141 ? -29.409 -5.166  26.301  1.00 27.40  ?  141 ILE C C   1 
ATOM   3541  O  O   . ILE C  1 141 ? -30.611 -5.204  26.035  1.00 26.98  ?  141 ILE C O   1 
ATOM   3542  C  CB  . ILE C  1 141 ? -29.072 -3.408  24.454  1.00 27.74  ?  141 ILE C CB  1 
ATOM   3543  C  CG1 . ILE C  1 141 ? -29.031 -4.312  23.217  1.00 29.25  ?  141 ILE C CG1 1 
ATOM   3544  C  CG2 . ILE C  1 141 ? -28.304 -2.142  24.100  1.00 27.41  ?  141 ILE C CG2 1 
ATOM   3545  C  CD1 . ILE C  1 141 ? -30.354 -4.884  22.857  1.00 29.45  ?  141 ILE C CD1 1 
ATOM   3546  N  N   . GLY C  1 142 ? -28.835 -6.013  27.146  1.00 27.96  ?  142 GLY C N   1 
ATOM   3547  C  CA  . GLY C  1 142 ? -29.576 -7.101  27.751  1.00 27.94  ?  142 GLY C CA  1 
ATOM   3548  C  C   . GLY C  1 142 ? -30.275 -6.760  29.047  1.00 28.01  ?  142 GLY C C   1 
ATOM   3549  O  O   . GLY C  1 142 ? -30.019 -5.736  29.692  1.00 28.16  ?  142 GLY C O   1 
ATOM   3550  N  N   . ASP C  1 143 ? -31.177 -7.658  29.402  1.00 28.26  ?  143 ASP C N   1 
ATOM   3551  C  CA  . ASP C  1 143 ? -31.929 -7.657  30.648  1.00 28.46  ?  143 ASP C CA  1 
ATOM   3552  C  C   . ASP C  1 143 ? -30.993 -7.850  31.828  1.00 28.10  ?  143 ASP C C   1 
ATOM   3553  O  O   . ASP C  1 143 ? -29.976 -8.497  31.693  1.00 28.39  ?  143 ASP C O   1 
ATOM   3554  C  CB  . ASP C  1 143 ? -32.942 -8.803  30.614  1.00 28.72  ?  143 ASP C CB  1 
ATOM   3555  C  CG  . ASP C  1 143 ? -32.308 -10.135 30.127  1.00 29.14  ?  143 ASP C CG  1 
ATOM   3556  O  OD1 . ASP C  1 143 ? -32.091 -10.278 28.901  1.00 26.76  ?  143 ASP C OD1 1 
ATOM   3557  O  OD2 . ASP C  1 143 ? -32.014 -11.023 30.965  1.00 30.72  -1 143 ASP C OD2 1 
ATOM   3558  N  N   . PHE C  1 144 ? -31.344 -7.265  32.971  1.00 28.50  ?  144 PHE C N   1 
ATOM   3559  C  CA  . PHE C  1 144 ? -30.577 -7.378  34.208  1.00 28.80  ?  144 PHE C CA  1 
ATOM   3560  C  C   . PHE C  1 144 ? -31.520 -7.935  35.243  1.00 28.91  ?  144 PHE C C   1 
ATOM   3561  O  O   . PHE C  1 144 ? -32.615 -7.380  35.414  1.00 28.35  ?  144 PHE C O   1 
ATOM   3562  C  CB  . PHE C  1 144 ? -30.084 -6.001  34.689  1.00 28.82  ?  144 PHE C CB  1 
ATOM   3563  C  CG  . PHE C  1 144 ? -29.110 -6.086  35.840  1.00 28.05  ?  144 PHE C CG  1 
ATOM   3564  C  CD1 . PHE C  1 144 ? -27.956 -6.881  35.728  1.00 24.57  ?  144 PHE C CD1 1 
ATOM   3565  C  CD2 . PHE C  1 144 ? -29.343 -5.394  37.034  1.00 24.86  ?  144 PHE C CD2 1 
ATOM   3566  C  CE1 . PHE C  1 144 ? -27.051 -6.982  36.780  1.00 21.62  ?  144 PHE C CE1 1 
ATOM   3567  C  CE2 . PHE C  1 144 ? -28.442 -5.489  38.091  1.00 22.54  ?  144 PHE C CE2 1 
ATOM   3568  C  CZ  . PHE C  1 144 ? -27.289 -6.293  37.968  1.00 21.64  ?  144 PHE C CZ  1 
ATOM   3569  N  N   . ASN C  1 145 ? -31.100 -9.017  35.918  1.00 28.98  ?  145 ASN C N   1 
ATOM   3570  C  CA  . ASN C  1 145 ? -31.949 -9.717  36.911  1.00 28.86  ?  145 ASN C CA  1 
ATOM   3571  C  C   . ASN C  1 145 ? -33.344 -10.026 36.386  1.00 29.19  ?  145 ASN C C   1 
ATOM   3572  O  O   . ASN C  1 145 ? -34.338 -9.764  37.050  1.00 29.17  ?  145 ASN C O   1 
ATOM   3573  C  CB  . ASN C  1 145 ? -32.110 -8.894  38.181  1.00 28.02  ?  145 ASN C CB  1 
ATOM   3574  C  CG  . ASN C  1 145 ? -30.802 -8.578  38.840  1.00 29.76  ?  145 ASN C CG  1 
ATOM   3575  O  OD1 . ASN C  1 145 ? -29.795 -9.254  38.611  1.00 33.50  ?  145 ASN C OD1 1 
ATOM   3576  N  ND2 . ASN C  1 145 ? -30.800 -7.557  39.691  1.00 30.31  ?  145 ASN C ND2 1 
ATOM   3577  N  N   . TRP C  1 146 ? -33.448 -10.561 35.186  1.00 29.07  ?  146 TRP C N   1 
ATOM   3578  C  CA  . TRP C  1 146 ? -34.777 -10.780 34.656  1.00 29.43  ?  146 TRP C CA  1 
ATOM   3579  C  C   . TRP C  1 146 ? -35.699 -11.642 35.576  1.00 30.39  ?  146 TRP C C   1 
ATOM   3580  O  O   . TRP C  1 146 ? -35.313 -12.737 35.996  1.00 30.54  ?  146 TRP C O   1 
ATOM   3581  C  CB  . TRP C  1 146 ? -34.686 -11.320 33.231  1.00 28.43  ?  146 TRP C CB  1 
ATOM   3582  C  CG  . TRP C  1 146 ? -35.862 -10.974 32.361  1.00 27.27  ?  146 TRP C CG  1 
ATOM   3583  C  CD1 . TRP C  1 146 ? -36.657 -11.849 31.676  1.00 26.38  ?  146 TRP C CD1 1 
ATOM   3584  C  CD2 . TRP C  1 146 ? -36.386 -9.670  32.098  1.00 25.63  ?  146 TRP C CD2 1 
ATOM   3585  N  NE1 . TRP C  1 146 ? -37.616 -11.170 30.979  1.00 27.51  ?  146 TRP C NE1 1 
ATOM   3586  C  CE2 . TRP C  1 146 ? -37.471 -9.830  31.216  1.00 25.46  ?  146 TRP C CE2 1 
ATOM   3587  C  CE3 . TRP C  1 146 ? -36.006 -8.374  32.479  1.00 26.00  ?  146 TRP C CE3 1 
ATOM   3588  C  CZ2 . TRP C  1 146 ? -38.203 -8.753  30.729  1.00 26.07  ?  146 TRP C CZ2 1 
ATOM   3589  C  CZ3 . TRP C  1 146 ? -36.736 -7.298  32.003  1.00 24.17  ?  146 TRP C CZ3 1 
ATOM   3590  C  CH2 . TRP C  1 146 ? -37.822 -7.495  31.140  1.00 25.23  ?  146 TRP C CH2 1 
ATOM   3591  N  N   . PRO C  1 147 ? -36.914 -11.132 35.892  1.00 31.40  ?  147 PRO C N   1 
ATOM   3592  C  CA  . PRO C  1 147 ? -37.973 -11.761 36.720  1.00 31.98  ?  147 PRO C CA  1 
ATOM   3593  C  C   . PRO C  1 147 ? -38.571 -13.055 36.162  1.00 32.70  ?  147 PRO C C   1 
ATOM   3594  O  O   . PRO C  1 147 ? -39.157 -13.844 36.932  1.00 31.82  ?  147 PRO C O   1 
ATOM   3595  C  CB  . PRO C  1 147 ? -39.080 -10.699 36.739  1.00 32.10  ?  147 PRO C CB  1 
ATOM   3596  C  CG  . PRO C  1 147 ? -38.412 -9.427  36.529  1.00 31.93  ?  147 PRO C CG  1 
ATOM   3597  C  CD  . PRO C  1 147 ? -37.189 -9.699  35.675  1.00 31.68  ?  147 PRO C CD  1 
ATOM   3598  N  N   . PHE C  1 148 ? -38.450 -13.235 34.840  1.00 33.13  ?  148 PHE C N   1 
ATOM   3599  C  CA  . PHE C  1 148 ? -39.042 -14.364 34.118  1.00 33.98  ?  148 PHE C CA  1 
ATOM   3600  C  C   . PHE C  1 148 ? -37.944 -15.354 33.695  1.00 35.77  ?  148 PHE C C   1 
ATOM   3601  O  O   . PHE C  1 148 ? -36.739 -15.068 33.839  1.00 35.89  ?  148 PHE C O   1 
ATOM   3602  C  CB  . PHE C  1 148 ? -39.801 -13.878 32.880  1.00 33.22  ?  148 PHE C CB  1 
ATOM   3603  C  CG  . PHE C  1 148 ? -40.821 -12.823 33.165  1.00 32.71  ?  148 PHE C CG  1 
ATOM   3604  C  CD1 . PHE C  1 148 ? -40.449 -11.497 33.342  1.00 30.49  ?  148 PHE C CD1 1 
ATOM   3605  C  CD2 . PHE C  1 148 ? -42.177 -13.149 33.258  1.00 32.17  ?  148 PHE C CD2 1 
ATOM   3606  C  CE1 . PHE C  1 148 ? -41.423 -10.519 33.624  1.00 31.10  ?  148 PHE C CE1 1 
ATOM   3607  C  CE2 . PHE C  1 148 ? -43.137 -12.175 33.541  1.00 29.23  ?  148 PHE C CE2 1 
ATOM   3608  C  CZ  . PHE C  1 148 ? -42.762 -10.869 33.726  1.00 28.40  ?  148 PHE C CZ  1 
ATOM   3609  N  N   . THR C  1 149 ? -38.370 -16.497 33.158  1.00 37.08  ?  149 THR C N   1 
ATOM   3610  C  CA  . THR C  1 149 ? -37.466 -17.573 32.765  1.00 38.68  ?  149 THR C CA  1 
ATOM   3611  C  C   . THR C  1 149 ? -37.286 -17.671 31.253  1.00 39.64  ?  149 THR C C   1 
ATOM   3612  O  O   . THR C  1 149 ? -37.455 -16.690 30.534  1.00 39.90  ?  149 THR C O   1 
ATOM   3613  C  CB  . THR C  1 149 ? -38.034 -18.928 33.212  1.00 38.66  ?  149 THR C CB  1 
ATOM   3614  O  OG1 . THR C  1 149 ? -39.360 -19.070 32.679  1.00 39.04  ?  149 THR C OG1 1 
ATOM   3615  C  CG2 . THR C  1 149 ? -38.072 -19.018 34.724  1.00 38.22  ?  149 THR C CG2 1 
ATOM   3616  N  N   . LYS C  1 150 ? -37.009 -18.902 30.794  1.00 41.04  ?  150 LYS C N   1 
ATOM   3617  C  CA  . LYS C  1 150 ? -36.500 -19.242 29.438  1.00 41.00  ?  150 LYS C CA  1 
ATOM   3618  C  C   . LYS C  1 150 ? -35.072 -18.779 29.285  1.00 40.42  ?  150 LYS C C   1 
ATOM   3619  O  O   . LYS C  1 150 ? -34.578 -18.056 30.141  1.00 39.71  ?  150 LYS C O   1 
ATOM   3620  C  CB  . LYS C  1 150 ? -37.378 -18.687 28.318  1.00 41.06  ?  150 LYS C CB  1 
ATOM   3621  C  CG  . LYS C  1 150 ? -38.227 -19.743 27.668  1.00 42.66  ?  150 LYS C CG  1 
ATOM   3622  C  CD  . LYS C  1 150 ? -37.422 -20.524 26.626  1.00 44.98  ?  150 LYS C CD  1 
ATOM   3623  C  CE  . LYS C  1 150 ? -38.076 -21.872 26.310  1.00 46.18  ?  150 LYS C CE  1 
ATOM   3624  N  NZ  . LYS C  1 150 ? -38.013 -22.815 27.475  1.00 46.54  ?  150 LYS C NZ  1 
ATOM   3625  N  N   . MET D  1 1   ? -4.314  56.229  -15.283 1.00 39.16  ?  1   MET D N   1 
ATOM   3626  C  CA  . MET D  1 1   ? -5.451  55.381  -14.832 1.00 38.84  ?  1   MET D CA  1 
ATOM   3627  C  C   . MET D  1 1   ? -6.732  55.628  -15.630 1.00 38.58  ?  1   MET D C   1 
ATOM   3628  O  O   . MET D  1 1   ? -7.072  56.779  -15.991 1.00 38.73  ?  1   MET D O   1 
ATOM   3629  C  CB  . MET D  1 1   ? -5.714  55.614  -13.362 1.00 39.12  ?  1   MET D CB  1 
ATOM   3630  C  CG  . MET D  1 1   ? -6.033  57.046  -13.072 1.00 39.53  ?  1   MET D CG  1 
ATOM   3631  S  SD  . MET D  1 1   ? -7.610  57.093  -12.263 1.00 39.14  ?  1   MET D SD  1 
ATOM   3632  C  CE  . MET D  1 1   ? -7.098  56.728  -10.559 1.00 38.70  ?  1   MET D CE  1 
ATOM   3633  N  N   . PHE D  1 2   ? -7.446  54.534  -15.887 1.00 37.68  ?  2   PHE D N   1 
ATOM   3634  C  CA  . PHE D  1 2   ? -8.554  54.543  -16.844 1.00 36.66  ?  2   PHE D CA  1 
ATOM   3635  C  C   . PHE D  1 2   ? -9.746  55.375  -16.404 1.00 35.81  ?  2   PHE D C   1 
ATOM   3636  O  O   . PHE D  1 2   ? -10.125 55.326  -15.245 1.00 35.46  ?  2   PHE D O   1 
ATOM   3637  C  CB  . PHE D  1 2   ? -9.028  53.112  -17.105 1.00 36.58  ?  2   PHE D CB  1 
ATOM   3638  C  CG  . PHE D  1 2   ? -10.345 53.038  -17.838 1.00 36.41  ?  2   PHE D CG  1 
ATOM   3639  C  CD1 . PHE D  1 2   ? -10.377 53.018  -19.225 1.00 34.59  ?  2   PHE D CD1 1 
ATOM   3640  C  CD2 . PHE D  1 2   ? -11.548 52.997  -17.136 1.00 36.87  ?  2   PHE D CD2 1 
ATOM   3641  C  CE1 . PHE D  1 2   ? -11.565 52.960  -19.909 1.00 34.53  ?  2   PHE D CE1 1 
ATOM   3642  C  CE2 . PHE D  1 2   ? -12.759 52.917  -17.813 1.00 36.52  ?  2   PHE D CE2 1 
ATOM   3643  C  CZ  . PHE D  1 2   ? -12.761 52.900  -19.206 1.00 37.12  ?  2   PHE D CZ  1 
ATOM   3644  N  N   . LYS D  1 3   ? -10.338 56.113  -17.346 1.00 35.21  ?  3   LYS D N   1 
ATOM   3645  C  CA  . LYS D  1 3   ? -11.611 56.835  -17.151 1.00 34.01  ?  3   LYS D CA  1 
ATOM   3646  C  C   . LYS D  1 3   ? -12.382 56.858  -18.473 1.00 33.27  ?  3   LYS D C   1 
ATOM   3647  O  O   . LYS D  1 3   ? -11.790 57.087  -19.532 1.00 34.05  ?  3   LYS D O   1 
ATOM   3648  C  CB  . LYS D  1 3   ? -11.363 58.260  -16.659 1.00 33.54  ?  3   LYS D CB  1 
ATOM   3649  C  CG  . LYS D  1 3   ? -10.754 58.330  -15.246 1.00 34.75  ?  3   LYS D CG  1 
ATOM   3650  C  CD  . LYS D  1 3   ? -10.399 59.738  -14.750 1.00 36.42  ?  3   LYS D CD  1 
ATOM   3651  C  CE  . LYS D  1 3   ? -9.025  60.210  -15.225 1.00 39.38  ?  3   LYS D CE  1 
ATOM   3652  N  NZ  . LYS D  1 3   ? -8.559  61.460  -14.497 1.00 41.34  ?  3   LYS D NZ  1 
ATOM   3653  N  N   . PRO D  1 4   ? -13.699 56.615  -18.442 1.00 32.14  ?  4   PRO D N   1 
ATOM   3654  C  CA  . PRO D  1 4   ? -14.370 56.632  -19.731 1.00 31.60  ?  4   PRO D CA  1 
ATOM   3655  C  C   . PRO D  1 4   ? -14.792 58.051  -20.073 1.00 31.28  ?  4   PRO D C   1 
ATOM   3656  O  O   . PRO D  1 4   ? -14.575 58.945  -19.274 1.00 31.97  ?  4   PRO D O   1 
ATOM   3657  C  CB  . PRO D  1 4   ? -15.586 55.753  -19.488 1.00 31.02  ?  4   PRO D CB  1 
ATOM   3658  C  CG  . PRO D  1 4   ? -15.917 56.002  -18.072 1.00 31.44  ?  4   PRO D CG  1 
ATOM   3659  C  CD  . PRO D  1 4   ? -14.628 56.262  -17.354 1.00 32.02  ?  4   PRO D CD  1 
ATOM   3660  N  N   . HIS D  1 5   ? -15.345 58.250  -21.258 1.00 30.11  ?  5   HIS D N   1 
ATOM   3661  C  CA  . HIS D  1 5   ? -15.994 59.484  -21.592 1.00 29.27  ?  5   HIS D CA  1 
ATOM   3662  C  C   . HIS D  1 5   ? -17.372 59.358  -21.019 1.00 28.64  ?  5   HIS D C   1 
ATOM   3663  O  O   . HIS D  1 5   ? -17.968 58.279  -21.011 1.00 27.63  ?  5   HIS D O   1 
ATOM   3664  C  CB  . HIS D  1 5   ? -16.151 59.671  -23.112 1.00 29.48  ?  5   HIS D CB  1 
ATOM   3665  C  CG  . HIS D  1 5   ? -14.888 60.027  -23.844 1.00 31.54  ?  5   HIS D CG  1 
ATOM   3666  N  ND1 . HIS D  1 5   ? -14.893 60.828  -24.968 1.00 30.26  ?  5   HIS D ND1 1 
ATOM   3667  C  CD2 . HIS D  1 5   ? -13.587 59.673  -23.639 1.00 33.82  ?  5   HIS D CD2 1 
ATOM   3668  C  CE1 . HIS D  1 5   ? -13.655 60.943  -25.426 1.00 33.09  ?  5   HIS D CE1 1 
ATOM   3669  N  NE2 . HIS D  1 5   ? -12.843 60.255  -24.639 1.00 32.91  ?  5   HIS D NE2 1 
ATOM   3670  N  N   . VAL D  1 6   ? -17.898 60.506  -20.607 1.00 28.36  ?  6   VAL D N   1 
ATOM   3671  C  CA  . VAL D  1 6   ? -19.218 60.625  -20.020 1.00 27.24  ?  6   VAL D CA  1 
ATOM   3672  C  C   . VAL D  1 6   ? -19.953 61.673  -20.771 1.00 26.57  ?  6   VAL D C   1 
ATOM   3673  O  O   . VAL D  1 6   ? -19.478 62.795  -20.916 1.00 26.47  ?  6   VAL D O   1 
ATOM   3674  C  CB  . VAL D  1 6   ? -19.128 61.088  -18.560 1.00 27.09  ?  6   VAL D CB  1 
ATOM   3675  C  CG1 . VAL D  1 6   ? -20.520 61.221  -17.964 1.00 27.49  ?  6   VAL D CG1 1 
ATOM   3676  C  CG2 . VAL D  1 6   ? -18.262 60.117  -17.752 1.00 27.76  ?  6   VAL D CG2 1 
ATOM   3677  N  N   . THR D  1 7   ? -21.136 61.325  -21.216 1.00 26.26  ?  7   THR D N   1 
ATOM   3678  C  CA  . THR D  1 7   ? -21.927 62.235  -22.004 1.00 27.27  ?  7   THR D CA  1 
ATOM   3679  C  C   . THR D  1 7   ? -23.394 62.129  -21.627 1.00 27.20  ?  7   THR D C   1 
ATOM   3680  O  O   . THR D  1 7   ? -23.821 61.167  -20.969 1.00 28.23  ?  7   THR D O   1 
ATOM   3681  C  CB  . THR D  1 7   ? -21.782 61.931  -23.534 1.00 27.68  ?  7   THR D CB  1 
ATOM   3682  O  OG1 . THR D  1 7   ? -22.408 60.679  -23.840 1.00 28.63  ?  7   THR D OG1 1 
ATOM   3683  C  CG2 . THR D  1 7   ? -20.329 61.836  -23.943 1.00 27.76  ?  7   THR D CG2 1 
ATOM   3684  N  N   . VAL D  1 8   ? -24.178 63.095  -22.067 1.00 27.03  ?  8   VAL D N   1 
ATOM   3685  C  CA  . VAL D  1 8   ? -25.596 63.082  -21.796 1.00 27.45  ?  8   VAL D CA  1 
ATOM   3686  C  C   . VAL D  1 8   ? -26.308 63.342  -23.081 1.00 27.34  ?  8   VAL D C   1 
ATOM   3687  O  O   . VAL D  1 8   ? -25.709 63.793  -24.051 1.00 27.19  ?  8   VAL D O   1 
ATOM   3688  C  CB  . VAL D  1 8   ? -26.040 64.201  -20.818 1.00 28.01  ?  8   VAL D CB  1 
ATOM   3689  C  CG1 . VAL D  1 8   ? -25.798 63.806  -19.361 1.00 29.00  ?  8   VAL D CG1 1 
ATOM   3690  C  CG2 . VAL D  1 8   ? -25.356 65.515  -21.169 1.00 29.37  ?  8   VAL D CG2 1 
ATOM   3691  N  N   . ALA D  1 9   ? -27.601 63.099  -23.058 1.00 27.50  ?  9   ALA D N   1 
ATOM   3692  C  CA  . ALA D  1 9   ? -28.386 63.232  -24.215 1.00 28.98  ?  9   ALA D CA  1 
ATOM   3693  C  C   . ALA D  1 9   ? -29.849 63.281  -23.798 1.00 30.33  ?  9   ALA D C   1 
ATOM   3694  O  O   . ALA D  1 9   ? -30.246 62.686  -22.774 1.00 31.08  ?  9   ALA D O   1 
ATOM   3695  C  CB  . ALA D  1 9   ? -28.116 62.064  -25.123 1.00 29.68  ?  9   ALA D CB  1 
ATOM   3696  N  N   . CYS D  1 10  ? -30.658 63.987  -24.577 1.00 31.23  ?  10  CYS D N   1 
ATOM   3697  C  CA  . CYS D  1 10  ? -32.021 64.167  -24.188 1.00 33.71  ?  10  CYS D CA  1 
ATOM   3698  C  C   . CYS D  1 10  ? -32.962 63.741  -25.288 1.00 33.89  ?  10  CYS D C   1 
ATOM   3699  O  O   . CYS D  1 10  ? -32.730 64.026  -26.447 1.00 34.72  ?  10  CYS D O   1 
ATOM   3700  C  CB  . CYS D  1 10  ? -32.268 65.637  -23.796 1.00 34.89  ?  10  CYS D CB  1 
ATOM   3701  S  SG  . CYS D  1 10  ? -30.981 66.395  -22.681 1.00 38.86  ?  10  CYS D SG  1 
ATOM   3702  N  N   . VAL D  1 11  ? -34.019 63.047  -24.905 1.00 33.96  ?  11  VAL D N   1 
ATOM   3703  C  CA  . VAL D  1 11  ? -35.056 62.666  -25.815 1.00 34.29  ?  11  VAL D CA  1 
ATOM   3704  C  C   . VAL D  1 11  ? -36.148 63.730  -25.700 1.00 35.47  ?  11  VAL D C   1 
ATOM   3705  O  O   . VAL D  1 11  ? -37.082 63.626  -24.898 1.00 35.95  ?  11  VAL D O   1 
ATOM   3706  C  CB  . VAL D  1 11  ? -35.584 61.194  -25.521 1.00 33.83  ?  11  VAL D CB  1 
ATOM   3707  C  CG1 . VAL D  1 11  ? -36.963 60.922  -26.171 1.00 32.08  ?  11  VAL D CG1 1 
ATOM   3708  C  CG2 . VAL D  1 11  ? -34.527 60.129  -25.909 1.00 31.81  ?  11  VAL D CG2 1 
ATOM   3709  N  N   . VAL D  1 12  ? -36.038 64.758  -26.523 1.00 36.56  ?  12  VAL D N   1 
ATOM   3710  C  CA  . VAL D  1 12  ? -36.989 65.850  -26.458 1.00 37.35  ?  12  VAL D CA  1 
ATOM   3711  C  C   . VAL D  1 12  ? -38.191 65.535  -27.319 1.00 38.33  ?  12  VAL D C   1 
ATOM   3712  O  O   . VAL D  1 12  ? -38.041 65.099  -28.455 1.00 38.52  ?  12  VAL D O   1 
ATOM   3713  C  CB  . VAL D  1 12  ? -36.347 67.103  -26.946 1.00 37.17  ?  12  VAL D CB  1 
ATOM   3714  C  CG1 . VAL D  1 12  ? -37.262 68.297  -26.667 1.00 38.09  ?  12  VAL D CG1 1 
ATOM   3715  C  CG2 . VAL D  1 12  ? -34.972 67.256  -26.291 1.00 37.21  ?  12  VAL D CG2 1 
ATOM   3716  N  N   . HIS D  1 13  ? -39.383 65.790  -26.803 1.00 39.45  ?  13  HIS D N   1 
ATOM   3717  C  CA  . HIS D  1 13  ? -40.576 65.273  -27.447 1.00 41.13  ?  13  HIS D CA  1 
ATOM   3718  C  C   . HIS D  1 13  ? -41.837 66.186  -27.411 1.00 43.54  ?  13  HIS D C   1 
ATOM   3719  O  O   . HIS D  1 13  ? -42.276 66.649  -26.338 1.00 44.37  ?  13  HIS D O   1 
ATOM   3720  C  CB  . HIS D  1 13  ? -40.852 63.898  -26.850 1.00 40.46  ?  13  HIS D CB  1 
ATOM   3721  C  CG  . HIS D  1 13  ? -42.203 63.358  -27.156 1.00 38.21  ?  13  HIS D CG  1 
ATOM   3722  N  ND1 . HIS D  1 13  ? -42.534 62.837  -28.386 1.00 37.04  ?  13  HIS D ND1 1 
ATOM   3723  C  CD2 . HIS D  1 13  ? -43.302 63.231  -26.383 1.00 36.67  ?  13  HIS D CD2 1 
ATOM   3724  C  CE1 . HIS D  1 13  ? -43.787 62.421  -28.363 1.00 38.34  ?  13  HIS D CE1 1 
ATOM   3725  N  NE2 . HIS D  1 13  ? -44.276 62.649  -27.157 1.00 39.03  ?  13  HIS D NE2 1 
ATOM   3726  N  N   . ALA D  1 14  ? -42.430 66.421  -28.588 1.00 45.53  ?  14  ALA D N   1 
ATOM   3727  C  CA  . ALA D  1 14  ? -43.617 67.278  -28.710 1.00 47.09  ?  14  ALA D CA  1 
ATOM   3728  C  C   . ALA D  1 14  ? -44.581 66.798  -29.777 1.00 48.14  ?  14  ALA D C   1 
ATOM   3729  O  O   . ALA D  1 14  ? -44.190 66.529  -30.923 1.00 48.20  ?  14  ALA D O   1 
ATOM   3730  C  CB  . ALA D  1 14  ? -43.200 68.701  -29.016 1.00 47.16  ?  14  ALA D CB  1 
ATOM   3731  N  N   . GLU D  1 15  ? -45.853 66.720  -29.398 1.00 49.57  ?  15  GLU D N   1 
ATOM   3732  C  CA  . GLU D  1 15  ? -46.920 66.390  -30.346 1.00 50.48  ?  15  GLU D CA  1 
ATOM   3733  C  C   . GLU D  1 15  ? -46.418 65.385  -31.410 1.00 49.74  ?  15  GLU D C   1 
ATOM   3734  O  O   . GLU D  1 15  ? -46.413 65.657  -32.611 1.00 49.09  ?  15  GLU D O   1 
ATOM   3735  C  CB  . GLU D  1 15  ? -47.511 67.686  -30.959 1.00 51.16  ?  15  GLU D CB  1 
ATOM   3736  C  CG  . GLU D  1 15  ? -46.466 68.753  -31.403 1.00 53.86  ?  15  GLU D CG  1 
ATOM   3737  C  CD  . GLU D  1 15  ? -47.051 70.191  -31.579 1.00 58.60  ?  15  GLU D CD  1 
ATOM   3738  O  OE1 . GLU D  1 15  ? -48.299 70.343  -31.719 1.00 57.36  ?  15  GLU D OE1 1 
ATOM   3739  O  OE2 . GLU D  1 15  ? -46.239 71.167  -31.586 1.00 60.31  -1 15  GLU D OE2 1 
ATOM   3740  N  N   . GLY D  1 16  ? -45.959 64.236  -30.921 1.00 49.20  ?  16  GLY D N   1 
ATOM   3741  C  CA  . GLY D  1 16  ? -45.493 63.137  -31.764 1.00 48.70  ?  16  GLY D CA  1 
ATOM   3742  C  C   . GLY D  1 16  ? -44.281 63.378  -32.647 1.00 48.15  ?  16  GLY D C   1 
ATOM   3743  O  O   . GLY D  1 16  ? -44.258 62.920  -33.774 1.00 48.53  ?  16  GLY D O   1 
ATOM   3744  N  N   . LYS D  1 17  ? -43.268 64.079  -32.154 1.00 47.66  ?  17  LYS D N   1 
ATOM   3745  C  CA  . LYS D  1 17  ? -42.064 64.321  -32.945 1.00 47.62  ?  17  LYS D CA  1 
ATOM   3746  C  C   . LYS D  1 17  ? -40.829 64.419  -32.028 1.00 46.70  ?  17  LYS D C   1 
ATOM   3747  O  O   . LYS D  1 17  ? -40.983 64.749  -30.872 1.00 46.66  ?  17  LYS D O   1 
ATOM   3748  C  CB  . LYS D  1 17  ? -42.240 65.570  -33.831 1.00 48.29  ?  17  LYS D CB  1 
ATOM   3749  C  CG  . LYS D  1 17  ? -42.942 65.317  -35.196 1.00 50.13  ?  17  LYS D CG  1 
ATOM   3750  C  CD  . LYS D  1 17  ? -42.688 66.493  -36.165 1.00 54.43  ?  17  LYS D CD  1 
ATOM   3751  C  CE  . LYS D  1 17  ? -42.466 66.083  -37.644 1.00 55.64  ?  17  LYS D CE  1 
ATOM   3752  N  NZ  . LYS D  1 17  ? -43.681 66.323  -38.494 1.00 56.84  ?  17  LYS D NZ  1 
ATOM   3753  N  N   . PHE D  1 18  ? -39.631 64.114  -32.531 1.00 45.47  ?  18  PHE D N   1 
ATOM   3754  C  CA  . PHE D  1 18  ? -38.437 63.983  -31.685 1.00 44.99  ?  18  PHE D CA  1 
ATOM   3755  C  C   . PHE D  1 18  ? -37.297 64.846  -32.182 1.00 45.33  ?  18  PHE D C   1 
ATOM   3756  O  O   . PHE D  1 18  ? -36.899 64.763  -33.363 1.00 45.66  ?  18  PHE D O   1 
ATOM   3757  C  CB  . PHE D  1 18  ? -37.962 62.516  -31.565 1.00 44.76  ?  18  PHE D CB  1 
ATOM   3758  C  CG  . PHE D  1 18  ? -38.895 61.639  -30.766 1.00 42.77  ?  18  PHE D CG  1 
ATOM   3759  C  CD1 . PHE D  1 18  ? -38.770 61.543  -29.384 1.00 42.12  ?  18  PHE D CD1 1 
ATOM   3760  C  CD2 . PHE D  1 18  ? -39.911 60.935  -31.393 1.00 40.79  ?  18  PHE D CD2 1 
ATOM   3761  C  CE1 . PHE D  1 18  ? -39.669 60.756  -28.634 1.00 43.22  ?  18  PHE D CE1 1 
ATOM   3762  C  CE2 . PHE D  1 18  ? -40.798 60.145  -30.664 1.00 41.95  ?  18  PHE D CE2 1 
ATOM   3763  C  CZ  . PHE D  1 18  ? -40.685 60.051  -29.281 1.00 41.36  ?  18  PHE D CZ  1 
ATOM   3764  N  N   . LEU D  1 19  ? -36.767 65.674  -31.287 1.00 45.02  ?  19  LEU D N   1 
ATOM   3765  C  CA  . LEU D  1 19  ? -35.806 66.655  -31.723 1.00 45.23  ?  19  LEU D CA  1 
ATOM   3766  C  C   . LEU D  1 19  ? -34.454 66.019  -31.909 1.00 45.52  ?  19  LEU D C   1 
ATOM   3767  O  O   . LEU D  1 19  ? -33.943 65.338  -31.028 1.00 45.38  ?  19  LEU D O   1 
ATOM   3768  C  CB  . LEU D  1 19  ? -35.720 67.871  -30.794 1.00 45.21  ?  19  LEU D CB  1 
ATOM   3769  C  CG  . LEU D  1 19  ? -34.565 68.789  -31.244 1.00 45.27  ?  19  LEU D CG  1 
ATOM   3770  C  CD1 . LEU D  1 19  ? -34.904 69.778  -32.406 1.00 45.23  ?  19  LEU D CD1 1 
ATOM   3771  C  CD2 . LEU D  1 19  ? -33.957 69.513  -30.069 1.00 46.94  ?  19  LEU D CD2 1 
ATOM   3772  N  N   . VAL D  1 20  ? -33.885 66.258  -33.081 1.00 46.54  ?  20  VAL D N   1 
ATOM   3773  C  CA  . VAL D  1 20  ? -32.589 65.715  -33.431 1.00 47.51  ?  20  VAL D CA  1 
ATOM   3774  C  C   . VAL D  1 20  ? -31.800 66.799  -34.133 1.00 48.12  ?  20  VAL D C   1 
ATOM   3775  O  O   . VAL D  1 20  ? -32.387 67.673  -34.777 1.00 48.52  ?  20  VAL D O   1 
ATOM   3776  C  CB  . VAL D  1 20  ? -32.717 64.425  -34.321 1.00 47.63  ?  20  VAL D CB  1 
ATOM   3777  C  CG1 . VAL D  1 20  ? -34.101 64.322  -34.946 1.00 46.62  ?  20  VAL D CG1 1 
ATOM   3778  C  CG2 . VAL D  1 20  ? -31.615 64.373  -35.389 1.00 47.52  ?  20  VAL D CG2 1 
ATOM   3779  N  N   . VAL D  1 21  ? -30.481 66.726  -33.980 1.00 48.50  ?  21  VAL D N   1 
ATOM   3780  C  CA  . VAL D  1 21  ? -29.542 67.642  -34.588 1.00 49.62  ?  21  VAL D CA  1 
ATOM   3781  C  C   . VAL D  1 21  ? -28.765 67.018  -35.793 1.00 51.14  ?  21  VAL D C   1 
ATOM   3782  O  O   . VAL D  1 21  ? -28.545 65.794  -35.849 1.00 51.32  ?  21  VAL D O   1 
ATOM   3783  C  CB  . VAL D  1 21  ? -28.570 68.180  -33.512 1.00 49.21  ?  21  VAL D CB  1 
ATOM   3784  C  CG1 . VAL D  1 21  ? -29.328 68.536  -32.275 1.00 49.04  ?  21  VAL D CG1 1 
ATOM   3785  C  CG2 . VAL D  1 21  ? -27.485 67.171  -33.169 1.00 49.21  ?  21  VAL D CG2 1 
ATOM   3786  N  N   . GLU D  1 22  ? -28.362 67.856  -36.755 1.00 52.50  ?  22  GLU D N   1 
ATOM   3787  C  CA  . GLU D  1 22  ? -27.583 67.386  -37.900 1.00 53.79  ?  22  GLU D CA  1 
ATOM   3788  C  C   . GLU D  1 22  ? -26.137 67.806  -37.744 1.00 54.50  ?  22  GLU D C   1 
ATOM   3789  O  O   . GLU D  1 22  ? -25.869 68.840  -37.161 1.00 54.87  ?  22  GLU D O   1 
ATOM   3790  C  CB  . GLU D  1 22  ? -28.154 67.913  -39.215 1.00 54.23  ?  22  GLU D CB  1 
ATOM   3791  C  CG  . GLU D  1 22  ? -29.497 67.280  -39.626 1.00 55.20  ?  22  GLU D CG  1 
ATOM   3792  C  CD  . GLU D  1 22  ? -29.798 67.392  -41.130 1.00 56.12  ?  22  GLU D CD  1 
ATOM   3793  O  OE1 . GLU D  1 22  ? -31.014 67.395  -41.477 1.00 53.52  ?  22  GLU D OE1 1 
ATOM   3794  O  OE2 . GLU D  1 22  ? -28.826 67.471  -41.946 1.00 56.47  -1 22  GLU D OE2 1 
ATOM   3795  N  N   . GLU D  1 23  ? -25.209 67.019  -38.280 1.00 55.73  ?  23  GLU D N   1 
ATOM   3796  C  CA  . GLU D  1 23  ? -23.795 67.171  -37.952 1.00 56.98  ?  23  GLU D CA  1 
ATOM   3797  C  C   . GLU D  1 23  ? -22.916 66.532  -39.028 1.00 57.75  ?  23  GLU D C   1 
ATOM   3798  O  O   . GLU D  1 23  ? -22.813 65.308  -39.125 1.00 57.73  ?  23  GLU D O   1 
ATOM   3799  C  CB  . GLU D  1 23  ? -23.519 66.492  -36.608 1.00 57.09  ?  23  GLU D CB  1 
ATOM   3800  C  CG  . GLU D  1 23  ? -22.931 67.377  -35.507 1.00 57.99  ?  23  GLU D CG  1 
ATOM   3801  C  CD  . GLU D  1 23  ? -22.937 66.682  -34.130 1.00 59.61  ?  23  GLU D CD  1 
ATOM   3802  O  OE1 . GLU D  1 23  ? -23.958 66.045  -33.753 1.00 59.15  ?  23  GLU D OE1 1 
ATOM   3803  O  OE2 . GLU D  1 23  ? -21.904 66.769  -33.427 1.00 60.49  -1 23  GLU D OE2 1 
ATOM   3804  N  N   . THR D  1 24  ? -22.277 67.357  -39.839 1.00 58.69  ?  24  THR D N   1 
ATOM   3805  C  CA  . THR D  1 24  ? -21.406 66.838  -40.870 1.00 59.82  ?  24  THR D CA  1 
ATOM   3806  C  C   . THR D  1 24  ? -20.092 66.403  -40.211 1.00 60.97  ?  24  THR D C   1 
ATOM   3807  O  O   . THR D  1 24  ? -19.207 67.230  -39.973 1.00 60.83  ?  24  THR D O   1 
ATOM   3808  C  CB  . THR D  1 24  ? -21.186 67.892  -41.996 1.00 59.86  ?  24  THR D CB  1 
ATOM   3809  O  OG1 . THR D  1 24  ? -22.451 68.459  -42.388 1.00 59.94  ?  24  THR D OG1 1 
ATOM   3810  C  CG2 . THR D  1 24  ? -20.489 67.278  -43.211 1.00 58.72  ?  24  THR D CG2 1 
ATOM   3811  N  N   . ILE D  1 25  ? -19.971 65.113  -39.886 1.00 62.26  ?  25  ILE D N   1 
ATOM   3812  C  CA  . ILE D  1 25  ? -18.714 64.625  -39.287 1.00 63.28  ?  25  ILE D CA  1 
ATOM   3813  C  C   . ILE D  1 25  ? -17.678 64.418  -40.404 1.00 63.90  ?  25  ILE D C   1 
ATOM   3814  O  O   . ILE D  1 25  ? -16.777 65.261  -40.562 1.00 64.36  ?  25  ILE D O   1 
ATOM   3815  C  CB  . ILE D  1 25  ? -18.882 63.374  -38.325 1.00 63.34  ?  25  ILE D CB  1 
ATOM   3816  C  CG1 . ILE D  1 25  ? -19.810 63.692  -37.136 1.00 62.78  ?  25  ILE D CG1 1 
ATOM   3817  C  CG2 . ILE D  1 25  ? -17.510 62.884  -37.798 1.00 63.35  ?  25  ILE D CG2 1 
ATOM   3818  C  CD1 . ILE D  1 25  ? -19.181 64.507  -35.987 1.00 62.37  ?  25  ILE D CD1 1 
ATOM   3819  N  N   . ASN D  1 26  ? -17.806 63.325  -41.170 1.00 64.32  ?  26  ASN D N   1 
ATOM   3820  C  CA  . ASN D  1 26  ? -17.037 63.164  -42.420 1.00 64.43  ?  26  ASN D CA  1 
ATOM   3821  C  C   . ASN D  1 26  ? -17.960 63.410  -43.609 1.00 64.56  ?  26  ASN D C   1 
ATOM   3822  O  O   . ASN D  1 26  ? -18.636 62.484  -44.093 1.00 64.77  ?  26  ASN D O   1 
ATOM   3823  C  CB  . ASN D  1 26  ? -16.390 61.775  -42.547 1.00 64.20  ?  26  ASN D CB  1 
ATOM   3824  C  CG  . ASN D  1 26  ? -15.487 61.415  -41.366 1.00 64.72  ?  26  ASN D CG  1 
ATOM   3825  O  OD1 . ASN D  1 26  ? -15.174 62.245  -40.498 1.00 64.18  ?  26  ASN D OD1 1 
ATOM   3826  N  ND2 . ASN D  1 26  ? -15.062 60.156  -41.334 1.00 64.78  ?  26  ASN D ND2 1 
ATOM   3827  N  N   . GLY D  1 27  ? -18.026 64.668  -44.046 1.00 64.19  ?  27  GLY D N   1 
ATOM   3828  C  CA  . GLY D  1 27  ? -18.798 65.036  -45.235 1.00 63.61  ?  27  GLY D CA  1 
ATOM   3829  C  C   . GLY D  1 27  ? -20.274 64.650  -45.244 1.00 63.14  ?  27  GLY D C   1 
ATOM   3830  O  O   . GLY D  1 27  ? -21.025 65.036  -46.159 1.00 63.03  ?  27  GLY D O   1 
ATOM   3831  N  N   . LYS D  1 28  ? -20.718 63.884  -44.250 1.00 62.48  ?  28  LYS D N   1 
ATOM   3832  C  CA  . LYS D  1 28  ? -22.150 63.617  -44.197 1.00 61.94  ?  28  LYS D CA  1 
ATOM   3833  C  C   . LYS D  1 28  ? -22.848 64.159  -42.963 1.00 61.01  ?  28  LYS D C   1 
ATOM   3834  O  O   . LYS D  1 28  ? -22.292 64.163  -41.861 1.00 61.08  ?  28  LYS D O   1 
ATOM   3835  C  CB  . LYS D  1 28  ? -22.527 62.146  -44.465 1.00 61.99  ?  28  LYS D CB  1 
ATOM   3836  C  CG  . LYS D  1 28  ? -23.762 62.033  -45.415 1.00 62.74  ?  28  LYS D CG  1 
ATOM   3837  C  CD  . LYS D  1 28  ? -24.877 61.103  -44.891 1.00 64.61  ?  28  LYS D CD  1 
ATOM   3838  C  CE  . LYS D  1 28  ? -24.478 59.602  -44.977 1.00 65.49  ?  28  LYS D CE  1 
ATOM   3839  N  NZ  . LYS D  1 28  ? -25.532 58.625  -44.554 1.00 64.71  ?  28  LYS D NZ  1 
ATOM   3840  N  N   . ALA D  1 29  ? -24.062 64.651  -43.206 1.00 59.73  ?  29  ALA D N   1 
ATOM   3841  C  CA  . ALA D  1 29  ? -25.027 64.936  -42.178 1.00 58.81  ?  29  ALA D CA  1 
ATOM   3842  C  C   . ALA D  1 29  ? -25.466 63.596  -41.558 1.00 58.01  ?  29  ALA D C   1 
ATOM   3843  O  O   . ALA D  1 29  ? -26.118 62.757  -42.219 1.00 58.20  ?  29  ALA D O   1 
ATOM   3844  C  CB  . ALA D  1 29  ? -26.230 65.700  -42.763 1.00 58.77  ?  29  ALA D CB  1 
ATOM   3845  N  N   . LEU D  1 30  ? -25.047 63.395  -40.304 1.00 56.41  ?  30  LEU D N   1 
ATOM   3846  C  CA  . LEU D  1 30  ? -25.582 62.343  -39.432 1.00 54.02  ?  30  LEU D CA  1 
ATOM   3847  C  C   . LEU D  1 30  ? -26.499 62.967  -38.391 1.00 52.35  ?  30  LEU D C   1 
ATOM   3848  O  O   . LEU D  1 30  ? -26.397 64.158  -38.081 1.00 51.95  ?  30  LEU D O   1 
ATOM   3849  C  CB  . LEU D  1 30  ? -24.471 61.574  -38.718 1.00 54.06  ?  30  LEU D CB  1 
ATOM   3850  C  CG  . LEU D  1 30  ? -23.301 60.833  -39.393 1.00 54.05  ?  30  LEU D CG  1 
ATOM   3851  C  CD1 . LEU D  1 30  ? -23.749 60.008  -40.599 1.00 53.29  ?  30  LEU D CD1 1 
ATOM   3852  C  CD2 . LEU D  1 30  ? -22.116 61.750  -39.729 1.00 53.68  ?  30  LEU D CD2 1 
ATOM   3853  N  N   . TRP D  1 31  ? -27.398 62.148  -37.863 1.00 50.47  ?  31  TRP D N   1 
ATOM   3854  C  CA  . TRP D  1 31  ? -28.282 62.565  -36.786 1.00 48.93  ?  31  TRP D CA  1 
ATOM   3855  C  C   . TRP D  1 31  ? -27.831 62.116  -35.394 1.00 47.19  ?  31  TRP D C   1 
ATOM   3856  O  O   . TRP D  1 31  ? -27.125 61.112  -35.233 1.00 46.31  ?  31  TRP D O   1 
ATOM   3857  C  CB  . TRP D  1 31  ? -29.697 62.081  -37.039 1.00 49.25  ?  31  TRP D CB  1 
ATOM   3858  C  CG  . TRP D  1 31  ? -30.344 62.811  -38.119 1.00 50.03  ?  31  TRP D CG  1 
ATOM   3859  C  CD1 . TRP D  1 31  ? -29.888 63.938  -38.730 1.00 52.39  ?  31  TRP D CD1 1 
ATOM   3860  C  CD2 . TRP D  1 31  ? -31.604 62.511  -38.712 1.00 50.86  ?  31  TRP D CD2 1 
ATOM   3861  N  NE1 . TRP D  1 31  ? -30.771 64.343  -39.700 1.00 52.46  ?  31  TRP D NE1 1 
ATOM   3862  C  CE2 . TRP D  1 31  ? -31.838 63.487  -39.706 1.00 51.90  ?  31  TRP D CE2 1 
ATOM   3863  C  CE3 . TRP D  1 31  ? -32.554 61.505  -38.511 1.00 49.74  ?  31  TRP D CE3 1 
ATOM   3864  C  CZ2 . TRP D  1 31  ? -32.981 63.493  -40.490 1.00 53.27  ?  31  TRP D CZ2 1 
ATOM   3865  C  CZ3 . TRP D  1 31  ? -33.683 61.505  -39.282 1.00 51.92  ?  31  TRP D CZ3 1 
ATOM   3866  C  CH2 . TRP D  1 31  ? -33.897 62.497  -40.267 1.00 53.93  ?  31  TRP D CH2 1 
ATOM   3867  N  N   . ASN D  1 32  ? -28.249 62.894  -34.400 1.00 45.36  ?  32  ASN D N   1 
ATOM   3868  C  CA  . ASN D  1 32  ? -28.037 62.566  -32.998 1.00 43.43  ?  32  ASN D CA  1 
ATOM   3869  C  C   . ASN D  1 32  ? -29.084 63.216  -32.142 1.00 41.96  ?  32  ASN D C   1 
ATOM   3870  O  O   . ASN D  1 32  ? -29.763 64.142  -32.577 1.00 41.70  ?  32  ASN D O   1 
ATOM   3871  C  CB  . ASN D  1 32  ? -26.658 63.016  -32.532 1.00 43.32  ?  32  ASN D CB  1 
ATOM   3872  C  CG  . ASN D  1 32  ? -26.235 62.350  -31.229 1.00 43.67  ?  32  ASN D CG  1 
ATOM   3873  O  OD1 . ASN D  1 32  ? -26.814 61.326  -30.809 1.00 42.37  ?  32  ASN D OD1 1 
ATOM   3874  N  ND2 . ASN D  1 32  ? -25.203 62.916  -30.585 1.00 43.18  ?  32  ASN D ND2 1 
ATOM   3875  N  N   . GLN D  1 33  ? -29.234 62.717  -30.922 1.00 40.48  ?  33  GLN D N   1 
ATOM   3876  C  CA  . GLN D  1 33  ? -29.960 63.471  -29.910 1.00 38.64  ?  33  GLN D CA  1 
ATOM   3877  C  C   . GLN D  1 33  ? -29.210 64.755  -29.589 1.00 38.00  ?  33  GLN D C   1 
ATOM   3878  O  O   . GLN D  1 33  ? -28.003 64.848  -29.843 1.00 38.11  ?  33  GLN D O   1 
ATOM   3879  C  CB  . GLN D  1 33  ? -30.104 62.665  -28.635 1.00 38.13  ?  33  GLN D CB  1 
ATOM   3880  C  CG  . GLN D  1 33  ? -31.377 61.881  -28.575 1.00 35.71  ?  33  GLN D CG  1 
ATOM   3881  C  CD  . GLN D  1 33  ? -31.240 60.584  -29.273 1.00 31.47  ?  33  GLN D CD  1 
ATOM   3882  O  OE1 . GLN D  1 33  ? -30.131 60.046  -29.413 1.00 29.39  ?  33  GLN D OE1 1 
ATOM   3883  N  NE2 . GLN D  1 33  ? -32.358 60.055  -29.719 1.00 28.01  ?  33  GLN D NE2 1 
ATOM   3884  N  N   . PRO D  1 34  ? -29.915 65.753  -29.041 1.00 37.19  ?  34  PRO D N   1 
ATOM   3885  C  CA  . PRO D  1 34  ? -29.182 66.875  -28.472 1.00 37.04  ?  34  PRO D CA  1 
ATOM   3886  C  C   . PRO D  1 34  ? -28.332 66.294  -27.345 1.00 36.65  ?  34  PRO D C   1 
ATOM   3887  O  O   . PRO D  1 34  ? -28.857 65.986  -26.305 1.00 36.71  ?  34  PRO D O   1 
ATOM   3888  C  CB  . PRO D  1 34  ? -30.297 67.764  -27.908 1.00 36.97  ?  34  PRO D CB  1 
ATOM   3889  C  CG  . PRO D  1 34  ? -31.534 67.336  -28.647 1.00 37.21  ?  34  PRO D CG  1 
ATOM   3890  C  CD  . PRO D  1 34  ? -31.362 65.860  -28.810 1.00 36.77  ?  34  PRO D CD  1 
ATOM   3891  N  N   . ALA D  1 35  ? -27.044 66.097  -27.580 1.00 36.55  ?  35  ALA D N   1 
ATOM   3892  C  CA  . ALA D  1 35  ? -26.206 65.285  -26.701 1.00 36.67  ?  35  ALA D CA  1 
ATOM   3893  C  C   . ALA D  1 35  ? -24.880 65.951  -26.652 1.00 36.70  ?  35  ALA D C   1 
ATOM   3894  O  O   . ALA D  1 35  ? -24.650 66.835  -27.437 1.00 36.92  ?  35  ALA D O   1 
ATOM   3895  C  CB  . ALA D  1 35  ? -26.037 63.894  -27.254 1.00 36.22  ?  35  ALA D CB  1 
ATOM   3896  N  N   . GLY D  1 36  ? -24.014 65.529  -25.740 1.00 37.30  ?  36  GLY D N   1 
ATOM   3897  C  CA  . GLY D  1 36  ? -22.668 66.085  -25.628 1.00 38.19  ?  36  GLY D CA  1 
ATOM   3898  C  C   . GLY D  1 36  ? -21.933 65.612  -24.391 1.00 39.17  ?  36  GLY D C   1 
ATOM   3899  O  O   . GLY D  1 36  ? -22.538 64.976  -23.520 1.00 39.00  ?  36  GLY D O   1 
ATOM   3900  N  N   . HIS D  1 37  ? -20.635 65.921  -24.324 1.00 39.74  ?  37  HIS D N   1 
ATOM   3901  C  CA  . HIS D  1 37  ? -19.793 65.582  -23.184 1.00 41.00  ?  37  HIS D CA  1 
ATOM   3902  C  C   . HIS D  1 37  ? -20.096 66.426  -21.931 1.00 41.57  ?  37  HIS D C   1 
ATOM   3903  O  O   . HIS D  1 37  ? -20.716 67.485  -22.013 1.00 42.64  ?  37  HIS D O   1 
ATOM   3904  C  CB  . HIS D  1 37  ? -18.318 65.759  -23.544 1.00 41.35  ?  37  HIS D CB  1 
ATOM   3905  C  CG  . HIS D  1 37  ? -17.742 64.625  -24.330 1.00 43.97  ?  37  HIS D CG  1 
ATOM   3906  N  ND1 . HIS D  1 37  ? -18.266 64.210  -25.539 1.00 46.91  ?  37  HIS D ND1 1 
ATOM   3907  C  CD2 . HIS D  1 37  ? -16.672 63.829  -24.091 1.00 45.45  ?  37  HIS D CD2 1 
ATOM   3908  C  CE1 . HIS D  1 37  ? -17.556 63.193  -25.998 1.00 46.48  ?  37  HIS D CE1 1 
ATOM   3909  N  NE2 . HIS D  1 37  ? -16.584 62.942  -25.137 1.00 46.86  ?  37  HIS D NE2 1 
ATOM   3910  N  N   . LEU D  1 38  ? -19.638 65.946  -20.777 1.00 41.64  ?  38  LEU D N   1 
ATOM   3911  C  CA  . LEU D  1 38  ? -19.735 66.632  -19.501 1.00 41.25  ?  38  LEU D CA  1 
ATOM   3912  C  C   . LEU D  1 38  ? -18.401 67.365  -19.237 1.00 41.78  ?  38  LEU D C   1 
ATOM   3913  O  O   . LEU D  1 38  ? -17.293 66.818  -19.507 1.00 42.08  ?  38  LEU D O   1 
ATOM   3914  C  CB  . LEU D  1 38  ? -19.984 65.562  -18.434 1.00 41.05  ?  38  LEU D CB  1 
ATOM   3915  C  CG  . LEU D  1 38  ? -19.948 65.864  -16.934 1.00 40.93  ?  38  LEU D CG  1 
ATOM   3916  C  CD1 . LEU D  1 38  ? -21.309 66.340  -16.430 1.00 38.53  ?  38  LEU D CD1 1 
ATOM   3917  C  CD2 . LEU D  1 38  ? -19.466 64.631  -16.153 1.00 39.93  ?  38  LEU D CD2 1 
ATOM   3918  N  N   . GLU D  1 39  ? -18.460 68.603  -18.748 1.00 41.55  ?  39  GLU D N   1 
ATOM   3919  C  CA  . GLU D  1 39  ? -17.199 69.199  -18.291 1.00 41.62  ?  39  GLU D CA  1 
ATOM   3920  C  C   . GLU D  1 39  ? -17.049 69.211  -16.772 1.00 40.42  ?  39  GLU D C   1 
ATOM   3921  O  O   . GLU D  1 39  ? -17.871 68.652  -16.050 1.00 40.29  ?  39  GLU D O   1 
ATOM   3922  C  CB  . GLU D  1 39  ? -16.888 70.570  -18.930 1.00 42.70  ?  39  GLU D CB  1 
ATOM   3923  C  CG  . GLU D  1 39  ? -15.829 70.516  -20.053 1.00 44.77  ?  39  GLU D CG  1 
ATOM   3924  C  CD  . GLU D  1 39  ? -16.449 70.194  -21.414 1.00 49.96  ?  39  GLU D CD  1 
ATOM   3925  O  OE1 . GLU D  1 39  ? -17.541 70.772  -21.700 1.00 51.93  ?  39  GLU D OE1 1 
ATOM   3926  O  OE2 . GLU D  1 39  ? -15.857 69.370  -22.186 1.00 51.12  -1 39  GLU D OE2 1 
ATOM   3927  N  N   . ALA D  1 40  ? -15.958 69.812  -16.310 1.00 39.55  ?  40  ALA D N   1 
ATOM   3928  C  CA  . ALA D  1 40  ? -15.631 69.894  -14.890 1.00 38.51  ?  40  ALA D CA  1 
ATOM   3929  C  C   . ALA D  1 40  ? -16.726 70.578  -14.112 1.00 37.90  ?  40  ALA D C   1 
ATOM   3930  O  O   . ALA D  1 40  ? -17.520 71.325  -14.693 1.00 37.84  ?  40  ALA D O   1 
ATOM   3931  C  CB  . ALA D  1 40  ? -14.302 70.626  -14.696 1.00 38.76  ?  40  ALA D CB  1 
ATOM   3932  N  N   . ASP D  1 41  ? -16.799 70.269  -12.812 1.00 37.19  ?  41  ASP D N   1 
ATOM   3933  C  CA  . ASP D  1 41  ? -17.583 71.049  -11.862 1.00 36.14  ?  41  ASP D CA  1 
ATOM   3934  C  C   . ASP D  1 41  ? -19.009 71.264  -12.352 1.00 35.95  ?  41  ASP D C   1 
ATOM   3935  O  O   . ASP D  1 41  ? -19.564 72.362  -12.235 1.00 35.60  ?  41  ASP D O   1 
ATOM   3936  C  CB  . ASP D  1 41  ? -16.887 72.385  -11.630 1.00 36.03  ?  41  ASP D CB  1 
ATOM   3937  C  CG  . ASP D  1 41  ? -15.438 72.208  -11.197 1.00 37.11  ?  41  ASP D CG  1 
ATOM   3938  O  OD1 . ASP D  1 41  ? -14.574 73.002  -11.641 1.00 39.31  ?  41  ASP D OD1 1 
ATOM   3939  O  OD2 . ASP D  1 41  ? -15.159 71.260  -10.428 1.00 35.84  -1 41  ASP D OD2 1 
ATOM   3940  N  N   . GLU D  1 42  ? -19.594 70.196  -12.887 1.00 35.55  ?  42  GLU D N   1 
ATOM   3941  C  CA  . GLU D  1 42  ? -20.900 70.254  -13.513 1.00 35.73  ?  42  GLU D CA  1 
ATOM   3942  C  C   . GLU D  1 42  ? -21.721 68.976  -13.246 1.00 35.04  ?  42  GLU D C   1 
ATOM   3943  O  O   . GLU D  1 42  ? -21.201 67.872  -13.387 1.00 35.16  ?  42  GLU D O   1 
ATOM   3944  C  CB  . GLU D  1 42  ? -20.646 70.413  -15.005 1.00 36.63  ?  42  GLU D CB  1 
ATOM   3945  C  CG  . GLU D  1 42  ? -21.875 70.587  -15.853 1.00 38.63  ?  42  GLU D CG  1 
ATOM   3946  C  CD  . GLU D  1 42  ? -21.498 70.784  -17.288 1.00 40.89  ?  42  GLU D CD  1 
ATOM   3947  O  OE1 . GLU D  1 42  ? -21.976 71.777  -17.887 1.00 42.02  ?  42  GLU D OE1 1 
ATOM   3948  O  OE2 . GLU D  1 42  ? -20.695 69.964  -17.797 1.00 42.87  -1 42  GLU D OE2 1 
ATOM   3949  N  N   . THR D  1 43  ? -22.987 69.136  -12.870 1.00 34.24  ?  43  THR D N   1 
ATOM   3950  C  CA  . THR D  1 43  ? -23.925 68.035  -12.630 1.00 33.91  ?  43  THR D CA  1 
ATOM   3951  C  C   . THR D  1 43  ? -24.287 67.382  -13.958 1.00 33.96  ?  43  THR D C   1 
ATOM   3952  O  O   . THR D  1 43  ? -24.269 68.055  -14.993 1.00 33.95  ?  43  THR D O   1 
ATOM   3953  C  CB  . THR D  1 43  ? -25.228 68.564  -11.930 1.00 33.81  ?  43  THR D CB  1 
ATOM   3954  O  OG1 . THR D  1 43  ? -25.147 68.317  -10.532 1.00 35.76  ?  43  THR D OG1 1 
ATOM   3955  C  CG2 . THR D  1 43  ? -26.479 67.886  -12.380 1.00 34.55  ?  43  THR D CG2 1 
ATOM   3956  N  N   . LEU D  1 44  ? -24.629 66.089  -13.925 1.00 33.02  ?  44  LEU D N   1 
ATOM   3957  C  CA  . LEU D  1 44  ? -25.248 65.428  -15.063 1.00 31.83  ?  44  LEU D CA  1 
ATOM   3958  C  C   . LEU D  1 44  ? -26.418 66.193  -15.643 1.00 32.77  ?  44  LEU D C   1 
ATOM   3959  O  O   . LEU D  1 44  ? -26.421 66.510  -16.843 1.00 33.87  ?  44  LEU D O   1 
ATOM   3960  C  CB  . LEU D  1 44  ? -25.622 63.978  -14.745 1.00 30.86  ?  44  LEU D CB  1 
ATOM   3961  C  CG  . LEU D  1 44  ? -24.346 63.093  -14.735 1.00 28.63  ?  44  LEU D CG  1 
ATOM   3962  C  CD1 . LEU D  1 44  ? -24.596 61.630  -14.373 1.00 23.99  ?  44  LEU D CD1 1 
ATOM   3963  C  CD2 . LEU D  1 44  ? -23.537 63.207  -16.054 1.00 23.25  ?  44  LEU D CD2 1 
ATOM   3964  N  N   . VAL D  1 45  ? -27.421 66.509  -14.840 1.00 33.04  ?  45  VAL D N   1 
ATOM   3965  C  CA  . VAL D  1 45  ? -28.574 67.200  -15.409 1.00 33.78  ?  45  VAL D CA  1 
ATOM   3966  C  C   . VAL D  1 45  ? -28.240 68.645  -15.812 1.00 34.04  ?  45  VAL D C   1 
ATOM   3967  O  O   . VAL D  1 45  ? -28.925 69.232  -16.632 1.00 34.46  ?  45  VAL D O   1 
ATOM   3968  C  CB  . VAL D  1 45  ? -29.860 67.054  -14.535 1.00 34.12  ?  45  VAL D CB  1 
ATOM   3969  C  CG1 . VAL D  1 45  ? -29.589 66.279  -13.239 1.00 35.46  ?  45  VAL D CG1 1 
ATOM   3970  C  CG2 . VAL D  1 45  ? -30.510 68.386  -14.238 1.00 35.28  ?  45  VAL D CG2 1 
ATOM   3971  N  N   . GLU D  1 46  ? -27.177 69.223  -15.262 1.00 33.98  ?  46  GLU D N   1 
ATOM   3972  C  CA  . GLU D  1 46  ? -26.729 70.509  -15.778 1.00 33.77  ?  46  GLU D CA  1 
ATOM   3973  C  C   . GLU D  1 46  ? -26.334 70.298  -17.207 1.00 33.87  ?  46  GLU D C   1 
ATOM   3974  O  O   . GLU D  1 46  ? -27.063 70.723  -18.087 1.00 34.64  ?  46  GLU D O   1 
ATOM   3975  C  CB  . GLU D  1 46  ? -25.597 71.138  -14.968 1.00 33.44  ?  46  GLU D CB  1 
ATOM   3976  C  CG  . GLU D  1 46  ? -26.128 72.061  -13.866 1.00 33.32  ?  46  GLU D CG  1 
ATOM   3977  C  CD  . GLU D  1 46  ? -25.126 72.324  -12.755 1.00 32.06  ?  46  GLU D CD  1 
ATOM   3978  O  OE1 . GLU D  1 46  ? -25.517 72.949  -11.756 1.00 32.75  ?  46  GLU D OE1 1 
ATOM   3979  O  OE2 . GLU D  1 46  ? -23.955 71.921  -12.877 1.00 32.89  -1 46  GLU D OE2 1 
ATOM   3980  N  N   . ALA D  1 47  ? -25.225 69.596  -17.437 1.00 33.65  ?  47  ALA D N   1 
ATOM   3981  C  CA  . ALA D  1 47  ? -24.753 69.240  -18.789 1.00 33.17  ?  47  ALA D CA  1 
ATOM   3982  C  C   . ALA D  1 47  ? -25.849 68.842  -19.829 1.00 32.97  ?  47  ALA D C   1 
ATOM   3983  O  O   . ALA D  1 47  ? -25.830 69.312  -20.970 1.00 32.72  ?  47  ALA D O   1 
ATOM   3984  C  CB  . ALA D  1 47  ? -23.658 68.193  -18.691 1.00 33.15  ?  47  ALA D CB  1 
ATOM   3985  N  N   . ALA D  1 48  ? -26.809 68.011  -19.437 1.00 33.02  ?  48  ALA D N   1 
ATOM   3986  C  CA  . ALA D  1 48  ? -27.917 67.665  -20.338 1.00 33.42  ?  48  ALA D CA  1 
ATOM   3987  C  C   . ALA D  1 48  ? -28.658 68.921  -20.768 1.00 33.71  ?  48  ALA D C   1 
ATOM   3988  O  O   . ALA D  1 48  ? -28.937 69.114  -21.948 1.00 34.46  ?  48  ALA D O   1 
ATOM   3989  C  CB  . ALA D  1 48  ? -28.868 66.693  -19.686 1.00 33.40  ?  48  ALA D CB  1 
ATOM   3990  N  N   . ALA D  1 49  ? -28.964 69.780  -19.803 1.00 33.78  ?  49  ALA D N   1 
ATOM   3991  C  CA  . ALA D  1 49  ? -29.472 71.139  -20.067 1.00 33.41  ?  49  ALA D CA  1 
ATOM   3992  C  C   . ALA D  1 49  ? -28.538 71.945  -20.952 1.00 33.22  ?  49  ALA D C   1 
ATOM   3993  O  O   . ALA D  1 49  ? -28.995 72.606  -21.897 1.00 33.29  ?  49  ALA D O   1 
ATOM   3994  C  CB  . ALA D  1 49  ? -29.676 71.876  -18.768 1.00 33.14  ?  49  ALA D CB  1 
ATOM   3995  N  N   . ARG D  1 50  ? -27.242 71.890  -20.642 1.00 32.73  ?  50  ARG D N   1 
ATOM   3996  C  CA  . ARG D  1 50  ? -26.302 72.811  -21.226 1.00 33.16  ?  50  ARG D CA  1 
ATOM   3997  C  C   . ARG D  1 50  ? -26.247 72.475  -22.696 1.00 34.03  ?  50  ARG D C   1 
ATOM   3998  O  O   . ARG D  1 50  ? -26.707 73.273  -23.518 1.00 34.97  ?  50  ARG D O   1 
ATOM   3999  C  CB  . ARG D  1 50  ? -24.935 72.740  -20.552 1.00 32.95  ?  50  ARG D CB  1 
ATOM   4000  C  CG  . ARG D  1 50  ? -23.988 73.804  -21.034 1.00 34.12  ?  50  ARG D CG  1 
ATOM   4001  C  CD  . ARG D  1 50  ? -22.551 73.546  -20.619 1.00 36.13  ?  50  ARG D CD  1 
ATOM   4002  N  NE  . ARG D  1 50  ? -22.262 72.128  -20.726 1.00 41.89  ?  50  ARG D NE  1 
ATOM   4003  C  CZ  . ARG D  1 50  ? -21.062 71.604  -20.977 1.00 45.73  ?  50  ARG D CZ  1 
ATOM   4004  N  NH1 . ARG D  1 50  ? -19.988 72.379  -21.176 1.00 46.11  ?  50  ARG D NH1 1 
ATOM   4005  N  NH2 . ARG D  1 50  ? -20.937 70.282  -21.033 1.00 46.59  ?  50  ARG D NH2 1 
ATOM   4006  N  N   . GLU D  1 51  ? -25.761 71.269  -23.023 1.00 34.36  ?  51  GLU D N   1 
ATOM   4007  C  CA  . GLU D  1 51  ? -25.687 70.792  -24.408 1.00 33.30  ?  51  GLU D CA  1 
ATOM   4008  C  C   . GLU D  1 51  ? -27.005 70.994  -25.166 1.00 33.72  ?  51  GLU D C   1 
ATOM   4009  O  O   . GLU D  1 51  ? -26.977 71.477  -26.268 1.00 33.91  ?  51  GLU D O   1 
ATOM   4010  C  CB  . GLU D  1 51  ? -25.167 69.354  -24.481 1.00 32.94  ?  51  GLU D CB  1 
ATOM   4011  C  CG  . GLU D  1 51  ? -23.682 69.159  -24.100 1.00 29.68  ?  51  GLU D CG  1 
ATOM   4012  C  CD  . GLU D  1 51  ? -22.711 69.487  -25.221 1.00 26.36  ?  51  GLU D CD  1 
ATOM   4013  O  OE1 . GLU D  1 51  ? -23.163 69.550  -26.379 1.00 29.76  ?  51  GLU D OE1 1 
ATOM   4014  O  OE2 . GLU D  1 51  ? -21.499 69.688  -24.983 1.00 23.45  -1 51  GLU D OE2 1 
ATOM   4015  N  N   . LEU D  1 52  ? -28.157 70.713  -24.578 1.00 34.86  ?  52  LEU D N   1 
ATOM   4016  C  CA  . LEU D  1 52  ? -29.436 71.008  -25.268 1.00 36.80  ?  52  LEU D CA  1 
ATOM   4017  C  C   . LEU D  1 52  ? -29.499 72.415  -25.831 1.00 39.21  ?  52  LEU D C   1 
ATOM   4018  O  O   . LEU D  1 52  ? -30.171 72.649  -26.844 1.00 40.60  ?  52  LEU D O   1 
ATOM   4019  C  CB  . LEU D  1 52  ? -30.614 70.934  -24.313 1.00 36.04  ?  52  LEU D CB  1 
ATOM   4020  C  CG  . LEU D  1 52  ? -31.987 70.475  -24.781 1.00 34.70  ?  52  LEU D CG  1 
ATOM   4021  C  CD1 . LEU D  1 52  ? -33.128 71.243  -24.108 1.00 36.71  ?  52  LEU D CD1 1 
ATOM   4022  C  CD2 . LEU D  1 52  ? -32.150 70.524  -26.240 1.00 33.46  ?  52  LEU D CD2 1 
ATOM   4023  N  N   . TRP D  1 53  ? -28.851 73.367  -25.143 1.00 40.98  ?  53  TRP D N   1 
ATOM   4024  C  CA  . TRP D  1 53  ? -28.960 74.789  -25.476 1.00 41.55  ?  53  TRP D CA  1 
ATOM   4025  C  C   . TRP D  1 53  ? -27.875 75.112  -26.478 1.00 42.28  ?  53  TRP D C   1 
ATOM   4026  O  O   . TRP D  1 53  ? -28.158 75.719  -27.530 1.00 42.46  ?  53  TRP D O   1 
ATOM   4027  C  CB  . TRP D  1 53  ? -28.841 75.699  -24.218 1.00 41.77  ?  53  TRP D CB  1 
ATOM   4028  C  CG  . TRP D  1 53  ? -28.638 77.213  -24.567 1.00 41.93  ?  53  TRP D CG  1 
ATOM   4029  C  CD1 . TRP D  1 53  ? -29.618 78.167  -24.721 1.00 40.99  ?  53  TRP D CD1 1 
ATOM   4030  C  CD2 . TRP D  1 53  ? -27.384 77.883  -24.844 1.00 40.75  ?  53  TRP D CD2 1 
ATOM   4031  N  NE1 . TRP D  1 53  ? -29.044 79.383  -25.056 1.00 41.34  ?  53  TRP D NE1 1 
ATOM   4032  C  CE2 . TRP D  1 53  ? -27.683 79.237  -25.130 1.00 40.19  ?  53  TRP D CE2 1 
ATOM   4033  C  CE3 . TRP D  1 53  ? -26.039 77.467  -24.870 1.00 42.31  ?  53  TRP D CE3 1 
ATOM   4034  C  CZ2 . TRP D  1 53  ? -26.688 80.180  -25.447 1.00 41.49  ?  53  TRP D CZ2 1 
ATOM   4035  C  CZ3 . TRP D  1 53  ? -25.030 78.417  -25.185 1.00 42.05  ?  53  TRP D CZ3 1 
ATOM   4036  C  CH2 . TRP D  1 53  ? -25.371 79.754  -25.473 1.00 42.55  ?  53  TRP D CH2 1 
ATOM   4037  N  N   . GLU D  1 54  ? -26.642 74.718  -26.133 1.00 42.87  ?  54  GLU D N   1 
ATOM   4038  C  CA  . GLU D  1 54  ? -25.490 74.801  -27.022 1.00 43.50  ?  54  GLU D CA  1 
ATOM   4039  C  C   . GLU D  1 54  ? -25.864 74.254  -28.393 1.00 44.47  ?  54  GLU D C   1 
ATOM   4040  O  O   . GLU D  1 54  ? -25.333 74.717  -29.407 1.00 44.95  ?  54  GLU D O   1 
ATOM   4041  C  CB  . GLU D  1 54  ? -24.301 73.999  -26.476 1.00 43.73  ?  54  GLU D CB  1 
ATOM   4042  C  CG  . GLU D  1 54  ? -23.641 74.568  -25.211 1.00 44.05  ?  54  GLU D CG  1 
ATOM   4043  C  CD  . GLU D  1 54  ? -22.248 73.977  -24.885 1.00 46.03  ?  54  GLU D CD  1 
ATOM   4044  O  OE1 . GLU D  1 54  ? -21.664 73.137  -25.650 1.00 44.33  ?  54  GLU D OE1 1 
ATOM   4045  O  OE2 . GLU D  1 54  ? -21.731 74.380  -23.818 1.00 46.43  -1 54  GLU D OE2 1 
ATOM   4046  N  N   . GLU D  1 55  ? -26.795 73.295  -28.432 1.00 44.89  ?  55  GLU D N   1 
ATOM   4047  C  CA  . GLU D  1 55  ? -27.084 72.574  -29.681 1.00 45.39  ?  55  GLU D CA  1 
ATOM   4048  C  C   . GLU D  1 55  ? -28.452 72.806  -30.275 1.00 46.05  ?  55  GLU D C   1 
ATOM   4049  O  O   . GLU D  1 55  ? -28.629 72.624  -31.482 1.00 46.66  ?  55  GLU D O   1 
ATOM   4050  C  CB  . GLU D  1 55  ? -26.824 71.068  -29.560 1.00 44.41  ?  55  GLU D CB  1 
ATOM   4051  C  CG  . GLU D  1 55  ? -25.371 70.759  -29.448 1.00 42.48  ?  55  GLU D CG  1 
ATOM   4052  C  CD  . GLU D  1 55  ? -25.105 69.275  -29.277 1.00 40.58  ?  55  GLU D CD  1 
ATOM   4053  O  OE1 . GLU D  1 55  ? -26.037 68.440  -29.472 1.00 38.07  ?  55  GLU D OE1 1 
ATOM   4054  O  OE2 . GLU D  1 55  ? -23.949 68.971  -28.946 1.00 35.64  -1 55  GLU D OE2 1 
ATOM   4055  N  N   . THR D  1 56  ? -29.434 73.169  -29.474 1.00 46.23  ?  56  THR D N   1 
ATOM   4056  C  CA  . THR D  1 56  ? -30.699 73.427  -30.115 1.00 47.28  ?  56  THR D CA  1 
ATOM   4057  C  C   . THR D  1 56  ? -31.270 74.809  -29.822 1.00 47.74  ?  56  THR D C   1 
ATOM   4058  O  O   . THR D  1 56  ? -32.300 75.200  -30.412 1.00 48.23  ?  56  THR D O   1 
ATOM   4059  C  CB  . THR D  1 56  ? -31.706 72.357  -29.776 1.00 47.41  ?  56  THR D CB  1 
ATOM   4060  O  OG1 . THR D  1 56  ? -32.299 72.670  -28.511 1.00 48.61  ?  56  THR D OG1 1 
ATOM   4061  C  CG2 . THR D  1 56  ? -31.021 71.006  -29.720 1.00 47.48  ?  56  THR D CG2 1 
ATOM   4062  N  N   . GLY D  1 57  ? -30.613 75.538  -28.914 1.00 47.75  ?  57  GLY D N   1 
ATOM   4063  C  CA  . GLY D  1 57  ? -31.072 76.870  -28.517 1.00 47.56  ?  57  GLY D CA  1 
ATOM   4064  C  C   . GLY D  1 57  ? -32.226 76.826  -27.531 1.00 47.39  ?  57  GLY D C   1 
ATOM   4065  O  O   . GLY D  1 57  ? -32.594 77.849  -26.934 1.00 47.72  ?  57  GLY D O   1 
ATOM   4066  N  N   . ILE D  1 58  ? -32.808 75.643  -27.355 1.00 46.87  ?  58  ILE D N   1 
ATOM   4067  C  CA  . ILE D  1 58  ? -33.820 75.453  -26.313 1.00 45.98  ?  58  ILE D CA  1 
ATOM   4068  C  C   . ILE D  1 58  ? -33.218 75.442  -24.903 1.00 45.38  ?  58  ILE D C   1 
ATOM   4069  O  O   . ILE D  1 58  ? -32.179 74.819  -24.627 1.00 44.75  ?  58  ILE D O   1 
ATOM   4070  C  CB  . ILE D  1 58  ? -34.677 74.212  -26.531 1.00 45.76  ?  58  ILE D CB  1 
ATOM   4071  C  CG1 . ILE D  1 58  ? -35.215 74.212  -27.960 1.00 45.54  ?  58  ILE D CG1 1 
ATOM   4072  C  CG2 . ILE D  1 58  ? -35.834 74.229  -25.555 1.00 45.99  ?  58  ILE D CG2 1 
ATOM   4073  C  CD1 . ILE D  1 58  ? -35.043 72.922  -28.666 1.00 44.40  ?  58  ILE D CD1 1 
ATOM   4074  N  N   . SER D  1 59  ? -33.874 76.210  -24.043 1.00 45.07  ?  59  SER D N   1 
ATOM   4075  C  CA  . SER D  1 59  ? -33.663 76.138  -22.621 1.00 44.44  ?  59  SER D CA  1 
ATOM   4076  C  C   . SER D  1 59  ? -34.798 75.311  -22.060 1.00 43.60  ?  59  SER D C   1 
ATOM   4077  O  O   . SER D  1 59  ? -35.968 75.757  -22.017 1.00 42.93  ?  59  SER D O   1 
ATOM   4078  C  CB  . SER D  1 59  ? -33.615 77.525  -21.987 1.00 44.47  ?  59  SER D CB  1 
ATOM   4079  O  OG  . SER D  1 59  ? -32.400 78.175  -22.335 1.00 44.65  ?  59  SER D OG  1 
ATOM   4080  N  N   . ALA D  1 60  ? -34.443 74.068  -21.719 1.00 42.34  ?  60  ALA D N   1 
ATOM   4081  C  CA  . ALA D  1 60  ? -35.290 73.239  -20.855 1.00 41.59  ?  60  ALA D CA  1 
ATOM   4082  C  C   . ALA D  1 60  ? -34.462 72.329  -20.002 1.00 40.16  ?  60  ALA D C   1 
ATOM   4083  O  O   . ALA D  1 60  ? -33.280 72.091  -20.258 1.00 40.12  ?  60  ALA D O   1 
ATOM   4084  C  CB  . ALA D  1 60  ? -36.400 72.465  -21.624 1.00 41.21  ?  60  ALA D CB  1 
ATOM   4085  N  N   . GLN D  1 61  ? -35.101 71.890  -18.939 1.00 39.47  ?  61  GLN D N   1 
ATOM   4086  C  CA  . GLN D  1 61  ? -34.467 71.078  -17.942 1.00 38.73  ?  61  GLN D CA  1 
ATOM   4087  C  C   . GLN D  1 61  ? -35.002 69.673  -18.193 1.00 37.80  ?  61  GLN D C   1 
ATOM   4088  O  O   . GLN D  1 61  ? -36.207 69.490  -18.512 1.00 37.44  ?  61  GLN D O   1 
ATOM   4089  C  CB  . GLN D  1 61  ? -34.826 71.618  -16.534 1.00 38.98  ?  61  GLN D CB  1 
ATOM   4090  C  CG  . GLN D  1 61  ? -33.641 71.787  -15.540 1.00 39.50  ?  61  GLN D CG  1 
ATOM   4091  C  CD  . GLN D  1 61  ? -32.470 72.652  -16.079 1.00 40.35  ?  61  GLN D CD  1 
ATOM   4092  O  OE1 . GLN D  1 61  ? -31.290 72.426  -15.759 1.00 37.81  ?  61  GLN D OE1 1 
ATOM   4093  N  NE2 . GLN D  1 61  ? -32.805 73.646  -16.891 1.00 40.92  ?  61  GLN D NE2 1 
ATOM   4094  N  N   . PRO D  1 62  ? -34.108 68.679  -18.099 1.00 36.89  ?  62  PRO D N   1 
ATOM   4095  C  CA  . PRO D  1 62  ? -34.462 67.255  -18.060 1.00 36.64  ?  62  PRO D CA  1 
ATOM   4096  C  C   . PRO D  1 62  ? -35.517 67.022  -16.999 1.00 36.23  ?  62  PRO D C   1 
ATOM   4097  O  O   . PRO D  1 62  ? -35.396 67.584  -15.909 1.00 36.74  ?  62  PRO D O   1 
ATOM   4098  C  CB  . PRO D  1 62  ? -33.153 66.579  -17.643 1.00 36.25  ?  62  PRO D CB  1 
ATOM   4099  C  CG  . PRO D  1 62  ? -32.080 67.488  -18.115 1.00 36.32  ?  62  PRO D CG  1 
ATOM   4100  C  CD  . PRO D  1 62  ? -32.651 68.894  -18.088 1.00 37.09  ?  62  PRO D CD  1 
ATOM   4101  N  N   . GLN D  1 63  ? -36.548 66.242  -17.301 1.00 36.01  ?  63  GLN D N   1 
ATOM   4102  C  CA  . GLN D  1 63  ? -37.581 65.933  -16.302 1.00 36.42  ?  63  GLN D CA  1 
ATOM   4103  C  C   . GLN D  1 63  ? -37.510 64.500  -15.788 1.00 35.98  ?  63  GLN D C   1 
ATOM   4104  O  O   . GLN D  1 63  ? -38.009 64.208  -14.702 1.00 36.35  ?  63  GLN D O   1 
ATOM   4105  C  CB  . GLN D  1 63  ? -38.969 66.144  -16.874 1.00 37.10  ?  63  GLN D CB  1 
ATOM   4106  C  CG  . GLN D  1 63  ? -39.115 67.336  -17.806 1.00 39.98  ?  63  GLN D CG  1 
ATOM   4107  C  CD  . GLN D  1 63  ? -40.179 67.093  -18.864 1.00 43.75  ?  63  GLN D CD  1 
ATOM   4108  O  OE1 . GLN D  1 63  ? -40.679 68.039  -19.460 1.00 45.28  ?  63  GLN D OE1 1 
ATOM   4109  N  NE2 . GLN D  1 63  ? -40.541 65.819  -19.091 1.00 43.38  ?  63  GLN D NE2 1 
ATOM   4110  N  N   . HIS D  1 64  ? -36.945 63.594  -16.592 1.00 35.25  ?  64  HIS D N   1 
ATOM   4111  C  CA  . HIS D  1 64  ? -36.783 62.196  -16.190 1.00 33.88  ?  64  HIS D CA  1 
ATOM   4112  C  C   . HIS D  1 64  ? -35.495 61.531  -16.635 1.00 32.65  ?  64  HIS D C   1 
ATOM   4113  O  O   . HIS D  1 64  ? -34.814 61.974  -17.554 1.00 32.35  ?  64  HIS D O   1 
ATOM   4114  C  CB  . HIS D  1 64  ? -37.961 61.376  -16.655 1.00 34.01  ?  64  HIS D CB  1 
ATOM   4115  C  CG  . HIS D  1 64  ? -39.224 61.726  -15.950 1.00 36.94  ?  64  HIS D CG  1 
ATOM   4116  N  ND1 . HIS D  1 64  ? -39.987 62.818  -16.305 1.00 37.67  ?  64  HIS D ND1 1 
ATOM   4117  C  CD2 . HIS D  1 64  ? -39.838 61.163  -14.880 1.00 37.88  ?  64  HIS D CD2 1 
ATOM   4118  C  CE1 . HIS D  1 64  ? -41.031 62.897  -15.496 1.00 38.50  ?  64  HIS D CE1 1 
ATOM   4119  N  NE2 . HIS D  1 64  ? -40.969 61.903  -14.628 1.00 37.56  ?  64  HIS D NE2 1 
ATOM   4120  N  N   . PHE D  1 65  ? -35.161 60.448  -15.960 1.00 31.18  ?  65  PHE D N   1 
ATOM   4121  C  CA  . PHE D  1 65  ? -33.994 59.677  -16.320 1.00 29.94  ?  65  PHE D CA  1 
ATOM   4122  C  C   . PHE D  1 65  ? -34.478 58.444  -16.995 1.00 29.72  ?  65  PHE D C   1 
ATOM   4123  O  O   . PHE D  1 65  ? -35.277 57.734  -16.420 1.00 29.91  ?  65  PHE D O   1 
ATOM   4124  C  CB  . PHE D  1 65  ? -33.245 59.269  -15.090 1.00 28.58  ?  65  PHE D CB  1 
ATOM   4125  C  CG  . PHE D  1 65  ? -32.046 58.480  -15.376 1.00 27.12  ?  65  PHE D CG  1 
ATOM   4126  C  CD1 . PHE D  1 65  ? -31.111 58.922  -16.288 1.00 27.92  ?  65  PHE D CD1 1 
ATOM   4127  C  CD2 . PHE D  1 65  ? -31.816 57.293  -14.724 1.00 24.77  ?  65  PHE D CD2 1 
ATOM   4128  C  CE1 . PHE D  1 65  ? -29.966 58.161  -16.531 1.00 26.03  ?  65  PHE D CE1 1 
ATOM   4129  C  CE2 . PHE D  1 65  ? -30.676 56.558  -14.961 1.00 20.17  ?  65  PHE D CE2 1 
ATOM   4130  C  CZ  . PHE D  1 65  ? -29.779 56.965  -15.838 1.00 22.51  ?  65  PHE D CZ  1 
ATOM   4131  N  N   . ILE D  1 66  ? -34.002 58.183  -18.207 1.00 29.46  ?  66  ILE D N   1 
ATOM   4132  C  CA  . ILE D  1 66  ? -34.488 57.017  -18.935 1.00 29.20  ?  66  ILE D CA  1 
ATOM   4133  C  C   . ILE D  1 66  ? -33.594 55.823  -18.771 1.00 28.22  ?  66  ILE D C   1 
ATOM   4134  O  O   . ILE D  1 66  ? -34.098 54.705  -18.546 1.00 27.47  ?  66  ILE D O   1 
ATOM   4135  C  CB  . ILE D  1 66  ? -34.645 57.260  -20.406 1.00 29.53  ?  66  ILE D CB  1 
ATOM   4136  C  CG1 . ILE D  1 66  ? -35.715 58.324  -20.631 1.00 29.20  ?  66  ILE D CG1 1 
ATOM   4137  C  CG2 . ILE D  1 66  ? -35.036 55.931  -21.091 1.00 30.81  ?  66  ILE D CG2 1 
ATOM   4138  C  CD1 . ILE D  1 66  ? -35.595 58.976  -21.954 1.00 28.32  ?  66  ILE D CD1 1 
ATOM   4139  N  N   . ARG D  1 67  ? -32.285 56.071  -18.889 1.00 26.73  ?  67  ARG D N   1 
ATOM   4140  C  CA  . ARG D  1 67  ? -31.323 55.031  -18.734 1.00 25.78  ?  67  ARG D CA  1 
ATOM   4141  C  C   . ARG D  1 67  ? -29.917 55.518  -19.085 1.00 25.83  ?  67  ARG D C   1 
ATOM   4142  O  O   . ARG D  1 67  ? -29.749 56.595  -19.629 1.00 26.14  ?  67  ARG D O   1 
ATOM   4143  C  CB  . ARG D  1 67  ? -31.742 53.922  -19.664 1.00 26.54  ?  67  ARG D CB  1 
ATOM   4144  C  CG  . ARG D  1 67  ? -31.029 52.651  -19.458 1.00 26.94  ?  67  ARG D CG  1 
ATOM   4145  C  CD  . ARG D  1 67  ? -30.680 52.173  -20.779 1.00 22.42  ?  67  ARG D CD  1 
ATOM   4146  N  NE  . ARG D  1 67  ? -29.370 51.585  -20.711 1.00 21.33  ?  67  ARG D NE  1 
ATOM   4147  C  CZ  . ARG D  1 67  ? -29.138 50.305  -20.979 1.00 19.95  ?  67  ARG D CZ  1 
ATOM   4148  N  NH1 . ARG D  1 67  ? -30.147 49.534  -21.341 1.00 13.18  ?  67  ARG D NH1 1 
ATOM   4149  N  NH2 . ARG D  1 67  ? -27.895 49.819  -20.908 1.00 19.44  ?  67  ARG D NH2 1 
ATOM   4150  N  N   . MET D  1 68  ? -28.895 54.735  -18.759 1.00 25.23  ?  68  MET D N   1 
ATOM   4151  C  CA  . MET D  1 68  ? -27.537 55.085  -19.155 1.00 24.59  ?  68  MET D CA  1 
ATOM   4152  C  C   . MET D  1 68  ? -26.919 53.924  -19.914 1.00 24.66  ?  68  MET D C   1 
ATOM   4153  O  O   . MET D  1 68  ? -26.882 52.816  -19.395 1.00 24.55  ?  68  MET D O   1 
ATOM   4154  C  CB  . MET D  1 68  ? -26.653 55.438  -17.949 1.00 24.24  ?  68  MET D CB  1 
ATOM   4155  C  CG  . MET D  1 68  ? -25.233 55.759  -18.328 1.00 21.47  ?  68  MET D CG  1 
ATOM   4156  S  SD  . MET D  1 68  ? -24.023 54.898  -17.304 1.00 27.72  ?  68  MET D SD  1 
ATOM   4157  C  CE  . MET D  1 68  ? -24.001 53.239  -17.977 1.00 24.94  ?  68  MET D CE  1 
ATOM   4158  N  N   . HIS D  1 69  ? -26.417 54.192  -21.125 1.00 24.48  ?  69  HIS D N   1 
ATOM   4159  C  CA  . HIS D  1 69  ? -25.717 53.172  -21.885 1.00 24.21  ?  69  HIS D CA  1 
ATOM   4160  C  C   . HIS D  1 69  ? -24.214 53.166  -21.654 1.00 24.26  ?  69  HIS D C   1 
ATOM   4161  O  O   . HIS D  1 69  ? -23.587 54.209  -21.601 1.00 23.93  ?  69  HIS D O   1 
ATOM   4162  C  CB  . HIS D  1 69  ? -26.085 53.267  -23.361 1.00 23.53  ?  69  HIS D CB  1 
ATOM   4163  C  CG  . HIS D  1 69  ? -27.498 52.852  -23.643 1.00 22.41  ?  69  HIS D CG  1 
ATOM   4164  N  ND1 . HIS D  1 69  ? -28.525 53.759  -23.829 1.00 20.90  ?  69  HIS D ND1 1 
ATOM   4165  C  CD2 . HIS D  1 69  ? -28.059 51.622  -23.756 1.00 20.06  ?  69  HIS D CD2 1 
ATOM   4166  C  CE1 . HIS D  1 69  ? -29.659 53.106  -24.027 1.00 20.12  ?  69  HIS D CE1 1 
ATOM   4167  N  NE2 . HIS D  1 69  ? -29.404 51.807  -23.986 1.00 22.50  ?  69  HIS D NE2 1 
ATOM   4168  N  N   . GLN D  1 70  ? -23.661 51.971  -21.444 1.00 26.38  ?  70  GLN D N   1 
ATOM   4169  C  CA  . GLN D  1 70  ? -22.203 51.755  -21.474 1.00 27.85  ?  70  GLN D CA  1 
ATOM   4170  C  C   . GLN D  1 70  ? -21.833 51.068  -22.783 1.00 29.79  ?  70  GLN D C   1 
ATOM   4171  O  O   . GLN D  1 70  ? -22.385 50.041  -23.132 1.00 30.42  ?  70  GLN D O   1 
ATOM   4172  C  CB  . GLN D  1 70  ? -21.693 50.983  -20.256 1.00 26.62  ?  70  GLN D CB  1 
ATOM   4173  C  CG  . GLN D  1 70  ? -20.162 50.904  -20.192 1.00 25.29  ?  70  GLN D CG  1 
ATOM   4174  C  CD  . GLN D  1 70  ? -19.632 49.981  -19.128 1.00 24.75  ?  70  GLN D CD  1 
ATOM   4175  O  OE1 . GLN D  1 70  ? -20.378 49.199  -18.530 1.00 31.42  ?  70  GLN D OE1 1 
ATOM   4176  N  NE2 . GLN D  1 70  ? -18.336 50.063  -18.864 1.00 24.01  ?  70  GLN D NE2 1 
ATOM   4177  N  N   . TRP D  1 71  ? -20.910 51.666  -23.523 1.00 32.96  ?  71  TRP D N   1 
ATOM   4178  C  CA  . TRP D  1 71  ? -20.692 51.333  -24.943 1.00 34.94  ?  71  TRP D CA  1 
ATOM   4179  C  C   . TRP D  1 71  ? -19.243 51.573  -25.297 1.00 36.06  ?  71  TRP D C   1 
ATOM   4180  O  O   . TRP D  1 71  ? -18.538 52.326  -24.594 1.00 36.22  ?  71  TRP D O   1 
ATOM   4181  C  CB  . TRP D  1 71  ? -21.548 52.258  -25.744 1.00 34.99  ?  71  TRP D CB  1 
ATOM   4182  C  CG  . TRP D  1 71  ? -21.502 52.108  -27.208 1.00 39.18  ?  71  TRP D CG  1 
ATOM   4183  C  CD1 . TRP D  1 71  ? -21.870 51.011  -27.948 1.00 42.13  ?  71  TRP D CD1 1 
ATOM   4184  C  CD2 . TRP D  1 71  ? -21.137 53.119  -28.150 1.00 40.22  ?  71  TRP D CD2 1 
ATOM   4185  N  NE1 . TRP D  1 71  ? -21.730 51.279  -29.291 1.00 41.79  ?  71  TRP D NE1 1 
ATOM   4186  C  CE2 . TRP D  1 71  ? -21.286 52.568  -29.436 1.00 41.65  ?  71  TRP D CE2 1 
ATOM   4187  C  CE3 . TRP D  1 71  ? -20.682 54.431  -28.028 1.00 40.71  ?  71  TRP D CE3 1 
ATOM   4188  C  CZ2 . TRP D  1 71  ? -21.002 53.289  -30.586 1.00 42.06  ?  71  TRP D CZ2 1 
ATOM   4189  C  CZ3 . TRP D  1 71  ? -20.413 55.149  -29.171 1.00 42.58  ?  71  TRP D CZ3 1 
ATOM   4190  C  CH2 . TRP D  1 71  ? -20.566 54.579  -30.431 1.00 41.82  ?  71  TRP D CH2 1 
ATOM   4191  N  N   . ILE D  1 72  ? -18.767 50.933  -26.363 1.00 37.35  ?  72  ILE D N   1 
ATOM   4192  C  CA  . ILE D  1 72  ? -17.352 51.091  -26.710 1.00 38.39  ?  72  ILE D CA  1 
ATOM   4193  C  C   . ILE D  1 72  ? -17.058 51.793  -28.026 1.00 39.63  ?  72  ILE D C   1 
ATOM   4194  O  O   . ILE D  1 72  ? -16.003 52.408  -28.148 1.00 41.09  ?  72  ILE D O   1 
ATOM   4195  C  CB  . ILE D  1 72  ? -16.508 49.810  -26.518 1.00 38.24  ?  72  ILE D CB  1 
ATOM   4196  C  CG1 . ILE D  1 72  ? -16.266 49.590  -25.024 1.00 37.96  ?  72  ILE D CG1 1 
ATOM   4197  C  CG2 . ILE D  1 72  ? -15.161 49.876  -27.318 1.00 37.81  ?  72  ILE D CG2 1 
ATOM   4198  C  CD1 . ILE D  1 72  ? -15.060 48.688  -24.655 1.00 38.06  ?  72  ILE D CD1 1 
ATOM   4199  N  N   . ALA D  1 73  ? -17.949 51.749  -29.005 1.00 40.44  ?  73  ALA D N   1 
ATOM   4200  C  CA  . ALA D  1 73  ? -17.743 52.632  -30.184 1.00 41.45  ?  73  ALA D CA  1 
ATOM   4201  C  C   . ALA D  1 73  ? -16.633 52.186  -31.140 1.00 42.24  ?  73  ALA D C   1 
ATOM   4202  O  O   . ALA D  1 73  ? -15.491 51.932  -30.693 1.00 41.77  ?  73  ALA D O   1 
ATOM   4203  C  CB  . ALA D  1 73  ? -17.465 54.083  -29.748 1.00 40.66  ?  73  ALA D CB  1 
ATOM   4204  N  N   . PRO D  1 74  ? -16.962 52.133  -32.463 1.00 42.91  ?  74  PRO D N   1 
ATOM   4205  C  CA  . PRO D  1 74  ? -16.068 51.880  -33.587 1.00 42.89  ?  74  PRO D CA  1 
ATOM   4206  C  C   . PRO D  1 74  ? -14.606 52.225  -33.282 1.00 43.40  ?  74  PRO D C   1 
ATOM   4207  O  O   . PRO D  1 74  ? -13.764 51.319  -33.206 1.00 43.43  ?  74  PRO D O   1 
ATOM   4208  C  CB  . PRO D  1 74  ? -16.636 52.793  -34.653 1.00 42.98  ?  74  PRO D CB  1 
ATOM   4209  C  CG  . PRO D  1 74  ? -18.123 53.032  -34.241 1.00 42.60  ?  74  PRO D CG  1 
ATOM   4210  C  CD  . PRO D  1 74  ? -18.335 52.358  -32.949 1.00 42.99  ?  74  PRO D CD  1 
ATOM   4211  N  N   . ASP D  1 75  ? -14.313 53.507  -33.050 1.00 43.89  ?  75  ASP D N   1 
ATOM   4212  C  CA  . ASP D  1 75  ? -12.931 53.953  -32.723 1.00 44.42  ?  75  ASP D CA  1 
ATOM   4213  C  C   . ASP D  1 75  ? -12.346 53.499  -31.358 1.00 44.11  ?  75  ASP D C   1 
ATOM   4214  O  O   . ASP D  1 75  ? -11.289 53.984  -30.955 1.00 43.69  ?  75  ASP D O   1 
ATOM   4215  C  CB  . ASP D  1 75  ? -12.737 55.480  -32.938 1.00 44.77  ?  75  ASP D CB  1 
ATOM   4216  C  CG  . ASP D  1 75  ? -13.953 56.314  -32.514 1.00 46.69  ?  75  ASP D CG  1 
ATOM   4217  O  OD1 . ASP D  1 75  ? -13.843 57.035  -31.495 1.00 48.92  ?  75  ASP D OD1 1 
ATOM   4218  O  OD2 . ASP D  1 75  ? -15.013 56.249  -33.198 1.00 47.10  -1 75  ASP D OD2 1 
ATOM   4219  N  N   . LYS D  1 76  ? -13.011 52.552  -30.683 1.00 43.56  ?  76  LYS D N   1 
ATOM   4220  C  CA  . LYS D  1 76  ? -12.536 51.964  -29.407 1.00 43.26  ?  76  LYS D CA  1 
ATOM   4221  C  C   . LYS D  1 76  ? -12.636 52.896  -28.172 1.00 42.36  ?  76  LYS D C   1 
ATOM   4222  O  O   . LYS D  1 76  ? -12.063 52.632  -27.119 1.00 41.77  ?  76  LYS D O   1 
ATOM   4223  C  CB  . LYS D  1 76  ? -11.122 51.342  -29.544 1.00 43.41  ?  76  LYS D CB  1 
ATOM   4224  C  CG  . LYS D  1 76  ? -10.963 50.473  -30.808 1.00 46.65  ?  76  LYS D CG  1 
ATOM   4225  C  CD  . LYS D  1 76  ? -10.519 48.996  -30.511 1.00 50.80  ?  76  LYS D CD  1 
ATOM   4226  C  CE  . LYS D  1 76  ? -11.199 47.934  -31.467 1.00 50.17  ?  76  LYS D CE  1 
ATOM   4227  N  NZ  . LYS D  1 76  ? -12.717 47.915  -31.387 1.00 48.73  ?  76  LYS D NZ  1 
ATOM   4228  N  N   . THR D  1 77  ? -13.390 53.976  -28.302 1.00 41.81  ?  77  THR D N   1 
ATOM   4229  C  CA  . THR D  1 77  ? -13.467 54.975  -27.244 1.00 41.38  ?  77  THR D CA  1 
ATOM   4230  C  C   . THR D  1 77  ? -14.627 54.670  -26.297 1.00 40.64  ?  77  THR D C   1 
ATOM   4231  O  O   . THR D  1 77  ? -15.770 54.533  -26.774 1.00 39.82  ?  77  THR D O   1 
ATOM   4232  C  CB  . THR D  1 77  ? -13.591 56.402  -27.834 1.00 41.57  ?  77  THR D CB  1 
ATOM   4233  O  OG1 . THR D  1 77  ? -12.532 56.603  -28.776 1.00 41.77  ?  77  THR D OG1 1 
ATOM   4234  C  CG2 . THR D  1 77  ? -13.498 57.461  -26.733 1.00 41.62  ?  77  THR D CG2 1 
ATOM   4235  N  N   . PRO D  1 78  ? -14.332 54.570  -24.958 1.00 39.89  ?  78  PRO D N   1 
ATOM   4236  C  CA  . PRO D  1 78  ? -15.306 54.096  -23.993 1.00 39.49  ?  78  PRO D CA  1 
ATOM   4237  C  C   . PRO D  1 78  ? -16.250 55.205  -23.506 1.00 39.19  ?  78  PRO D C   1 
ATOM   4238  O  O   . PRO D  1 78  ? -15.786 56.217  -22.981 1.00 39.27  ?  78  PRO D O   1 
ATOM   4239  C  CB  . PRO D  1 78  ? -14.434 53.542  -22.860 1.00 38.96  ?  78  PRO D CB  1 
ATOM   4240  C  CG  . PRO D  1 78  ? -13.119 54.167  -22.995 1.00 38.51  ?  78  PRO D CG  1 
ATOM   4241  C  CD  . PRO D  1 78  ? -13.069 54.925  -24.281 1.00 40.14  ?  78  PRO D CD  1 
ATOM   4242  N  N   . PHE D  1 79  ? -17.549 54.999  -23.720 1.00 38.35  ?  79  PHE D N   1 
ATOM   4243  C  CA  . PHE D  1 79  ? -18.592 55.909  -23.285 1.00 38.46  ?  79  PHE D CA  1 
ATOM   4244  C  C   . PHE D  1 79  ? -19.515 55.407  -22.161 1.00 37.95  ?  79  PHE D C   1 
ATOM   4245  O  O   . PHE D  1 79  ? -19.782 54.209  -22.030 1.00 38.01  ?  79  PHE D O   1 
ATOM   4246  C  CB  . PHE D  1 79  ? -19.452 56.293  -24.472 1.00 38.48  ?  79  PHE D CB  1 
ATOM   4247  C  CG  . PHE D  1 79  ? -18.752 57.175  -25.431 1.00 41.61  ?  79  PHE D CG  1 
ATOM   4248  C  CD1 . PHE D  1 79  ? -18.971 58.552  -25.413 1.00 43.71  ?  79  PHE D CD1 1 
ATOM   4249  C  CD2 . PHE D  1 79  ? -17.841 56.641  -26.350 1.00 44.26  ?  79  PHE D CD2 1 
ATOM   4250  C  CE1 . PHE D  1 79  ? -18.298 59.392  -26.304 1.00 45.12  ?  79  PHE D CE1 1 
ATOM   4251  C  CE2 . PHE D  1 79  ? -17.151 57.461  -27.247 1.00 44.11  ?  79  PHE D CE2 1 
ATOM   4252  C  CZ  . PHE D  1 79  ? -17.389 58.844  -27.231 1.00 45.08  ?  79  PHE D CZ  1 
ATOM   4253  N  N   . LEU D  1 80  ? -20.003 56.364  -21.371 1.00 37.13  ?  80  LEU D N   1 
ATOM   4254  C  CA  . LEU D  1 80  ? -21.086 56.178  -20.423 1.00 35.52  ?  80  LEU D CA  1 
ATOM   4255  C  C   . LEU D  1 80  ? -22.054 57.269  -20.793 1.00 35.21  ?  80  LEU D C   1 
ATOM   4256  O  O   . LEU D  1 80  ? -21.791 58.454  -20.557 1.00 35.26  ?  80  LEU D O   1 
ATOM   4257  C  CB  . LEU D  1 80  ? -20.574 56.407  -19.000 1.00 34.88  ?  80  LEU D CB  1 
ATOM   4258  C  CG  . LEU D  1 80  ? -20.296 55.269  -18.022 1.00 33.90  ?  80  LEU D CG  1 
ATOM   4259  C  CD1 . LEU D  1 80  ? -19.944 53.960  -18.696 1.00 31.57  ?  80  LEU D CD1 1 
ATOM   4260  C  CD2 . LEU D  1 80  ? -19.174 55.683  -17.113 1.00 31.83  ?  80  LEU D CD2 1 
ATOM   4261  N  N   . ARG D  1 81  ? -23.164 56.900  -21.398 1.00 34.28  ?  81  ARG D N   1 
ATOM   4262  C  CA  . ARG D  1 81  ? -24.019 57.911  -21.957 1.00 33.64  ?  81  ARG D CA  1 
ATOM   4263  C  C   . ARG D  1 81  ? -25.333 57.854  -21.258 1.00 33.37  ?  81  ARG D C   1 
ATOM   4264  O  O   . ARG D  1 81  ? -26.055 56.858  -21.387 1.00 33.82  ?  81  ARG D O   1 
ATOM   4265  C  CB  . ARG D  1 81  ? -24.209 57.650  -23.444 1.00 33.55  ?  81  ARG D CB  1 
ATOM   4266  C  CG  . ARG D  1 81  ? -24.928 58.743  -24.189 1.00 35.64  ?  81  ARG D CG  1 
ATOM   4267  C  CD  . ARG D  1 81  ? -25.391 58.162  -25.507 1.00 38.73  ?  81  ARG D CD  1 
ATOM   4268  N  NE  . ARG D  1 81  ? -25.823 59.135  -26.508 1.00 38.33  ?  81  ARG D NE  1 
ATOM   4269  C  CZ  . ARG D  1 81  ? -27.029 59.156  -27.073 1.00 36.66  ?  81  ARG D CZ  1 
ATOM   4270  N  NH1 . ARG D  1 81  ? -27.942 58.262  -26.748 1.00 34.11  ?  81  ARG D NH1 1 
ATOM   4271  N  NH2 . ARG D  1 81  ? -27.317 60.083  -27.974 1.00 37.99  ?  81  ARG D NH2 1 
ATOM   4272  N  N   . PHE D  1 82  ? -25.636 58.926  -20.524 1.00 32.28  ?  82  PHE D N   1 
ATOM   4273  C  CA  . PHE D  1 82  ? -26.858 59.040  -19.730 1.00 30.56  ?  82  PHE D CA  1 
ATOM   4274  C  C   . PHE D  1 82  ? -27.954 59.681  -20.545 1.00 30.76  ?  82  PHE D C   1 
ATOM   4275  O  O   . PHE D  1 82  ? -27.703 60.688  -21.172 1.00 31.19  ?  82  PHE D O   1 
ATOM   4276  C  CB  . PHE D  1 82  ? -26.601 59.902  -18.481 1.00 29.85  ?  82  PHE D CB  1 
ATOM   4277  C  CG  . PHE D  1 82  ? -25.573 59.333  -17.547 1.00 25.71  ?  82  PHE D CG  1 
ATOM   4278  C  CD1 . PHE D  1 82  ? -24.211 59.406  -17.853 1.00 25.02  ?  82  PHE D CD1 1 
ATOM   4279  C  CD2 . PHE D  1 82  ? -25.955 58.737  -16.369 1.00 21.30  ?  82  PHE D CD2 1 
ATOM   4280  C  CE1 . PHE D  1 82  ? -23.245 58.867  -17.007 1.00 22.30  ?  82  PHE D CE1 1 
ATOM   4281  C  CE2 . PHE D  1 82  ? -25.005 58.215  -15.498 1.00 19.61  ?  82  PHE D CE2 1 
ATOM   4282  C  CZ  . PHE D  1 82  ? -23.652 58.269  -15.819 1.00 22.42  ?  82  PHE D CZ  1 
ATOM   4283  N  N   . LEU D  1 83  ? -29.172 59.142  -20.488 1.00 30.80  ?  83  LEU D N   1 
ATOM   4284  C  CA  . LEU D  1 83  ? -30.270 59.585  -21.343 1.00 31.05  ?  83  LEU D CA  1 
ATOM   4285  C  C   . LEU D  1 83  ? -31.486 60.070  -20.610 1.00 32.08  ?  83  LEU D C   1 
ATOM   4286  O  O   . LEU D  1 83  ? -32.042 59.361  -19.762 1.00 32.94  ?  83  LEU D O   1 
ATOM   4287  C  CB  . LEU D  1 83  ? -30.728 58.449  -22.246 1.00 30.84  ?  83  LEU D CB  1 
ATOM   4288  C  CG  . LEU D  1 83  ? -31.669 58.794  -23.403 1.00 29.17  ?  83  LEU D CG  1 
ATOM   4289  C  CD1 . LEU D  1 83  ? -30.931 59.543  -24.517 1.00 26.59  ?  83  LEU D CD1 1 
ATOM   4290  C  CD2 . LEU D  1 83  ? -32.244 57.519  -23.881 1.00 25.86  ?  83  LEU D CD2 1 
ATOM   4291  N  N   . PHE D  1 84  ? -31.963 61.244  -21.001 1.00 32.94  ?  84  PHE D N   1 
ATOM   4292  C  CA  . PHE D  1 84  ? -33.063 61.882  -20.275 1.00 33.09  ?  84  PHE D CA  1 
ATOM   4293  C  C   . PHE D  1 84  ? -34.275 62.120  -21.126 1.00 34.06  ?  84  PHE D C   1 
ATOM   4294  O  O   . PHE D  1 84  ? -34.159 62.245  -22.336 1.00 34.50  ?  84  PHE D O   1 
ATOM   4295  C  CB  . PHE D  1 84  ? -32.603 63.215  -19.702 1.00 32.60  ?  84  PHE D CB  1 
ATOM   4296  C  CG  . PHE D  1 84  ? -31.410 63.105  -18.827 1.00 30.63  ?  84  PHE D CG  1 
ATOM   4297  C  CD1 . PHE D  1 84  ? -30.126 63.208  -19.370 1.00 29.09  ?  84  PHE D CD1 1 
ATOM   4298  C  CD2 . PHE D  1 84  ? -31.551 62.869  -17.457 1.00 28.38  ?  84  PHE D CD2 1 
ATOM   4299  C  CE1 . PHE D  1 84  ? -28.990 63.090  -18.570 1.00 24.93  ?  84  PHE D CE1 1 
ATOM   4300  C  CE2 . PHE D  1 84  ? -30.392 62.739  -16.631 1.00 25.97  ?  84  PHE D CE2 1 
ATOM   4301  C  CZ  . PHE D  1 84  ? -29.127 62.859  -17.193 1.00 25.01  ?  84  PHE D CZ  1 
ATOM   4302  N  N   . ALA D  1 85  ? -35.429 62.189  -20.468 1.00 35.88  ?  85  ALA D N   1 
ATOM   4303  C  CA  . ALA D  1 85  ? -36.710 62.504  -21.070 1.00 37.71  ?  85  ALA D CA  1 
ATOM   4304  C  C   . ALA D  1 85  ? -37.091 63.967  -20.810 1.00 40.00  ?  85  ALA D C   1 
ATOM   4305  O  O   . ALA D  1 85  ? -37.320 64.355  -19.655 1.00 40.76  ?  85  ALA D O   1 
ATOM   4306  C  CB  . ALA D  1 85  ? -37.767 61.594  -20.508 1.00 36.58  ?  85  ALA D CB  1 
ATOM   4307  N  N   . ILE D  1 86  ? -37.164 64.774  -21.870 1.00 42.23  ?  86  ILE D N   1 
ATOM   4308  C  CA  . ILE D  1 86  ? -37.858 66.065  -21.804 1.00 44.45  ?  86  ILE D CA  1 
ATOM   4309  C  C   . ILE D  1 86  ? -39.130 66.042  -22.657 1.00 46.50  ?  86  ILE D C   1 
ATOM   4310  O  O   . ILE D  1 86  ? -39.120 65.591  -23.806 1.00 46.94  ?  86  ILE D O   1 
ATOM   4311  C  CB  . ILE D  1 86  ? -36.960 67.272  -22.199 1.00 44.18  ?  86  ILE D CB  1 
ATOM   4312  C  CG1 . ILE D  1 86  ? -35.597 67.208  -21.478 1.00 44.40  ?  86  ILE D CG1 1 
ATOM   4313  C  CG2 . ILE D  1 86  ? -37.676 68.583  -21.876 1.00 43.93  ?  86  ILE D CG2 1 
ATOM   4314  C  CD1 . ILE D  1 86  ? -34.553 68.344  -21.814 1.00 41.67  ?  86  ILE D CD1 1 
ATOM   4315  N  N   . GLU D  1 87  ? -40.217 66.523  -22.063 1.00 49.08  ?  87  GLU D N   1 
ATOM   4316  C  CA  . GLU D  1 87  ? -41.525 66.671  -22.704 1.00 51.52  ?  87  GLU D CA  1 
ATOM   4317  C  C   . GLU D  1 87  ? -41.835 68.113  -23.076 1.00 53.10  ?  87  GLU D C   1 
ATOM   4318  O  O   . GLU D  1 87  ? -41.189 69.032  -22.572 1.00 53.49  ?  87  GLU D O   1 
ATOM   4319  C  CB  . GLU D  1 87  ? -42.618 66.246  -21.724 1.00 51.51  ?  87  GLU D CB  1 
ATOM   4320  C  CG  . GLU D  1 87  ? -42.762 64.778  -21.590 1.00 53.45  ?  87  GLU D CG  1 
ATOM   4321  C  CD  . GLU D  1 87  ? -42.758 64.097  -22.937 1.00 56.89  ?  87  GLU D CD  1 
ATOM   4322  O  OE1 . GLU D  1 87  ? -42.224 62.968  -23.008 1.00 56.42  ?  87  GLU D OE1 1 
ATOM   4323  O  OE2 . GLU D  1 87  ? -43.295 64.690  -23.919 1.00 58.92  -1 87  GLU D OE2 1 
ATOM   4324  N  N   . LEU D  1 88  ? -42.847 68.295  -23.932 1.00 55.01  ?  88  LEU D N   1 
ATOM   4325  C  CA  . LEU D  1 88  ? -43.450 69.605  -24.235 1.00 56.49  ?  88  LEU D CA  1 
ATOM   4326  C  C   . LEU D  1 88  ? -44.917 69.394  -24.618 1.00 58.35  ?  88  LEU D C   1 
ATOM   4327  O  O   . LEU D  1 88  ? -45.446 68.280  -24.434 1.00 57.58  ?  88  LEU D O   1 
ATOM   4328  C  CB  . LEU D  1 88  ? -42.670 70.328  -25.331 1.00 55.69  ?  88  LEU D CB  1 
ATOM   4329  C  CG  . LEU D  1 88  ? -41.292 70.822  -24.852 1.00 55.14  ?  88  LEU D CG  1 
ATOM   4330  C  CD1 . LEU D  1 88  ? -40.262 71.037  -25.954 1.00 52.76  ?  88  LEU D CD1 1 
ATOM   4331  C  CD2 . LEU D  1 88  ? -41.444 72.076  -23.988 1.00 55.88  ?  88  LEU D CD2 1 
ATOM   4332  N  N   . GLU D  1 89  ? -45.596 70.454  -25.074 1.00 60.80  ?  89  GLU D N   1 
ATOM   4333  C  CA  . GLU D  1 89  ? -46.848 70.263  -25.837 1.00 63.38  ?  89  GLU D CA  1 
ATOM   4334  C  C   . GLU D  1 89  ? -46.710 70.887  -27.204 1.00 64.59  ?  89  GLU D C   1 
ATOM   4335  O  O   . GLU D  1 89  ? -47.382 70.453  -28.146 1.00 64.94  ?  89  GLU D O   1 
ATOM   4336  C  CB  . GLU D  1 89  ? -48.127 70.797  -25.174 1.00 63.48  ?  89  GLU D CB  1 
ATOM   4337  C  CG  . GLU D  1 89  ? -48.359 70.407  -23.754 1.00 65.41  ?  89  GLU D CG  1 
ATOM   4338  C  CD  . GLU D  1 89  ? -47.739 71.423  -22.824 1.00 69.56  ?  89  GLU D CD  1 
ATOM   4339  O  OE1 . GLU D  1 89  ? -46.521 71.709  -23.004 1.00 70.25  ?  89  GLU D OE1 1 
ATOM   4340  O  OE2 . GLU D  1 89  ? -48.467 71.945  -21.933 1.00 71.06  -1 89  GLU D OE2 1 
ATOM   4341  N  N   . GLN D  1 90  ? -45.859 71.903  -27.324 1.00 66.05  ?  90  GLN D N   1 
ATOM   4342  C  CA  . GLN D  1 90  ? -45.575 72.424  -28.661 1.00 68.09  ?  90  GLN D CA  1 
ATOM   4343  C  C   . GLN D  1 90  ? -44.119 72.512  -29.081 1.00 68.82  ?  90  GLN D C   1 
ATOM   4344  O  O   . GLN D  1 90  ? -43.252 72.981  -28.327 1.00 68.92  ?  90  GLN D O   1 
ATOM   4345  C  CB  . GLN D  1 90  ? -46.364 73.701  -29.027 1.00 68.34  ?  90  GLN D CB  1 
ATOM   4346  C  CG  . GLN D  1 90  ? -46.499 74.757  -27.960 1.00 69.96  ?  90  GLN D CG  1 
ATOM   4347  C  CD  . GLN D  1 90  ? -47.834 75.484  -28.070 1.00 72.77  ?  90  GLN D CD  1 
ATOM   4348  O  OE1 . GLN D  1 90  ? -47.934 76.527  -28.736 1.00 72.98  ?  90  GLN D OE1 1 
ATOM   4349  N  NE2 . GLN D  1 90  ? -48.879 74.920  -27.437 1.00 72.94  ?  90  GLN D NE2 1 
ATOM   4350  N  N   . ILE D  1 91  ? -43.892 72.066  -30.317 1.00 69.76  ?  91  ILE D N   1 
ATOM   4351  C  CA  . ILE D  1 91  ? -42.661 72.326  -31.045 1.00 70.72  ?  91  ILE D CA  1 
ATOM   4352  C  C   . ILE D  1 91  ? -42.518 73.833  -31.137 1.00 71.38  ?  91  ILE D C   1 
ATOM   4353  O  O   . ILE D  1 91  ? -43.510 74.554  -31.273 1.00 71.52  ?  91  ILE D O   1 
ATOM   4354  C  CB  . ILE D  1 91  ? -42.717 71.733  -32.480 1.00 70.71  ?  91  ILE D CB  1 
ATOM   4355  C  CG1 . ILE D  1 91  ? -43.155 70.268  -32.446 1.00 70.86  ?  91  ILE D CG1 1 
ATOM   4356  C  CG2 . ILE D  1 91  ? -41.374 71.873  -33.181 1.00 70.22  ?  91  ILE D CG2 1 
ATOM   4357  C  CD1 . ILE D  1 91  ? -43.765 69.776  -33.731 1.00 71.30  ?  91  ILE D CD1 1 
ATOM   4358  N  N   . CYS D  1 92  ? -41.286 74.305  -31.066 1.00 72.17  ?  92  CYS D N   1 
ATOM   4359  C  CA  . CYS D  1 92  ? -41.029 75.731  -31.054 1.00 73.33  ?  92  CYS D CA  1 
ATOM   4360  C  C   . CYS D  1 92  ? -39.864 76.049  -31.990 1.00 73.58  ?  92  CYS D C   1 
ATOM   4361  O  O   . CYS D  1 92  ? -39.364 75.147  -32.669 1.00 73.61  ?  92  CYS D O   1 
ATOM   4362  C  CB  . CYS D  1 92  ? -40.718 76.167  -29.619 1.00 73.61  ?  92  CYS D CB  1 
ATOM   4363  S  SG  . CYS D  1 92  ? -39.339 75.246  -28.879 1.00 74.96  ?  92  CYS D SG  1 
ATOM   4364  N  N   . PRO D  1 93  ? -39.435 77.331  -32.043 1.00 74.05  ?  93  PRO D N   1 
ATOM   4365  C  CA  . PRO D  1 93  ? -38.174 77.707  -32.693 1.00 74.31  ?  93  PRO D CA  1 
ATOM   4366  C  C   . PRO D  1 93  ? -37.064 76.686  -32.492 1.00 74.27  ?  93  PRO D C   1 
ATOM   4367  O  O   . PRO D  1 93  ? -37.127 75.852  -31.592 1.00 74.03  ?  93  PRO D O   1 
ATOM   4368  C  CB  . PRO D  1 93  ? -37.776 79.013  -31.964 1.00 74.53  ?  93  PRO D CB  1 
ATOM   4369  C  CG  . PRO D  1 93  ? -39.014 79.445  -31.144 1.00 74.11  ?  93  PRO D CG  1 
ATOM   4370  C  CD  . PRO D  1 93  ? -40.151 78.531  -31.573 1.00 74.11  ?  93  PRO D CD  1 
ATOM   4371  N  N   . THR D  1 94  ? -36.057 76.760  -33.346 1.00 74.50  ?  94  THR D N   1 
ATOM   4372  C  CA  . THR D  1 94  ? -34.822 76.010  -33.148 1.00 74.61  ?  94  THR D CA  1 
ATOM   4373  C  C   . THR D  1 94  ? -33.655 77.014  -33.067 1.00 74.09  ?  94  THR D C   1 
ATOM   4374  O  O   . THR D  1 94  ? -33.777 78.036  -32.390 1.00 74.12  ?  94  THR D O   1 
ATOM   4375  C  CB  . THR D  1 94  ? -34.651 74.857  -34.204 1.00 74.86  ?  94  THR D CB  1 
ATOM   4376  O  OG1 . THR D  1 94  ? -33.288 74.402  -34.215 1.00 76.01  ?  94  THR D OG1 1 
ATOM   4377  C  CG2 . THR D  1 94  ? -35.090 75.289  -35.633 1.00 75.17  ?  94  THR D CG2 1 
ATOM   4378  N  N   . GLN D  1 95  ? -32.541 76.727  -33.734 1.00 73.65  ?  95  GLN D N   1 
ATOM   4379  C  CA  . GLN D  1 95  ? -31.384 77.636  -33.813 1.00 73.34  ?  95  GLN D CA  1 
ATOM   4380  C  C   . GLN D  1 95  ? -30.260 77.319  -32.806 1.00 72.75  ?  95  GLN D C   1 
ATOM   4381  O  O   . GLN D  1 95  ? -30.195 77.893  -31.717 1.00 72.41  ?  95  GLN D O   1 
ATOM   4382  C  CB  . GLN D  1 95  ? -31.807 79.129  -33.794 1.00 73.53  ?  95  GLN D CB  1 
ATOM   4383  C  CG  . GLN D  1 95  ? -30.659 80.185  -33.926 1.00 74.79  ?  95  GLN D CG  1 
ATOM   4384  C  CD  . GLN D  1 95  ? -29.788 80.054  -35.200 1.00 75.80  ?  95  GLN D CD  1 
ATOM   4385  O  OE1 . GLN D  1 95  ? -28.577 80.296  -35.155 1.00 76.40  ?  95  GLN D OE1 1 
ATOM   4386  N  NE2 . GLN D  1 95  ? -30.403 79.683  -36.326 1.00 75.00  ?  95  GLN D NE2 1 
ATOM   4387  N  N   . PRO D  1 96  ? -29.372 76.389  -33.185 1.00 72.46  ?  96  PRO D N   1 
ATOM   4388  C  CA  . PRO D  1 96  ? -28.098 76.107  -32.537 1.00 72.24  ?  96  PRO D CA  1 
ATOM   4389  C  C   . PRO D  1 96  ? -27.322 77.355  -32.174 1.00 71.95  ?  96  PRO D C   1 
ATOM   4390  O  O   . PRO D  1 96  ? -27.295 78.318  -32.941 1.00 71.93  ?  96  PRO D O   1 
ATOM   4391  C  CB  . PRO D  1 96  ? -27.310 75.357  -33.619 1.00 72.32  ?  96  PRO D CB  1 
ATOM   4392  C  CG  . PRO D  1 96  ? -28.346 74.748  -34.515 1.00 72.45  ?  96  PRO D CG  1 
ATOM   4393  C  CD  . PRO D  1 96  ? -29.685 75.381  -34.214 1.00 72.69  ?  96  PRO D CD  1 
ATOM   4394  N  N   . HIS D  1 97  ? -26.700 77.319  -31.003 1.00 71.83  ?  97  HIS D N   1 
ATOM   4395  C  CA  . HIS D  1 97  ? -25.723 78.324  -30.598 1.00 71.81  ?  97  HIS D CA  1 
ATOM   4396  C  C   . HIS D  1 97  ? -24.341 77.658  -30.535 1.00 71.55  ?  97  HIS D C   1 
ATOM   4397  O  O   . HIS D  1 97  ? -23.563 77.889  -29.598 1.00 71.76  ?  97  HIS D O   1 
ATOM   4398  C  CB  . HIS D  1 97  ? -26.123 78.981  -29.265 1.00 71.68  ?  97  HIS D CB  1 
ATOM   4399  C  CG  . HIS D  1 97  ? -27.488 79.610  -29.279 1.00 72.58  ?  97  HIS D CG  1 
ATOM   4400  N  ND1 . HIS D  1 97  ? -27.916 80.451  -30.285 1.00 74.11  ?  97  HIS D ND1 1 
ATOM   4401  C  CD2 . HIS D  1 97  ? -28.514 79.535  -28.397 1.00 73.76  ?  97  HIS D CD2 1 
ATOM   4402  C  CE1 . HIS D  1 97  ? -29.147 80.860  -30.028 1.00 74.56  ?  97  HIS D CE1 1 
ATOM   4403  N  NE2 . HIS D  1 97  ? -29.535 80.318  -28.886 1.00 73.83  ?  97  HIS D NE2 1 
ATOM   4404  N  N   . ASP D  1 98  ? -24.077 76.807  -31.535 1.00 71.07  ?  98  ASP D N   1 
ATOM   4405  C  CA  . ASP D  1 98  ? -22.775 76.139  -31.752 1.00 70.49  ?  98  ASP D CA  1 
ATOM   4406  C  C   . ASP D  1 98  ? -22.532 75.877  -33.243 1.00 70.32  ?  98  ASP D C   1 
ATOM   4407  O  O   . ASP D  1 98  ? -23.404 75.370  -33.965 1.00 70.32  ?  98  ASP D O   1 
ATOM   4408  C  CB  . ASP D  1 98  ? -22.651 74.817  -30.959 1.00 70.33  ?  98  ASP D CB  1 
ATOM   4409  C  CG  . ASP D  1 98  ? -21.199 74.297  -30.866 1.00 69.43  ?  98  ASP D CG  1 
ATOM   4410  O  OD1 . ASP D  1 98  ? -20.317 74.771  -31.615 1.00 69.05  ?  98  ASP D OD1 1 
ATOM   4411  O  OD2 . ASP D  1 98  ? -20.936 73.401  -30.032 1.00 67.37  -1 98  ASP D OD2 1 
ATOM   4412  N  N   . SER D  1 99  ? -21.330 76.251  -33.674 1.00 70.09  ?  99  SER D N   1 
ATOM   4413  C  CA  . SER D  1 99  ? -20.802 76.002  -35.016 1.00 69.51  ?  99  SER D CA  1 
ATOM   4414  C  C   . SER D  1 99  ? -21.043 74.578  -35.514 1.00 69.07  ?  99  SER D C   1 
ATOM   4415  O  O   . SER D  1 99  ? -21.562 74.379  -36.618 1.00 69.38  ?  99  SER D O   1 
ATOM   4416  C  CB  . SER D  1 99  ? -19.290 76.307  -35.033 1.00 69.68  ?  99  SER D CB  1 
ATOM   4417  O  OG  . SER D  1 99  ? -18.563 75.347  -35.787 1.00 68.99  ?  99  SER D OG  1 
ATOM   4418  N  N   . ASP D  1 100 ? -20.674 73.602  -34.688 1.00 67.94  ?  100 ASP D N   1 
ATOM   4419  C  CA  . ASP D  1 100 ? -20.652 72.199  -35.089 1.00 66.96  ?  100 ASP D CA  1 
ATOM   4420  C  C   . ASP D  1 100 ? -21.939 71.681  -35.702 1.00 65.93  ?  100 ASP D C   1 
ATOM   4421  O  O   . ASP D  1 100 ? -21.905 70.900  -36.652 1.00 65.37  ?  100 ASP D O   1 
ATOM   4422  C  CB  . ASP D  1 100 ? -20.230 71.334  -33.912 1.00 67.14  ?  100 ASP D CB  1 
ATOM   4423  C  CG  . ASP D  1 100 ? -18.764 71.496  -33.580 1.00 67.78  ?  100 ASP D CG  1 
ATOM   4424  O  OD1 . ASP D  1 100 ? -18.423 71.377  -32.390 1.00 68.58  ?  100 ASP D OD1 1 
ATOM   4425  O  OD2 . ASP D  1 100 ? -17.950 71.746  -34.507 1.00 68.53  -1 100 ASP D OD2 1 
ATOM   4426  N  N   . ILE D  1 101 ? -23.061 72.130  -35.158 1.00 65.13  ?  101 ILE D N   1 
ATOM   4427  C  CA  . ILE D  1 101 ? -24.368 71.730  -35.641 1.00 64.90  ?  101 ILE D CA  1 
ATOM   4428  C  C   . ILE D  1 101 ? -24.689 72.438  -36.940 1.00 64.80  ?  101 ILE D C   1 
ATOM   4429  O  O   . ILE D  1 101 ? -24.525 73.658  -37.030 1.00 65.03  ?  101 ILE D O   1 
ATOM   4430  C  CB  . ILE D  1 101 ? -25.477 72.052  -34.599 1.00 64.82  ?  101 ILE D CB  1 
ATOM   4431  C  CG1 . ILE D  1 101 ? -25.206 71.344  -33.264 1.00 64.66  ?  101 ILE D CG1 1 
ATOM   4432  C  CG2 . ILE D  1 101 ? -26.874 71.713  -35.131 1.00 64.93  ?  101 ILE D CG2 1 
ATOM   4433  C  CD1 . ILE D  1 101 ? -24.911 69.865  -33.361 1.00 63.63  ?  101 ILE D CD1 1 
ATOM   4434  N  N   . ASP D  1 102 ? -25.133 71.668  -37.939 1.00 64.69  ?  102 ASP D N   1 
ATOM   4435  C  CA  . ASP D  1 102 ? -25.687 72.229  -39.180 1.00 64.48  ?  102 ASP D CA  1 
ATOM   4436  C  C   . ASP D  1 102 ? -27.072 72.833  -38.872 1.00 64.57  ?  102 ASP D C   1 
ATOM   4437  O  O   . ASP D  1 102 ? -27.243 74.038  -38.944 1.00 64.47  ?  102 ASP D O   1 
ATOM   4438  C  CB  . ASP D  1 102 ? -25.769 71.187  -40.318 1.00 64.29  ?  102 ASP D CB  1 
ATOM   4439  C  CG  . ASP D  1 102 ? -24.487 70.335  -40.477 1.00 64.19  ?  102 ASP D CG  1 
ATOM   4440  O  OD1 . ASP D  1 102 ? -23.416 70.756  -39.997 1.00 64.32  ?  102 ASP D OD1 1 
ATOM   4441  O  OD2 . ASP D  1 102 ? -24.554 69.239  -41.102 1.00 63.40  -1 102 ASP D OD2 1 
ATOM   4442  N  N   . CYS D  1 103 ? -28.045 72.003  -38.503 1.00 64.71  ?  103 CYS D N   1 
ATOM   4443  C  CA  . CYS D  1 103 ? -29.379 72.479  -38.121 1.00 64.89  ?  103 CYS D CA  1 
ATOM   4444  C  C   . CYS D  1 103 ? -30.066 71.413  -37.263 1.00 64.87  ?  103 CYS D C   1 
ATOM   4445  O  O   . CYS D  1 103 ? -29.471 70.358  -36.985 1.00 64.86  ?  103 CYS D O   1 
ATOM   4446  C  CB  . CYS D  1 103 ? -30.223 72.777  -39.368 1.00 65.13  ?  103 CYS D CB  1 
ATOM   4447  S  SG  . CYS D  1 103 ? -30.851 71.288  -40.272 1.00 66.78  ?  103 CYS D SG  1 
ATOM   4448  N  N   . CYS D  1 104 ? -31.313 71.673  -36.863 1.00 64.52  ?  104 CYS D N   1 
ATOM   4449  C  CA  . CYS D  1 104 ? -32.111 70.694  -36.122 1.00 64.28  ?  104 CYS D CA  1 
ATOM   4450  C  C   . CYS D  1 104 ? -33.426 70.506  -36.816 1.00 63.89  ?  104 CYS D C   1 
ATOM   4451  O  O   . CYS D  1 104 ? -33.886 71.414  -37.505 1.00 64.31  ?  104 CYS D O   1 
ATOM   4452  C  CB  . CYS D  1 104 ? -32.415 71.200  -34.713 1.00 64.55  ?  104 CYS D CB  1 
ATOM   4453  S  SG  . CYS D  1 104 ? -30.961 71.627  -33.729 1.00 65.72  ?  104 CYS D SG  1 
ATOM   4454  N  N   . ARG D  1 105 ? -34.036 69.337  -36.637 1.00 63.19  ?  105 ARG D N   1 
ATOM   4455  C  CA  . ARG D  1 105 ? -35.440 69.136  -37.035 1.00 62.52  ?  105 ARG D CA  1 
ATOM   4456  C  C   . ARG D  1 105 ? -36.203 68.171  -36.143 1.00 61.37  ?  105 ARG D C   1 
ATOM   4457  O  O   . ARG D  1 105 ? -35.653 67.556  -35.237 1.00 61.26  ?  105 ARG D O   1 
ATOM   4458  C  CB  . ARG D  1 105 ? -35.622 68.763  -38.528 1.00 62.77  ?  105 ARG D CB  1 
ATOM   4459  C  CG  . ARG D  1 105 ? -34.806 67.594  -39.038 1.00 64.02  ?  105 ARG D CG  1 
ATOM   4460  C  CD  . ARG D  1 105 ? -33.794 68.047  -40.062 1.00 66.65  ?  105 ARG D CD  1 
ATOM   4461  N  NE  . ARG D  1 105 ? -34.447 68.348  -41.334 1.00 69.11  ?  105 ARG D NE  1 
ATOM   4462  C  CZ  . ARG D  1 105 ? -33.819 68.768  -42.435 1.00 70.84  ?  105 ARG D CZ  1 
ATOM   4463  N  NH1 . ARG D  1 105 ? -32.496 68.951  -42.450 1.00 70.52  ?  105 ARG D NH1 1 
ATOM   4464  N  NH2 . ARG D  1 105 ? -34.526 69.003  -43.535 1.00 71.05  ?  105 ARG D NH2 1 
ATOM   4465  N  N   . TRP D  1 106 ? -37.479 68.040  -36.443 1.00 60.38  ?  106 TRP D N   1 
ATOM   4466  C  CA  . TRP D  1 106 ? -38.403 67.431  -35.542 1.00 60.10  ?  106 TRP D CA  1 
ATOM   4467  C  C   . TRP D  1 106 ? -39.037 66.183  -36.102 1.00 59.43  ?  106 TRP D C   1 
ATOM   4468  O  O   . TRP D  1 106 ? -40.235 65.978  -35.968 1.00 59.31  ?  106 TRP D O   1 
ATOM   4469  C  CB  . TRP D  1 106 ? -39.452 68.460  -35.163 1.00 60.52  ?  106 TRP D CB  1 
ATOM   4470  C  CG  . TRP D  1 106 ? -38.972 69.281  -34.033 1.00 62.58  ?  106 TRP D CG  1 
ATOM   4471  C  CD1 . TRP D  1 106 ? -38.029 70.277  -34.076 1.00 63.48  ?  106 TRP D CD1 1 
ATOM   4472  C  CD2 . TRP D  1 106 ? -39.365 69.153  -32.661 1.00 63.56  ?  106 TRP D CD2 1 
ATOM   4473  N  NE1 . TRP D  1 106 ? -37.831 70.784  -32.814 1.00 63.79  ?  106 TRP D NE1 1 
ATOM   4474  C  CE2 . TRP D  1 106 ? -38.635 70.111  -31.928 1.00 63.98  ?  106 TRP D CE2 1 
ATOM   4475  C  CE3 . TRP D  1 106 ? -40.278 68.336  -31.986 1.00 64.26  ?  106 TRP D CE3 1 
ATOM   4476  C  CZ2 . TRP D  1 106 ? -38.793 70.274  -30.550 1.00 64.38  ?  106 TRP D CZ2 1 
ATOM   4477  C  CZ3 . TRP D  1 106 ? -40.431 68.498  -30.620 1.00 65.01  ?  106 TRP D CZ3 1 
ATOM   4478  C  CH2 . TRP D  1 106 ? -39.694 69.463  -29.915 1.00 63.96  ?  106 TRP D CH2 1 
ATOM   4479  N  N   . VAL D  1 107 ? -38.203 65.330  -36.689 1.00 58.35  ?  107 VAL D N   1 
ATOM   4480  C  CA  . VAL D  1 107 ? -38.626 64.075  -37.318 1.00 57.18  ?  107 VAL D CA  1 
ATOM   4481  C  C   . VAL D  1 107 ? -39.347 63.086  -36.396 1.00 56.01  ?  107 VAL D C   1 
ATOM   4482  O  O   . VAL D  1 107 ? -39.021 62.987  -35.217 1.00 56.03  ?  107 VAL D O   1 
ATOM   4483  C  CB  . VAL D  1 107 ? -37.428 63.397  -37.938 1.00 57.26  ?  107 VAL D CB  1 
ATOM   4484  C  CG1 . VAL D  1 107 ? -37.186 63.953  -39.333 1.00 58.44  ?  107 VAL D CG1 1 
ATOM   4485  C  CG2 . VAL D  1 107 ? -36.214 63.645  -37.079 1.00 56.94  ?  107 VAL D CG2 1 
ATOM   4486  N  N   . SER D  1 108 ? -40.324 62.372  -36.962 1.00 54.83  ?  108 SER D N   1 
ATOM   4487  C  CA  . SER D  1 108 ? -41.145 61.354  -36.281 1.00 53.48  ?  108 SER D CA  1 
ATOM   4488  C  C   . SER D  1 108 ? -40.374 60.070  -35.928 1.00 53.02  ?  108 SER D C   1 
ATOM   4489  O  O   . SER D  1 108 ? -39.248 59.823  -36.421 1.00 52.13  ?  108 SER D O   1 
ATOM   4490  C  CB  . SER D  1 108 ? -42.248 60.928  -37.216 1.00 53.34  ?  108 SER D CB  1 
ATOM   4491  O  OG  . SER D  1 108 ? -41.652 60.229  -38.300 1.00 52.59  ?  108 SER D OG  1 
ATOM   4492  N  N   . ALA D  1 109 ? -41.016 59.229  -35.117 1.00 52.39  ?  109 ALA D N   1 
ATOM   4493  C  CA  . ALA D  1 109 ? -40.371 58.007  -34.631 1.00 52.06  ?  109 ALA D CA  1 
ATOM   4494  C  C   . ALA D  1 109 ? -39.876 57.182  -35.792 1.00 51.64  ?  109 ALA D C   1 
ATOM   4495  O  O   . ALA D  1 109 ? -38.685 56.918  -35.900 1.00 51.61  ?  109 ALA D O   1 
ATOM   4496  C  CB  . ALA D  1 109 ? -41.306 57.189  -33.746 1.00 51.76  ?  109 ALA D CB  1 
ATOM   4497  N  N   . GLU D  1 110 ? -40.782 56.807  -36.690 1.00 51.47  ?  110 GLU D N   1 
ATOM   4498  C  CA  . GLU D  1 110 ? -40.419 55.810  -37.684 1.00 51.40  ?  110 GLU D CA  1 
ATOM   4499  C  C   . GLU D  1 110 ? -39.427 56.335  -38.715 1.00 50.49  ?  110 GLU D C   1 
ATOM   4500  O  O   . GLU D  1 110 ? -38.585 55.579  -39.180 1.00 51.25  ?  110 GLU D O   1 
ATOM   4501  C  CB  . GLU D  1 110 ? -41.617 54.978  -38.228 1.00 51.70  ?  110 GLU D CB  1 
ATOM   4502  C  CG  . GLU D  1 110 ? -42.656 55.689  -39.109 1.00 55.12  ?  110 GLU D CG  1 
ATOM   4503  C  CD  . GLU D  1 110 ? -43.520 56.762  -38.382 1.00 59.60  ?  110 GLU D CD  1 
ATOM   4504  O  OE1 . GLU D  1 110 ? -44.156 57.590  -39.114 1.00 59.62  ?  110 GLU D OE1 1 
ATOM   4505  O  OE2 . GLU D  1 110 ? -43.559 56.779  -37.109 1.00 59.58  -1 110 GLU D OE2 1 
ATOM   4506  N  N   . GLU D  1 111 ? -39.436 57.633  -38.993 1.00 49.37  ?  111 GLU D N   1 
ATOM   4507  C  CA  . GLU D  1 111 ? -38.358 58.188  -39.816 1.00 48.15  ?  111 GLU D CA  1 
ATOM   4508  C  C   . GLU D  1 111 ? -36.985 58.026  -39.149 1.00 47.07  ?  111 GLU D C   1 
ATOM   4509  O  O   . GLU D  1 111 ? -35.964 57.758  -39.826 1.00 47.13  ?  111 GLU D O   1 
ATOM   4510  C  CB  . GLU D  1 111 ? -38.603 59.656  -40.173 1.00 48.57  ?  111 GLU D CB  1 
ATOM   4511  C  CG  . GLU D  1 111 ? -37.495 60.230  -41.110 1.00 49.70  ?  111 GLU D CG  1 
ATOM   4512  C  CD  . GLU D  1 111 ? -37.788 61.601  -41.756 1.00 51.18  ?  111 GLU D CD  1 
ATOM   4513  O  OE1 . GLU D  1 111 ? -38.906 62.178  -41.608 1.00 51.04  ?  111 GLU D OE1 1 
ATOM   4514  O  OE2 . GLU D  1 111 ? -36.852 62.100  -42.426 1.00 52.92  -1 111 GLU D OE2 1 
ATOM   4515  N  N   . ILE D  1 112 ? -36.963 58.199  -37.827 1.00 45.31  ?  112 ILE D N   1 
ATOM   4516  C  CA  . ILE D  1 112 ? -35.720 58.092  -37.063 1.00 43.43  ?  112 ILE D CA  1 
ATOM   4517  C  C   . ILE D  1 112 ? -35.245 56.659  -37.088 1.00 42.57  ?  112 ILE D C   1 
ATOM   4518  O  O   . ILE D  1 112 ? -34.145 56.374  -37.557 1.00 42.29  ?  112 ILE D O   1 
ATOM   4519  C  CB  . ILE D  1 112 ? -35.876 58.592  -35.600 1.00 43.15  ?  112 ILE D CB  1 
ATOM   4520  C  CG1 . ILE D  1 112 ? -36.121 60.100  -35.585 1.00 42.42  ?  112 ILE D CG1 1 
ATOM   4521  C  CG2 . ILE D  1 112 ? -34.659 58.256  -34.790 1.00 42.96  ?  112 ILE D CG2 1 
ATOM   4522  C  CD1 . ILE D  1 112 ? -35.609 60.828  -34.368 1.00 40.48  ?  112 ILE D CD1 1 
ATOM   4523  N  N   . LEU D  1 113 ? -36.111 55.780  -36.589 1.00 41.76  ?  113 LEU D N   1 
ATOM   4524  C  CA  . LEU D  1 113 ? -35.936 54.341  -36.581 1.00 41.12  ?  113 LEU D CA  1 
ATOM   4525  C  C   . LEU D  1 113 ? -35.614 53.717  -37.945 1.00 41.91  ?  113 LEU D C   1 
ATOM   4526  O  O   . LEU D  1 113 ? -35.060 52.620  -37.996 1.00 42.20  ?  113 LEU D O   1 
ATOM   4527  C  CB  . LEU D  1 113 ? -37.216 53.728  -36.032 1.00 40.95  ?  113 LEU D CB  1 
ATOM   4528  C  CG  . LEU D  1 113 ? -37.335 53.328  -34.554 1.00 39.74  ?  113 LEU D CG  1 
ATOM   4529  C  CD1 . LEU D  1 113 ? -36.400 54.105  -33.661 1.00 37.72  ?  113 LEU D CD1 1 
ATOM   4530  C  CD2 . LEU D  1 113 ? -38.778 53.404  -34.050 1.00 38.17  ?  113 LEU D CD2 1 
ATOM   4531  N  N   . GLN D  1 114 ? -35.956 54.391  -39.049 1.00 42.18  ?  114 GLN D N   1 
ATOM   4532  C  CA  . GLN D  1 114 ? -35.643 53.848  -40.384 1.00 42.97  ?  114 GLN D CA  1 
ATOM   4533  C  C   . GLN D  1 114 ? -34.522 54.593  -41.173 1.00 42.72  ?  114 GLN D C   1 
ATOM   4534  O  O   . GLN D  1 114 ? -34.589 54.644  -42.412 1.00 42.66  ?  114 GLN D O   1 
ATOM   4535  C  CB  . GLN D  1 114 ? -36.927 53.725  -41.268 1.00 43.57  ?  114 GLN D CB  1 
ATOM   4536  C  CG  . GLN D  1 114 ? -38.012 52.645  -40.853 1.00 44.38  ?  114 GLN D CG  1 
ATOM   4537  C  CD  . GLN D  1 114 ? -37.806 51.197  -41.437 1.00 46.07  ?  114 GLN D CD  1 
ATOM   4538  O  OE1 . GLN D  1 114 ? -38.600 50.298  -41.141 1.00 46.98  ?  114 GLN D OE1 1 
ATOM   4539  N  NE2 . GLN D  1 114 ? -36.761 50.985  -42.252 1.00 45.42  ?  114 GLN D NE2 1 
ATOM   4540  N  N   . ALA D  1 115 ? -33.498 55.137  -40.508 1.00 41.40  ?  115 ALA D N   1 
ATOM   4541  C  CA  . ALA D  1 115 ? -32.600 56.038  -41.240 1.00 40.86  ?  115 ALA D CA  1 
ATOM   4542  C  C   . ALA D  1 115 ? -31.130 55.648  -41.336 1.00 41.02  ?  115 ALA D C   1 
ATOM   4543  O  O   . ALA D  1 115 ? -30.480 55.214  -40.373 1.00 40.79  ?  115 ALA D O   1 
ATOM   4544  C  CB  . ALA D  1 115 ? -32.755 57.466  -40.775 1.00 40.15  ?  115 ALA D CB  1 
ATOM   4545  N  N   . SER D  1 116 ? -30.594 55.868  -42.519 1.00 41.24  ?  116 SER D N   1 
ATOM   4546  C  CA  . SER D  1 116 ? -29.232 55.490  -42.794 1.00 42.40  ?  116 SER D CA  1 
ATOM   4547  C  C   . SER D  1 116 ? -28.214 56.479  -42.260 1.00 42.91  ?  116 SER D C   1 
ATOM   4548  O  O   . SER D  1 116 ? -27.016 56.235  -42.417 1.00 43.69  ?  116 SER D O   1 
ATOM   4549  C  CB  . SER D  1 116 ? -29.011 55.245  -44.303 1.00 42.87  ?  116 SER D CB  1 
ATOM   4550  O  OG  . SER D  1 116 ? -29.946 55.952  -45.107 1.00 43.29  ?  116 SER D OG  1 
ATOM   4551  N  N   . ASN D  1 117 ? -28.657 57.573  -41.631 1.00 42.80  ?  117 ASN D N   1 
ATOM   4552  C  CA  . ASN D  1 117 ? -27.687 58.579  -41.150 1.00 43.31  ?  117 ASN D CA  1 
ATOM   4553  C  C   . ASN D  1 117 ? -27.611 58.851  -39.633 1.00 43.12  ?  117 ASN D C   1 
ATOM   4554  O  O   . ASN D  1 117 ? -27.296 59.968  -39.232 1.00 43.89  ?  117 ASN D O   1 
ATOM   4555  C  CB  . ASN D  1 117 ? -27.849 59.914  -41.908 1.00 43.65  ?  117 ASN D CB  1 
ATOM   4556  C  CG  . ASN D  1 117 ? -29.217 60.571  -41.674 1.00 45.18  ?  117 ASN D CG  1 
ATOM   4557  O  OD1 . ASN D  1 117 ? -30.248 59.891  -41.559 1.00 47.21  ?  117 ASN D OD1 1 
ATOM   4558  N  ND2 . ASN D  1 117 ? -29.224 61.892  -41.592 1.00 44.98  ?  117 ASN D ND2 1 
ATOM   4559  N  N   . LEU D  1 118 ? -27.875 57.850  -38.793 1.00 42.37  ?  118 LEU D N   1 
ATOM   4560  C  CA  . LEU D  1 118 ? -27.817 58.032  -37.344 1.00 40.96  ?  118 LEU D CA  1 
ATOM   4561  C  C   . LEU D  1 118 ? -26.365 58.005  -36.886 1.00 40.80  ?  118 LEU D C   1 
ATOM   4562  O  O   . LEU D  1 118 ? -25.586 57.193  -37.360 1.00 40.31  ?  118 LEU D O   1 
ATOM   4563  C  CB  . LEU D  1 118 ? -28.646 56.956  -36.659 1.00 40.69  ?  118 LEU D CB  1 
ATOM   4564  C  CG  . LEU D  1 118 ? -30.115 56.929  -37.132 1.00 41.20  ?  118 LEU D CG  1 
ATOM   4565  C  CD1 . LEU D  1 118 ? -30.956 55.925  -36.353 1.00 40.54  ?  118 LEU D CD1 1 
ATOM   4566  C  CD2 . LEU D  1 118 ? -30.798 58.319  -37.119 1.00 39.38  ?  118 LEU D CD2 1 
ATOM   4567  N  N   . ARG D  1 119 ? -25.985 58.913  -35.987 1.00 40.32  ?  119 ARG D N   1 
ATOM   4568  C  CA  . ARG D  1 119 ? -24.564 59.096  -35.665 1.00 39.80  ?  119 ARG D CA  1 
ATOM   4569  C  C   . ARG D  1 119 ? -23.956 57.866  -35.001 1.00 39.24  ?  119 ARG D C   1 
ATOM   4570  O  O   . ARG D  1 119 ? -22.766 57.583  -35.160 1.00 38.48  ?  119 ARG D O   1 
ATOM   4571  C  CB  . ARG D  1 119 ? -24.338 60.365  -34.811 1.00 40.55  ?  119 ARG D CB  1 
ATOM   4572  C  CG  . ARG D  1 119 ? -22.989 60.434  -34.072 1.00 41.25  ?  119 ARG D CG  1 
ATOM   4573  C  CD  . ARG D  1 119 ? -21.971 61.346  -34.715 1.00 44.51  ?  119 ARG D CD  1 
ATOM   4574  N  NE  . ARG D  1 119 ? -21.152 61.948  -33.662 1.00 50.55  ?  119 ARG D NE  1 
ATOM   4575  C  CZ  . ARG D  1 119 ? -21.554 62.927  -32.828 1.00 52.51  ?  119 ARG D CZ  1 
ATOM   4576  N  NH1 . ARG D  1 119 ? -22.781 63.478  -32.912 1.00 51.45  ?  119 ARG D NH1 1 
ATOM   4577  N  NH2 . ARG D  1 119 ? -20.712 63.366  -31.896 1.00 52.64  ?  119 ARG D NH2 1 
ATOM   4578  N  N   . SER D  1 120 ? -24.773 57.143  -34.242 1.00 38.76  ?  120 SER D N   1 
ATOM   4579  C  CA  . SER D  1 120 ? -24.300 55.933  -33.563 1.00 38.34  ?  120 SER D CA  1 
ATOM   4580  C  C   . SER D  1 120 ? -25.493 55.053  -33.347 1.00 37.42  ?  120 SER D C   1 
ATOM   4581  O  O   . SER D  1 120 ? -26.624 55.533  -33.370 1.00 36.95  ?  120 SER D O   1 
ATOM   4582  C  CB  . SER D  1 120 ? -23.573 56.228  -32.225 1.00 38.31  ?  120 SER D CB  1 
ATOM   4583  O  OG  . SER D  1 120 ? -24.440 56.842  -31.277 1.00 38.69  ?  120 SER D OG  1 
ATOM   4584  N  N   . PRO D  1 121 ? -25.237 53.745  -33.184 1.00 37.14  ?  121 PRO D N   1 
ATOM   4585  C  CA  . PRO D  1 121 ? -26.264 52.772  -32.816 1.00 36.48  ?  121 PRO D CA  1 
ATOM   4586  C  C   . PRO D  1 121 ? -27.137 53.353  -31.679 1.00 35.91  ?  121 PRO D C   1 
ATOM   4587  O  O   . PRO D  1 121 ? -28.385 53.279  -31.716 1.00 36.44  ?  121 PRO D O   1 
ATOM   4588  C  CB  . PRO D  1 121 ? -25.439 51.571  -32.326 1.00 36.80  ?  121 PRO D CB  1 
ATOM   4589  C  CG  . PRO D  1 121 ? -23.947 51.931  -32.559 1.00 36.82  ?  121 PRO D CG  1 
ATOM   4590  C  CD  . PRO D  1 121 ? -23.920 53.116  -33.432 1.00 36.58  ?  121 PRO D CD  1 
ATOM   4591  N  N   . LEU D  1 122 ? -26.477 54.016  -30.730 1.00 34.07  ?  122 LEU D N   1 
ATOM   4592  C  CA  . LEU D  1 122 ? -27.162 54.609  -29.577 1.00 32.66  ?  122 LEU D CA  1 
ATOM   4593  C  C   . LEU D  1 122 ? -28.410 55.455  -29.881 1.00 31.70  ?  122 LEU D C   1 
ATOM   4594  O  O   . LEU D  1 122 ? -29.301 55.578  -29.029 1.00 31.45  ?  122 LEU D O   1 
ATOM   4595  C  CB  . LEU D  1 122 ? -26.161 55.409  -28.729 1.00 31.90  ?  122 LEU D CB  1 
ATOM   4596  C  CG  . LEU D  1 122 ? -25.260 54.476  -27.939 1.00 30.88  ?  122 LEU D CG  1 
ATOM   4597  C  CD1 . LEU D  1 122 ? -24.228 55.173  -27.117 1.00 31.08  ?  122 LEU D CD1 1 
ATOM   4598  C  CD2 . LEU D  1 122 ? -26.117 53.617  -27.053 1.00 30.15  ?  122 LEU D CD2 1 
ATOM   4599  N  N   . VAL D  1 123 ? -28.458 56.029  -31.085 1.00 30.25  ?  123 VAL D N   1 
ATOM   4600  C  CA  . VAL D  1 123 ? -29.437 57.060  -31.415 1.00 28.61  ?  123 VAL D CA  1 
ATOM   4601  C  C   . VAL D  1 123 ? -30.816 56.463  -31.592 1.00 28.22  ?  123 VAL D C   1 
ATOM   4602  O  O   . VAL D  1 123 ? -31.792 57.065  -31.172 1.00 28.25  ?  123 VAL D O   1 
ATOM   4603  C  CB  . VAL D  1 123 ? -28.973 57.892  -32.635 1.00 28.27  ?  123 VAL D CB  1 
ATOM   4604  C  CG1 . VAL D  1 123 ? -29.945 59.029  -32.991 1.00 26.23  ?  123 VAL D CG1 1 
ATOM   4605  C  CG2 . VAL D  1 123 ? -27.595 58.470  -32.344 1.00 28.11  ?  123 VAL D CG2 1 
ATOM   4606  N  N   . ALA D  1 124 ? -30.901 55.263  -32.162 1.00 27.50  ?  124 ALA D N   1 
ATOM   4607  C  CA  . ALA D  1 124 ? -32.200 54.600  -32.292 1.00 26.92  ?  124 ALA D CA  1 
ATOM   4608  C  C   . ALA D  1 124 ? -32.587 53.908  -30.980 1.00 26.86  ?  124 ALA D C   1 
ATOM   4609  O  O   . ALA D  1 124 ? -33.775 53.894  -30.571 1.00 25.47  ?  124 ALA D O   1 
ATOM   4610  C  CB  . ALA D  1 124 ? -32.186 53.621  -33.448 1.00 26.14  ?  124 ALA D CB  1 
ATOM   4611  N  N   . GLU D  1 125 ? -31.579 53.342  -30.308 1.00 27.51  ?  125 GLU D N   1 
ATOM   4612  C  CA  . GLU D  1 125 ? -31.820 52.735  -29.000 1.00 28.67  ?  125 GLU D CA  1 
ATOM   4613  C  C   . GLU D  1 125 ? -32.612 53.720  -28.176 1.00 28.27  ?  125 GLU D C   1 
ATOM   4614  O  O   . GLU D  1 125 ? -33.735 53.427  -27.707 1.00 27.63  ?  125 GLU D O   1 
ATOM   4615  C  CB  . GLU D  1 125 ? -30.520 52.391  -28.294 1.00 28.91  ?  125 GLU D CB  1 
ATOM   4616  C  CG  . GLU D  1 125 ? -30.161 50.931  -28.384 1.00 32.83  ?  125 GLU D CG  1 
ATOM   4617  C  CD  . GLU D  1 125 ? -31.302 49.963  -27.963 1.00 37.86  ?  125 GLU D CD  1 
ATOM   4618  O  OE1 . GLU D  1 125 ? -31.560 49.807  -26.731 1.00 37.19  ?  125 GLU D OE1 1 
ATOM   4619  O  OE2 . GLU D  1 125 ? -31.902 49.328  -28.881 1.00 40.17  -1 125 GLU D OE2 1 
ATOM   4620  N  N   . SER D  1 126 ? -32.029 54.909  -28.098 1.00 28.17  ?  126 SER D N   1 
ATOM   4621  C  CA  . SER D  1 126 ? -32.585 56.049  -27.385 1.00 29.50  ?  126 SER D CA  1 
ATOM   4622  C  C   . SER D  1 126 ? -34.086 56.166  -27.507 1.00 29.76  ?  126 SER D C   1 
ATOM   4623  O  O   . SER D  1 126 ? -34.788 56.325  -26.498 1.00 30.26  ?  126 SER D O   1 
ATOM   4624  C  CB  . SER D  1 126 ? -31.933 57.322  -27.886 1.00 29.89  ?  126 SER D CB  1 
ATOM   4625  O  OG  . SER D  1 126 ? -30.540 57.304  -27.619 1.00 30.73  ?  126 SER D OG  1 
ATOM   4626  N  N   . ILE D  1 127 ? -34.571 56.036  -28.737 1.00 29.98  ?  127 ILE D N   1 
ATOM   4627  C  CA  . ILE D  1 127 ? -35.962 56.279  -29.059 1.00 30.28  ?  127 ILE D CA  1 
ATOM   4628  C  C   . ILE D  1 127 ? -36.758 55.115  -28.609 1.00 30.81  ?  127 ILE D C   1 
ATOM   4629  O  O   . ILE D  1 127 ? -37.866 55.287  -28.125 1.00 30.57  ?  127 ILE D O   1 
ATOM   4630  C  CB  . ILE D  1 127 ? -36.148 56.561  -30.585 1.00 30.24  ?  127 ILE D CB  1 
ATOM   4631  C  CG1 . ILE D  1 127 ? -35.511 57.916  -30.941 1.00 31.76  ?  127 ILE D CG1 1 
ATOM   4632  C  CG2 . ILE D  1 127 ? -37.589 56.615  -30.994 1.00 28.85  ?  127 ILE D CG2 1 
ATOM   4633  C  CD1 . ILE D  1 127 ? -34.021 57.808  -31.280 1.00 31.78  ?  127 ILE D CD1 1 
ATOM   4634  N  N   . ARG D  1 128 ? -36.176 53.925  -28.736 1.00 32.34  ?  128 ARG D N   1 
ATOM   4635  C  CA  . ARG D  1 128 ? -36.845 52.690  -28.296 1.00 33.30  ?  128 ARG D CA  1 
ATOM   4636  C  C   . ARG D  1 128 ? -37.048 52.627  -26.787 1.00 33.13  ?  128 ARG D C   1 
ATOM   4637  O  O   . ARG D  1 128 ? -38.087 52.179  -26.292 1.00 32.75  ?  128 ARG D O   1 
ATOM   4638  C  CB  . ARG D  1 128 ? -36.052 51.475  -28.768 1.00 33.88  ?  128 ARG D CB  1 
ATOM   4639  C  CG  . ARG D  1 128 ? -36.502 50.981  -30.111 1.00 35.45  ?  128 ARG D CG  1 
ATOM   4640  C  CD  . ARG D  1 128 ? -35.824 49.699  -30.470 1.00 38.37  ?  128 ARG D CD  1 
ATOM   4641  N  NE  . ARG D  1 128 ? -34.497 49.927  -31.029 1.00 37.93  ?  128 ARG D NE  1 
ATOM   4642  C  CZ  . ARG D  1 128 ? -34.255 50.198  -32.307 1.00 38.24  ?  128 ARG D CZ  1 
ATOM   4643  N  NH1 . ARG D  1 128 ? -35.250 50.311  -33.205 1.00 35.59  ?  128 ARG D NH1 1 
ATOM   4644  N  NH2 . ARG D  1 128 ? -32.997 50.363  -32.680 1.00 38.71  ?  128 ARG D NH2 1 
ATOM   4645  N  N   . CYS D  1 129 ? -36.022 53.092  -26.086 1.00 33.55  ?  129 CYS D N   1 
ATOM   4646  C  CA  . CYS D  1 129 ? -36.012 53.196  -24.646 1.00 33.74  ?  129 CYS D CA  1 
ATOM   4647  C  C   . CYS D  1 129 ? -37.133 54.080  -24.227 1.00 34.31  ?  129 CYS D C   1 
ATOM   4648  O  O   . CYS D  1 129 ? -37.970 53.632  -23.464 1.00 35.25  ?  129 CYS D O   1 
ATOM   4649  C  CB  . CYS D  1 129 ? -34.663 53.734  -24.153 1.00 33.61  ?  129 CYS D CB  1 
ATOM   4650  S  SG  . CYS D  1 129 ? -33.332 52.485  -24.199 1.00 31.72  ?  129 CYS D SG  1 
ATOM   4651  N  N   . TYR D  1 130 ? -37.173 55.317  -24.745 1.00 34.98  ?  130 TYR D N   1 
ATOM   4652  C  CA  . TYR D  1 130 ? -38.286 56.249  -24.490 1.00 35.45  ?  130 TYR D CA  1 
ATOM   4653  C  C   . TYR D  1 130 ? -39.584 55.563  -24.791 1.00 35.28  ?  130 TYR D C   1 
ATOM   4654  O  O   . TYR D  1 130 ? -40.436 55.458  -23.946 1.00 36.13  ?  130 TYR D O   1 
ATOM   4655  C  CB  . TYR D  1 130 ? -38.218 57.543  -25.329 1.00 36.16  ?  130 TYR D CB  1 
ATOM   4656  C  CG  . TYR D  1 130 ? -39.541 58.303  -25.261 1.00 39.27  ?  130 TYR D CG  1 
ATOM   4657  C  CD1 . TYR D  1 130 ? -39.805 59.206  -24.225 1.00 39.39  ?  130 TYR D CD1 1 
ATOM   4658  C  CD2 . TYR D  1 130 ? -40.566 58.056  -26.195 1.00 42.16  ?  130 TYR D CD2 1 
ATOM   4659  C  CE1 . TYR D  1 130 ? -41.037 59.871  -24.135 1.00 40.71  ?  130 TYR D CE1 1 
ATOM   4660  C  CE2 . TYR D  1 130 ? -41.802 58.713  -26.110 1.00 43.90  ?  130 TYR D CE2 1 
ATOM   4661  C  CZ  . TYR D  1 130 ? -42.027 59.628  -25.078 1.00 42.97  ?  130 TYR D CZ  1 
ATOM   4662  O  OH  . TYR D  1 130 ? -43.243 60.259  -24.991 1.00 42.93  ?  130 TYR D OH  1 
ATOM   4663  N  N   . GLN D  1 131 ? -39.724 55.080  -26.009 1.00 35.20  ?  131 GLN D N   1 
ATOM   4664  C  CA  . GLN D  1 131 ? -40.906 54.380  -26.401 1.00 35.66  ?  131 GLN D CA  1 
ATOM   4665  C  C   . GLN D  1 131 ? -41.309 53.221  -25.485 1.00 35.09  ?  131 GLN D C   1 
ATOM   4666  O  O   . GLN D  1 131 ? -42.505 52.884  -25.405 1.00 34.53  ?  131 GLN D O   1 
ATOM   4667  C  CB  . GLN D  1 131 ? -40.732 53.865  -27.811 1.00 36.43  ?  131 GLN D CB  1 
ATOM   4668  C  CG  . GLN D  1 131 ? -40.723 54.933  -28.881 1.00 40.12  ?  131 GLN D CG  1 
ATOM   4669  C  CD  . GLN D  1 131 ? -41.269 54.403  -30.218 1.00 45.79  ?  131 GLN D CD  1 
ATOM   4670  O  OE1 . GLN D  1 131 ? -40.980 53.256  -30.607 1.00 47.38  ?  131 GLN D OE1 1 
ATOM   4671  N  NE2 . GLN D  1 131 ? -42.082 55.228  -30.914 1.00 45.72  ?  131 GLN D NE2 1 
ATOM   4672  N  N   . SER D  1 132 ? -40.343 52.614  -24.794 1.00 34.52  ?  132 SER D N   1 
ATOM   4673  C  CA  . SER D  1 132 ? -40.663 51.447  -23.972 1.00 34.91  ?  132 SER D CA  1 
ATOM   4674  C  C   . SER D  1 132 ? -41.555 51.814  -22.804 1.00 35.06  ?  132 SER D C   1 
ATOM   4675  O  O   . SER D  1 132 ? -42.280 50.981  -22.264 1.00 35.07  ?  132 SER D O   1 
ATOM   4676  C  CB  . SER D  1 132 ? -39.413 50.779  -23.464 1.00 34.67  ?  132 SER D CB  1 
ATOM   4677  O  OG  . SER D  1 132 ? -38.880 51.553  -22.439 1.00 35.36  ?  132 SER D OG  1 
ATOM   4678  N  N   . GLY D  1 133 ? -41.486 53.091  -22.440 1.00 35.59  ?  133 GLY D N   1 
ATOM   4679  C  CA  . GLY D  1 133 ? -42.359 53.692  -21.464 1.00 35.09  ?  133 GLY D CA  1 
ATOM   4680  C  C   . GLY D  1 133 ? -41.601 53.954  -20.190 1.00 35.57  ?  133 GLY D C   1 
ATOM   4681  O  O   . GLY D  1 133 ? -42.206 54.373  -19.204 1.00 36.71  ?  133 GLY D O   1 
ATOM   4682  N  N   . GLN D  1 134 ? -40.284 53.729  -20.196 1.00 34.83  ?  134 GLN D N   1 
ATOM   4683  C  CA  . GLN D  1 134 ? -39.541 53.669  -18.955 1.00 34.03  ?  134 GLN D CA  1 
ATOM   4684  C  C   . GLN D  1 134 ? -38.836 54.953  -18.614 1.00 33.68  ?  134 GLN D C   1 
ATOM   4685  O  O   . GLN D  1 134 ? -38.225 55.593  -19.464 1.00 34.24  ?  134 GLN D O   1 
ATOM   4686  C  CB  . GLN D  1 134 ? -38.594 52.478  -18.931 1.00 34.26  ?  134 GLN D CB  1 
ATOM   4687  C  CG  . GLN D  1 134 ? -37.217 52.648  -19.581 1.00 36.07  ?  134 GLN D CG  1 
ATOM   4688  C  CD  . GLN D  1 134 ? -36.169 51.628  -19.067 1.00 36.32  ?  134 GLN D CD  1 
ATOM   4689  O  OE1 . GLN D  1 134 ? -34.943 51.840  -19.173 1.00 35.63  ?  134 GLN D OE1 1 
ATOM   4690  N  NE2 . GLN D  1 134 ? -36.655 50.535  -18.489 1.00 37.56  ?  134 GLN D NE2 1 
ATOM   4691  N  N   . ARG D  1 135 ? -38.943 55.327  -17.349 1.00 32.58  ?  135 ARG D N   1 
ATOM   4692  C  CA  . ARG D  1 135 ? -38.459 56.595  -16.845 0.50 31.38  ?  135 ARG D CA  1 
ATOM   4693  C  C   . ARG D  1 135 ? -38.341 56.446  -15.340 1.00 31.43  ?  135 ARG D C   1 
ATOM   4694  O  O   . ARG D  1 135 ? -39.116 55.714  -14.721 1.00 32.06  ?  135 ARG D O   1 
ATOM   4695  C  CB  . ARG D  1 135 ? -39.453 57.696  -17.180 0.50 30.87  ?  135 ARG D CB  1 
ATOM   4696  C  CG  . ARG D  1 135 ? -40.876 57.331  -16.842 0.50 28.44  ?  135 ARG D CG  1 
ATOM   4697  C  CD  . ARG D  1 135 ? -41.818 58.270  -17.481 0.50 25.89  ?  135 ARG D CD  1 
ATOM   4698  N  NE  . ARG D  1 135 ? -41.897 59.524  -16.744 0.50 24.31  ?  135 ARG D NE  1 
ATOM   4699  C  CZ  . ARG D  1 135 ? -42.850 60.423  -16.946 0.50 22.60  ?  135 ARG D CZ  1 
ATOM   4700  N  NH1 . ARG D  1 135 ? -43.784 60.196  -17.846 0.50 20.21  ?  135 ARG D NH1 1 
ATOM   4701  N  NH2 . ARG D  1 135 ? -42.875 61.544  -16.254 0.50 22.34  ?  135 ARG D NH2 1 
ATOM   4702  N  N   . TYR D  1 136 ? -37.383 57.165  -14.771 1.00 31.07  ?  136 TYR D N   1 
ATOM   4703  C  CA  . TYR D  1 136 ? -36.964 57.057  -13.388 1.00 30.67  ?  136 TYR D CA  1 
ATOM   4704  C  C   . TYR D  1 136 ? -36.629 58.458  -12.834 1.00 30.37  ?  136 TYR D C   1 
ATOM   4705  O  O   . TYR D  1 136 ? -36.346 59.383  -13.574 1.00 30.21  ?  136 TYR D O   1 
ATOM   4706  C  CB  . TYR D  1 136 ? -35.718 56.187  -13.335 1.00 31.02  ?  136 TYR D CB  1 
ATOM   4707  C  CG  . TYR D  1 136 ? -35.937 54.754  -13.772 1.00 33.42  ?  136 TYR D CG  1 
ATOM   4708  C  CD1 . TYR D  1 136 ? -36.897 53.968  -13.149 1.00 37.08  ?  136 TYR D CD1 1 
ATOM   4709  C  CD2 . TYR D  1 136 ? -35.176 54.182  -14.793 1.00 33.57  ?  136 TYR D CD2 1 
ATOM   4710  C  CE1 . TYR D  1 136 ? -37.105 52.645  -13.537 1.00 39.31  ?  136 TYR D CE1 1 
ATOM   4711  C  CE2 . TYR D  1 136 ? -35.367 52.873  -15.189 1.00 36.22  ?  136 TYR D CE2 1 
ATOM   4712  C  CZ  . TYR D  1 136 ? -36.337 52.090  -14.555 1.00 38.36  ?  136 TYR D CZ  1 
ATOM   4713  O  OH  . TYR D  1 136 ? -36.561 50.758  -14.908 1.00 36.82  ?  136 TYR D OH  1 
ATOM   4714  N  N   . PRO D  1 137 ? -36.642 58.626  -11.520 1.00 29.86  ?  137 PRO D N   1 
ATOM   4715  C  CA  . PRO D  1 137 ? -36.374 59.974  -11.066 1.00 29.17  ?  137 PRO D CA  1 
ATOM   4716  C  C   . PRO D  1 137 ? -34.975 60.371  -11.406 1.00 28.71  ?  137 PRO D C   1 
ATOM   4717  O  O   . PRO D  1 137 ? -34.101 59.512  -11.443 1.00 28.19  ?  137 PRO D O   1 
ATOM   4718  C  CB  . PRO D  1 137 ? -36.434 59.828  -9.553  1.00 29.85  ?  137 PRO D CB  1 
ATOM   4719  C  CG  . PRO D  1 137 ? -37.274 58.568  -9.330  1.00 29.33  ?  137 PRO D CG  1 
ATOM   4720  C  CD  . PRO D  1 137 ? -36.798 57.685  -10.400 1.00 29.87  ?  137 PRO D CD  1 
ATOM   4721  N  N   . LEU D  1 138 ? -34.768 61.665  -11.616 1.00 28.22  ?  138 LEU D N   1 
ATOM   4722  C  CA  . LEU D  1 138 ? -33.447 62.229  -11.834 1.00 28.14  ?  138 LEU D CA  1 
ATOM   4723  C  C   . LEU D  1 138 ? -32.562 61.995  -10.653 1.00 28.01  ?  138 LEU D C   1 
ATOM   4724  O  O   . LEU D  1 138 ? -31.331 61.999  -10.787 1.00 27.08  ?  138 LEU D O   1 
ATOM   4725  C  CB  . LEU D  1 138 ? -33.542 63.729  -12.073 1.00 28.58  ?  138 LEU D CB  1 
ATOM   4726  C  CG  . LEU D  1 138 ? -34.441 64.067  -13.252 1.00 30.80  ?  138 LEU D CG  1 
ATOM   4727  C  CD1 . LEU D  1 138 ? -34.970 65.457  -13.117 1.00 30.06  ?  138 LEU D CD1 1 
ATOM   4728  C  CD2 . LEU D  1 138 ? -33.646 63.887  -14.542 1.00 30.88  ?  138 LEU D CD2 1 
ATOM   4729  N  N   . GLU D  1 139 ? -33.184 61.801  -9.483  1.00 28.93  ?  139 GLU D N   1 
ATOM   4730  C  CA  . GLU D  1 139 ? -32.392 61.526  -8.289  0.50 29.32  ?  139 GLU D CA  1 
ATOM   4731  C  C   . GLU D  1 139 ? -31.500 60.300  -8.479  1.00 29.84  ?  139 GLU D C   1 
ATOM   4732  O  O   . GLU D  1 139 ? -30.370 60.309  -7.974  1.00 30.60  ?  139 GLU D O   1 
ATOM   4733  C  CB  . GLU D  1 139 ? -33.225 61.463  -7.014  0.50 29.04  ?  139 GLU D CB  1 
ATOM   4734  C  CG  . GLU D  1 139 ? -33.504 60.087  -6.459  0.50 30.20  ?  139 GLU D CG  1 
ATOM   4735  C  CD  . GLU D  1 139 ? -33.684 60.118  -4.947  0.50 31.47  ?  139 GLU D CD  1 
ATOM   4736  O  OE1 . GLU D  1 139 ? -34.520 59.353  -4.396  0.50 28.56  ?  139 GLU D OE1 1 
ATOM   4737  O  OE2 . GLU D  1 139 ? -32.974 60.939  -4.322  0.50 32.33  -1 139 GLU D OE2 1 
ATOM   4738  N  N   . MET D  1 140 ? -31.971 59.286  -9.241  1.00 29.64  ?  140 MET D N   1 
ATOM   4739  C  CA  . MET D  1 140 ? -31.158 58.076  -9.601  1.00 28.85  ?  140 MET D CA  1 
ATOM   4740  C  C   . MET D  1 140 ? -29.689 58.338  -9.804  1.00 27.69  ?  140 MET D C   1 
ATOM   4741  O  O   . MET D  1 140 ? -28.861 57.561  -9.389  1.00 29.38  ?  140 MET D O   1 
ATOM   4742  C  CB  . MET D  1 140 ? -31.580 57.454  -10.934 1.00 28.96  ?  140 MET D CB  1 
ATOM   4743  C  CG  . MET D  1 140 ? -32.709 56.457  -10.961 1.00 30.88  ?  140 MET D CG  1 
ATOM   4744  S  SD  . MET D  1 140 ? -32.813 55.259  -9.647  1.00 37.45  ?  140 MET D SD  1 
ATOM   4745  C  CE  . MET D  1 140 ? -31.157 54.588  -9.610  1.00 35.51  ?  140 MET D CE  1 
ATOM   4746  N  N   . ILE D  1 141 ? -29.364 59.393  -10.519 1.00 25.77  ?  141 ILE D N   1 
ATOM   4747  C  CA  . ILE D  1 141 ? -28.001 59.637  -10.913 1.00 24.23  ?  141 ILE D CA  1 
ATOM   4748  C  C   . ILE D  1 141 ? -27.598 61.051  -10.507 1.00 24.45  ?  141 ILE D C   1 
ATOM   4749  O  O   . ILE D  1 141 ? -27.016 61.776  -11.281 1.00 24.31  ?  141 ILE D O   1 
ATOM   4750  C  CB  . ILE D  1 141 ? -27.804 59.351  -12.447 1.00 24.36  ?  141 ILE D CB  1 
ATOM   4751  C  CG1 . ILE D  1 141 ? -28.936 59.904  -13.343 1.00 22.87  ?  141 ILE D CG1 1 
ATOM   4752  C  CG2 . ILE D  1 141 ? -27.800 57.858  -12.693 1.00 22.77  ?  141 ILE D CG2 1 
ATOM   4753  C  CD1 . ILE D  1 141 ? -29.138 61.392  -13.282 1.00 23.74  ?  141 ILE D CD1 1 
ATOM   4754  N  N   . GLY D  1 142 ? -27.920 61.431  -9.273  1.00 24.56  ?  142 GLY D N   1 
ATOM   4755  C  CA  . GLY D  1 142 ? -27.712 62.775  -8.797  1.00 24.56  ?  142 GLY D CA  1 
ATOM   4756  C  C   . GLY D  1 142 ? -26.438 63.122  -8.039  1.00 25.31  ?  142 GLY D C   1 
ATOM   4757  O  O   . GLY D  1 142 ? -25.647 62.256  -7.600  1.00 24.86  ?  142 GLY D O   1 
ATOM   4758  N  N   . ASP D  1 143 ? -26.232 64.429  -7.896  1.00 25.66  ?  143 ASP D N   1 
ATOM   4759  C  CA  . ASP D  1 143 ? -25.165 64.977  -7.056  1.00 26.02  ?  143 ASP D CA  1 
ATOM   4760  C  C   . ASP D  1 143 ? -25.516 64.845  -5.564  1.00 25.78  ?  143 ASP D C   1 
ATOM   4761  O  O   . ASP D  1 143 ? -26.684 64.961  -5.153  1.00 26.27  ?  143 ASP D O   1 
ATOM   4762  C  CB  . ASP D  1 143 ? -25.002 66.436  -7.381  1.00 26.42  ?  143 ASP D CB  1 
ATOM   4763  C  CG  . ASP D  1 143 ? -26.339 67.178  -7.349  1.00 27.13  ?  143 ASP D CG  1 
ATOM   4764  O  OD1 . ASP D  1 143 ? -27.165 66.950  -8.249  1.00 26.58  ?  143 ASP D OD1 1 
ATOM   4765  O  OD2 . ASP D  1 143 ? -26.581 67.948  -6.401  1.00 28.53  -1 143 ASP D OD2 1 
ATOM   4766  N  N   . PHE D  1 144 ? -24.499 64.597  -4.765  1.00 24.93  ?  144 PHE D N   1 
ATOM   4767  C  CA  . PHE D  1 144 ? -24.650 64.457  -3.357  1.00 24.69  ?  144 PHE D CA  1 
ATOM   4768  C  C   . PHE D  1 144 ? -23.667 65.430  -2.702  1.00 25.20  ?  144 PHE D C   1 
ATOM   4769  O  O   . PHE D  1 144 ? -22.490 65.467  -3.103  1.00 24.92  ?  144 PHE D O   1 
ATOM   4770  C  CB  . PHE D  1 144 ? -24.303 63.033  -2.978  1.00 24.47  ?  144 PHE D CB  1 
ATOM   4771  C  CG  . PHE D  1 144 ? -24.184 62.828  -1.497  1.00 25.25  ?  144 PHE D CG  1 
ATOM   4772  C  CD1 . PHE D  1 144 ? -25.330 62.655  -0.710  1.00 23.42  ?  144 PHE D CD1 1 
ATOM   4773  C  CD2 . PHE D  1 144 ? -22.935 62.837  -0.881  1.00 24.48  ?  144 PHE D CD2 1 
ATOM   4774  C  CE1 . PHE D  1 144 ? -25.234 62.509  0.646   1.00 22.84  ?  144 PHE D CE1 1 
ATOM   4775  C  CE2 . PHE D  1 144 ? -22.830 62.665  0.490   1.00 23.92  ?  144 PHE D CE2 1 
ATOM   4776  C  CZ  . PHE D  1 144 ? -23.986 62.507  1.253   1.00 23.87  ?  144 PHE D CZ  1 
ATOM   4777  N  N   . ASN D  1 145 ? -24.126 66.209  -1.714  1.00 25.48  ?  145 ASN D N   1 
ATOM   4778  C  CA  . ASN D  1 145 ? -23.263 67.223  -1.056  1.00 26.16  ?  145 ASN D CA  1 
ATOM   4779  C  C   . ASN D  1 145 ? -22.503 68.083  -2.012  1.00 26.46  ?  145 ASN D C   1 
ATOM   4780  O  O   . ASN D  1 145 ? -21.332 68.417  -1.786  1.00 26.10  ?  145 ASN D O   1 
ATOM   4781  C  CB  . ASN D  1 145 ? -22.254 66.586  -0.095  1.00 25.72  ?  145 ASN D CB  1 
ATOM   4782  C  CG  . ASN D  1 145 ? -22.897 66.160  1.195   1.00 26.07  ?  145 ASN D CG  1 
ATOM   4783  O  OD1 . ASN D  1 145 ? -24.139 66.183  1.314   1.00 25.41  ?  145 ASN D OD1 1 
ATOM   4784  N  ND2 . ASN D  1 145 ? -22.074 65.743  2.166   1.00 22.68  ?  145 ASN D ND2 1 
ATOM   4785  N  N   . TRP D  1 146 ? -23.195 68.419  -3.082  1.00 27.66  ?  146 TRP D N   1 
ATOM   4786  C  CA  . TRP D  1 146 ? -22.669 69.188  -4.178  1.00 29.42  ?  146 TRP D CA  1 
ATOM   4787  C  C   . TRP D  1 146 ? -22.288 70.592  -3.689  1.00 30.86  ?  146 TRP D C   1 
ATOM   4788  O  O   . TRP D  1 146 ? -23.135 71.312  -3.137  1.00 30.47  ?  146 TRP D O   1 
ATOM   4789  C  CB  . TRP D  1 146 ? -23.766 69.271  -5.232  1.00 29.52  ?  146 TRP D CB  1 
ATOM   4790  C  CG  . TRP D  1 146 ? -23.306 69.762  -6.537  1.00 32.62  ?  146 TRP D CG  1 
ATOM   4791  C  CD1 . TRP D  1 146 ? -23.647 70.937  -7.129  1.00 34.55  ?  146 TRP D CD1 1 
ATOM   4792  C  CD2 . TRP D  1 146 ? -22.401 69.106  -7.429  1.00 35.08  ?  146 TRP D CD2 1 
ATOM   4793  N  NE1 . TRP D  1 146 ? -23.013 71.060  -8.336  1.00 36.04  ?  146 TRP D NE1 1 
ATOM   4794  C  CE2 . TRP D  1 146 ? -22.253 69.942  -8.556  1.00 35.98  ?  146 TRP D CE2 1 
ATOM   4795  C  CE3 . TRP D  1 146 ? -21.713 67.878  -7.396  1.00 34.76  ?  146 TRP D CE3 1 
ATOM   4796  C  CZ2 . TRP D  1 146 ? -21.441 69.600  -9.644  1.00 35.75  ?  146 TRP D CZ2 1 
ATOM   4797  C  CZ3 . TRP D  1 146 ? -20.911 67.539  -8.467  1.00 34.44  ?  146 TRP D CZ3 1 
ATOM   4798  C  CH2 . TRP D  1 146 ? -20.771 68.405  -9.577  1.00 35.20  ?  146 TRP D CH2 1 
ATOM   4799  N  N   . PRO D  1 147 ? -21.010 70.982  -3.866  1.00 31.77  ?  147 PRO D N   1 
ATOM   4800  C  CA  . PRO D  1 147 ? -20.516 72.210  -3.301  1.00 32.26  ?  147 PRO D CA  1 
ATOM   4801  C  C   . PRO D  1 147 ? -20.743 73.470  -4.134  1.00 32.85  ?  147 PRO D C   1 
ATOM   4802  O  O   . PRO D  1 147 ? -20.435 74.554  -3.637  1.00 32.77  ?  147 PRO D O   1 
ATOM   4803  C  CB  . PRO D  1 147 ? -19.021 71.938  -3.187  1.00 32.50  ?  147 PRO D CB  1 
ATOM   4804  C  CG  . PRO D  1 147 ? -18.728 71.141  -4.364  1.00 32.33  ?  147 PRO D CG  1 
ATOM   4805  C  CD  . PRO D  1 147 ? -19.921 70.221  -4.491  1.00 32.12  ?  147 PRO D CD  1 
ATOM   4806  N  N   . PHE D  1 148 ? -21.252 73.350  -5.366  1.00 33.55  ?  148 PHE D N   1 
ATOM   4807  C  CA  . PHE D  1 148 ? -21.396 74.532  -6.273  1.00 33.40  ?  148 PHE D CA  1 
ATOM   4808  C  C   . PHE D  1 148 ? -22.825 74.991  -6.270  1.00 33.81  ?  148 PHE D C   1 
ATOM   4809  O  O   . PHE D  1 148 ? -23.706 74.170  -6.125  1.00 34.61  ?  148 PHE D O   1 
ATOM   4810  C  CB  . PHE D  1 148 ? -20.929 74.209  -7.702  1.00 32.72  ?  148 PHE D CB  1 
ATOM   4811  C  CG  . PHE D  1 148 ? -19.459 73.865  -7.794  1.00 31.73  ?  148 PHE D CG  1 
ATOM   4812  C  CD1 . PHE D  1 148 ? -19.043 72.598  -8.197  1.00 29.00  ?  148 PHE D CD1 1 
ATOM   4813  C  CD2 . PHE D  1 148 ? -18.474 74.807  -7.443  1.00 32.00  ?  148 PHE D CD2 1 
ATOM   4814  C  CE1 . PHE D  1 148 ? -17.680 72.279  -8.262  1.00 24.97  ?  148 PHE D CE1 1 
ATOM   4815  C  CE2 . PHE D  1 148 ? -17.089 74.490  -7.527  1.00 29.11  ?  148 PHE D CE2 1 
ATOM   4816  C  CZ  . PHE D  1 148 ? -16.705 73.229  -7.935  1.00 25.76  ?  148 PHE D CZ  1 
ATOM   4817  N  N   . THR D  1 149 ? -23.084 76.287  -6.401  1.00 34.65  ?  149 THR D N   1 
ATOM   4818  C  CA  . THR D  1 149 ? -24.479 76.749  -6.396  1.00 35.26  ?  149 THR D CA  1 
ATOM   4819  C  C   . THR D  1 149 ? -25.072 76.278  -7.693  1.00 36.70  ?  149 THR D C   1 
ATOM   4820  O  O   . THR D  1 149 ? -24.343 76.180  -8.702  1.00 36.96  ?  149 THR D O   1 
ATOM   4821  C  CB  . THR D  1 149 ? -24.630 78.290  -6.386  1.00 35.39  ?  149 THR D CB  1 
ATOM   4822  O  OG1 . THR D  1 149 ? -24.222 78.821  -7.643  1.00 33.29  ?  149 THR D OG1 1 
ATOM   4823  C  CG2 . THR D  1 149 ? -23.792 78.936  -5.303  1.00 36.34  ?  149 THR D CG2 1 
ATOM   4824  N  N   . LYS D  1 150 ? -26.383 76.025  -7.684  1.00 37.79  ?  150 LYS D N   1 
ATOM   4825  C  CA  . LYS D  1 150 ? -27.100 75.531  -8.852  1.00 38.62  ?  150 LYS D CA  1 
ATOM   4826  C  C   . LYS D  1 150 ? -28.599 75.801  -8.672  1.00 39.89  ?  150 LYS D C   1 
ATOM   4827  O  O   . LYS D  1 150 ? -29.193 76.652  -9.352  1.00 41.24  ?  150 LYS D O   1 
ATOM   4828  C  CB  . LYS D  1 150 ? -26.848 74.020  -9.020  1.00 38.64  ?  150 LYS D CB  1 
ATOM   4829  C  CG  . LYS D  1 150 ? -27.817 73.108  -8.232  1.00 38.87  ?  150 LYS D CG  1 
ATOM   4830  C  CD  . LYS D  1 150 ? -27.333 71.636  -8.159  1.00 38.18  ?  150 LYS D CD  1 
ATOM   4831  C  CE  . LYS D  1 150 ? -27.868 70.912  -6.895  1.00 35.72  ?  150 LYS D CE  1 
ATOM   4832  N  NZ  . LYS D  1 150 ? -27.328 71.523  -5.613  1.00 32.10  ?  150 LYS D NZ  1 
ATOM   4833  N  N   . MET E  1 1   ? -9.449  66.759  -22.271 1.00 40.07  ?  1   MET E N   1 
ATOM   4834  C  CA  . MET E  1 1   ? -10.926 66.745  -22.094 1.00 40.65  ?  1   MET E CA  1 
ATOM   4835  C  C   . MET E  1 1   ? -11.358 66.106  -20.767 1.00 40.04  ?  1   MET E C   1 
ATOM   4836  O  O   . MET E  1 1   ? -10.708 65.163  -20.269 1.00 40.73  ?  1   MET E O   1 
ATOM   4837  C  CB  . MET E  1 1   ? -11.590 66.020  -23.251 1.00 41.14  ?  1   MET E CB  1 
ATOM   4838  C  CG  . MET E  1 1   ? -11.476 64.496  -23.194 1.00 43.67  ?  1   MET E CG  1 
ATOM   4839  S  SD  . MET E  1 1   ? -12.997 63.818  -23.864 1.00 48.21  ?  1   MET E SD  1 
ATOM   4840  C  CE  . MET E  1 1   ? -14.029 65.312  -23.815 1.00 46.45  ?  1   MET E CE  1 
ATOM   4841  N  N   . PHE E  1 2   ? -12.461 66.602  -20.203 1.00 38.51  ?  2   PHE E N   1 
ATOM   4842  C  CA  . PHE E  1 2   ? -12.789 66.263  -18.826 1.00 36.45  ?  2   PHE E CA  1 
ATOM   4843  C  C   . PHE E  1 2   ? -13.468 64.936  -18.738 1.00 35.73  ?  2   PHE E C   1 
ATOM   4844  O  O   . PHE E  1 2   ? -14.494 64.711  -19.395 1.00 35.37  ?  2   PHE E O   1 
ATOM   4845  C  CB  . PHE E  1 2   ? -13.666 67.327  -18.175 1.00 36.12  ?  2   PHE E CB  1 
ATOM   4846  C  CG  . PHE E  1 2   ? -14.264 66.899  -16.856 1.00 33.76  ?  2   PHE E CG  1 
ATOM   4847  C  CD1 . PHE E  1 2   ? -13.490 66.909  -15.689 1.00 31.47  ?  2   PHE E CD1 1 
ATOM   4848  C  CD2 . PHE E  1 2   ? -15.615 66.480  -16.781 1.00 31.20  ?  2   PHE E CD2 1 
ATOM   4849  C  CE1 . PHE E  1 2   ? -14.052 66.515  -14.441 1.00 29.26  ?  2   PHE E CE1 1 
ATOM   4850  C  CE2 . PHE E  1 2   ? -16.188 66.101  -15.563 1.00 30.64  ?  2   PHE E CE2 1 
ATOM   4851  C  CZ  . PHE E  1 2   ? -15.395 66.110  -14.381 1.00 29.98  ?  2   PHE E CZ  1 
ATOM   4852  N  N   . LYS E  1 3   ? -12.901 64.082  -17.893 1.00 34.42  ?  3   LYS E N   1 
ATOM   4853  C  CA  . LYS E  1 3   ? -13.491 62.789  -17.573 1.00 33.95  ?  3   LYS E CA  1 
ATOM   4854  C  C   . LYS E  1 3   ? -13.468 62.556  -16.056 1.00 32.51  ?  3   LYS E C   1 
ATOM   4855  O  O   . LYS E  1 3   ? -12.407 62.617  -15.430 1.00 31.92  ?  3   LYS E O   1 
ATOM   4856  C  CB  . LYS E  1 3   ? -12.736 61.668  -18.301 1.00 34.57  ?  3   LYS E CB  1 
ATOM   4857  C  CG  . LYS E  1 3   ? -12.752 61.793  -19.843 1.00 36.92  ?  3   LYS E CG  1 
ATOM   4858  C  CD  . LYS E  1 3   ? -12.065 60.605  -20.573 1.00 41.04  ?  3   LYS E CD  1 
ATOM   4859  C  CE  . LYS E  1 3   ? -10.515 60.753  -20.747 1.00 43.46  ?  3   LYS E CE  1 
ATOM   4860  N  NZ  . LYS E  1 3   ? -9.967  59.967  -21.923 1.00 40.82  ?  3   LYS E NZ  1 
ATOM   4861  N  N   . PRO E  1 4   ? -14.637 62.278  -15.454 1.00 31.32  ?  4   PRO E N   1 
ATOM   4862  C  CA  . PRO E  1 4   ? -14.696 61.978  -14.018 1.00 30.54  ?  4   PRO E CA  1 
ATOM   4863  C  C   . PRO E  1 4   ? -14.102 60.623  -13.686 1.00 29.67  ?  4   PRO E C   1 
ATOM   4864  O  O   . PRO E  1 4   ? -14.182 59.739  -14.529 1.00 29.95  ?  4   PRO E O   1 
ATOM   4865  C  CB  . PRO E  1 4   ? -16.196 61.914  -13.750 1.00 30.73  ?  4   PRO E CB  1 
ATOM   4866  C  CG  . PRO E  1 4   ? -16.785 61.518  -15.044 1.00 31.19  ?  4   PRO E CG  1 
ATOM   4867  C  CD  . PRO E  1 4   ? -15.964 62.223  -16.082 1.00 31.11  ?  4   PRO E CD  1 
ATOM   4868  N  N   . HIS E  1 5   ? -13.541 60.436  -12.488 1.00 28.32  ?  5   HIS E N   1 
ATOM   4869  C  CA  . HIS E  1 5   ? -13.351 59.085  -11.986 1.00 27.91  ?  5   HIS E CA  1 
ATOM   4870  C  C   . HIS E  1 5   ? -14.712 58.420  -11.862 1.00 27.21  ?  5   HIS E C   1 
ATOM   4871  O  O   . HIS E  1 5   ? -15.665 59.053  -11.417 1.00 27.56  ?  5   HIS E O   1 
ATOM   4872  C  CB  . HIS E  1 5   ? -12.739 59.054  -10.607 1.00 28.53  ?  5   HIS E CB  1 
ATOM   4873  C  CG  . HIS E  1 5   ? -11.370 59.642  -10.534 1.00 30.93  ?  5   HIS E CG  1 
ATOM   4874  N  ND1 . HIS E  1 5   ? -10.331 59.017  -9.874  1.00 33.05  ?  5   HIS E ND1 1 
ATOM   4875  C  CD2 . HIS E  1 5   ? -10.867 60.800  -11.022 1.00 31.14  ?  5   HIS E CD2 1 
ATOM   4876  C  CE1 . HIS E  1 5   ? -9.246  59.769  -9.959  1.00 32.73  ?  5   HIS E CE1 1 
ATOM   4877  N  NE2 . HIS E  1 5   ? -9.540  60.847  -10.663 1.00 32.35  ?  5   HIS E NE2 1 
ATOM   4878  N  N   . VAL E  1 6   ? -14.794 57.154  -12.282 1.00 26.30  ?  6   VAL E N   1 
ATOM   4879  C  CA  . VAL E  1 6   ? -16.003 56.337  -12.155 1.00 24.86  ?  6   VAL E CA  1 
ATOM   4880  C  C   . VAL E  1 6   ? -15.685 55.161  -11.276 1.00 23.73  ?  6   VAL E C   1 
ATOM   4881  O  O   . VAL E  1 6   ? -14.888 54.314  -11.621 1.00 24.41  ?  6   VAL E O   1 
ATOM   4882  C  CB  . VAL E  1 6   ? -16.460 55.805  -13.486 1.00 24.54  ?  6   VAL E CB  1 
ATOM   4883  C  CG1 . VAL E  1 6   ? -17.868 55.367  -13.386 1.00 24.20  ?  6   VAL E CG1 1 
ATOM   4884  C  CG2 . VAL E  1 6   ? -16.341 56.894  -14.526 1.00 25.22  ?  6   VAL E CG2 1 
ATOM   4885  N  N   . THR E  1 7   ? -16.289 55.136  -10.112 1.00 22.69  ?  7   THR E N   1 
ATOM   4886  C  CA  . THR E  1 7   ? -16.088 54.050  -9.167  1.00 21.20  ?  7   THR E CA  1 
ATOM   4887  C  C   . THR E  1 7   ? -17.393 53.260  -9.058  1.00 20.39  ?  7   THR E C   1 
ATOM   4888  O  O   . THR E  1 7   ? -18.453 53.702  -9.544  1.00 18.98  ?  7   THR E O   1 
ATOM   4889  C  CB  . THR E  1 7   ? -15.780 54.611  -7.783  1.00 20.96  ?  7   THR E CB  1 
ATOM   4890  O  OG1 . THR E  1 7   ? -16.729 55.671  -7.509  1.00 22.37  ?  7   THR E OG1 1 
ATOM   4891  C  CG2 . THR E  1 7   ? -14.359 55.125  -7.719  1.00 18.10  ?  7   THR E CG2 1 
ATOM   4892  N  N   . VAL E  1 8   ? -17.296 52.101  -8.400  1.00 19.94  ?  8   VAL E N   1 
ATOM   4893  C  CA  . VAL E  1 8   ? -18.433 51.210  -8.126  1.00 18.55  ?  8   VAL E CA  1 
ATOM   4894  C  C   . VAL E  1 8   ? -18.366 50.739  -6.706  1.00 18.76  ?  8   VAL E C   1 
ATOM   4895  O  O   . VAL E  1 8   ? -17.265 50.540  -6.161  1.00 18.91  ?  8   VAL E O   1 
ATOM   4896  C  CB  . VAL E  1 8   ? -18.435 49.984  -9.055  1.00 18.72  ?  8   VAL E CB  1 
ATOM   4897  C  CG1 . VAL E  1 8   ? -18.928 50.370  -10.449 1.00 17.22  ?  8   VAL E CG1 1 
ATOM   4898  C  CG2 . VAL E  1 8   ? -17.063 49.341  -9.105  1.00 17.07  ?  8   VAL E CG2 1 
ATOM   4899  N  N   . ALA E  1 9   ? -19.534 50.580  -6.084  1.00 19.03  ?  9   ALA E N   1 
ATOM   4900  C  CA  . ALA E  1 9   ? -19.605 50.202  -4.656  1.00 20.13  ?  9   ALA E CA  1 
ATOM   4901  C  C   . ALA E  1 9   ? -20.728 49.245  -4.390  1.00 20.51  ?  9   ALA E C   1 
ATOM   4902  O  O   . ALA E  1 9   ? -21.794 49.353  -5.009  1.00 21.21  ?  9   ALA E O   1 
ATOM   4903  C  CB  . ALA E  1 9   ? -19.761 51.449  -3.754  1.00 20.20  ?  9   ALA E CB  1 
ATOM   4904  N  N   . CYS E  1 10  ? -20.508 48.328  -3.448  1.00 21.16  ?  10  CYS E N   1 
ATOM   4905  C  CA  . CYS E  1 10  ? -21.516 47.312  -3.126  1.00 21.54  ?  10  CYS E CA  1 
ATOM   4906  C  C   . CYS E  1 10  ? -21.966 47.372  -1.711  1.00 21.36  ?  10  CYS E C   1 
ATOM   4907  O  O   . CYS E  1 10  ? -21.136 47.258  -0.790  1.00 21.91  ?  10  CYS E O   1 
ATOM   4908  C  CB  . CYS E  1 10  ? -20.953 45.912  -3.341  1.00 22.34  ?  10  CYS E CB  1 
ATOM   4909  S  SG  . CYS E  1 10  ? -20.756 45.479  -5.030  1.00 23.49  ?  10  CYS E SG  1 
ATOM   4910  N  N   . VAL E  1 11  ? -23.271 47.502  -1.518  1.00 21.25  ?  11  VAL E N   1 
ATOM   4911  C  CA  . VAL E  1 11  ? -23.819 47.279  -0.189  1.00 21.58  ?  11  VAL E CA  1 
ATOM   4912  C  C   . VAL E  1 11  ? -24.114 45.812  -0.035  1.00 21.73  ?  11  VAL E C   1 
ATOM   4913  O  O   . VAL E  1 11  ? -24.986 45.279  -0.714  1.00 21.89  ?  11  VAL E O   1 
ATOM   4914  C  CB  . VAL E  1 11  ? -25.051 48.097  0.073   1.00 21.82  ?  11  VAL E CB  1 
ATOM   4915  C  CG1 . VAL E  1 11  ? -25.737 47.569  1.282   1.00 21.59  ?  11  VAL E CG1 1 
ATOM   4916  C  CG2 . VAL E  1 11  ? -24.638 49.537  0.298   1.00 20.60  ?  11  VAL E CG2 1 
ATOM   4917  N  N   . VAL E  1 12  ? -23.331 45.147  0.811   1.00 22.04  ?  12  VAL E N   1 
ATOM   4918  C  CA  . VAL E  1 12  ? -23.465 43.699  1.001   1.00 22.71  ?  12  VAL E CA  1 
ATOM   4919  C  C   . VAL E  1 12  ? -23.927 43.389  2.405   1.00 23.77  ?  12  VAL E C   1 
ATOM   4920  O  O   . VAL E  1 12  ? -23.326 43.861  3.401   1.00 23.78  ?  12  VAL E O   1 
ATOM   4921  C  CB  . VAL E  1 12  ? -22.158 42.945  0.735   1.00 22.21  ?  12  VAL E CB  1 
ATOM   4922  C  CG1 . VAL E  1 12  ? -22.436 41.468  0.443   1.00 21.99  ?  12  VAL E CG1 1 
ATOM   4923  C  CG2 . VAL E  1 12  ? -21.444 43.560  -0.423  1.00 22.39  ?  12  VAL E CG2 1 
ATOM   4924  N  N   . HIS E  1 13  ? -24.967 42.558  2.472   1.00 24.94  ?  13  HIS E N   1 
ATOM   4925  C  CA  . HIS E  1 13  ? -25.763 42.376  3.680   1.00 26.18  ?  13  HIS E CA  1 
ATOM   4926  C  C   . HIS E  1 13  ? -26.086 40.891  3.822   1.00 27.80  ?  13  HIS E C   1 
ATOM   4927  O  O   . HIS E  1 13  ? -26.368 40.181  2.825   1.00 27.42  ?  13  HIS E O   1 
ATOM   4928  C  CB  . HIS E  1 13  ? -27.044 43.191  3.538   1.00 25.91  ?  13  HIS E CB  1 
ATOM   4929  C  CG  . HIS E  1 13  ? -28.069 42.950  4.603   1.00 26.10  ?  13  HIS E CG  1 
ATOM   4930  N  ND1 . HIS E  1 13  ? -28.013 43.549  5.845   1.00 25.26  ?  13  HIS E ND1 1 
ATOM   4931  C  CD2 . HIS E  1 13  ? -29.200 42.208  4.595   1.00 24.95  ?  13  HIS E CD2 1 
ATOM   4932  C  CE1 . HIS E  1 13  ? -29.053 43.171  6.562   1.00 24.66  ?  13  HIS E CE1 1 
ATOM   4933  N  NE2 . HIS E  1 13  ? -29.788 42.354  5.829   1.00 24.49  ?  13  HIS E NE2 1 
ATOM   4934  N  N   . ALA E  1 14  ? -26.023 40.439  5.073   1.00 28.92  ?  14  ALA E N   1 
ATOM   4935  C  CA  . ALA E  1 14  ? -26.340 39.085  5.434   1.00 30.40  ?  14  ALA E CA  1 
ATOM   4936  C  C   . ALA E  1 14  ? -26.535 39.075  6.933   1.00 31.90  ?  14  ALA E C   1 
ATOM   4937  O  O   . ALA E  1 14  ? -25.677 39.597  7.652   1.00 32.33  ?  14  ALA E O   1 
ATOM   4938  C  CB  . ALA E  1 14  ? -25.203 38.175  5.050   1.00 30.03  ?  14  ALA E CB  1 
ATOM   4939  N  N   . GLU E  1 15  ? -27.655 38.498  7.404   1.00 33.40  ?  15  GLU E N   1 
ATOM   4940  C  CA  . GLU E  1 15  ? -27.922 38.343  8.858   1.00 34.43  ?  15  GLU E CA  1 
ATOM   4941  C  C   . GLU E  1 15  ? -27.715 39.650  9.619   1.00 34.28  ?  15  GLU E C   1 
ATOM   4942  O  O   . GLU E  1 15  ? -26.856 39.739  10.511  1.00 34.66  ?  15  GLU E O   1 
ATOM   4943  C  CB  . GLU E  1 15  ? -27.037 37.235  9.450   1.00 34.92  ?  15  GLU E CB  1 
ATOM   4944  C  CG  . GLU E  1 15  ? -27.363 35.837  8.850   1.00 38.13  ?  15  GLU E CG  1 
ATOM   4945  C  CD  . GLU E  1 15  ? -26.350 34.729  9.218   1.00 40.17  ?  15  GLU E CD  1 
ATOM   4946  O  OE1 . GLU E  1 15  ? -26.817 33.586  9.486   1.00 41.70  ?  15  GLU E OE1 1 
ATOM   4947  O  OE2 . GLU E  1 15  ? -25.119 34.990  9.228   1.00 37.40  -1 15  GLU E OE2 1 
ATOM   4948  N  N   . GLY E  1 16  ? -28.476 40.668  9.228   1.00 33.60  ?  16  GLY E N   1 
ATOM   4949  C  CA  . GLY E  1 16  ? -28.471 41.966  9.902   1.00 33.59  ?  16  GLY E CA  1 
ATOM   4950  C  C   . GLY E  1 16  ? -27.134 42.694  9.924   1.00 33.45  ?  16  GLY E C   1 
ATOM   4951  O  O   . GLY E  1 16  ? -26.973 43.689  10.640  1.00 33.70  ?  16  GLY E O   1 
ATOM   4952  N  N   . LYS E  1 17  ? -26.170 42.228  9.142   1.00 32.96  ?  17  LYS E N   1 
ATOM   4953  C  CA  . LYS E  1 17  ? -24.923 42.955  9.057   1.00 32.88  ?  17  LYS E CA  1 
ATOM   4954  C  C   . LYS E  1 17  ? -24.498 43.433  7.651   1.00 32.52  ?  17  LYS E C   1 
ATOM   4955  O  O   . LYS E  1 17  ? -25.077 43.049  6.613   1.00 32.30  ?  17  LYS E O   1 
ATOM   4956  C  CB  . LYS E  1 17  ? -23.829 42.219  9.820   1.00 33.56  ?  17  LYS E CB  1 
ATOM   4957  C  CG  . LYS E  1 17  ? -24.115 42.177  11.325  1.00 34.96  ?  17  LYS E CG  1 
ATOM   4958  C  CD  . LYS E  1 17  ? -22.963 41.597  12.116  1.00 38.93  ?  17  LYS E CD  1 
ATOM   4959  C  CE  . LYS E  1 17  ? -22.846 42.225  13.521  1.00 41.20  ?  17  LYS E CE  1 
ATOM   4960  N  NZ  . LYS E  1 17  ? -24.019 41.958  14.394  1.00 38.28  ?  17  LYS E NZ  1 
ATOM   4961  N  N   . PHE E  1 18  ? -23.523 44.327  7.644   1.00 32.07  ?  18  PHE E N   1 
ATOM   4962  C  CA  . PHE E  1 18  ? -23.093 44.971  6.425   1.00 32.31  ?  18  PHE E CA  1 
ATOM   4963  C  C   . PHE E  1 18  ? -21.593 44.855  6.264   1.00 32.62  ?  18  PHE E C   1 
ATOM   4964  O  O   . PHE E  1 18  ? -20.834 45.097  7.196   1.00 32.38  ?  18  PHE E O   1 
ATOM   4965  C  CB  . PHE E  1 18  ? -23.552 46.434  6.379   1.00 32.08  ?  18  PHE E CB  1 
ATOM   4966  C  CG  . PHE E  1 18  ? -25.044 46.589  6.208   1.00 32.21  ?  18  PHE E CG  1 
ATOM   4967  C  CD1 . PHE E  1 18  ? -25.632 46.447  4.957   1.00 29.57  ?  18  PHE E CD1 1 
ATOM   4968  C  CD2 . PHE E  1 18  ? -25.862 46.861  7.306   1.00 31.88  ?  18  PHE E CD2 1 
ATOM   4969  C  CE1 . PHE E  1 18  ? -26.999 46.581  4.791   1.00 30.33  ?  18  PHE E CE1 1 
ATOM   4970  C  CE2 . PHE E  1 18  ? -27.237 46.996  7.145   1.00 32.28  ?  18  PHE E CE2 1 
ATOM   4971  C  CZ  . PHE E  1 18  ? -27.808 46.851  5.871   1.00 30.86  ?  18  PHE E CZ  1 
ATOM   4972  N  N   . LEU E  1 19  ? -21.169 44.464  5.074   1.00 32.95  ?  19  LEU E N   1 
ATOM   4973  C  CA  . LEU E  1 19  ? -19.758 44.230  4.867   1.00 33.55  ?  19  LEU E CA  1 
ATOM   4974  C  C   . LEU E  1 19  ? -19.026 45.522  4.565   1.00 33.97  ?  19  LEU E C   1 
ATOM   4975  O  O   . LEU E  1 19  ? -19.269 46.199  3.564   1.00 33.95  ?  19  LEU E O   1 
ATOM   4976  C  CB  . LEU E  1 19  ? -19.527 43.204  3.758   1.00 33.62  ?  19  LEU E CB  1 
ATOM   4977  C  CG  . LEU E  1 19  ? -18.067 42.813  3.541   1.00 33.15  ?  19  LEU E CG  1 
ATOM   4978  C  CD1 . LEU E  1 19  ? -17.463 42.234  4.834   1.00 33.50  ?  19  LEU E CD1 1 
ATOM   4979  C  CD2 . LEU E  1 19  ? -17.990 41.831  2.397   1.00 31.19  ?  19  LEU E CD2 1 
ATOM   4980  N  N   . VAL E  1 20  ? -18.097 45.840  5.442   1.00 34.75  ?  20  VAL E N   1 
ATOM   4981  C  CA  . VAL E  1 20  ? -17.352 47.066  5.337   1.00 34.88  ?  20  VAL E CA  1 
ATOM   4982  C  C   . VAL E  1 20  ? -15.882 46.664  5.227   1.00 35.93  ?  20  VAL E C   1 
ATOM   4983  O  O   . VAL E  1 20  ? -15.495 45.593  5.669   1.00 35.87  ?  20  VAL E O   1 
ATOM   4984  C  CB  . VAL E  1 20  ? -17.683 47.969  6.555   1.00 34.52  ?  20  VAL E CB  1 
ATOM   4985  C  CG1 . VAL E  1 20  ? -16.619 47.889  7.644   1.00 33.15  ?  20  VAL E CG1 1 
ATOM   4986  C  CG2 . VAL E  1 20  ? -17.915 49.356  6.110   1.00 33.74  ?  20  VAL E CG2 1 
ATOM   4987  N  N   . VAL E  1 21  ? -15.075 47.501  4.594   1.00 37.39  ?  21  VAL E N   1 
ATOM   4988  C  CA  . VAL E  1 21  ? -13.659 47.220  4.465   1.00 38.69  ?  21  VAL E CA  1 
ATOM   4989  C  C   . VAL E  1 21  ? -12.907 48.283  5.225   1.00 40.14  ?  21  VAL E C   1 
ATOM   4990  O  O   . VAL E  1 21  ? -13.270 49.444  5.156   1.00 40.46  ?  21  VAL E O   1 
ATOM   4991  C  CB  . VAL E  1 21  ? -13.200 47.163  2.973   1.00 38.38  ?  21  VAL E CB  1 
ATOM   4992  C  CG1 . VAL E  1 21  ? -13.923 46.053  2.230   1.00 38.52  ?  21  VAL E CG1 1 
ATOM   4993  C  CG2 . VAL E  1 21  ? -13.404 48.489  2.264   1.00 37.59  ?  21  VAL E CG2 1 
ATOM   4994  N  N   . GLU E  1 22  ? -11.871 47.889  5.945   1.00 42.39  ?  22  GLU E N   1 
ATOM   4995  C  CA  . GLU E  1 22  ? -11.079 48.824  6.737   1.00 45.57  ?  22  GLU E CA  1 
ATOM   4996  C  C   . GLU E  1 22  ? -9.833  49.224  5.940   1.00 47.35  ?  22  GLU E C   1 
ATOM   4997  O  O   . GLU E  1 22  ? -9.145  48.367  5.415   1.00 47.67  ?  22  GLU E O   1 
ATOM   4998  C  CB  . GLU E  1 22  ? -10.691 48.158  8.065   1.00 45.86  ?  22  GLU E CB  1 
ATOM   4999  C  CG  . GLU E  1 22  ? -10.366 49.085  9.247   1.00 47.13  ?  22  GLU E CG  1 
ATOM   5000  C  CD  . GLU E  1 22  ? -10.614 48.395  10.606  1.00 49.19  ?  22  GLU E CD  1 
ATOM   5001  O  OE1 . GLU E  1 22  ? -9.621  47.916  11.205  1.00 52.42  ?  22  GLU E OE1 1 
ATOM   5002  O  OE2 . GLU E  1 22  ? -11.784 48.295  11.067  1.00 47.29  -1 22  GLU E OE2 1 
ATOM   5003  N  N   . GLU E  1 23  ? -9.527  50.515  5.865   1.00 49.62  ?  23  GLU E N   1 
ATOM   5004  C  CA  . GLU E  1 23  ? -8.481  50.997  4.962   1.00 51.60  ?  23  GLU E CA  1 
ATOM   5005  C  C   . GLU E  1 23  ? -7.702  52.187  5.531   1.00 53.12  ?  23  GLU E C   1 
ATOM   5006  O  O   . GLU E  1 23  ? -8.261  53.261  5.753   1.00 53.74  ?  23  GLU E O   1 
ATOM   5007  C  CB  . GLU E  1 23  ? -9.138  51.413  3.662   1.00 51.69  ?  23  GLU E CB  1 
ATOM   5008  C  CG  . GLU E  1 23  ? -8.289  51.344  2.449   1.00 51.52  ?  23  GLU E CG  1 
ATOM   5009  C  CD  . GLU E  1 23  ? -9.137  51.402  1.172   1.00 54.39  ?  23  GLU E CD  1 
ATOM   5010  O  OE1 . GLU E  1 23  ? -10.409 51.553  1.229   1.00 52.29  ?  23  GLU E OE1 1 
ATOM   5011  O  OE2 . GLU E  1 23  ? -8.508  51.293  0.092   1.00 56.58  -1 23  GLU E OE2 1 
ATOM   5012  N  N   . THR E  1 24  ? -6.408  52.004  5.757   1.00 54.90  ?  24  THR E N   1 
ATOM   5013  C  CA  . THR E  1 24  ? -5.585  53.057  6.347   1.00 56.25  ?  24  THR E CA  1 
ATOM   5014  C  C   . THR E  1 24  ? -5.387  54.217  5.363   1.00 56.84  ?  24  THR E C   1 
ATOM   5015  O  O   . THR E  1 24  ? -4.485  54.183  4.527   1.00 56.61  ?  24  THR E O   1 
ATOM   5016  C  CB  . THR E  1 24  ? -4.235  52.464  6.844   1.00 56.75  ?  24  THR E CB  1 
ATOM   5017  O  OG1 . THR E  1 24  ? -4.460  51.681  8.030   1.00 56.52  ?  24  THR E OG1 1 
ATOM   5018  C  CG2 . THR E  1 24  ? -3.179  53.558  7.119   1.00 57.38  ?  24  THR E CG2 1 
ATOM   5019  N  N   . ILE E  1 25  ? -6.270  55.214  5.411   1.00 57.54  ?  25  ILE E N   1 
ATOM   5020  C  CA  . ILE E  1 25  ? -5.974  56.441  4.667   1.00 58.24  ?  25  ILE E CA  1 
ATOM   5021  C  C   . ILE E  1 25  ? -5.218  57.391  5.599   1.00 58.52  ?  25  ILE E C   1 
ATOM   5022  O  O   . ILE E  1 25  ? -5.737  57.853  6.633   1.00 58.39  ?  25  ILE E O   1 
ATOM   5023  C  CB  . ILE E  1 25  ? -7.159  57.015  3.837   1.00 58.12  ?  25  ILE E CB  1 
ATOM   5024  C  CG1 . ILE E  1 25  ? -7.202  56.331  2.476   1.00 57.97  ?  25  ILE E CG1 1 
ATOM   5025  C  CG2 . ILE E  1 25  ? -6.976  58.487  3.520   1.00 58.24  ?  25  ILE E CG2 1 
ATOM   5026  C  CD1 . ILE E  1 25  ? -7.391  54.835  2.527   1.00 57.55  ?  25  ILE E CD1 1 
ATOM   5027  N  N   . ASN E  1 26  ? -3.969  57.621  5.174   1.00 58.94  ?  26  ASN E N   1 
ATOM   5028  C  CA  . ASN E  1 26  ? -2.812  58.071  5.974   1.00 59.07  ?  26  ASN E CA  1 
ATOM   5029  C  C   . ASN E  1 26  ? -3.057  58.501  7.421   1.00 58.65  ?  26  ASN E C   1 
ATOM   5030  O  O   . ASN E  1 26  ? -3.358  59.667  7.702   1.00 58.27  ?  26  ASN E O   1 
ATOM   5031  C  CB  . ASN E  1 26  ? -1.990  59.117  5.195   1.00 59.16  ?  26  ASN E CB  1 
ATOM   5032  C  CG  . ASN E  1 26  ? -2.866  59.999  4.320   1.00 59.87  ?  26  ASN E CG  1 
ATOM   5033  O  OD1 . ASN E  1 26  ? -3.842  60.591  4.797   1.00 59.46  ?  26  ASN E OD1 1 
ATOM   5034  N  ND2 . ASN E  1 26  ? -2.537  60.073  3.027   1.00 60.14  ?  26  ASN E ND2 1 
ATOM   5035  N  N   . GLY E  1 27  ? -2.909  57.533  8.323   1.00 58.35  ?  27  GLY E N   1 
ATOM   5036  C  CA  . GLY E  1 27  ? -2.940  57.800  9.752   1.00 58.28  ?  27  GLY E CA  1 
ATOM   5037  C  C   . GLY E  1 27  ? -4.004  56.997  10.464  1.00 58.11  ?  27  GLY E C   1 
ATOM   5038  O  O   . GLY E  1 27  ? -3.755  56.438  11.545  1.00 58.30  ?  27  GLY E O   1 
ATOM   5039  N  N   . LYS E  1 28  ? -5.203  56.941  9.878   1.00 57.50  ?  28  LYS E N   1 
ATOM   5040  C  CA  . LYS E  1 28  ? -6.291  56.196  10.522  1.00 56.77  ?  28  LYS E CA  1 
ATOM   5041  C  C   . LYS E  1 28  ? -6.967  55.177  9.612   1.00 55.07  ?  28  LYS E C   1 
ATOM   5042  O  O   . LYS E  1 28  ? -6.905  55.271  8.375   1.00 54.80  ?  28  LYS E O   1 
ATOM   5043  C  CB  . LYS E  1 28  ? -7.327  57.147  11.177  1.00 57.52  ?  28  LYS E CB  1 
ATOM   5044  C  CG  . LYS E  1 28  ? -7.968  56.597  12.499  1.00 59.63  ?  28  LYS E CG  1 
ATOM   5045  C  CD  . LYS E  1 28  ? -8.326  57.721  13.521  1.00 63.77  ?  28  LYS E CD  1 
ATOM   5046  C  CE  . LYS E  1 28  ? -7.061  58.434  14.082  1.00 64.87  ?  28  LYS E CE  1 
ATOM   5047  N  NZ  . LYS E  1 28  ? -7.352  59.477  15.102  1.00 65.54  ?  28  LYS E NZ  1 
ATOM   5048  N  N   . ALA E  1 29  ? -7.601  54.205  10.268  1.00 53.01  ?  29  ALA E N   1 
ATOM   5049  C  CA  . ALA E  1 29  ? -8.339  53.152  9.619   1.00 51.15  ?  29  ALA E CA  1 
ATOM   5050  C  C   . ALA E  1 29  ? -9.780  53.593  9.366   1.00 49.80  ?  29  ALA E C   1 
ATOM   5051  O  O   . ALA E  1 29  ? -10.580 53.787  10.288  1.00 49.07  ?  29  ALA E O   1 
ATOM   5052  C  CB  . ALA E  1 29  ? -8.283  51.863  10.459  1.00 51.32  ?  29  ALA E CB  1 
ATOM   5053  N  N   . LEU E  1 30  ? -10.079 53.746  8.086   1.00 48.43  ?  30  LEU E N   1 
ATOM   5054  C  CA  . LEU E  1 30  ? -11.386 54.161  7.611   1.00 47.63  ?  30  LEU E CA  1 
ATOM   5055  C  C   . LEU E  1 30  ? -12.238 53.003  7.053   1.00 46.34  ?  30  LEU E C   1 
ATOM   5056  O  O   . LEU E  1 30  ? -11.715 51.996  6.557   1.00 46.69  ?  30  LEU E O   1 
ATOM   5057  C  CB  . LEU E  1 30  ? -11.221 55.244  6.539   1.00 47.97  ?  30  LEU E CB  1 
ATOM   5058  C  CG  . LEU E  1 30  ? -10.925 56.688  6.946   1.00 48.01  ?  30  LEU E CG  1 
ATOM   5059  C  CD1 . LEU E  1 30  ? -9.934  56.772  8.079   1.00 47.00  ?  30  LEU E CD1 1 
ATOM   5060  C  CD2 . LEU E  1 30  ? -10.415 57.448  5.726   1.00 48.69  ?  30  LEU E CD2 1 
ATOM   5061  N  N   . TRP E  1 31  ? -13.553 53.167  7.127   1.00 44.07  ?  31  TRP E N   1 
ATOM   5062  C  CA  . TRP E  1 31  ? -14.462 52.183  6.597   1.00 41.57  ?  31  TRP E CA  1 
ATOM   5063  C  C   . TRP E  1 31  ? -15.059 52.663  5.304   1.00 39.84  ?  31  TRP E C   1 
ATOM   5064  O  O   . TRP E  1 31  ? -15.266 53.864  5.138   1.00 39.45  ?  31  TRP E O   1 
ATOM   5065  C  CB  . TRP E  1 31  ? -15.551 51.900  7.601   1.00 41.45  ?  31  TRP E CB  1 
ATOM   5066  C  CG  . TRP E  1 31  ? -15.025 51.282  8.810   1.00 42.14  ?  31  TRP E CG  1 
ATOM   5067  C  CD1 . TRP E  1 31  ? -13.724 50.914  9.048   1.00 42.56  ?  31  TRP E CD1 1 
ATOM   5068  C  CD2 . TRP E  1 31  ? -15.779 50.881  9.965   1.00 42.67  ?  31  TRP E CD2 1 
ATOM   5069  N  NE1 . TRP E  1 31  ? -13.628 50.324  10.289  1.00 44.23  ?  31  TRP E NE1 1 
ATOM   5070  C  CE2 . TRP E  1 31  ? -14.872 50.299  10.873  1.00 43.50  ?  31  TRP E CE2 1 
ATOM   5071  C  CE3 . TRP E  1 31  ? -17.125 50.974  10.327  1.00 41.66  ?  31  TRP E CE3 1 
ATOM   5072  C  CZ2 . TRP E  1 31  ? -15.273 49.818  12.118  1.00 43.08  ?  31  TRP E CZ2 1 
ATOM   5073  C  CZ3 . TRP E  1 31  ? -17.521 50.486  11.560  1.00 42.72  ?  31  TRP E CZ3 1 
ATOM   5074  C  CH2 . TRP E  1 31  ? -16.598 49.922  12.439  1.00 42.84  ?  31  TRP E CH2 1 
ATOM   5075  N  N   . ASN E  1 32  ? -15.293 51.718  4.387   1.00 37.74  ?  32  ASN E N   1 
ATOM   5076  C  CA  . ASN E  1 32  ? -15.942 51.976  3.089   1.00 35.69  ?  32  ASN E CA  1 
ATOM   5077  C  C   . ASN E  1 32  ? -16.803 50.780  2.712   1.00 33.94  ?  32  ASN E C   1 
ATOM   5078  O  O   . ASN E  1 32  ? -16.650 49.713  3.290   1.00 33.39  ?  32  ASN E O   1 
ATOM   5079  C  CB  . ASN E  1 32  ? -14.893 52.252  1.991   1.00 35.64  ?  32  ASN E CB  1 
ATOM   5080  C  CG  . ASN E  1 32  ? -15.501 52.791  0.667   1.00 35.92  ?  32  ASN E CG  1 
ATOM   5081  O  OD1 . ASN E  1 32  ? -16.711 53.027  0.556   1.00 39.78  ?  32  ASN E OD1 1 
ATOM   5082  N  ND2 . ASN E  1 32  ? -14.654 52.986  -0.330  1.00 32.22  ?  32  ASN E ND2 1 
ATOM   5083  N  N   . GLN E  1 33  ? -17.712 50.958  1.761   1.00 32.08  ?  33  GLN E N   1 
ATOM   5084  C  CA  . GLN E  1 33  ? -18.256 49.799  1.071   1.00 30.99  ?  33  GLN E CA  1 
ATOM   5085  C  C   . GLN E  1 33  ? -17.121 49.160  0.297   1.00 29.93  ?  33  GLN E C   1 
ATOM   5086  O  O   . GLN E  1 33  ? -16.185 49.840  -0.068  1.00 30.20  ?  33  GLN E O   1 
ATOM   5087  C  CB  . GLN E  1 33  ? -19.408 50.172  0.124   1.00 30.91  ?  33  GLN E CB  1 
ATOM   5088  C  CG  . GLN E  1 33  ? -20.767 50.286  0.810   1.00 28.58  ?  33  GLN E CG  1 
ATOM   5089  C  CD  . GLN E  1 33  ? -20.860 51.575  1.598   1.00 27.48  ?  33  GLN E CD  1 
ATOM   5090  O  OE1 . GLN E  1 33  ? -20.544 52.662  1.082   1.00 24.53  ?  33  GLN E OE1 1 
ATOM   5091  N  NE2 . GLN E  1 33  ? -21.262 51.467  2.851   1.00 25.83  ?  33  GLN E NE2 1 
ATOM   5092  N  N   . PRO E  1 34  ? -17.173 47.843  0.077   1.00 29.25  ?  34  PRO E N   1 
ATOM   5093  C  CA  . PRO E  1 34  ? -16.170 47.319  -0.851  1.00 29.02  ?  34  PRO E CA  1 
ATOM   5094  C  C   . PRO E  1 34  ? -16.429 48.000  -2.178  1.00 28.60  ?  34  PRO E C   1 
ATOM   5095  O  O   . PRO E  1 34  ? -17.552 47.957  -2.673  1.00 28.62  ?  34  PRO E O   1 
ATOM   5096  C  CB  . PRO E  1 34  ? -16.497 45.823  -0.925  1.00 28.44  ?  34  PRO E CB  1 
ATOM   5097  C  CG  . PRO E  1 34  ? -17.262 45.539  0.337   1.00 28.38  ?  34  PRO E CG  1 
ATOM   5098  C  CD  . PRO E  1 34  ? -18.044 46.786  0.616   1.00 29.17  ?  34  PRO E CD  1 
ATOM   5099  N  N   . ALA E  1 35  ? -15.436 48.701  -2.705  1.00 28.66  ?  35  ALA E N   1 
ATOM   5100  C  CA  . ALA E  1 35  ? -15.654 49.530  -3.904  1.00 29.50  ?  35  ALA E CA  1 
ATOM   5101  C  C   . ALA E  1 35  ? -14.350 49.914  -4.545  1.00 29.73  ?  35  ALA E C   1 
ATOM   5102  O  O   . ALA E  1 35  ? -13.307 49.717  -3.942  1.00 29.44  ?  35  ALA E O   1 
ATOM   5103  C  CB  . ALA E  1 35  ? -16.405 50.790  -3.551  1.00 29.72  ?  35  ALA E CB  1 
ATOM   5104  N  N   . GLY E  1 36  ? -14.418 50.504  -5.740  1.00 29.82  ?  36  GLY E N   1 
ATOM   5105  C  CA  . GLY E  1 36  ? -13.222 50.989  -6.406  1.00 30.16  ?  36  GLY E CA  1 
ATOM   5106  C  C   . GLY E  1 36  ? -13.499 51.453  -7.812  1.00 30.68  ?  36  GLY E C   1 
ATOM   5107  O  O   . GLY E  1 36  ? -14.662 51.485  -8.237  1.00 30.86  ?  36  GLY E O   1 
ATOM   5108  N  N   . HIS E  1 37  ? -12.428 51.797  -8.534  1.00 30.60  ?  37  HIS E N   1 
ATOM   5109  C  CA  . HIS E  1 37  ? -12.532 52.399  -9.860  1.00 30.79  ?  37  HIS E CA  1 
ATOM   5110  C  C   . HIS E  1 37  ? -12.863 51.420  -10.973 1.00 30.84  ?  37  HIS E C   1 
ATOM   5111  O  O   . HIS E  1 37  ? -12.430 50.272  -10.955 1.00 31.03  ?  37  HIS E O   1 
ATOM   5112  C  CB  . HIS E  1 37  ? -11.233 53.091  -10.198 1.00 30.89  ?  37  HIS E CB  1 
ATOM   5113  C  CG  . HIS E  1 37  ? -10.962 54.285  -9.349  1.00 31.62  ?  37  HIS E CG  1 
ATOM   5114  N  ND1 . HIS E  1 37  ? -10.549 54.185  -8.039  1.00 33.15  ?  37  HIS E ND1 1 
ATOM   5115  C  CD2 . HIS E  1 37  ? -11.047 55.608  -9.618  1.00 32.54  ?  37  HIS E CD2 1 
ATOM   5116  C  CE1 . HIS E  1 37  ? -10.391 55.398  -7.538  1.00 33.36  ?  37  HIS E CE1 1 
ATOM   5117  N  NE2 . HIS E  1 37  ? -10.684 56.279  -8.475  1.00 32.20  ?  37  HIS E NE2 1 
ATOM   5118  N  N   . LEU E  1 38  ? -13.634 51.881  -11.940 1.00 30.71  ?  38  LEU E N   1 
ATOM   5119  C  CA  . LEU E  1 38  ? -13.785 51.168  -13.192 1.00 31.41  ?  38  LEU E CA  1 
ATOM   5120  C  C   . LEU E  1 38  ? -12.426 51.098  -13.896 1.00 32.43  ?  38  LEU E C   1 
ATOM   5121  O  O   . LEU E  1 38  ? -11.729 52.127  -14.039 1.00 32.94  ?  38  LEU E O   1 
ATOM   5122  C  CB  . LEU E  1 38  ? -14.778 51.915  -14.075 1.00 30.48  ?  38  LEU E CB  1 
ATOM   5123  C  CG  . LEU E  1 38  ? -15.284 51.297  -15.380 1.00 30.15  ?  38  LEU E CG  1 
ATOM   5124  C  CD1 . LEU E  1 38  ? -15.616 49.837  -15.191 1.00 28.53  ?  38  LEU E CD1 1 
ATOM   5125  C  CD2 . LEU E  1 38  ? -16.543 52.065  -15.868 1.00 27.70  ?  38  LEU E CD2 1 
ATOM   5126  N  N   . GLU E  1 39  ? -12.023 49.894  -14.309 1.00 33.10  ?  39  GLU E N   1 
ATOM   5127  C  CA  . GLU E  1 39  ? -10.936 49.779  -15.287 1.00 33.79  ?  39  GLU E CA  1 
ATOM   5128  C  C   . GLU E  1 39  ? -11.412 49.620  -16.742 1.00 33.01  ?  39  GLU E C   1 
ATOM   5129  O  O   . GLU E  1 39  ? -12.609 49.549  -17.027 1.00 32.48  ?  39  GLU E O   1 
ATOM   5130  C  CB  . GLU E  1 39  ? -9.940  48.689  -14.901 1.00 34.46  ?  39  GLU E CB  1 
ATOM   5131  C  CG  . GLU E  1 39  ? -8.609  49.247  -14.404 1.00 38.35  ?  39  GLU E CG  1 
ATOM   5132  C  CD  . GLU E  1 39  ? -8.482  49.172  -12.896 1.00 43.74  ?  39  GLU E CD  1 
ATOM   5133  O  OE1 . GLU E  1 39  ? -8.997  48.186  -12.313 1.00 44.82  ?  39  GLU E OE1 1 
ATOM   5134  O  OE2 . GLU E  1 39  ? -7.867  50.094  -12.291 1.00 46.88  -1 39  GLU E OE2 1 
ATOM   5135  N  N   . ALA E  1 40  ? -10.458 49.588  -17.669 1.00 32.85  ?  40  ALA E N   1 
ATOM   5136  C  CA  . ALA E  1 40  ? -10.783 49.403  -19.094 1.00 32.09  ?  40  ALA E CA  1 
ATOM   5137  C  C   . ALA E  1 40  ? -11.481 48.056  -19.413 1.00 31.35  ?  40  ALA E C   1 
ATOM   5138  O  O   . ALA E  1 40  ? -11.293 47.061  -18.714 1.00 29.65  ?  40  ALA E O   1 
ATOM   5139  C  CB  . ALA E  1 40  ? -9.518  49.561  -19.925 1.00 31.75  ?  40  ALA E CB  1 
ATOM   5140  N  N   . ASP E  1 41  ? -12.290 48.052  -20.470 1.00 31.72  ?  41  ASP E N   1 
ATOM   5141  C  CA  . ASP E  1 41  ? -12.873 46.820  -21.035 1.00 31.87  ?  41  ASP E CA  1 
ATOM   5142  C  C   . ASP E  1 41  ? -13.718 46.010  -20.075 1.00 31.57  ?  41  ASP E C   1 
ATOM   5143  O  O   . ASP E  1 41  ? -13.866 44.790  -20.232 1.00 31.60  ?  41  ASP E O   1 
ATOM   5144  C  CB  . ASP E  1 41  ? -11.752 45.919  -21.561 1.00 32.54  ?  41  ASP E CB  1 
ATOM   5145  C  CG  . ASP E  1 41  ? -10.921 46.587  -22.630 1.00 33.27  ?  41  ASP E CG  1 
ATOM   5146  O  OD1 . ASP E  1 41  ? -9.703  46.296  -22.635 1.00 32.80  ?  41  ASP E OD1 1 
ATOM   5147  O  OD2 . ASP E  1 41  ? -11.493 47.395  -23.444 1.00 34.83  -1 41  ASP E OD2 1 
ATOM   5148  N  N   . GLU E  1 42  ? -14.260 46.700  -19.076 1.00 31.18  ?  42  GLU E N   1 
ATOM   5149  C  CA  . GLU E  1 42  ? -14.946 46.098  -17.951 1.00 29.77  ?  42  GLU E CA  1 
ATOM   5150  C  C   . GLU E  1 42  ? -16.311 46.720  -17.906 1.00 28.71  ?  42  GLU E C   1 
ATOM   5151  O  O   . GLU E  1 42  ? -16.484 47.912  -18.176 1.00 28.73  ?  42  GLU E O   1 
ATOM   5152  C  CB  . GLU E  1 42  ? -14.212 46.524  -16.710 1.00 30.56  ?  42  GLU E CB  1 
ATOM   5153  C  CG  . GLU E  1 42  ? -14.347 45.638  -15.501 1.00 31.62  ?  42  GLU E CG  1 
ATOM   5154  C  CD  . GLU E  1 42  ? -13.354 46.057  -14.462 1.00 33.63  ?  42  GLU E CD  1 
ATOM   5155  O  OE1 . GLU E  1 42  ? -12.693 45.163  -13.906 1.00 35.43  ?  42  GLU E OE1 1 
ATOM   5156  O  OE2 . GLU E  1 42  ? -13.189 47.287  -14.240 1.00 34.60  -1 42  GLU E OE2 1 
ATOM   5157  N  N   . THR E  1 43  ? -17.286 45.912  -17.543 1.00 27.68  ?  43  THR E N   1 
ATOM   5158  C  CA  . THR E  1 43  ? -18.685 46.366  -17.389 1.00 25.98  ?  43  THR E CA  1 
ATOM   5159  C  C   . THR E  1 43  ? -18.862 46.962  -15.982 1.00 24.47  ?  43  THR E C   1 
ATOM   5160  O  O   . THR E  1 43  ? -17.991 46.736  -15.109 1.00 23.71  ?  43  THR E O   1 
ATOM   5161  C  CB  . THR E  1 43  ? -19.577 45.168  -17.709 1.00 26.05  ?  43  THR E CB  1 
ATOM   5162  O  OG1 . THR E  1 43  ? -20.301 45.451  -18.911 1.00 30.12  ?  43  THR E OG1 1 
ATOM   5163  C  CG2 . THR E  1 43  ? -20.496 44.799  -16.617 1.00 25.30  ?  43  THR E CG2 1 
ATOM   5164  N  N   . LEU E  1 44  ? -19.923 47.740  -15.737 1.00 21.92  ?  44  LEU E N   1 
ATOM   5165  C  CA  . LEU E  1 44  ? -20.074 48.285  -14.382 1.00 19.65  ?  44  LEU E CA  1 
ATOM   5166  C  C   . LEU E  1 44  ? -20.204 47.212  -13.336 1.00 19.04  ?  44  LEU E C   1 
ATOM   5167  O  O   . LEU E  1 44  ? -19.526 47.240  -12.279 1.00 17.66  ?  44  LEU E O   1 
ATOM   5168  C  CB  . LEU E  1 44  ? -21.232 49.265  -14.285 1.00 19.62  ?  44  LEU E CB  1 
ATOM   5169  C  CG  . LEU E  1 44  ? -20.857 50.698  -14.723 1.00 18.75  ?  44  LEU E CG  1 
ATOM   5170  C  CD1 . LEU E  1 44  ? -22.038 51.694  -14.561 1.00 14.01  ?  44  LEU E CD1 1 
ATOM   5171  C  CD2 . LEU E  1 44  ? -19.644 51.155  -13.953 1.00 17.05  ?  44  LEU E CD2 1 
ATOM   5172  N  N   . VAL E  1 45  ? -21.040 46.222  -13.643 1.00 19.05  ?  45  VAL E N   1 
ATOM   5173  C  CA  . VAL E  1 45  ? -21.227 45.140  -12.699 1.00 20.06  ?  45  VAL E CA  1 
ATOM   5174  C  C   . VAL E  1 45  ? -19.961 44.265  -12.588 1.00 20.50  ?  45  VAL E C   1 
ATOM   5175  O  O   . VAL E  1 45  ? -19.582 43.808  -11.484 1.00 20.88  ?  45  VAL E O   1 
ATOM   5176  C  CB  . VAL E  1 45  ? -22.536 44.342  -12.907 1.00 19.65  ?  45  VAL E CB  1 
ATOM   5177  C  CG1 . VAL E  1 45  ? -23.671 45.245  -13.396 1.00 19.95  ?  45  VAL E CG1 1 
ATOM   5178  C  CG2 . VAL E  1 45  ? -22.326 43.216  -13.817 1.00 21.40  ?  45  VAL E CG2 1 
ATOM   5179  N  N   . GLU E  1 46  ? -19.267 44.098  -13.699 1.00 21.38  ?  46  GLU E N   1 
ATOM   5180  C  CA  . GLU E  1 46  ? -17.998 43.379  -13.655 1.00 23.30  ?  46  GLU E CA  1 
ATOM   5181  C  C   . GLU E  1 46  ? -17.008 43.963  -12.696 1.00 23.53  ?  46  GLU E C   1 
ATOM   5182  O  O   . GLU E  1 46  ? -16.378 43.210  -11.964 1.00 23.94  ?  46  GLU E O   1 
ATOM   5183  C  CB  . GLU E  1 46  ? -17.364 43.230  -15.039 1.00 23.90  ?  46  GLU E CB  1 
ATOM   5184  C  CG  . GLU E  1 46  ? -17.943 42.043  -15.881 1.00 25.48  ?  46  GLU E CG  1 
ATOM   5185  C  CD  . GLU E  1 46  ? -17.560 42.189  -17.342 1.00 31.62  ?  46  GLU E CD  1 
ATOM   5186  O  OE1 . GLU E  1 46  ? -18.117 41.439  -18.183 1.00 31.79  ?  46  GLU E OE1 1 
ATOM   5187  O  OE2 . GLU E  1 46  ? -16.701 43.085  -17.640 1.00 33.43  -1 46  GLU E OE2 1 
ATOM   5188  N  N   . ALA E  1 47  ? -16.873 45.298  -12.705 1.00 24.70  ?  47  ALA E N   1 
ATOM   5189  C  CA  . ALA E  1 47  ? -15.964 46.042  -11.807 1.00 24.60  ?  47  ALA E CA  1 
ATOM   5190  C  C   . ALA E  1 47  ? -16.474 45.900  -10.384 1.00 24.89  ?  47  ALA E C   1 
ATOM   5191  O  O   . ALA E  1 47  ? -15.712 45.604  -9.427  1.00 24.83  ?  47  ALA E O   1 
ATOM   5192  C  CB  . ALA E  1 47  ? -15.928 47.502  -12.211 1.00 24.44  ?  47  ALA E CB  1 
ATOM   5193  N  N   . ALA E  1 48  ? -17.792 46.079  -10.251 1.00 25.21  ?  48  ALA E N   1 
ATOM   5194  C  CA  . ALA E  1 48  ? -18.418 45.999  -8.949  1.00 25.02  ?  48  ALA E CA  1 
ATOM   5195  C  C   . ALA E  1 48  ? -18.083 44.636  -8.365  1.00 25.06  ?  48  ALA E C   1 
ATOM   5196  O  O   . ALA E  1 48  ? -17.510 44.570  -7.265  1.00 25.33  ?  48  ALA E O   1 
ATOM   5197  C  CB  . ALA E  1 48  ? -19.903 46.231  -9.054  1.00 25.41  ?  48  ALA E CB  1 
ATOM   5198  N  N   . ALA E  1 49  ? -18.361 43.559  -9.123  1.00 25.10  ?  49  ALA E N   1 
ATOM   5199  C  CA  . ALA E  1 49  ? -17.967 42.175  -8.694  1.00 24.99  ?  49  ALA E CA  1 
ATOM   5200  C  C   . ALA E  1 49  ? -16.457 42.038  -8.417  1.00 24.81  ?  49  ALA E C   1 
ATOM   5201  O  O   . ALA E  1 49  ? -16.042 41.503  -7.367  1.00 24.92  ?  49  ALA E O   1 
ATOM   5202  C  CB  . ALA E  1 49  ? -18.441 41.104  -9.695  1.00 23.94  ?  49  ALA E CB  1 
ATOM   5203  N  N   . ARG E  1 50  ? -15.640 42.536  -9.337  1.00 24.98  ?  50  ARG E N   1 
ATOM   5204  C  CA  . ARG E  1 50  ? -14.197 42.402  -9.181  1.00 26.01  ?  50  ARG E CA  1 
ATOM   5205  C  C   . ARG E  1 50  ? -13.691 43.105  -7.915  1.00 26.24  ?  50  ARG E C   1 
ATOM   5206  O  O   . ARG E  1 50  ? -12.939 42.496  -7.154  1.00 25.11  ?  50  ARG E O   1 
ATOM   5207  C  CB  . ARG E  1 50  ? -13.417 42.890  -10.407 1.00 26.11  ?  50  ARG E CB  1 
ATOM   5208  C  CG  . ARG E  1 50  ? -11.916 42.793  -10.213 1.00 27.48  ?  50  ARG E CG  1 
ATOM   5209  C  CD  . ARG E  1 50  ? -11.105 43.607  -11.204 1.00 31.78  ?  50  ARG E CD  1 
ATOM   5210  N  NE  . ARG E  1 50  ? -11.765 44.840  -11.641 1.00 34.39  ?  50  ARG E NE  1 
ATOM   5211  C  CZ  . ARG E  1 50  ? -11.671 46.027  -11.043 1.00 36.82  ?  50  ARG E CZ  1 
ATOM   5212  N  NH1 . ARG E  1 50  ? -10.946 46.191  -9.932  1.00 38.99  ?  50  ARG E NH1 1 
ATOM   5213  N  NH2 . ARG E  1 50  ? -12.328 47.061  -11.561 1.00 36.93  ?  50  ARG E NH2 1 
ATOM   5214  N  N   . GLU E  1 51  ? -14.106 44.357  -7.667  1.00 26.52  ?  51  GLU E N   1 
ATOM   5215  C  CA  . GLU E  1 51  ? -13.507 45.062  -6.524  1.00 26.97  ?  51  GLU E CA  1 
ATOM   5216  C  C   . GLU E  1 51  ? -13.925 44.410  -5.223  1.00 26.60  ?  51  GLU E C   1 
ATOM   5217  O  O   . GLU E  1 51  ? -13.137 44.373  -4.263  1.00 27.26  ?  51  GLU E O   1 
ATOM   5218  C  CB  . GLU E  1 51  ? -13.784 46.569  -6.526  1.00 27.74  ?  51  GLU E CB  1 
ATOM   5219  C  CG  . GLU E  1 51  ? -12.854 47.403  -7.435  1.00 29.39  ?  51  GLU E CG  1 
ATOM   5220  C  CD  . GLU E  1 51  ? -11.532 47.759  -6.766  1.00 33.33  ?  51  GLU E CD  1 
ATOM   5221  O  OE1 . GLU E  1 51  ? -11.344 47.417  -5.573  1.00 33.38  ?  51  GLU E OE1 1 
ATOM   5222  O  OE2 . GLU E  1 51  ? -10.670 48.393  -7.431  1.00 35.84  -1 51  GLU E OE2 1 
ATOM   5223  N  N   . LEU E  1 52  ? -15.131 43.843  -5.214  1.00 25.55  ?  52  LEU E N   1 
ATOM   5224  C  CA  . LEU E  1 52  ? -15.590 43.069  -4.082  1.00 25.41  ?  52  LEU E CA  1 
ATOM   5225  C  C   . LEU E  1 52  ? -14.561 41.996  -3.745  1.00 26.26  ?  52  LEU E C   1 
ATOM   5226  O  O   . LEU E  1 52  ? -14.157 41.823  -2.581  1.00 27.24  ?  52  LEU E O   1 
ATOM   5227  C  CB  . LEU E  1 52  ? -16.954 42.416  -4.378  1.00 24.66  ?  52  LEU E CB  1 
ATOM   5228  C  CG  . LEU E  1 52  ? -17.988 42.222  -3.239  1.00 21.75  ?  52  LEU E CG  1 
ATOM   5229  C  CD1 . LEU E  1 52  ? -18.930 40.993  -3.440  1.00 14.21  ?  52  LEU E CD1 1 
ATOM   5230  C  CD2 . LEU E  1 52  ? -17.408 42.267  -1.805  1.00 15.24  ?  52  LEU E CD2 1 
ATOM   5231  N  N   . TRP E  1 53  ? -14.124 41.292  -4.775  1.00 26.86  ?  53  TRP E N   1 
ATOM   5232  C  CA  . TRP E  1 53  ? -13.274 40.155  -4.590  1.00 27.86  ?  53  TRP E CA  1 
ATOM   5233  C  C   . TRP E  1 53  ? -11.952 40.709  -4.082  1.00 28.52  ?  53  TRP E C   1 
ATOM   5234  O  O   . TRP E  1 53  ? -11.523 40.422  -2.970  1.00 28.40  ?  53  TRP E O   1 
ATOM   5235  C  CB  . TRP E  1 53  ? -13.151 39.358  -5.909  1.00 28.10  ?  53  TRP E CB  1 
ATOM   5236  C  CG  . TRP E  1 53  ? -12.266 38.178  -5.779  1.00 29.93  ?  53  TRP E CG  1 
ATOM   5237  C  CD1 . TRP E  1 53  ? -12.613 36.939  -5.298  1.00 31.07  ?  53  TRP E CD1 1 
ATOM   5238  C  CD2 . TRP E  1 53  ? -10.860 38.120  -6.061  1.00 30.57  ?  53  TRP E CD2 1 
ATOM   5239  N  NE1 . TRP E  1 53  ? -11.510 36.119  -5.275  1.00 31.44  ?  53  TRP E NE1 1 
ATOM   5240  C  CE2 . TRP E  1 53  ? -10.423 36.812  -5.743  1.00 30.38  ?  53  TRP E CE2 1 
ATOM   5241  C  CE3 . TRP E  1 53  ? -9.926  39.046  -6.560  1.00 32.31  ?  53  TRP E CE3 1 
ATOM   5242  C  CZ2 . TRP E  1 53  ? -9.082  36.396  -5.909  1.00 30.94  ?  53  TRP E CZ2 1 
ATOM   5243  C  CZ3 . TRP E  1 53  ? -8.575  38.638  -6.718  1.00 31.49  ?  53  TRP E CZ3 1 
ATOM   5244  C  CH2 . TRP E  1 53  ? -8.175  37.326  -6.386  1.00 32.23  ?  53  TRP E CH2 1 
ATOM   5245  N  N   . GLU E  1 54  ? -11.361 41.598  -4.857  1.00 29.95  ?  54  GLU E N   1 
ATOM   5246  C  CA  . GLU E  1 54  ? -10.084 42.211  -4.507  1.00 31.40  ?  54  GLU E CA  1 
ATOM   5247  C  C   . GLU E  1 54  ? -9.989  42.754  -3.083  1.00 32.33  ?  54  GLU E C   1 
ATOM   5248  O  O   . GLU E  1 54  ? -8.875  42.888  -2.551  1.00 32.05  ?  54  GLU E O   1 
ATOM   5249  C  CB  . GLU E  1 54  ? -9.740  43.321  -5.485  1.00 31.51  ?  54  GLU E CB  1 
ATOM   5250  C  CG  . GLU E  1 54  ? -9.377  42.836  -6.868  1.00 32.38  ?  54  GLU E CG  1 
ATOM   5251  C  CD  . GLU E  1 54  ? -8.912  43.964  -7.746  1.00 37.34  ?  54  GLU E CD  1 
ATOM   5252  O  OE1 . GLU E  1 54  ? -8.866  45.117  -7.230  1.00 39.16  ?  54  GLU E OE1 1 
ATOM   5253  O  OE2 . GLU E  1 54  ? -8.591  43.704  -8.946  1.00 40.58  -1 54  GLU E OE2 1 
ATOM   5254  N  N   . GLU E  1 55  ? -11.143 43.038  -2.466  1.00 33.22  ?  55  GLU E N   1 
ATOM   5255  C  CA  . GLU E  1 55  ? -11.161 43.729  -1.181  1.00 33.66  ?  55  GLU E CA  1 
ATOM   5256  C  C   . GLU E  1 55  ? -11.669 42.948  0.028   1.00 34.19  ?  55  GLU E C   1 
ATOM   5257  O  O   . GLU E  1 55  ? -11.360 43.299  1.179   1.00 34.19  ?  55  GLU E O   1 
ATOM   5258  C  CB  . GLU E  1 55  ? -11.954 44.992  -1.306  1.00 33.49  ?  55  GLU E CB  1 
ATOM   5259  C  CG  . GLU E  1 55  ? -11.359 45.923  -2.266  1.00 35.03  ?  55  GLU E CG  1 
ATOM   5260  C  CD  . GLU E  1 55  ? -11.800 47.302  -1.984  1.00 37.16  ?  55  GLU E CD  1 
ATOM   5261  O  OE1 . GLU E  1 55  ? -12.971 47.503  -1.609  1.00 40.40  ?  55  GLU E OE1 1 
ATOM   5262  O  OE2 . GLU E  1 55  ? -10.969 48.191  -2.124  1.00 38.51  -1 55  GLU E OE2 1 
ATOM   5263  N  N   . THR E  1 56  ? -12.435 41.894  -0.238  1.00 34.06  ?  56  THR E N   1 
ATOM   5264  C  CA  . THR E  1 56  ? -13.016 41.065  0.795   1.00 33.35  ?  56  THR E CA  1 
ATOM   5265  C  C   . THR E  1 56  ? -12.830 39.622  0.403   1.00 33.54  ?  56  THR E C   1 
ATOM   5266  O  O   . THR E  1 56  ? -12.915 38.725  1.233   1.00 34.48  ?  56  THR E O   1 
ATOM   5267  C  CB  . THR E  1 56  ? -14.503 41.277  0.817   1.00 33.64  ?  56  THR E CB  1 
ATOM   5268  O  OG1 . THR E  1 56  ? -15.062 40.726  -0.387  1.00 32.55  ?  56  THR E OG1 1 
ATOM   5269  C  CG2 . THR E  1 56  ? -14.795 42.749  0.859   1.00 33.54  ?  56  THR E CG2 1 
ATOM   5270  N  N   . GLY E  1 57  ? -12.640 39.383  -0.889  1.00 33.34  ?  57  GLY E N   1 
ATOM   5271  C  CA  . GLY E  1 57  ? -12.381 38.035  -1.373  1.00 32.50  ?  57  GLY E CA  1 
ATOM   5272  C  C   . GLY E  1 57  ? -13.616 37.177  -1.458  1.00 31.80  ?  57  GLY E C   1 
ATOM   5273  O  O   . GLY E  1 57  ? -13.522 36.004  -1.749  1.00 32.14  ?  57  GLY E O   1 
ATOM   5274  N  N   . ILE E  1 58  ? -14.771 37.758  -1.188  1.00 30.94  ?  58  ILE E N   1 
ATOM   5275  C  CA  . ILE E  1 58  ? -16.037 37.128  -1.539  1.00 30.22  ?  58  ILE E CA  1 
ATOM   5276  C  C   . ILE E  1 58  ? -16.315 37.266  -3.019  1.00 29.55  ?  58  ILE E C   1 
ATOM   5277  O  O   . ILE E  1 58  ? -16.063 38.321  -3.628  1.00 29.09  ?  58  ILE E O   1 
ATOM   5278  C  CB  . ILE E  1 58  ? -17.222 37.759  -0.813  1.00 30.41  ?  58  ILE E CB  1 
ATOM   5279  C  CG1 . ILE E  1 58  ? -16.809 38.122  0.620   1.00 29.96  ?  58  ILE E CG1 1 
ATOM   5280  C  CG2 . ILE E  1 58  ? -18.450 36.827  -0.917  1.00 29.71  ?  58  ILE E CG2 1 
ATOM   5281  C  CD1 . ILE E  1 58  ? -17.951 38.481  1.513   1.00 31.32  ?  58  ILE E CD1 1 
ATOM   5282  N  N   . SER E  1 59  ? -16.820 36.180  -3.591  1.00 29.09  ?  59  SER E N   1 
ATOM   5283  C  CA  . SER E  1 59  ? -17.235 36.178  -4.971  1.00 28.85  ?  59  SER E CA  1 
ATOM   5284  C  C   . SER E  1 59  ? -18.743 36.241  -5.014  1.00 29.19  ?  59  SER E C   1 
ATOM   5285  O  O   . SER E  1 59  ? -19.440 35.281  -4.661  1.00 29.32  ?  59  SER E O   1 
ATOM   5286  C  CB  . SER E  1 59  ? -16.738 34.931  -5.687  1.00 28.52  ?  59  SER E CB  1 
ATOM   5287  O  OG  . SER E  1 59  ? -15.334 34.897  -5.637  1.00 28.02  ?  59  SER E OG  1 
ATOM   5288  N  N   . ALA E  1 60  ? -19.258 37.388  -5.434  1.00 29.15  ?  60  ALA E N   1 
ATOM   5289  C  CA  . ALA E  1 60  ? -20.684 37.517  -5.603  1.00 28.77  ?  60  ALA E CA  1 
ATOM   5290  C  C   . ALA E  1 60  ? -20.930 38.498  -6.699  1.00 28.95  ?  60  ALA E C   1 
ATOM   5291  O  O   . ALA E  1 60  ? -20.079 39.357  -6.998  1.00 29.37  ?  60  ALA E O   1 
ATOM   5292  C  CB  . ALA E  1 60  ? -21.346 37.966  -4.314  1.00 28.34  ?  60  ALA E CB  1 
ATOM   5293  N  N   . GLN E  1 61  ? -22.109 38.346  -7.285  1.00 28.58  ?  61  GLN E N   1 
ATOM   5294  C  CA  . GLN E  1 61  ? -22.572 39.144  -8.375  1.00 28.37  ?  61  GLN E CA  1 
ATOM   5295  C  C   . GLN E  1 61  ? -23.596 40.119  -7.809  1.00 27.94  ?  61  GLN E C   1 
ATOM   5296  O  O   . GLN E  1 61  ? -24.459 39.722  -7.031  1.00 28.43  ?  61  GLN E O   1 
ATOM   5297  C  CB  . GLN E  1 61  ? -23.232 38.219  -9.388  1.00 28.33  ?  61  GLN E CB  1 
ATOM   5298  C  CG  . GLN E  1 61  ? -23.226 38.734  -10.804 1.00 31.43  ?  61  GLN E CG  1 
ATOM   5299  C  CD  . GLN E  1 61  ? -21.819 38.868  -11.411 1.00 34.07  ?  61  GLN E CD  1 
ATOM   5300  O  OE1 . GLN E  1 61  ? -21.687 39.322  -12.539 1.00 37.74  ?  61  GLN E OE1 1 
ATOM   5301  N  NE2 . GLN E  1 61  ? -20.782 38.493  -10.665 1.00 32.94  ?  61  GLN E NE2 1 
ATOM   5302  N  N   . PRO E  1 62  ? -23.495 41.403  -8.179  1.00 27.11  ?  62  PRO E N   1 
ATOM   5303  C  CA  . PRO E  1 62  ? -24.445 42.430  -7.806  1.00 26.24  ?  62  PRO E CA  1 
ATOM   5304  C  C   . PRO E  1 62  ? -25.869 42.006  -8.122  1.00 25.47  ?  62  PRO E C   1 
ATOM   5305  O  O   . PRO E  1 62  ? -26.096 41.439  -9.149  1.00 25.88  ?  62  PRO E O   1 
ATOM   5306  C  CB  . PRO E  1 62  ? -24.026 43.596  -8.699  1.00 26.01  ?  62  PRO E CB  1 
ATOM   5307  C  CG  . PRO E  1 62  ? -22.556 43.464  -8.765  1.00 26.45  ?  62  PRO E CG  1 
ATOM   5308  C  CD  . PRO E  1 62  ? -22.313 41.980  -8.843  1.00 27.54  ?  62  PRO E CD  1 
ATOM   5309  N  N   . GLN E  1 63  ? -26.825 42.255  -7.251  1.00 25.04  ?  63  GLN E N   1 
ATOM   5310  C  CA  . GLN E  1 63  ? -28.179 41.835  -7.560  1.00 25.11  ?  63  GLN E CA  1 
ATOM   5311  C  C   . GLN E  1 63  ? -29.017 42.960  -8.130  1.00 24.35  ?  63  GLN E C   1 
ATOM   5312  O  O   . GLN E  1 63  ? -29.836 42.745  -9.045  1.00 23.24  ?  63  GLN E O   1 
ATOM   5313  C  CB  . GLN E  1 63  ? -28.891 41.312  -6.325  1.00 26.17  ?  63  GLN E CB  1 
ATOM   5314  C  CG  . GLN E  1 63  ? -28.498 39.912  -5.851  1.00 27.27  ?  63  GLN E CG  1 
ATOM   5315  C  CD  . GLN E  1 63  ? -28.564 39.821  -4.360  1.00 30.00  ?  63  GLN E CD  1 
ATOM   5316  O  OE1 . GLN E  1 63  ? -27.998 38.925  -3.779  1.00 32.51  ?  63  GLN E OE1 1 
ATOM   5317  N  NE2 . GLN E  1 63  ? -29.239 40.783  -3.717  1.00 32.29  ?  63  GLN E NE2 1 
ATOM   5318  N  N   . HIS E  1 64  ? -28.802 44.149  -7.570  1.00 23.51  ?  64  HIS E N   1 
ATOM   5319  C  CA  . HIS E  1 64  ? -29.612 45.291  -7.864  1.00 22.81  ?  64  HIS E CA  1 
ATOM   5320  C  C   . HIS E  1 64  ? -28.763 46.553  -7.959  1.00 22.46  ?  64  HIS E C   1 
ATOM   5321  O  O   . HIS E  1 64  ? -27.688 46.662  -7.334  1.00 23.45  ?  64  HIS E O   1 
ATOM   5322  C  CB  . HIS E  1 64  ? -30.564 45.515  -6.734  1.00 23.13  ?  64  HIS E CB  1 
ATOM   5323  C  CG  . HIS E  1 64  ? -31.652 44.504  -6.620  1.00 26.24  ?  64  HIS E CG  1 
ATOM   5324  N  ND1 . HIS E  1 64  ? -31.796 43.694  -5.509  1.00 28.70  ?  64  HIS E ND1 1 
ATOM   5325  C  CD2 . HIS E  1 64  ? -32.696 44.222  -7.430  1.00 28.91  ?  64  HIS E CD2 1 
ATOM   5326  C  CE1 . HIS E  1 64  ? -32.869 42.937  -5.652  1.00 29.82  ?  64  HIS E CE1 1 
ATOM   5327  N  NE2 . HIS E  1 64  ? -33.435 43.238  -6.809  1.00 32.66  ?  64  HIS E NE2 1 
ATOM   5328  N  N   . PHE E  1 65  ? -29.264 47.511  -8.727  1.00 20.79  ?  65  PHE E N   1 
ATOM   5329  C  CA  . PHE E  1 65  ? -28.758 48.858  -8.705  1.00 20.44  ?  65  PHE E CA  1 
ATOM   5330  C  C   . PHE E  1 65  ? -29.500 49.670  -7.661  1.00 20.01  ?  65  PHE E C   1 
ATOM   5331  O  O   . PHE E  1 65  ? -30.723 49.588  -7.573  1.00 20.50  ?  65  PHE E O   1 
ATOM   5332  C  CB  . PHE E  1 65  ? -29.018 49.491  -10.058 1.00 20.53  ?  65  PHE E CB  1 
ATOM   5333  C  CG  . PHE E  1 65  ? -28.453 50.855  -10.204 1.00 19.15  ?  65  PHE E CG  1 
ATOM   5334  C  CD1 . PHE E  1 65  ? -27.145 51.123  -9.825  1.00 19.12  ?  65  PHE E CD1 1 
ATOM   5335  C  CD2 . PHE E  1 65  ? -29.215 51.865  -10.744 1.00 17.45  ?  65  PHE E CD2 1 
ATOM   5336  C  CE1 . PHE E  1 65  ? -26.614 52.377  -9.978  1.00 19.90  ?  65  PHE E CE1 1 
ATOM   5337  C  CE2 . PHE E  1 65  ? -28.687 53.113  -10.902 1.00 16.65  ?  65  PHE E CE2 1 
ATOM   5338  C  CZ  . PHE E  1 65  ? -27.393 53.368  -10.525 1.00 20.25  ?  65  PHE E CZ  1 
ATOM   5339  N  N   . ILE E  1 66  ? -28.782 50.475  -6.892  1.00 19.27  ?  66  ILE E N   1 
ATOM   5340  C  CA  . ILE E  1 66  ? -29.436 51.284  -5.865  1.00 18.25  ?  66  ILE E CA  1 
ATOM   5341  C  C   . ILE E  1 66  ? -29.603 52.701  -6.350  1.00 17.77  ?  66  ILE E C   1 
ATOM   5342  O  O   . ILE E  1 66  ? -30.681 53.263  -6.253  1.00 16.91  ?  66  ILE E O   1 
ATOM   5343  C  CB  . ILE E  1 66  ? -28.683 51.263  -4.539  1.00 17.59  ?  66  ILE E CB  1 
ATOM   5344  C  CG1 . ILE E  1 66  ? -28.901 49.929  -3.847  1.00 16.45  ?  66  ILE E CG1 1 
ATOM   5345  C  CG2 . ILE E  1 66  ? -29.247 52.272  -3.600  1.00 19.11  ?  66  ILE E CG2 1 
ATOM   5346  C  CD1 . ILE E  1 66  ? -27.841 49.600  -2.852  1.00 14.81  ?  66  ILE E CD1 1 
ATOM   5347  N  N   . ARG E  1 67  ? -28.537 53.255  -6.912  1.00 18.79  ?  67  ARG E N   1 
ATOM   5348  C  CA  . ARG E  1 67  ? -28.457 54.691  -7.221  1.00 19.17  ?  67  ARG E CA  1 
ATOM   5349  C  C   . ARG E  1 67  ? -27.029 54.897  -7.599  1.00 19.94  ?  67  ARG E C   1 
ATOM   5350  O  O   . ARG E  1 67  ? -26.166 54.077  -7.227  1.00 19.52  ?  67  ARG E O   1 
ATOM   5351  C  CB  . ARG E  1 67  ? -28.620 55.466  -5.959  1.00 18.69  ?  67  ARG E CB  1 
ATOM   5352  C  CG  . ARG E  1 67  ? -29.614 56.490  -6.007  1.00 22.63  ?  67  ARG E CG  1 
ATOM   5353  C  CD  . ARG E  1 67  ? -29.254 57.599  -4.983  1.00 24.08  ?  67  ARG E CD  1 
ATOM   5354  N  NE  . ARG E  1 67  ? -28.322 58.563  -5.550  1.00 21.95  ?  67  ARG E NE  1 
ATOM   5355  C  CZ  . ARG E  1 67  ? -28.401 59.865  -5.351  1.00 24.78  ?  67  ARG E CZ  1 
ATOM   5356  N  NH1 . ARG E  1 67  ? -29.389 60.380  -4.624  1.00 25.48  ?  67  ARG E NH1 1 
ATOM   5357  N  NH2 . ARG E  1 67  ? -27.498 60.654  -5.894  1.00 24.67  ?  67  ARG E NH2 1 
ATOM   5358  N  N   . MET E  1 68  ? -26.772 55.982  -8.329  1.00 20.92  ?  68  MET E N   1 
ATOM   5359  C  CA  . MET E  1 68  ? -25.424 56.492  -8.503  1.00 22.25  ?  68  MET E CA  1 
ATOM   5360  C  C   . MET E  1 68  ? -25.394 57.819  -7.772  1.00 22.66  ?  68  MET E C   1 
ATOM   5361  O  O   . MET E  1 68  ? -26.418 58.467  -7.638  1.00 22.38  ?  68  MET E O   1 
ATOM   5362  C  CB  . MET E  1 68  ? -25.114 56.677  -10.007 1.00 23.15  ?  68  MET E CB  1 
ATOM   5363  C  CG  . MET E  1 68  ? -23.694 57.179  -10.377 1.00 22.69  ?  68  MET E CG  1 
ATOM   5364  S  SD  . MET E  1 68  ? -23.753 58.430  -11.685 1.00 27.06  ?  68  MET E SD  1 
ATOM   5365  C  CE  . MET E  1 68  ? -23.395 59.861  -10.690 1.00 26.15  ?  68  MET E CE  1 
ATOM   5366  N  N   . HIS E  1 69  ? -24.218 58.208  -7.307  1.00 23.78  ?  69  HIS E N   1 
ATOM   5367  C  CA  . HIS E  1 69  ? -24.009 59.484  -6.648  1.00 24.70  ?  69  HIS E CA  1 
ATOM   5368  C  C   . HIS E  1 69  ? -22.904 60.198  -7.366  1.00 25.98  ?  69  HIS E C   1 
ATOM   5369  O  O   . HIS E  1 69  ? -21.800 59.659  -7.488  1.00 26.02  ?  69  HIS E O   1 
ATOM   5370  C  CB  . HIS E  1 69  ? -23.534 59.289  -5.178  1.00 25.22  ?  69  HIS E CB  1 
ATOM   5371  C  CG  . HIS E  1 69  ? -24.605 58.782  -4.269  1.00 23.69  ?  69  HIS E CG  1 
ATOM   5372  N  ND1 . HIS E  1 69  ? -24.788 57.437  -4.015  1.00 21.36  ?  69  HIS E ND1 1 
ATOM   5373  C  CD2 . HIS E  1 69  ? -25.608 59.428  -3.633  1.00 22.05  ?  69  HIS E CD2 1 
ATOM   5374  C  CE1 . HIS E  1 69  ? -25.840 57.279  -3.235  1.00 20.75  ?  69  HIS E CE1 1 
ATOM   5375  N  NE2 . HIS E  1 69  ? -26.360 58.468  -2.994  1.00 22.42  ?  69  HIS E NE2 1 
ATOM   5376  N  N   . GLN E  1 70  ? -23.173 61.426  -7.802  1.00 26.95  ?  70  GLN E N   1 
ATOM   5377  C  CA  . GLN E  1 70  ? -22.112 62.288  -8.312  1.00 27.53  ?  70  GLN E CA  1 
ATOM   5378  C  C   . GLN E  1 70  ? -21.604 63.157  -7.171  1.00 27.45  ?  70  GLN E C   1 
ATOM   5379  O  O   . GLN E  1 70  ? -22.375 63.800  -6.496  1.00 27.12  ?  70  GLN E O   1 
ATOM   5380  C  CB  . GLN E  1 70  ? -22.694 63.131  -9.433  1.00 27.88  ?  70  GLN E CB  1 
ATOM   5381  C  CG  . GLN E  1 70  ? -21.764 64.150  -10.075 1.00 28.27  ?  70  GLN E CG  1 
ATOM   5382  C  CD  . GLN E  1 70  ? -22.490 64.922  -11.201 1.00 31.10  ?  70  GLN E CD  1 
ATOM   5383  O  OE1 . GLN E  1 70  ? -23.776 64.943  -11.309 1.00 28.28  ?  70  GLN E OE1 1 
ATOM   5384  N  NE2 . GLN E  1 70  ? -21.679 65.568  -12.044 1.00 28.65  ?  70  GLN E NE2 1 
ATOM   5385  N  N   . TRP E  1 71  ? -20.305 63.190  -6.966  1.00 28.11  ?  71  TRP E N   1 
ATOM   5386  C  CA  . TRP E  1 71  ? -19.766 63.765  -5.748  1.00 28.60  ?  71  TRP E CA  1 
ATOM   5387  C  C   . TRP E  1 71  ? -18.379 64.233  -5.992  1.00 28.35  ?  71  TRP E C   1 
ATOM   5388  O  O   . TRP E  1 71  ? -17.661 63.579  -6.717  1.00 28.56  ?  71  TRP E O   1 
ATOM   5389  C  CB  . TRP E  1 71  ? -19.701 62.661  -4.713  1.00 29.46  ?  71  TRP E CB  1 
ATOM   5390  C  CG  . TRP E  1 71  ? -19.160 63.042  -3.408  1.00 31.27  ?  71  TRP E CG  1 
ATOM   5391  C  CD1 . TRP E  1 71  ? -19.730 63.895  -2.488  1.00 33.55  ?  71  TRP E CD1 1 
ATOM   5392  C  CD2 . TRP E  1 71  ? -17.946 62.570  -2.817  1.00 33.30  ?  71  TRP E CD2 1 
ATOM   5393  N  NE1 . TRP E  1 71  ? -18.927 63.985  -1.359  1.00 31.88  ?  71  TRP E NE1 1 
ATOM   5394  C  CE2 . TRP E  1 71  ? -17.831 63.182  -1.537  1.00 33.35  ?  71  TRP E CE2 1 
ATOM   5395  C  CE3 . TRP E  1 71  ? -16.947 61.690  -3.235  1.00 35.09  ?  71  TRP E CE3 1 
ATOM   5396  C  CZ2 . TRP E  1 71  ? -16.751 62.936  -0.681  1.00 34.87  ?  71  TRP E CZ2 1 
ATOM   5397  C  CZ3 . TRP E  1 71  ? -15.865 61.450  -2.379  1.00 36.77  ?  71  TRP E CZ3 1 
ATOM   5398  C  CH2 . TRP E  1 71  ? -15.779 62.073  -1.117  1.00 36.20  ?  71  TRP E CH2 1 
ATOM   5399  N  N   . ILE E  1 72  ? -17.982 65.349  -5.391  1.00 28.94  ?  72  ILE E N   1 
ATOM   5400  C  CA  . ILE E  1 72  ? -16.579 65.743  -5.411  1.00 29.25  ?  72  ILE E CA  1 
ATOM   5401  C  C   . ILE E  1 72  ? -15.995 65.568  -4.037  1.00 30.74  ?  72  ILE E C   1 
ATOM   5402  O  O   . ILE E  1 72  ? -16.595 65.967  -3.047  1.00 31.10  ?  72  ILE E O   1 
ATOM   5403  C  CB  . ILE E  1 72  ? -16.385 67.172  -5.872  1.00 28.86  ?  72  ILE E CB  1 
ATOM   5404  C  CG1 . ILE E  1 72  ? -16.992 67.311  -7.265  1.00 30.32  ?  72  ILE E CG1 1 
ATOM   5405  C  CG2 . ILE E  1 72  ? -14.899 67.529  -5.866  1.00 27.04  ?  72  ILE E CG2 1 
ATOM   5406  C  CD1 . ILE E  1 72  ? -17.403 68.696  -7.655  1.00 30.80  ?  72  ILE E CD1 1 
ATOM   5407  N  N   . ALA E  1 73  ? -14.804 64.976  -3.999  1.00 32.80  ?  73  ALA E N   1 
ATOM   5408  C  CA  . ALA E  1 73  ? -14.073 64.670  -2.767  1.00 34.15  ?  73  ALA E CA  1 
ATOM   5409  C  C   . ALA E  1 73  ? -13.524 65.923  -2.102  1.00 35.48  ?  73  ALA E C   1 
ATOM   5410  O  O   . ALA E  1 73  ? -13.401 66.980  -2.726  1.00 35.55  ?  73  ALA E O   1 
ATOM   5411  C  CB  . ALA E  1 73  ? -12.927 63.690  -3.057  1.00 33.83  ?  73  ALA E CB  1 
ATOM   5412  N  N   . PRO E  1 74  ? -13.170 65.810  -0.821  1.00 36.72  ?  74  PRO E N   1 
ATOM   5413  C  CA  . PRO E  1 74  ? -12.556 66.981  -0.237  1.00 37.48  ?  74  PRO E CA  1 
ATOM   5414  C  C   . PRO E  1 74  ? -11.283 67.372  -1.012  1.00 38.11  ?  74  PRO E C   1 
ATOM   5415  O  O   . PRO E  1 74  ? -10.944 68.551  -1.094  1.00 38.84  ?  74  PRO E O   1 
ATOM   5416  C  CB  . PRO E  1 74  ? -12.236 66.531  1.194   1.00 37.35  ?  74  PRO E CB  1 
ATOM   5417  C  CG  . PRO E  1 74  ? -12.305 65.049  1.173   1.00 37.28  ?  74  PRO E CG  1 
ATOM   5418  C  CD  . PRO E  1 74  ? -13.286 64.698  0.136   1.00 36.97  ?  74  PRO E CD  1 
ATOM   5419  N  N   . ASP E  1 75  ? -10.604 66.402  -1.607  1.00 38.38  ?  75  ASP E N   1 
ATOM   5420  C  CA  . ASP E  1 75  ? -9.370  66.704  -2.327  1.00 38.55  ?  75  ASP E CA  1 
ATOM   5421  C  C   . ASP E  1 75  ? -9.596  67.031  -3.809  1.00 38.15  ?  75  ASP E C   1 
ATOM   5422  O  O   . ASP E  1 75  ? -8.668  66.896  -4.622  1.00 38.70  ?  75  ASP E O   1 
ATOM   5423  C  CB  . ASP E  1 75  ? -8.419  65.525  -2.224  1.00 39.15  ?  75  ASP E CB  1 
ATOM   5424  C  CG  . ASP E  1 75  ? -8.615  64.538  -3.339  1.00 39.88  ?  75  ASP E CG  1 
ATOM   5425  O  OD1 . ASP E  1 75  ? -9.773  64.236  -3.732  1.00 41.77  ?  75  ASP E OD1 1 
ATOM   5426  O  OD2 . ASP E  1 75  ? -7.585  64.091  -3.845  1.00 42.24  -1 75  ASP E OD2 1 
ATOM   5427  N  N   . LYS E  1 76  ? -10.826 67.425  -4.155  1.00 36.83  ?  76  LYS E N   1 
ATOM   5428  C  CA  . LYS E  1 76  ? -11.185 67.979  -5.489  1.00 35.90  ?  76  LYS E CA  1 
ATOM   5429  C  C   . LYS E  1 76  ? -11.355 66.911  -6.605  1.00 34.52  ?  76  LYS E C   1 
ATOM   5430  O  O   . LYS E  1 76  ? -11.845 67.222  -7.698  1.00 33.82  ?  76  LYS E O   1 
ATOM   5431  C  CB  . LYS E  1 76  ? -10.267 69.148  -5.913  1.00 36.04  ?  76  LYS E CB  1 
ATOM   5432  C  CG  . LYS E  1 76  ? -9.993  70.195  -4.785  1.00 39.33  ?  76  LYS E CG  1 
ATOM   5433  C  CD  . LYS E  1 76  ? -10.575 71.620  -5.013  1.00 42.72  ?  76  LYS E CD  1 
ATOM   5434  C  CE  . LYS E  1 76  ? -11.859 71.900  -4.218  1.00 42.75  ?  76  LYS E CE  1 
ATOM   5435  N  NZ  . LYS E  1 76  ? -13.100 72.079  -5.105  1.00 44.94  ?  76  LYS E NZ  1 
ATOM   5436  N  N   . THR E  1 77  ? -11.005 65.657  -6.301  1.00 32.82  ?  77  THR E N   1 
ATOM   5437  C  CA  . THR E  1 77  ? -11.260 64.537  -7.216  1.00 31.11  ?  77  THR E CA  1 
ATOM   5438  C  C   . THR E  1 77  ? -12.753 64.350  -7.377  1.00 29.41  ?  77  THR E C   1 
ATOM   5439  O  O   . THR E  1 77  ? -13.465 64.159  -6.408  1.00 29.80  ?  77  THR E O   1 
ATOM   5440  C  CB  . THR E  1 77  ? -10.672 63.192  -6.718  1.00 31.38  ?  77  THR E CB  1 
ATOM   5441  O  OG1 . THR E  1 77  ? -9.266  63.323  -6.474  1.00 29.98  ?  77  THR E OG1 1 
ATOM   5442  C  CG2 . THR E  1 77  ? -10.906 62.108  -7.749  1.00 31.46  ?  77  THR E CG2 1 
ATOM   5443  N  N   . PRO E  1 78  ? -13.231 64.442  -8.606  1.00 27.85  ?  78  PRO E N   1 
ATOM   5444  C  CA  . PRO E  1 78  ? -14.621 64.248  -8.922  1.00 27.40  ?  78  PRO E CA  1 
ATOM   5445  C  C   . PRO E  1 78  ? -14.910 62.764  -9.211  1.00 27.16  ?  78  PRO E C   1 
ATOM   5446  O  O   . PRO E  1 78  ? -14.018 62.030  -9.663  1.00 26.88  ?  78  PRO E O   1 
ATOM   5447  C  CB  . PRO E  1 78  ? -14.770 65.076  -10.178 1.00 27.46  ?  78  PRO E CB  1 
ATOM   5448  C  CG  . PRO E  1 78  ? -13.459 64.839  -10.867 1.00 27.19  ?  78  PRO E CG  1 
ATOM   5449  C  CD  . PRO E  1 78  ? -12.456 64.867  -9.778  1.00 27.32  ?  78  PRO E CD  1 
ATOM   5450  N  N   . PHE E  1 79  ? -16.144 62.342  -8.934  1.00 26.78  ?  79  PHE E N   1 
ATOM   5451  C  CA  . PHE E  1 79  ? -16.490 60.924  -8.873  1.00 26.60  ?  79  PHE E CA  1 
ATOM   5452  C  C   . PHE E  1 79  ? -17.896 60.714  -9.295  1.00 26.76  ?  79  PHE E C   1 
ATOM   5453  O  O   . PHE E  1 79  ? -18.774 61.508  -8.923  1.00 28.09  ?  79  PHE E O   1 
ATOM   5454  C  CB  . PHE E  1 79  ? -16.445 60.434  -7.457  1.00 26.25  ?  79  PHE E CB  1 
ATOM   5455  C  CG  . PHE E  1 79  ? -15.091 60.080  -6.977  1.00 28.00  ?  79  PHE E CG  1 
ATOM   5456  C  CD1 . PHE E  1 79  ? -14.538 58.829  -7.269  1.00 27.84  ?  79  PHE E CD1 1 
ATOM   5457  C  CD2 . PHE E  1 79  ? -14.365 60.975  -6.176  1.00 28.60  ?  79  PHE E CD2 1 
ATOM   5458  C  CE1 . PHE E  1 79  ? -13.269 58.483  -6.766  1.00 27.30  ?  79  PHE E CE1 1 
ATOM   5459  C  CE2 . PHE E  1 79  ? -13.093 60.630  -5.669  1.00 27.32  ?  79  PHE E CE2 1 
ATOM   5460  C  CZ  . PHE E  1 79  ? -12.547 59.392  -5.960  1.00 25.50  ?  79  PHE E CZ  1 
ATOM   5461  N  N   . LEU E  1 80  ? -18.111 59.664  -10.083 1.00 26.33  ?  80  LEU E N   1 
ATOM   5462  C  CA  . LEU E  1 80  ? -19.432 59.062  -10.276 1.00 25.47  ?  80  LEU E CA  1 
ATOM   5463  C  C   . LEU E  1 80  ? -19.348 57.690  -9.634  1.00 25.34  ?  80  LEU E C   1 
ATOM   5464  O  O   . LEU E  1 80  ? -18.485 56.838  -9.992  1.00 24.77  ?  80  LEU E O   1 
ATOM   5465  C  CB  . LEU E  1 80  ? -19.728 58.890  -11.749 1.00 25.71  ?  80  LEU E CB  1 
ATOM   5466  C  CG  . LEU E  1 80  ? -20.485 59.907  -12.591 1.00 25.55  ?  80  LEU E CG  1 
ATOM   5467  C  CD1 . LEU E  1 80  ? -20.224 61.333  -12.204 1.00 26.30  ?  80  LEU E CD1 1 
ATOM   5468  C  CD2 . LEU E  1 80  ? -20.158 59.667  -14.075 1.00 24.24  ?  80  LEU E CD2 1 
ATOM   5469  N  N   . ARG E  1 81  ? -20.215 57.482  -8.652  1.00 24.52  ?  81  ARG E N   1 
ATOM   5470  C  CA  . ARG E  1 81  ? -20.084 56.323  -7.784  1.00 22.93  ?  81  ARG E CA  1 
ATOM   5471  C  C   . ARG E  1 81  ? -21.346 55.535  -7.873  1.00 22.00  ?  81  ARG E C   1 
ATOM   5472  O  O   . ARG E  1 81  ? -22.391 55.937  -7.344  1.00 22.28  ?  81  ARG E O   1 
ATOM   5473  C  CB  . ARG E  1 81  ? -19.820 56.736  -6.342  1.00 23.22  ?  81  ARG E CB  1 
ATOM   5474  C  CG  . ARG E  1 81  ? -19.229 55.595  -5.457  1.00 22.36  ?  81  ARG E CG  1 
ATOM   5475  C  CD  . ARG E  1 81  ? -19.736 55.744  -4.069  1.00 16.18  ?  81  ARG E CD  1 
ATOM   5476  N  NE  . ARG E  1 81  ? -18.985 55.111  -3.004  1.00 15.59  ?  81  ARG E NE  1 
ATOM   5477  C  CZ  . ARG E  1 81  ? -19.638 54.546  -1.977  1.00 19.38  ?  81  ARG E CZ  1 
ATOM   5478  N  NH1 . ARG E  1 81  ? -20.966 54.522  -2.001  1.00 14.93  ?  81  ARG E NH1 1 
ATOM   5479  N  NH2 . ARG E  1 81  ? -19.009 53.983  -0.951  1.00 20.20  ?  81  ARG E NH2 1 
ATOM   5480  N  N   . PHE E  1 82  ? -21.247 54.426  -8.592  1.00 20.63  ?  82  PHE E N   1 
ATOM   5481  C  CA  . PHE E  1 82  ? -22.391 53.584  -8.840  1.00 19.71  ?  82  PHE E CA  1 
ATOM   5482  C  C   . PHE E  1 82  ? -22.554 52.646  -7.663  1.00 19.19  ?  82  PHE E C   1 
ATOM   5483  O  O   . PHE E  1 82  ? -21.588 52.028  -7.248  1.00 19.22  ?  82  PHE E O   1 
ATOM   5484  C  CB  . PHE E  1 82  ? -22.147 52.813  -10.125 1.00 19.71  ?  82  PHE E CB  1 
ATOM   5485  C  CG  . PHE E  1 82  ? -22.152 53.675  -11.345 1.00 17.83  ?  82  PHE E CG  1 
ATOM   5486  C  CD1 . PHE E  1 82  ? -21.024 54.376  -11.716 1.00 16.78  ?  82  PHE E CD1 1 
ATOM   5487  C  CD2 . PHE E  1 82  ? -23.306 53.791  -12.120 1.00 18.51  ?  82  PHE E CD2 1 
ATOM   5488  C  CE1 . PHE E  1 82  ? -21.041 55.167  -12.867 1.00 17.78  ?  82  PHE E CE1 1 
ATOM   5489  C  CE2 . PHE E  1 82  ? -23.341 54.585  -13.250 1.00 16.73  ?  82  PHE E CE2 1 
ATOM   5490  C  CZ  . PHE E  1 82  ? -22.216 55.264  -13.634 1.00 17.69  ?  82  PHE E CZ  1 
ATOM   5491  N  N   . LEU E  1 83  ? -23.758 52.565  -7.110  1.00 18.39  ?  83  LEU E N   1 
ATOM   5492  C  CA  . LEU E  1 83  ? -23.998 51.749  -5.921  1.00 17.91  ?  83  LEU E CA  1 
ATOM   5493  C  C   . LEU E  1 83  ? -24.914 50.534  -6.134  1.00 18.54  ?  83  LEU E C   1 
ATOM   5494  O  O   . LEU E  1 83  ? -26.074 50.667  -6.589  1.00 17.51  ?  83  LEU E O   1 
ATOM   5495  C  CB  . LEU E  1 83  ? -24.570 52.627  -4.800  1.00 17.74  ?  83  LEU E CB  1 
ATOM   5496  C  CG  . LEU E  1 83  ? -24.654 52.020  -3.389  1.00 15.99  ?  83  LEU E CG  1 
ATOM   5497  C  CD1 . LEU E  1 83  ? -23.319 51.926  -2.662  1.00 10.80  ?  83  LEU E CD1 1 
ATOM   5498  C  CD2 . LEU E  1 83  ? -25.617 52.829  -2.591  1.00 16.73  ?  83  LEU E CD2 1 
ATOM   5499  N  N   . PHE E  1 84  ? -24.410 49.355  -5.762  1.00 19.47  ?  84  PHE E N   1 
ATOM   5500  C  CA  . PHE E  1 84  ? -25.212 48.108  -5.915  1.00 20.35  ?  84  PHE E CA  1 
ATOM   5501  C  C   . PHE E  1 84  ? -25.553 47.419  -4.593  1.00 20.65  ?  84  PHE E C   1 
ATOM   5502  O  O   . PHE E  1 84  ? -24.845 47.584  -3.589  1.00 20.33  ?  84  PHE E O   1 
ATOM   5503  C  CB  . PHE E  1 84  ? -24.536 47.099  -6.838  1.00 20.27  ?  84  PHE E CB  1 
ATOM   5504  C  CG  . PHE E  1 84  ? -24.113 47.655  -8.118  1.00 20.01  ?  84  PHE E CG  1 
ATOM   5505  C  CD1 . PHE E  1 84  ? -22.858 48.222  -8.251  1.00 24.11  ?  84  PHE E CD1 1 
ATOM   5506  C  CD2 . PHE E  1 84  ? -24.952 47.651  -9.187  1.00 21.71  ?  84  PHE E CD2 1 
ATOM   5507  C  CE1 . PHE E  1 84  ? -22.441 48.781  -9.452  1.00 22.70  ?  84  PHE E CE1 1 
ATOM   5508  C  CE2 . PHE E  1 84  ? -24.546 48.208  -10.403 1.00 22.16  ?  84  PHE E CE2 1 
ATOM   5509  C  CZ  . PHE E  1 84  ? -23.284 48.765  -10.527 1.00 20.92  ?  84  PHE E CZ  1 
ATOM   5510  N  N   . ALA E  1 85  ? -26.629 46.625  -4.628  1.00 21.50  ?  85  ALA E N   1 
ATOM   5511  C  CA  . ALA E  1 85  ? -27.111 45.854  -3.468  1.00 22.10  ?  85  ALA E CA  1 
ATOM   5512  C  C   . ALA E  1 85  ? -26.796 44.392  -3.669  1.00 22.80  ?  85  ALA E C   1 
ATOM   5513  O  O   . ALA E  1 85  ? -27.051 43.864  -4.743  1.00 23.66  ?  85  ALA E O   1 
ATOM   5514  C  CB  . ALA E  1 85  ? -28.621 46.030  -3.334  1.00 20.96  ?  85  ALA E CB  1 
ATOM   5515  N  N   . ILE E  1 86  ? -26.244 43.731  -2.659  1.00 24.37  ?  86  ILE E N   1 
ATOM   5516  C  CA  . ILE E  1 86  ? -26.176 42.258  -2.675  1.00 25.60  ?  86  ILE E CA  1 
ATOM   5517  C  C   . ILE E  1 86  ? -26.618 41.658  -1.349  1.00 26.62  ?  86  ILE E C   1 
ATOM   5518  O  O   . ILE E  1 86  ? -26.034 41.963  -0.290  1.00 26.87  ?  86  ILE E O   1 
ATOM   5519  C  CB  . ILE E  1 86  ? -24.765 41.676  -3.010  1.00 25.42  ?  86  ILE E CB  1 
ATOM   5520  C  CG1 . ILE E  1 86  ? -24.196 42.235  -4.275  1.00 24.01  ?  86  ILE E CG1 1 
ATOM   5521  C  CG2 . ILE E  1 86  ? -24.852 40.172  -3.274  1.00 25.12  ?  86  ILE E CG2 1 
ATOM   5522  C  CD1 . ILE E  1 86  ? -22.728 41.833  -4.460  1.00 24.65  ?  86  ILE E CD1 1 
ATOM   5523  N  N   . GLU E  1 87  ? -27.635 40.803  -1.432  1.00 28.09  ?  87  GLU E N   1 
ATOM   5524  C  CA  . GLU E  1 87  ? -28.083 39.969  -0.312  1.00 30.53  ?  87  GLU E CA  1 
ATOM   5525  C  C   . GLU E  1 87  ? -27.347 38.619  -0.319  1.00 31.23  ?  87  GLU E C   1 
ATOM   5526  O  O   . GLU E  1 87  ? -27.482 37.839  -1.252  1.00 31.26  ?  87  GLU E O   1 
ATOM   5527  C  CB  . GLU E  1 87  ? -29.559 39.637  -0.453  1.00 30.80  ?  87  GLU E CB  1 
ATOM   5528  C  CG  . GLU E  1 87  ? -30.529 40.765  -0.338  1.00 33.68  ?  87  GLU E CG  1 
ATOM   5529  C  CD  . GLU E  1 87  ? -30.369 41.589  0.923   1.00 37.83  ?  87  GLU E CD  1 
ATOM   5530  O  OE1 . GLU E  1 87  ? -30.456 42.844  0.748   1.00 39.04  ?  87  GLU E OE1 1 
ATOM   5531  O  OE2 . GLU E  1 87  ? -30.158 41.002  2.040   1.00 36.19  -1 87  GLU E OE2 1 
ATOM   5532  N  N   . LEU E  1 88  ? -26.576 38.335  0.714   1.00 32.37  ?  88  LEU E N   1 
ATOM   5533  C  CA  . LEU E  1 88  ? -26.012 37.002  0.852   1.00 33.02  ?  88  LEU E CA  1 
ATOM   5534  C  C   . LEU E  1 88  ? -26.862 36.184  1.813   1.00 34.39  ?  88  LEU E C   1 
ATOM   5535  O  O   . LEU E  1 88  ? -27.538 36.750  2.690   1.00 33.72  ?  88  LEU E O   1 
ATOM   5536  C  CB  . LEU E  1 88  ? -24.599 37.087  1.371   1.00 32.28  ?  88  LEU E CB  1 
ATOM   5537  C  CG  . LEU E  1 88  ? -23.654 37.853  0.472   1.00 30.53  ?  88  LEU E CG  1 
ATOM   5538  C  CD1 . LEU E  1 88  ? -22.357 37.921  1.176   1.00 31.20  ?  88  LEU E CD1 1 
ATOM   5539  C  CD2 . LEU E  1 88  ? -23.511 37.163  -0.860  1.00 28.88  ?  88  LEU E CD2 1 
ATOM   5540  N  N   . GLU E  1 89  ? -26.808 34.862  1.641   1.00 36.28  ?  89  GLU E N   1 
ATOM   5541  C  CA  . GLU E  1 89  ? -27.566 33.917  2.471   1.00 38.54  ?  89  GLU E CA  1 
ATOM   5542  C  C   . GLU E  1 89  ? -27.042 33.853  3.890   1.00 39.41  ?  89  GLU E C   1 
ATOM   5543  O  O   . GLU E  1 89  ? -27.827 33.711  4.823   1.00 39.44  ?  89  GLU E O   1 
ATOM   5544  C  CB  . GLU E  1 89  ? -27.535 32.522  1.869   1.00 38.91  ?  89  GLU E CB  1 
ATOM   5545  C  CG  . GLU E  1 89  ? -28.095 32.459  0.450   1.00 42.17  ?  89  GLU E CG  1 
ATOM   5546  C  CD  . GLU E  1 89  ? -28.131 31.038  -0.081  1.00 47.77  ?  89  GLU E CD  1 
ATOM   5547  O  OE1 . GLU E  1 89  ? -28.626 30.133  0.667   1.00 48.59  ?  89  GLU E OE1 1 
ATOM   5548  O  OE2 . GLU E  1 89  ? -27.654 30.842  -1.235  1.00 47.69  -1 89  GLU E OE2 1 
ATOM   5549  N  N   . GLN E  1 90  ? -25.719 33.964  4.045   1.00 40.45  ?  90  GLN E N   1 
ATOM   5550  C  CA  . GLN E  1 90  ? -25.117 34.015  5.358   1.00 41.32  ?  90  GLN E CA  1 
ATOM   5551  C  C   . GLN E  1 90  ? -23.755 34.614  5.323   1.00 41.81  ?  90  GLN E C   1 
ATOM   5552  O  O   . GLN E  1 90  ? -23.059 34.523  4.313   1.00 42.12  ?  90  GLN E O   1 
ATOM   5553  C  CB  . GLN E  1 90  ? -25.064 32.637  5.992   1.00 41.88  ?  90  GLN E CB  1 
ATOM   5554  C  CG  . GLN E  1 90  ? -24.205 31.601  5.288   1.00 44.36  ?  90  GLN E CG  1 
ATOM   5555  C  CD  . GLN E  1 90  ? -24.150 30.271  6.065   1.00 47.89  ?  90  GLN E CD  1 
ATOM   5556  O  OE1 . GLN E  1 90  ? -23.096 29.884  6.586   1.00 50.17  ?  90  GLN E OE1 1 
ATOM   5557  N  NE2 . GLN E  1 90  ? -25.296 29.584  6.161   1.00 48.13  ?  90  GLN E NE2 1 
ATOM   5558  N  N   . ILE E  1 91  ? -23.392 35.238  6.441   1.00 42.71  ?  91  ILE E N   1 
ATOM   5559  C  CA  . ILE E  1 91  ? -22.121 35.933  6.612   1.00 43.75  ?  91  ILE E CA  1 
ATOM   5560  C  C   . ILE E  1 91  ? -20.985 34.936  6.451   1.00 45.28  ?  91  ILE E C   1 
ATOM   5561  O  O   . ILE E  1 91  ? -21.062 33.833  6.952   1.00 45.57  ?  91  ILE E O   1 
ATOM   5562  C  CB  . ILE E  1 91  ? -22.038 36.588  8.004   1.00 43.19  ?  91  ILE E CB  1 
ATOM   5563  C  CG1 . ILE E  1 91  ? -23.029 37.729  8.122   1.00 43.27  ?  91  ILE E CG1 1 
ATOM   5564  C  CG2 . ILE E  1 91  ? -20.674 37.193  8.251   1.00 43.40  ?  91  ILE E CG2 1 
ATOM   5565  C  CD1 . ILE E  1 91  ? -23.486 37.981  9.538   1.00 43.60  ?  91  ILE E CD1 1 
ATOM   5566  N  N   . CYS E  1 92  ? -19.926 35.316  5.752   1.00 47.58  ?  92  CYS E N   1 
ATOM   5567  C  CA  . CYS E  1 92  ? -18.831 34.378  5.515   1.00 49.75  ?  92  CYS E CA  1 
ATOM   5568  C  C   . CYS E  1 92  ? -17.426 34.950  5.758   1.00 50.72  ?  92  CYS E C   1 
ATOM   5569  O  O   . CYS E  1 92  ? -17.185 36.139  5.505   1.00 50.45  ?  92  CYS E O   1 
ATOM   5570  C  CB  . CYS E  1 92  ? -18.942 33.807  4.096   1.00 50.15  ?  92  CYS E CB  1 
ATOM   5571  S  SG  . CYS E  1 92  ? -19.406 35.033  2.851   1.00 51.72  ?  92  CYS E SG  1 
ATOM   5572  N  N   . PRO E  1 93  ? -16.505 34.100  6.274   1.00 51.99  ?  93  PRO E N   1 
ATOM   5573  C  CA  . PRO E  1 93  ? -15.069 34.405  6.313   1.00 52.70  ?  93  PRO E CA  1 
ATOM   5574  C  C   . PRO E  1 93  ? -14.613 35.154  5.073   1.00 53.44  ?  93  PRO E C   1 
ATOM   5575  O  O   . PRO E  1 93  ? -14.921 34.765  3.941   1.00 53.60  ?  93  PRO E O   1 
ATOM   5576  C  CB  . PRO E  1 93  ? -14.432 33.025  6.398   1.00 52.56  ?  93  PRO E CB  1 
ATOM   5577  C  CG  . PRO E  1 93  ? -15.438 32.233  7.296   1.00 52.80  ?  93  PRO E CG  1 
ATOM   5578  C  CD  . PRO E  1 93  ? -16.815 32.909  7.100   1.00 52.32  ?  93  PRO E CD  1 
ATOM   5579  N  N   . THR E  1 94  ? -13.923 36.259  5.317   1.00 54.16  ?  94  THR E N   1 
ATOM   5580  C  CA  . THR E  1 94  ? -13.634 37.251  4.297   1.00 54.86  ?  94  THR E CA  1 
ATOM   5581  C  C   . THR E  1 94  ? -12.117 37.345  4.186   1.00 55.28  ?  94  THR E C   1 
ATOM   5582  O  O   . THR E  1 94  ? -11.422 37.156  5.168   1.00 55.25  ?  94  THR E O   1 
ATOM   5583  C  CB  . THR E  1 94  ? -14.299 38.640  4.673   1.00 55.19  ?  94  THR E CB  1 
ATOM   5584  O  OG1 . THR E  1 94  ? -13.375 39.500  5.364   1.00 54.34  ?  94  THR E OG1 1 
ATOM   5585  C  CG2 . THR E  1 94  ? -15.550 38.429  5.562   1.00 54.98  ?  94  THR E CG2 1 
ATOM   5586  N  N   . GLN E  1 95  ? -11.594 37.609  2.998   1.00 56.08  ?  95  GLN E N   1 
ATOM   5587  C  CA  . GLN E  1 95  ? -10.144 37.597  2.806   1.00 57.08  ?  95  GLN E CA  1 
ATOM   5588  C  C   . GLN E  1 95  ? -9.701  38.566  1.722   1.00 57.12  ?  95  GLN E C   1 
ATOM   5589  O  O   . GLN E  1 95  ? -9.817  38.261  0.525   1.00 56.87  ?  95  GLN E O   1 
ATOM   5590  C  CB  . GLN E  1 95  ? -9.668  36.182  2.468   1.00 57.31  ?  95  GLN E CB  1 
ATOM   5591  C  CG  . GLN E  1 95  ? -8.153  35.980  2.472   1.00 59.44  ?  95  GLN E CG  1 
ATOM   5592  C  CD  . GLN E  1 95  ? -7.770  34.582  1.959   1.00 62.24  ?  95  GLN E CD  1 
ATOM   5593  O  OE1 . GLN E  1 95  ? -7.300  34.430  0.817   1.00 63.37  ?  95  GLN E OE1 1 
ATOM   5594  N  NE2 . GLN E  1 95  ? -7.992  33.555  2.794   1.00 61.73  ?  95  GLN E NE2 1 
ATOM   5595  N  N   . PRO E  1 96  ? -9.176  39.735  2.135   1.00 57.27  ?  96  PRO E N   1 
ATOM   5596  C  CA  . PRO E  1 96  ? -8.693  40.695  1.142   1.00 57.50  ?  96  PRO E CA  1 
ATOM   5597  C  C   . PRO E  1 96  ? -7.637  40.050  0.233   1.00 57.89  ?  96  PRO E C   1 
ATOM   5598  O  O   . PRO E  1 96  ? -7.096  38.985  0.576   1.00 57.51  ?  96  PRO E O   1 
ATOM   5599  C  CB  . PRO E  1 96  ? -8.076  41.813  1.995   1.00 57.23  ?  96  PRO E CB  1 
ATOM   5600  C  CG  . PRO E  1 96  ? -8.716  41.676  3.327   1.00 56.90  ?  96  PRO E CG  1 
ATOM   5601  C  CD  . PRO E  1 96  ? -9.034  40.231  3.517   1.00 57.13  ?  96  PRO E CD  1 
ATOM   5602  N  N   . HIS E  1 97  ? -7.389  40.680  -0.919  1.00 58.25  ?  97  HIS E N   1 
ATOM   5603  C  CA  . HIS E  1 97  ? -6.316  40.290  -1.838  1.00 58.57  ?  97  HIS E CA  1 
ATOM   5604  C  C   . HIS E  1 97  ? -5.562  41.543  -2.257  1.00 59.08  ?  97  HIS E C   1 
ATOM   5605  O  O   . HIS E  1 97  ? -4.391  41.475  -2.602  1.00 59.65  ?  97  HIS E O   1 
ATOM   5606  C  CB  . HIS E  1 97  ? -6.852  39.529  -3.058  1.00 58.37  ?  97  HIS E CB  1 
ATOM   5607  C  CG  . HIS E  1 97  ? -7.442  38.198  -2.723  1.00 58.07  ?  97  HIS E CG  1 
ATOM   5608  N  ND1 . HIS E  1 97  ? -6.694  37.044  -2.670  1.00 59.75  ?  97  HIS E ND1 1 
ATOM   5609  C  CD2 . HIS E  1 97  ? -8.704  37.839  -2.387  1.00 58.69  ?  97  HIS E CD2 1 
ATOM   5610  C  CE1 . HIS E  1 97  ? -7.471  36.028  -2.328  1.00 59.82  ?  97  HIS E CE1 1 
ATOM   5611  N  NE2 . HIS E  1 97  ? -8.697  36.484  -2.152  1.00 57.99  ?  97  HIS E NE2 1 
ATOM   5612  N  N   . ASP E  1 98  ? -6.232  42.690  -2.223  1.00 59.25  ?  98  ASP E N   1 
ATOM   5613  C  CA  . ASP E  1 98  ? -5.545  43.966  -2.390  1.00 59.54  ?  98  ASP E CA  1 
ATOM   5614  C  C   . ASP E  1 98  ? -4.847  44.277  -1.067  1.00 59.59  ?  98  ASP E C   1 
ATOM   5615  O  O   . ASP E  1 98  ? -5.492  44.583  -0.064  1.00 59.45  ?  98  ASP E O   1 
ATOM   5616  C  CB  . ASP E  1 98  ? -6.531  45.078  -2.815  1.00 59.69  ?  98  ASP E CB  1 
ATOM   5617  C  CG  . ASP E  1 98  ? -5.868  46.206  -3.620  1.00 60.37  ?  98  ASP E CG  1 
ATOM   5618  O  OD1 . ASP E  1 98  ? -5.132  46.999  -3.008  1.00 62.62  ?  98  ASP E OD1 1 
ATOM   5619  O  OD2 . ASP E  1 98  ? -6.094  46.321  -4.853  1.00 60.42  -1 98  ASP E OD2 1 
ATOM   5620  N  N   . SER E  1 99  ? -3.523  44.158  -1.068  1.00 59.89  ?  99  SER E N   1 
ATOM   5621  C  CA  . SER E  1 99  ? -2.692  44.421  0.114   1.00 59.85  ?  99  SER E CA  1 
ATOM   5622  C  C   . SER E  1 99  ? -2.979  45.767  0.816   1.00 59.92  ?  99  SER E C   1 
ATOM   5623  O  O   . SER E  1 99  ? -2.547  45.965  1.960   1.00 59.94  ?  99  SER E O   1 
ATOM   5624  C  CB  . SER E  1 99  ? -1.210  44.368  -0.265  1.00 60.13  ?  99  SER E CB  1 
ATOM   5625  O  OG  . SER E  1 99  ? -0.729  45.670  -0.597  1.00 59.83  ?  99  SER E OG  1 
ATOM   5626  N  N   . ASP E  1 100 ? -3.675  46.685  0.134   1.00 59.38  ?  100 ASP E N   1 
ATOM   5627  C  CA  . ASP E  1 100 ? -4.120  47.965  0.736   1.00 59.15  ?  100 ASP E CA  1 
ATOM   5628  C  C   . ASP E  1 100 ? -5.211  47.864  1.822   1.00 58.52  ?  100 ASP E C   1 
ATOM   5629  O  O   . ASP E  1 100 ? -5.455  48.829  2.556   1.00 58.67  ?  100 ASP E O   1 
ATOM   5630  C  CB  . ASP E  1 100 ? -4.627  48.915  -0.349  1.00 59.45  ?  100 ASP E CB  1 
ATOM   5631  C  CG  . ASP E  1 100 ? -3.534  49.362  -1.281  1.00 61.00  ?  100 ASP E CG  1 
ATOM   5632  O  OD1 . ASP E  1 100 ? -3.865  49.704  -2.442  1.00 61.38  ?  100 ASP E OD1 1 
ATOM   5633  O  OD2 . ASP E  1 100 ? -2.349  49.371  -0.849  1.00 62.88  -1 100 ASP E OD2 1 
ATOM   5634  N  N   . ILE E  1 101 ? -5.867  46.709  1.895   1.00 57.39  ?  101 ILE E N   1 
ATOM   5635  C  CA  . ILE E  1 101 ? -7.033  46.510  2.730   1.00 56.05  ?  101 ILE E CA  1 
ATOM   5636  C  C   . ILE E  1 101 ? -6.588  45.796  3.997   1.00 56.05  ?  101 ILE E C   1 
ATOM   5637  O  O   . ILE E  1 101 ? -6.156  44.647  3.964   1.00 56.17  ?  101 ILE E O   1 
ATOM   5638  C  CB  . ILE E  1 101 ? -8.123  45.682  1.964   1.00 55.85  ?  101 ILE E CB  1 
ATOM   5639  C  CG1 . ILE E  1 101 ? -8.517  46.364  0.642   1.00 54.28  ?  101 ILE E CG1 1 
ATOM   5640  C  CG2 . ILE E  1 101 ? -9.328  45.375  2.846   1.00 54.92  ?  101 ILE E CG2 1 
ATOM   5641  C  CD1 . ILE E  1 101 ? -9.114  47.781  0.751   1.00 52.15  ?  101 ILE E CD1 1 
ATOM   5642  N  N   . ASP E  1 102 ? -6.704  46.484  5.121   1.00 55.65  ?  102 ASP E N   1 
ATOM   5643  C  CA  . ASP E  1 102 ? -6.247  45.953  6.395   1.00 55.30  ?  102 ASP E CA  1 
ATOM   5644  C  C   . ASP E  1 102 ? -7.072  44.744  6.906   1.00 54.76  ?  102 ASP E C   1 
ATOM   5645  O  O   . ASP E  1 102 ? -6.495  43.776  7.423   1.00 55.31  ?  102 ASP E O   1 
ATOM   5646  C  CB  . ASP E  1 102 ? -6.156  47.098  7.414   1.00 55.72  ?  102 ASP E CB  1 
ATOM   5647  C  CG  . ASP E  1 102 ? -5.487  48.376  6.825   1.00 56.74  ?  102 ASP E CG  1 
ATOM   5648  O  OD1 . ASP E  1 102 ? -4.818  48.295  5.759   1.00 55.74  ?  102 ASP E OD1 1 
ATOM   5649  O  OD2 . ASP E  1 102 ? -5.642  49.470  7.432   1.00 57.66  -1 102 ASP E OD2 1 
ATOM   5650  N  N   . CYS E  1 103 ? -8.398  44.785  6.743   1.00 53.65  ?  103 CYS E N   1 
ATOM   5651  C  CA  . CYS E  1 103 ? -9.302  43.658  7.089   1.00 52.30  ?  103 CYS E CA  1 
ATOM   5652  C  C   . CYS E  1 103 ? -10.736 43.973  6.685   1.00 51.09  ?  103 CYS E C   1 
ATOM   5653  O  O   . CYS E  1 103 ? -11.010 45.023  6.097   1.00 51.08  ?  103 CYS E O   1 
ATOM   5654  C  CB  . CYS E  1 103 ? -9.272  43.363  8.592   1.00 52.69  ?  103 CYS E CB  1 
ATOM   5655  S  SG  . CYS E  1 103 ? -9.605  44.830  9.658   1.00 53.96  ?  103 CYS E SG  1 
ATOM   5656  N  N   . CYS E  1 104 ? -11.661 43.075  7.007   1.00 49.57  ?  104 CYS E N   1 
ATOM   5657  C  CA  . CYS E  1 104 ? -13.085 43.357  6.809   1.00 48.41  ?  104 CYS E CA  1 
ATOM   5658  C  C   . CYS E  1 104 ? -13.857 43.090  8.068   1.00 47.08  ?  104 CYS E C   1 
ATOM   5659  O  O   . CYS E  1 104 ? -13.443 42.270  8.880   1.00 46.86  ?  104 CYS E O   1 
ATOM   5660  C  CB  . CYS E  1 104 ? -13.662 42.481  5.716   1.00 48.43  ?  104 CYS E CB  1 
ATOM   5661  S  SG  . CYS E  1 104 ? -12.625 42.435  4.315   1.00 51.25  ?  104 CYS E SG  1 
ATOM   5662  N  N   . ARG E  1 105 ? -14.982 43.779  8.232   1.00 45.47  ?  105 ARG E N   1 
ATOM   5663  C  CA  . ARG E  1 105 ? -15.895 43.474  9.324   1.00 44.13  ?  105 ARG E CA  1 
ATOM   5664  C  C   . ARG E  1 105 ? -17.344 43.536  8.896   1.00 43.07  ?  105 ARG E C   1 
ATOM   5665  O  O   . ARG E  1 105 ? -17.752 44.375  8.097   1.00 43.11  ?  105 ARG E O   1 
ATOM   5666  C  CB  . ARG E  1 105 ? -15.632 44.289  10.623  1.00 44.07  ?  105 ARG E CB  1 
ATOM   5667  C  CG  . ARG E  1 105 ? -14.622 45.463  10.546  1.00 45.00  ?  105 ARG E CG  1 
ATOM   5668  C  CD  . ARG E  1 105 ? -14.152 46.005  11.936  1.00 47.18  ?  105 ARG E CD  1 
ATOM   5669  N  NE  . ARG E  1 105 ? -13.630 44.939  12.796  1.00 52.24  ?  105 ARG E NE  1 
ATOM   5670  C  CZ  . ARG E  1 105 ? -12.369 44.490  12.795  1.00 54.60  ?  105 ARG E CZ  1 
ATOM   5671  N  NH1 . ARG E  1 105 ? -11.448 45.032  11.991  1.00 54.25  ?  105 ARG E NH1 1 
ATOM   5672  N  NH2 . ARG E  1 105 ? -12.026 43.484  13.605  1.00 55.26  ?  105 ARG E NH2 1 
ATOM   5673  N  N   . TRP E  1 106 ? -18.103 42.597  9.426   1.00 41.44  ?  106 TRP E N   1 
ATOM   5674  C  CA  . TRP E  1 106 ? -19.519 42.581  9.270   1.00 40.40  ?  106 TRP E CA  1 
ATOM   5675  C  C   . TRP E  1 106 ? -20.169 43.303  10.443  1.00 40.40  ?  106 TRP E C   1 
ATOM   5676  O  O   . TRP E  1 106 ? -19.909 42.976  11.615  1.00 40.73  ?  106 TRP E O   1 
ATOM   5677  C  CB  . TRP E  1 106 ? -19.973 41.144  9.212   1.00 40.15  ?  106 TRP E CB  1 
ATOM   5678  C  CG  . TRP E  1 106 ? -19.653 40.491  7.935   1.00 38.78  ?  106 TRP E CG  1 
ATOM   5679  C  CD1 . TRP E  1 106 ? -18.492 39.830  7.598   1.00 38.93  ?  106 TRP E CD1 1 
ATOM   5680  C  CD2 . TRP E  1 106 ? -20.498 40.425  6.798   1.00 36.75  ?  106 TRP E CD2 1 
ATOM   5681  N  NE1 . TRP E  1 106 ? -18.584 39.343  6.316   1.00 37.00  ?  106 TRP E NE1 1 
ATOM   5682  C  CE2 . TRP E  1 106 ? -19.805 39.697  5.803   1.00 36.18  ?  106 TRP E CE2 1 
ATOM   5683  C  CE3 . TRP E  1 106 ? -21.784 40.901  6.521   1.00 36.36  ?  106 TRP E CE3 1 
ATOM   5684  C  CZ2 . TRP E  1 106 ? -20.354 39.440  4.556   1.00 35.58  ?  106 TRP E CZ2 1 
ATOM   5685  C  CZ3 . TRP E  1 106 ? -22.329 40.637  5.278   1.00 35.42  ?  106 TRP E CZ3 1 
ATOM   5686  C  CH2 . TRP E  1 106 ? -21.610 39.909  4.311   1.00 34.31  ?  106 TRP E CH2 1 
ATOM   5687  N  N   . VAL E  1 107 ? -21.040 44.263  10.119  1.00 40.09  ?  107 VAL E N   1 
ATOM   5688  C  CA  . VAL E  1 107 ? -21.424 45.327  11.051  1.00 39.34  ?  107 VAL E CA  1 
ATOM   5689  C  C   . VAL E  1 107 ? -22.910 45.762  10.969  1.00 39.23  ?  107 VAL E C   1 
ATOM   5690  O  O   . VAL E  1 107 ? -23.516 45.678  9.907   1.00 39.50  ?  107 VAL E O   1 
ATOM   5691  C  CB  . VAL E  1 107 ? -20.477 46.514  10.824  1.00 38.54  ?  107 VAL E CB  1 
ATOM   5692  C  CG1 . VAL E  1 107 ? -21.051 47.755  11.376  1.00 40.55  ?  107 VAL E CG1 1 
ATOM   5693  C  CG2 . VAL E  1 107 ? -19.164 46.258  11.474  1.00 35.87  ?  107 VAL E CG2 1 
ATOM   5694  N  N   . SER E  1 108 ? -23.485 46.220  12.087  1.00 38.98  ?  108 SER E N   1 
ATOM   5695  C  CA  . SER E  1 108 ? -24.885 46.713  12.118  1.00 39.28  ?  108 SER E CA  1 
ATOM   5696  C  C   . SER E  1 108 ? -25.054 47.977  11.288  1.00 39.19  ?  108 SER E C   1 
ATOM   5697  O  O   . SER E  1 108 ? -24.106 48.731  11.106  1.00 38.96  ?  108 SER E O   1 
ATOM   5698  C  CB  . SER E  1 108 ? -25.352 47.023  13.556  1.00 39.13  ?  108 SER E CB  1 
ATOM   5699  O  OG  . SER E  1 108 ? -24.718 48.203  14.073  1.00 39.00  ?  108 SER E OG  1 
ATOM   5700  N  N   . ALA E  1 109 ? -26.270 48.234  10.825  1.00 39.59  ?  109 ALA E N   1 
ATOM   5701  C  CA  . ALA E  1 109 ? -26.535 49.464  10.078  1.00 40.26  ?  109 ALA E CA  1 
ATOM   5702  C  C   . ALA E  1 109 ? -26.138 50.683  10.914  1.00 40.74  ?  109 ALA E C   1 
ATOM   5703  O  O   . ALA E  1 109 ? -25.295 51.501  10.526  1.00 41.34  ?  109 ALA E O   1 
ATOM   5704  C  CB  . ALA E  1 109 ? -28.004 49.541  9.696   1.00 40.04  ?  109 ALA E CB  1 
ATOM   5705  N  N   . GLU E  1 110 ? -26.731 50.750  12.093  1.00 40.92  ?  110 GLU E N   1 
ATOM   5706  C  CA  . GLU E  1 110 ? -26.554 51.826  13.029  1.00 41.49  ?  110 GLU E CA  1 
ATOM   5707  C  C   . GLU E  1 110 ? -25.077 52.006  13.463  1.00 40.78  ?  110 GLU E C   1 
ATOM   5708  O  O   . GLU E  1 110 ? -24.589 53.122  13.687  1.00 40.54  ?  110 GLU E O   1 
ATOM   5709  C  CB  . GLU E  1 110 ? -27.575 51.668  14.174  1.00 41.92  ?  110 GLU E CB  1 
ATOM   5710  C  CG  . GLU E  1 110 ? -28.126 50.210  14.432  1.00 45.69  ?  110 GLU E CG  1 
ATOM   5711  C  CD  . GLU E  1 110 ? -29.101 49.603  13.338  1.00 49.65  ?  110 GLU E CD  1 
ATOM   5712  O  OE1 . GLU E  1 110 ? -28.795 48.503  12.778  1.00 50.06  ?  110 GLU E OE1 1 
ATOM   5713  O  OE2 . GLU E  1 110 ? -30.179 50.197  13.061  1.00 50.38  -1 110 GLU E OE2 1 
ATOM   5714  N  N   . GLU E  1 111 ? -24.332 50.919  13.492  1.00 40.56  ?  111 GLU E N   1 
ATOM   5715  C  CA  . GLU E  1 111 ? -22.885 51.040  13.701  1.00 40.42  ?  111 GLU E CA  1 
ATOM   5716  C  C   . GLU E  1 111 ? -22.095 51.803  12.613  1.00 39.59  ?  111 GLU E C   1 
ATOM   5717  O  O   . GLU E  1 111 ? -21.136 52.544  12.917  1.00 39.06  ?  111 GLU E O   1 
ATOM   5718  C  CB  . GLU E  1 111 ? -22.309 49.668  13.850  1.00 40.78  ?  111 GLU E CB  1 
ATOM   5719  C  CG  . GLU E  1 111 ? -21.702 49.453  15.157  1.00 43.25  ?  111 GLU E CG  1 
ATOM   5720  C  CD  . GLU E  1 111 ? -20.719 48.329  15.083  1.00 47.19  ?  111 GLU E CD  1 
ATOM   5721  O  OE1 . GLU E  1 111 ? -21.181 47.155  14.892  1.00 45.57  ?  111 GLU E OE1 1 
ATOM   5722  O  OE2 . GLU E  1 111 ? -19.498 48.650  15.193  1.00 48.88  -1 111 GLU E OE2 1 
ATOM   5723  N  N   . ILE E  1 112 ? -22.470 51.575  11.348  1.00 38.35  ?  112 ILE E N   1 
ATOM   5724  C  CA  . ILE E  1 112 ? -21.940 52.347  10.221  1.00 36.96  ?  112 ILE E CA  1 
ATOM   5725  C  C   . ILE E  1 112 ? -22.455 53.773  10.319  1.00 36.77  ?  112 ILE E C   1 
ATOM   5726  O  O   . ILE E  1 112 ? -21.674 54.741  10.364  1.00 35.93  ?  112 ILE E O   1 
ATOM   5727  C  CB  . ILE E  1 112 ? -22.403 51.757  8.877   1.00 37.12  ?  112 ILE E CB  1 
ATOM   5728  C  CG1 . ILE E  1 112 ? -21.772 50.360  8.690   1.00 37.24  ?  112 ILE E CG1 1 
ATOM   5729  C  CG2 . ILE E  1 112 ? -22.100 52.729  7.733   1.00 34.28  ?  112 ILE E CG2 1 
ATOM   5730  C  CD1 . ILE E  1 112 ? -22.086 49.671  7.390   1.00 35.08  ?  112 ILE E CD1 1 
ATOM   5731  N  N   . LEU E  1 113 ? -23.786 53.872  10.360  1.00 36.02  ?  113 LEU E N   1 
ATOM   5732  C  CA  . LEU E  1 113 ? -24.483 55.125  10.499  1.00 35.83  ?  113 LEU E CA  1 
ATOM   5733  C  C   . LEU E  1 113 ? -23.828 56.029  11.524  1.00 36.57  ?  113 LEU E C   1 
ATOM   5734  O  O   . LEU E  1 113 ? -23.510 57.160  11.206  1.00 36.46  ?  113 LEU E O   1 
ATOM   5735  C  CB  . LEU E  1 113 ? -25.931 54.854  10.857  1.00 35.43  ?  113 LEU E CB  1 
ATOM   5736  C  CG  . LEU E  1 113 ? -27.033 54.976  9.818   1.00 34.06  ?  113 LEU E CG  1 
ATOM   5737  C  CD1 . LEU E  1 113 ? -26.539 55.087  8.395   1.00 35.41  ?  113 LEU E CD1 1 
ATOM   5738  C  CD2 . LEU E  1 113 ? -27.918 53.812  9.982   1.00 34.22  ?  113 LEU E CD2 1 
ATOM   5739  N  N   . GLN E  1 114 ? -23.584 55.530  12.737  1.00 37.43  ?  114 GLN E N   1 
ATOM   5740  C  CA  . GLN E  1 114 ? -22.943 56.363  13.757  1.00 38.50  ?  114 GLN E CA  1 
ATOM   5741  C  C   . GLN E  1 114 ? -21.397 56.388  13.746  1.00 38.74  ?  114 GLN E C   1 
ATOM   5742  O  O   . GLN E  1 114 ? -20.803 57.166  14.479  1.00 39.00  ?  114 GLN E O   1 
ATOM   5743  C  CB  . GLN E  1 114 ? -23.451 55.997  15.146  1.00 38.53  ?  114 GLN E CB  1 
ATOM   5744  C  CG  . GLN E  1 114 ? -24.977 56.043  15.277  1.00 41.21  ?  114 GLN E CG  1 
ATOM   5745  C  CD  . GLN E  1 114 ? -25.514 55.201  16.458  1.00 43.94  ?  114 GLN E CD  1 
ATOM   5746  O  OE1 . GLN E  1 114 ? -24.839 55.048  17.489  1.00 45.14  ?  114 GLN E OE1 1 
ATOM   5747  N  NE2 . GLN E  1 114 ? -26.730 54.655  16.302  1.00 42.55  ?  114 GLN E NE2 1 
ATOM   5748  N  N   . ALA E  1 115 ? -20.739 55.558  12.942  1.00 38.77  ?  115 ALA E N   1 
ATOM   5749  C  CA  . ALA E  1 115 ? -19.263 55.502  12.972  1.00 39.14  ?  115 ALA E CA  1 
ATOM   5750  C  C   . ALA E  1 115 ? -18.564 56.856  12.749  1.00 39.01  ?  115 ALA E C   1 
ATOM   5751  O  O   . ALA E  1 115 ? -19.021 57.666  11.948  1.00 39.02  ?  115 ALA E O   1 
ATOM   5752  C  CB  . ALA E  1 115 ? -18.763 54.482  11.971  1.00 39.39  ?  115 ALA E CB  1 
ATOM   5753  N  N   . SER E  1 116 ? -17.457 57.101  13.443  1.00 39.23  ?  116 SER E N   1 
ATOM   5754  C  CA  . SER E  1 116 ? -16.744 58.385  13.267  1.00 40.08  ?  116 SER E CA  1 
ATOM   5755  C  C   . SER E  1 116 ? -15.507 58.303  12.351  1.00 40.57  ?  116 SER E C   1 
ATOM   5756  O  O   . SER E  1 116 ? -14.760 59.297  12.205  1.00 40.39  ?  116 SER E O   1 
ATOM   5757  C  CB  . SER E  1 116 ? -16.336 58.967  14.626  1.00 39.73  ?  116 SER E CB  1 
ATOM   5758  O  OG  . SER E  1 116 ? -15.169 58.317  15.092  1.00 41.26  ?  116 SER E OG  1 
ATOM   5759  N  N   . ASN E  1 117 ? -15.295 57.123  11.751  1.00 40.78  ?  117 ASN E N   1 
ATOM   5760  C  CA  . ASN E  1 117 ? -14.131 56.837  10.905  1.00 40.64  ?  117 ASN E CA  1 
ATOM   5761  C  C   . ASN E  1 117 ? -14.497 56.334  9.506   1.00 40.30  ?  117 ASN E C   1 
ATOM   5762  O  O   . ASN E  1 117 ? -13.790 55.492  8.927   1.00 40.14  ?  117 ASN E O   1 
ATOM   5763  C  CB  . ASN E  1 117 ? -13.231 55.804  11.589  1.00 41.01  ?  117 ASN E CB  1 
ATOM   5764  C  CG  . ASN E  1 117 ? -13.921 54.462  11.778  1.00 42.46  ?  117 ASN E CG  1 
ATOM   5765  O  OD1 . ASN E  1 117 ? -15.145 54.387  11.898  1.00 43.64  ?  117 ASN E OD1 1 
ATOM   5766  N  ND2 . ASN E  1 117 ? -13.138 53.393  11.796  1.00 44.46  ?  117 ASN E ND2 1 
ATOM   5767  N  N   . LEU E  1 118 ? -15.590 56.848  8.950   1.00 39.64  ?  118 LEU E N   1 
ATOM   5768  C  CA  . LEU E  1 118 ? -15.999 56.430  7.607   1.00 38.90  ?  118 LEU E CA  1 
ATOM   5769  C  C   . LEU E  1 118 ? -15.087 57.124  6.641   1.00 38.50  ?  118 LEU E C   1 
ATOM   5770  O  O   . LEU E  1 118 ? -14.546 58.164  6.964   1.00 38.37  ?  118 LEU E O   1 
ATOM   5771  C  CB  . LEU E  1 118 ? -17.458 56.776  7.317   1.00 38.55  ?  118 LEU E CB  1 
ATOM   5772  C  CG  . LEU E  1 118 ? -18.493 56.113  8.232   1.00 38.02  ?  118 LEU E CG  1 
ATOM   5773  C  CD1 . LEU E  1 118 ? -19.927 56.357  7.748   1.00 36.89  ?  118 LEU E CD1 1 
ATOM   5774  C  CD2 . LEU E  1 118 ? -18.211 54.626  8.375   1.00 36.02  ?  118 LEU E CD2 1 
ATOM   5775  N  N   . ARG E  1 119 ? -14.906 56.535  5.465   1.00 38.16  ?  119 ARG E N   1 
ATOM   5776  C  CA  . ARG E  1 119 ? -14.019 57.078  4.456   1.00 37.52  ?  119 ARG E CA  1 
ATOM   5777  C  C   . ARG E  1 119 ? -14.560 58.395  3.912   1.00 36.90  ?  119 ARG E C   1 
ATOM   5778  O  O   . ARG E  1 119 ? -13.809 59.230  3.410   1.00 36.78  ?  119 ARG E O   1 
ATOM   5779  C  CB  . ARG E  1 119 ? -13.872 56.058  3.353   1.00 38.00  ?  119 ARG E CB  1 
ATOM   5780  C  CG  . ARG E  1 119 ? -12.999 56.482  2.229   1.00 40.32  ?  119 ARG E CG  1 
ATOM   5781  C  CD  . ARG E  1 119 ? -11.593 55.971  2.382   1.00 45.88  ?  119 ARG E CD  1 
ATOM   5782  N  NE  . ARG E  1 119 ? -10.835 56.244  1.159   1.00 50.42  ?  119 ARG E NE  1 
ATOM   5783  C  CZ  . ARG E  1 119 ? -10.732 55.399  0.134   1.00 52.00  ?  119 ARG E CZ  1 
ATOM   5784  N  NH1 . ARG E  1 119 ? -11.316 54.192  0.170   1.00 51.38  ?  119 ARG E NH1 1 
ATOM   5785  N  NH2 . ARG E  1 119 ? -10.021 55.763  -0.922  1.00 53.03  ?  119 ARG E NH2 1 
ATOM   5786  N  N   . SER E  1 120 ? -15.871 58.577  4.047   1.00 35.97  ?  120 SER E N   1 
ATOM   5787  C  CA  . SER E  1 120 ? -16.571 59.727  3.531   1.00 34.55  ?  120 SER E CA  1 
ATOM   5788  C  C   . SER E  1 120 ? -17.992 59.586  3.972   1.00 33.42  ?  120 SER E C   1 
ATOM   5789  O  O   . SER E  1 120 ? -18.445 58.470  4.239   1.00 33.45  ?  120 SER E O   1 
ATOM   5790  C  CB  . SER E  1 120 ? -16.643 59.683  2.022   1.00 34.92  ?  120 SER E CB  1 
ATOM   5791  O  OG  . SER E  1 120 ? -17.882 59.090  1.663   1.00 36.17  ?  120 SER E OG  1 
ATOM   5792  N  N   . PRO E  1 121 ? -18.724 60.712  3.988   1.00 32.51  ?  121 PRO E N   1 
ATOM   5793  C  CA  . PRO E  1 121 ? -20.166 60.750  4.281   1.00 31.47  ?  121 PRO E CA  1 
ATOM   5794  C  C   . PRO E  1 121 ? -21.063 59.969  3.306   1.00 29.91  ?  121 PRO E C   1 
ATOM   5795  O  O   . PRO E  1 121 ? -22.190 59.618  3.660   1.00 29.52  ?  121 PRO E O   1 
ATOM   5796  C  CB  . PRO E  1 121 ? -20.478 62.246  4.254   1.00 32.14  ?  121 PRO E CB  1 
ATOM   5797  C  CG  . PRO E  1 121 ? -19.170 62.892  4.676   1.00 32.45  ?  121 PRO E CG  1 
ATOM   5798  C  CD  . PRO E  1 121 ? -18.139 62.070  3.964   1.00 32.41  ?  121 PRO E CD  1 
ATOM   5799  N  N   . LEU E  1 122 ? -20.566 59.670  2.112   1.00 27.94  ?  122 LEU E N   1 
ATOM   5800  C  CA  . LEU E  1 122 ? -21.276 58.745  1.233   1.00 26.22  ?  122 LEU E CA  1 
ATOM   5801  C  C   . LEU E  1 122 ? -21.347 57.344  1.812   1.00 24.62  ?  122 LEU E C   1 
ATOM   5802  O  O   . LEU E  1 122 ? -22.275 56.607  1.510   1.00 23.54  ?  122 LEU E O   1 
ATOM   5803  C  CB  . LEU E  1 122 ? -20.591 58.653  -0.137  1.00 27.14  ?  122 LEU E CB  1 
ATOM   5804  C  CG  . LEU E  1 122 ? -21.148 59.479  -1.301  1.00 27.45  ?  122 LEU E CG  1 
ATOM   5805  C  CD1 . LEU E  1 122 ? -20.368 59.142  -2.505  1.00 27.45  ?  122 LEU E CD1 1 
ATOM   5806  C  CD2 . LEU E  1 122 ? -22.615 59.230  -1.533  1.00 25.96  ?  122 LEU E CD2 1 
ATOM   5807  N  N   . VAL E  1 123 ? -20.351 56.965  2.621   1.00 22.92  ?  123 VAL E N   1 
ATOM   5808  C  CA  . VAL E  1 123 ? -20.290 55.601  3.118   1.00 21.41  ?  123 VAL E CA  1 
ATOM   5809  C  C   . VAL E  1 123 ? -21.541 55.285  3.914   1.00 20.44  ?  123 VAL E C   1 
ATOM   5810  O  O   . VAL E  1 123 ? -22.059 54.194  3.845   1.00 19.62  ?  123 VAL E O   1 
ATOM   5811  C  CB  . VAL E  1 123 ? -19.020 55.316  3.941   1.00 21.97  ?  123 VAL E CB  1 
ATOM   5812  C  CG1 . VAL E  1 123 ? -19.101 53.946  4.595   1.00 20.36  ?  123 VAL E CG1 1 
ATOM   5813  C  CG2 . VAL E  1 123 ? -17.787 55.406  3.067   1.00 21.24  ?  123 VAL E CG2 1 
ATOM   5814  N  N   . ALA E  1 124 ? -22.037 56.289  4.619   1.00 20.53  ?  124 ALA E N   1 
ATOM   5815  C  CA  . ALA E  1 124 ? -23.238 56.174  5.482   1.00 20.27  ?  124 ALA E CA  1 
ATOM   5816  C  C   . ALA E  1 124 ? -24.517 56.357  4.684   1.00 20.03  ?  124 ALA E C   1 
ATOM   5817  O  O   . ALA E  1 124 ? -25.475 55.594  4.849   1.00 20.68  ?  124 ALA E O   1 
ATOM   5818  C  CB  . ALA E  1 124 ? -23.174 57.201  6.618   1.00 19.56  ?  124 ALA E CB  1 
ATOM   5819  N  N   . GLU E  1 125 ? -24.517 57.374  3.821   1.00 20.23  ?  125 GLU E N   1 
ATOM   5820  C  CA  . GLU E  1 125 ? -25.627 57.665  2.922   1.00 20.26  ?  125 GLU E CA  1 
ATOM   5821  C  C   . GLU E  1 125 ? -26.012 56.401  2.171   1.00 20.62  ?  125 GLU E C   1 
ATOM   5822  O  O   . GLU E  1 125 ? -27.208 56.137  1.958   1.00 20.35  ?  125 GLU E O   1 
ATOM   5823  C  CB  . GLU E  1 125 ? -25.274 58.782  1.938   1.00 20.01  ?  125 GLU E CB  1 
ATOM   5824  C  CG  . GLU E  1 125 ? -26.381 59.127  0.966   1.00 20.94  ?  125 GLU E CG  1 
ATOM   5825  C  CD  . GLU E  1 125 ? -27.709 59.474  1.663   1.00 23.59  ?  125 GLU E CD  1 
ATOM   5826  O  OE1 . GLU E  1 125 ? -28.751 59.537  0.987   1.00 27.42  ?  125 GLU E OE1 1 
ATOM   5827  O  OE2 . GLU E  1 125 ? -27.740 59.673  2.888   1.00 25.02  -1 125 GLU E OE2 1 
ATOM   5828  N  N   . SER E  1 126 ? -24.991 55.621  1.806   1.00 20.44  ?  126 SER E N   1 
ATOM   5829  C  CA  . SER E  1 126 ? -25.162 54.335  1.114   1.00 21.43  ?  126 SER E CA  1 
ATOM   5830  C  C   . SER E  1 126 ? -26.091 53.449  1.874   1.00 21.36  ?  126 SER E C   1 
ATOM   5831  O  O   . SER E  1 126 ? -27.008 52.883  1.305   1.00 22.46  ?  126 SER E O   1 
ATOM   5832  C  CB  . SER E  1 126 ? -23.816 53.594  0.907   1.00 21.62  ?  126 SER E CB  1 
ATOM   5833  O  OG  . SER E  1 126 ? -22.975 54.306  0.007   1.00 19.95  ?  126 SER E OG  1 
ATOM   5834  N  N   . ILE E  1 127 ? -25.873 53.342  3.173   1.00 21.27  ?  127 ILE E N   1 
ATOM   5835  C  CA  . ILE E  1 127 ? -26.770 52.571  4.005   1.00 21.00  ?  127 ILE E CA  1 
ATOM   5836  C  C   . ILE E  1 127 ? -28.186 53.150  4.015   1.00 21.15  ?  127 ILE E C   1 
ATOM   5837  O  O   . ILE E  1 127 ? -29.197 52.424  3.951   1.00 21.23  ?  127 ILE E O   1 
ATOM   5838  C  CB  . ILE E  1 127 ? -26.222 52.454  5.409   1.00 21.18  ?  127 ILE E CB  1 
ATOM   5839  C  CG1 . ILE E  1 127 ? -25.198 51.323  5.454   1.00 21.20  ?  127 ILE E CG1 1 
ATOM   5840  C  CG2 . ILE E  1 127 ? -27.317 51.976  6.341   1.00 21.25  ?  127 ILE E CG2 1 
ATOM   5841  C  CD1 . ILE E  1 127 ? -23.987 51.552  4.720   1.00 23.79  ?  127 ILE E CD1 1 
ATOM   5842  N  N   . ARG E  1 128 ? -28.279 54.462  4.077   1.00 20.98  ?  128 ARG E N   1 
ATOM   5843  C  CA  . ARG E  1 128 ? -29.607 55.022  4.180   1.00 21.49  ?  128 ARG E CA  1 
ATOM   5844  C  C   . ARG E  1 128 ? -30.350 54.694  2.887   1.00 21.24  ?  128 ARG E C   1 
ATOM   5845  O  O   . ARG E  1 128 ? -31.552 54.461  2.902   1.00 20.54  ?  128 ARG E O   1 
ATOM   5846  C  CB  . ARG E  1 128 ? -29.558 56.522  4.555   1.00 21.29  ?  128 ARG E CB  1 
ATOM   5847  C  CG  . ARG E  1 128 ? -29.170 56.745  6.044   1.00 24.09  ?  128 ARG E CG  1 
ATOM   5848  C  CD  . ARG E  1 128 ? -29.301 58.216  6.522   1.00 28.67  ?  128 ARG E CD  1 
ATOM   5849  N  NE  . ARG E  1 128 ? -28.167 58.974  6.013   1.00 31.39  ?  128 ARG E NE  1 
ATOM   5850  C  CZ  . ARG E  1 128 ? -27.124 59.303  6.747   1.00 32.67  ?  128 ARG E CZ  1 
ATOM   5851  N  NH1 . ARG E  1 128 ? -27.112 58.973  8.016   1.00 35.18  ?  128 ARG E NH1 1 
ATOM   5852  N  NH2 . ARG E  1 128 ? -26.107 59.966  6.223   1.00 34.38  ?  128 ARG E NH2 1 
ATOM   5853  N  N   . CYS E  1 129 ? -29.611 54.635  1.779   1.00 21.41  ?  129 CYS E N   1 
ATOM   5854  C  CA  . CYS E  1 129 ? -30.192 54.321  0.487   1.00 21.80  ?  129 CYS E CA  1 
ATOM   5855  C  C   . CYS E  1 129 ? -30.580 52.849  0.490   1.00 23.02  ?  129 CYS E C   1 
ATOM   5856  O  O   . CYS E  1 129 ? -31.647 52.510  0.044   1.00 24.14  ?  129 CYS E O   1 
ATOM   5857  C  CB  . CYS E  1 129 ? -29.191 54.560  -0.646  1.00 21.61  ?  129 CYS E CB  1 
ATOM   5858  S  SG  . CYS E  1 129 ? -28.816 56.280  -1.112  1.00 20.07  ?  129 CYS E SG  1 
ATOM   5859  N  N   . TYR E  1 130 ? -29.712 51.975  0.985   1.00 23.49  ?  130 TYR E N   1 
ATOM   5860  C  CA  . TYR E  1 130 ? -30.049 50.585  1.092   1.00 24.48  ?  130 TYR E CA  1 
ATOM   5861  C  C   . TYR E  1 130 ? -31.310 50.396  1.885   1.00 24.65  ?  130 TYR E C   1 
ATOM   5862  O  O   . TYR E  1 130 ? -32.159 49.584  1.497   1.00 24.65  ?  130 TYR E O   1 
ATOM   5863  C  CB  . TYR E  1 130 ? -28.924 49.783  1.761   1.00 25.01  ?  130 TYR E CB  1 
ATOM   5864  C  CG  . TYR E  1 130 ? -29.290 48.306  2.022   1.00 26.02  ?  130 TYR E CG  1 
ATOM   5865  C  CD1 . TYR E  1 130 ? -28.905 47.294  1.131   1.00 26.83  ?  130 TYR E CD1 1 
ATOM   5866  C  CD2 . TYR E  1 130 ? -30.025 47.935  3.146   1.00 27.61  ?  130 TYR E CD2 1 
ATOM   5867  C  CE1 . TYR E  1 130 ? -29.222 45.958  1.355   1.00 26.13  ?  130 TYR E CE1 1 
ATOM   5868  C  CE2 . TYR E  1 130 ? -30.347 46.600  3.379   1.00 29.51  ?  130 TYR E CE2 1 
ATOM   5869  C  CZ  . TYR E  1 130 ? -29.933 45.620  2.476   1.00 29.40  ?  130 TYR E CZ  1 
ATOM   5870  O  OH  . TYR E  1 130 ? -30.245 44.304  2.722   1.00 30.68  ?  130 TYR E OH  1 
ATOM   5871  N  N   . GLN E  1 131 ? -31.420 51.148  2.981   1.00 24.81  ?  131 GLN E N   1 
ATOM   5872  C  CA  . GLN E  1 131 ? -32.531 51.004  3.916   1.00 26.17  ?  131 GLN E CA  1 
ATOM   5873  C  C   . GLN E  1 131 ? -33.887 51.570  3.480   1.00 26.80  ?  131 GLN E C   1 
ATOM   5874  O  O   . GLN E  1 131 ? -34.908 51.244  4.100   1.00 27.15  ?  131 GLN E O   1 
ATOM   5875  C  CB  . GLN E  1 131 ? -32.194 51.606  5.258   1.00 26.66  ?  131 GLN E CB  1 
ATOM   5876  C  CG  . GLN E  1 131 ? -31.021 51.006  5.980   1.00 28.47  ?  131 GLN E CG  1 
ATOM   5877  C  CD  . GLN E  1 131 ? -30.833 51.647  7.353   1.00 32.70  ?  131 GLN E CD  1 
ATOM   5878  O  OE1 . GLN E  1 131 ? -30.815 52.881  7.495   1.00 35.39  ?  131 GLN E OE1 1 
ATOM   5879  N  NE2 . GLN E  1 131 ? -30.703 50.808  8.376   1.00 34.92  ?  131 GLN E NE2 1 
ATOM   5880  N  N   . SER E  1 132 ? -33.919 52.406  2.440   1.00 27.27  ?  132 SER E N   1 
ATOM   5881  C  CA  . SER E  1 132 ? -35.194 52.868  1.860   1.00 27.33  ?  132 SER E CA  1 
ATOM   5882  C  C   . SER E  1 132 ? -36.045 51.741  1.188   1.00 27.94  ?  132 SER E C   1 
ATOM   5883  O  O   . SER E  1 132 ? -37.225 51.961  0.934   1.00 27.94  ?  132 SER E O   1 
ATOM   5884  C  CB  . SER E  1 132 ? -34.921 53.909  0.800   1.00 27.34  ?  132 SER E CB  1 
ATOM   5885  O  OG  . SER E  1 132 ? -34.542 53.251  -0.424  1.00 27.54  ?  132 SER E OG  1 
ATOM   5886  N  N   . GLY E  1 133 ? -35.462 50.580  0.850   1.00 27.26  ?  133 GLY E N   1 
ATOM   5887  C  CA  . GLY E  1 133 ? -36.278 49.519  0.249   1.00 27.32  ?  133 GLY E CA  1 
ATOM   5888  C  C   . GLY E  1 133 ? -36.437 49.522  -1.285  1.00 27.99  ?  133 GLY E C   1 
ATOM   5889  O  O   . GLY E  1 133 ? -36.925 48.527  -1.855  1.00 27.54  ?  133 GLY E O   1 
ATOM   5890  N  N   . GLN E  1 134 ? -36.022 50.614  -1.948  1.00 27.63  ?  134 GLN E N   1 
ATOM   5891  C  CA  . GLN E  1 134 ? -36.058 50.722  -3.413  1.00 27.66  ?  134 GLN E CA  1 
ATOM   5892  C  C   . GLN E  1 134 ? -34.840 50.151  -4.132  1.00 26.73  ?  134 GLN E C   1 
ATOM   5893  O  O   . GLN E  1 134 ? -33.747 50.678  -4.005  1.00 25.99  ?  134 GLN E O   1 
ATOM   5894  C  CB  . GLN E  1 134 ? -36.258 52.161  -3.850  1.00 27.84  ?  134 GLN E CB  1 
ATOM   5895  C  CG  . GLN E  1 134 ? -37.579 52.714  -3.394  1.00 33.33  ?  134 GLN E CG  1 
ATOM   5896  C  CD  . GLN E  1 134 ? -38.726 52.264  -4.271  1.00 36.95  ?  134 GLN E CD  1 
ATOM   5897  O  OE1 . GLN E  1 134 ? -39.832 52.014  -3.789  1.00 40.08  ?  134 GLN E OE1 1 
ATOM   5898  N  NE2 . GLN E  1 134 ? -38.469 52.168  -5.571  1.00 37.38  ?  134 GLN E NE2 1 
ATOM   5899  N  N   . ARG E  1 135 ? -35.070 49.102  -4.928  1.00 25.88  ?  135 ARG E N   1 
ATOM   5900  C  CA  . ARG E  1 135 ? -34.043 48.429  -5.654  0.50 25.23  ?  135 ARG E CA  1 
ATOM   5901  C  C   . ARG E  1 135 ? -34.387 48.566  -7.113  1.00 26.25  ?  135 ARG E C   1 
ATOM   5902  O  O   . ARG E  1 135 ? -35.535 48.395  -7.517  1.00 27.10  ?  135 ARG E O   1 
ATOM   5903  C  CB  . ARG E  1 135 ? -34.014 46.972  -5.242  0.50 24.59  ?  135 ARG E CB  1 
ATOM   5904  C  CG  . ARG E  1 135 ? -33.731 46.783  -3.777  0.50 21.09  ?  135 ARG E CG  1 
ATOM   5905  C  CD  . ARG E  1 135 ? -32.264 46.558  -3.522  0.50 16.44  ?  135 ARG E CD  1 
ATOM   5906  N  NE  . ARG E  1 135 ? -32.026 46.269  -2.105  0.50 12.76  ?  135 ARG E NE  1 
ATOM   5907  C  CZ  . ARG E  1 135 ? -32.234 47.178  -1.175  0.50 9.68   ?  135 ARG E CZ  1 
ATOM   5908  N  NH1 . ARG E  1 135 ? -32.671 48.357  -1.553  0.50 12.46  ?  135 ARG E NH1 1 
ATOM   5909  N  NH2 . ARG E  1 135 ? -32.036 46.925  0.095   0.50 8.52   ?  135 ARG E NH2 1 
ATOM   5910  N  N   . TYR E  1 136 ? -33.395 48.881  -7.922  1.00 26.38  ?  136 TYR E N   1 
ATOM   5911  C  CA  . TYR E  1 136 ? -33.647 49.138  -9.325  1.00 26.84  ?  136 TYR E CA  1 
ATOM   5912  C  C   . TYR E  1 136 ? -32.914 48.139  -10.203 1.00 26.08  ?  136 TYR E C   1 
ATOM   5913  O  O   . TYR E  1 136 ? -31.839 47.673  -9.827  1.00 26.92  ?  136 TYR E O   1 
ATOM   5914  C  CB  . TYR E  1 136 ? -33.209 50.565  -9.673  1.00 27.61  ?  136 TYR E CB  1 
ATOM   5915  C  CG  . TYR E  1 136 ? -34.163 51.615  -9.156  1.00 30.01  ?  136 TYR E CG  1 
ATOM   5916  C  CD1 . TYR E  1 136 ? -35.351 51.880  -9.817  1.00 31.04  ?  136 TYR E CD1 1 
ATOM   5917  C  CD2 . TYR E  1 136 ? -33.879 52.336  -8.012  1.00 32.76  ?  136 TYR E CD2 1 
ATOM   5918  C  CE1 . TYR E  1 136 ? -36.236 52.815  -9.347  1.00 34.32  ?  136 TYR E CE1 1 
ATOM   5919  C  CE2 . TYR E  1 136 ? -34.751 53.291  -7.546  1.00 35.42  ?  136 TYR E CE2 1 
ATOM   5920  C  CZ  . TYR E  1 136 ? -35.938 53.529  -8.215  1.00 36.71  ?  136 TYR E CZ  1 
ATOM   5921  O  OH  . TYR E  1 136 ? -36.833 54.506  -7.765  1.00 41.11  ?  136 TYR E OH  1 
ATOM   5922  N  N   . PRO E  1 137 ? -33.483 47.821  -11.374 1.00 24.87  ?  137 PRO E N   1 
ATOM   5923  C  CA  . PRO E  1 137 ? -32.896 46.925  -12.389 1.00 23.93  ?  137 PRO E CA  1 
ATOM   5924  C  C   . PRO E  1 137 ? -31.454 47.225  -12.741 1.00 22.81  ?  137 PRO E C   1 
ATOM   5925  O  O   . PRO E  1 137 ? -31.131 48.360  -12.984 1.00 22.40  ?  137 PRO E O   1 
ATOM   5926  C  CB  . PRO E  1 137 ? -33.760 47.190  -13.611 1.00 23.55  ?  137 PRO E CB  1 
ATOM   5927  C  CG  . PRO E  1 137 ? -35.096 47.592  -13.052 1.00 24.19  ?  137 PRO E CG  1 
ATOM   5928  C  CD  . PRO E  1 137 ? -34.801 48.342  -11.782 1.00 24.53  ?  137 PRO E CD  1 
ATOM   5929  N  N   . LEU E  1 138 ? -30.605 46.210  -12.802 1.00 23.27  ?  138 LEU E N   1 
ATOM   5930  C  CA  . LEU E  1 138 ? -29.206 46.386  -13.245 1.00 23.86  ?  138 LEU E CA  1 
ATOM   5931  C  C   . LEU E  1 138 ? -29.075 46.879  -14.695 1.00 24.14  ?  138 LEU E C   1 
ATOM   5932  O  O   . LEU E  1 138 ? -28.100 47.565  -15.032 1.00 25.03  ?  138 LEU E O   1 
ATOM   5933  C  CB  . LEU E  1 138 ? -28.413 45.082  -13.099 1.00 24.00  ?  138 LEU E CB  1 
ATOM   5934  C  CG  . LEU E  1 138 ? -28.165 44.439  -11.715 1.00 24.09  ?  138 LEU E CG  1 
ATOM   5935  C  CD1 . LEU E  1 138 ? -27.583 43.039  -11.855 1.00 21.92  ?  138 LEU E CD1 1 
ATOM   5936  C  CD2 . LEU E  1 138 ? -27.223 45.285  -10.884 1.00 24.74  ?  138 LEU E CD2 1 
ATOM   5937  N  N   . GLU E  1 139 ? -30.052 46.527  -15.529 1.00 23.56  ?  139 GLU E N   1 
ATOM   5938  C  CA  . GLU E  1 139 ? -30.127 46.926  -16.920 0.50 24.35  ?  139 GLU E CA  1 
ATOM   5939  C  C   . GLU E  1 139 ? -30.229 48.448  -17.036 1.00 25.09  ?  139 GLU E C   1 
ATOM   5940  O  O   . GLU E  1 139 ? -30.066 49.015  -18.109 1.00 25.12  ?  139 GLU E O   1 
ATOM   5941  C  CB  . GLU E  1 139 ? -31.358 46.285  -17.580 0.50 24.21  ?  139 GLU E CB  1 
ATOM   5942  C  CG  . GLU E  1 139 ? -31.415 44.726  -17.564 0.50 24.73  ?  139 GLU E CG  1 
ATOM   5943  C  CD  . GLU E  1 139 ? -31.339 44.098  -16.146 0.50 24.39  ?  139 GLU E CD  1 
ATOM   5944  O  OE1 . GLU E  1 139 ? -30.356 43.354  -15.879 0.50 21.71  ?  139 GLU E OE1 1 
ATOM   5945  O  OE2 . GLU E  1 139 ? -32.243 44.351  -15.309 0.50 22.31  -1 139 GLU E OE2 1 
ATOM   5946  N  N   . MET E  1 140 ? -30.499 49.131  -15.939 1.00 25.85  ?  140 MET E N   1 
ATOM   5947  C  CA  . MET E  1 140 ? -30.727 50.577  -16.009 1.00 26.54  ?  140 MET E CA  1 
ATOM   5948  C  C   . MET E  1 140 ? -29.390 51.306  -16.223 1.00 26.80  ?  140 MET E C   1 
ATOM   5949  O  O   . MET E  1 140 ? -29.350 52.493  -16.606 1.00 26.36  ?  140 MET E O   1 
ATOM   5950  C  CB  . MET E  1 140 ? -31.403 51.073  -14.732 1.00 26.72  ?  140 MET E CB  1 
ATOM   5951  C  CG  . MET E  1 140 ? -32.178 52.366  -14.912 1.00 28.74  ?  140 MET E CG  1 
ATOM   5952  S  SD  . MET E  1 140 ? -32.537 53.126  -13.305 1.00 33.51  ?  140 MET E SD  1 
ATOM   5953  C  CE  . MET E  1 140 ? -31.005 53.984  -13.087 1.00 27.82  ?  140 MET E CE  1 
ATOM   5954  N  N   . ILE E  1 141 ? -28.281 50.605  -15.994 1.00 26.24  ?  141 ILE E N   1 
ATOM   5955  C  CA  . ILE E  1 141 ? -27.012 51.253  -16.290 1.00 26.03  ?  141 ILE E CA  1 
ATOM   5956  C  C   . ILE E  1 141 ? -26.136 50.348  -17.105 1.00 25.94  ?  141 ILE E C   1 
ATOM   5957  O  O   . ILE E  1 141 ? -24.913 50.419  -17.030 1.00 25.20  ?  141 ILE E O   1 
ATOM   5958  C  CB  . ILE E  1 141 ? -26.301 51.813  -15.018 1.00 26.34  ?  141 ILE E CB  1 
ATOM   5959  C  CG1 . ILE E  1 141 ? -26.293 50.799  -13.880 1.00 25.33  ?  141 ILE E CG1 1 
ATOM   5960  C  CG2 . ILE E  1 141 ? -26.980 53.085  -14.537 1.00 26.18  ?  141 ILE E CG2 1 
ATOM   5961  C  CD1 . ILE E  1 141 ? -25.288 49.691  -14.089 1.00 24.67  ?  141 ILE E CD1 1 
ATOM   5962  N  N   . GLY E  1 142 ? -26.782 49.538  -17.945 1.00 26.28  ?  142 GLY E N   1 
ATOM   5963  C  CA  . GLY E  1 142 ? -26.101 48.445  -18.626 1.00 26.22  ?  142 GLY E CA  1 
ATOM   5964  C  C   . GLY E  1 142 ? -25.284 48.753  -19.873 1.00 26.66  ?  142 GLY E C   1 
ATOM   5965  O  O   . GLY E  1 142 ? -25.528 49.736  -20.617 1.00 26.49  ?  142 GLY E O   1 
ATOM   5966  N  N   . ASP E  1 143 ? -24.309 47.872  -20.103 1.00 27.08  ?  143 ASP E N   1 
ATOM   5967  C  CA  . ASP E  1 143 ? -23.532 47.817  -21.357 1.00 26.68  ?  143 ASP E CA  1 
ATOM   5968  C  C   . ASP E  1 143 ? -24.495 47.566  -22.500 1.00 25.98  ?  143 ASP E C   1 
ATOM   5969  O  O   . ASP E  1 143 ? -25.502 46.870  -22.320 1.00 24.59  ?  143 ASP E O   1 
ATOM   5970  C  CB  . ASP E  1 143 ? -22.514 46.691  -21.323 1.00 27.01  ?  143 ASP E CB  1 
ATOM   5971  C  CG  . ASP E  1 143 ? -23.188 45.302  -21.227 1.00 28.99  ?  143 ASP E CG  1 
ATOM   5972  O  OD1 . ASP E  1 143 ? -23.482 44.884  -20.090 1.00 27.16  ?  143 ASP E OD1 1 
ATOM   5973  O  OD2 . ASP E  1 143 ? -23.442 44.658  -22.290 1.00 31.27  -1 143 ASP E OD2 1 
ATOM   5974  N  N   . PHE E  1 144 ? -24.186 48.185  -23.641 1.00 25.74  ?  144 PHE E N   1 
ATOM   5975  C  CA  . PHE E  1 144 ? -24.970 48.054  -24.857 1.00 26.25  ?  144 PHE E CA  1 
ATOM   5976  C  C   . PHE E  1 144 ? -24.063 47.634  -26.005 1.00 26.33  ?  144 PHE E C   1 
ATOM   5977  O  O   . PHE E  1 144 ? -22.992 48.235  -26.193 1.00 25.48  ?  144 PHE E O   1 
ATOM   5978  C  CB  . PHE E  1 144 ? -25.667 49.376  -25.193 1.00 26.49  ?  144 PHE E CB  1 
ATOM   5979  C  CG  . PHE E  1 144 ? -26.406 49.346  -26.488 1.00 24.49  ?  144 PHE E CG  1 
ATOM   5980  C  CD1 . PHE E  1 144 ? -27.557 48.578  -26.615 1.00 21.20  ?  144 PHE E CD1 1 
ATOM   5981  C  CD2 . PHE E  1 144 ? -25.949 50.082  -27.578 1.00 23.35  ?  144 PHE E CD2 1 
ATOM   5982  C  CE1 . PHE E  1 144 ? -28.249 48.505  -27.812 1.00 19.06  ?  144 PHE E CE1 1 
ATOM   5983  C  CE2 . PHE E  1 144 ? -26.646 50.035  -28.787 1.00 23.25  ?  144 PHE E CE2 1 
ATOM   5984  C  CZ  . PHE E  1 144 ? -27.806 49.234  -28.901 1.00 21.31  ?  144 PHE E CZ  1 
ATOM   5985  N  N   . ASN E  1 145 ? -24.525 46.621  -26.764 1.00 26.55  ?  145 ASN E N   1 
ATOM   5986  C  CA  . ASN E  1 145 ? -23.696 45.870  -27.741 1.00 26.71  ?  145 ASN E CA  1 
ATOM   5987  C  C   . ASN E  1 145 ? -22.287 45.603  -27.222 1.00 26.65  ?  145 ASN E C   1 
ATOM   5988  O  O   . ASN E  1 145 ? -21.306 45.823  -27.916 1.00 25.99  ?  145 ASN E O   1 
ATOM   5989  C  CB  . ASN E  1 145 ? -23.553 46.603  -29.067 1.00 26.40  ?  145 ASN E CB  1 
ATOM   5990  C  CG  . ASN E  1 145 ? -24.870 46.958  -29.694 1.00 29.18  ?  145 ASN E CG  1 
ATOM   5991  O  OD1 . ASN E  1 145 ? -25.929 46.419  -29.335 1.00 32.59  ?  145 ASN E OD1 1 
ATOM   5992  N  ND2 . ASN E  1 145 ? -24.819 47.869  -30.669 1.00 30.07  ?  145 ASN E ND2 1 
ATOM   5993  N  N   . TRP E  1 146 ? -22.174 45.158  -25.991 1.00 26.88  ?  146 TRP E N   1 
ATOM   5994  C  CA  . TRP E  1 146 ? -20.844 44.932  -25.455 1.00 28.19  ?  146 TRP E CA  1 
ATOM   5995  C  C   . TRP E  1 146 ? -19.984 44.017  -26.355 1.00 29.51  ?  146 TRP E C   1 
ATOM   5996  O  O   . TRP E  1 146 ? -20.454 42.944  -26.735 1.00 30.00  ?  146 TRP E O   1 
ATOM   5997  C  CB  . TRP E  1 146 ? -20.947 44.368  -24.033 1.00 26.41  ?  146 TRP E CB  1 
ATOM   5998  C  CG  . TRP E  1 146 ? -19.732 44.528  -23.217 1.00 24.08  ?  146 TRP E CG  1 
ATOM   5999  C  CD1 . TRP E  1 146 ? -19.011 43.526  -22.619 1.00 23.22  ?  146 TRP E CD1 1 
ATOM   6000  C  CD2 . TRP E  1 146 ? -19.072 45.752  -22.873 1.00 21.18  ?  146 TRP E CD2 1 
ATOM   6001  N  NE1 . TRP E  1 146 ? -17.964 44.054  -21.906 1.00 21.69  ?  146 TRP E NE1 1 
ATOM   6002  C  CE2 . TRP E  1 146 ? -17.975 45.418  -22.042 1.00 21.67  ?  146 TRP E CE2 1 
ATOM   6003  C  CE3 . TRP E  1 146 ? -19.311 47.098  -23.165 1.00 21.29  ?  146 TRP E CE3 1 
ATOM   6004  C  CZ2 . TRP E  1 146 ? -17.102 46.390  -21.506 1.00 23.57  ?  146 TRP E CZ2 1 
ATOM   6005  C  CZ3 . TRP E  1 146 ? -18.447 48.069  -22.636 1.00 21.02  ?  146 TRP E CZ3 1 
ATOM   6006  C  CH2 . TRP E  1 146 ? -17.356 47.705  -21.815 1.00 22.47  ?  146 TRP E CH2 1 
ATOM   6007  N  N   . PRO E  1 147 ? -18.742 44.451  -26.688 1.00 30.75  ?  147 PRO E N   1 
ATOM   6008  C  CA  . PRO E  1 147 ? -17.628 43.738  -27.404 1.00 32.12  ?  147 PRO E CA  1 
ATOM   6009  C  C   . PRO E  1 147 ? -17.107 42.409  -26.836 1.00 33.51  ?  147 PRO E C   1 
ATOM   6010  O  O   . PRO E  1 147 ? -16.627 41.558  -27.613 1.00 34.50  ?  147 PRO E O   1 
ATOM   6011  C  CB  . PRO E  1 147 ? -16.453 44.741  -27.360 1.00 31.95  ?  147 PRO E CB  1 
ATOM   6012  C  CG  . PRO E  1 147 ? -17.029 46.067  -26.928 1.00 31.14  ?  147 PRO E CG  1 
ATOM   6013  C  CD  . PRO E  1 147 ? -18.545 45.913  -26.727 1.00 30.55  ?  147 PRO E CD  1 
ATOM   6014  N  N   . PHE E  1 148 ? -17.159 42.253  -25.511 1.00 34.47  ?  148 PHE E N   1 
ATOM   6015  C  CA  . PHE E  1 148 ? -16.505 41.125  -24.811 1.00 35.48  ?  148 PHE E CA  1 
ATOM   6016  C  C   . PHE E  1 148 ? -17.514 40.020  -24.403 1.00 36.57  ?  148 PHE E C   1 
ATOM   6017  O  O   . PHE E  1 148 ? -18.719 40.281  -24.284 1.00 36.96  ?  148 PHE E O   1 
ATOM   6018  C  CB  . PHE E  1 148 ? -15.731 41.631  -23.572 1.00 35.18  ?  148 PHE E CB  1 
ATOM   6019  C  CG  . PHE E  1 148 ? -14.693 42.687  -23.874 1.00 34.07  ?  148 PHE E CG  1 
ATOM   6020  C  CD1 . PHE E  1 148 ? -15.062 44.018  -24.074 1.00 33.29  ?  148 PHE E CD1 1 
ATOM   6021  C  CD2 . PHE E  1 148 ? -13.332 42.353  -23.948 1.00 35.60  ?  148 PHE E CD2 1 
ATOM   6022  C  CE1 . PHE E  1 148 ? -14.092 45.008  -24.375 1.00 34.01  ?  148 PHE E CE1 1 
ATOM   6023  C  CE2 . PHE E  1 148 ? -12.343 43.337  -24.241 1.00 34.62  ?  148 PHE E CE2 1 
ATOM   6024  C  CZ  . PHE E  1 148 ? -12.732 44.661  -24.461 1.00 33.79  ?  148 PHE E CZ  1 
ATOM   6025  N  N   . THR E  1 149 ? -17.019 38.803  -24.197 1.00 37.56  ?  149 THR E N   1 
ATOM   6026  C  CA  . THR E  1 149 ? -17.830 37.668  -23.738 1.00 38.82  ?  149 THR E CA  1 
ATOM   6027  C  C   . THR E  1 149 ? -18.131 37.816  -22.263 1.00 40.08  ?  149 THR E C   1 
ATOM   6028  O  O   . THR E  1 149 ? -17.447 38.577  -21.554 1.00 39.62  ?  149 THR E O   1 
ATOM   6029  C  CB  . THR E  1 149 ? -17.042 36.367  -23.870 1.00 38.97  ?  149 THR E CB  1 
ATOM   6030  O  OG1 . THR E  1 149 ? -15.712 36.582  -23.365 1.00 39.92  ?  149 THR E OG1 1 
ATOM   6031  C  CG2 . THR E  1 149 ? -16.940 35.956  -25.331 1.00 39.31  ?  149 THR E CG2 1 
ATOM   6032  N  N   . LYS E  1 150 ? -19.121 37.051  -21.785 1.00 41.46  ?  150 LYS E N   1 
ATOM   6033  C  CA  . LYS E  1 150 ? -19.504 37.087  -20.367 1.00 42.02  ?  150 LYS E CA  1 
ATOM   6034  C  C   . LYS E  1 150 ? -19.255 35.760  -19.654 1.00 42.62  ?  150 LYS E C   1 
ATOM   6035  O  O   . LYS E  1 150 ? -18.499 35.695  -18.675 1.00 42.91  ?  150 LYS E O   1 
ATOM   6036  C  CB  . LYS E  1 150 ? -20.973 37.510  -20.240 1.00 42.59  ?  150 LYS E CB  1 
ATOM   6037  C  CG  . LYS E  1 150 ? -21.283 38.952  -20.776 1.00 42.57  ?  150 LYS E CG  1 
ATOM   6038  C  CD  . LYS E  1 150 ? -20.672 40.076  -19.893 1.00 40.00  ?  150 LYS E CD  1 
ATOM   6039  C  CE  . LYS E  1 150 ? -20.851 41.485  -20.471 1.00 39.04  ?  150 LYS E CE  1 
ATOM   6040  N  NZ  . LYS E  1 150 ? -22.237 41.881  -20.911 1.00 35.61  ?  150 LYS E NZ  1 
ATOM   6041  N  N   . MET F  1 1   ? -62.191 25.035  12.761  1.00 51.54  ?  1   MET F N   1 
ATOM   6042  C  CA  . MET F  1 1   ? -61.804 26.469  12.766  1.00 51.53  ?  1   MET F CA  1 
ATOM   6043  C  C   . MET F  1 1   ? -61.153 26.896  11.443  1.00 51.44  ?  1   MET F C   1 
ATOM   6044  O  O   . MET F  1 1   ? -60.376 26.131  10.842  1.00 52.02  ?  1   MET F O   1 
ATOM   6045  C  CB  . MET F  1 1   ? -60.874 26.769  13.941  1.00 51.73  ?  1   MET F CB  1 
ATOM   6046  C  CG  . MET F  1 1   ? -59.578 25.964  13.985  1.00 51.89  ?  1   MET F CG  1 
ATOM   6047  S  SD  . MET F  1 1   ? -58.218 26.817  14.842  1.00 52.82  ?  1   MET F SD  1 
ATOM   6048  C  CE  . MET F  1 1   ? -59.085 27.927  15.982  1.00 53.08  ?  1   MET F CE  1 
ATOM   6049  N  N   . PHE F  1 2   ? -61.477 28.118  11.001  1.00 50.40  ?  2   PHE F N   1 
ATOM   6050  C  CA  . PHE F  1 2   ? -60.965 28.670  9.744   1.00 48.89  ?  2   PHE F CA  1 
ATOM   6051  C  C   . PHE F  1 2   ? -59.451 28.844  9.766   1.00 47.72  ?  2   PHE F C   1 
ATOM   6052  O  O   . PHE F  1 2   ? -58.938 29.770  10.377  1.00 47.86  ?  2   PHE F O   1 
ATOM   6053  C  CB  . PHE F  1 2   ? -61.653 30.006  9.429   1.00 49.13  ?  2   PHE F CB  1 
ATOM   6054  C  CG  . PHE F  1 2   ? -61.146 30.685  8.178   1.00 49.94  ?  2   PHE F CG  1 
ATOM   6055  C  CD1 . PHE F  1 2   ? -61.560 30.261  6.913   1.00 50.77  ?  2   PHE F CD1 1 
ATOM   6056  C  CD2 . PHE F  1 2   ? -60.283 31.766  8.258   1.00 50.62  ?  2   PHE F CD2 1 
ATOM   6057  C  CE1 . PHE F  1 2   ? -61.108 30.898  5.747   1.00 50.44  ?  2   PHE F CE1 1 
ATOM   6058  C  CE2 . PHE F  1 2   ? -59.825 32.415  7.082   1.00 51.26  ?  2   PHE F CE2 1 
ATOM   6059  C  CZ  . PHE F  1 2   ? -60.237 31.977  5.835   1.00 49.73  ?  2   PHE F CZ  1 
ATOM   6060  N  N   . LYS F  1 3   ? -58.744 27.909  9.151   1.00 46.27  ?  3   LYS F N   1 
ATOM   6061  C  CA  . LYS F  1 3   ? -57.399 28.169  8.679   1.00 44.91  ?  3   LYS F CA  1 
ATOM   6062  C  C   . LYS F  1 3   ? -57.578 28.428  7.185   1.00 44.27  ?  3   LYS F C   1 
ATOM   6063  O  O   . LYS F  1 3   ? -58.693 28.225  6.654   1.00 44.35  ?  3   LYS F O   1 
ATOM   6064  C  CB  . LYS F  1 3   ? -56.473 26.984  8.916   1.00 44.97  ?  3   LYS F CB  1 
ATOM   6065  C  CG  . LYS F  1 3   ? -56.413 26.507  10.361  1.00 44.60  ?  3   LYS F CG  1 
ATOM   6066  C  CD  . LYS F  1 3   ? -55.538 25.268  10.460  1.00 43.43  ?  3   LYS F CD  1 
ATOM   6067  C  CE  . LYS F  1 3   ? -55.511 24.684  11.882  1.00 43.59  ?  3   LYS F CE  1 
ATOM   6068  N  NZ  . LYS F  1 3   ? -55.044 23.246  11.993  1.00 42.37  ?  3   LYS F NZ  1 
ATOM   6069  N  N   . PRO F  1 4   ? -56.524 28.939  6.513   1.00 42.78  ?  4   PRO F N   1 
ATOM   6070  C  CA  . PRO F  1 4   ? -56.580 29.205  5.086   1.00 41.75  ?  4   PRO F CA  1 
ATOM   6071  C  C   . PRO F  1 4   ? -55.430 28.527  4.366   1.00 40.92  ?  4   PRO F C   1 
ATOM   6072  O  O   . PRO F  1 4   ? -54.489 28.092  5.013   1.00 41.57  ?  4   PRO F O   1 
ATOM   6073  C  CB  . PRO F  1 4   ? -56.354 30.708  5.036   1.00 41.85  ?  4   PRO F CB  1 
ATOM   6074  C  CG  . PRO F  1 4   ? -55.429 30.979  6.237   1.00 42.81  ?  4   PRO F CG  1 
ATOM   6075  C  CD  . PRO F  1 4   ? -55.466 29.746  7.140   1.00 42.44  ?  4   PRO F CD  1 
ATOM   6076  N  N   . HIS F  1 5   ? -55.472 28.443  3.046   1.00 39.46  ?  5   HIS F N   1 
ATOM   6077  C  CA  . HIS F  1 5   ? -54.357 27.863  2.347   1.00 38.23  ?  5   HIS F CA  1 
ATOM   6078  C  C   . HIS F  1 5   ? -53.230 28.888  2.344   1.00 36.92  ?  5   HIS F C   1 
ATOM   6079  O  O   . HIS F  1 5   ? -53.430 30.066  2.034   1.00 36.70  ?  5   HIS F O   1 
ATOM   6080  C  CB  . HIS F  1 5   ? -54.760 27.479  0.928   1.00 39.13  ?  5   HIS F CB  1 
ATOM   6081  C  CG  . HIS F  1 5   ? -55.715 26.328  0.851   1.00 41.71  ?  5   HIS F CG  1 
ATOM   6082  N  ND1 . HIS F  1 5   ? -55.630 25.358  -0.125  1.00 44.82  ?  5   HIS F ND1 1 
ATOM   6083  C  CD2 . HIS F  1 5   ? -56.786 25.997  1.614   1.00 44.49  ?  5   HIS F CD2 1 
ATOM   6084  C  CE1 . HIS F  1 5   ? -56.597 24.473  0.044   1.00 45.79  ?  5   HIS F CE1 1 
ATOM   6085  N  NE2 . HIS F  1 5   ? -57.313 24.836  1.094   1.00 47.58  ?  5   HIS F NE2 1 
ATOM   6086  N  N   . VAL F  1 6   ? -52.043 28.450  2.717   1.00 35.23  ?  6   VAL F N   1 
ATOM   6087  C  CA  . VAL F  1 6   ? -50.908 29.337  2.717   1.00 33.63  ?  6   VAL F CA  1 
ATOM   6088  C  C   . VAL F  1 6   ? -50.001 28.861  1.646   1.00 32.96  ?  6   VAL F C   1 
ATOM   6089  O  O   . VAL F  1 6   ? -49.511 27.714  1.710   1.00 33.31  ?  6   VAL F O   1 
ATOM   6090  C  CB  . VAL F  1 6   ? -50.133 29.282  4.035   1.00 33.54  ?  6   VAL F CB  1 
ATOM   6091  C  CG1 . VAL F  1 6   ? -48.851 30.100  3.933   1.00 33.07  ?  6   VAL F CG1 1 
ATOM   6092  C  CG2 . VAL F  1 6   ? -50.991 29.784  5.147   1.00 32.48  ?  6   VAL F CG2 1 
ATOM   6093  N  N   . THR F  1 7   ? -49.783 29.740  0.672   1.00 31.80  ?  7   THR F N   1 
ATOM   6094  C  CA  . THR F  1 7   ? -48.871 29.496  -0.446  1.00 30.36  ?  7   THR F CA  1 
ATOM   6095  C  C   . THR F  1 7   ? -47.764 30.520  -0.568  1.00 29.96  ?  7   THR F C   1 
ATOM   6096  O  O   . THR F  1 7   ? -47.844 31.620  -0.004  1.00 29.18  ?  7   THR F O   1 
ATOM   6097  C  CB  . THR F  1 7   ? -49.589 29.450  -1.782  1.00 30.57  ?  7   THR F CB  1 
ATOM   6098  O  OG1 . THR F  1 7   ? -50.427 30.606  -1.924  1.00 29.09  ?  7   THR F OG1 1 
ATOM   6099  C  CG2 . THR F  1 7   ? -50.413 28.153  -1.904  1.00 29.61  ?  7   THR F CG2 1 
ATOM   6100  N  N   . VAL F  1 8   ? -46.740 30.114  -1.320  1.00 29.11  ?  8   VAL F N   1 
ATOM   6101  C  CA  . VAL F  1 8   ? -45.571 30.921  -1.645  1.00 27.99  ?  8   VAL F CA  1 
ATOM   6102  C  C   . VAL F  1 8   ? -45.318 30.866  -3.170  1.00 28.13  ?  8   VAL F C   1 
ATOM   6103  O  O   . VAL F  1 8   ? -45.758 29.928  -3.841  1.00 28.56  ?  8   VAL F O   1 
ATOM   6104  C  CB  . VAL F  1 8   ? -44.318 30.404  -0.912  1.00 27.83  ?  8   VAL F CB  1 
ATOM   6105  C  CG1 . VAL F  1 8   ? -44.540 30.408  0.576   1.00 26.63  ?  8   VAL F CG1 1 
ATOM   6106  C  CG2 . VAL F  1 8   ? -43.948 29.018  -1.385  1.00 26.42  ?  8   VAL F CG2 1 
ATOM   6107  N  N   . ALA F  1 9   ? -44.602 31.857  -3.701  1.00 27.02  ?  9   ALA F N   1 
ATOM   6108  C  CA  . ALA F  1 9   ? -44.331 31.975  -5.129  1.00 26.00  ?  9   ALA F CA  1 
ATOM   6109  C  C   . ALA F  1 9   ? -43.080 32.835  -5.324  1.00 25.64  ?  9   ALA F C   1 
ATOM   6110  O  O   . ALA F  1 9   ? -42.644 33.532  -4.405  1.00 25.32  ?  9   ALA F O   1 
ATOM   6111  C  CB  . ALA F  1 9   ? -45.514 32.558  -5.861  1.00 24.72  ?  9   ALA F CB  1 
ATOM   6112  N  N   . CYS F  1 10  ? -42.476 32.749  -6.500  1.00 25.17  ?  10  CYS F N   1 
ATOM   6113  C  CA  . CYS F  1 10  ? -41.186 33.346  -6.674  1.00 25.68  ?  10  CYS F CA  1 
ATOM   6114  C  C   . CYS F  1 10  ? -41.121 34.054  -7.999  1.00 25.97  ?  10  CYS F C   1 
ATOM   6115  O  O   . CYS F  1 10  ? -41.367 33.438  -9.055  1.00 27.51  ?  10  CYS F O   1 
ATOM   6116  C  CB  . CYS F  1 10  ? -40.102 32.292  -6.621  1.00 25.98  ?  10  CYS F CB  1 
ATOM   6117  S  SG  . CYS F  1 10  ? -39.619 31.828  -4.947  1.00 27.05  ?  10  CYS F SG  1 
ATOM   6118  N  N   . VAL F  1 11  ? -40.823 35.349  -7.953  1.00 23.94  ?  11  VAL F N   1 
ATOM   6119  C  CA  . VAL F  1 11  ? -40.579 36.054  -9.147  1.00 23.03  ?  11  VAL F CA  1 
ATOM   6120  C  C   . VAL F  1 11  ? -39.106 35.945  -9.322  1.00 23.16  ?  11  VAL F C   1 
ATOM   6121  O  O   . VAL F  1 11  ? -38.328 36.504  -8.551  1.00 22.66  ?  11  VAL F O   1 
ATOM   6122  C  CB  . VAL F  1 11  ? -41.017 37.495  -9.040  1.00 23.14  ?  11  VAL F CB  1 
ATOM   6123  C  CG1 . VAL F  1 11  ? -40.425 38.307  -10.202 1.00 23.58  ?  11  VAL F CG1 1 
ATOM   6124  C  CG2 . VAL F  1 11  ? -42.488 37.559  -9.108  1.00 22.57  ?  11  VAL F CG2 1 
ATOM   6125  N  N   . VAL F  1 12  ? -38.719 35.188  -10.336 1.00 24.55  ?  12  VAL F N   1 
ATOM   6126  C  CA  . VAL F  1 12  ? -37.307 34.862  -10.590 1.00 25.00  ?  12  VAL F CA  1 
ATOM   6127  C  C   . VAL F  1 12  ? -36.926 35.486  -11.907 1.00 25.94  ?  12  VAL F C   1 
ATOM   6128  O  O   . VAL F  1 12  ? -37.603 35.308  -12.898 1.00 27.05  ?  12  VAL F O   1 
ATOM   6129  C  CB  . VAL F  1 12  ? -37.081 33.352  -10.719 1.00 24.79  ?  12  VAL F CB  1 
ATOM   6130  C  CG1 . VAL F  1 12  ? -35.612 33.031  -10.583 1.00 24.00  ?  12  VAL F CG1 1 
ATOM   6131  C  CG2 . VAL F  1 12  ? -37.905 32.589  -9.686  1.00 24.66  ?  12  VAL F CG2 1 
ATOM   6132  N  N   . HIS F  1 13  ? -35.819 36.189  -11.927 1.00 26.74  ?  13  HIS F N   1 
ATOM   6133  C  CA  . HIS F  1 13  ? -35.547 37.078  -13.004 1.00 27.46  ?  13  HIS F CA  1 
ATOM   6134  C  C   . HIS F  1 13  ? -34.053 37.036  -13.285 1.00 28.87  ?  13  HIS F C   1 
ATOM   6135  O  O   . HIS F  1 13  ? -33.203 37.008  -12.365 1.00 27.94  ?  13  HIS F O   1 
ATOM   6136  C  CB  . HIS F  1 13  ? -36.021 38.478  -12.601 1.00 27.24  ?  13  HIS F CB  1 
ATOM   6137  C  CG  . HIS F  1 13  ? -35.468 39.579  -13.442 1.00 25.43  ?  13  HIS F CG  1 
ATOM   6138  N  ND1 . HIS F  1 13  ? -36.064 39.983  -14.619 1.00 23.97  ?  13  HIS F ND1 1 
ATOM   6139  C  CD2 . HIS F  1 13  ? -34.397 40.388  -13.260 1.00 24.15  ?  13  HIS F CD2 1 
ATOM   6140  C  CE1 . HIS F  1 13  ? -35.376 40.989  -15.131 1.00 24.65  ?  13  HIS F CE1 1 
ATOM   6141  N  NE2 . HIS F  1 13  ? -34.350 41.245  -14.332 1.00 25.15  ?  13  HIS F NE2 1 
ATOM   6142  N  N   . ALA F  1 14  ? -33.759 36.986  -14.582 1.00 30.51  ?  14  ALA F N   1 
ATOM   6143  C  CA  . ALA F  1 14  ? -32.403 36.881  -15.078 1.00 32.49  ?  14  ALA F CA  1 
ATOM   6144  C  C   . ALA F  1 14  ? -32.404 37.361  -16.510 1.00 33.56  ?  14  ALA F C   1 
ATOM   6145  O  O   . ALA F  1 14  ? -33.338 37.061  -17.292 1.00 33.23  ?  14  ALA F O   1 
ATOM   6146  C  CB  . ALA F  1 14  ? -31.870 35.424  -14.977 1.00 32.31  ?  14  ALA F CB  1 
ATOM   6147  N  N   . GLU F  1 15  ? -31.368 38.133  -16.836 1.00 35.32  ?  15  GLU F N   1 
ATOM   6148  C  CA  . GLU F  1 15  ? -31.208 38.719  -18.182 1.00 37.11  ?  15  GLU F CA  1 
ATOM   6149  C  C   . GLU F  1 15  ? -32.552 39.117  -18.771 1.00 36.83  ?  15  GLU F C   1 
ATOM   6150  O  O   . GLU F  1 15  ? -32.941 38.632  -19.843 1.00 37.56  ?  15  GLU F O   1 
ATOM   6151  C  CB  . GLU F  1 15  ? -30.462 37.756  -19.134 1.00 37.47  ?  15  GLU F CB  1 
ATOM   6152  C  CG  . GLU F  1 15  ? -29.126 37.240  -18.541 1.00 40.79  ?  15  GLU F CG  1 
ATOM   6153  C  CD  . GLU F  1 15  ? -28.358 36.259  -19.433 1.00 45.05  ?  15  GLU F CD  1 
ATOM   6154  O  OE1 . GLU F  1 15  ? -27.108 36.218  -19.290 1.00 45.86  ?  15  GLU F OE1 1 
ATOM   6155  O  OE2 . GLU F  1 15  ? -28.987 35.531  -20.250 1.00 47.30  -1 15  GLU F OE2 1 
ATOM   6156  N  N   . GLY F  1 16  ? -33.271 39.971  -18.045 1.00 36.16  ?  16  GLY F N   1 
ATOM   6157  C  CA  . GLY F  1 16  ? -34.456 40.601  -18.589 1.00 36.04  ?  16  GLY F CA  1 
ATOM   6158  C  C   . GLY F  1 16  ? -35.708 39.762  -18.767 1.00 36.34  ?  16  GLY F C   1 
ATOM   6159  O  O   . GLY F  1 16  ? -36.749 40.286  -19.156 1.00 35.77  ?  16  GLY F O   1 
ATOM   6160  N  N   . LYS F  1 17  ? -35.653 38.468  -18.479 1.00 36.57  ?  17  LYS F N   1 
ATOM   6161  C  CA  . LYS F  1 17  ? -36.899 37.736  -18.518 1.00 36.91  ?  17  LYS F CA  1 
ATOM   6162  C  C   . LYS F  1 17  ? -37.322 37.146  -17.178 1.00 36.61  ?  17  LYS F C   1 
ATOM   6163  O  O   . LYS F  1 17  ? -36.647 37.305  -16.144 1.00 35.74  ?  17  LYS F O   1 
ATOM   6164  C  CB  . LYS F  1 17  ? -36.940 36.713  -19.676 1.00 37.65  ?  17  LYS F CB  1 
ATOM   6165  C  CG  . LYS F  1 17  ? -36.965 37.366  -21.068 1.00 39.53  ?  17  LYS F CG  1 
ATOM   6166  C  CD  . LYS F  1 17  ? -37.091 36.341  -22.195 1.00 41.90  ?  17  LYS F CD  1 
ATOM   6167  C  CE  . LYS F  1 17  ? -37.834 36.914  -23.453 1.00 43.36  ?  17  LYS F CE  1 
ATOM   6168  N  NZ  . LYS F  1 17  ? -38.469 35.865  -24.379 1.00 40.44  ?  17  LYS F NZ  1 
ATOM   6169  N  N   . PHE F  1 18  ? -38.471 36.477  -17.235 1.00 36.52  ?  18  PHE F N   1 
ATOM   6170  C  CA  . PHE F  1 18  ? -39.175 36.006  -16.079 1.00 36.48  ?  18  PHE F CA  1 
ATOM   6171  C  C   . PHE F  1 18  ? -39.541 34.534  -16.198 1.00 37.21  ?  18  PHE F C   1 
ATOM   6172  O  O   . PHE F  1 18  ? -40.281 34.108  -17.098 1.00 36.75  ?  18  PHE F O   1 
ATOM   6173  C  CB  . PHE F  1 18  ? -40.402 36.874  -15.852 1.00 36.02  ?  18  PHE F CB  1 
ATOM   6174  C  CG  . PHE F  1 18  ? -40.067 38.200  -15.307 1.00 35.03  ?  18  PHE F CG  1 
ATOM   6175  C  CD1 . PHE F  1 18  ? -39.914 38.382  -13.944 1.00 34.44  ?  18  PHE F CD1 1 
ATOM   6176  C  CD2 . PHE F  1 18  ? -39.855 39.269  -16.143 1.00 34.87  ?  18  PHE F CD2 1 
ATOM   6177  C  CE1 . PHE F  1 18  ? -39.555 39.621  -13.429 1.00 34.37  ?  18  PHE F CE1 1 
ATOM   6178  C  CE2 . PHE F  1 18  ? -39.500 40.515  -15.616 1.00 34.12  ?  18  PHE F CE2 1 
ATOM   6179  C  CZ  . PHE F  1 18  ? -39.352 40.682  -14.263 1.00 31.90  ?  18  PHE F CZ  1 
ATOM   6180  N  N   . LEU F  1 19  ? -38.992 33.774  -15.256 1.00 37.69  ?  19  LEU F N   1 
ATOM   6181  C  CA  . LEU F  1 19  ? -39.216 32.354  -15.155 1.00 37.85  ?  19  LEU F CA  1 
ATOM   6182  C  C   . LEU F  1 19  ? -40.646 32.119  -14.804 1.00 37.91  ?  19  LEU F C   1 
ATOM   6183  O  O   . LEU F  1 19  ? -41.085 32.436  -13.724 1.00 37.58  ?  19  LEU F O   1 
ATOM   6184  C  CB  . LEU F  1 19  ? -38.310 31.734  -14.077 1.00 38.07  ?  19  LEU F CB  1 
ATOM   6185  C  CG  . LEU F  1 19  ? -38.489 30.240  -13.765 1.00 37.62  ?  19  LEU F CG  1 
ATOM   6186  C  CD1 . LEU F  1 19  ? -38.798 29.482  -15.034 1.00 36.26  ?  19  LEU F CD1 1 
ATOM   6187  C  CD2 . LEU F  1 19  ? -37.271 29.632  -13.055 1.00 36.76  ?  19  LEU F CD2 1 
ATOM   6188  N  N   . VAL F  1 20  ? -41.355 31.500  -15.718 1.00 39.12  ?  20  VAL F N   1 
ATOM   6189  C  CA  . VAL F  1 20  ? -42.710 31.100  -15.457 1.00 40.64  ?  20  VAL F CA  1 
ATOM   6190  C  C   . VAL F  1 20  ? -42.861 29.571  -15.717 1.00 42.32  ?  20  VAL F C   1 
ATOM   6191  O  O   . VAL F  1 20  ? -42.106 28.994  -16.499 1.00 41.85  ?  20  VAL F O   1 
ATOM   6192  C  CB  . VAL F  1 20  ? -43.626 31.996  -16.298 1.00 39.98  ?  20  VAL F CB  1 
ATOM   6193  C  CG1 . VAL F  1 20  ? -43.270 31.894  -17.783 1.00 39.92  ?  20  VAL F CG1 1 
ATOM   6194  C  CG2 . VAL F  1 20  ? -45.047 31.699  -16.055 1.00 39.76  ?  20  VAL F CG2 1 
ATOM   6195  N  N   . VAL F  1 21  ? -43.797 28.915  -15.024 1.00 45.04  ?  21  VAL F N   1 
ATOM   6196  C  CA  . VAL F  1 21  ? -44.032 27.467  -15.212 1.00 47.18  ?  21  VAL F CA  1 
ATOM   6197  C  C   . VAL F  1 21  ? -45.370 27.197  -15.868 1.00 49.28  ?  21  VAL F C   1 
ATOM   6198  O  O   . VAL F  1 21  ? -46.350 27.885  -15.604 1.00 49.04  ?  21  VAL F O   1 
ATOM   6199  C  CB  . VAL F  1 21  ? -43.929 26.594  -13.895 1.00 46.73  ?  21  VAL F CB  1 
ATOM   6200  C  CG1 . VAL F  1 21  ? -42.587 26.739  -13.194 1.00 45.22  ?  21  VAL F CG1 1 
ATOM   6201  C  CG2 . VAL F  1 21  ? -45.075 26.867  -12.936 1.00 47.02  ?  21  VAL F CG2 1 
ATOM   6202  N  N   . GLU F  1 22  ? -45.396 26.150  -16.696 1.00 52.54  ?  22  GLU F N   1 
ATOM   6203  C  CA  . GLU F  1 22  ? -46.590 25.733  -17.449 1.00 55.45  ?  22  GLU F CA  1 
ATOM   6204  C  C   . GLU F  1 22  ? -47.362 24.621  -16.754 1.00 56.61  ?  22  GLU F C   1 
ATOM   6205  O  O   . GLU F  1 22  ? -46.774 23.694  -16.202 1.00 56.62  ?  22  GLU F O   1 
ATOM   6206  C  CB  . GLU F  1 22  ? -46.167 25.255  -18.827 1.00 55.66  ?  22  GLU F CB  1 
ATOM   6207  C  CG  . GLU F  1 22  ? -47.155 25.527  -19.933 1.00 58.16  ?  22  GLU F CG  1 
ATOM   6208  C  CD  . GLU F  1 22  ? -46.513 25.325  -21.301 1.00 61.77  ?  22  GLU F CD  1 
ATOM   6209  O  OE1 . GLU F  1 22  ? -46.656 24.214  -21.888 1.00 62.35  ?  22  GLU F OE1 1 
ATOM   6210  O  OE2 . GLU F  1 22  ? -45.836 26.274  -21.767 1.00 62.47  -1 22  GLU F OE2 1 
ATOM   6211  N  N   . GLU F  1 23  ? -48.683 24.710  -16.795 1.00 58.73  ?  23  GLU F N   1 
ATOM   6212  C  CA  . GLU F  1 23  ? -49.515 23.743  -16.093 1.00 61.16  ?  23  GLU F CA  1 
ATOM   6213  C  C   . GLU F  1 23  ? -50.972 23.738  -16.600 1.00 62.35  ?  23  GLU F C   1 
ATOM   6214  O  O   . GLU F  1 23  ? -51.505 24.777  -16.986 1.00 62.52  ?  23  GLU F O   1 
ATOM   6215  C  CB  . GLU F  1 23  ? -49.458 24.036  -14.595 1.00 61.51  ?  23  GLU F CB  1 
ATOM   6216  C  CG  . GLU F  1 23  ? -49.619 22.818  -13.678 1.00 63.92  ?  23  GLU F CG  1 
ATOM   6217  C  CD  . GLU F  1 23  ? -49.700 23.206  -12.192 1.00 66.23  ?  23  GLU F CD  1 
ATOM   6218  O  OE1 . GLU F  1 23  ? -49.084 24.240  -11.806 1.00 66.21  ?  23  GLU F OE1 1 
ATOM   6219  O  OE2 . GLU F  1 23  ? -50.389 22.474  -11.426 1.00 67.04  -1 23  GLU F OE2 1 
ATOM   6220  N  N   . THR F  1 24  ? -51.613 22.569  -16.581 1.00 63.79  ?  24  THR F N   1 
ATOM   6221  C  CA  . THR F  1 24  ? -52.950 22.406  -17.158 1.00 65.07  ?  24  THR F CA  1 
ATOM   6222  C  C   . THR F  1 24  ? -54.065 22.316  -16.073 1.00 66.35  ?  24  THR F C   1 
ATOM   6223  O  O   . THR F  1 24  ? -53.895 21.621  -15.057 1.00 66.30  ?  24  THR F O   1 
ATOM   6224  C  CB  . THR F  1 24  ? -52.968 21.197  -18.146 1.00 64.94  ?  24  THR F CB  1 
ATOM   6225  O  OG1 . THR F  1 24  ? -51.788 21.222  -18.954 1.00 64.10  ?  24  THR F OG1 1 
ATOM   6226  C  CG2 . THR F  1 24  ? -54.161 21.246  -19.067 1.00 64.94  ?  24  THR F CG2 1 
ATOM   6227  N  N   . ILE F  1 25  ? -55.175 23.042  -16.293 1.00 67.41  ?  25  ILE F N   1 
ATOM   6228  C  CA  . ILE F  1 25  ? -56.397 22.999  -15.434 1.00 68.69  ?  25  ILE F CA  1 
ATOM   6229  C  C   . ILE F  1 25  ? -57.296 21.756  -15.723 1.00 68.97  ?  25  ILE F C   1 
ATOM   6230  O  O   . ILE F  1 25  ? -56.881 20.598  -15.540 1.00 69.33  ?  25  ILE F O   1 
ATOM   6231  C  CB  . ILE F  1 25  ? -57.264 24.354  -15.549 1.00 68.89  ?  25  ILE F CB  1 
ATOM   6232  C  CG1 . ILE F  1 25  ? -58.331 24.459  -14.413 1.00 69.42  ?  25  ILE F CG1 1 
ATOM   6233  C  CG2 . ILE F  1 25  ? -57.837 24.552  -17.006 1.00 69.03  ?  25  ILE F CG2 1 
ATOM   6234  C  CD1 . ILE F  1 25  ? -59.272 25.725  -14.396 1.00 68.32  ?  25  ILE F CD1 1 
ATOM   6235  N  N   . ASN F  1 26  ? -58.541 22.031  -16.120 1.00 69.00  ?  26  ASN F N   1 
ATOM   6236  C  CA  . ASN F  1 26  ? -59.351 21.129  -16.916 1.00 68.73  ?  26  ASN F CA  1 
ATOM   6237  C  C   . ASN F  1 26  ? -58.939 21.413  -18.384 1.00 68.67  ?  26  ASN F C   1 
ATOM   6238  O  O   . ASN F  1 26  ? -59.646 22.110  -19.134 1.00 68.65  ?  26  ASN F O   1 
ATOM   6239  C  CB  . ASN F  1 26  ? -60.873 21.389  -16.724 1.00 68.82  ?  26  ASN F CB  1 
ATOM   6240  C  CG  . ASN F  1 26  ? -61.281 21.823  -15.273 1.00 68.32  ?  26  ASN F CG  1 
ATOM   6241  O  OD1 . ASN F  1 26  ? -60.455 21.998  -14.364 1.00 65.15  ?  26  ASN F OD1 1 
ATOM   6242  N  ND2 . ASN F  1 26  ? -62.593 21.999  -15.084 1.00 67.70  ?  26  ASN F ND2 1 
ATOM   6243  N  N   . GLY F  1 27  ? -57.762 20.930  -18.771 1.00 68.17  ?  27  GLY F N   1 
ATOM   6244  C  CA  . GLY F  1 27  ? -57.382 20.912  -20.179 1.00 67.75  ?  27  GLY F CA  1 
ATOM   6245  C  C   . GLY F  1 27  ? -57.015 22.197  -20.915 1.00 67.48  ?  27  GLY F C   1 
ATOM   6246  O  O   . GLY F  1 27  ? -57.091 22.235  -22.149 1.00 67.38  ?  27  GLY F O   1 
ATOM   6247  N  N   . LYS F  1 28  ? -56.610 23.251  -20.200 1.00 66.94  ?  28  LYS F N   1 
ATOM   6248  C  CA  . LYS F  1 28  ? -55.825 24.324  -20.876 1.00 66.04  ?  28  LYS F CA  1 
ATOM   6249  C  C   . LYS F  1 28  ? -54.476 24.616  -20.196 1.00 64.75  ?  28  LYS F C   1 
ATOM   6250  O  O   . LYS F  1 28  ? -54.304 24.335  -19.005 1.00 64.65  ?  28  LYS F O   1 
ATOM   6251  C  CB  . LYS F  1 28  ? -56.654 25.595  -21.156 1.00 66.48  ?  28  LYS F CB  1 
ATOM   6252  C  CG  . LYS F  1 28  ? -57.180 25.682  -22.619 1.00 66.87  ?  28  LYS F CG  1 
ATOM   6253  C  CD  . LYS F  1 28  ? -58.410 26.614  -22.756 1.00 66.10  ?  28  LYS F CD  1 
ATOM   6254  C  CE  . LYS F  1 28  ? -58.963 26.613  -24.185 1.00 64.86  ?  28  LYS F CE  1 
ATOM   6255  N  NZ  . LYS F  1 28  ? -60.346 27.161  -24.284 1.00 63.89  ?  28  LYS F NZ  1 
ATOM   6256  N  N   . ALA F  1 29  ? -53.525 25.149  -20.965 1.00 62.95  ?  29  ALA F N   1 
ATOM   6257  C  CA  . ALA F  1 29  ? -52.148 25.326  -20.484 1.00 61.39  ?  29  ALA F CA  1 
ATOM   6258  C  C   . ALA F  1 29  ? -51.928 26.718  -19.890 1.00 60.23  ?  29  ALA F C   1 
ATOM   6259  O  O   . ALA F  1 29  ? -51.850 27.734  -20.609 1.00 60.45  ?  29  ALA F O   1 
ATOM   6260  C  CB  . ALA F  1 29  ? -51.141 25.037  -21.592 1.00 61.46  ?  29  ALA F CB  1 
ATOM   6261  N  N   . LEU F  1 30  ? -51.821 26.747  -18.565 1.00 58.31  ?  30  LEU F N   1 
ATOM   6262  C  CA  . LEU F  1 30  ? -51.850 27.992  -17.795 1.00 56.11  ?  30  LEU F CA  1 
ATOM   6263  C  C   . LEU F  1 30  ? -50.533 28.293  -17.085 1.00 54.20  ?  30  LEU F C   1 
ATOM   6264  O  O   . LEU F  1 30  ? -50.032 27.476  -16.313 1.00 54.19  ?  30  LEU F O   1 
ATOM   6265  C  CB  . LEU F  1 30  ? -53.008 27.946  -16.790 1.00 56.18  ?  30  LEU F CB  1 
ATOM   6266  C  CG  . LEU F  1 30  ? -54.417 28.481  -17.123 1.00 56.75  ?  30  LEU F CG  1 
ATOM   6267  C  CD1 . LEU F  1 30  ? -54.960 28.061  -18.491 1.00 57.51  ?  30  LEU F CD1 1 
ATOM   6268  C  CD2 . LEU F  1 30  ? -55.399 28.065  -16.021 1.00 56.59  ?  30  LEU F CD2 1 
ATOM   6269  N  N   . TRP F  1 31  ? -49.979 29.468  -17.350 1.00 51.93  ?  31  TRP F N   1 
ATOM   6270  C  CA  . TRP F  1 31  ? -48.787 29.933  -16.626 1.00 50.53  ?  31  TRP F CA  1 
ATOM   6271  C  C   . TRP F  1 31  ? -49.003 30.381  -15.151 1.00 48.62  ?  31  TRP F C   1 
ATOM   6272  O  O   . TRP F  1 31  ? -50.085 30.851  -14.777 1.00 48.27  ?  31  TRP F O   1 
ATOM   6273  C  CB  . TRP F  1 31  ? -48.088 31.056  -17.394 1.00 50.93  ?  31  TRP F CB  1 
ATOM   6274  C  CG  . TRP F  1 31  ? -47.681 30.714  -18.792 1.00 52.98  ?  31  TRP F CG  1 
ATOM   6275  C  CD1 . TRP F  1 31  ? -47.546 29.464  -19.329 1.00 53.82  ?  31  TRP F CD1 1 
ATOM   6276  C  CD2 . TRP F  1 31  ? -47.336 31.644  -19.836 1.00 55.74  ?  31  TRP F CD2 1 
ATOM   6277  N  NE1 . TRP F  1 31  ? -47.152 29.559  -20.638 1.00 55.65  ?  31  TRP F NE1 1 
ATOM   6278  C  CE2 . TRP F  1 31  ? -47.016 30.884  -20.978 1.00 56.30  ?  31  TRP F CE2 1 
ATOM   6279  C  CE3 . TRP F  1 31  ? -47.274 33.048  -19.917 1.00 56.07  ?  31  TRP F CE3 1 
ATOM   6280  C  CZ2 . TRP F  1 31  ? -46.629 31.479  -22.187 1.00 56.36  ?  31  TRP F CZ2 1 
ATOM   6281  C  CZ3 . TRP F  1 31  ? -46.890 33.634  -21.119 1.00 56.16  ?  31  TRP F CZ3 1 
ATOM   6282  C  CH2 . TRP F  1 31  ? -46.573 32.850  -22.233 1.00 57.13  ?  31  TRP F CH2 1 
ATOM   6283  N  N   . ASN F  1 32  ? -47.947 30.209  -14.344 1.00 46.31  ?  32  ASN F N   1 
ATOM   6284  C  CA  . ASN F  1 32  ? -47.839 30.684  -12.944 1.00 44.10  ?  32  ASN F CA  1 
ATOM   6285  C  C   . ASN F  1 32  ? -46.382 31.170  -12.676 1.00 42.08  ?  32  ASN F C   1 
ATOM   6286  O  O   . ASN F  1 32  ? -45.528 30.993  -13.546 1.00 42.39  ?  32  ASN F O   1 
ATOM   6287  C  CB  . ASN F  1 32  ? -48.218 29.546  -11.977 1.00 43.96  ?  32  ASN F CB  1 
ATOM   6288  C  CG  . ASN F  1 32  ? -48.565 30.046  -10.570 1.00 43.97  ?  32  ASN F CG  1 
ATOM   6289  O  OD1 . ASN F  1 32  ? -48.561 31.262  -10.293 1.00 44.21  ?  32  ASN F OD1 1 
ATOM   6290  N  ND2 . ASN F  1 32  ? -48.876 29.101  -9.672  1.00 42.23  ?  32  ASN F ND2 1 
ATOM   6291  N  N   . GLN F  1 33  ? -46.082 31.774  -11.518 1.00 38.95  ?  33  GLN F N   1 
ATOM   6292  C  CA  . GLN F  1 33  ? -44.684 31.808  -11.049 1.00 36.45  ?  33  GLN F CA  1 
ATOM   6293  C  C   . GLN F  1 33  ? -44.496 30.413  -10.506 1.00 34.80  ?  33  GLN F C   1 
ATOM   6294  O  O   . GLN F  1 33  ? -45.487 29.780  -10.192 1.00 35.02  ?  33  GLN F O   1 
ATOM   6295  C  CB  . GLN F  1 33  ? -44.466 32.791  -9.889  1.00 36.19  ?  33  GLN F CB  1 
ATOM   6296  C  CG  . GLN F  1 33  ? -44.419 34.262  -10.240 1.00 35.06  ?  33  GLN F CG  1 
ATOM   6297  C  CD  . GLN F  1 33  ? -45.785 34.821  -10.629 1.00 34.65  ?  33  GLN F CD  1 
ATOM   6298  O  OE1 . GLN F  1 33  ? -46.840 34.429  -10.099 1.00 33.13  ?  33  GLN F OE1 1 
ATOM   6299  N  NE2 . GLN F  1 33  ? -45.766 35.747  -11.566 1.00 35.87  ?  33  GLN F NE2 1 
ATOM   6300  N  N   . PRO F  1 34  ? -43.252 29.932  -10.374 1.00 33.31  ?  34  PRO F N   1 
ATOM   6301  C  CA  . PRO F  1 34  ? -43.078 28.735  -9.579  1.00 33.12  ?  34  PRO F CA  1 
ATOM   6302  C  C   . PRO F  1 34  ? -43.638 29.024  -8.205  1.00 33.22  ?  34  PRO F C   1 
ATOM   6303  O  O   . PRO F  1 34  ? -43.184 29.929  -7.513  1.00 33.38  ?  34  PRO F O   1 
ATOM   6304  C  CB  . PRO F  1 34  ? -41.558 28.549  -9.497  1.00 33.42  ?  34  PRO F CB  1 
ATOM   6305  C  CG  . PRO F  1 34  ? -40.960 29.457  -10.494 1.00 32.69  ?  34  PRO F CG  1 
ATOM   6306  C  CD  . PRO F  1 34  ? -41.989 30.444  -10.928 1.00 33.67  ?  34  PRO F CD  1 
ATOM   6307  N  N   . ALA F  1 35  ? -44.663 28.292  -7.838  1.00 33.30  ?  35  ALA F N   1 
ATOM   6308  C  CA  . ALA F  1 35  ? -45.338 28.552  -6.608  1.00 33.89  ?  35  ALA F CA  1 
ATOM   6309  C  C   . ALA F  1 35  ? -45.668 27.192  -6.006  1.00 34.10  ?  35  ALA F C   1 
ATOM   6310  O  O   . ALA F  1 35  ? -45.207 26.176  -6.512  1.00 34.61  ?  35  ALA F O   1 
ATOM   6311  C  CB  . ALA F  1 35  ? -46.599 29.353  -6.882  1.00 33.93  ?  35  ALA F CB  1 
ATOM   6312  N  N   . GLY F  1 36  ? -46.471 27.173  -4.948  1.00 34.23  ?  36  GLY F N   1 
ATOM   6313  C  CA  . GLY F  1 36  ? -46.854 25.938  -4.292  1.00 33.92  ?  36  GLY F CA  1 
ATOM   6314  C  C   . GLY F  1 36  ? -47.332 26.194  -2.888  1.00 34.03  ?  36  GLY F C   1 
ATOM   6315  O  O   . GLY F  1 36  ? -47.325 27.351  -2.424  1.00 34.44  ?  36  GLY F O   1 
ATOM   6316  N  N   . HIS F  1 37  ? -47.753 25.116  -2.218  1.00 33.32  ?  37  HIS F N   1 
ATOM   6317  C  CA  . HIS F  1 37  ? -48.398 25.196  -0.919  1.00 31.95  ?  37  HIS F CA  1 
ATOM   6318  C  C   . HIS F  1 37  ? -47.371 25.033  0.147   1.00 31.57  ?  37  HIS F C   1 
ATOM   6319  O  O   . HIS F  1 37  ? -46.507 24.166  0.024   1.00 30.98  ?  37  HIS F O   1 
ATOM   6320  C  CB  . HIS F  1 37  ? -49.406 24.071  -0.776  1.00 31.90  ?  37  HIS F CB  1 
ATOM   6321  C  CG  . HIS F  1 37  ? -50.782 24.463  -1.157  1.00 32.22  ?  37  HIS F CG  1 
ATOM   6322  N  ND1 . HIS F  1 37  ? -51.134 24.744  -2.456  1.00 33.09  ?  37  HIS F ND1 1 
ATOM   6323  C  CD2 . HIS F  1 37  ? -51.895 24.662  -0.407  1.00 32.91  ?  37  HIS F CD2 1 
ATOM   6324  C  CE1 . HIS F  1 37  ? -52.410 25.094  -2.493  1.00 33.10  ?  37  HIS F CE1 1 
ATOM   6325  N  NE2 . HIS F  1 37  ? -52.894 25.052  -1.263  1.00 31.65  ?  37  HIS F NE2 1 
ATOM   6326  N  N   . LEU F  1 38  ? -47.492 25.819  1.218   1.00 31.35  ?  38  LEU F N   1 
ATOM   6327  C  CA  . LEU F  1 38  ? -46.573 25.684  2.331   1.00 30.92  ?  38  LEU F CA  1 
ATOM   6328  C  C   . LEU F  1 38  ? -46.810 24.327  2.940   1.00 31.71  ?  38  LEU F C   1 
ATOM   6329  O  O   . LEU F  1 38  ? -47.953 23.870  3.058   1.00 31.63  ?  38  LEU F O   1 
ATOM   6330  C  CB  . LEU F  1 38  ? -46.738 26.809  3.358   1.00 30.15  ?  38  LEU F CB  1 
ATOM   6331  C  CG  . LEU F  1 38  ? -46.058 26.624  4.728   1.00 28.65  ?  38  LEU F CG  1 
ATOM   6332  C  CD1 . LEU F  1 38  ? -44.579 26.813  4.712   1.00 25.14  ?  38  LEU F CD1 1 
ATOM   6333  C  CD2 . LEU F  1 38  ? -46.684 27.510  5.791   1.00 27.56  ?  38  LEU F CD2 1 
ATOM   6334  N  N   . GLU F  1 39  ? -45.726 23.655  3.298   1.00 32.47  ?  39  GLU F N   1 
ATOM   6335  C  CA  . GLU F  1 39  ? -45.855 22.302  3.835   1.00 33.29  ?  39  GLU F CA  1 
ATOM   6336  C  C   . GLU F  1 39  ? -45.539 22.335  5.351   1.00 32.96  ?  39  GLU F C   1 
ATOM   6337  O  O   . GLU F  1 39  ? -45.139 23.380  5.896   1.00 33.09  ?  39  GLU F O   1 
ATOM   6338  C  CB  . GLU F  1 39  ? -44.936 21.350  3.029   1.00 33.79  ?  39  GLU F CB  1 
ATOM   6339  C  CG  . GLU F  1 39  ? -45.530 20.000  2.479   1.00 37.03  ?  39  GLU F CG  1 
ATOM   6340  C  CD  . GLU F  1 39  ? -47.076 19.974  2.234   1.00 41.66  ?  39  GLU F CD  1 
ATOM   6341  O  OE1 . GLU F  1 39  ? -47.471 20.150  1.049   1.00 42.64  ?  39  GLU F OE1 1 
ATOM   6342  O  OE2 . GLU F  1 39  ? -47.881 19.730  3.204   1.00 41.51  -1 39  GLU F OE2 1 
ATOM   6343  N  N   . ALA F  1 40  ? -45.730 21.209  6.031   1.00 32.34  ?  40  ALA F N   1 
ATOM   6344  C  CA  . ALA F  1 40  ? -45.527 21.134  7.475   1.00 31.64  ?  40  ALA F CA  1 
ATOM   6345  C  C   . ALA F  1 40  ? -44.065 21.196  7.846   1.00 31.27  ?  40  ALA F C   1 
ATOM   6346  O  O   . ALA F  1 40  ? -43.196 20.734  7.100   1.00 32.29  ?  40  ALA F O   1 
ATOM   6347  C  CB  . ALA F  1 40  ? -46.131 19.868  8.011   1.00 31.76  ?  40  ALA F CB  1 
ATOM   6348  N  N   . ASP F  1 41  ? -43.791 21.772  9.002   1.00 30.09  ?  41  ASP F N   1 
ATOM   6349  C  CA  . ASP F  1 41  ? -42.432 21.842  9.540   1.00 29.62  ?  41  ASP F CA  1 
ATOM   6350  C  C   . ASP F  1 41  ? -41.357 22.422  8.594   1.00 28.36  ?  41  ASP F C   1 
ATOM   6351  O  O   . ASP F  1 41  ? -40.163 22.085  8.670   1.00 27.51  ?  41  ASP F O   1 
ATOM   6352  C  CB  . ASP F  1 41  ? -42.035 20.493  10.170  1.00 30.30  ?  41  ASP F CB  1 
ATOM   6353  C  CG  . ASP F  1 41  ? -42.963 20.088  11.352  1.00 32.11  ?  41  ASP F CG  1 
ATOM   6354  O  OD1 . ASP F  1 41  ? -42.823 18.918  11.788  1.00 36.94  ?  41  ASP F OD1 1 
ATOM   6355  O  OD2 . ASP F  1 41  ? -43.798 20.913  11.855  1.00 29.12  -1 41  ASP F OD2 1 
ATOM   6356  N  N   . GLU F  1 42  ? -41.800 23.340  7.738   1.00 27.48  ?  42  GLU F N   1 
ATOM   6357  C  CA  . GLU F  1 42  ? -40.886 24.173  6.968   1.00 26.76  ?  42  GLU F CA  1 
ATOM   6358  C  C   . GLU F  1 42  ? -41.225 25.646  7.070   1.00 26.09  ?  42  GLU F C   1 
ATOM   6359  O  O   . GLU F  1 42  ? -42.404 26.068  7.115   1.00 25.64  ?  42  GLU F O   1 
ATOM   6360  C  CB  . GLU F  1 42  ? -40.843 23.766  5.494   1.00 26.77  ?  42  GLU F CB  1 
ATOM   6361  C  CG  . GLU F  1 42  ? -42.116 24.052  4.736   1.00 27.90  ?  42  GLU F CG  1 
ATOM   6362  C  CD  . GLU F  1 42  ? -42.084 23.523  3.327   1.00 31.84  ?  42  GLU F CD  1 
ATOM   6363  O  OE1 . GLU F  1 42  ? -40.989 23.128  2.856   1.00 33.11  ?  42  GLU F OE1 1 
ATOM   6364  O  OE2 . GLU F  1 42  ? -43.166 23.504  2.687   1.00 33.70  -1 42  GLU F OE2 1 
ATOM   6365  N  N   . THR F  1 43  ? -40.142 26.406  7.085   1.00 25.27  ?  43  THR F N   1 
ATOM   6366  C  CA  . THR F  1 43  ? -40.125 27.845  6.929   1.00 24.79  ?  43  THR F CA  1 
ATOM   6367  C  C   . THR F  1 43  ? -40.697 28.305  5.593   1.00 23.79  ?  43  THR F C   1 
ATOM   6368  O  O   . THR F  1 43  ? -40.718 27.526  4.636   1.00 23.38  ?  43  THR F O   1 
ATOM   6369  C  CB  . THR F  1 43  ? -38.696 28.244  7.061   1.00 25.04  ?  43  THR F CB  1 
ATOM   6370  O  OG1 . THR F  1 43  ? -38.540 28.969  8.282   1.00 28.31  ?  43  THR F OG1 1 
ATOM   6371  C  CG2 . THR F  1 43  ? -38.241 29.056  5.938   1.00 25.49  ?  43  THR F CG2 1 
ATOM   6372  N  N   . LEU F  1 44  ? -41.195 29.550  5.523   1.00 22.88  ?  44  LEU F N   1 
ATOM   6373  C  CA  . LEU F  1 44  ? -41.724 30.076  4.250   1.00 21.47  ?  44  LEU F CA  1 
ATOM   6374  C  C   . LEU F  1 44  ? -40.608 30.166  3.165   1.00 22.07  ?  44  LEU F C   1 
ATOM   6375  O  O   . LEU F  1 44  ? -40.850 29.875  1.996   1.00 21.06  ?  44  LEU F O   1 
ATOM   6376  C  CB  . LEU F  1 44  ? -42.495 31.394  4.429   1.00 20.57  ?  44  LEU F CB  1 
ATOM   6377  C  CG  . LEU F  1 44  ? -43.851 31.448  5.167   1.00 19.58  ?  44  LEU F CG  1 
ATOM   6378  C  CD1 . LEU F  1 44  ? -44.280 32.869  5.509   1.00 16.94  ?  44  LEU F CD1 1 
ATOM   6379  C  CD2 . LEU F  1 44  ? -44.998 30.771  4.427   1.00 18.00  ?  44  LEU F CD2 1 
ATOM   6380  N  N   . VAL F  1 45  ? -39.374 30.530  3.529   1.00 23.26  ?  45  VAL F N   1 
ATOM   6381  C  CA  . VAL F  1 45  ? -38.346 30.531  2.473   1.00 24.63  ?  45  VAL F CA  1 
ATOM   6382  C  C   . VAL F  1 45  ? -37.956 29.112  2.097   1.00 24.99  ?  45  VAL F C   1 
ATOM   6383  O  O   . VAL F  1 45  ? -37.779 28.818  0.912   1.00 25.46  ?  45  VAL F O   1 
ATOM   6384  C  CB  . VAL F  1 45  ? -37.134 31.488  2.672   1.00 24.42  ?  45  VAL F CB  1 
ATOM   6385  C  CG1 . VAL F  1 45  ? -37.614 32.837  3.137   1.00 25.24  ?  45  VAL F CG1 1 
ATOM   6386  C  CG2 . VAL F  1 45  ? -36.117 30.931  3.632   1.00 25.22  ?  45  VAL F CG2 1 
ATOM   6387  N  N   . GLU F  1 46  ? -37.885 28.225  3.085   1.00 24.62  ?  46  GLU F N   1 
ATOM   6388  C  CA  . GLU F  1 46  ? -37.660 26.830  2.787   1.00 24.68  ?  46  GLU F CA  1 
ATOM   6389  C  C   . GLU F  1 46  ? -38.710 26.357  1.831   1.00 24.93  ?  46  GLU F C   1 
ATOM   6390  O  O   . GLU F  1 46  ? -38.399 25.587  0.920   1.00 25.14  ?  46  GLU F O   1 
ATOM   6391  C  CB  . GLU F  1 46  ? -37.692 25.976  4.031   1.00 24.57  ?  46  GLU F CB  1 
ATOM   6392  C  CG  . GLU F  1 46  ? -36.291 25.594  4.498   1.00 27.06  ?  46  GLU F CG  1 
ATOM   6393  C  CD  . GLU F  1 46  ? -36.270 25.097  5.940   1.00 29.79  ?  46  GLU F CD  1 
ATOM   6394  O  OE1 . GLU F  1 46  ? -35.124 24.935  6.451   1.00 30.86  ?  46  GLU F OE1 1 
ATOM   6395  O  OE2 . GLU F  1 46  ? -37.384 24.892  6.538   1.00 26.02  -1 46  GLU F OE2 1 
ATOM   6396  N  N   . ALA F  1 47  ? -39.944 26.841  2.010   1.00 24.95  ?  47  ALA F N   1 
ATOM   6397  C  CA  . ALA F  1 47  ? -41.024 26.414  1.151   1.00 24.79  ?  47  ALA F CA  1 
ATOM   6398  C  C   . ALA F  1 47  ? -40.735 26.917  -0.271  1.00 25.04  ?  47  ALA F C   1 
ATOM   6399  O  O   . ALA F  1 47  ? -40.391 26.124  -1.140  1.00 26.28  ?  47  ALA F O   1 
ATOM   6400  C  CB  . ALA F  1 47  ? -42.345 26.909  1.663   1.00 24.07  ?  47  ALA F CB  1 
ATOM   6401  N  N   . ALA F  1 48  ? -40.834 28.223  -0.489  1.00 24.59  ?  48  ALA F N   1 
ATOM   6402  C  CA  . ALA F  1 48  ? -40.443 28.855  -1.741  1.00 24.10  ?  48  ALA F CA  1 
ATOM   6403  C  C   . ALA F  1 48  ? -39.270 28.146  -2.439  1.00 23.99  ?  48  ALA F C   1 
ATOM   6404  O  O   . ALA F  1 48  ? -39.482 27.588  -3.533  1.00 24.68  ?  48  ALA F O   1 
ATOM   6405  C  CB  . ALA F  1 48  ? -40.140 30.342  -1.520  1.00 23.47  ?  48  ALA F CB  1 
ATOM   6406  N  N   . ALA F  1 49  ? -38.079 28.117  -1.820  1.00 23.08  ?  49  ALA F N   1 
ATOM   6407  C  CA  . ALA F  1 49  ? -36.883 27.489  -2.473  1.00 23.75  ?  49  ALA F CA  1 
ATOM   6408  C  C   . ALA F  1 49  ? -37.200 26.101  -2.974  1.00 23.89  ?  49  ALA F C   1 
ATOM   6409  O  O   . ALA F  1 49  ? -36.806 25.732  -4.081  1.00 23.47  ?  49  ALA F O   1 
ATOM   6410  C  CB  . ALA F  1 49  ? -35.628 27.462  -1.586  1.00 22.81  ?  49  ALA F CB  1 
ATOM   6411  N  N   . ARG F  1 50  ? -37.979 25.382  -2.167  1.00 24.76  ?  50  ARG F N   1 
ATOM   6412  C  CA  . ARG F  1 50  ? -38.355 24.001  -2.419  1.00 24.85  ?  50  ARG F CA  1 
ATOM   6413  C  C   . ARG F  1 50  ? -39.300 23.938  -3.619  1.00 25.68  ?  50  ARG F C   1 
ATOM   6414  O  O   . ARG F  1 50  ? -39.026 23.207  -4.575  1.00 25.94  ?  50  ARG F O   1 
ATOM   6415  C  CB  . ARG F  1 50  ? -38.966 23.368  -1.174  1.00 23.86  ?  50  ARG F CB  1 
ATOM   6416  C  CG  . ARG F  1 50  ? -39.175 21.856  -1.310  1.00 24.36  ?  50  ARG F CG  1 
ATOM   6417  C  CD  . ARG F  1 50  ? -40.155 21.225  -0.257  1.00 21.90  ?  50  ARG F CD  1 
ATOM   6418  N  NE  . ARG F  1 50  ? -41.358 21.996  0.076   1.00 18.98  ?  50  ARG F NE  1 
ATOM   6419  C  CZ  . ARG F  1 50  ? -42.397 22.179  -0.736  1.00 22.42  ?  50  ARG F CZ  1 
ATOM   6420  N  NH1 . ARG F  1 50  ? -42.387 21.662  -1.962  1.00 22.20  ?  50  ARG F NH1 1 
ATOM   6421  N  NH2 . ARG F  1 50  ? -43.451 22.909  -0.342  1.00 21.14  ?  50  ARG F NH2 1 
ATOM   6422  N  N   . GLU F  1 51  ? -40.377 24.718  -3.625  1.00 26.27  ?  51  GLU F N   1 
ATOM   6423  C  CA  . GLU F  1 51  ? -41.246 24.652  -4.783  1.00 27.01  ?  51  GLU F CA  1 
ATOM   6424  C  C   . GLU F  1 51  ? -40.509 25.212  -5.996  1.00 28.21  ?  51  GLU F C   1 
ATOM   6425  O  O   . GLU F  1 51  ? -40.956 24.988  -7.106  1.00 29.15  ?  51  GLU F O   1 
ATOM   6426  C  CB  . GLU F  1 51  ? -42.574 25.390  -4.613  1.00 26.92  ?  51  GLU F CB  1 
ATOM   6427  C  CG  . GLU F  1 51  ? -43.544 24.848  -3.588  1.00 27.23  ?  51  GLU F CG  1 
ATOM   6428  C  CD  . GLU F  1 51  ? -44.317 23.622  -4.059  1.00 29.37  ?  51  GLU F CD  1 
ATOM   6429  O  OE1 . GLU F  1 51  ? -44.495 23.441  -5.283  1.00 28.01  ?  51  GLU F OE1 1 
ATOM   6430  O  OE2 . GLU F  1 51  ? -44.750 22.824  -3.186  1.00 33.89  -1 51  GLU F OE2 1 
ATOM   6431  N  N   . LEU F  1 52  ? -39.385 25.923  -5.814  1.00 28.67  ?  52  LEU F N   1 
ATOM   6432  C  CA  . LEU F  1 52  ? -38.635 26.382  -6.984  1.00 28.92  ?  52  LEU F CA  1 
ATOM   6433  C  C   . LEU F  1 52  ? -38.054 25.174  -7.691  1.00 29.55  ?  52  LEU F C   1 
ATOM   6434  O  O   . LEU F  1 52  ? -38.224 25.004  -8.915  1.00 29.52  ?  52  LEU F O   1 
ATOM   6435  C  CB  . LEU F  1 52  ? -37.503 27.362  -6.631  1.00 28.80  ?  52  LEU F CB  1 
ATOM   6436  C  CG  . LEU F  1 52  ? -37.149 28.540  -7.582  1.00 28.32  ?  52  LEU F CG  1 
ATOM   6437  C  CD1 . LEU F  1 52  ? -35.686 28.864  -7.504  1.00 28.22  ?  52  LEU F CD1 1 
ATOM   6438  C  CD2 . LEU F  1 52  ? -37.550 28.392  -9.077  1.00 28.21  ?  52  LEU F CD2 1 
ATOM   6439  N  N   . TRP F  1 53  ? -37.381 24.339  -6.904  1.00 30.15  ?  53  TRP F N   1 
ATOM   6440  C  CA  . TRP F  1 53  ? -36.687 23.154  -7.403  1.00 31.18  ?  53  TRP F CA  1 
ATOM   6441  C  C   . TRP F  1 53  ? -37.706 22.115  -7.910  1.00 30.56  ?  53  TRP F C   1 
ATOM   6442  O  O   . TRP F  1 53  ? -37.605 21.628  -9.038  1.00 30.39  ?  53  TRP F O   1 
ATOM   6443  C  CB  . TRP F  1 53  ? -35.796 22.615  -6.294  1.00 31.46  ?  53  TRP F CB  1 
ATOM   6444  C  CG  . TRP F  1 53  ? -34.809 21.542  -6.649  1.00 35.04  ?  53  TRP F CG  1 
ATOM   6445  C  CD1 . TRP F  1 53  ? -33.594 21.684  -7.319  1.00 37.76  ?  53  TRP F CD1 1 
ATOM   6446  C  CD2 . TRP F  1 53  ? -34.891 20.179  -6.260  1.00 35.23  ?  53  TRP F CD2 1 
ATOM   6447  N  NE1 . TRP F  1 53  ? -32.944 20.466  -7.379  1.00 38.51  ?  53  TRP F NE1 1 
ATOM   6448  C  CE2 . TRP F  1 53  ? -33.730 19.529  -6.742  1.00 38.57  ?  53  TRP F CE2 1 
ATOM   6449  C  CE3 . TRP F  1 53  ? -35.847 19.437  -5.577  1.00 36.87  ?  53  TRP F CE3 1 
ATOM   6450  C  CZ2 . TRP F  1 53  ? -33.514 18.159  -6.552  1.00 41.98  ?  53  TRP F CZ2 1 
ATOM   6451  C  CZ3 . TRP F  1 53  ? -35.641 18.070  -5.395  1.00 41.94  ?  53  TRP F CZ3 1 
ATOM   6452  C  CH2 . TRP F  1 53  ? -34.484 17.442  -5.877  1.00 42.77  ?  53  TRP F CH2 1 
ATOM   6453  N  N   . GLU F  1 54  ? -38.736 21.845  -7.119  1.00 29.67  ?  54  GLU F N   1 
ATOM   6454  C  CA  . GLU F  1 54  ? -39.719 20.857  -7.537  1.00 29.18  ?  54  GLU F CA  1 
ATOM   6455  C  C   . GLU F  1 54  ? -40.282 21.178  -8.875  1.00 28.66  ?  54  GLU F C   1 
ATOM   6456  O  O   . GLU F  1 54  ? -40.763 20.290  -9.572  1.00 28.93  ?  54  GLU F O   1 
ATOM   6457  C  CB  . GLU F  1 54  ? -40.882 20.727  -6.557  1.00 29.13  ?  54  GLU F CB  1 
ATOM   6458  C  CG  . GLU F  1 54  ? -40.481 20.155  -5.224  1.00 30.69  ?  54  GLU F CG  1 
ATOM   6459  C  CD  . GLU F  1 54  ? -41.671 19.880  -4.338  1.00 35.15  ?  54  GLU F CD  1 
ATOM   6460  O  OE1 . GLU F  1 54  ? -42.809 20.250  -4.741  1.00 37.12  ?  54  GLU F OE1 1 
ATOM   6461  O  OE2 . GLU F  1 54  ? -41.466 19.290  -3.237  1.00 36.96  -1 54  GLU F OE2 1 
ATOM   6462  N  N   . GLU F  1 55  ? -40.234 22.450  -9.239  1.00 28.23  ?  55  GLU F N   1 
ATOM   6463  C  CA  . GLU F  1 55  ? -41.005 22.904  -10.371 1.00 27.70  ?  55  GLU F CA  1 
ATOM   6464  C  C   . GLU F  1 55  ? -40.178 23.383  -11.532 1.00 27.79  ?  55  GLU F C   1 
ATOM   6465  O  O   . GLU F  1 55  ? -40.724 23.656  -12.594 1.00 28.00  ?  55  GLU F O   1 
ATOM   6466  C  CB  . GLU F  1 55  ? -41.934 24.004  -9.930  1.00 26.88  ?  55  GLU F CB  1 
ATOM   6467  C  CG  . GLU F  1 55  ? -42.953 23.472  -9.049  1.00 27.55  ?  55  GLU F CG  1 
ATOM   6468  C  CD  . GLU F  1 55  ? -44.225 24.265  -9.064  1.00 28.14  ?  55  GLU F CD  1 
ATOM   6469  O  OE1 . GLU F  1 55  ? -44.234 25.491  -9.349  1.00 29.66  ?  55  GLU F OE1 1 
ATOM   6470  O  OE2 . GLU F  1 55  ? -45.235 23.633  -8.762  1.00 28.93  -1 55  GLU F OE2 1 
ATOM   6471  N  N   . THR F  1 56  ? -38.878 23.538  -11.330 1.00 27.66  ?  56  THR F N   1 
ATOM   6472  C  CA  . THR F  1 56  ? -38.053 24.151  -12.347 1.00 27.60  ?  56  THR F CA  1 
ATOM   6473  C  C   . THR F  1 56  ? -36.662 23.546  -12.308 1.00 29.25  ?  56  THR F C   1 
ATOM   6474  O  O   . THR F  1 56  ? -35.855 23.718  -13.236 1.00 30.07  ?  56  THR F O   1 
ATOM   6475  C  CB  . THR F  1 56  ? -37.913 25.696  -12.134 1.00 27.15  ?  56  THR F CB  1 
ATOM   6476  O  OG1 . THR F  1 56  ? -37.020 25.952  -11.045 1.00 26.68  ?  56  THR F OG1 1 
ATOM   6477  C  CG2 . THR F  1 56  ? -39.215 26.350  -11.875 1.00 24.26  ?  56  THR F CG2 1 
ATOM   6478  N  N   . GLY F  1 57  ? -36.346 22.863  -11.218 1.00 30.16  ?  57  GLY F N   1 
ATOM   6479  C  CA  . GLY F  1 57  ? -35.025 22.299  -11.104 1.00 31.31  ?  57  GLY F CA  1 
ATOM   6480  C  C   . GLY F  1 57  ? -33.985 23.357  -10.807 1.00 32.27  ?  57  GLY F C   1 
ATOM   6481  O  O   . GLY F  1 57  ? -32.806 23.016  -10.625 1.00 32.78  ?  57  GLY F O   1 
ATOM   6482  N  N   . ILE F  1 58  ? -34.388 24.631  -10.739 1.00 32.35  ?  58  ILE F N   1 
ATOM   6483  C  CA  . ILE F  1 58  ? -33.427 25.695  -10.397 1.00 32.56  ?  58  ILE F CA  1 
ATOM   6484  C  C   . ILE F  1 58  ? -33.081 25.647  -8.918  1.00 32.09  ?  58  ILE F C   1 
ATOM   6485  O  O   . ILE F  1 58  ? -33.919 25.360  -8.084  1.00 31.90  ?  58  ILE F O   1 
ATOM   6486  C  CB  . ILE F  1 58  ? -33.946 27.094  -10.782 1.00 32.97  ?  58  ILE F CB  1 
ATOM   6487  C  CG1 . ILE F  1 58  ? -34.650 27.042  -12.147 1.00 34.31  ?  58  ILE F CG1 1 
ATOM   6488  C  CG2 . ILE F  1 58  ? -32.795 28.129  -10.807 1.00 33.04  ?  58  ILE F CG2 1 
ATOM   6489  C  CD1 . ILE F  1 58  ? -33.718 27.107  -13.394 1.00 33.79  ?  58  ILE F CD1 1 
ATOM   6490  N  N   . SER F  1 59  ? -31.830 25.906  -8.593  1.00 32.19  ?  59  SER F N   1 
ATOM   6491  C  CA  . SER F  1 59  ? -31.419 25.849  -7.212  1.00 32.23  ?  59  SER F CA  1 
ATOM   6492  C  C   . SER F  1 59  ? -31.186 27.231  -6.678  1.00 31.88  ?  59  SER F C   1 
ATOM   6493  O  O   . SER F  1 59  ? -30.098 27.788  -6.866  1.00 32.22  ?  59  SER F O   1 
ATOM   6494  C  CB  . SER F  1 59  ? -30.136 25.043  -7.082  1.00 32.48  ?  59  SER F CB  1 
ATOM   6495  O  OG  . SER F  1 59  ? -30.380 23.675  -7.329  1.00 34.98  ?  59  SER F OG  1 
ATOM   6496  N  N   . ALA F  1 60  ? -32.183 27.794  -5.997  1.00 31.79  ?  60  ALA F N   1 
ATOM   6497  C  CA  . ALA F  1 60  ? -32.077 29.205  -5.597  1.00 31.39  ?  60  ALA F CA  1 
ATOM   6498  C  C   . ALA F  1 60  ? -32.834 29.619  -4.358  1.00 31.16  ?  60  ALA F C   1 
ATOM   6499  O  O   . ALA F  1 60  ? -34.037 29.374  -4.243  1.00 31.33  ?  60  ALA F O   1 
ATOM   6500  C  CB  . ALA F  1 60  ? -32.464 30.123  -6.774  1.00 30.79  ?  60  ALA F CB  1 
ATOM   6501  N  N   . GLN F  1 61  ? -32.125 30.303  -3.468  1.00 30.94  ?  61  GLN F N   1 
ATOM   6502  C  CA  . GLN F  1 61  ? -32.730 30.928  -2.297  1.00 31.26  ?  61  GLN F CA  1 
ATOM   6503  C  C   . GLN F  1 61  ? -33.509 32.188  -2.658  1.00 30.50  ?  61  GLN F C   1 
ATOM   6504  O  O   . GLN F  1 61  ? -33.041 33.030  -3.428  1.00 30.94  ?  61  GLN F O   1 
ATOM   6505  C  CB  . GLN F  1 61  ? -31.639 31.303  -1.284  1.00 31.35  ?  61  GLN F CB  1 
ATOM   6506  C  CG  . GLN F  1 61  ? -31.829 30.695  0.098   1.00 34.36  ?  61  GLN F CG  1 
ATOM   6507  C  CD  . GLN F  1 61  ? -32.267 29.223  0.065   1.00 38.65  ?  61  GLN F CD  1 
ATOM   6508  O  OE1 . GLN F  1 61  ? -33.204 28.829  0.771   1.00 41.59  ?  61  GLN F OE1 1 
ATOM   6509  N  NE2 . GLN F  1 61  ? -31.614 28.416  -0.766  1.00 38.24  ?  61  GLN F NE2 1 
ATOM   6510  N  N   . PRO F  1 62  ? -34.709 32.331  -2.095  1.00 29.67  ?  62  PRO F N   1 
ATOM   6511  C  CA  . PRO F  1 62  ? -35.311 33.652  -2.079  1.00 28.44  ?  62  PRO F CA  1 
ATOM   6512  C  C   . PRO F  1 62  ? -34.359 34.659  -1.457  1.00 27.36  ?  62  PRO F C   1 
ATOM   6513  O  O   . PRO F  1 62  ? -33.640 34.331  -0.530  1.00 27.75  ?  62  PRO F O   1 
ATOM   6514  C  CB  . PRO F  1 62  ? -36.520 33.437  -1.193  1.00 28.38  ?  62  PRO F CB  1 
ATOM   6515  C  CG  . PRO F  1 62  ? -36.924 32.029  -1.535  1.00 28.28  ?  62  PRO F CG  1 
ATOM   6516  C  CD  . PRO F  1 62  ? -35.648 31.288  -1.645  1.00 29.12  ?  62  PRO F CD  1 
ATOM   6517  N  N   . GLN F  1 63  ? -34.351 35.867  -1.991  1.00 26.76  ?  63  GLN F N   1 
ATOM   6518  C  CA  . GLN F  1 63  ? -33.507 36.974  -1.514  1.00 25.62  ?  63  GLN F CA  1 
ATOM   6519  C  C   . GLN F  1 63  ? -34.327 38.084  -0.867  1.00 24.29  ?  63  GLN F C   1 
ATOM   6520  O  O   . GLN F  1 63  ? -33.883 38.662  0.089   1.00 24.21  ?  63  GLN F O   1 
ATOM   6521  C  CB  . GLN F  1 63  ? -32.720 37.609  -2.660  1.00 25.70  ?  63  GLN F CB  1 
ATOM   6522  C  CG  . GLN F  1 63  ? -31.862 36.646  -3.438  1.00 26.97  ?  63  GLN F CG  1 
ATOM   6523  C  CD  . GLN F  1 63  ? -31.635 37.095  -4.868  1.00 29.54  ?  63  GLN F CD  1 
ATOM   6524  O  OE1 . GLN F  1 63  ? -30.649 36.707  -5.498  1.00 31.03  ?  63  GLN F OE1 1 
ATOM   6525  N  NE2 . GLN F  1 63  ? -32.554 37.893  -5.396  1.00 28.52  ?  63  GLN F NE2 1 
ATOM   6526  N  N   . HIS F  1 64  ? -35.500 38.405  -1.403  1.00 22.83  ?  64  HIS F N   1 
ATOM   6527  C  CA  . HIS F  1 64  ? -36.298 39.485  -0.841  1.00 22.31  ?  64  HIS F CA  1 
ATOM   6528  C  C   . HIS F  1 64  ? -37.739 39.075  -0.700  1.00 21.93  ?  64  HIS F C   1 
ATOM   6529  O  O   . HIS F  1 64  ? -38.197 38.186  -1.421  1.00 21.70  ?  64  HIS F O   1 
ATOM   6530  C  CB  . HIS F  1 64  ? -36.222 40.716  -1.731  1.00 22.43  ?  64  HIS F CB  1 
ATOM   6531  C  CG  . HIS F  1 64  ? -34.922 41.427  -1.623  1.00 24.85  ?  64  HIS F CG  1 
ATOM   6532  N  ND1 . HIS F  1 64  ? -33.904 41.254  -2.533  1.00 27.83  ?  64  HIS F ND1 1 
ATOM   6533  C  CD2 . HIS F  1 64  ? -34.440 42.259  -0.673  1.00 28.44  ?  64  HIS F CD2 1 
ATOM   6534  C  CE1 . HIS F  1 64  ? -32.856 41.960  -2.160  1.00 27.79  ?  64  HIS F CE1 1 
ATOM   6535  N  NE2 . HIS F  1 64  ? -33.151 42.578  -1.032  1.00 29.79  ?  64  HIS F NE2 1 
ATOM   6536  N  N   . PHE F  1 65  ? -38.443 39.713  0.226   1.00 20.72  ?  65  PHE F N   1 
ATOM   6537  C  CA  . PHE F  1 65  ? -39.870 39.525  0.325   1.00 21.14  ?  65  PHE F CA  1 
ATOM   6538  C  C   . PHE F  1 65  ? -40.526 40.665  -0.434  1.00 21.69  ?  65  PHE F C   1 
ATOM   6539  O  O   . PHE F  1 65  ? -40.148 41.817  -0.259  1.00 22.11  ?  65  PHE F O   1 
ATOM   6540  C  CB  . PHE F  1 65  ? -40.310 39.510  1.789   1.00 21.19  ?  65  PHE F CB  1 
ATOM   6541  C  CG  . PHE F  1 65  ? -41.839 39.461  2.000   1.00 19.35  ?  65  PHE F CG  1 
ATOM   6542  C  CD1 . PHE F  1 65  ? -42.604 38.445  1.458   1.00 18.48  ?  65  PHE F CD1 1 
ATOM   6543  C  CD2 . PHE F  1 65  ? -42.470 40.397  2.799   1.00 18.12  ?  65  PHE F CD2 1 
ATOM   6544  C  CE1 . PHE F  1 65  ? -43.965 38.393  1.668   1.00 16.74  ?  65  PHE F CE1 1 
ATOM   6545  C  CE2 . PHE F  1 65  ? -43.834 40.355  3.018   1.00 17.73  ?  65  PHE F CE2 1 
ATOM   6546  C  CZ  . PHE F  1 65  ? -44.575 39.346  2.448   1.00 18.17  ?  65  PHE F CZ  1 
ATOM   6547  N  N   . ILE F  1 66  ? -41.460 40.355  -1.321  1.00 21.95  ?  66  ILE F N   1 
ATOM   6548  C  CA  . ILE F  1 66  ? -42.042 41.398  -2.128  1.00 22.20  ?  66  ILE F CA  1 
ATOM   6549  C  C   . ILE F  1 66  ? -43.284 41.889  -1.414  1.00 23.35  ?  66  ILE F C   1 
ATOM   6550  O  O   . ILE F  1 66  ? -43.416 43.083  -1.075  1.00 22.68  ?  66  ILE F O   1 
ATOM   6551  C  CB  . ILE F  1 66  ? -42.292 40.935  -3.622  1.00 23.00  ?  66  ILE F CB  1 
ATOM   6552  C  CG1 . ILE F  1 66  ? -40.926 40.762  -4.335  1.00 21.71  ?  66  ILE F CG1 1 
ATOM   6553  C  CG2 . ILE F  1 66  ? -43.220 41.924  -4.391  1.00 17.02  ?  66  ILE F CG2 1 
ATOM   6554  C  CD1 . ILE F  1 66  ? -40.972 40.148  -5.692  1.00 20.50  ?  66  ILE F CD1 1 
ATOM   6555  N  N   . ARG F  1 67  ? -44.174 40.955  -1.136  1.00 24.26  ?  67  ARG F N   1 
ATOM   6556  C  CA  . ARG F  1 67  ? -45.412 41.299  -0.505  1.00 26.16  ?  67  ARG F CA  1 
ATOM   6557  C  C   . ARG F  1 67  ? -46.134 39.970  -0.394  1.00 27.28  ?  67  ARG F C   1 
ATOM   6558  O  O   . ARG F  1 67  ? -45.628 38.978  -0.904  1.00 28.43  ?  67  ARG F O   1 
ATOM   6559  C  CB  . ARG F  1 67  ? -46.166 42.283  -1.405  1.00 26.21  ?  67  ARG F CB  1 
ATOM   6560  C  CG  . ARG F  1 67  ? -47.612 42.272  -1.128  1.00 28.08  ?  67  ARG F CG  1 
ATOM   6561  C  CD  . ARG F  1 67  ? -48.468 42.999  -2.071  1.00 27.34  ?  67  ARG F CD  1 
ATOM   6562  N  NE  . ARG F  1 67  ? -49.788 42.940  -1.457  1.00 31.54  ?  67  ARG F NE  1 
ATOM   6563  C  CZ  . ARG F  1 67  ? -50.732 43.863  -1.606  1.00 35.88  ?  67  ARG F CZ  1 
ATOM   6564  N  NH1 . ARG F  1 67  ? -50.501 44.928  -2.375  1.00 37.48  ?  67  ARG F NH1 1 
ATOM   6565  N  NH2 . ARG F  1 67  ? -51.911 43.725  -0.990  1.00 36.34  ?  67  ARG F NH2 1 
ATOM   6566  N  N   . MET F  1 68  ? -47.268 39.940  0.311   1.00 28.34  ?  68  MET F N   1 
ATOM   6567  C  CA  . MET F  1 68  ? -48.172 38.796  0.383   1.00 28.92  ?  68  MET F CA  1 
ATOM   6568  C  C   . MET F  1 68  ? -49.540 39.273  -0.064  1.00 30.14  ?  68  MET F C   1 
ATOM   6569  O  O   . MET F  1 68  ? -49.869 40.468  0.033   1.00 30.75  ?  68  MET F O   1 
ATOM   6570  C  CB  . MET F  1 68  ? -48.264 38.253  1.808   1.00 28.63  ?  68  MET F CB  1 
ATOM   6571  C  CG  . MET F  1 68  ? -49.329 37.147  2.045   1.00 29.80  ?  68  MET F CG  1 
ATOM   6572  S  SD  . MET F  1 68  ? -50.164 37.155  3.699   1.00 31.66  ?  68  MET F SD  1 
ATOM   6573  C  CE  . MET F  1 68  ? -51.697 37.976  3.217   1.00 30.06  ?  68  MET F CE  1 
ATOM   6574  N  N   . HIS F  1 69  ? -50.348 38.346  -0.557  1.00 30.90  ?  69  HIS F N   1 
ATOM   6575  C  CA  . HIS F  1 69  ? -51.640 38.686  -1.057  1.00 31.26  ?  69  HIS F CA  1 
ATOM   6576  C  C   . HIS F  1 69  ? -52.607 37.793  -0.373  1.00 33.47  ?  69  HIS F C   1 
ATOM   6577  O  O   . HIS F  1 69  ? -52.344 36.595  -0.202  1.00 33.93  ?  69  HIS F O   1 
ATOM   6578  C  CB  . HIS F  1 69  ? -51.690 38.455  -2.555  1.00 31.39  ?  69  HIS F CB  1 
ATOM   6579  C  CG  . HIS F  1 69  ? -51.035 39.539  -3.354  1.00 28.86  ?  69  HIS F CG  1 
ATOM   6580  N  ND1 . HIS F  1 69  ? -49.735 39.452  -3.797  1.00 25.55  ?  69  HIS F ND1 1 
ATOM   6581  C  CD2 . HIS F  1 69  ? -51.500 40.737  -3.775  1.00 26.02  ?  69  HIS F CD2 1 
ATOM   6582  C  CE1 . HIS F  1 69  ? -49.428 40.552  -4.458  1.00 27.79  ?  69  HIS F CE1 1 
ATOM   6583  N  NE2 . HIS F  1 69  ? -50.480 41.352  -4.455  1.00 26.79  ?  69  HIS F NE2 1 
ATOM   6584  N  N   . GLN F  1 70  ? -53.710 38.387  0.064   1.00 35.22  ?  70  GLN F N   1 
ATOM   6585  C  CA  . GLN F  1 70  ? -54.812 37.649  0.616   1.00 36.94  ?  70  GLN F CA  1 
ATOM   6586  C  C   . GLN F  1 70  ? -55.821 37.685  -0.502  1.00 38.70  ?  70  GLN F C   1 
ATOM   6587  O  O   . GLN F  1 70  ? -55.952 38.703  -1.158  1.00 38.74  ?  70  GLN F O   1 
ATOM   6588  C  CB  . GLN F  1 70  ? -55.361 38.330  1.867   1.00 36.51  ?  70  GLN F CB  1 
ATOM   6589  C  CG  . GLN F  1 70  ? -56.231 37.382  2.696   1.00 37.49  ?  70  GLN F CG  1 
ATOM   6590  C  CD  . GLN F  1 70  ? -56.880 37.982  3.962   1.00 37.42  ?  70  GLN F CD  1 
ATOM   6591  O  OE1 . GLN F  1 70  ? -56.884 39.193  4.187   1.00 37.55  ?  70  GLN F OE1 1 
ATOM   6592  N  NE2 . GLN F  1 70  ? -57.437 37.099  4.794   1.00 37.78  ?  70  GLN F NE2 1 
ATOM   6593  N  N   . TRP F  1 71  ? -56.540 36.584  -0.717  1.00 40.96  ?  71  TRP F N   1 
ATOM   6594  C  CA  . TRP F  1 71  ? -57.235 36.372  -1.980  1.00 42.63  ?  71  TRP F CA  1 
ATOM   6595  C  C   . TRP F  1 71  ? -58.259 35.262  -1.886  1.00 43.65  ?  71  TRP F C   1 
ATOM   6596  O  O   . TRP F  1 71  ? -58.036 34.254  -1.221  1.00 43.96  ?  71  TRP F O   1 
ATOM   6597  C  CB  . TRP F  1 71  ? -56.200 35.988  -3.014  1.00 42.70  ?  71  TRP F CB  1 
ATOM   6598  C  CG  . TRP F  1 71  ? -56.722 35.720  -4.356  1.00 44.88  ?  71  TRP F CG  1 
ATOM   6599  C  CD1 . TRP F  1 71  ? -57.407 36.586  -5.159  1.00 46.72  ?  71  TRP F CD1 1 
ATOM   6600  C  CD2 . TRP F  1 71  ? -56.566 34.516  -5.101  1.00 47.36  ?  71  TRP F CD2 1 
ATOM   6601  N  NE1 . TRP F  1 71  ? -57.703 35.990  -6.357  1.00 47.40  ?  71  TRP F NE1 1 
ATOM   6602  C  CE2 . TRP F  1 71  ? -57.197 34.716  -6.352  1.00 47.91  ?  71  TRP F CE2 1 
ATOM   6603  C  CE3 . TRP F  1 71  ? -55.958 33.282  -4.836  1.00 48.95  ?  71  TRP F CE3 1 
ATOM   6604  C  CZ2 . TRP F  1 71  ? -57.233 33.730  -7.342  1.00 47.78  ?  71  TRP F CZ2 1 
ATOM   6605  C  CZ3 . TRP F  1 71  ? -55.999 32.299  -5.817  1.00 50.28  ?  71  TRP F CZ3 1 
ATOM   6606  C  CH2 . TRP F  1 71  ? -56.635 32.533  -7.058  1.00 49.89  ?  71  TRP F CH2 1 
ATOM   6607  N  N   . ILE F  1 72  ? -59.377 35.433  -2.578  1.00 45.23  ?  72  ILE F N   1 
ATOM   6608  C  CA  . ILE F  1 72  ? -60.440 34.427  -2.502  1.00 46.35  ?  72  ILE F CA  1 
ATOM   6609  C  C   . ILE F  1 72  ? -60.397 33.288  -3.526  1.00 46.84  ?  72  ILE F C   1 
ATOM   6610  O  O   . ILE F  1 72  ? -60.604 32.143  -3.134  1.00 46.98  ?  72  ILE F O   1 
ATOM   6611  C  CB  . ILE F  1 72  ? -61.869 35.069  -2.286  1.00 46.38  ?  72  ILE F CB  1 
ATOM   6612  C  CG1 . ILE F  1 72  ? -62.292 34.943  -0.798  1.00 46.08  ?  72  ILE F CG1 1 
ATOM   6613  C  CG2 . ILE F  1 72  ? -62.932 34.540  -3.271  1.00 46.53  ?  72  ILE F CG2 1 
ATOM   6614  C  CD1 . ILE F  1 72  ? -61.985 33.593  -0.138  1.00 44.07  ?  72  ILE F CD1 1 
ATOM   6615  N  N   . ALA F  1 73  ? -60.105 33.571  -4.797  1.00 47.50  ?  73  ALA F N   1 
ATOM   6616  C  CA  . ALA F  1 73  ? -60.135 32.522  -5.859  1.00 48.74  ?  73  ALA F CA  1 
ATOM   6617  C  C   . ALA F  1 73  ? -61.551 32.110  -6.267  1.00 49.40  ?  73  ALA F C   1 
ATOM   6618  O  O   . ALA F  1 73  ? -62.386 31.818  -5.410  1.00 49.05  ?  73  ALA F O   1 
ATOM   6619  C  CB  . ALA F  1 73  ? -59.317 31.264  -5.477  1.00 48.10  ?  73  ALA F CB  1 
ATOM   6620  N  N   . PRO F  1 74  ? -61.809 32.039  -7.588  1.00 50.48  ?  74  PRO F N   1 
ATOM   6621  C  CA  . PRO F  1 74  ? -63.196 31.860  -8.069  1.00 50.94  ?  74  PRO F CA  1 
ATOM   6622  C  C   . PRO F  1 74  ? -63.958 30.722  -7.355  1.00 51.20  ?  74  PRO F C   1 
ATOM   6623  O  O   . PRO F  1 74  ? -65.152 30.884  -7.030  1.00 50.95  ?  74  PRO F O   1 
ATOM   6624  C  CB  . PRO F  1 74  ? -63.033 31.604  -9.577  1.00 51.01  ?  74  PRO F CB  1 
ATOM   6625  C  CG  . PRO F  1 74  ? -61.505 31.384  -9.814  1.00 51.30  ?  74  PRO F CG  1 
ATOM   6626  C  CD  . PRO F  1 74  ? -60.824 32.104  -8.694  1.00 50.75  ?  74  PRO F CD  1 
ATOM   6627  N  N   . ASP F  1 75  ? -63.258 29.618  -7.069  1.00 51.26  ?  75  ASP F N   1 
ATOM   6628  C  CA  . ASP F  1 75  ? -63.857 28.439  -6.424  1.00 51.40  ?  75  ASP F CA  1 
ATOM   6629  C  C   . ASP F  1 75  ? -63.913 28.521  -4.894  1.00 50.94  ?  75  ASP F C   1 
ATOM   6630  O  O   . ASP F  1 75  ? -63.726 27.498  -4.212  1.00 51.17  ?  75  ASP F O   1 
ATOM   6631  C  CB  . ASP F  1 75  ? -63.110 27.161  -6.846  1.00 51.98  ?  75  ASP F CB  1 
ATOM   6632  C  CG  . ASP F  1 75  ? -61.595 27.252  -6.613  1.00 54.36  ?  75  ASP F CG  1 
ATOM   6633  O  OD1 . ASP F  1 75  ? -61.145 26.734  -5.567  1.00 55.82  ?  75  ASP F OD1 1 
ATOM   6634  O  OD2 . ASP F  1 75  ? -60.868 27.854  -7.459  1.00 55.86  -1 75  ASP F OD2 1 
ATOM   6635  N  N   . LYS F  1 76  ? -64.162 29.729  -4.370  1.00 49.97  ?  76  LYS F N   1 
ATOM   6636  C  CA  . LYS F  1 76  ? -64.335 29.995  -2.922  1.00 49.19  ?  76  LYS F CA  1 
ATOM   6637  C  C   . LYS F  1 76  ? -63.138 29.638  -2.001  1.00 48.17  ?  76  LYS F C   1 
ATOM   6638  O  O   . LYS F  1 76  ? -63.199 29.894  -0.787  1.00 48.18  ?  76  LYS F O   1 
ATOM   6639  C  CB  . LYS F  1 76  ? -65.615 29.335  -2.363  1.00 49.63  ?  76  LYS F CB  1 
ATOM   6640  C  CG  . LYS F  1 76  ? -66.915 29.610  -3.105  1.00 50.97  ?  76  LYS F CG  1 
ATOM   6641  C  CD  . LYS F  1 76  ? -67.705 30.779  -2.518  1.00 54.08  ?  76  LYS F CD  1 
ATOM   6642  C  CE  . LYS F  1 76  ? -69.214 30.624  -2.834  1.00 57.26  ?  76  LYS F CE  1 
ATOM   6643  N  NZ  . LYS F  1 76  ? -70.008 31.895  -2.676  1.00 57.48  ?  76  LYS F NZ  1 
ATOM   6644  N  N   . THR F  1 77  ? -62.062 29.080  -2.555  1.00 46.34  ?  77  THR F N   1 
ATOM   6645  C  CA  . THR F  1 77  ? -60.932 28.636  -1.723  1.00 45.56  ?  77  THR F CA  1 
ATOM   6646  C  C   . THR F  1 77  ? -59.928 29.737  -1.247  1.00 44.19  ?  77  THR F C   1 
ATOM   6647  O  O   . THR F  1 77  ? -59.314 30.435  -2.064  1.00 43.56  ?  77  THR F O   1 
ATOM   6648  C  CB  . THR F  1 77  ? -60.223 27.380  -2.340  1.00 46.03  ?  77  THR F CB  1 
ATOM   6649  O  OG1 . THR F  1 77  ? -61.196 26.334  -2.523  1.00 45.46  ?  77  THR F OG1 1 
ATOM   6650  C  CG2 . THR F  1 77  ? -59.079 26.856  -1.418  1.00 46.39  ?  77  THR F CG2 1 
ATOM   6651  N  N   . PRO F  1 78  ? -59.751 29.864  0.088   1.00 43.06  ?  78  PRO F N   1 
ATOM   6652  C  CA  . PRO F  1 78  ? -59.079 31.016  0.706   1.00 42.17  ?  78  PRO F CA  1 
ATOM   6653  C  C   . PRO F  1 78  ? -57.534 30.893  0.785   1.00 41.24  ?  78  PRO F C   1 
ATOM   6654  O  O   . PRO F  1 78  ? -57.003 29.849  1.205   1.00 40.80  ?  78  PRO F O   1 
ATOM   6655  C  CB  . PRO F  1 78  ? -59.703 31.050  2.104   1.00 42.04  ?  78  PRO F CB  1 
ATOM   6656  C  CG  . PRO F  1 78  ? -60.043 29.577  2.407   1.00 43.24  ?  78  PRO F CG  1 
ATOM   6657  C  CD  . PRO F  1 78  ? -60.034 28.814  1.090   1.00 43.21  ?  78  PRO F CD  1 
ATOM   6658  N  N   . PHE F  1 79  ? -56.836 31.967  0.406   1.00 39.85  ?  79  PHE F N   1 
ATOM   6659  C  CA  . PHE F  1 79  ? -55.389 31.933  0.192   1.00 38.82  ?  79  PHE F CA  1 
ATOM   6660  C  C   . PHE F  1 79  ? -54.588 33.100  0.813   1.00 37.96  ?  79  PHE F C   1 
ATOM   6661  O  O   . PHE F  1 79  ? -54.973 34.289  0.685   1.00 37.94  ?  79  PHE F O   1 
ATOM   6662  C  CB  . PHE F  1 79  ? -55.106 31.977  -1.307  1.00 39.41  ?  79  PHE F CB  1 
ATOM   6663  C  CG  . PHE F  1 79  ? -55.061 30.643  -1.979  1.00 40.82  ?  79  PHE F CG  1 
ATOM   6664  C  CD1 . PHE F  1 79  ? -53.993 29.779  -1.775  1.00 41.87  ?  79  PHE F CD1 1 
ATOM   6665  C  CD2 . PHE F  1 79  ? -56.059 30.279  -2.874  1.00 42.57  ?  79  PHE F CD2 1 
ATOM   6666  C  CE1 . PHE F  1 79  ? -53.947 28.558  -2.410  1.00 43.36  ?  79  PHE F CE1 1 
ATOM   6667  C  CE2 . PHE F  1 79  ? -56.023 29.052  -3.527  1.00 42.73  ?  79  PHE F CE2 1 
ATOM   6668  C  CZ  . PHE F  1 79  ? -54.963 28.193  -3.296  1.00 44.06  ?  79  PHE F CZ  1 
ATOM   6669  N  N   . LEU F  1 80  ? -53.453 32.748  1.424   1.00 35.52  ?  80  LEU F N   1 
ATOM   6670  C  CA  . LEU F  1 80  ? -52.381 33.684  1.751   1.00 33.30  ?  80  LEU F CA  1 
ATOM   6671  C  C   . LEU F  1 80  ? -51.116 33.351  0.939   1.00 32.37  ?  80  LEU F C   1 
ATOM   6672  O  O   . LEU F  1 80  ? -50.257 32.565  1.370   1.00 32.78  ?  80  LEU F O   1 
ATOM   6673  C  CB  . LEU F  1 80  ? -52.048 33.603  3.242   1.00 32.52  ?  80  LEU F CB  1 
ATOM   6674  C  CG  . LEU F  1 80  ? -52.675 34.500  4.310   1.00 32.50  ?  80  LEU F CG  1 
ATOM   6675  C  CD1 . LEU F  1 80  ? -54.099 35.042  4.016   1.00 28.30  ?  80  LEU F CD1 1 
ATOM   6676  C  CD2 . LEU F  1 80  ? -52.616 33.780  5.652   1.00 28.75  ?  80  LEU F CD2 1 
ATOM   6677  N  N   . ARG F  1 81  ? -50.969 33.989  -0.210  1.00 30.96  ?  81  ARG F N   1 
ATOM   6678  C  CA  . ARG F  1 81  ? -49.829 33.758  -1.088  1.00 29.29  ?  81  ARG F CA  1 
ATOM   6679  C  C   . ARG F  1 81  ? -48.678 34.691  -0.765  1.00 28.75  ?  81  ARG F C   1 
ATOM   6680  O  O   . ARG F  1 81  ? -48.850 35.894  -0.845  1.00 28.86  ?  81  ARG F O   1 
ATOM   6681  C  CB  . ARG F  1 81  ? -50.281 34.029  -2.518  1.00 28.76  ?  81  ARG F CB  1 
ATOM   6682  C  CG  . ARG F  1 81  ? -49.416 33.512  -3.612  1.00 28.08  ?  81  ARG F CG  1 
ATOM   6683  C  CD  . ARG F  1 81  ? -50.176 33.711  -4.884  1.00 26.87  ?  81  ARG F CD  1 
ATOM   6684  N  NE  . ARG F  1 81  ? -49.443 33.346  -6.076  1.00 25.91  ?  81  ARG F NE  1 
ATOM   6685  C  CZ  . ARG F  1 81  ? -48.549 34.120  -6.676  1.00 29.82  ?  81  ARG F CZ  1 
ATOM   6686  N  NH1 . ARG F  1 81  ? -48.233 35.319  -6.157  1.00 27.37  ?  81  ARG F NH1 1 
ATOM   6687  N  NH2 . ARG F  1 81  ? -47.963 33.685  -7.807  1.00 31.42  ?  81  ARG F NH2 1 
ATOM   6688  N  N   . PHE F  1 82  ? -47.499 34.130  -0.461  1.00 27.85  ?  82  PHE F N   1 
ATOM   6689  C  CA  . PHE F  1 82  ? -46.303 34.902  -0.111  1.00 26.36  ?  82  PHE F CA  1 
ATOM   6690  C  C   . PHE F  1 82  ? -45.325 34.958  -1.253  1.00 26.05  ?  82  PHE F C   1 
ATOM   6691  O  O   . PHE F  1 82  ? -44.771 33.943  -1.673  1.00 26.22  ?  82  PHE F O   1 
ATOM   6692  C  CB  . PHE F  1 82  ? -45.579 34.300  1.083   1.00 25.91  ?  82  PHE F CB  1 
ATOM   6693  C  CG  . PHE F  1 82  ? -46.298 34.456  2.391   1.00 24.98  ?  82  PHE F CG  1 
ATOM   6694  C  CD1 . PHE F  1 82  ? -47.139 33.454  2.866   1.00 22.05  ?  82  PHE F CD1 1 
ATOM   6695  C  CD2 . PHE F  1 82  ? -46.082 35.573  3.192   1.00 23.69  ?  82  PHE F CD2 1 
ATOM   6696  C  CE1 . PHE F  1 82  ? -47.793 33.577  4.091   1.00 19.65  ?  82  PHE F CE1 1 
ATOM   6697  C  CE2 . PHE F  1 82  ? -46.734 35.692  4.436   1.00 23.28  ?  82  PHE F CE2 1 
ATOM   6698  C  CZ  . PHE F  1 82  ? -47.578 34.678  4.883   1.00 20.88  ?  82  PHE F CZ  1 
ATOM   6699  N  N   . LEU F  1 83  ? -45.070 36.175  -1.714  1.00 25.38  ?  83  LEU F N   1 
ATOM   6700  C  CA  . LEU F  1 83  ? -44.308 36.414  -2.926  1.00 24.01  ?  83  LEU F CA  1 
ATOM   6701  C  C   . LEU F  1 83  ? -42.864 36.872  -2.635  1.00 23.86  ?  83  LEU F C   1 
ATOM   6702  O  O   . LEU F  1 83  ? -42.642 37.838  -1.870  1.00 24.04  ?  83  LEU F O   1 
ATOM   6703  C  CB  . LEU F  1 83  ? -45.063 37.473  -3.731  1.00 23.59  ?  83  LEU F CB  1 
ATOM   6704  C  CG  . LEU F  1 83  ? -44.634 37.688  -5.178  1.00 24.06  ?  83  LEU F CG  1 
ATOM   6705  C  CD1 . LEU F  1 83  ? -45.002 36.485  -6.075  1.00 22.25  ?  83  LEU F CD1 1 
ATOM   6706  C  CD2 . LEU F  1 83  ? -45.306 38.917  -5.659  1.00 23.63  ?  83  LEU F CD2 1 
ATOM   6707  N  N   . PHE F  1 84  ? -41.890 36.192  -3.240  1.00 22.84  ?  84  PHE F N   1 
ATOM   6708  C  CA  . PHE F  1 84  ? -40.478 36.488  -3.005  1.00 22.29  ?  84  PHE F CA  1 
ATOM   6709  C  C   . PHE F  1 84  ? -39.803 36.904  -4.288  1.00 22.97  ?  84  PHE F C   1 
ATOM   6710  O  O   . PHE F  1 84  ? -40.362 36.691  -5.344  1.00 24.03  ?  84  PHE F O   1 
ATOM   6711  C  CB  . PHE F  1 84  ? -39.756 35.281  -2.429  1.00 22.03  ?  84  PHE F CB  1 
ATOM   6712  C  CG  . PHE F  1 84  ? -40.292 34.850  -1.117  1.00 21.33  ?  84  PHE F CG  1 
ATOM   6713  C  CD1 . PHE F  1 84  ? -41.300 33.887  -1.050  1.00 17.89  ?  84  PHE F CD1 1 
ATOM   6714  C  CD2 . PHE F  1 84  ? -39.824 35.434  0.056   1.00 20.58  ?  84  PHE F CD2 1 
ATOM   6715  C  CE1 . PHE F  1 84  ? -41.815 33.504  0.149   1.00 18.06  ?  84  PHE F CE1 1 
ATOM   6716  C  CE2 . PHE F  1 84  ? -40.363 35.064  1.292   1.00 21.68  ?  84  PHE F CE2 1 
ATOM   6717  C  CZ  . PHE F  1 84  ? -41.361 34.103  1.338   1.00 19.77  ?  84  PHE F CZ  1 
ATOM   6718  N  N   . ALA F  1 85  ? -38.611 37.485  -4.207  1.00 22.60  ?  85  ALA F N   1 
ATOM   6719  C  CA  . ALA F  1 85  ? -37.873 37.825  -5.413  1.00 23.14  ?  85  ALA F CA  1 
ATOM   6720  C  C   . ALA F  1 85  ? -36.566 37.070  -5.426  1.00 23.84  ?  85  ALA F C   1 
ATOM   6721  O  O   . ALA F  1 85  ? -35.898 36.958  -4.391  1.00 23.84  ?  85  ALA F O   1 
ATOM   6722  C  CB  . ALA F  1 85  ? -37.585 39.320  -5.463  1.00 22.40  ?  85  ALA F CB  1 
ATOM   6723  N  N   . ILE F  1 86  ? -36.202 36.547  -6.590  1.00 24.84  ?  86  ILE F N   1 
ATOM   6724  C  CA  . ILE F  1 86  ? -34.875 35.996  -6.783  1.00 26.06  ?  86  ILE F CA  1 
ATOM   6725  C  C   . ILE F  1 86  ? -34.262 36.576  -8.047  1.00 27.31  ?  86  ILE F C   1 
ATOM   6726  O  O   . ILE F  1 86  ? -34.879 36.517  -9.121  1.00 27.22  ?  86  ILE F O   1 
ATOM   6727  C  CB  . ILE F  1 86  ? -34.885 34.466  -6.887  1.00 26.29  ?  86  ILE F CB  1 
ATOM   6728  C  CG1 . ILE F  1 86  ? -35.386 33.847  -5.600  1.00 27.58  ?  86  ILE F CG1 1 
ATOM   6729  C  CG2 . ILE F  1 86  ? -33.482 33.932  -7.095  1.00 24.62  ?  86  ILE F CG2 1 
ATOM   6730  C  CD1 . ILE F  1 86  ? -35.743 32.377  -5.751  1.00 29.87  ?  86  ILE F CD1 1 
ATOM   6731  N  N   . GLU F  1 87  ? -33.047 37.112  -7.929  1.00 28.59  ?  87  GLU F N   1 
ATOM   6732  C  CA  . GLU F  1 87  ? -32.273 37.515  -9.104  1.00 30.33  ?  87  GLU F CA  1 
ATOM   6733  C  C   . GLU F  1 87  ? -31.171 36.501  -9.398  1.00 31.68  ?  87  GLU F C   1 
ATOM   6734  O  O   . GLU F  1 87  ? -30.228 36.406  -8.626  1.00 32.14  ?  87  GLU F O   1 
ATOM   6735  C  CB  . GLU F  1 87  ? -31.611 38.890  -8.901  1.00 29.15  ?  87  GLU F CB  1 
ATOM   6736  C  CG  . GLU F  1 87  ? -32.556 40.020  -8.619  1.00 29.83  ?  87  GLU F CG  1 
ATOM   6737  C  CD  . GLU F  1 87  ? -33.369 40.439  -9.809  1.00 30.50  ?  87  GLU F CD  1 
ATOM   6738  O  OE1 . GLU F  1 87  ? -34.575 40.700  -9.631  1.00 30.00  ?  87  GLU F OE1 1 
ATOM   6739  O  OE2 . GLU F  1 87  ? -32.803 40.521  -10.921 1.00 32.45  -1 87  GLU F OE2 1 
ATOM   6740  N  N   . LEU F  1 88  ? -31.251 35.785  -10.519 1.00 34.05  ?  88  LEU F N   1 
ATOM   6741  C  CA  . LEU F  1 88  ? -30.137 34.908  -10.948 1.00 36.41  ?  88  LEU F CA  1 
ATOM   6742  C  C   . LEU F  1 88  ? -29.187 35.590  -11.901 1.00 38.95  ?  88  LEU F C   1 
ATOM   6743  O  O   . LEU F  1 88  ? -29.663 36.226  -12.837 1.00 39.40  ?  88  LEU F O   1 
ATOM   6744  C  CB  . LEU F  1 88  ? -30.681 33.700  -11.679 1.00 35.17  ?  88  LEU F CB  1 
ATOM   6745  C  CG  . LEU F  1 88  ? -31.834 32.976  -11.030 1.00 34.16  ?  88  LEU F CG  1 
ATOM   6746  C  CD1 . LEU F  1 88  ? -32.273 31.860  -11.952 1.00 30.29  ?  88  LEU F CD1 1 
ATOM   6747  C  CD2 . LEU F  1 88  ? -31.417 32.477  -9.644  1.00 32.96  ?  88  LEU F CD2 1 
ATOM   6748  N  N   . GLU F  1 89  ? -27.870 35.399  -11.704 1.00 42.61  ?  89  GLU F N   1 
ATOM   6749  C  CA  . GLU F  1 89  ? -26.789 35.832  -12.646 1.00 46.05  ?  89  GLU F CA  1 
ATOM   6750  C  C   . GLU F  1 89  ? -27.128 35.713  -14.131 1.00 48.26  ?  89  GLU F C   1 
ATOM   6751  O  O   . GLU F  1 89  ? -26.855 36.638  -14.913 1.00 48.94  ?  89  GLU F O   1 
ATOM   6752  C  CB  . GLU F  1 89  ? -25.526 34.980  -12.483 1.00 46.50  ?  89  GLU F CB  1 
ATOM   6753  C  CG  . GLU F  1 89  ? -24.542 35.383  -11.405 1.00 49.42  ?  89  GLU F CG  1 
ATOM   6754  C  CD  . GLU F  1 89  ? -24.888 34.796  -10.048 1.00 53.25  ?  89  GLU F CD  1 
ATOM   6755  O  OE1 . GLU F  1 89  ? -26.006 34.214  -9.904  1.00 53.94  ?  89  GLU F OE1 1 
ATOM   6756  O  OE2 . GLU F  1 89  ? -24.045 34.931  -9.123  1.00 54.84  -1 89  GLU F OE2 1 
ATOM   6757  N  N   . GLN F  1 90  ? -27.650 34.550  -14.532 1.00 50.46  ?  90  GLN F N   1 
ATOM   6758  C  CA  . GLN F  1 90  ? -28.006 34.300  -15.928 1.00 52.89  ?  90  GLN F CA  1 
ATOM   6759  C  C   . GLN F  1 90  ? -29.080 33.225  -16.087 1.00 54.11  ?  90  GLN F C   1 
ATOM   6760  O  O   . GLN F  1 90  ? -29.182 32.304  -15.263 1.00 54.01  ?  90  GLN F O   1 
ATOM   6761  C  CB  . GLN F  1 90  ? -26.763 33.938  -16.755 1.00 53.36  ?  90  GLN F CB  1 
ATOM   6762  C  CG  . GLN F  1 90  ? -26.271 32.491  -16.597 1.00 55.84  ?  90  GLN F CG  1 
ATOM   6763  C  CD  . GLN F  1 90  ? -25.513 32.253  -15.305 1.00 58.49  ?  90  GLN F CD  1 
ATOM   6764  O  OE1 . GLN F  1 90  ? -24.285 32.245  -15.308 1.00 60.89  ?  90  GLN F OE1 1 
ATOM   6765  N  NE2 . GLN F  1 90  ? -26.234 32.053  -14.197 1.00 58.09  ?  90  GLN F NE2 1 
ATOM   6766  N  N   . ILE F  1 91  ? -29.863 33.351  -17.162 1.00 55.74  ?  91  ILE F N   1 
ATOM   6767  C  CA  . ILE F  1 91  ? -30.822 32.333  -17.575 1.00 57.36  ?  91  ILE F CA  1 
ATOM   6768  C  C   . ILE F  1 91  ? -30.084 30.995  -17.679 1.00 58.73  ?  91  ILE F C   1 
ATOM   6769  O  O   . ILE F  1 91  ? -28.884 30.977  -17.950 1.00 59.04  ?  91  ILE F O   1 
ATOM   6770  C  CB  . ILE F  1 91  ? -31.522 32.742  -18.905 1.00 57.37  ?  91  ILE F CB  1 
ATOM   6771  C  CG1 . ILE F  1 91  ? -32.411 33.965  -18.682 1.00 57.37  ?  91  ILE F CG1 1 
ATOM   6772  C  CG2 . ILE F  1 91  ? -32.391 31.604  -19.473 1.00 57.36  ?  91  ILE F CG2 1 
ATOM   6773  C  CD1 . ILE F  1 91  ? -32.505 34.912  -19.892 1.00 58.83  ?  91  ILE F CD1 1 
ATOM   6774  N  N   . CYS F  1 92  ? -30.780 29.882  -17.439 1.00 60.31  ?  92  CYS F N   1 
ATOM   6775  C  CA  . CYS F  1 92  ? -30.105 28.581  -17.329 1.00 62.07  ?  92  CYS F CA  1 
ATOM   6776  C  C   . CYS F  1 92  ? -31.050 27.386  -17.603 1.00 62.93  ?  92  CYS F C   1 
ATOM   6777  O  O   . CYS F  1 92  ? -32.281 27.552  -17.563 1.00 63.36  ?  92  CYS F O   1 
ATOM   6778  C  CB  . CYS F  1 92  ? -29.468 28.458  -15.941 1.00 61.96  ?  92  CYS F CB  1 
ATOM   6779  S  SG  . CYS F  1 92  ? -30.655 28.852  -14.615 1.00 63.90  ?  92  CYS F SG  1 
ATOM   6780  N  N   . PRO F  1 93  ? -30.471 26.189  -17.895 1.00 63.43  ?  93  PRO F N   1 
ATOM   6781  C  CA  . PRO F  1 93  ? -31.213 24.947  -18.184 1.00 63.65  ?  93  PRO F CA  1 
ATOM   6782  C  C   . PRO F  1 93  ? -32.259 24.546  -17.118 1.00 63.75  ?  93  PRO F C   1 
ATOM   6783  O  O   . PRO F  1 93  ? -31.914 24.110  -16.005 1.00 63.72  ?  93  PRO F O   1 
ATOM   6784  C  CB  . PRO F  1 93  ? -30.096 23.886  -18.271 1.00 63.87  ?  93  PRO F CB  1 
ATOM   6785  C  CG  . PRO F  1 93  ? -28.865 24.546  -17.627 1.00 63.52  ?  93  PRO F CG  1 
ATOM   6786  C  CD  . PRO F  1 93  ? -29.013 25.976  -18.025 1.00 63.28  ?  93  PRO F CD  1 
ATOM   6787  N  N   . THR F  1 94  ? -33.528 24.670  -17.472 1.00 63.51  ?  94  THR F N   1 
ATOM   6788  C  CA  . THR F  1 94  ? -34.577 24.376  -16.521 1.00 63.89  ?  94  THR F CA  1 
ATOM   6789  C  C   . THR F  1 94  ? -35.187 22.990  -16.781 1.00 64.31  ?  94  THR F C   1 
ATOM   6790  O  O   . THR F  1 94  ? -35.818 22.763  -17.829 1.00 64.76  ?  94  THR F O   1 
ATOM   6791  C  CB  . THR F  1 94  ? -35.659 25.507  -16.471 1.00 63.99  ?  94  THR F CB  1 
ATOM   6792  O  OG1 . THR F  1 94  ? -36.919 25.034  -16.959 1.00 63.30  ?  94  THR F OG1 1 
ATOM   6793  C  CG2 . THR F  1 94  ? -35.222 26.749  -17.271 1.00 64.13  ?  94  THR F CG2 1 
ATOM   6794  N  N   . GLN F  1 95  ? -34.972 22.065  -15.835 1.00 64.23  ?  95  GLN F N   1 
ATOM   6795  C  CA  . GLN F  1 95  ? -35.588 20.731  -15.870 1.00 63.70  ?  95  GLN F CA  1 
ATOM   6796  C  C   . GLN F  1 95  ? -36.482 20.452  -14.637 1.00 62.89  ?  95  GLN F C   1 
ATOM   6797  O  O   . GLN F  1 95  ? -35.973 20.114  -13.567 1.00 62.43  ?  95  GLN F O   1 
ATOM   6798  C  CB  . GLN F  1 95  ? -34.507 19.647  -16.029 1.00 64.27  ?  95  GLN F CB  1 
ATOM   6799  C  CG  . GLN F  1 95  ? -34.816 18.578  -17.126 1.00 65.50  ?  95  GLN F CG  1 
ATOM   6800  C  CD  . GLN F  1 95  ? -35.817 17.488  -16.681 1.00 67.16  ?  95  GLN F CD  1 
ATOM   6801  O  OE1 . GLN F  1 95  ? -35.497 16.630  -15.849 1.00 67.32  ?  95  GLN F OE1 1 
ATOM   6802  N  NE2 . GLN F  1 95  ? -37.024 17.513  -17.258 1.00 66.25  ?  95  GLN F NE2 1 
ATOM   6803  N  N   . PRO F  1 96  ? -37.818 20.618  -14.791 1.00 62.43  ?  96  PRO F N   1 
ATOM   6804  C  CA  . PRO F  1 96  ? -38.880 20.255  -13.834 1.00 61.82  ?  96  PRO F CA  1 
ATOM   6805  C  C   . PRO F  1 96  ? -38.691 18.924  -13.129 1.00 61.30  ?  96  PRO F C   1 
ATOM   6806  O  O   . PRO F  1 96  ? -38.294 17.945  -13.757 1.00 60.98  ?  96  PRO F O   1 
ATOM   6807  C  CB  . PRO F  1 96  ? -40.134 20.190  -14.719 1.00 61.94  ?  96  PRO F CB  1 
ATOM   6808  C  CG  . PRO F  1 96  ? -39.888 21.231  -15.783 1.00 62.28  ?  96  PRO F CG  1 
ATOM   6809  C  CD  . PRO F  1 96  ? -38.369 21.438  -15.892 1.00 62.57  ?  96  PRO F CD  1 
ATOM   6810  N  N   . HIS F  1 97  ? -39.000 18.908  -11.829 1.00 60.94  ?  97  HIS F N   1 
ATOM   6811  C  CA  . HIS F  1 97  ? -38.842 17.737  -10.957 1.00 60.23  ?  97  HIS F CA  1 
ATOM   6812  C  C   . HIS F  1 97  ? -40.214 17.246  -10.458 1.00 60.46  ?  97  HIS F C   1 
ATOM   6813  O  O   . HIS F  1 97  ? -40.305 16.605  -9.410  1.00 60.38  ?  97  HIS F O   1 
ATOM   6814  C  CB  . HIS F  1 97  ? -37.900 18.074  -9.779  1.00 59.63  ?  97  HIS F CB  1 
ATOM   6815  C  CG  . HIS F  1 97  ? -36.442 18.137  -10.149 1.00 58.72  ?  97  HIS F CG  1 
ATOM   6816  N  ND1 . HIS F  1 97  ? -35.436 17.809  -9.267  1.00 58.44  ?  97  HIS F ND1 1 
ATOM   6817  C  CD2 . HIS F  1 97  ? -35.820 18.478  -11.305 1.00 58.82  ?  97  HIS F CD2 1 
ATOM   6818  C  CE1 . HIS F  1 97  ? -34.260 17.945  -9.860  1.00 57.81  ?  97  HIS F CE1 1 
ATOM   6819  N  NE2 . HIS F  1 97  ? -34.465 18.354  -11.098 1.00 57.81  ?  97  HIS F NE2 1 
ATOM   6820  N  N   . ASP F  1 98  ? -41.267 17.535  -11.235 1.00 60.70  ?  98  ASP F N   1 
ATOM   6821  C  CA  . ASP F  1 98  ? -42.672 17.323  -10.832 1.00 60.85  ?  98  ASP F CA  1 
ATOM   6822  C  C   . ASP F  1 98  ? -43.598 16.998  -12.014 1.00 61.23  ?  98  ASP F C   1 
ATOM   6823  O  O   . ASP F  1 98  ? -43.753 17.805  -12.942 1.00 60.82  ?  98  ASP F O   1 
ATOM   6824  C  CB  . ASP F  1 98  ? -43.215 18.561  -10.076 1.00 60.47  ?  98  ASP F CB  1 
ATOM   6825  C  CG  . ASP F  1 98  ? -44.524 18.283  -9.306  1.00 60.22  ?  98  ASP F CG  1 
ATOM   6826  O  OD1 . ASP F  1 98  ? -45.414 17.571  -9.807  1.00 59.78  ?  98  ASP F OD1 1 
ATOM   6827  O  OD2 . ASP F  1 98  ? -44.688 18.810  -8.187  1.00 59.99  -1 98  ASP F OD2 1 
ATOM   6828  N  N   . SER F  1 99  ? -44.219 15.815  -11.953 1.00 61.97  ?  99  SER F N   1 
ATOM   6829  C  CA  . SER F  1 99  ? -45.338 15.429  -12.833 1.00 62.58  ?  99  SER F CA  1 
ATOM   6830  C  C   . SER F  1 99  ? -46.037 16.614  -13.527 1.00 62.81  ?  99  SER F C   1 
ATOM   6831  O  O   . SER F  1 99  ? -45.950 16.780  -14.745 1.00 62.84  ?  99  SER F O   1 
ATOM   6832  C  CB  . SER F  1 99  ? -46.397 14.661  -12.025 1.00 62.50  ?  99  SER F CB  1 
ATOM   6833  O  OG  . SER F  1 99  ? -46.086 13.292  -11.913 1.00 63.75  ?  99  SER F OG  1 
ATOM   6834  N  N   . ASP F  1 100 ? -46.706 17.435  -12.719 1.00 62.89  ?  100 ASP F N   1 
ATOM   6835  C  CA  . ASP F  1 100 ? -47.703 18.397  -13.179 1.00 62.98  ?  100 ASP F CA  1 
ATOM   6836  C  C   . ASP F  1 100 ? -47.129 19.557  -14.013 1.00 62.54  ?  100 ASP F C   1 
ATOM   6837  O  O   . ASP F  1 100 ? -47.836 20.120  -14.877 1.00 62.49  ?  100 ASP F O   1 
ATOM   6838  C  CB  . ASP F  1 100 ? -48.502 18.936  -11.976 1.00 63.59  ?  100 ASP F CB  1 
ATOM   6839  C  CG  . ASP F  1 100 ? -48.711 17.882  -10.874 1.00 65.05  ?  100 ASP F CG  1 
ATOM   6840  O  OD1 . ASP F  1 100 ? -48.445 18.213  -9.692  1.00 65.76  ?  100 ASP F OD1 1 
ATOM   6841  O  OD2 . ASP F  1 100 ? -49.119 16.729  -11.187 1.00 66.55  -1 100 ASP F OD2 1 
ATOM   6842  N  N   . ILE F  1 101 ? -45.860 19.905  -13.765 1.00 61.50  ?  101 ILE F N   1 
ATOM   6843  C  CA  . ILE F  1 101 ? -45.177 20.950  -14.548 1.00 60.56  ?  101 ILE F CA  1 
ATOM   6844  C  C   . ILE F  1 101 ? -44.898 20.388  -15.949 1.00 60.02  ?  101 ILE F C   1 
ATOM   6845  O  O   . ILE F  1 101 ? -44.216 19.361  -16.103 1.00 60.17  ?  101 ILE F O   1 
ATOM   6846  C  CB  . ILE F  1 101 ? -43.869 21.533  -13.827 1.00 60.69  ?  101 ILE F CB  1 
ATOM   6847  C  CG1 . ILE F  1 101 ? -44.165 22.103  -12.422 1.00 60.64  ?  101 ILE F CG1 1 
ATOM   6848  C  CG2 . ILE F  1 101 ? -43.175 22.606  -14.661 1.00 59.99  ?  101 ILE F CG2 1 
ATOM   6849  C  CD1 . ILE F  1 101 ? -45.345 23.125  -12.340 1.00 60.49  ?  101 ILE F CD1 1 
ATOM   6850  N  N   . ASP F  1 102 ? -45.481 21.035  -16.958 1.00 59.10  ?  102 ASP F N   1 
ATOM   6851  C  CA  . ASP F  1 102 ? -45.290 20.630  -18.352 1.00 58.07  ?  102 ASP F CA  1 
ATOM   6852  C  C   . ASP F  1 102 ? -43.941 21.109  -18.833 1.00 57.18  ?  102 ASP F C   1 
ATOM   6853  O  O   . ASP F  1 102 ? -43.200 20.357  -19.458 1.00 57.50  ?  102 ASP F O   1 
ATOM   6854  C  CB  . ASP F  1 102 ? -46.390 21.203  -19.245 1.00 58.33  ?  102 ASP F CB  1 
ATOM   6855  C  CG  . ASP F  1 102 ? -47.780 20.795  -18.797 1.00 58.30  ?  102 ASP F CG  1 
ATOM   6856  O  OD1 . ASP F  1 102 ? -47.877 19.857  -17.970 1.00 57.53  ?  102 ASP F OD1 1 
ATOM   6857  O  OD2 . ASP F  1 102 ? -48.766 21.419  -19.269 1.00 57.69  -1 102 ASP F OD2 1 
ATOM   6858  N  N   . CYS F  1 103 ? -43.628 22.366  -18.537 1.00 55.79  ?  103 CYS F N   1 
ATOM   6859  C  CA  . CYS F  1 103 ? -42.310 22.942  -18.821 1.00 54.89  ?  103 CYS F CA  1 
ATOM   6860  C  C   . CYS F  1 103 ? -42.169 24.308  -18.142 1.00 53.42  ?  103 CYS F C   1 
ATOM   6861  O  O   . CYS F  1 103 ? -43.105 24.817  -17.525 1.00 53.25  ?  103 CYS F O   1 
ATOM   6862  C  CB  . CYS F  1 103 ? -42.056 23.056  -20.346 1.00 55.01  ?  103 CYS F CB  1 
ATOM   6863  S  SG  . CYS F  1 103 ? -43.496 23.689  -21.315 1.00 56.31  ?  103 CYS F SG  1 
ATOM   6864  N  N   . CYS F  1 104 ? -40.996 24.897  -18.256 1.00 51.64  ?  104 CYS F N   1 
ATOM   6865  C  CA  . CYS F  1 104 ? -40.864 26.273  -17.907 1.00 50.72  ?  104 CYS F CA  1 
ATOM   6866  C  C   . CYS F  1 104 ? -40.484 27.011  -19.176 1.00 50.36  ?  104 CYS F C   1 
ATOM   6867  O  O   . CYS F  1 104 ? -39.968 26.403  -20.111 1.00 50.44  ?  104 CYS F O   1 
ATOM   6868  C  CB  . CYS F  1 104 ? -39.778 26.438  -16.860 1.00 50.60  ?  104 CYS F CB  1 
ATOM   6869  S  SG  . CYS F  1 104 ? -39.918 25.274  -15.521 1.00 50.76  ?  104 CYS F SG  1 
ATOM   6870  N  N   . ARG F  1 105 ? -40.772 28.307  -19.234 1.00 49.18  ?  105 ARG F N   1 
ATOM   6871  C  CA  . ARG F  1 105 ? -40.051 29.161  -20.161 1.00 48.19  ?  105 ARG F CA  1 
ATOM   6872  C  C   . ARG F  1 105 ? -39.761 30.477  -19.482 1.00 46.67  ?  105 ARG F C   1 
ATOM   6873  O  O   . ARG F  1 105 ? -40.356 30.801  -18.465 1.00 46.38  ?  105 ARG F O   1 
ATOM   6874  C  CB  . ARG F  1 105 ? -40.738 29.328  -21.547 1.00 48.67  ?  105 ARG F CB  1 
ATOM   6875  C  CG  . ARG F  1 105 ? -42.220 29.761  -21.566 1.00 50.55  ?  105 ARG F CG  1 
ATOM   6876  C  CD  . ARG F  1 105 ? -43.207 28.590  -21.837 1.00 53.25  ?  105 ARG F CD  1 
ATOM   6877  N  NE  . ARG F  1 105 ? -42.955 27.883  -23.112 1.00 56.07  ?  105 ARG F NE  1 
ATOM   6878  C  CZ  . ARG F  1 105 ? -43.836 27.711  -24.104 1.00 55.35  ?  105 ARG F CZ  1 
ATOM   6879  N  NH1 . ARG F  1 105 ? -45.078 28.183  -24.010 1.00 56.23  ?  105 ARG F NH1 1 
ATOM   6880  N  NH2 . ARG F  1 105 ? -43.475 27.045  -25.194 1.00 53.74  ?  105 ARG F NH2 1 
ATOM   6881  N  N   . TRP F  1 106 ? -38.813 31.201  -20.054 1.00 45.16  ?  106 TRP F N   1 
ATOM   6882  C  CA  . TRP F  1 106 ? -38.409 32.516  -19.614 1.00 43.43  ?  106 TRP F CA  1 
ATOM   6883  C  C   . TRP F  1 106 ? -39.092 33.549  -20.474 1.00 42.73  ?  106 TRP F C   1 
ATOM   6884  O  O   . TRP F  1 106 ? -38.865 33.631  -21.672 1.00 42.08  ?  106 TRP F O   1 
ATOM   6885  C  CB  . TRP F  1 106 ? -36.913 32.650  -19.793 1.00 43.03  ?  106 TRP F CB  1 
ATOM   6886  C  CG  . TRP F  1 106 ? -36.152 31.846  -18.819 1.00 43.10  ?  106 TRP F CG  1 
ATOM   6887  C  CD1 . TRP F  1 106 ? -35.599 30.618  -19.017 1.00 43.26  ?  106 TRP F CD1 1 
ATOM   6888  C  CD2 . TRP F  1 106 ? -35.852 32.212  -17.472 1.00 42.34  ?  106 TRP F CD2 1 
ATOM   6889  N  NE1 . TRP F  1 106 ? -34.965 30.194  -17.873 1.00 43.63  ?  106 TRP F NE1 1 
ATOM   6890  C  CE2 . TRP F  1 106 ? -35.100 31.167  -16.913 1.00 42.70  ?  106 TRP F CE2 1 
ATOM   6891  C  CE3 . TRP F  1 106 ? -36.143 33.330  -16.686 1.00 41.06  ?  106 TRP F CE3 1 
ATOM   6892  C  CZ2 . TRP F  1 106 ? -34.628 31.210  -15.608 1.00 41.71  ?  106 TRP F CZ2 1 
ATOM   6893  C  CZ3 . TRP F  1 106 ? -35.671 33.373  -15.403 1.00 41.77  ?  106 TRP F CZ3 1 
ATOM   6894  C  CH2 . TRP F  1 106 ? -34.922 32.321  -14.871 1.00 41.34  ?  106 TRP F CH2 1 
ATOM   6895  N  N   . VAL F  1 107 ? -39.923 34.353  -19.845 1.00 42.21  ?  107 VAL F N   1 
ATOM   6896  C  CA  . VAL F  1 107 ? -40.771 35.271  -20.567 1.00 41.48  ?  107 VAL F CA  1 
ATOM   6897  C  C   . VAL F  1 107 ? -40.592 36.727  -20.091 1.00 41.07  ?  107 VAL F C   1 
ATOM   6898  O  O   . VAL F  1 107 ? -40.024 36.976  -19.040 1.00 40.92  ?  107 VAL F O   1 
ATOM   6899  C  CB  . VAL F  1 107 ? -42.191 34.748  -20.452 1.00 41.75  ?  107 VAL F CB  1 
ATOM   6900  C  CG1 . VAL F  1 107 ? -43.201 35.831  -20.616 1.00 42.51  ?  107 VAL F CG1 1 
ATOM   6901  C  CG2 . VAL F  1 107 ? -42.399 33.615  -21.473 1.00 41.57  ?  107 VAL F CG2 1 
ATOM   6902  N  N   . SER F  1 108 ? -41.023 37.690  -20.893 1.00 41.00  ?  108 SER F N   1 
ATOM   6903  C  CA  . SER F  1 108 ? -40.919 39.100  -20.511 1.00 40.64  ?  108 SER F CA  1 
ATOM   6904  C  C   . SER F  1 108 ? -42.112 39.520  -19.690 1.00 40.80  ?  108 SER F C   1 
ATOM   6905  O  O   . SER F  1 108 ? -43.202 38.914  -19.756 1.00 40.34  ?  108 SER F O   1 
ATOM   6906  C  CB  . SER F  1 108 ? -40.803 40.016  -21.731 1.00 40.37  ?  108 SER F CB  1 
ATOM   6907  O  OG  . SER F  1 108 ? -42.046 40.090  -22.388 1.00 39.20  ?  108 SER F OG  1 
ATOM   6908  N  N   . ALA F  1 109 ? -41.890 40.572  -18.915 1.00 41.07  ?  109 ALA F N   1 
ATOM   6909  C  CA  . ALA F  1 109 ? -42.976 41.221  -18.195 1.00 42.07  ?  109 ALA F CA  1 
ATOM   6910  C  C   . ALA F  1 109 ? -44.173 41.440  -19.122 1.00 42.46  ?  109 ALA F C   1 
ATOM   6911  O  O   . ALA F  1 109 ? -45.289 40.983  -18.840 1.00 42.60  ?  109 ALA F O   1 
ATOM   6912  C  CB  . ALA F  1 109 ? -42.489 42.559  -17.598 1.00 42.03  ?  109 ALA F CB  1 
ATOM   6913  N  N   . GLU F  1 110 ? -43.912 42.109  -20.241 1.00 43.05  ?  110 GLU F N   1 
ATOM   6914  C  CA  . GLU F  1 110 ? -44.922 42.345  -21.251 1.00 44.97  ?  110 GLU F CA  1 
ATOM   6915  C  C   . GLU F  1 110 ? -45.685 41.071  -21.649 1.00 44.76  ?  110 GLU F C   1 
ATOM   6916  O  O   . GLU F  1 110 ? -46.901 41.048  -21.523 1.00 44.74  ?  110 GLU F O   1 
ATOM   6917  C  CB  . GLU F  1 110 ? -44.347 43.098  -22.450 1.00 45.41  ?  110 GLU F CB  1 
ATOM   6918  C  CG  . GLU F  1 110 ? -42.800 43.203  -22.445 1.00 50.87  ?  110 GLU F CG  1 
ATOM   6919  C  CD  . GLU F  1 110 ? -42.239 44.261  -21.454 1.00 56.58  ?  110 GLU F CD  1 
ATOM   6920  O  OE1 . GLU F  1 110 ? -42.849 45.364  -21.360 1.00 59.07  ?  110 GLU F OE1 1 
ATOM   6921  O  OE2 . GLU F  1 110 ? -41.191 43.996  -20.787 1.00 56.20  -1 110 GLU F OE2 1 
ATOM   6922  N  N   . GLU F  1 111 ? -45.002 40.002  -22.060 1.00 45.02  ?  111 GLU F N   1 
ATOM   6923  C  CA  . GLU F  1 111 ? -45.732 38.774  -22.459 1.00 45.28  ?  111 GLU F CA  1 
ATOM   6924  C  C   . GLU F  1 111 ? -46.696 38.330  -21.364 1.00 44.93  ?  111 GLU F C   1 
ATOM   6925  O  O   . GLU F  1 111 ? -47.852 37.974  -21.666 1.00 45.06  ?  111 GLU F O   1 
ATOM   6926  C  CB  . GLU F  1 111 ? -44.812 37.609  -22.837 1.00 45.56  ?  111 GLU F CB  1 
ATOM   6927  C  CG  . GLU F  1 111 ? -43.852 37.832  -24.039 1.00 47.25  ?  111 GLU F CG  1 
ATOM   6928  C  CD  . GLU F  1 111 ? -42.738 36.785  -24.074 1.00 48.91  ?  111 GLU F CD  1 
ATOM   6929  O  OE1 . GLU F  1 111 ? -43.044 35.580  -24.247 1.00 50.13  ?  111 GLU F OE1 1 
ATOM   6930  O  OE2 . GLU F  1 111 ? -41.561 37.162  -23.911 1.00 47.89  -1 111 GLU F OE2 1 
ATOM   6931  N  N   . ILE F  1 112 ? -46.233 38.389  -20.104 1.00 44.09  ?  112 ILE F N   1 
ATOM   6932  C  CA  . ILE F  1 112 ? -47.046 37.970  -18.948 1.00 42.73  ?  112 ILE F CA  1 
ATOM   6933  C  C   . ILE F  1 112 ? -48.203 38.919  -18.697 1.00 42.99  ?  112 ILE F C   1 
ATOM   6934  O  O   . ILE F  1 112 ? -49.348 38.487  -18.486 1.00 42.85  ?  112 ILE F O   1 
ATOM   6935  C  CB  . ILE F  1 112 ? -46.234 37.879  -17.656 1.00 42.34  ?  112 ILE F CB  1 
ATOM   6936  C  CG1 . ILE F  1 112 ? -44.995 37.010  -17.872 1.00 40.95  ?  112 ILE F CG1 1 
ATOM   6937  C  CG2 . ILE F  1 112 ? -47.125 37.354  -16.532 1.00 41.57  ?  112 ILE F CG2 1 
ATOM   6938  C  CD1 . ILE F  1 112 ? -44.141 36.773  -16.674 1.00 35.14  ?  112 ILE F CD1 1 
ATOM   6939  N  N   . LEU F  1 113 ? -47.890 40.212  -18.694 1.00 43.04  ?  113 LEU F N   1 
ATOM   6940  C  CA  . LEU F  1 113 ? -48.902 41.258  -18.592 1.00 43.49  ?  113 LEU F CA  1 
ATOM   6941  C  C   . LEU F  1 113 ? -49.956 41.211  -19.738 1.00 44.66  ?  113 LEU F C   1 
ATOM   6942  O  O   . LEU F  1 113 ? -51.156 41.370  -19.477 1.00 44.40  ?  113 LEU F O   1 
ATOM   6943  C  CB  . LEU F  1 113 ? -48.201 42.620  -18.501 1.00 43.32  ?  113 LEU F CB  1 
ATOM   6944  C  CG  . LEU F  1 113 ? -47.920 43.337  -17.155 1.00 40.89  ?  113 LEU F CG  1 
ATOM   6945  C  CD1 . LEU F  1 113 ? -47.860 42.419  -15.936 1.00 38.49  ?  113 LEU F CD1 1 
ATOM   6946  C  CD2 . LEU F  1 113 ? -46.661 44.151  -17.280 1.00 37.98  ?  113 LEU F CD2 1 
ATOM   6947  N  N   . GLN F  1 114 ? -49.497 40.982  -20.984 1.00 45.64  ?  114 GLN F N   1 
ATOM   6948  C  CA  . GLN F  1 114 ? -50.370 40.744  -22.146 1.00 46.64  ?  114 GLN F CA  1 
ATOM   6949  C  C   . GLN F  1 114 ? -51.083 39.384  -22.088 1.00 47.05  ?  114 GLN F C   1 
ATOM   6950  O  O   . GLN F  1 114 ? -52.247 39.287  -22.458 1.00 47.22  ?  114 GLN F O   1 
ATOM   6951  C  CB  . GLN F  1 114 ? -49.605 40.791  -23.471 1.00 46.83  ?  114 GLN F CB  1 
ATOM   6952  C  CG  . GLN F  1 114 ? -48.434 41.760  -23.555 1.00 48.76  ?  114 GLN F CG  1 
ATOM   6953  C  CD  . GLN F  1 114 ? -48.841 43.197  -23.801 1.00 50.28  ?  114 GLN F CD  1 
ATOM   6954  O  OE1 . GLN F  1 114 ? -48.602 44.078  -22.959 1.00 50.70  ?  114 GLN F OE1 1 
ATOM   6955  N  NE2 . GLN F  1 114 ? -49.465 43.446  -24.954 1.00 48.44  ?  114 GLN F NE2 1 
ATOM   6956  N  N   . ALA F  1 115 ? -50.392 38.337  -21.643 1.00 47.28  ?  115 ALA F N   1 
ATOM   6957  C  CA  . ALA F  1 115 ? -50.950 36.968  -21.675 1.00 47.65  ?  115 ALA F CA  1 
ATOM   6958  C  C   . ALA F  1 115 ? -52.355 36.815  -21.100 1.00 47.68  ?  115 ALA F C   1 
ATOM   6959  O  O   . ALA F  1 115 ? -52.780 37.596  -20.250 1.00 47.91  ?  115 ALA F O   1 
ATOM   6960  C  CB  . ALA F  1 115 ? -50.001 35.994  -20.992 1.00 47.63  ?  115 ALA F CB  1 
ATOM   6961  N  N   . SER F  1 116 ? -53.079 35.804  -21.565 1.00 48.01  ?  116 SER F N   1 
ATOM   6962  C  CA  . SER F  1 116 ? -54.414 35.537  -21.020 1.00 48.25  ?  116 SER F CA  1 
ATOM   6963  C  C   . SER F  1 116 ? -54.648 34.059  -20.774 1.00 48.19  ?  116 SER F C   1 
ATOM   6964  O  O   . SER F  1 116 ? -55.776 33.576  -20.798 1.00 48.24  ?  116 SER F O   1 
ATOM   6965  C  CB  . SER F  1 116 ? -55.488 36.102  -21.938 1.00 48.45  ?  116 SER F CB  1 
ATOM   6966  O  OG  . SER F  1 116 ? -55.353 35.540  -23.220 1.00 48.85  ?  116 SER F OG  1 
ATOM   6967  N  N   . ASN F  1 117 ? -53.559 33.345  -20.543 1.00 48.34  ?  117 ASN F N   1 
ATOM   6968  C  CA  . ASN F  1 117 ? -53.604 31.971  -20.068 1.00 48.58  ?  117 ASN F CA  1 
ATOM   6969  C  C   . ASN F  1 117 ? -52.996 31.910  -18.644 1.00 48.91  ?  117 ASN F C   1 
ATOM   6970  O  O   . ASN F  1 117 ? -52.310 30.940  -18.291 1.00 49.24  ?  117 ASN F O   1 
ATOM   6971  C  CB  . ASN F  1 117 ? -52.796 31.105  -21.019 1.00 48.41  ?  117 ASN F CB  1 
ATOM   6972  C  CG  . ASN F  1 117 ? -51.523 31.789  -21.453 1.00 47.86  ?  117 ASN F CG  1 
ATOM   6973  O  OD1 . ASN F  1 117 ? -51.485 33.005  -21.534 1.00 49.55  ?  117 ASN F OD1 1 
ATOM   6974  N  ND2 . ASN F  1 117 ? -50.474 31.024  -21.711 1.00 47.11  ?  117 ASN F ND2 1 
ATOM   6975  N  N   . LEU F  1 118 ? -53.234 32.938  -17.823 1.00 48.10  ?  118 LEU F N   1 
ATOM   6976  C  CA  . LEU F  1 118 ? -52.609 32.958  -16.501 1.00 47.18  ?  118 LEU F CA  1 
ATOM   6977  C  C   . LEU F  1 118 ? -53.450 32.179  -15.510 1.00 47.21  ?  118 LEU F C   1 
ATOM   6978  O  O   . LEU F  1 118 ? -54.687 32.295  -15.481 1.00 46.98  ?  118 LEU F O   1 
ATOM   6979  C  CB  . LEU F  1 118 ? -52.330 34.393  -16.027 1.00 46.67  ?  118 LEU F CB  1 
ATOM   6980  C  CG  . LEU F  1 118 ? -51.516 35.290  -16.989 1.00 46.25  ?  118 LEU F CG  1 
ATOM   6981  C  CD1 . LEU F  1 118 ? -51.310 36.706  -16.452 1.00 45.21  ?  118 LEU F CD1 1 
ATOM   6982  C  CD2 . LEU F  1 118 ? -50.171 34.691  -17.377 1.00 42.29  ?  118 LEU F CD2 1 
ATOM   6983  N  N   . ARG F  1 119 ? -52.768 31.367  -14.711 1.00 47.21  ?  119 ARG F N   1 
ATOM   6984  C  CA  . ARG F  1 119 ? -53.422 30.468  -13.748 1.00 47.66  ?  119 ARG F CA  1 
ATOM   6985  C  C   . ARG F  1 119 ? -54.260 31.178  -12.672 1.00 47.23  ?  119 ARG F C   1 
ATOM   6986  O  O   . ARG F  1 119 ? -55.094 30.540  -12.023 1.00 47.66  ?  119 ARG F O   1 
ATOM   6987  C  CB  . ARG F  1 119 ? -52.382 29.505  -13.135 1.00 48.46  ?  119 ARG F CB  1 
ATOM   6988  C  CG  . ARG F  1 119 ? -52.761 28.812  -11.823 1.00 50.32  ?  119 ARG F CG  1 
ATOM   6989  C  CD  . ARG F  1 119 ? -52.901 27.295  -11.963 1.00 56.65  ?  119 ARG F CD  1 
ATOM   6990  N  NE  . ARG F  1 119 ? -52.949 26.648  -10.639 1.00 60.58  ?  119 ARG F NE  1 
ATOM   6991  C  CZ  . ARG F  1 119 ? -51.902 26.109  -10.009 1.00 62.13  ?  119 ARG F CZ  1 
ATOM   6992  N  NH1 . ARG F  1 119 ? -50.692 26.104  -10.574 1.00 64.48  ?  119 ARG F NH1 1 
ATOM   6993  N  NH2 . ARG F  1 119 ? -52.065 25.573  -8.804  1.00 62.31  ?  119 ARG F NH2 1 
ATOM   6994  N  N   . SER F  1 120 ? -54.031 32.485  -12.494 1.00 46.64  ?  120 SER F N   1 
ATOM   6995  C  CA  . SER F  1 120 ? -54.794 33.366  -11.578 1.00 45.55  ?  120 SER F CA  1 
ATOM   6996  C  C   . SER F  1 120 ? -54.386 34.774  -11.933 1.00 44.76  ?  120 SER F C   1 
ATOM   6997  O  O   . SER F  1 120 ? -53.277 34.961  -12.423 1.00 44.51  ?  120 SER F O   1 
ATOM   6998  C  CB  . SER F  1 120 ? -54.500 33.065  -10.090 1.00 45.84  ?  120 SER F CB  1 
ATOM   6999  O  OG  . SER F  1 120 ? -53.267 33.610  -9.611  1.00 45.75  ?  120 SER F OG  1 
ATOM   7000  N  N   . PRO F  1 121 ? -55.262 35.777  -11.705 1.00 44.33  ?  121 PRO F N   1 
ATOM   7001  C  CA  . PRO F  1 121 ? -54.863 37.140  -12.114 1.00 43.64  ?  121 PRO F CA  1 
ATOM   7002  C  C   . PRO F  1 121 ? -53.675 37.646  -11.286 1.00 42.61  ?  121 PRO F C   1 
ATOM   7003  O  O   . PRO F  1 121 ? -52.911 38.510  -11.731 1.00 43.15  ?  121 PRO F O   1 
ATOM   7004  C  CB  . PRO F  1 121 ? -56.131 37.969  -11.883 1.00 43.87  ?  121 PRO F CB  1 
ATOM   7005  C  CG  . PRO F  1 121 ? -56.870 37.226  -10.804 1.00 44.55  ?  121 PRO F CG  1 
ATOM   7006  C  CD  . PRO F  1 121 ? -56.565 35.763  -11.012 1.00 44.58  ?  121 PRO F CD  1 
ATOM   7007  N  N   . LEU F  1 122 ? -53.504 37.051  -10.112 1.00 40.94  ?  122 LEU F N   1 
ATOM   7008  C  CA  . LEU F  1 122 ? -52.358 37.304  -9.243  1.00 39.70  ?  122 LEU F CA  1 
ATOM   7009  C  C   . LEU F  1 122 ? -51.007 37.286  -9.945  1.00 38.87  ?  122 LEU F C   1 
ATOM   7010  O  O   . LEU F  1 122 ? -50.078 38.055  -9.588  1.00 38.57  ?  122 LEU F O   1 
ATOM   7011  C  CB  . LEU F  1 122 ? -52.352 36.297  -8.086  1.00 39.26  ?  122 LEU F CB  1 
ATOM   7012  C  CG  . LEU F  1 122 ? -53.084 36.843  -6.864  1.00 39.45  ?  122 LEU F CG  1 
ATOM   7013  C  CD1 . LEU F  1 122 ? -53.167 35.815  -5.770  1.00 38.60  ?  122 LEU F CD1 1 
ATOM   7014  C  CD2 . LEU F  1 122 ? -52.354 38.100  -6.377  1.00 38.51  ?  122 LEU F CD2 1 
ATOM   7015  N  N   . VAL F  1 123 ? -50.921 36.395  -10.935 1.00 37.58  ?  123 VAL F N   1 
ATOM   7016  C  CA  . VAL F  1 123 ? -49.686 36.079  -11.617 1.00 36.07  ?  123 VAL F CA  1 
ATOM   7017  C  C   . VAL F  1 123 ? -49.241 37.367  -12.248 1.00 35.04  ?  123 VAL F C   1 
ATOM   7018  O  O   . VAL F  1 123 ? -48.061 37.717  -12.187 1.00 34.82  ?  123 VAL F O   1 
ATOM   7019  C  CB  . VAL F  1 123 ? -49.897 34.964  -12.705 1.00 36.41  ?  123 VAL F CB  1 
ATOM   7020  C  CG1 . VAL F  1 123 ? -48.607 34.653  -13.408 1.00 36.06  ?  123 VAL F CG1 1 
ATOM   7021  C  CG2 . VAL F  1 123 ? -50.471 33.677  -12.096 1.00 35.91  ?  123 VAL F CG2 1 
ATOM   7022  N  N   . ALA F  1 124 ? -50.199 38.093  -12.824 1.00 33.84  ?  124 ALA F N   1 
ATOM   7023  C  CA  . ALA F  1 124 ? -49.899 39.415  -13.402 1.00 33.39  ?  124 ALA F CA  1 
ATOM   7024  C  C   . ALA F  1 124 ? -49.503 40.428  -12.319 1.00 32.66  ?  124 ALA F C   1 
ATOM   7025  O  O   . ALA F  1 124 ? -48.453 41.043  -12.386 1.00 32.58  ?  124 ALA F O   1 
ATOM   7026  C  CB  . ALA F  1 124 ? -51.082 39.936  -14.238 1.00 33.17  ?  124 ALA F CB  1 
ATOM   7027  N  N   . GLU F  1 125 ? -50.349 40.575  -11.307 1.00 32.49  ?  125 GLU F N   1 
ATOM   7028  C  CA  . GLU F  1 125 ? -50.005 41.400  -10.178 1.00 31.98  ?  125 GLU F CA  1 
ATOM   7029  C  C   . GLU F  1 125 ? -48.627 41.085  -9.669  1.00 31.11  ?  125 GLU F C   1 
ATOM   7030  O  O   . GLU F  1 125 ? -47.855 42.008  -9.363  1.00 30.52  ?  125 GLU F O   1 
ATOM   7031  C  CB  . GLU F  1 125 ? -51.013 41.253  -9.066  1.00 32.05  ?  125 GLU F CB  1 
ATOM   7032  C  CG  . GLU F  1 125 ? -51.817 42.504  -8.915  1.00 35.59  ?  125 GLU F CG  1 
ATOM   7033  C  CD  . GLU F  1 125 ? -50.994 43.672  -8.404  1.00 38.08  ?  125 GLU F CD  1 
ATOM   7034  O  OE1 . GLU F  1 125 ? -50.308 43.496  -7.380  1.00 39.50  ?  125 GLU F OE1 1 
ATOM   7035  O  OE2 . GLU F  1 125 ? -51.071 44.774  -8.999  1.00 39.20  -1 125 GLU F OE2 1 
ATOM   7036  N  N   . SER F  1 126 ? -48.305 39.797  -9.575  1.00 29.46  ?  126 SER F N   1 
ATOM   7037  C  CA  . SER F  1 126 ? -46.983 39.468  -9.107  1.00 28.62  ?  126 SER F CA  1 
ATOM   7038  C  C   . SER F  1 126 ? -45.975 40.254  -9.902  1.00 28.05  ?  126 SER F C   1 
ATOM   7039  O  O   . SER F  1 126 ? -45.167 40.951  -9.314  1.00 28.53  ?  126 SER F O   1 
ATOM   7040  C  CB  . SER F  1 126 ? -46.715 37.985  -9.177  1.00 28.57  ?  126 SER F CB  1 
ATOM   7041  O  OG  . SER F  1 126 ? -47.459 37.325  -8.179  1.00 28.05  ?  126 SER F OG  1 
ATOM   7042  N  N   . ILE F  1 127 ? -46.026 40.209  -11.230 1.00 27.63  ?  127 ILE F N   1 
ATOM   7043  C  CA  . ILE F  1 127 ? -45.042 40.980  -11.967 1.00 27.94  ?  127 ILE F CA  1 
ATOM   7044  C  C   . ILE F  1 127 ? -45.168 42.491  -11.697 1.00 28.80  ?  127 ILE F C   1 
ATOM   7045  O  O   . ILE F  1 127 ? -44.161 43.185  -11.536 1.00 28.75  ?  127 ILE F O   1 
ATOM   7046  C  CB  . ILE F  1 127 ? -44.936 40.622  -13.459 1.00 27.58  ?  127 ILE F CB  1 
ATOM   7047  C  CG1 . ILE F  1 127 ? -44.002 39.432  -13.645 1.00 27.44  ?  127 ILE F CG1 1 
ATOM   7048  C  CG2 . ILE F  1 127 ? -44.279 41.781  -14.260 1.00 28.17  ?  127 ILE F CG2 1 
ATOM   7049  C  CD1 . ILE F  1 127 ? -44.678 38.097  -13.458 1.00 28.44  ?  127 ILE F CD1 1 
ATOM   7050  N  N   . ARG F  1 128 ? -46.394 43.000  -11.612 1.00 29.71  ?  128 ARG F N   1 
ATOM   7051  C  CA  . ARG F  1 128 ? -46.555 44.424  -11.302 1.00 30.35  ?  128 ARG F CA  1 
ATOM   7052  C  C   . ARG F  1 128 ? -45.867 44.812  -9.972  1.00 29.78  ?  128 ARG F C   1 
ATOM   7053  O  O   . ARG F  1 128 ? -45.158 45.815  -9.909  1.00 30.79  ?  128 ARG F O   1 
ATOM   7054  C  CB  . ARG F  1 128 ? -48.026 44.888  -11.424 1.00 30.21  ?  128 ARG F CB  1 
ATOM   7055  C  CG  . ARG F  1 128 ? -48.370 45.388  -12.834 1.00 33.30  ?  128 ARG F CG  1 
ATOM   7056  C  CD  . ARG F  1 128 ? -49.778 45.923  -12.976 1.00 34.65  ?  128 ARG F CD  1 
ATOM   7057  N  NE  . ARG F  1 128 ? -50.709 44.951  -12.479 1.00 38.05  ?  128 ARG F NE  1 
ATOM   7058  C  CZ  . ARG F  1 128 ? -51.395 44.106  -13.236 1.00 43.58  ?  128 ARG F CZ  1 
ATOM   7059  N  NH1 . ARG F  1 128 ? -51.272 44.134  -14.569 1.00 44.31  ?  128 ARG F NH1 1 
ATOM   7060  N  NH2 . ARG F  1 128 ? -52.227 43.232  -12.646 1.00 45.56  ?  128 ARG F NH2 1 
ATOM   7061  N  N   . CYS F  1 129 ? -46.023 43.993  -8.944  1.00 28.72  ?  129 CYS F N   1 
ATOM   7062  C  CA  . CYS F  1 129 ? -45.304 44.204  -7.694  1.00 28.35  ?  129 CYS F CA  1 
ATOM   7063  C  C   . CYS F  1 129 ? -43.799 44.212  -7.819  1.00 27.41  ?  129 CYS F C   1 
ATOM   7064  O  O   . CYS F  1 129 ? -43.130 45.021  -7.193  1.00 27.38  ?  129 CYS F O   1 
ATOM   7065  C  CB  . CYS F  1 129 ? -45.706 43.172  -6.650  1.00 28.07  ?  129 CYS F CB  1 
ATOM   7066  S  SG  . CYS F  1 129 ? -47.390 43.408  -6.095  1.00 29.02  ?  129 CYS F SG  1 
ATOM   7067  N  N   . TYR F  1 130 ? -43.271 43.306  -8.624  1.00 27.41  ?  130 TYR F N   1 
ATOM   7068  C  CA  . TYR F  1 130 ? -41.836 43.215  -8.853  1.00 26.70  ?  130 TYR F CA  1 
ATOM   7069  C  C   . TYR F  1 130 ? -41.374 44.551  -9.319  1.00 27.54  ?  130 TYR F C   1 
ATOM   7070  O  O   . TYR F  1 130 ? -40.432 45.149  -8.783  1.00 27.55  ?  130 TYR F O   1 
ATOM   7071  C  CB  . TYR F  1 130 ? -41.562 42.231  -9.989  1.00 27.13  ?  130 TYR F CB  1 
ATOM   7072  C  CG  . TYR F  1 130 ? -40.111 42.081  -10.289 1.00 24.47  ?  130 TYR F CG  1 
ATOM   7073  C  CD1 . TYR F  1 130 ? -39.324 41.287  -9.501  1.00 22.40  ?  130 TYR F CD1 1 
ATOM   7074  C  CD2 . TYR F  1 130 ? -39.524 42.757  -11.350 1.00 24.34  ?  130 TYR F CD2 1 
ATOM   7075  C  CE1 . TYR F  1 130 ? -37.982 41.161  -9.758  1.00 27.39  ?  130 TYR F CE1 1 
ATOM   7076  C  CE2 . TYR F  1 130 ? -38.164 42.637  -11.621 1.00 24.44  ?  130 TYR F CE2 1 
ATOM   7077  C  CZ  . TYR F  1 130 ? -37.398 41.844  -10.820 1.00 25.40  ?  130 TYR F CZ  1 
ATOM   7078  O  OH  . TYR F  1 130 ? -36.044 41.709  -11.027 1.00 27.86  ?  130 TYR F OH  1 
ATOM   7079  N  N   . GLN F  1 131 ? -42.086 45.025  -10.329 1.00 28.05  ?  131 GLN F N   1 
ATOM   7080  C  CA  . GLN F  1 131 ? -41.657 46.152  -11.112 1.00 28.80  ?  131 GLN F CA  1 
ATOM   7081  C  C   . GLN F  1 131 ? -41.723 47.459  -10.373 1.00 29.17  ?  131 GLN F C   1 
ATOM   7082  O  O   . GLN F  1 131 ? -41.122 48.430  -10.853 1.00 29.98  ?  131 GLN F O   1 
ATOM   7083  C  CB  . GLN F  1 131 ? -42.487 46.267  -12.371 1.00 29.20  ?  131 GLN F CB  1 
ATOM   7084  C  CG  . GLN F  1 131 ? -42.163 45.230  -13.422 1.00 28.92  ?  131 GLN F CG  1 
ATOM   7085  C  CD  . GLN F  1 131 ? -42.894 45.526  -14.710 1.00 28.08  ?  131 GLN F CD  1 
ATOM   7086  O  OE1 . GLN F  1 131 ? -44.115 45.865  -14.720 1.00 24.37  ?  131 GLN F OE1 1 
ATOM   7087  N  NE2 . GLN F  1 131 ? -42.164 45.400  -15.810 1.00 24.39  ?  131 GLN F NE2 1 
ATOM   7088  N  N   . SER F  1 132 ? -42.419 47.522  -9.227  1.00 28.02  ?  132 SER F N   1 
ATOM   7089  C  CA  . SER F  1 132 ? -42.343 48.762  -8.456  1.00 26.71  ?  132 SER F CA  1 
ATOM   7090  C  C   . SER F  1 132 ? -40.953 49.008  -7.868  1.00 26.53  ?  132 SER F C   1 
ATOM   7091  O  O   . SER F  1 132 ? -40.600 50.133  -7.611  1.00 28.46  ?  132 SER F O   1 
ATOM   7092  C  CB  . SER F  1 132 ? -43.430 48.904  -7.400  1.00 26.35  ?  132 SER F CB  1 
ATOM   7093  O  OG  . SER F  1 132 ? -43.070 48.212  -6.231  1.00 25.27  ?  132 SER F OG  1 
ATOM   7094  N  N   . GLY F  1 133 ? -40.157 47.986  -7.644  1.00 25.64  ?  133 GLY F N   1 
ATOM   7095  C  CA  . GLY F  1 133 ? -38.806 48.220  -7.161  1.00 24.90  ?  133 GLY F CA  1 
ATOM   7096  C  C   . GLY F  1 133 ? -38.609 48.158  -5.648  1.00 24.78  ?  133 GLY F C   1 
ATOM   7097  O  O   . GLY F  1 133 ? -37.453 48.315  -5.157  1.00 24.10  ?  133 GLY F O   1 
ATOM   7098  N  N   . GLN F  1 134 ? -39.704 47.916  -4.914  1.00 23.37  ?  134 GLN F N   1 
ATOM   7099  C  CA  . GLN F  1 134 ? -39.682 47.927  -3.454  1.00 22.94  ?  134 GLN F CA  1 
ATOM   7100  C  C   . GLN F  1 134 ? -39.477 46.494  -3.028  1.00 22.72  ?  134 GLN F C   1 
ATOM   7101  O  O   . GLN F  1 134 ? -40.335 45.633  -3.294  1.00 22.82  ?  134 GLN F O   1 
ATOM   7102  C  CB  . GLN F  1 134 ? -40.985 48.507  -2.933  1.00 23.15  ?  134 GLN F CB  1 
ATOM   7103  C  CG  . GLN F  1 134 ? -41.688 49.161  -4.116  1.00 26.97  ?  134 GLN F CG  1 
ATOM   7104  C  CD  . GLN F  1 134 ? -42.900 49.984  -3.796  1.00 31.08  ?  134 GLN F CD  1 
ATOM   7105  O  OE1 . GLN F  1 134 ? -43.969 49.464  -3.392  1.00 34.01  ?  134 GLN F OE1 1 
ATOM   7106  N  NE2 . GLN F  1 134 ? -42.777 51.284  -4.044  1.00 29.93  ?  134 GLN F NE2 1 
ATOM   7107  N  N   . ARG F  1 135 ? -38.301 46.239  -2.431  1.00 21.25  ?  135 ARG F N   1 
ATOM   7108  C  CA  . ARG F  1 135 ? -37.913 44.937  -1.946  0.50 19.39  ?  135 ARG F CA  1 
ATOM   7109  C  C   . ARG F  1 135 ? -37.811 45.012  -0.435  1.00 19.88  ?  135 ARG F C   1 
ATOM   7110  O  O   . ARG F  1 135 ? -37.258 45.968  0.149   1.00 19.60  ?  135 ARG F O   1 
ATOM   7111  C  CB  . ARG F  1 135 ? -36.565 44.543  -2.526  0.50 18.97  ?  135 ARG F CB  1 
ATOM   7112  C  CG  . ARG F  1 135 ? -36.520 44.479  -4.042  0.50 16.22  ?  135 ARG F CG  1 
ATOM   7113  C  CD  . ARG F  1 135 ? -37.107 43.212  -4.616  0.50 11.14  ?  135 ARG F CD  1 
ATOM   7114  N  NE  . ARG F  1 135 ? -37.130 43.386  -6.049  0.50 12.05  ?  135 ARG F NE  1 
ATOM   7115  C  CZ  . ARG F  1 135 ? -38.158 43.910  -6.707  0.50 10.61  ?  135 ARG F CZ  1 
ATOM   7116  N  NH1 . ARG F  1 135 ? -39.259 44.250  -6.040  0.50 10.91  ?  135 ARG F NH1 1 
ATOM   7117  N  NH2 . ARG F  1 135 ? -38.085 44.092  -8.019  0.50 5.79   ?  135 ARG F NH2 1 
ATOM   7118  N  N   . TYR F  1 136 ? -38.337 43.992  0.221   1.00 20.06  ?  136 TYR F N   1 
ATOM   7119  C  CA  . TYR F  1 136 ? -38.392 43.964  1.672   1.00 20.29  ?  136 TYR F CA  1 
ATOM   7120  C  C   . TYR F  1 136 ? -37.517 42.826  2.182   1.00 19.15  ?  136 TYR F C   1 
ATOM   7121  O  O   . TYR F  1 136 ? -37.182 41.953  1.407   1.00 18.96  ?  136 TYR F O   1 
ATOM   7122  C  CB  . TYR F  1 136 ? -39.860 43.833  2.118   1.00 20.89  ?  136 TYR F CB  1 
ATOM   7123  C  CG  . TYR F  1 136 ? -40.690 45.054  1.708   1.00 25.13  ?  136 TYR F CG  1 
ATOM   7124  C  CD1 . TYR F  1 136 ? -40.609 46.270  2.411   1.00 27.80  ?  136 TYR F CD1 1 
ATOM   7125  C  CD2 . TYR F  1 136 ? -41.509 45.006  0.593   1.00 29.47  ?  136 TYR F CD2 1 
ATOM   7126  C  CE1 . TYR F  1 136 ? -41.345 47.372  2.015   1.00 29.54  ?  136 TYR F CE1 1 
ATOM   7127  C  CE2 . TYR F  1 136 ? -42.254 46.107  0.182   1.00 30.79  ?  136 TYR F CE2 1 
ATOM   7128  C  CZ  . TYR F  1 136 ? -42.182 47.278  0.892   1.00 31.98  ?  136 TYR F CZ  1 
ATOM   7129  O  OH  . TYR F  1 136 ? -42.951 48.343  0.452   1.00 32.67  ?  136 TYR F OH  1 
ATOM   7130  N  N   . PRO F  1 137 ? -37.144 42.850  3.482   1.00 18.57  ?  137 PRO F N   1 
ATOM   7131  C  CA  . PRO F  1 137 ? -36.315 41.842  4.136   1.00 18.03  ?  137 PRO F CA  1 
ATOM   7132  C  C   . PRO F  1 137 ? -37.074 40.566  4.375   1.00 17.58  ?  137 PRO F C   1 
ATOM   7133  O  O   . PRO F  1 137 ? -38.238 40.601  4.736   1.00 15.70  ?  137 PRO F O   1 
ATOM   7134  C  CB  . PRO F  1 137 ? -35.974 42.469  5.517   1.00 17.98  ?  137 PRO F CB  1 
ATOM   7135  C  CG  . PRO F  1 137 ? -36.455 43.920  5.448   1.00 18.46  ?  137 PRO F CG  1 
ATOM   7136  C  CD  . PRO F  1 137 ? -37.578 43.889  4.446   1.00 19.07  ?  137 PRO F CD  1 
ATOM   7137  N  N   . LEU F  1 138 ? -36.380 39.441  4.214   1.00 18.27  ?  138 LEU F N   1 
ATOM   7138  C  CA  . LEU F  1 138 ? -36.946 38.144  4.549   1.00 18.74  ?  138 LEU F CA  1 
ATOM   7139  C  C   . LEU F  1 138 ? -37.354 38.119  6.018   1.00 19.72  ?  138 LEU F C   1 
ATOM   7140  O  O   . LEU F  1 138 ? -38.451 37.610  6.335   1.00 20.52  ?  138 LEU F O   1 
ATOM   7141  C  CB  . LEU F  1 138 ? -35.985 37.001  4.187   1.00 17.70  ?  138 LEU F CB  1 
ATOM   7142  C  CG  . LEU F  1 138 ? -35.653 36.893  2.686   1.00 18.30  ?  138 LEU F CG  1 
ATOM   7143  C  CD1 . LEU F  1 138 ? -34.401 36.052  2.342   1.00 17.66  ?  138 LEU F CD1 1 
ATOM   7144  C  CD2 . LEU F  1 138 ? -36.846 36.446  1.873   1.00 14.89  ?  138 LEU F CD2 1 
ATOM   7145  N  N   . GLU F  1 139 ? -36.525 38.704  6.900   1.00 20.02  ?  139 GLU F N   1 
ATOM   7146  C  CA  . GLU F  1 139 ? -36.803 38.686  8.344   0.50 20.78  ?  139 GLU F CA  1 
ATOM   7147  C  C   . GLU F  1 139 ? -38.257 39.065  8.618   1.00 21.45  ?  139 GLU F C   1 
ATOM   7148  O  O   . GLU F  1 139 ? -38.833 38.603  9.575   1.00 22.27  ?  139 GLU F O   1 
ATOM   7149  C  CB  . GLU F  1 139 ? -35.843 39.586  9.147   0.50 20.53  ?  139 GLU F CB  1 
ATOM   7150  C  CG  . GLU F  1 139 ? -36.213 41.096  9.121   0.50 21.76  ?  139 GLU F CG  1 
ATOM   7151  C  CD  . GLU F  1 139 ? -35.396 41.974  10.074  0.50 23.03  ?  139 GLU F CD  1 
ATOM   7152  O  OE1 . GLU F  1 139 ? -35.356 41.651  11.286  0.50 24.49  ?  139 GLU F OE1 1 
ATOM   7153  O  OE2 . GLU F  1 139 ? -34.821 43.003  9.614   0.50 21.64  -1 139 GLU F OE2 1 
ATOM   7154  N  N   . MET F  1 140 ? -38.857 39.890  7.768   1.00 22.31  ?  140 MET F N   1 
ATOM   7155  C  CA  . MET F  1 140 ? -40.213 40.418  8.013   1.00 23.59  ?  140 MET F CA  1 
ATOM   7156  C  C   . MET F  1 140 ? -41.305 39.363  8.227   1.00 23.84  ?  140 MET F C   1 
ATOM   7157  O  O   . MET F  1 140 ? -42.375 39.662  8.738   1.00 24.59  ?  140 MET F O   1 
ATOM   7158  C  CB  . MET F  1 140 ? -40.667 41.362  6.882   1.00 23.36  ?  140 MET F CB  1 
ATOM   7159  C  CG  . MET F  1 140 ? -41.868 42.196  7.294   1.00 24.58  ?  140 MET F CG  1 
ATOM   7160  S  SD  . MET F  1 140 ? -42.683 42.977  5.887   1.00 30.52  ?  140 MET F SD  1 
ATOM   7161  C  CE  . MET F  1 140 ? -41.400 44.168  5.465   1.00 26.94  ?  140 MET F CE  1 
ATOM   7162  N  N   . ILE F  1 141 ? -41.057 38.146  7.780   1.00 24.15  ?  141 ILE F N   1 
ATOM   7163  C  CA  . ILE F  1 141 ? -42.002 37.070  7.969   1.00 24.15  ?  141 ILE F CA  1 
ATOM   7164  C  C   . ILE F  1 141 ? -41.247 35.808  8.410   1.00 23.63  ?  141 ILE F C   1 
ATOM   7165  O  O   . ILE F  1 141 ? -41.643 34.684  8.087   1.00 24.00  ?  141 ILE F O   1 
ATOM   7166  C  CB  . ILE F  1 141 ? -42.855 36.806  6.679   1.00 24.77  ?  141 ILE F CB  1 
ATOM   7167  C  CG1 . ILE F  1 141 ? -42.003 36.809  5.404   1.00 25.57  ?  141 ILE F CG1 1 
ATOM   7168  C  CG2 . ILE F  1 141 ? -43.956 37.823  6.538   1.00 25.80  ?  141 ILE F CG2 1 
ATOM   7169  C  CD1 . ILE F  1 141 ? -40.938 35.710  5.353   1.00 28.03  ?  141 ILE F CD1 1 
ATOM   7170  N  N   . GLY F  1 142 ? -40.164 35.998  9.150   1.00 22.89  ?  142 GLY F N   1 
ATOM   7171  C  CA  . GLY F  1 142 ? -39.275 34.898  9.487   1.00 23.41  ?  142 GLY F CA  1 
ATOM   7172  C  C   . GLY F  1 142 ? -39.741 34.033  10.633  1.00 24.07  ?  142 GLY F C   1 
ATOM   7173  O  O   . GLY F  1 142 ? -40.500 34.492  11.521  1.00 24.09  ?  142 GLY F O   1 
ATOM   7174  N  N   . ASP F  1 143 ? -39.298 32.774  10.596  1.00 25.07  ?  143 ASP F N   1 
ATOM   7175  C  CA  . ASP F  1 143 ? -39.434 31.800  11.707  1.00 26.03  ?  143 ASP F CA  1 
ATOM   7176  C  C   . ASP F  1 143 ? -38.861 32.445  12.977  1.00 26.29  ?  143 ASP F C   1 
ATOM   7177  O  O   . ASP F  1 143 ? -37.963 33.273  12.876  1.00 27.31  ?  143 ASP F O   1 
ATOM   7178  C  CB  . ASP F  1 143 ? -38.628 30.535  11.374  1.00 25.74  ?  143 ASP F CB  1 
ATOM   7179  C  CG  . ASP F  1 143 ? -37.188 30.846  10.970  1.00 28.39  ?  143 ASP F CG  1 
ATOM   7180  O  OD1 . ASP F  1 143 ? -37.003 31.584  9.969   1.00 32.10  ?  143 ASP F OD1 1 
ATOM   7181  O  OD2 . ASP F  1 143 ? -36.231 30.389  11.646  1.00 29.50  -1 143 ASP F OD2 1 
ATOM   7182  N  N   . PHE F  1 144 ? -39.350 32.085  14.155  1.00 26.51  ?  144 PHE F N   1 
ATOM   7183  C  CA  . PHE F  1 144 ? -38.719 32.555  15.378  1.00 27.60  ?  144 PHE F CA  1 
ATOM   7184  C  C   . PHE F  1 144 ? -38.444 31.434  16.377  1.00 28.63  ?  144 PHE F C   1 
ATOM   7185  O  O   . PHE F  1 144 ? -39.367 30.689  16.745  1.00 29.05  ?  144 PHE F O   1 
ATOM   7186  C  CB  . PHE F  1 144 ? -39.564 33.674  16.017  1.00 28.01  ?  144 PHE F CB  1 
ATOM   7187  C  CG  . PHE F  1 144 ? -39.142 34.039  17.419  1.00 26.41  ?  144 PHE F CG  1 
ATOM   7188  C  CD1 . PHE F  1 144 ? -38.071 34.900  17.635  1.00 25.64  ?  144 PHE F CD1 1 
ATOM   7189  C  CD2 . PHE F  1 144 ? -39.822 33.512  18.520  1.00 26.12  ?  144 PHE F CD2 1 
ATOM   7190  C  CE1 . PHE F  1 144 ? -37.673 35.234  18.922  1.00 26.98  ?  144 PHE F CE1 1 
ATOM   7191  C  CE2 . PHE F  1 144 ? -39.444 33.836  19.817  1.00 26.07  ?  144 PHE F CE2 1 
ATOM   7192  C  CZ  . PHE F  1 144 ? -38.362 34.686  20.025  1.00 28.03  ?  144 PHE F CZ  1 
ATOM   7193  N  N   . ASN F  1 145 ? -37.199 31.310  16.847  1.00 29.81  ?  145 ASN F N   1 
ATOM   7194  C  CA  . ASN F  1 145 ? -36.886 30.188  17.725  1.00 30.95  ?  145 ASN F CA  1 
ATOM   7195  C  C   . ASN F  1 145 ? -37.243 28.897  16.969  1.00 30.91  ?  145 ASN F C   1 
ATOM   7196  O  O   . ASN F  1 145 ? -37.990 28.067  17.485  1.00 31.45  ?  145 ASN F O   1 
ATOM   7197  C  CB  . ASN F  1 145 ? -37.798 30.214  18.957  1.00 32.03  ?  145 ASN F CB  1 
ATOM   7198  C  CG  . ASN F  1 145 ? -37.317 31.118  20.090  1.00 35.99  ?  145 ASN F CG  1 
ATOM   7199  O  OD1 . ASN F  1 145 ? -36.317 31.840  19.987  1.00 42.01  ?  145 ASN F OD1 1 
ATOM   7200  N  ND2 . ASN F  1 145 ? -38.050 31.063  21.211  1.00 38.88  ?  145 ASN F ND2 1 
ATOM   7201  N  N   . TRP F  1 146 ? -36.802 28.729  15.726  1.00 30.47  ?  146 TRP F N   1 
ATOM   7202  C  CA  . TRP F  1 146 ? -37.241 27.537  14.959  1.00 30.14  ?  146 TRP F CA  1 
ATOM   7203  C  C   . TRP F  1 146 ? -36.488 26.255  15.412  1.00 30.71  ?  146 TRP F C   1 
ATOM   7204  O  O   . TRP F  1 146 ? -35.249 26.220  15.423  1.00 31.35  ?  146 TRP F O   1 
ATOM   7205  C  CB  . TRP F  1 146 ? -37.098 27.814  13.457  1.00 29.69  ?  146 TRP F CB  1 
ATOM   7206  C  CG  . TRP F  1 146 ? -37.827 26.911  12.488  1.00 27.58  ?  146 TRP F CG  1 
ATOM   7207  C  CD1 . TRP F  1 146 ? -37.261 26.001  11.671  1.00 24.94  ?  146 TRP F CD1 1 
ATOM   7208  C  CD2 . TRP F  1 146 ? -39.238 26.867  12.213  1.00 25.19  ?  146 TRP F CD2 1 
ATOM   7209  N  NE1 . TRP F  1 146 ? -38.213 25.375  10.920  1.00 21.47  ?  146 TRP F NE1 1 
ATOM   7210  C  CE2 . TRP F  1 146 ? -39.435 25.895  11.223  1.00 23.07  ?  146 TRP F CE2 1 
ATOM   7211  C  CE3 . TRP F  1 146 ? -40.349 27.543  12.723  1.00 26.79  ?  146 TRP F CE3 1 
ATOM   7212  C  CZ2 . TRP F  1 146 ? -40.702 25.577  10.708  1.00 24.51  ?  146 TRP F CZ2 1 
ATOM   7213  C  CZ3 . TRP F  1 146 ? -41.618 27.227  12.222  1.00 26.43  ?  146 TRP F CZ3 1 
ATOM   7214  C  CH2 . TRP F  1 146 ? -41.779 26.249  11.212  1.00 25.08  ?  146 TRP F CH2 1 
ATOM   7215  N  N   . PRO F  1 147 ? -37.239 25.212  15.812  1.00 30.65  ?  147 PRO F N   1 
ATOM   7216  C  CA  . PRO F  1 147 ? -36.689 23.964  16.403  1.00 30.78  ?  147 PRO F CA  1 
ATOM   7217  C  C   . PRO F  1 147 ? -35.882 23.075  15.456  1.00 31.58  ?  147 PRO F C   1 
ATOM   7218  O  O   . PRO F  1 147 ? -34.944 22.395  15.895  1.00 32.26  ?  147 PRO F O   1 
ATOM   7219  C  CB  . PRO F  1 147 ? -37.950 23.200  16.830  1.00 31.13  ?  147 PRO F CB  1 
ATOM   7220  C  CG  . PRO F  1 147 ? -39.100 23.814  15.973  1.00 29.09  ?  147 PRO F CG  1 
ATOM   7221  C  CD  . PRO F  1 147 ? -38.717 25.225  15.774  1.00 29.76  ?  147 PRO F CD  1 
ATOM   7222  N  N   . PHE F  1 148 ? -36.262 23.060  14.175  1.00 31.87  ?  148 PHE F N   1 
ATOM   7223  C  CA  . PHE F  1 148 ? -35.719 22.145  13.162  1.00 31.23  ?  148 PHE F CA  1 
ATOM   7224  C  C   . PHE F  1 148 ? -34.384 22.587  12.551  1.00 31.78  ?  148 PHE F C   1 
ATOM   7225  O  O   . PHE F  1 148 ? -34.156 23.775  12.431  1.00 31.70  ?  148 PHE F O   1 
ATOM   7226  C  CB  . PHE F  1 148 ? -36.755 22.037  12.085  1.00 30.45  ?  148 PHE F CB  1 
ATOM   7227  C  CG  . PHE F  1 148 ? -38.084 21.655  12.598  1.00 31.11  ?  148 PHE F CG  1 
ATOM   7228  C  CD1 . PHE F  1 148 ? -39.082 22.603  12.773  1.00 32.41  ?  148 PHE F CD1 1 
ATOM   7229  C  CD2 . PHE F  1 148 ? -38.361 20.312  12.941  1.00 33.23  ?  148 PHE F CD2 1 
ATOM   7230  C  CE1 . PHE F  1 148 ? -40.381 22.221  13.273  1.00 34.18  ?  148 PHE F CE1 1 
ATOM   7231  C  CE2 . PHE F  1 148 ? -39.640 19.921  13.452  1.00 31.39  ?  148 PHE F CE2 1 
ATOM   7232  C  CZ  . PHE F  1 148 ? -40.651 20.866  13.614  1.00 31.32  ?  148 PHE F CZ  1 
ATOM   7233  N  N   . THR F  1 149 ? -33.497 21.655  12.174  1.00 32.87  ?  149 THR F N   1 
ATOM   7234  C  CA  . THR F  1 149 ? -32.261 22.038  11.458  1.00 34.40  ?  149 THR F CA  1 
ATOM   7235  C  C   . THR F  1 149 ? -32.498 22.598  10.065  1.00 35.41  ?  149 THR F C   1 
ATOM   7236  O  O   . THR F  1 149 ? -33.599 22.555  9.505   1.00 34.89  ?  149 THR F O   1 
ATOM   7237  C  CB  . THR F  1 149 ? -31.299 20.863  11.108  1.00 34.47  ?  149 THR F CB  1 
ATOM   7238  O  OG1 . THR F  1 149 ? -32.046 19.695  10.772  1.00 33.82  ?  149 THR F OG1 1 
ATOM   7239  C  CG2 . THR F  1 149 ? -30.245 20.601  12.168  1.00 34.65  ?  149 THR F CG2 1 
ATOM   7240  N  N   . LYS F  1 150 ? -31.392 23.055  9.490   1.00 36.96  ?  150 LYS F N   1 
ATOM   7241  C  CA  . LYS F  1 150 ? -31.338 23.375  8.069   1.00 38.52  ?  150 LYS F CA  1 
ATOM   7242  C  C   . LYS F  1 150 ? -30.471 22.375  7.291   1.00 37.59  ?  150 LYS F C   1 
ATOM   7243  O  O   . LYS F  1 150 ? -30.470 21.176  7.587   1.00 36.50  ?  150 LYS F O   1 
ATOM   7244  C  CB  . LYS F  1 150 ? -30.864 24.827  7.894   1.00 39.45  ?  150 LYS F CB  1 
ATOM   7245  C  CG  . LYS F  1 150 ? -32.016 25.902  7.962   1.00 42.01  ?  150 LYS F CG  1 
ATOM   7246  C  CD  . LYS F  1 150 ? -33.043 25.716  9.132   1.00 41.29  ?  150 LYS F CD  1 
ATOM   7247  C  CE  . LYS F  1 150 ? -34.269 26.643  9.020   1.00 40.32  ?  150 LYS F CE  1 
ATOM   7248  N  NZ  . LYS F  1 150 ? -33.981 28.088  9.362   1.00 40.42  ?  150 LYS F NZ  1 
ATOM   7249  N  N   . MET G  1 1   ? -51.195 0.704   24.395  1.00 41.93  ?  1   MET G N   1 
ATOM   7250  C  CA  . MET G  1 1   ? -49.994 -0.056  23.940  1.00 41.68  ?  1   MET G CA  1 
ATOM   7251  C  C   . MET G  1 1   ? -48.762 0.180   24.823  1.00 41.35  ?  1   MET G C   1 
ATOM   7252  O  O   . MET G  1 1   ? -48.494 1.304   25.292  1.00 41.23  ?  1   MET G O   1 
ATOM   7253  C  CB  . MET G  1 1   ? -49.657 0.246   22.498  1.00 41.48  ?  1   MET G CB  1 
ATOM   7254  C  CG  . MET G  1 1   ? -49.251 1.665   22.294  1.00 44.47  ?  1   MET G CG  1 
ATOM   7255  S  SD  . MET G  1 1   ? -47.732 1.719   21.371  1.00 49.70  ?  1   MET G SD  1 
ATOM   7256  C  CE  . MET G  1 1   ? -48.313 1.083   19.782  1.00 48.54  ?  1   MET G CE  1 
ATOM   7257  N  N   . PHE G  1 2   ? -48.022 -0.907  25.036  1.00 40.24  ?  2   PHE G N   1 
ATOM   7258  C  CA  . PHE G  1 2   ? -46.919 -0.918  25.963  1.00 39.42  ?  2   PHE G CA  1 
ATOM   7259  C  C   . PHE G  1 2   ? -45.748 -0.068  25.489  1.00 38.52  ?  2   PHE G C   1 
ATOM   7260  O  O   . PHE G  1 2   ? -45.416 -0.110  24.318  1.00 38.45  ?  2   PHE G O   1 
ATOM   7261  C  CB  . PHE G  1 2   ? -46.450 -2.351  26.104  1.00 39.56  ?  2   PHE G CB  1 
ATOM   7262  C  CG  . PHE G  1 2   ? -45.184 -2.488  26.861  1.00 40.47  ?  2   PHE G CG  1 
ATOM   7263  C  CD1 . PHE G  1 2   ? -45.196 -2.499  28.254  1.00 40.42  ?  2   PHE G CD1 1 
ATOM   7264  C  CD2 . PHE G  1 2   ? -43.965 -2.595  26.190  1.00 41.78  ?  2   PHE G CD2 1 
ATOM   7265  C  CE1 . PHE G  1 2   ? -44.015 -2.632  28.968  1.00 40.52  ?  2   PHE G CE1 1 
ATOM   7266  C  CE2 . PHE G  1 2   ? -42.779 -2.733  26.898  1.00 41.22  ?  2   PHE G CE2 1 
ATOM   7267  C  CZ  . PHE G  1 2   ? -42.805 -2.760  28.280  1.00 41.67  ?  2   PHE G CZ  1 
ATOM   7268  N  N   . LYS G  1 3   ? -45.127 0.684   26.401  1.00 37.50  ?  3   LYS G N   1 
ATOM   7269  C  CA  . LYS G  1 3   ? -43.842 1.374   26.175  1.00 35.87  ?  3   LYS G CA  1 
ATOM   7270  C  C   . LYS G  1 3   ? -43.132 1.364   27.526  1.00 34.70  ?  3   LYS G C   1 
ATOM   7271  O  O   . LYS G  1 3   ? -43.761 1.639   28.539  1.00 34.51  ?  3   LYS G O   1 
ATOM   7272  C  CB  . LYS G  1 3   ? -44.037 2.828   25.747  1.00 35.96  ?  3   LYS G CB  1 
ATOM   7273  C  CG  . LYS G  1 3   ? -45.023 3.067   24.625  1.00 38.60  ?  3   LYS G CG  1 
ATOM   7274  C  CD  . LYS G  1 3   ? -45.247 4.549   24.330  1.00 41.24  ?  3   LYS G CD  1 
ATOM   7275  C  CE  . LYS G  1 3   ? -46.636 4.763   23.696  1.00 44.57  ?  3   LYS G CE  1 
ATOM   7276  N  NZ  . LYS G  1 3   ? -46.812 6.079   22.965  1.00 44.14  ?  3   LYS G NZ  1 
ATOM   7277  N  N   . PRO G  1 4   ? -41.824 1.051   27.560  1.00 33.72  ?  4   PRO G N   1 
ATOM   7278  C  CA  . PRO G  1 4   ? -41.148 1.052   28.848  1.00 33.02  ?  4   PRO G CA  1 
ATOM   7279  C  C   . PRO G  1 4   ? -40.815 2.479   29.246  1.00 32.78  ?  4   PRO G C   1 
ATOM   7280  O  O   . PRO G  1 4   ? -41.134 3.403   28.523  1.00 33.71  ?  4   PRO G O   1 
ATOM   7281  C  CB  . PRO G  1 4   ? -39.856 0.315   28.546  1.00 32.86  ?  4   PRO G CB  1 
ATOM   7282  C  CG  . PRO G  1 4   ? -39.555 0.706   27.161  1.00 33.35  ?  4   PRO G CG  1 
ATOM   7283  C  CD  . PRO G  1 4   ? -40.876 0.817   26.453  1.00 33.25  ?  4   PRO G CD  1 
ATOM   7284  N  N   . HIS G  1 5   ? -40.186 2.653   30.385  1.00 32.11  ?  5   HIS G N   1 
ATOM   7285  C  CA  . HIS G  1 5   ? -39.643 3.938   30.764  1.00 32.05  ?  5   HIS G CA  1 
ATOM   7286  C  C   . HIS G  1 5   ? -38.255 3.952   30.189  1.00 31.31  ?  5   HIS G C   1 
ATOM   7287  O  O   . HIS G  1 5   ? -37.549 2.943   30.232  1.00 31.67  ?  5   HIS G O   1 
ATOM   7288  C  CB  . HIS G  1 5   ? -39.488 4.063   32.291  1.00 32.48  ?  5   HIS G CB  1 
ATOM   7289  C  CG  . HIS G  1 5   ? -40.725 4.485   33.011  1.00 33.30  ?  5   HIS G CG  1 
ATOM   7290  N  ND1 . HIS G  1 5   ? -40.751 5.575   33.853  1.00 34.70  ?  5   HIS G ND1 1 
ATOM   7291  C  CD2 . HIS G  1 5   ? -41.970 3.951   33.042  1.00 35.79  ?  5   HIS G CD2 1 
ATOM   7292  C  CE1 . HIS G  1 5   ? -41.961 5.697   34.369  1.00 36.21  ?  5   HIS G CE1 1 
ATOM   7293  N  NE2 . HIS G  1 5   ? -42.723 4.725   33.892  1.00 36.51  ?  5   HIS G NE2 1 
ATOM   7294  N  N   . VAL G  1 6   ? -37.833 5.103   29.683  1.00 30.34  ?  6   VAL G N   1 
ATOM   7295  C  CA  . VAL G  1 6   ? -36.483 5.204   29.139  1.00 28.31  ?  6   VAL G CA  1 
ATOM   7296  C  C   . VAL G  1 6   ? -35.743 6.206   29.940  1.00 26.89  ?  6   VAL G C   1 
ATOM   7297  O  O   . VAL G  1 6   ? -36.229 7.303   30.135  1.00 26.55  ?  6   VAL G O   1 
ATOM   7298  C  CB  . VAL G  1 6   ? -36.486 5.589   27.645  1.00 28.03  ?  6   VAL G CB  1 
ATOM   7299  C  CG1 . VAL G  1 6   ? -35.074 5.622   27.127  1.00 27.34  ?  6   VAL G CG1 1 
ATOM   7300  C  CG2 . VAL G  1 6   ? -37.327 4.583   26.866  1.00 27.58  ?  6   VAL G CG2 1 
ATOM   7301  N  N   . THR G  1 7   ? -34.575 5.814   30.416  1.00 25.69  ?  7   THR G N   1 
ATOM   7302  C  CA  . THR G  1 7   ? -33.786 6.679   31.250  1.00 25.64  ?  7   THR G CA  1 
ATOM   7303  C  C   . THR G  1 7   ? -32.348 6.567   30.819  1.00 25.68  ?  7   THR G C   1 
ATOM   7304  O  O   . THR G  1 7   ? -31.976 5.649   30.093  1.00 25.87  ?  7   THR G O   1 
ATOM   7305  C  CB  . THR G  1 7   ? -33.863 6.294   32.755  1.00 25.82  ?  7   THR G CB  1 
ATOM   7306  O  OG1 . THR G  1 7   ? -33.379 4.958   32.932  1.00 25.56  ?  7   THR G OG1 1 
ATOM   7307  C  CG2 . THR G  1 7   ? -35.270 6.399   33.279  1.00 24.58  ?  7   THR G CG2 1 
ATOM   7308  N  N   . VAL G  1 8   ? -31.536 7.499   31.286  1.00 25.07  ?  8   VAL G N   1 
ATOM   7309  C  CA  . VAL G  1 8   ? -30.160 7.550   30.883  1.00 24.96  ?  8   VAL G CA  1 
ATOM   7310  C  C   . VAL G  1 8   ? -29.373 7.840   32.132  1.00 24.92  ?  8   VAL G C   1 
ATOM   7311  O  O   . VAL G  1 8   ? -29.940 8.293   33.108  1.00 24.91  ?  8   VAL G O   1 
ATOM   7312  C  CB  . VAL G  1 8   ? -29.940 8.681   29.836  1.00 25.87  ?  8   VAL G CB  1 
ATOM   7313  C  CG1 . VAL G  1 8   ? -30.778 8.412   28.539  1.00 23.85  ?  8   VAL G CG1 1 
ATOM   7314  C  CG2 . VAL G  1 8   ? -30.269 10.029  30.427  1.00 25.55  ?  8   VAL G CG2 1 
ATOM   7315  N  N   . ALA G  1 9   ? -28.080 7.579   32.122  1.00 24.90  ?  9   ALA G N   1 
ATOM   7316  C  CA  . ALA G  1 9   ? -27.339 7.644   33.349  1.00 25.84  ?  9   ALA G CA  1 
ATOM   7317  C  C   . ALA G  1 9   ? -25.856 7.749   33.039  1.00 26.69  ?  9   ALA G C   1 
ATOM   7318  O  O   . ALA G  1 9   ? -25.404 7.207   32.030  1.00 27.47  ?  9   ALA G O   1 
ATOM   7319  C  CB  . ALA G  1 9   ? -27.627 6.420   34.174  1.00 25.84  ?  9   ALA G CB  1 
ATOM   7320  N  N   . CYS G  1 10  ? -25.102 8.429   33.897  1.00 27.24  ?  10  CYS G N   1 
ATOM   7321  C  CA  . CYS G  1 10  ? -23.741 8.752   33.550  1.00 29.45  ?  10  CYS G CA  1 
ATOM   7322  C  C   . CYS G  1 10  ? -22.760 8.366   34.602  1.00 29.59  ?  10  CYS G C   1 
ATOM   7323  O  O   . CYS G  1 10  ? -22.996 8.643   35.762  1.00 30.35  ?  10  CYS G O   1 
ATOM   7324  C  CB  . CYS G  1 10  ? -23.591 10.242  33.289  1.00 30.20  ?  10  CYS G CB  1 
ATOM   7325  S  SG  . CYS G  1 10  ? -23.930 10.698  31.601  1.00 34.25  ?  10  CYS G SG  1 
ATOM   7326  N  N   . VAL G  1 11  ? -21.656 7.757   34.171  1.00 29.76  ?  11  VAL G N   1 
ATOM   7327  C  CA  . VAL G  1 11  ? -20.603 7.327   35.042  1.00 30.67  ?  11  VAL G CA  1 
ATOM   7328  C  C   . VAL G  1 11  ? -19.501 8.351   34.870  1.00 32.03  ?  11  VAL G C   1 
ATOM   7329  O  O   . VAL G  1 11  ? -18.533 8.166   34.115  1.00 33.20  ?  11  VAL G O   1 
ATOM   7330  C  CB  . VAL G  1 11  ? -20.136 5.861   34.722  1.00 30.92  ?  11  VAL G CB  1 
ATOM   7331  C  CG1 . VAL G  1 11  ? -18.796 5.515   35.388  1.00 29.46  ?  11  VAL G CG1 1 
ATOM   7332  C  CG2 . VAL G  1 11  ? -21.233 4.826   35.103  1.00 31.19  ?  11  VAL G CG2 1 
ATOM   7333  N  N   . VAL G  1 12  ? -19.635 9.463   35.571  1.00 32.35  ?  12  VAL G N   1 
ATOM   7334  C  CA  . VAL G  1 12  ? -18.647 10.496  35.438  1.00 32.38  ?  12  VAL G CA  1 
ATOM   7335  C  C   . VAL G  1 12  ? -17.481 10.031  36.289  1.00 32.88  ?  12  VAL G C   1 
ATOM   7336  O  O   . VAL G  1 12  ? -17.702 9.590   37.399  1.00 33.37  ?  12  VAL G O   1 
ATOM   7337  C  CB  . VAL G  1 12  ? -19.227 11.798  35.958  1.00 32.37  ?  12  VAL G CB  1 
ATOM   7338  C  CG1 . VAL G  1 12  ? -18.253 12.961  35.741  1.00 32.06  ?  12  VAL G CG1 1 
ATOM   7339  C  CG2 . VAL G  1 12  ? -20.562 12.052  35.292  1.00 32.57  ?  12  VAL G CG2 1 
ATOM   7340  N  N   . HIS G  1 13  ? -16.257 10.137  35.791  1.00 33.46  ?  13  HIS G N   1 
ATOM   7341  C  CA  . HIS G  1 13  ? -15.092 9.607   36.501  1.00 34.70  ?  13  HIS G CA  1 
ATOM   7342  C  C   . HIS G  1 13  ? -13.866 10.580  36.584  1.00 36.98  ?  13  HIS G C   1 
ATOM   7343  O  O   . HIS G  1 13  ? -13.312 11.034  35.560  1.00 37.07  ?  13  HIS G O   1 
ATOM   7344  C  CB  . HIS G  1 13  ? -14.710 8.256   35.867  1.00 33.84  ?  13  HIS G CB  1 
ATOM   7345  C  CG  . HIS G  1 13  ? -13.313 7.791   36.162  1.00 31.60  ?  13  HIS G CG  1 
ATOM   7346  N  ND1 . HIS G  1 13  ? -12.970 7.146   37.329  1.00 29.83  ?  13  HIS G ND1 1 
ATOM   7347  C  CD2 . HIS G  1 13  ? -12.178 7.857   35.428  1.00 29.09  ?  13  HIS G CD2 1 
ATOM   7348  C  CE1 . HIS G  1 13  ? -11.685 6.846   37.307  1.00 29.46  ?  13  HIS G CE1 1 
ATOM   7349  N  NE2 . HIS G  1 13  ? -11.183 7.265   36.162  1.00 28.98  ?  13  HIS G NE2 1 
ATOM   7350  N  N   . ALA G  1 14  ? -13.412 10.879  37.803  1.00 38.95  ?  14  ALA G N   1 
ATOM   7351  C  CA  . ALA G  1 14  ? -12.189 11.683  37.948  1.00 40.64  ?  14  ALA G CA  1 
ATOM   7352  C  C   . ALA G  1 14  ? -11.393 11.348  39.174  1.00 41.49  ?  14  ALA G C   1 
ATOM   7353  O  O   . ALA G  1 14  ? -11.957 11.114  40.261  1.00 41.70  ?  14  ALA G O   1 
ATOM   7354  C  CB  . ALA G  1 14  ? -12.511 13.172  37.956  1.00 41.05  ?  14  ALA G CB  1 
ATOM   7355  N  N   . GLU G  1 15  ? -10.073 11.351  38.986  1.00 42.33  ?  15  GLU G N   1 
ATOM   7356  C  CA  . GLU G  1 15  ? -9.133  11.296  40.092  1.00 42.84  ?  15  GLU G CA  1 
ATOM   7357  C  C   . GLU G  1 15  ? -9.490  10.150  40.993  1.00 42.55  ?  15  GLU G C   1 
ATOM   7358  O  O   . GLU G  1 15  ? -9.589  10.328  42.198  1.00 43.08  ?  15  GLU G O   1 
ATOM   7359  C  CB  . GLU G  1 15  ? -9.153  12.626  40.870  1.00 43.00  ?  15  GLU G CB  1 
ATOM   7360  C  CG  . GLU G  1 15  ? -8.039  13.637  40.467  1.00 45.38  ?  15  GLU G CG  1 
ATOM   7361  C  CD  . GLU G  1 15  ? -8.396  15.070  40.868  1.00 49.01  ?  15  GLU G CD  1 
ATOM   7362  O  OE1 . GLU G  1 15  ? -7.529  15.802  41.398  1.00 46.27  ?  15  GLU G OE1 1 
ATOM   7363  O  OE2 . GLU G  1 15  ? -9.573  15.461  40.661  1.00 52.33  -1 15  GLU G OE2 1 
ATOM   7364  N  N   . GLY G  1 16  ? -9.729  8.984   40.393  1.00 42.56  ?  16  GLY G N   1 
ATOM   7365  C  CA  . GLY G  1 16  ? -10.059 7.766   41.131  1.00 42.21  ?  16  GLY G CA  1 
ATOM   7366  C  C   . GLY G  1 16  ? -11.458 7.709   41.694  1.00 41.80  ?  16  GLY G C   1 
ATOM   7367  O  O   . GLY G  1 16  ? -11.852 6.725   42.265  1.00 41.85  ?  16  GLY G O   1 
ATOM   7368  N  N   . LYS G  1 17  ? -12.224 8.766   41.532  1.00 42.37  ?  17  LYS G N   1 
ATOM   7369  C  CA  . LYS G  1 17  ? -13.526 8.843   42.173  1.00 42.97  ?  17  LYS G CA  1 
ATOM   7370  C  C   . LYS G  1 17  ? -14.687 8.814   41.149  1.00 42.79  ?  17  LYS G C   1 
ATOM   7371  O  O   . LYS G  1 17  ? -14.469 9.065   39.964  1.00 42.90  ?  17  LYS G O   1 
ATOM   7372  C  CB  . LYS G  1 17  ? -13.591 10.092  43.078  1.00 43.36  ?  17  LYS G CB  1 
ATOM   7373  C  CG  . LYS G  1 17  ? -12.992 9.914   44.474  1.00 44.08  ?  17  LYS G CG  1 
ATOM   7374  C  CD  . LYS G  1 17  ? -13.858 10.672  45.466  1.00 45.56  ?  17  LYS G CD  1 
ATOM   7375  C  CE  . LYS G  1 17  ? -13.632 10.260  46.925  1.00 47.12  ?  17  LYS G CE  1 
ATOM   7376  N  NZ  . LYS G  1 17  ? -12.371 10.822  47.527  1.00 49.08  ?  17  LYS G NZ  1 
ATOM   7377  N  N   . PHE G  1 18  ? -15.899 8.503   41.606  1.00 42.24  ?  18  PHE G N   1 
ATOM   7378  C  CA  . PHE G  1 18  ? -17.058 8.422   40.723  1.00 42.57  ?  18  PHE G CA  1 
ATOM   7379  C  C   . PHE G  1 18  ? -18.159 9.281   41.254  1.00 43.26  ?  18  PHE G C   1 
ATOM   7380  O  O   . PHE G  1 18  ? -18.536 9.181   42.436  1.00 43.39  ?  18  PHE G O   1 
ATOM   7381  C  CB  . PHE G  1 18  ? -17.577 6.989   40.589  1.00 42.43  ?  18  PHE G CB  1 
ATOM   7382  C  CG  . PHE G  1 18  ? -16.615 6.086   39.934  1.00 41.79  ?  18  PHE G CG  1 
ATOM   7383  C  CD1 . PHE G  1 18  ? -16.614 5.946   38.551  1.00 42.61  ?  18  PHE G CD1 1 
ATOM   7384  C  CD2 . PHE G  1 18  ? -15.662 5.415   40.684  1.00 39.49  ?  18  PHE G CD2 1 
ATOM   7385  C  CE1 . PHE G  1 18  ? -15.668 5.112   37.917  1.00 42.91  ?  18  PHE G CE1 1 
ATOM   7386  C  CE2 . PHE G  1 18  ? -14.728 4.597   40.078  1.00 40.74  ?  18  PHE G CE2 1 
ATOM   7387  C  CZ  . PHE G  1 18  ? -14.727 4.432   38.689  1.00 40.72  ?  18  PHE G CZ  1 
ATOM   7388  N  N   . LEU G  1 19  ? -18.688 10.122  40.379  1.00 43.67  ?  19  LEU G N   1 
ATOM   7389  C  CA  . LEU G  1 19  ? -19.622 11.109  40.834  1.00 44.49  ?  19  LEU G CA  1 
ATOM   7390  C  C   . LEU G  1 19  ? -20.992 10.489  41.067  1.00 44.71  ?  19  LEU G C   1 
ATOM   7391  O  O   . LEU G  1 19  ? -21.584 9.885   40.183  1.00 44.77  ?  19  LEU G O   1 
ATOM   7392  C  CB  . LEU G  1 19  ? -19.679 12.294  39.879  1.00 44.79  ?  19  LEU G CB  1 
ATOM   7393  C  CG  . LEU G  1 19  ? -20.762 13.274  40.317  1.00 45.28  ?  19  LEU G CG  1 
ATOM   7394  C  CD1 . LEU G  1 19  ? -20.186 14.400  41.163  1.00 45.87  ?  19  LEU G CD1 1 
ATOM   7395  C  CD2 . LEU G  1 19  ? -21.463 13.803  39.112  1.00 46.30  ?  19  LEU G CD2 1 
ATOM   7396  N  N   . VAL G  1 20  ? -21.475 10.614  42.287  1.00 45.54  ?  20  VAL G N   1 
ATOM   7397  C  CA  . VAL G  1 20  ? -22.742 10.008  42.623  1.00 46.89  ?  20  VAL G CA  1 
ATOM   7398  C  C   . VAL G  1 20  ? -23.593 11.049  43.327  1.00 47.63  ?  20  VAL G C   1 
ATOM   7399  O  O   . VAL G  1 20  ? -23.094 11.764  44.199  1.00 48.09  ?  20  VAL G O   1 
ATOM   7400  C  CB  . VAL G  1 20  ? -22.556 8.687   43.471  1.00 46.77  ?  20  VAL G CB  1 
ATOM   7401  C  CG1 . VAL G  1 20  ? -21.221 8.667   44.183  1.00 46.01  ?  20  VAL G CG1 1 
ATOM   7402  C  CG2 . VAL G  1 20  ? -23.721 8.470   44.458  1.00 46.44  ?  20  VAL G CG2 1 
ATOM   7403  N  N   . VAL G  1 21  ? -24.856 11.148  42.926  1.00 48.25  ?  21  VAL G N   1 
ATOM   7404  C  CA  . VAL G  1 21  ? -25.772 12.082  43.548  1.00 49.69  ?  21  VAL G CA  1 
ATOM   7405  C  C   . VAL G  1 21  ? -26.515 11.448  44.738  1.00 51.42  ?  21  VAL G C   1 
ATOM   7406  O  O   . VAL G  1 21  ? -26.883 10.264  44.703  1.00 52.04  ?  21  VAL G O   1 
ATOM   7407  C  CB  . VAL G  1 21  ? -26.786 12.673  42.528  1.00 49.10  ?  21  VAL G CB  1 
ATOM   7408  C  CG1 . VAL G  1 21  ? -26.096 13.033  41.244  1.00 49.17  ?  21  VAL G CG1 1 
ATOM   7409  C  CG2 . VAL G  1 21  ? -27.931 11.733  42.274  1.00 48.53  ?  21  VAL G CG2 1 
ATOM   7410  N  N   . GLU G  1 22  ? -26.726 12.238  45.791  1.00 52.88  ?  22  GLU G N   1 
ATOM   7411  C  CA  . GLU G  1 22  ? -27.518 11.810  46.929  1.00 54.21  ?  22  GLU G CA  1 
ATOM   7412  C  C   . GLU G  1 22  ? -28.868 12.464  46.783  1.00 54.83  ?  22  GLU G C   1 
ATOM   7413  O  O   . GLU G  1 22  ? -28.944 13.583  46.275  1.00 54.31  ?  22  GLU G O   1 
ATOM   7414  C  CB  . GLU G  1 22  ? -26.859 12.247  48.229  1.00 54.53  ?  22  GLU G CB  1 
ATOM   7415  C  CG  . GLU G  1 22  ? -27.447 11.597  49.483  1.00 57.28  ?  22  GLU G CG  1 
ATOM   7416  C  CD  . GLU G  1 22  ? -27.085 12.341  50.765  1.00 59.88  ?  22  GLU G CD  1 
ATOM   7417  O  OE1 . GLU G  1 22  ? -27.820 12.196  51.773  1.00 60.67  ?  22  GLU G OE1 1 
ATOM   7418  O  OE2 . GLU G  1 22  ? -26.075 13.081  50.765  1.00 61.88  -1 22  GLU G OE2 1 
ATOM   7419  N  N   . GLU G  1 23  ? -29.909 11.771  47.256  1.00 56.10  ?  23  GLU G N   1 
ATOM   7420  C  CA  . GLU G  1 23  ? -31.308 12.104  46.980  1.00 57.92  ?  23  GLU G CA  1 
ATOM   7421  C  C   . GLU G  1 23  ? -32.242 11.329  47.935  1.00 58.77  ?  23  GLU G C   1 
ATOM   7422  O  O   . GLU G  1 23  ? -32.136 10.121  48.056  1.00 59.37  ?  23  GLU G O   1 
ATOM   7423  C  CB  . GLU G  1 23  ? -31.591 11.783  45.509  1.00 58.19  ?  23  GLU G CB  1 
ATOM   7424  C  CG  . GLU G  1 23  ? -33.038 11.508  45.086  1.00 60.68  ?  23  GLU G CG  1 
ATOM   7425  C  CD  . GLU G  1 23  ? -33.148 11.007  43.614  1.00 64.34  ?  23  GLU G CD  1 
ATOM   7426  O  OE1 . GLU G  1 23  ? -32.209 10.318  43.107  1.00 63.62  ?  23  GLU G OE1 1 
ATOM   7427  O  OE2 . GLU G  1 23  ? -34.192 11.303  42.971  1.00 65.38  -1 23  GLU G OE2 1 
ATOM   7428  N  N   . THR G  1 24  ? -33.133 12.027  48.633  1.00 59.67  ?  24  THR G N   1 
ATOM   7429  C  CA  . THR G  1 24  ? -33.972 11.405  49.654  1.00 60.35  ?  24  THR G CA  1 
ATOM   7430  C  C   . THR G  1 24  ? -35.278 10.912  49.036  1.00 61.40  ?  24  THR G C   1 
ATOM   7431  O  O   . THR G  1 24  ? -36.156 11.713  48.703  1.00 61.11  ?  24  THR G O   1 
ATOM   7432  C  CB  . THR G  1 24  ? -34.272 12.409  50.813  1.00 60.37  ?  24  THR G CB  1 
ATOM   7433  O  OG1 . THR G  1 24  ? -33.044 12.959  51.299  1.00 59.93  ?  24  THR G OG1 1 
ATOM   7434  C  CG2 . THR G  1 24  ? -35.039 11.757  51.986  1.00 59.83  ?  24  THR G CG2 1 
ATOM   7435  N  N   . ILE G  1 25  ? -35.417 9.597   48.872  1.00 62.87  ?  25  ILE G N   1 
ATOM   7436  C  CA  . ILE G  1 25  ? -36.692 9.055   48.362  1.00 63.91  ?  25  ILE G CA  1 
ATOM   7437  C  C   . ILE G  1 25  ? -37.772 9.083   49.465  1.00 64.44  ?  25  ILE G C   1 
ATOM   7438  O  O   . ILE G  1 25  ? -38.831 9.712   49.283  1.00 64.78  ?  25  ILE G O   1 
ATOM   7439  C  CB  . ILE G  1 25  ? -36.552 7.677   47.569  1.00 63.92  ?  25  ILE G CB  1 
ATOM   7440  C  CG1 . ILE G  1 25  ? -36.037 7.919   46.132  1.00 63.71  ?  25  ILE G CG1 1 
ATOM   7441  C  CG2 . ILE G  1 25  ? -37.887 6.901   47.515  1.00 63.50  ?  25  ILE G CG2 1 
ATOM   7442  C  CD1 . ILE G  1 25  ? -37.132 8.188   45.056  1.00 62.25  ?  25  ILE G CD1 1 
ATOM   7443  N  N   . ASN G  1 26  ? -37.516 8.436   50.602  1.00 64.80  ?  26  ASN G N   1 
ATOM   7444  C  CA  . ASN G  1 26  ? -38.407 8.627   51.763  1.00 65.08  ?  26  ASN G CA  1 
ATOM   7445  C  C   . ASN G  1 26  ? -37.746 8.393   53.111  1.00 65.11  ?  26  ASN G C   1 
ATOM   7446  O  O   . ASN G  1 26  ? -37.865 7.312   53.703  1.00 64.86  ?  26  ASN G O   1 
ATOM   7447  C  CB  . ASN G  1 26  ? -39.763 7.892   51.630  1.00 65.20  ?  26  ASN G CB  1 
ATOM   7448  C  CG  . ASN G  1 26  ? -39.620 6.386   51.455  1.00 65.42  ?  26  ASN G CG  1 
ATOM   7449  O  OD1 . ASN G  1 26  ? -40.010 5.614   52.333  1.00 64.92  ?  26  ASN G OD1 1 
ATOM   7450  N  ND2 . ASN G  1 26  ? -39.084 5.964   50.313  1.00 64.73  ?  26  ASN G ND2 1 
ATOM   7451  N  N   . GLY G  1 27  ? -37.044 9.433   53.573  1.00 65.10  ?  27  GLY G N   1 
ATOM   7452  C  CA  . GLY G  1 27  ? -36.366 9.436   54.871  1.00 64.79  ?  27  GLY G CA  1 
ATOM   7453  C  C   . GLY G  1 27  ? -34.958 8.912   54.732  1.00 64.59  ?  27  GLY G C   1 
ATOM   7454  O  O   . GLY G  1 27  ? -34.024 9.397   55.390  1.00 64.57  ?  27  GLY G O   1 
ATOM   7455  N  N   . LYS G  1 28  ? -34.814 7.901   53.876  1.00 64.25  ?  28  LYS G N   1 
ATOM   7456  C  CA  . LYS G  1 28  ? -33.498 7.409   53.492  1.00 63.37  ?  28  LYS G CA  1 
ATOM   7457  C  C   . LYS G  1 28  ? -32.956 8.223   52.316  1.00 62.12  ?  28  LYS G C   1 
ATOM   7458  O  O   . LYS G  1 28  ? -33.574 8.307   51.243  1.00 62.07  ?  28  LYS G O   1 
ATOM   7459  C  CB  . LYS G  1 28  ? -33.528 5.905   53.185  1.00 63.84  ?  28  LYS G CB  1 
ATOM   7460  C  CG  . LYS G  1 28  ? -32.706 5.003   54.156  1.00 64.84  ?  28  LYS G CG  1 
ATOM   7461  C  CD  . LYS G  1 28  ? -31.227 4.717   53.674  1.00 64.57  ?  28  LYS G CD  1 
ATOM   7462  C  CE  . LYS G  1 28  ? -30.926 3.182   53.550  1.00 63.76  ?  28  LYS G CE  1 
ATOM   7463  N  NZ  . LYS G  1 28  ? -29.504 2.761   53.844  1.00 62.43  ?  28  LYS G NZ  1 
ATOM   7464  N  N   . ALA G  1 29  ? -31.815 8.856   52.574  1.00 60.46  ?  29  ALA G N   1 
ATOM   7465  C  CA  . ALA G  1 29  ? -31.025 9.536   51.563  1.00 58.88  ?  29  ALA G CA  1 
ATOM   7466  C  C   . ALA G  1 29  ? -30.189 8.485   50.817  1.00 57.83  ?  29  ALA G C   1 
ATOM   7467  O  O   . ALA G  1 29  ? -29.346 7.792   51.411  1.00 57.71  ?  29  ALA G O   1 
ATOM   7468  C  CB  . ALA G  1 29  ? -30.141 10.598  52.209  1.00 58.45  ?  29  ALA G CB  1 
ATOM   7469  N  N   . LEU G  1 30  ? -30.452 8.373   49.515  1.00 56.21  ?  30  LEU G N   1 
ATOM   7470  C  CA  . LEU G  1 30  ? -29.931 7.294   48.670  1.00 54.23  ?  30  LEU G CA  1 
ATOM   7471  C  C   . LEU G  1 30  ? -29.008 7.786   47.582  1.00 52.71  ?  30  LEU G C   1 
ATOM   7472  O  O   . LEU G  1 30  ? -29.117 8.920   47.127  1.00 53.23  ?  30  LEU G O   1 
ATOM   7473  C  CB  . LEU G  1 30  ? -31.088 6.542   48.014  1.00 54.43  ?  30  LEU G CB  1 
ATOM   7474  C  CG  . LEU G  1 30  ? -31.808 5.401   48.734  1.00 53.88  ?  30  LEU G CG  1 
ATOM   7475  C  CD1 . LEU G  1 30  ? -31.390 5.330   50.173  1.00 54.59  ?  30  LEU G CD1 1 
ATOM   7476  C  CD2 . LEU G  1 30  ? -33.330 5.541   48.592  1.00 54.25  ?  30  LEU G CD2 1 
ATOM   7477  N  N   . TRP G  1 31  ? -28.111 6.906   47.159  1.00 50.79  ?  31  TRP G N   1 
ATOM   7478  C  CA  . TRP G  1 31  ? -27.150 7.195   46.108  1.00 48.35  ?  31  TRP G CA  1 
ATOM   7479  C  C   . TRP G  1 31  ? -27.623 6.709   44.734  1.00 46.61  ?  31  TRP G C   1 
ATOM   7480  O  O   . TRP G  1 31  ? -28.268 5.660   44.614  1.00 46.25  ?  31  TRP G O   1 
ATOM   7481  C  CB  . TRP G  1 31  ? -25.838 6.564   46.495  1.00 48.49  ?  31  TRP G CB  1 
ATOM   7482  C  CG  . TRP G  1 31  ? -25.185 7.360   47.537  1.00 50.26  ?  31  TRP G CG  1 
ATOM   7483  C  CD1 . TRP G  1 31  ? -25.732 8.413   48.222  1.00 51.99  ?  31  TRP G CD1 1 
ATOM   7484  C  CD2 . TRP G  1 31  ? -23.854 7.197   48.049  1.00 51.47  ?  31  TRP G CD2 1 
ATOM   7485  N  NE1 . TRP G  1 31  ? -24.825 8.917   49.121  1.00 52.14  ?  31  TRP G NE1 1 
ATOM   7486  C  CE2 . TRP G  1 31  ? -23.666 8.189   49.043  1.00 51.48  ?  31  TRP G CE2 1 
ATOM   7487  C  CE3 . TRP G  1 31  ? -22.805 6.309   47.770  1.00 50.92  ?  31  TRP G CE3 1 
ATOM   7488  C  CZ2 . TRP G  1 31  ? -22.473 8.325   49.748  1.00 50.92  ?  31  TRP G CZ2 1 
ATOM   7489  C  CZ3 . TRP G  1 31  ? -21.616 6.446   48.471  1.00 51.07  ?  31  TRP G CZ3 1 
ATOM   7490  C  CH2 . TRP G  1 31  ? -21.464 7.446   49.455  1.00 51.96  ?  31  TRP G CH2 1 
ATOM   7491  N  N   . ASN G  1 32  ? -27.359 7.518   43.713  1.00 44.14  ?  32  ASN G N   1 
ATOM   7492  C  CA  . ASN G  1 32  ? -27.585 7.138   42.319  1.00 41.60  ?  32  ASN G CA  1 
ATOM   7493  C  C   . ASN G  1 32  ? -26.557 7.840   41.485  1.00 39.69  ?  32  ASN G C   1 
ATOM   7494  O  O   . ASN G  1 32  ? -26.011 8.839   41.913  1.00 39.65  ?  32  ASN G O   1 
ATOM   7495  C  CB  . ASN G  1 32  ? -28.999 7.493   41.834  1.00 41.18  ?  32  ASN G CB  1 
ATOM   7496  C  CG  . ASN G  1 32  ? -29.372 6.794   40.507  1.00 41.36  ?  32  ASN G CG  1 
ATOM   7497  O  OD1 . ASN G  1 32  ? -28.709 5.838   40.062  1.00 39.11  ?  32  ASN G OD1 1 
ATOM   7498  N  ND2 . ASN G  1 32  ? -30.451 7.268   39.878  1.00 42.42  ?  32  ASN G ND2 1 
ATOM   7499  N  N   . GLN G  1 33  ? -26.255 7.279   40.318  1.00 37.82  ?  33  GLN G N   1 
ATOM   7500  C  CA  . GLN G  1 33  ? -25.529 7.993   39.285  1.00 36.07  ?  33  GLN G CA  1 
ATOM   7501  C  C   . GLN G  1 33  ? -26.336 9.200   38.895  1.00 35.12  ?  33  GLN G C   1 
ATOM   7502  O  O   . GLN G  1 33  ? -27.554 9.197   39.048  1.00 35.73  ?  33  GLN G O   1 
ATOM   7503  C  CB  . GLN G  1 33  ? -25.367 7.124   38.047  1.00 36.03  ?  33  GLN G CB  1 
ATOM   7504  C  CG  . GLN G  1 33  ? -24.063 6.353   38.004  1.00 35.90  ?  33  GLN G CG  1 
ATOM   7505  C  CD  . GLN G  1 33  ? -24.229 4.963   38.503  1.00 34.45  ?  33  GLN G CD  1 
ATOM   7506  O  OE1 . GLN G  1 33  ? -25.341 4.395   38.504  1.00 33.72  ?  33  GLN G OE1 1 
ATOM   7507  N  NE2 . GLN G  1 33  ? -23.130 4.387   38.927  1.00 33.02  ?  33  GLN G NE2 1 
ATOM   7508  N  N   . PRO G  1 34  ? -25.678 10.238  38.383  1.00 34.07  ?  34  PRO G N   1 
ATOM   7509  C  CA  . PRO G  1 34  ? -26.451 11.332  37.835  1.00 33.52  ?  34  PRO G CA  1 
ATOM   7510  C  C   . PRO G  1 34  ? -27.211 10.752  36.656  1.00 32.93  ?  34  PRO G C   1 
ATOM   7511  O  O   . PRO G  1 34  ? -26.608 10.170  35.765  1.00 33.25  ?  34  PRO G O   1 
ATOM   7512  C  CB  . PRO G  1 34  ? -25.380 12.309  37.351  1.00 33.00  ?  34  PRO G CB  1 
ATOM   7513  C  CG  . PRO G  1 34  ? -24.188 11.946  38.102  1.00 33.68  ?  34  PRO G CG  1 
ATOM   7514  C  CD  . PRO G  1 34  ? -24.238 10.457  38.221  1.00 34.00  ?  34  PRO G CD  1 
ATOM   7515  N  N   . ALA G  1 35  ? -28.525 10.861  36.662  1.00 32.31  ?  35  ALA G N   1 
ATOM   7516  C  CA  . ALA G  1 35  ? -29.306 10.030  35.779  1.00 32.09  ?  35  ALA G CA  1 
ATOM   7517  C  C   . ALA G  1 35  ? -30.720 10.482  35.885  1.00 32.24  ?  35  ALA G C   1 
ATOM   7518  O  O   . ALA G  1 35  ? -31.063 11.111  36.874  1.00 31.86  ?  35  ALA G O   1 
ATOM   7519  C  CB  . ALA G  1 35  ? -29.203 8.601   36.207  1.00 31.96  ?  35  ALA G CB  1 
ATOM   7520  N  N   . GLY G  1 36  ? -31.521 10.175  34.865  1.00 32.39  ?  36  GLY G N   1 
ATOM   7521  C  CA  . GLY G  1 36  ? -32.936 10.516  34.843  1.00 33.30  ?  36  GLY G CA  1 
ATOM   7522  C  C   . GLY G  1 36  ? -33.615 10.055  33.574  1.00 34.17  ?  36  GLY G C   1 
ATOM   7523  O  O   . GLY G  1 36  ? -32.957 9.477   32.695  1.00 34.69  ?  36  GLY G O   1 
ATOM   7524  N  N   . HIS G  1 37  ? -34.922 10.313  33.478  1.00 34.73  ?  37  HIS G N   1 
ATOM   7525  C  CA  . HIS G  1 37  ? -35.712 9.930   32.310  1.00 36.31  ?  37  HIS G CA  1 
ATOM   7526  C  C   . HIS G  1 37  ? -35.335 10.746  31.047  1.00 36.90  ?  37  HIS G C   1 
ATOM   7527  O  O   . HIS G  1 37  ? -34.579 11.723  31.118  1.00 37.51  ?  37  HIS G O   1 
ATOM   7528  C  CB  . HIS G  1 37  ? -37.214 10.042  32.602  1.00 36.63  ?  37  HIS G CB  1 
ATOM   7529  C  CG  . HIS G  1 37  ? -37.768 8.928   33.443  1.00 39.68  ?  37  HIS G CG  1 
ATOM   7530  N  ND1 . HIS G  1 37  ? -37.290 8.628   34.706  1.00 41.87  ?  37  HIS G ND1 1 
ATOM   7531  C  CD2 . HIS G  1 37  ? -38.792 8.064   33.218  1.00 41.36  ?  37  HIS G CD2 1 
ATOM   7532  C  CE1 . HIS G  1 37  ? -37.975 7.612   35.208  1.00 42.06  ?  37  HIS G CE1 1 
ATOM   7533  N  NE2 . HIS G  1 37  ? -38.894 7.252   34.326  1.00 42.28  ?  37  HIS G NE2 1 
ATOM   7534  N  N   . LEU G  1 38  ? -35.845 10.315  29.899  1.00 36.89  ?  38  LEU G N   1 
ATOM   7535  C  CA  . LEU G  1 38  ? -35.701 11.001  28.635  1.00 36.44  ?  38  LEU G CA  1 
ATOM   7536  C  C   . LEU G  1 38  ? -36.938 11.869  28.450  1.00 37.58  ?  38  LEU G C   1 
ATOM   7537  O  O   . LEU G  1 38  ? -38.036 11.549  28.975  1.00 37.44  ?  38  LEU G O   1 
ATOM   7538  C  CB  . LEU G  1 38  ? -35.668 9.943   27.520  1.00 36.26  ?  38  LEU G CB  1 
ATOM   7539  C  CG  . LEU G  1 38  ? -35.660 10.262  26.014  1.00 33.62  ?  38  LEU G CG  1 
ATOM   7540  C  CD1 . LEU G  1 38  ? -34.398 10.990  25.551  1.00 29.33  ?  38  LEU G CD1 1 
ATOM   7541  C  CD2 . LEU G  1 38  ? -35.868 8.995   25.213  1.00 31.09  ?  38  LEU G CD2 1 
ATOM   7542  N  N   . GLU G  1 39  ? -36.792 12.954  27.684  1.00 37.92  ?  39  GLU G N   1 
ATOM   7543  C  CA  . GLU G  1 39  ? -37.964 13.731  27.309  1.00 38.07  ?  39  GLU G CA  1 
ATOM   7544  C  C   . GLU G  1 39  ? -38.290 13.738  25.824  1.00 37.40  ?  39  GLU G C   1 
ATOM   7545  O  O   . GLU G  1 39  ? -37.481 13.331  25.007  1.00 37.40  ?  39  GLU G O   1 
ATOM   7546  C  CB  . GLU G  1 39  ? -37.902 15.137  27.878  1.00 38.78  ?  39  GLU G CB  1 
ATOM   7547  C  CG  . GLU G  1 39  ? -39.067 15.369  28.835  1.00 41.64  ?  39  GLU G CG  1 
ATOM   7548  C  CD  . GLU G  1 39  ? -38.677 15.092  30.247  1.00 44.97  ?  39  GLU G CD  1 
ATOM   7549  O  OE1 . GLU G  1 39  ? -37.566 15.555  30.621  1.00 46.54  ?  39  GLU G OE1 1 
ATOM   7550  O  OE2 . GLU G  1 39  ? -39.468 14.416  30.963  1.00 46.69  -1 39  GLU G OE2 1 
ATOM   7551  N  N   . ALA G  1 40  ? -39.495 14.190  25.484  1.00 36.85  ?  40  ALA G N   1 
ATOM   7552  C  CA  . ALA G  1 40  ? -39.918 14.276  24.083  1.00 36.27  ?  40  ALA G CA  1 
ATOM   7553  C  C   . ALA G  1 40  ? -38.949 15.110  23.270  1.00 35.81  ?  40  ALA G C   1 
ATOM   7554  O  O   . ALA G  1 40  ? -38.352 16.039  23.803  1.00 36.26  ?  40  ALA G O   1 
ATOM   7555  C  CB  . ALA G  1 40  ? -41.348 14.832  23.971  1.00 35.95  ?  40  ALA G CB  1 
ATOM   7556  N  N   . ASP G  1 41  ? -38.774 14.753  21.995  1.00 35.47  ?  41  ASP G N   1 
ATOM   7557  C  CA  . ASP G  1 41  ? -37.972 15.535  21.045  1.00 34.71  ?  41  ASP G CA  1 
ATOM   7558  C  C   . ASP G  1 41  ? -36.537 15.737  21.530  1.00 34.22  ?  41  ASP G C   1 
ATOM   7559  O  O   . ASP G  1 41  ? -36.017 16.845  21.472  1.00 34.25  ?  41  ASP G O   1 
ATOM   7560  C  CB  . ASP G  1 41  ? -38.644 16.878  20.770  1.00 34.58  ?  41  ASP G CB  1 
ATOM   7561  C  CG  . ASP G  1 41  ? -40.054 16.724  20.190  1.00 36.21  ?  41  ASP G CG  1 
ATOM   7562  O  OD1 . ASP G  1 41  ? -40.877 17.638  20.413  1.00 37.88  ?  41  ASP G OD1 1 
ATOM   7563  O  OD2 . ASP G  1 41  ? -40.349 15.702  19.519  1.00 35.19  -1 41  ASP G OD2 1 
ATOM   7564  N  N   . GLU G  1 42  ? -35.893 14.659  21.979  1.00 33.46  ?  42  GLU G N   1 
ATOM   7565  C  CA  . GLU G  1 42  ? -34.610 14.775  22.656  1.00 33.51  ?  42  GLU G CA  1 
ATOM   7566  C  C   . GLU G  1 42  ? -33.695 13.565  22.371  1.00 32.77  ?  42  GLU G C   1 
ATOM   7567  O  O   . GLU G  1 42  ? -34.159 12.432  22.440  1.00 32.72  ?  42  GLU G O   1 
ATOM   7568  C  CB  . GLU G  1 42  ? -34.911 14.901  24.162  1.00 34.14  ?  42  GLU G CB  1 
ATOM   7569  C  CG  . GLU G  1 42  ? -33.726 15.327  25.041  1.00 35.89  ?  42  GLU G CG  1 
ATOM   7570  C  CD  . GLU G  1 42  ? -34.108 15.546  26.485  1.00 36.23  ?  42  GLU G CD  1 
ATOM   7571  O  OE1 . GLU G  1 42  ? -33.799 16.639  26.994  1.00 35.23  ?  42  GLU G OE1 1 
ATOM   7572  O  OE2 . GLU G  1 42  ? -34.715 14.637  27.104  1.00 38.49  -1 42  GLU G OE2 1 
ATOM   7573  N  N   . THR G  1 43  ? -32.419 13.787  22.042  1.00 32.43  ?  43  THR G N   1 
ATOM   7574  C  CA  . THR G  1 43  ? -31.481 12.668  21.767  1.00 32.23  ?  43  THR G CA  1 
ATOM   7575  C  C   . THR G  1 43  ? -31.157 12.039  23.090  1.00 32.33  ?  43  THR G C   1 
ATOM   7576  O  O   . THR G  1 43  ? -31.023 12.754  24.089  1.00 32.97  ?  43  THR G O   1 
ATOM   7577  C  CB  . THR G  1 43  ? -30.148 13.126  21.102  1.00 31.84  ?  43  THR G CB  1 
ATOM   7578  O  OG1 . THR G  1 43  ? -30.300 13.162  19.686  1.00 33.30  ?  43  THR G OG1 1 
ATOM   7579  C  CG2 . THR G  1 43  ? -29.015 12.151  21.340  1.00 34.57  ?  43  THR G CG2 1 
ATOM   7580  N  N   . LEU G  1 44  ? -31.043 10.714  23.112  1.00 31.86  ?  44  LEU G N   1 
ATOM   7581  C  CA  . LEU G  1 44  ? -30.468 10.005  24.235  1.00 30.86  ?  44  LEU G CA  1 
ATOM   7582  C  C   . LEU G  1 44  ? -29.233 10.693  24.809  1.00 31.32  ?  44  LEU G C   1 
ATOM   7583  O  O   . LEU G  1 44  ? -29.184 10.926  26.023  1.00 31.88  ?  44  LEU G O   1 
ATOM   7584  C  CB  . LEU G  1 44  ? -30.171 8.537   23.875  1.00 30.54  ?  44  LEU G CB  1 
ATOM   7585  C  CG  . LEU G  1 44  ? -31.353 7.529   23.755  1.00 30.26  ?  44  LEU G CG  1 
ATOM   7586  C  CD1 . LEU G  1 44  ? -30.878 6.082   23.583  1.00 28.41  ?  44  LEU G CD1 1 
ATOM   7587  C  CD2 . LEU G  1 44  ? -32.373 7.580   24.916  1.00 25.26  ?  44  LEU G CD2 1 
ATOM   7588  N  N   . VAL G  1 45  ? -28.228 11.035  24.004  1.00 31.37  ?  45  VAL G N   1 
ATOM   7589  C  CA  . VAL G  1 45  ? -27.038 11.683  24.634  1.00 31.92  ?  45  VAL G CA  1 
ATOM   7590  C  C   . VAL G  1 45  ? -27.331 13.117  25.094  1.00 32.14  ?  45  VAL G C   1 
ATOM   7591  O  O   . VAL G  1 45  ? -26.648 13.640  25.954  1.00 31.88  ?  45  VAL G O   1 
ATOM   7592  C  CB  . VAL G  1 45  ? -25.661 11.631  23.821  1.00 31.69  ?  45  VAL G CB  1 
ATOM   7593  C  CG1 . VAL G  1 45  ? -25.553 10.424  22.890  1.00 31.07  ?  45  VAL G CG1 1 
ATOM   7594  C  CG2 . VAL G  1 45  ? -25.418 12.917  23.058  1.00 31.43  ?  45  VAL G CG2 1 
ATOM   7595  N  N   . GLU G  1 46  ? -28.345 13.744  24.514  1.00 32.77  ?  46  GLU G N   1 
ATOM   7596  C  CA  . GLU G  1 46  ? -28.789 15.053  24.987  1.00 33.37  ?  46  GLU G CA  1 
ATOM   7597  C  C   . GLU G  1 46  ? -29.286 14.917  26.401  1.00 33.70  ?  46  GLU G C   1 
ATOM   7598  O  O   . GLU G  1 46  ? -28.670 15.465  27.302  1.00 34.59  ?  46  GLU G O   1 
ATOM   7599  C  CB  . GLU G  1 46  ? -29.890 15.633  24.104  1.00 33.25  ?  46  GLU G CB  1 
ATOM   7600  C  CG  . GLU G  1 46  ? -29.376 16.572  23.059  1.00 33.05  ?  46  GLU G CG  1 
ATOM   7601  C  CD  . GLU G  1 46  ? -30.331 16.724  21.909  1.00 33.99  ?  46  GLU G CD  1 
ATOM   7602  O  OE1 . GLU G  1 46  ? -29.906 17.227  20.859  1.00 34.99  ?  46  GLU G OE1 1 
ATOM   7603  O  OE2 . GLU G  1 46  ? -31.509 16.354  22.056  1.00 36.67  -1 46  GLU G OE2 1 
ATOM   7604  N  N   . ALA G  1 47  ? -30.389 14.191  26.585  1.00 33.71  ?  47  ALA G N   1 
ATOM   7605  C  CA  . ALA G  1 47  ? -30.896 13.807  27.913  1.00 34.00  ?  47  ALA G CA  1 
ATOM   7606  C  C   . ALA G  1 47  ? -29.819 13.316  28.939  1.00 34.23  ?  47  ALA G C   1 
ATOM   7607  O  O   . ALA G  1 47  ? -29.878 13.666  30.128  1.00 34.85  ?  47  ALA G O   1 
ATOM   7608  C  CB  . ALA G  1 47  ? -32.019 12.802  27.772  1.00 33.29  ?  47  ALA G CB  1 
ATOM   7609  N  N   . ALA G  1 48  ? -28.839 12.547  28.491  1.00 34.25  ?  48  ALA G N   1 
ATOM   7610  C  CA  . ALA G  1 48  ? -27.726 12.187  29.360  1.00 35.23  ?  48  ALA G CA  1 
ATOM   7611  C  C   . ALA G  1 48  ? -27.053 13.433  29.898  1.00 35.83  ?  48  ALA G C   1 
ATOM   7612  O  O   . ALA G  1 48  ? -26.935 13.604  31.096  1.00 36.53  ?  48  ALA G O   1 
ATOM   7613  C  CB  . ALA G  1 48  ? -26.703 11.289  28.631  1.00 34.87  ?  48  ALA G CB  1 
ATOM   7614  N  N   . ALA G  1 49  ? -26.640 14.316  28.993  1.00 36.93  ?  49  ALA G N   1 
ATOM   7615  C  CA  . ALA G  1 49  ? -25.996 15.593  29.322  1.00 36.94  ?  49  ALA G CA  1 
ATOM   7616  C  C   . ALA G  1 49  ? -26.896 16.481  30.160  1.00 37.22  ?  49  ALA G C   1 
ATOM   7617  O  O   . ALA G  1 49  ? -26.417 17.218  31.036  1.00 38.00  ?  49  ALA G O   1 
ATOM   7618  C  CB  . ALA G  1 49  ? -25.620 16.317  28.055  1.00 36.77  ?  49  ALA G CB  1 
ATOM   7619  N  N   . ARG G  1 50  ? -28.191 16.424  29.889  1.00 36.82  ?  50  ARG G N   1 
ATOM   7620  C  CA  . ARG G  1 50  ? -29.108 17.325  30.543  1.00 36.89  ?  50  ARG G CA  1 
ATOM   7621  C  C   . ARG G  1 50  ? -29.223 16.947  32.009  1.00 36.95  ?  50  ARG G C   1 
ATOM   7622  O  O   . ARG G  1 50  ? -28.767 17.691  32.853  1.00 37.28  ?  50  ARG G O   1 
ATOM   7623  C  CB  . ARG G  1 50  ? -30.460 17.346  29.848  1.00 36.63  ?  50  ARG G CB  1 
ATOM   7624  C  CG  . ARG G  1 50  ? -31.413 18.299  30.499  1.00 37.87  ?  50  ARG G CG  1 
ATOM   7625  C  CD  . ARG G  1 50  ? -32.770 18.285  29.822  1.00 39.83  ?  50  ARG G CD  1 
ATOM   7626  N  NE  . ARG G  1 50  ? -33.293 16.936  29.671  1.00 41.26  ?  50  ARG G NE  1 
ATOM   7627  C  CZ  . ARG G  1 50  ? -33.919 16.271  30.634  1.00 43.22  ?  50  ARG G CZ  1 
ATOM   7628  N  NH1 . ARG G  1 50  ? -34.086 16.841  31.811  1.00 42.24  ?  50  ARG G NH1 1 
ATOM   7629  N  NH2 . ARG G  1 50  ? -34.385 15.036  30.420  1.00 44.62  ?  50  ARG G NH2 1 
ATOM   7630  N  N   . GLU G  1 51  ? -29.796 15.783  32.313  1.00 37.18  ?  51  GLU G N   1 
ATOM   7631  C  CA  . GLU G  1 51  ? -29.878 15.324  33.697  1.00 36.53  ?  51  GLU G CA  1 
ATOM   7632  C  C   . GLU G  1 51  ? -28.533 15.540  34.411  1.00 36.88  ?  51  GLU G C   1 
ATOM   7633  O  O   . GLU G  1 51  ? -28.502 16.173  35.451  1.00 36.98  ?  51  GLU G O   1 
ATOM   7634  C  CB  . GLU G  1 51  ? -30.368 13.879  33.798  1.00 36.14  ?  51  GLU G CB  1 
ATOM   7635  C  CG  . GLU G  1 51  ? -31.816 13.656  33.371  1.00 33.85  ?  51  GLU G CG  1 
ATOM   7636  C  CD  . GLU G  1 51  ? -32.832 13.970  34.464  1.00 32.95  ?  51  GLU G CD  1 
ATOM   7637  O  OE1 . GLU G  1 51  ? -32.395 14.148  35.628  1.00 38.83  ?  51  GLU G OE1 1 
ATOM   7638  O  OE2 . GLU G  1 51  ? -34.052 14.048  34.191  1.00 26.68  -1 51  GLU G OE2 1 
ATOM   7639  N  N   . LEU G  1 52  ? -27.417 15.124  33.840  1.00 37.05  ?  52  LEU G N   1 
ATOM   7640  C  CA  . LEU G  1 52  ? -26.121 15.438  34.480  1.00 38.54  ?  52  LEU G CA  1 
ATOM   7641  C  C   . LEU G  1 52  ? -25.957 16.900  34.993  1.00 40.47  ?  52  LEU G C   1 
ATOM   7642  O  O   . LEU G  1 52  ? -25.260 17.155  35.984  1.00 40.94  ?  52  LEU G O   1 
ATOM   7643  C  CB  . LEU G  1 52  ? -24.976 15.071  33.546  1.00 37.63  ?  52  LEU G CB  1 
ATOM   7644  C  CG  . LEU G  1 52  ? -23.526 15.047  33.977  1.00 36.38  ?  52  LEU G CG  1 
ATOM   7645  C  CD1 . LEU G  1 52  ? -22.855 16.378  33.773  1.00 39.47  ?  52  LEU G CD1 1 
ATOM   7646  C  CD2 . LEU G  1 52  ? -23.407 14.652  35.388  1.00 35.56  ?  52  LEU G CD2 1 
ATOM   7647  N  N   . TRP G  1 53  ? -26.601 17.854  34.320  1.00 42.30  ?  53  TRP G N   1 
ATOM   7648  C  CA  . TRP G  1 53  ? -26.547 19.258  34.711  1.00 43.36  ?  53  TRP G CA  1 
ATOM   7649  C  C   . TRP G  1 53  ? -27.710 19.579  35.669  1.00 43.83  ?  53  TRP G C   1 
ATOM   7650  O  O   . TRP G  1 53  ? -27.460 20.163  36.746  1.00 44.24  ?  53  TRP G O   1 
ATOM   7651  C  CB  . TRP G  1 53  ? -26.551 20.195  33.474  1.00 43.82  ?  53  TRP G CB  1 
ATOM   7652  C  CG  . TRP G  1 53  ? -26.607 21.702  33.831  1.00 44.59  ?  53  TRP G CG  1 
ATOM   7653  C  CD1 . TRP G  1 53  ? -25.541 22.575  33.938  1.00 45.44  ?  53  TRP G CD1 1 
ATOM   7654  C  CD2 . TRP G  1 53  ? -27.778 22.467  34.150  1.00 44.68  ?  53  TRP G CD2 1 
ATOM   7655  N  NE1 . TRP G  1 53  ? -25.990 23.831  34.292  1.00 44.48  ?  53  TRP G NE1 1 
ATOM   7656  C  CE2 . TRP G  1 53  ? -27.355 23.793  34.422  1.00 44.94  ?  53  TRP G CE2 1 
ATOM   7657  C  CE3 . TRP G  1 53  ? -29.152 22.162  34.224  1.00 47.00  ?  53  TRP G CE3 1 
ATOM   7658  C  CZ2 . TRP G  1 53  ? -28.257 24.812  34.769  1.00 45.86  ?  53  TRP G CZ2 1 
ATOM   7659  C  CZ3 . TRP G  1 53  ? -30.056 23.177  34.573  1.00 46.06  ?  53  TRP G CZ3 1 
ATOM   7660  C  CH2 . TRP G  1 53  ? -29.596 24.485  34.845  1.00 48.12  ?  53  TRP G CH2 1 
ATOM   7661  N  N   . GLU G  1 54  ? -28.949 19.221  35.268  1.00 43.59  ?  54  GLU G N   1 
ATOM   7662  C  CA  . GLU G  1 54  ? -30.166 19.298  36.109  1.00 43.57  ?  54  GLU G CA  1 
ATOM   7663  C  C   . GLU G  1 54  ? -29.909 18.884  37.560  1.00 44.01  ?  54  GLU G C   1 
ATOM   7664  O  O   . GLU G  1 54  ? -30.669 19.260  38.472  1.00 44.60  ?  54  GLU G O   1 
ATOM   7665  C  CB  . GLU G  1 54  ? -31.251 18.340  35.584  1.00 43.76  ?  54  GLU G CB  1 
ATOM   7666  C  CG  . GLU G  1 54  ? -32.268 18.921  34.610  1.00 44.29  ?  54  GLU G CG  1 
ATOM   7667  C  CD  . GLU G  1 54  ? -33.624 18.139  34.532  1.00 45.26  ?  54  GLU G CD  1 
ATOM   7668  O  OE1 . GLU G  1 54  ? -33.880 17.129  35.274  1.00 43.25  ?  54  GLU G OE1 1 
ATOM   7669  O  OE2 . GLU G  1 54  ? -34.449 18.565  33.682  1.00 44.59  -1 54  GLU G OE2 1 
ATOM   7670  N  N   . GLU G  1 55  ? -28.851 18.095  37.772  1.00 43.82  ?  55  GLU G N   1 
ATOM   7671  C  CA  . GLU G  1 55  ? -28.712 17.285  38.986  1.00 43.81  ?  55  GLU G CA  1 
ATOM   7672  C  C   . GLU G  1 55  ? -27.334 17.346  39.551  1.00 44.21  ?  55  GLU G C   1 
ATOM   7673  O  O   . GLU G  1 55  ? -27.115 16.876  40.670  1.00 44.79  ?  55  GLU G O   1 
ATOM   7674  C  CB  . GLU G  1 55  ? -29.075 15.798  38.748  1.00 43.07  ?  55  GLU G CB  1 
ATOM   7675  C  CG  . GLU G  1 55  ? -30.566 15.546  38.452  1.00 41.11  ?  55  GLU G CG  1 
ATOM   7676  C  CD  . GLU G  1 55  ? -30.946 14.078  38.526  1.00 37.69  ?  55  GLU G CD  1 
ATOM   7677  O  OE1 . GLU G  1 55  ? -30.074 13.210  38.810  1.00 37.14  ?  55  GLU G OE1 1 
ATOM   7678  O  OE2 . GLU G  1 55  ? -32.125 13.801  38.298  1.00 31.85  -1 55  GLU G OE2 1 
ATOM   7679  N  N   . THR G  1 56  ? -26.393 17.897  38.802  1.00 44.06  ?  56  THR G N   1 
ATOM   7680  C  CA  . THR G  1 56  ? -25.086 18.099  39.402  1.00 44.39  ?  56  THR G CA  1 
ATOM   7681  C  C   . THR G  1 56  ? -24.447 19.450  39.056  1.00 44.91  ?  56  THR G C   1 
ATOM   7682  O  O   . THR G  1 56  ? -23.367 19.803  39.595  1.00 45.40  ?  56  THR G O   1 
ATOM   7683  C  CB  . THR G  1 56  ? -24.135 16.931  39.087  1.00 44.24  ?  56  THR G CB  1 
ATOM   7684  O  OG1 . THR G  1 56  ? -23.273 17.268  37.996  1.00 44.14  ?  56  THR G OG1 1 
ATOM   7685  C  CG2 . THR G  1 56  ? -24.927 15.702  38.753  1.00 44.49  ?  56  THR G CG2 1 
ATOM   7686  N  N   . GLY G  1 57  ? -25.099 20.196  38.161  1.00 44.66  ?  57  GLY G N   1 
ATOM   7687  C  CA  . GLY G  1 57  ? -24.570 21.475  37.706  1.00 44.70  ?  57  GLY G CA  1 
ATOM   7688  C  C   . GLY G  1 57  ? -23.434 21.403  36.694  1.00 44.76  ?  57  GLY G C   1 
ATOM   7689  O  O   . GLY G  1 57  ? -23.172 22.400  35.989  1.00 44.80  ?  57  GLY G O   1 
ATOM   7690  N  N   . ILE G  1 58  ? -22.753 20.247  36.609  1.00 44.39  ?  58  ILE G N   1 
ATOM   7691  C  CA  . ILE G  1 58  ? -21.665 20.049  35.607  1.00 43.75  ?  58  ILE G CA  1 
ATOM   7692  C  C   . ILE G  1 58  ? -22.153 20.121  34.156  1.00 43.36  ?  58  ILE G C   1 
ATOM   7693  O  O   . ILE G  1 58  ? -23.246 19.617  33.806  1.00 42.68  ?  58  ILE G O   1 
ATOM   7694  C  CB  . ILE G  1 58  ? -20.916 18.698  35.729  1.00 43.63  ?  58  ILE G CB  1 
ATOM   7695  C  CG1 . ILE G  1 58  ? -20.718 18.280  37.198  1.00 42.48  ?  58  ILE G CG1 1 
ATOM   7696  C  CG2 . ILE G  1 58  ? -19.605 18.752  34.897  1.00 42.06  ?  58  ILE G CG2 1 
ATOM   7697  C  CD1 . ILE G  1 58  ? -19.326 18.502  37.716  1.00 41.18  ?  58  ILE G CD1 1 
ATOM   7698  N  N   . SER G  1 59  ? -21.323 20.759  33.335  1.00 42.83  ?  59  SER G N   1 
ATOM   7699  C  CA  . SER G  1 59  ? -21.576 20.828  31.922  1.00 42.77  ?  59  SER G CA  1 
ATOM   7700  C  C   . SER G  1 59  ? -20.554 20.023  31.196  1.00 42.10  ?  59  SER G C   1 
ATOM   7701  O  O   . SER G  1 59  ? -19.431 20.513  30.951  1.00 42.06  ?  59  SER G O   1 
ATOM   7702  C  CB  . SER G  1 59  ? -21.572 22.262  31.440  1.00 43.06  ?  59  SER G CB  1 
ATOM   7703  O  OG  . SER G  1 59  ? -22.818 22.840  31.799  1.00 45.71  ?  59  SER G OG  1 
ATOM   7704  N  N   . ALA G  1 60  ? -20.939 18.773  30.886  1.00 41.02  ?  60  ALA G N   1 
ATOM   7705  C  CA  . ALA G  1 60  ? -20.133 17.900  30.005  1.00 40.07  ?  60  ALA G CA  1 
ATOM   7706  C  C   . ALA G  1 60  ? -20.963 16.940  29.176  1.00 38.67  ?  60  ALA G C   1 
ATOM   7707  O  O   . ALA G  1 60  ? -22.126 16.656  29.469  1.00 38.03  ?  60  ALA G O   1 
ATOM   7708  C  CB  . ALA G  1 60  ? -18.966 17.170  30.754  1.00 39.62  ?  60  ALA G CB  1 
ATOM   7709  N  N   . GLN G  1 61  ? -20.323 16.474  28.115  1.00 37.86  ?  61  GLN G N   1 
ATOM   7710  C  CA  . GLN G  1 61  ? -20.963 15.684  27.089  1.00 36.44  ?  61  GLN G CA  1 
ATOM   7711  C  C   . GLN G  1 61  ? -20.534 14.241  27.323  1.00 35.04  ?  61  GLN G C   1 
ATOM   7712  O  O   . GLN G  1 61  ? -19.336 13.979  27.518  1.00 34.37  ?  61  GLN G O   1 
ATOM   7713  C  CB  . GLN G  1 61  ? -20.487 16.196  25.725  1.00 36.81  ?  61  GLN G CB  1 
ATOM   7714  C  CG  . GLN G  1 61  ? -21.565 16.324  24.665  1.00 37.72  ?  61  GLN G CG  1 
ATOM   7715  C  CD  . GLN G  1 61  ? -22.774 17.099  25.150  1.00 39.91  ?  61  GLN G CD  1 
ATOM   7716  O  OE1 . GLN G  1 61  ? -23.915 16.840  24.729  1.00 37.73  ?  61  GLN G OE1 1 
ATOM   7717  N  NE2 . GLN G  1 61  ? -22.537 18.056  26.052  1.00 41.23  ?  61  GLN G NE2 1 
ATOM   7718  N  N   . PRO G  1 62  ? -21.508 13.309  27.352  1.00 33.51  ?  62  PRO G N   1 
ATOM   7719  C  CA  . PRO G  1 62  ? -21.247 11.863  27.373  1.00 32.88  ?  62  PRO G CA  1 
ATOM   7720  C  C   . PRO G  1 62  ? -20.234 11.511  26.294  1.00 32.85  ?  62  PRO G C   1 
ATOM   7721  O  O   . PRO G  1 62  ? -20.362 12.004  25.155  1.00 33.33  ?  62  PRO G O   1 
ATOM   7722  C  CB  . PRO G  1 62  ? -22.610 11.248  27.022  1.00 32.87  ?  62  PRO G CB  1 
ATOM   7723  C  CG  . PRO G  1 62  ? -23.621 12.249  27.454  1.00 32.55  ?  62  PRO G CG  1 
ATOM   7724  C  CD  . PRO G  1 62  ? -22.942 13.620  27.441  1.00 33.06  ?  62  PRO G CD  1 
ATOM   7725  N  N   . GLN G  1 63  ? -19.227 10.702  26.607  1.00 32.04  ?  63  GLN G N   1 
ATOM   7726  C  CA  . GLN G  1 63  ? -18.212 10.449  25.591  1.00 32.37  ?  63  GLN G CA  1 
ATOM   7727  C  C   . GLN G  1 63  ? -18.274 9.063   24.929  1.00 32.23  ?  63  GLN G C   1 
ATOM   7728  O  O   . GLN G  1 63  ? -17.818 8.882   23.808  1.00 32.39  ?  63  GLN G O   1 
ATOM   7729  C  CB  . GLN G  1 63  ? -16.826 10.696  26.144  1.00 32.55  ?  63  GLN G CB  1 
ATOM   7730  C  CG  . GLN G  1 63  ? -16.714 11.723  27.249  1.00 34.28  ?  63  GLN G CG  1 
ATOM   7731  C  CD  . GLN G  1 63  ? -15.391 11.542  28.006  1.00 38.28  ?  63  GLN G CD  1 
ATOM   7732  O  OE1 . GLN G  1 63  ? -14.844 12.487  28.569  1.00 38.07  ?  63  GLN G OE1 1 
ATOM   7733  N  NE2 . GLN G  1 63  ? -14.861 10.307  27.998  1.00 41.09  ?  63  GLN G NE2 1 
ATOM   7734  N  N   . HIS G  1 64  ? -18.803 8.078   25.645  1.00 32.13  ?  64  HIS G N   1 
ATOM   7735  C  CA  . HIS G  1 64  ? -18.934 6.709   25.149  1.00 30.97  ?  64  HIS G CA  1 
ATOM   7736  C  C   . HIS G  1 64  ? -20.183 6.044   25.701  1.00 30.09  ?  64  HIS G C   1 
ATOM   7737  O  O   . HIS G  1 64  ? -20.772 6.478   26.700  1.00 29.52  ?  64  HIS G O   1 
ATOM   7738  C  CB  . HIS G  1 64  ? -17.754 5.877   25.579  1.00 31.20  ?  64  HIS G CB  1 
ATOM   7739  C  CG  . HIS G  1 64  ? -16.455 6.302   24.982  1.00 33.41  ?  64  HIS G CG  1 
ATOM   7740  N  ND1 . HIS G  1 64  ? -15.760 7.406   25.430  1.00 35.08  ?  64  HIS G ND1 1 
ATOM   7741  C  CD2 . HIS G  1 64  ? -15.700 5.746   24.003  1.00 34.46  ?  64  HIS G CD2 1 
ATOM   7742  C  CE1 . HIS G  1 64  ? -14.635 7.518   24.742  1.00 35.93  ?  64  HIS G CE1 1 
ATOM   7743  N  NE2 . HIS G  1 64  ? -14.575 6.525   23.869  1.00 35.39  ?  64  HIS G NE2 1 
ATOM   7744  N  N   . PHE G  1 65  ? -20.579 4.969   25.039  1.00 29.06  ?  65  PHE G N   1 
ATOM   7745  C  CA  . PHE G  1 65  ? -21.708 4.173   25.477  1.00 27.47  ?  65  PHE G CA  1 
ATOM   7746  C  C   . PHE G  1 65  ? -21.122 2.975   26.171  1.00 27.26  ?  65  PHE G C   1 
ATOM   7747  O  O   . PHE G  1 65  ? -20.194 2.339   25.634  1.00 27.39  ?  65  PHE G O   1 
ATOM   7748  C  CB  . PHE G  1 65  ? -22.477 3.715   24.266  1.00 26.96  ?  65  PHE G CB  1 
ATOM   7749  C  CG  . PHE G  1 65  ? -23.698 2.922   24.574  1.00 25.46  ?  65  PHE G CG  1 
ATOM   7750  C  CD1 . PHE G  1 65  ? -24.684 3.424   25.393  1.00 23.95  ?  65  PHE G CD1 1 
ATOM   7751  C  CD2 . PHE G  1 65  ? -23.899 1.690   23.987  1.00 23.40  ?  65  PHE G CD2 1 
ATOM   7752  C  CE1 . PHE G  1 65  ? -25.822 2.669   25.654  1.00 24.11  ?  65  PHE G CE1 1 
ATOM   7753  C  CE2 . PHE G  1 65  ? -25.071 0.953   24.229  1.00 21.02  ?  65  PHE G CE2 1 
ATOM   7754  C  CZ  . PHE G  1 65  ? -26.006 1.420   25.052  1.00 19.77  ?  65  PHE G CZ  1 
ATOM   7755  N  N   . ILE G  1 66  ? -21.638 2.672   27.363  1.00 26.02  ?  66  ILE G N   1 
ATOM   7756  C  CA  . ILE G  1 66  ? -21.147 1.520   28.100  1.00 25.36  ?  66  ILE G CA  1 
ATOM   7757  C  C   . ILE G  1 66  ? -22.010 0.316   27.883  1.00 24.81  ?  66  ILE G C   1 
ATOM   7758  O  O   . ILE G  1 66  ? -21.529 -0.710  27.434  1.00 24.00  ?  66  ILE G O   1 
ATOM   7759  C  CB  . ILE G  1 66  ? -21.095 1.742   29.559  1.00 25.69  ?  66  ILE G CB  1 
ATOM   7760  C  CG1 . ILE G  1 66  ? -20.297 3.007   29.873  1.00 24.90  ?  66  ILE G CG1 1 
ATOM   7761  C  CG2 . ILE G  1 66  ? -20.459 0.497   30.177  1.00 26.80  ?  66  ILE G CG2 1 
ATOM   7762  C  CD1 . ILE G  1 66  ? -20.366 3.373   31.318  1.00 28.57  ?  66  ILE G CD1 1 
ATOM   7763  N  N   . ARG G  1 67  ? -23.281 0.450   28.248  1.00 23.99  ?  67  ARG G N   1 
ATOM   7764  C  CA  . ARG G  1 67  ? -24.287 -0.448  27.760  1.00 23.15  ?  67  ARG G CA  1 
ATOM   7765  C  C   . ARG G  1 67  ? -25.634 0.009   28.229  1.00 23.37  ?  67  ARG G C   1 
ATOM   7766  O  O   . ARG G  1 67  ? -25.713 1.011   28.946  1.00 23.54  ?  67  ARG G O   1 
ATOM   7767  C  CB  . ARG G  1 67  ? -24.042 -1.835  28.269  1.00 23.31  ?  67  ARG G CB  1 
ATOM   7768  C  CG  . ARG G  1 67  ? -24.403 -2.040  29.712  1.00 22.25  ?  67  ARG G CG  1 
ATOM   7769  C  CD  . ARG G  1 67  ? -24.522 -3.516  29.891  1.00 21.85  ?  67  ARG G CD  1 
ATOM   7770  N  NE  . ARG G  1 67  ? -25.902 -3.986  29.815  1.00 17.43  ?  67  ARG G NE  1 
ATOM   7771  C  CZ  . ARG G  1 67  ? -26.241 -5.244  30.111  1.00 17.07  ?  67  ARG G CZ  1 
ATOM   7772  N  NH1 . ARG G  1 67  ? -25.283 -6.124  30.435  1.00 10.13  ?  67  ARG G NH1 1 
ATOM   7773  N  NH2 . ARG G  1 67  ? -27.519 -5.632  30.063  1.00 16.29  ?  67  ARG G NH2 1 
ATOM   7774  N  N   . MET G  1 68  ? -26.685 -0.722  27.837  1.00 22.67  ?  68  MET G N   1 
ATOM   7775  C  CA  . MET G  1 68  ? -28.034 -0.422  28.288  1.00 22.89  ?  68  MET G CA  1 
ATOM   7776  C  C   . MET G  1 68  ? -28.543 -1.564  29.154  1.00 23.29  ?  68  MET G C   1 
ATOM   7777  O  O   . MET G  1 68  ? -28.292 -2.719  28.807  1.00 23.61  ?  68  MET G O   1 
ATOM   7778  C  CB  . MET G  1 68  ? -28.978 -0.228  27.094  1.00 22.75  ?  68  MET G CB  1 
ATOM   7779  C  CG  . MET G  1 68  ? -30.357 0.205   27.461  1.00 19.80  ?  68  MET G CG  1 
ATOM   7780  S  SD  . MET G  1 68  ? -31.594 -0.554  26.403  1.00 26.23  ?  68  MET G SD  1 
ATOM   7781  C  CE  . MET G  1 68  ? -31.925 -2.118  27.206  1.00 23.92  ?  68  MET G CE  1 
ATOM   7782  N  N   . HIS G  1 69  ? -29.258 -1.262  30.255  1.00 22.91  ?  69  HIS G N   1 
ATOM   7783  C  CA  . HIS G  1 69  ? -29.879 -2.338  31.030  1.00 23.23  ?  69  HIS G CA  1 
ATOM   7784  C  C   . HIS G  1 69  ? -31.391 -2.376  30.823  1.00 24.06  ?  69  HIS G C   1 
ATOM   7785  O  O   . HIS G  1 69  ? -32.053 -1.340  30.816  1.00 24.21  ?  69  HIS G O   1 
ATOM   7786  C  CB  . HIS G  1 69  ? -29.498 -2.267  32.509  1.00 22.25  ?  69  HIS G CB  1 
ATOM   7787  C  CG  . HIS G  1 69  ? -28.073 -2.632  32.796  1.00 21.62  ?  69  HIS G CG  1 
ATOM   7788  N  ND1 . HIS G  1 69  ? -27.083 -1.691  33.035  1.00 20.97  ?  69  HIS G ND1 1 
ATOM   7789  C  CD2 . HIS G  1 69  ? -27.462 -3.837  32.879  1.00 23.42  ?  69  HIS G CD2 1 
ATOM   7790  C  CE1 . HIS G  1 69  ? -25.933 -2.300  33.268  1.00 20.19  ?  69  HIS G CE1 1 
ATOM   7791  N  NE2 . HIS G  1 69  ? -26.131 -3.606  33.179  1.00 23.79  ?  69  HIS G NE2 1 
ATOM   7792  N  N   . GLN G  1 70  ? -31.938 -3.570  30.603  1.00 25.62  ?  70  GLN G N   1 
ATOM   7793  C  CA  . GLN G  1 70  ? -33.399 -3.718  30.575  1.00 26.91  ?  70  GLN G CA  1 
ATOM   7794  C  C   . GLN G  1 70  ? -33.804 -4.325  31.897  1.00 29.11  ?  70  GLN G C   1 
ATOM   7795  O  O   . GLN G  1 70  ? -33.455 -5.457  32.176  1.00 29.53  ?  70  GLN G O   1 
ATOM   7796  C  CB  . GLN G  1 70  ? -33.893 -4.584  29.417  1.00 25.48  ?  70  GLN G CB  1 
ATOM   7797  C  CG  . GLN G  1 70  ? -35.417 -4.763  29.439  1.00 24.47  ?  70  GLN G CG  1 
ATOM   7798  C  CD  . GLN G  1 70  ? -35.976 -5.585  28.295  1.00 23.87  ?  70  GLN G CD  1 
ATOM   7799  O  OE1 . GLN G  1 70  ? -35.264 -6.334  27.633  1.00 27.36  ?  70  GLN G OE1 1 
ATOM   7800  N  NE2 . GLN G  1 70  ? -37.275 -5.446  28.053  1.00 24.44  ?  70  GLN G NE2 1 
ATOM   7801  N  N   . TRP G  1 71  ? -34.499 -3.572  32.743  1.00 32.13  ?  71  TRP G N   1 
ATOM   7802  C  CA  . TRP G  1 71  ? -34.894 -4.124  34.024  1.00 35.23  ?  71  TRP G CA  1 
ATOM   7803  C  C   . TRP G  1 71  ? -36.296 -3.745  34.470  1.00 36.36  ?  71  TRP G C   1 
ATOM   7804  O  O   . TRP G  1 71  ? -36.949 -2.898  33.845  1.00 37.28  ?  71  TRP G O   1 
ATOM   7805  C  CB  . TRP G  1 71  ? -33.854 -3.828  35.068  1.00 35.66  ?  71  TRP G CB  1 
ATOM   7806  C  CG  . TRP G  1 71  ? -34.256 -2.844  36.076  1.00 41.20  ?  71  TRP G CG  1 
ATOM   7807  C  CD1 . TRP G  1 71  ? -34.928 -1.671  35.874  1.00 45.20  ?  71  TRP G CD1 1 
ATOM   7808  C  CD2 . TRP G  1 71  ? -33.974 -2.908  37.472  1.00 45.46  ?  71  TRP G CD2 1 
ATOM   7809  N  NE1 . TRP G  1 71  ? -35.098 -0.995  37.080  1.00 45.83  ?  71  TRP G NE1 1 
ATOM   7810  C  CE2 . TRP G  1 71  ? -34.513 -1.727  38.070  1.00 46.34  ?  71  TRP G CE2 1 
ATOM   7811  C  CE3 . TRP G  1 71  ? -33.316 -3.842  38.277  1.00 46.93  ?  71  TRP G CE3 1 
ATOM   7812  C  CZ2 . TRP G  1 71  ? -34.417 -1.464  39.420  1.00 47.40  ?  71  TRP G CZ2 1 
ATOM   7813  C  CZ3 . TRP G  1 71  ? -33.228 -3.591  39.615  1.00 49.71  ?  71  TRP G CZ3 1 
ATOM   7814  C  CH2 . TRP G  1 71  ? -33.780 -2.404  40.183  1.00 50.23  ?  71  TRP G CH2 1 
ATOM   7815  N  N   . ILE G  1 72  ? -36.780 -4.372  35.539  1.00 37.36  ?  72  ILE G N   1 
ATOM   7816  C  CA  . ILE G  1 72  ? -38.168 -4.153  35.907  1.00 38.05  ?  72  ILE G CA  1 
ATOM   7817  C  C   . ILE G  1 72  ? -38.319 -3.387  37.210  1.00 39.31  ?  72  ILE G C   1 
ATOM   7818  O  O   . ILE G  1 72  ? -39.015 -2.365  37.248  1.00 40.49  ?  72  ILE G O   1 
ATOM   7819  C  CB  . ILE G  1 72  ? -38.997 -5.429  35.816  1.00 37.80  ?  72  ILE G CB  1 
ATOM   7820  C  CG1 . ILE G  1 72  ? -39.240 -5.721  34.338  1.00 36.97  ?  72  ILE G CG1 1 
ATOM   7821  C  CG2 . ILE G  1 72  ? -40.301 -5.288  36.619  1.00 37.71  ?  72  ILE G CG2 1 
ATOM   7822  C  CD1 . ILE G  1 72  ? -40.149 -6.916  34.006  1.00 38.71  ?  72  ILE G CD1 1 
ATOM   7823  N  N   . ALA G  1 73  ? -37.639 -3.791  38.266  1.00 39.99  ?  73  ALA G N   1 
ATOM   7824  C  CA  . ALA G  1 73  ? -37.712 -2.957  39.481  1.00 41.23  ?  73  ALA G CA  1 
ATOM   7825  C  C   . ALA G  1 73  ? -38.980 -3.222  40.310  1.00 41.53  ?  73  ALA G C   1 
ATOM   7826  O  O   . ALA G  1 73  ? -40.072 -3.422  39.732  1.00 40.87  ?  73  ALA G O   1 
ATOM   7827  C  CB  . ALA G  1 73  ? -37.646 -1.446  39.116  1.00 40.75  ?  73  ALA G CB  1 
ATOM   7828  N  N   . PRO G  1 74  ? -38.829 -3.187  41.660  1.00 42.06  ?  74  PRO G N   1 
ATOM   7829  C  CA  . PRO G  1 74  ? -39.800 -3.526  42.705  1.00 42.30  ?  74  PRO G CA  1 
ATOM   7830  C  C   . PRO G  1 74  ? -41.277 -3.266  42.360  1.00 43.13  ?  74  PRO G C   1 
ATOM   7831  O  O   . PRO G  1 74  ? -42.084 -4.188  42.473  1.00 43.39  ?  74  PRO G O   1 
ATOM   7832  C  CB  . PRO G  1 74  ? -39.342 -2.667  43.868  1.00 42.08  ?  74  PRO G CB  1 
ATOM   7833  C  CG  . PRO G  1 74  ? -37.824 -2.564  43.695  1.00 42.20  ?  74  PRO G CG  1 
ATOM   7834  C  CD  . PRO G  1 74  ? -37.509 -2.871  42.257  1.00 42.26  ?  74  PRO G CD  1 
ATOM   7835  N  N   . ASP G  1 75  ? -41.631 -2.052  41.926  1.00 43.73  ?  75  ASP G N   1 
ATOM   7836  C  CA  . ASP G  1 75  ? -43.033 -1.751  41.582  1.00 44.61  ?  75  ASP G CA  1 
ATOM   7837  C  C   . ASP G  1 75  ? -43.570 -2.345  40.251  1.00 44.87  ?  75  ASP G C   1 
ATOM   7838  O  O   . ASP G  1 75  ? -44.720 -2.091  39.883  1.00 44.90  ?  75  ASP G O   1 
ATOM   7839  C  CB  . ASP G  1 75  ? -43.377 -0.244  41.725  1.00 45.02  ?  75  ASP G CB  1 
ATOM   7840  C  CG  . ASP G  1 75  ? -42.242 0.682   41.281  1.00 47.13  ?  75  ASP G CG  1 
ATOM   7841  O  OD1 . ASP G  1 75  ? -42.324 1.155   40.131  1.00 47.93  ?  75  ASP G OD1 1 
ATOM   7842  O  OD2 . ASP G  1 75  ? -41.277 0.937   42.070  1.00 49.14  -1 75  ASP G OD2 1 
ATOM   7843  N  N   . LYS G  1 76  ? -42.765 -3.146  39.554  1.00 44.56  ?  76  LYS G N   1 
ATOM   7844  C  CA  . LYS G  1 76  ? -43.183 -3.754  38.277  1.00 44.45  ?  76  LYS G CA  1 
ATOM   7845  C  C   . LYS G  1 76  ? -43.121 -2.743  37.096  1.00 43.26  ?  76  LYS G C   1 
ATOM   7846  O  O   . LYS G  1 76  ? -43.533 -3.042  35.969  1.00 42.43  ?  76  LYS G O   1 
ATOM   7847  C  CB  . LYS G  1 76  ? -44.539 -4.510  38.431  1.00 45.01  ?  76  LYS G CB  1 
ATOM   7848  C  CG  . LYS G  1 76  ? -45.176 -5.175  37.153  1.00 49.25  ?  76  LYS G CG  1 
ATOM   7849  C  CD  . LYS G  1 76  ? -44.228 -6.122  36.328  1.00 53.81  ?  76  LYS G CD  1 
ATOM   7850  C  CE  . LYS G  1 76  ? -44.591 -7.617  36.453  1.00 56.38  ?  76  LYS G CE  1 
ATOM   7851  N  NZ  . LYS G  1 76  ? -43.349 -8.440  36.688  1.00 58.33  ?  76  LYS G NZ  1 
ATOM   7852  N  N   . THR G  1 77  ? -42.532 -1.574  37.363  1.00 42.58  ?  77  THR G N   1 
ATOM   7853  C  CA  . THR G  1 77  ? -42.297 -0.512  36.355  1.00 41.97  ?  77  THR G CA  1 
ATOM   7854  C  C   . THR G  1 77  ? -41.076 -0.787  35.442  1.00 41.04  ?  77  THR G C   1 
ATOM   7855  O  O   . THR G  1 77  ? -39.943 -0.838  35.943  1.00 40.33  ?  77  THR G O   1 
ATOM   7856  C  CB  . THR G  1 77  ? -42.118 0.877   37.049  1.00 42.25  ?  77  THR G CB  1 
ATOM   7857  O  OG1 . THR G  1 77  ? -43.334 1.219   37.719  1.00 42.60  ?  77  THR G OG1 1 
ATOM   7858  C  CG2 . THR G  1 77  ? -41.785 1.982   36.052  1.00 41.88  ?  77  THR G CG2 1 
ATOM   7859  N  N   . PRO G  1 78  ? -41.310 -0.922  34.103  1.00 40.13  ?  78  PRO G N   1 
ATOM   7860  C  CA  . PRO G  1 78  ? -40.300 -1.366  33.127  1.00 39.23  ?  78  PRO G CA  1 
ATOM   7861  C  C   . PRO G  1 78  ? -39.294 -0.279  32.797  1.00 38.20  ?  78  PRO G C   1 
ATOM   7862  O  O   . PRO G  1 78  ? -39.703 0.846   32.532  1.00 38.52  ?  78  PRO G O   1 
ATOM   7863  C  CB  . PRO G  1 78  ? -41.123 -1.691  31.877  1.00 38.52  ?  78  PRO G CB  1 
ATOM   7864  C  CG  . PRO G  1 78  ? -42.558 -1.530  32.265  1.00 39.97  ?  78  PRO G CG  1 
ATOM   7865  C  CD  . PRO G  1 78  ? -42.573 -0.595  33.420  1.00 40.73  ?  78  PRO G CD  1 
ATOM   7866  N  N   . PHE G  1 79  ? -38.005 -0.607  32.819  1.00 36.39  ?  79  PHE G N   1 
ATOM   7867  C  CA  . PHE G  1 79  ? -36.994 0.356   32.415  1.00 35.67  ?  79  PHE G CA  1 
ATOM   7868  C  C   . PHE G  1 79  ? -36.079 -0.051  31.268  1.00 34.31  ?  79  PHE G C   1 
ATOM   7869  O  O   . PHE G  1 79  ? -35.764 -1.216  31.100  1.00 33.94  ?  79  PHE G O   1 
ATOM   7870  C  CB  . PHE G  1 79  ? -36.127 0.732   33.601  1.00 36.33  ?  79  PHE G CB  1 
ATOM   7871  C  CG  . PHE G  1 79  ? -36.738 1.766   34.469  1.00 38.71  ?  79  PHE G CG  1 
ATOM   7872  C  CD1 . PHE G  1 79  ? -36.304 3.090   34.396  1.00 39.89  ?  79  PHE G CD1 1 
ATOM   7873  C  CD2 . PHE G  1 79  ? -37.761 1.419   35.359  1.00 41.32  ?  79  PHE G CD2 1 
ATOM   7874  C  CE1 . PHE G  1 79  ? -36.876 4.061   35.205  1.00 43.15  ?  79  PHE G CE1 1 
ATOM   7875  C  CE2 . PHE G  1 79  ? -38.348 2.370   36.190  1.00 42.87  ?  79  PHE G CE2 1 
ATOM   7876  C  CZ  . PHE G  1 79  ? -37.916 3.702   36.115  1.00 44.66  ?  79  PHE G CZ  1 
ATOM   7877  N  N   . LEU G  1 80  ? -35.654 0.935   30.483  1.00 32.88  ?  80  LEU G N   1 
ATOM   7878  C  CA  . LEU G  1 80  ? -34.525 0.781   29.585  1.00 31.30  ?  80  LEU G CA  1 
ATOM   7879  C  C   . LEU G  1 80  ? -33.575 1.892   29.990  1.00 30.80  ?  80  LEU G C   1 
ATOM   7880  O  O   . LEU G  1 80  ? -33.957 3.067   29.973  1.00 30.31  ?  80  LEU G O   1 
ATOM   7881  C  CB  . LEU G  1 80  ? -34.960 0.943   28.135  1.00 31.29  ?  80  LEU G CB  1 
ATOM   7882  C  CG  . LEU G  1 80  ? -35.245 -0.238  27.196  1.00 30.38  ?  80  LEU G CG  1 
ATOM   7883  C  CD1 . LEU G  1 80  ? -35.955 -1.442  27.831  1.00 27.99  ?  80  LEU G CD1 1 
ATOM   7884  C  CD2 . LEU G  1 80  ? -36.050 0.290   26.046  1.00 26.92  ?  80  LEU G CD2 1 
ATOM   7885  N  N   . ARG G  1 81  ? -32.355 1.525   30.383  1.00 29.40  ?  81  ARG G N   1 
ATOM   7886  C  CA  . ARG G  1 81  ? -31.487 2.477   31.019  1.00 29.22  ?  81  ARG G CA  1 
ATOM   7887  C  C   . ARG G  1 81  ? -30.156 2.484   30.339  1.00 29.53  ?  81  ARG G C   1 
ATOM   7888  O  O   . ARG G  1 81  ? -29.421 1.488   30.382  1.00 30.81  ?  81  ARG G O   1 
ATOM   7889  C  CB  . ARG G  1 81  ? -31.340 2.164   32.520  1.00 29.28  ?  81  ARG G CB  1 
ATOM   7890  C  CG  . ARG G  1 81  ? -30.712 3.276   33.377  1.00 28.87  ?  81  ARG G CG  1 
ATOM   7891  C  CD  . ARG G  1 81  ? -30.898 2.941   34.835  1.00 28.49  ?  81  ARG G CD  1 
ATOM   7892  N  NE  . ARG G  1 81  ? -30.103 3.721   35.801  1.00 29.79  ?  81  ARG G NE  1 
ATOM   7893  C  CZ  . ARG G  1 81  ? -28.778 3.606   36.026  1.00 28.70  ?  81  ARG G CZ  1 
ATOM   7894  N  NH1 . ARG G  1 81  ? -27.999 2.773   35.311  1.00 25.06  ?  81  ARG G NH1 1 
ATOM   7895  N  NH2 . ARG G  1 81  ? -28.220 4.364   36.969  1.00 26.79  ?  81  ARG G NH2 1 
ATOM   7896  N  N   . PHE G  1 82  ? -29.833 3.619   29.728  1.00 28.73  ?  82  PHE G N   1 
ATOM   7897  C  CA  . PHE G  1 82  ? -28.635 3.729   28.930  1.00 27.59  ?  82  PHE G CA  1 
ATOM   7898  C  C   . PHE G  1 82  ? -27.539 4.349   29.734  1.00 27.95  ?  82  PHE G C   1 
ATOM   7899  O  O   . PHE G  1 82  ? -27.781 5.326   30.421  1.00 28.93  ?  82  PHE G O   1 
ATOM   7900  C  CB  . PHE G  1 82  ? -28.916 4.582   27.707  1.00 26.77  ?  82  PHE G CB  1 
ATOM   7901  C  CG  . PHE G  1 82  ? -29.843 3.948   26.732  1.00 22.80  ?  82  PHE G CG  1 
ATOM   7902  C  CD1 . PHE G  1 82  ? -31.216 4.057   26.887  1.00 22.71  ?  82  PHE G CD1 1 
ATOM   7903  C  CD2 . PHE G  1 82  ? -29.345 3.235   25.658  1.00 17.87  ?  82  PHE G CD2 1 
ATOM   7904  C  CE1 . PHE G  1 82  ? -32.086 3.482   25.966  1.00 19.78  ?  82  PHE G CE1 1 
ATOM   7905  C  CE2 . PHE G  1 82  ? -30.176 2.660   24.746  1.00 15.06  ?  82  PHE G CE2 1 
ATOM   7906  C  CZ  . PHE G  1 82  ? -31.552 2.779   24.886  1.00 19.36  ?  82  PHE G CZ  1 
ATOM   7907  N  N   . LEU G  1 83  ? -26.330 3.809   29.612  1.00 28.43  ?  83  LEU G N   1 
ATOM   7908  C  CA  . LEU G  1 83  ? -25.232 4.138   30.498  1.00 29.14  ?  83  LEU G CA  1 
ATOM   7909  C  C   . LEU G  1 83  ? -24.024 4.591   29.764  1.00 30.89  ?  83  LEU G C   1 
ATOM   7910  O  O   . LEU G  1 83  ? -23.467 3.830   28.977  1.00 32.37  ?  83  LEU G O   1 
ATOM   7911  C  CB  . LEU G  1 83  ? -24.817 2.917   31.297  1.00 28.61  ?  83  LEU G CB  1 
ATOM   7912  C  CG  . LEU G  1 83  ? -23.864 3.153   32.463  1.00 27.21  ?  83  LEU G CG  1 
ATOM   7913  C  CD1 . LEU G  1 83  ? -24.577 3.824   33.629  1.00 23.06  ?  83  LEU G CD1 1 
ATOM   7914  C  CD2 . LEU G  1 83  ? -23.228 1.848   32.882  1.00 25.93  ?  83  LEU G CD2 1 
ATOM   7915  N  N   . PHE G  1 84  ? -23.563 5.808   30.053  1.00 32.33  ?  84  PHE G N   1 
ATOM   7916  C  CA  . PHE G  1 84  ? -22.427 6.350   29.320  1.00 32.66  ?  84  PHE G CA  1 
ATOM   7917  C  C   . PHE G  1 84  ? -21.310 6.665   30.256  1.00 34.07  ?  84  PHE G C   1 
ATOM   7918  O  O   . PHE G  1 84  ? -21.558 6.921   31.433  1.00 34.85  ?  84  PHE G O   1 
ATOM   7919  C  CB  . PHE G  1 84  ? -22.828 7.627   28.601  1.00 32.33  ?  84  PHE G CB  1 
ATOM   7920  C  CG  . PHE G  1 84  ? -24.059 7.486   27.744  1.00 29.88  ?  84  PHE G CG  1 
ATOM   7921  C  CD1 . PHE G  1 84  ? -25.315 7.628   28.296  1.00 27.53  ?  84  PHE G CD1 1 
ATOM   7922  C  CD2 . PHE G  1 84  ? -23.948 7.218   26.385  1.00 27.20  ?  84  PHE G CD2 1 
ATOM   7923  C  CE1 . PHE G  1 84  ? -26.461 7.520   27.515  1.00 27.09  ?  84  PHE G CE1 1 
ATOM   7924  C  CE2 . PHE G  1 84  ? -25.068 7.125   25.589  1.00 27.67  ?  84  PHE G CE2 1 
ATOM   7925  C  CZ  . PHE G  1 84  ? -26.344 7.272   26.160  1.00 28.39  ?  84  PHE G CZ  1 
ATOM   7926  N  N   . ALA G  1 85  ? -20.093 6.636   29.721  1.00 35.31  ?  85  ALA G N   1 
ATOM   7927  C  CA  . ALA G  1 85  ? -18.903 7.080   30.399  1.00 36.95  ?  85  ALA G CA  1 
ATOM   7928  C  C   . ALA G  1 85  ? -18.708 8.611   30.237  1.00 38.47  ?  85  ALA G C   1 
ATOM   7929  O  O   . ALA G  1 85  ? -19.143 9.186   29.251  1.00 38.92  ?  85  ALA G O   1 
ATOM   7930  C  CB  . ALA G  1 85  ? -17.720 6.336   29.829  1.00 36.72  ?  85  ALA G CB  1 
ATOM   7931  N  N   . ILE G  1 86  ? -18.077 9.268   31.213  1.00 39.81  ?  86  ILE G N   1 
ATOM   7932  C  CA  . ILE G  1 86  ? -17.516 10.611  31.038  1.00 40.67  ?  86  ILE G CA  1 
ATOM   7933  C  C   . ILE G  1 86  ? -16.197 10.687  31.792  1.00 42.21  ?  86  ILE G C   1 
ATOM   7934  O  O   . ILE G  1 86  ? -16.188 10.757  33.006  1.00 42.56  ?  86  ILE G O   1 
ATOM   7935  C  CB  . ILE G  1 86  ? -18.444 11.736  31.553  1.00 40.07  ?  86  ILE G CB  1 
ATOM   7936  C  CG1 . ILE G  1 86  ? -19.725 11.804  30.721  1.00 40.06  ?  86  ILE G CG1 1 
ATOM   7937  C  CG2 . ILE G  1 86  ? -17.722 13.067  31.474  1.00 39.56  ?  86  ILE G CG2 1 
ATOM   7938  C  CD1 . ILE G  1 86  ? -20.796 12.872  31.116  1.00 37.83  ?  86  ILE G CD1 1 
ATOM   7939  N  N   . GLU G  1 87  ? -15.081 10.636  31.084  1.00 44.63  ?  87  GLU G N   1 
ATOM   7940  C  CA  . GLU G  1 87  ? -13.764 10.892  31.704  1.00 47.09  ?  87  GLU G CA  1 
ATOM   7941  C  C   . GLU G  1 87  ? -13.564 12.357  32.114  1.00 48.53  ?  87  GLU G C   1 
ATOM   7942  O  O   . GLU G  1 87  ? -14.183 13.267  31.536  1.00 48.53  ?  87  GLU G O   1 
ATOM   7943  C  CB  . GLU G  1 87  ? -12.626 10.505  30.749  1.00 46.90  ?  87  GLU G CB  1 
ATOM   7944  C  CG  . GLU G  1 87  ? -12.386 9.032   30.675  1.00 47.80  ?  87  GLU G CG  1 
ATOM   7945  C  CD  . GLU G  1 87  ? -12.633 8.364   32.010  1.00 49.06  ?  87  GLU G CD  1 
ATOM   7946  O  OE1 . GLU G  1 87  ? -13.483 7.444   32.059  1.00 48.17  ?  87  GLU G OE1 1 
ATOM   7947  O  OE2 . GLU G  1 87  ? -11.982 8.778   33.003  1.00 49.56  -1 87  GLU G OE2 1 
ATOM   7948  N  N   . LEU G  1 88  ? -12.703 12.580  33.107  1.00 50.30  ?  88  LEU G N   1 
ATOM   7949  C  CA  . LEU G  1 88  ? -12.291 13.944  33.459  1.00 51.93  ?  88  LEU G CA  1 
ATOM   7950  C  C   . LEU G  1 88  ? -10.809 14.071  33.764  1.00 54.11  ?  88  LEU G C   1 
ATOM   7951  O  O   . LEU G  1 88  ? -10.057 13.088  33.845  1.00 53.95  ?  88  LEU G O   1 
ATOM   7952  C  CB  . LEU G  1 88  ? -13.146 14.586  34.559  1.00 50.67  ?  88  LEU G CB  1 
ATOM   7953  C  CG  . LEU G  1 88  ? -14.581 14.982  34.176  1.00 49.45  ?  88  LEU G CG  1 
ATOM   7954  C  CD1 . LEU G  1 88  ? -15.383 15.514  35.341  1.00 47.06  ?  88  LEU G CD1 1 
ATOM   7955  C  CD2 . LEU G  1 88  ? -14.623 15.981  33.046  1.00 49.75  ?  88  LEU G CD2 1 
ATOM   7956  N  N   . GLU G  1 89  ? -10.411 15.328  33.862  1.00 56.91  ?  89  GLU G N   1 
ATOM   7957  C  CA  . GLU G  1 89  ? -9.053  15.726  34.099  1.00 59.58  ?  89  GLU G CA  1 
ATOM   7958  C  C   . GLU G  1 89  ? -8.982  15.860  35.611  1.00 60.88  ?  89  GLU G C   1 
ATOM   7959  O  O   . GLU G  1 89  ? -8.049  15.344  36.236  1.00 61.23  ?  89  GLU G O   1 
ATOM   7960  C  CB  . GLU G  1 89  ? -8.781  17.061  33.390  1.00 59.73  ?  89  GLU G CB  1 
ATOM   7961  C  CG  . GLU G  1 89  ? -9.433  17.186  31.969  1.00 61.44  ?  89  GLU G CG  1 
ATOM   7962  C  CD  . GLU G  1 89  ? -11.000 17.340  31.948  1.00 62.41  ?  89  GLU G CD  1 
ATOM   7963  O  OE1 . GLU G  1 89  ? -11.594 17.956  32.876  1.00 62.45  ?  89  GLU G OE1 1 
ATOM   7964  O  OE2 . GLU G  1 89  ? -11.630 16.849  30.976  1.00 62.17  -1 89  GLU G OE2 1 
ATOM   7965  N  N   . GLN G  1 90  ? -10.002 16.502  36.193  1.00 62.63  ?  90  GLN G N   1 
ATOM   7966  C  CA  . GLN G  1 90  ? -10.093 16.666  37.655  1.00 64.73  ?  90  GLN G CA  1 
ATOM   7967  C  C   . GLN G  1 90  ? -11.501 16.914  38.195  1.00 65.27  ?  90  GLN G C   1 
ATOM   7968  O  O   . GLN G  1 90  ? -12.423 17.218  37.428  1.00 65.38  ?  90  GLN G O   1 
ATOM   7969  C  CB  . GLN G  1 90  ? -9.175  17.800  38.130  1.00 65.16  ?  90  GLN G CB  1 
ATOM   7970  C  CG  . GLN G  1 90  ? -9.446  19.135  37.450  1.00 67.39  ?  90  GLN G CG  1 
ATOM   7971  C  CD  . GLN G  1 90  ? -8.210  20.008  37.384  1.00 70.10  ?  90  GLN G CD  1 
ATOM   7972  O  OE1 . GLN G  1 90  ? -8.240  21.167  37.802  1.00 71.14  ?  90  GLN G OE1 1 
ATOM   7973  N  NE2 . GLN G  1 90  ? -7.105  19.453  36.864  1.00 70.45  ?  90  GLN G NE2 1 
ATOM   7974  N  N   . ILE G  1 91  ? -11.640 16.795  39.521  1.00 66.00  ?  91  ILE G N   1 
ATOM   7975  C  CA  . ILE G  1 91  ? -12.870 17.163  40.222  1.00 67.03  ?  91  ILE G CA  1 
ATOM   7976  C  C   . ILE G  1 91  ? -13.076 18.681  40.168  1.00 67.80  ?  91  ILE G C   1 
ATOM   7977  O  O   . ILE G  1 91  ? -12.225 19.421  39.671  1.00 67.80  ?  91  ILE G O   1 
ATOM   7978  C  CB  . ILE G  1 91  ? -12.874 16.722  41.718  1.00 67.05  ?  91  ILE G CB  1 
ATOM   7979  C  CG1 . ILE G  1 91  ? -12.071 15.434  41.953  1.00 66.97  ?  91  ILE G CG1 1 
ATOM   7980  C  CG2 . ILE G  1 91  ? -14.325 16.632  42.250  1.00 66.48  ?  91  ILE G CG2 1 
ATOM   7981  C  CD1 . ILE G  1 91  ? -12.898 14.166  42.095  1.00 66.38  ?  91  ILE G CD1 1 
ATOM   7982  N  N   . CYS G  1 92  ? -14.197 19.137  40.713  1.00 68.86  ?  92  CYS G N   1 
ATOM   7983  C  CA  . CYS G  1 92  ? -14.649 20.509  40.529  1.00 70.16  ?  92  CYS G CA  1 
ATOM   7984  C  C   . CYS G  1 92  ? -15.889 20.807  41.384  1.00 70.79  ?  92  CYS G C   1 
ATOM   7985  O  O   . CYS G  1 92  ? -16.494 19.878  41.949  1.00 70.81  ?  92  CYS G O   1 
ATOM   7986  C  CB  . CYS G  1 92  ? -15.007 20.718  39.050  1.00 70.40  ?  92  CYS G CB  1 
ATOM   7987  S  SG  . CYS G  1 92  ? -16.164 19.454  38.414  1.00 70.46  ?  92  CYS G SG  1 
ATOM   7988  N  N   . PRO G  1 93  ? -16.273 22.103  41.476  1.00 71.33  ?  93  PRO G N   1 
ATOM   7989  C  CA  . PRO G  1 93  ? -17.581 22.563  41.951  1.00 71.67  ?  93  PRO G CA  1 
ATOM   7990  C  C   . PRO G  1 93  ? -18.714 21.563  41.721  1.00 71.63  ?  93  PRO G C   1 
ATOM   7991  O  O   . PRO G  1 93  ? -18.469 20.395  41.409  1.00 71.51  ?  93  PRO G O   1 
ATOM   7992  C  CB  . PRO G  1 93  ? -17.825 23.836  41.102  1.00 71.78  ?  93  PRO G CB  1 
ATOM   7993  C  CG  . PRO G  1 93  ? -16.411 24.322  40.686  1.00 71.81  ?  93  PRO G CG  1 
ATOM   7994  C  CD  . PRO G  1 93  ? -15.406 23.262  41.188  1.00 71.56  ?  93  PRO G CD  1 
ATOM   7995  N  N   . THR G  1 94  ? -19.947 22.032  41.886  1.00 71.60  ?  94  THR G N   1 
ATOM   7996  C  CA  . THR G  1 94  ? -21.134 21.196  41.727  1.00 71.65  ?  94  THR G CA  1 
ATOM   7997  C  C   . THR G  1 94  ? -22.400 21.957  42.118  1.00 71.31  ?  94  THR G C   1 
ATOM   7998  O  O   . THR G  1 94  ? -22.596 23.106  41.727  1.00 71.22  ?  94  THR G O   1 
ATOM   7999  C  CB  . THR G  1 94  ? -21.012 19.803  42.483  1.00 71.93  ?  94  THR G CB  1 
ATOM   8000  O  OG1 . THR G  1 94  ? -22.270 19.115  42.461  1.00 71.44  ?  94  THR G OG1 1 
ATOM   8001  C  CG2 . THR G  1 94  ? -20.508 19.951  43.951  1.00 72.60  ?  94  THR G CG2 1 
ATOM   8002  N  N   . GLN G  1 95  ? -23.242 21.292  42.895  1.00 71.18  ?  95  GLN G N   1 
ATOM   8003  C  CA  . GLN G  1 95  ? -24.539 21.790  43.348  1.00 71.24  ?  95  GLN G CA  1 
ATOM   8004  C  C   . GLN G  1 95  ? -25.597 21.690  42.254  1.00 70.73  ?  95  GLN G C   1 
ATOM   8005  O  O   . GLN G  1 95  ? -25.475 22.288  41.181  1.00 70.15  ?  95  GLN G O   1 
ATOM   8006  C  CB  . GLN G  1 95  ? -24.471 23.186  44.017  1.00 71.54  ?  95  GLN G CB  1 
ATOM   8007  C  CG  . GLN G  1 95  ? -25.094 23.218  45.444  1.00 72.31  ?  95  GLN G CG  1 
ATOM   8008  C  CD  . GLN G  1 95  ? -24.175 23.864  46.512  1.00 73.93  ?  95  GLN G CD  1 
ATOM   8009  O  OE1 . GLN G  1 95  ? -23.647 24.966  46.318  1.00 73.53  ?  95  GLN G OE1 1 
ATOM   8010  N  NE2 . GLN G  1 95  ? -23.997 23.172  47.647  1.00 73.40  ?  95  GLN G NE2 1 
ATOM   8011  N  N   . PRO G  1 96  ? -26.625 20.875  42.527  1.00 70.71  ?  96  PRO G N   1 
ATOM   8012  C  CA  . PRO G  1 96  ? -27.799 20.691  41.697  1.00 70.59  ?  96  PRO G CA  1 
ATOM   8013  C  C   . PRO G  1 96  ? -28.388 21.987  41.167  1.00 70.22  ?  96  PRO G C   1 
ATOM   8014  O  O   . PRO G  1 96  ? -27.876 23.078  41.406  1.00 70.09  ?  96  PRO G O   1 
ATOM   8015  C  CB  . PRO G  1 96  ? -28.818 20.023  42.658  1.00 70.74  ?  96  PRO G CB  1 
ATOM   8016  C  CG  . PRO G  1 96  ? -28.130 19.932  44.012  1.00 70.78  ?  96  PRO G CG  1 
ATOM   8017  C  CD  . PRO G  1 96  ? -26.669 19.986  43.704  1.00 70.72  ?  96  PRO G CD  1 
ATOM   8018  N  N   . HIS G  1 97  ? -29.462 21.822  40.419  1.00 69.82  ?  97  HIS G N   1 
ATOM   8019  C  CA  . HIS G  1 97  ? -30.293 22.899  39.995  1.00 69.71  ?  97  HIS G CA  1 
ATOM   8020  C  C   . HIS G  1 97  ? -31.663 22.287  40.170  1.00 69.77  ?  97  HIS G C   1 
ATOM   8021  O  O   . HIS G  1 97  ? -32.573 22.492  39.364  1.00 70.12  ?  97  HIS G O   1 
ATOM   8022  C  CB  . HIS G  1 97  ? -29.971 23.290  38.545  1.00 69.47  ?  97  HIS G CB  1 
ATOM   8023  C  CG  . HIS G  1 97  ? -28.661 24.010  38.392  1.00 68.97  ?  97  HIS G CG  1 
ATOM   8024  N  ND1 . HIS G  1 97  ? -28.577 25.360  38.126  1.00 69.07  ?  97  HIS G ND1 1 
ATOM   8025  C  CD2 . HIS G  1 97  ? -27.383 23.570  38.486  1.00 68.41  ?  97  HIS G CD2 1 
ATOM   8026  C  CE1 . HIS G  1 97  ? -27.307 25.718  38.050  1.00 68.61  ?  97  HIS G CE1 1 
ATOM   8027  N  NE2 . HIS G  1 97  ? -26.562 24.650  38.262  1.00 68.34  ?  97  HIS G NE2 1 
ATOM   8028  N  N   . ASP G  1 98  ? -31.788 21.514  41.248  1.00 69.83  ?  98  ASP G N   1 
ATOM   8029  C  CA  . ASP G  1 98  ? -33.014 20.777  41.536  1.00 69.93  ?  98  ASP G CA  1 
ATOM   8030  C  C   . ASP G  1 98  ? -33.302 20.541  43.028  1.00 69.95  ?  98  ASP G C   1 
ATOM   8031  O  O   . ASP G  1 98  ? -32.392 20.237  43.808  1.00 69.92  ?  98  ASP G O   1 
ATOM   8032  C  CB  . ASP G  1 98  ? -32.988 19.441  40.803  1.00 69.93  ?  98  ASP G CB  1 
ATOM   8033  C  CG  . ASP G  1 98  ? -34.362 18.957  40.452  1.00 69.80  ?  98  ASP G CG  1 
ATOM   8034  O  OD1 . ASP G  1 98  ? -35.334 19.487  41.020  1.00 70.02  ?  98  ASP G OD1 1 
ATOM   8035  O  OD2 . ASP G  1 98  ? -34.478 18.052  39.605  1.00 70.43  -1 98  ASP G OD2 1 
ATOM   8036  N  N   . SER G  1 99  ? -34.580 20.696  43.393  1.00 70.01  ?  99  SER G N   1 
ATOM   8037  C  CA  . SER G  1 99  ? -35.116 20.366  44.728  1.00 69.98  ?  99  SER G CA  1 
ATOM   8038  C  C   . SER G  1 99  ? -34.657 18.973  45.126  1.00 69.67  ?  99  SER G C   1 
ATOM   8039  O  O   . SER G  1 99  ? -33.993 18.791  46.155  1.00 69.71  ?  99  SER G O   1 
ATOM   8040  C  CB  . SER G  1 99  ? -36.666 20.349  44.734  1.00 70.13  ?  99  SER G CB  1 
ATOM   8041  O  OG  . SER G  1 99  ? -37.272 21.635  44.737  1.00 70.59  ?  99  SER G OG  1 
ATOM   8042  N  N   . ASP G  1 100 ? -35.012 18.010  44.272  1.00 69.01  ?  100 ASP G N   1 
ATOM   8043  C  CA  . ASP G  1 100 ? -34.829 16.578  44.505  1.00 68.35  ?  100 ASP G CA  1 
ATOM   8044  C  C   . ASP G  1 100 ? -33.435 16.166  44.961  1.00 67.30  ?  100 ASP G C   1 
ATOM   8045  O  O   . ASP G  1 100 ? -33.289 15.302  45.819  1.00 67.06  ?  100 ASP G O   1 
ATOM   8046  C  CB  . ASP G  1 100 ? -35.206 15.804  43.244  1.00 68.69  ?  100 ASP G CB  1 
ATOM   8047  C  CG  . ASP G  1 100 ? -36.623 16.086  42.787  1.00 69.93  ?  100 ASP G CG  1 
ATOM   8048  O  OD1 . ASP G  1 100 ? -36.808 16.283  41.566  1.00 70.72  ?  100 ASP G OD1 1 
ATOM   8049  O  OD2 . ASP G  1 100 ? -37.546 16.114  43.642  1.00 71.81  -1 100 ASP G OD2 1 
ATOM   8050  N  N   . ILE G  1 101 ? -32.419 16.787  44.389  1.00 66.39  ?  101 ILE G N   1 
ATOM   8051  C  CA  . ILE G  1 101 ? -31.060 16.422  44.720  1.00 65.91  ?  101 ILE G CA  1 
ATOM   8052  C  C   . ILE G  1 101 ? -30.595 17.179  45.938  1.00 65.73  ?  101 ILE G C   1 
ATOM   8053  O  O   . ILE G  1 101 ? -30.623 18.416  45.948  1.00 66.22  ?  101 ILE G O   1 
ATOM   8054  C  CB  . ILE G  1 101 ? -30.100 16.664  43.542  1.00 65.79  ?  101 ILE G CB  1 
ATOM   8055  C  CG1 . ILE G  1 101 ? -30.474 15.747  42.367  1.00 65.06  ?  101 ILE G CG1 1 
ATOM   8056  C  CG2 . ILE G  1 101 ? -28.628 16.502  43.986  1.00 65.47  ?  101 ILE G CG2 1 
ATOM   8057  C  CD1 . ILE G  1 101 ? -30.595 14.259  42.710  1.00 63.19  ?  101 ILE G CD1 1 
ATOM   8058  N  N   . ASP G  1 102 ? -30.177 16.429  46.959  1.00 65.22  ?  102 ASP G N   1 
ATOM   8059  C  CA  . ASP G  1 102 ? -29.684 17.015  48.207  1.00 64.89  ?  102 ASP G CA  1 
ATOM   8060  C  C   . ASP G  1 102 ? -28.276 17.591  47.991  1.00 64.85  ?  102 ASP G C   1 
ATOM   8061  O  O   . ASP G  1 102 ? -27.986 18.694  48.440  1.00 64.81  ?  102 ASP G O   1 
ATOM   8062  C  CB  . ASP G  1 102 ? -29.723 16.006  49.375  1.00 64.48  ?  102 ASP G CB  1 
ATOM   8063  C  CG  . ASP G  1 102 ? -31.082 15.305  49.532  1.00 64.14  ?  102 ASP G CG  1 
ATOM   8064  O  OD1 . ASP G  1 102 ? -32.117 15.848  49.099  1.00 64.10  ?  102 ASP G OD1 1 
ATOM   8065  O  OD2 . ASP G  1 102 ? -31.113 14.191  50.098  1.00 62.82  -1 102 ASP G OD2 1 
ATOM   8066  N  N   . CYS G  1 103 ? -27.415 16.835  47.308  1.00 64.71  ?  103 CYS G N   1 
ATOM   8067  C  CA  . CYS G  1 103 ? -26.095 17.300  46.848  1.00 64.96  ?  103 CYS G CA  1 
ATOM   8068  C  C   . CYS G  1 103 ? -25.393 16.123  46.196  1.00 64.41  ?  103 CYS G C   1 
ATOM   8069  O  O   . CYS G  1 103 ? -26.007 15.078  45.985  1.00 64.82  ?  103 CYS G O   1 
ATOM   8070  C  CB  . CYS G  1 103 ? -25.227 17.862  47.984  1.00 65.03  ?  103 CYS G CB  1 
ATOM   8071  S  SG  . CYS G  1 103 ? -24.584 16.580  49.119  1.00 67.90  ?  103 CYS G SG  1 
ATOM   8072  N  N   . CYS G  1 104 ? -24.108 16.283  45.891  1.00 63.85  ?  104 CYS G N   1 
ATOM   8073  C  CA  . CYS G  1 104 ? -23.344 15.232  45.220  1.00 63.00  ?  104 CYS G CA  1 
ATOM   8074  C  C   . CYS G  1 104 ? -22.005 15.097  45.864  1.00 61.90  ?  104 CYS G C   1 
ATOM   8075  O  O   . CYS G  1 104 ? -21.332 16.091  46.108  1.00 61.47  ?  104 CYS G O   1 
ATOM   8076  C  CB  . CYS G  1 104 ? -23.112 15.581  43.742  1.00 63.31  ?  104 CYS G CB  1 
ATOM   8077  S  SG  . CYS G  1 104 ? -24.614 16.024  42.812  1.00 64.64  ?  104 CYS G SG  1 
ATOM   8078  N  N   . ARG G  1 105 ? -21.611 13.866  46.142  1.00 61.01  ?  105 ARG G N   1 
ATOM   8079  C  CA  . ARG G  1 105 ? -20.216 13.630  46.461  1.00 60.15  ?  105 ARG G CA  1 
ATOM   8080  C  C   . ARG G  1 105 ? -19.542 12.757  45.437  1.00 59.05  ?  105 ARG G C   1 
ATOM   8081  O  O   . ARG G  1 105 ? -20.158 11.942  44.757  1.00 58.94  ?  105 ARG G O   1 
ATOM   8082  C  CB  . ARG G  1 105 ? -19.937 13.145  47.908  1.00 60.31  ?  105 ARG G CB  1 
ATOM   8083  C  CG  . ARG G  1 105 ? -21.099 12.635  48.749  1.00 60.93  ?  105 ARG G CG  1 
ATOM   8084  C  CD  . ARG G  1 105 ? -21.978 13.788  49.257  1.00 63.34  ?  105 ARG G CD  1 
ATOM   8085  N  NE  . ARG G  1 105 ? -22.671 13.491  50.511  1.00 64.50  ?  105 ARG G NE  1 
ATOM   8086  C  CZ  . ARG G  1 105 ? -23.401 12.400  50.754  1.00 64.27  ?  105 ARG G CZ  1 
ATOM   8087  N  NH1 . ARG G  1 105 ? -23.542 11.455  49.838  1.00 62.82  ?  105 ARG G NH1 1 
ATOM   8088  N  NH2 . ARG G  1 105 ? -23.987 12.252  51.936  1.00 64.63  ?  105 ARG G NH2 1 
ATOM   8089  N  N   . TRP G  1 106 ? -18.260 13.012  45.310  1.00 57.98  ?  106 TRP G N   1 
ATOM   8090  C  CA  . TRP G  1 106 ? -17.373 12.152  44.612  1.00 57.67  ?  106 TRP G CA  1 
ATOM   8091  C  C   . TRP G  1 106 ? -16.970 11.104  45.596  1.00 56.80  ?  106 TRP G C   1 
ATOM   8092  O  O   . TRP G  1 106 ? -16.728 11.386  46.767  1.00 56.93  ?  106 TRP G O   1 
ATOM   8093  C  CB  . TRP G  1 106 ? -16.178 12.952  44.156  1.00 58.28  ?  106 TRP G CB  1 
ATOM   8094  C  CG  . TRP G  1 106 ? -16.577 13.896  43.085  1.00 60.62  ?  106 TRP G CG  1 
ATOM   8095  C  CD1 . TRP G  1 106 ? -17.301 15.059  43.221  1.00 61.18  ?  106 TRP G CD1 1 
ATOM   8096  C  CD2 . TRP G  1 106 ? -16.323 13.738  41.692  1.00 61.90  ?  106 TRP G CD2 1 
ATOM   8097  N  NE1 . TRP G  1 106 ? -17.485 15.636  41.990  1.00 61.10  ?  106 TRP G NE1 1 
ATOM   8098  C  CE2 . TRP G  1 106 ? -16.895 14.848  41.036  1.00 61.53  ?  106 TRP G CE2 1 
ATOM   8099  C  CE3 . TRP G  1 106 ? -15.649 12.770  40.933  1.00 62.29  ?  106 TRP G CE3 1 
ATOM   8100  C  CZ2 . TRP G  1 106 ? -16.811 15.018  39.655  1.00 62.50  ?  106 TRP G CZ2 1 
ATOM   8101  C  CZ3 . TRP G  1 106 ? -15.569 12.940  39.562  1.00 63.52  ?  106 TRP G CZ3 1 
ATOM   8102  C  CH2 . TRP G  1 106 ? -16.142 14.060  38.935  1.00 62.60  ?  106 TRP G CH2 1 
ATOM   8103  N  N   . VAL G  1 107 ? -16.911 9.876   45.116  1.00 55.74  ?  107 VAL G N   1 
ATOM   8104  C  CA  . VAL G  1 107 ? -16.784 8.725   45.982  1.00 54.02  ?  107 VAL G CA  1 
ATOM   8105  C  C   . VAL G  1 107 ? -15.836 7.736   45.314  1.00 52.82  ?  107 VAL G C   1 
ATOM   8106  O  O   . VAL G  1 107 ? -15.635 7.825   44.111  1.00 52.84  ?  107 VAL G O   1 
ATOM   8107  C  CB  . VAL G  1 107 ? -18.151 8.150   46.211  1.00 53.86  ?  107 VAL G CB  1 
ATOM   8108  C  CG1 . VAL G  1 107 ? -18.051 6.828   46.861  1.00 55.29  ?  107 VAL G CG1 1 
ATOM   8109  C  CG2 . VAL G  1 107 ? -18.939 9.090   47.082  1.00 53.60  ?  107 VAL G CG2 1 
ATOM   8110  N  N   . SER G  1 108 ? -15.222 6.841   46.090  1.00 51.32  ?  108 SER G N   1 
ATOM   8111  C  CA  . SER G  1 108 ? -14.329 5.812   45.543  1.00 49.93  ?  108 SER G CA  1 
ATOM   8112  C  C   . SER G  1 108 ? -15.144 4.629   45.046  1.00 49.07  ?  108 SER G C   1 
ATOM   8113  O  O   . SER G  1 108 ? -16.276 4.421   45.490  1.00 48.52  ?  108 SER G O   1 
ATOM   8114  C  CB  . SER G  1 108 ? -13.401 5.292   46.623  1.00 49.91  ?  108 SER G CB  1 
ATOM   8115  O  OG  . SER G  1 108 ? -14.137 4.448   47.497  1.00 49.25  ?  108 SER G OG  1 
ATOM   8116  N  N   . ALA G  1 109 ? -14.547 3.835   44.159  1.00 48.47  ?  109 ALA G N   1 
ATOM   8117  C  CA  . ALA G  1 109 ? -15.196 2.619   43.638  1.00 48.07  ?  109 ALA G CA  1 
ATOM   8118  C  C   . ALA G  1 109 ? -15.697 1.731   44.767  1.00 47.53  ?  109 ALA G C   1 
ATOM   8119  O  O   . ALA G  1 109 ? -16.895 1.451   44.871  1.00 47.27  ?  109 ALA G O   1 
ATOM   8120  C  CB  . ALA G  1 109 ? -14.239 1.850   42.748  1.00 47.94  ?  109 ALA G CB  1 
ATOM   8121  N  N   . GLU G  1 110 ? -14.767 1.338   45.634  1.00 47.16  ?  110 GLU G N   1 
ATOM   8122  C  CA  . GLU G  1 110 ? -15.038 0.400   46.723  1.00 47.53  ?  110 GLU G CA  1 
ATOM   8123  C  C   . GLU G  1 110 ? -16.112 0.884   47.701  1.00 46.72  ?  110 GLU G C   1 
ATOM   8124  O  O   . GLU G  1 110 ? -16.942 0.096   48.138  1.00 47.06  ?  110 GLU G O   1 
ATOM   8125  C  CB  . GLU G  1 110 ? -13.737 -0.045  47.427  1.00 47.94  ?  110 GLU G CB  1 
ATOM   8126  C  CG  . GLU G  1 110 ? -12.729 1.091   47.745  1.00 51.33  ?  110 GLU G CG  1 
ATOM   8127  C  CD  . GLU G  1 110 ? -11.729 1.406   46.606  1.00 53.36  ?  110 GLU G CD  1 
ATOM   8128  O  OE1 . GLU G  1 110 ? -10.497 1.234   46.828  1.00 55.55  ?  110 GLU G OE1 1 
ATOM   8129  O  OE2 . GLU G  1 110 ? -12.160 1.840   45.510  1.00 52.83  -1 110 GLU G OE2 1 
ATOM   8130  N  N   . GLU G  1 111 ? -16.113 2.181   48.000  1.00 46.06  ?  111 GLU G N   1 
ATOM   8131  C  CA  . GLU G  1 111 ? -17.160 2.826   48.803  1.00 45.58  ?  111 GLU G CA  1 
ATOM   8132  C  C   . GLU G  1 111 ? -18.577 2.631   48.269  1.00 45.10  ?  111 GLU G C   1 
ATOM   8133  O  O   . GLU G  1 111 ? -19.492 2.259   49.014  1.00 45.47  ?  111 GLU G O   1 
ATOM   8134  C  CB  . GLU G  1 111 ? -16.893 4.329   48.923  1.00 45.89  ?  111 GLU G CB  1 
ATOM   8135  C  CG  . GLU G  1 111 ? -16.571 4.817   50.333  1.00 46.69  ?  111 GLU G CG  1 
ATOM   8136  C  CD  . GLU G  1 111 ? -17.204 6.171   50.688  1.00 48.12  ?  111 GLU G CD  1 
ATOM   8137  O  OE1 . GLU G  1 111 ? -16.475 7.193   50.568  1.00 47.77  ?  111 GLU G OE1 1 
ATOM   8138  O  OE2 . GLU G  1 111 ? -18.408 6.205   51.094  1.00 47.36  -1 111 GLU G OE2 1 
ATOM   8139  N  N   . ILE G  1 112 ? -18.758 2.901   46.981  1.00 44.44  ?  112 ILE G N   1 
ATOM   8140  C  CA  . ILE G  1 112 ? -20.049 2.729   46.338  1.00 43.48  ?  112 ILE G CA  1 
ATOM   8141  C  C   . ILE G  1 112 ? -20.484 1.279   46.426  1.00 43.31  ?  112 ILE G C   1 
ATOM   8142  O  O   . ILE G  1 112 ? -21.582 0.974   46.920  1.00 43.13  ?  112 ILE G O   1 
ATOM   8143  C  CB  . ILE G  1 112 ? -20.024 3.146   44.832  1.00 43.36  ?  112 ILE G CB  1 
ATOM   8144  C  CG1 . ILE G  1 112 ? -19.292 4.475   44.645  1.00 42.24  ?  112 ILE G CG1 1 
ATOM   8145  C  CG2 . ILE G  1 112 ? -21.446 3.189   44.277  1.00 43.03  ?  112 ILE G CG2 1 
ATOM   8146  C  CD1 . ILE G  1 112 ? -19.782 5.318   43.507  1.00 39.66  ?  112 ILE G CD1 1 
ATOM   8147  N  N   . LEU G  1 113 ? -19.598 0.407   45.947  1.00 42.86  ?  113 LEU G N   1 
ATOM   8148  C  CA  . LEU G  1 113 ? -19.851 -1.020  45.812  1.00 42.96  ?  113 LEU G CA  1 
ATOM   8149  C  C   . LEU G  1 113 ? -20.266 -1.723  47.120  1.00 43.91  ?  113 LEU G C   1 
ATOM   8150  O  O   . LEU G  1 113 ? -20.779 -2.854  47.095  1.00 44.04  ?  113 LEU G O   1 
ATOM   8151  C  CB  . LEU G  1 113 ? -18.597 -1.679  45.232  1.00 42.45  ?  113 LEU G CB  1 
ATOM   8152  C  CG  . LEU G  1 113 ? -18.538 -2.077  43.751  1.00 41.03  ?  113 LEU G CG  1 
ATOM   8153  C  CD1 . LEU G  1 113 ? -19.386 -1.215  42.880  1.00 38.82  ?  113 LEU G CD1 1 
ATOM   8154  C  CD2 . LEU G  1 113 ? -17.125 -2.135  43.220  1.00 38.98  ?  113 LEU G CD2 1 
ATOM   8155  N  N   . GLN G  1 114 ? -20.059 -1.053  48.254  1.00 44.68  ?  114 GLN G N   1 
ATOM   8156  C  CA  . GLN G  1 114 ? -20.299 -1.676  49.555  1.00 45.93  ?  114 GLN G CA  1 
ATOM   8157  C  C   . GLN G  1 114 ? -21.411 -1.019  50.436  1.00 45.82  ?  114 GLN G C   1 
ATOM   8158  O  O   . GLN G  1 114 ? -21.564 -1.351  51.620  1.00 45.49  ?  114 GLN G O   1 
ATOM   8159  C  CB  . GLN G  1 114 ? -18.966 -1.775  50.318  1.00 46.23  ?  114 GLN G CB  1 
ATOM   8160  C  CG  . GLN G  1 114 ? -18.891 -2.929  51.332  1.00 47.96  ?  114 GLN G CG  1 
ATOM   8161  C  CD  . GLN G  1 114 ? -18.088 -4.143  50.843  1.00 49.95  ?  114 GLN G CD  1 
ATOM   8162  O  OE1 . GLN G  1 114 ? -17.228 -4.024  49.946  1.00 50.55  ?  114 GLN G OE1 1 
ATOM   8163  N  NE2 . GLN G  1 114 ? -18.344 -5.312  51.458  1.00 48.01  ?  114 GLN G NE2 1 
ATOM   8164  N  N   . ALA G  1 115 ? -22.193 -0.109  49.865  1.00 45.37  ?  115 ALA G N   1 
ATOM   8165  C  CA  . ALA G  1 115 ? -23.098 0.679   50.693  1.00 44.89  ?  115 ALA G CA  1 
ATOM   8166  C  C   . ALA G  1 115 ? -24.483 0.103   50.783  1.00 44.79  ?  115 ALA G C   1 
ATOM   8167  O  O   . ALA G  1 115 ? -24.953 -0.604  49.893  1.00 44.90  ?  115 ALA G O   1 
ATOM   8168  C  CB  . ALA G  1 115 ? -23.153 2.113   50.214  1.00 44.83  ?  115 ALA G CB  1 
ATOM   8169  N  N   . SER G  1 116 ? -25.143 0.415   51.880  1.00 45.07  ?  116 SER G N   1 
ATOM   8170  C  CA  . SER G  1 116 ? -26.528 0.031   52.040  1.00 45.39  ?  116 SER G CA  1 
ATOM   8171  C  C   . SER G  1 116 ? -27.465 1.097   51.489  1.00 45.17  ?  116 SER G C   1 
ATOM   8172  O  O   . SER G  1 116 ? -28.680 0.911   51.591  1.00 45.85  ?  116 SER G O   1 
ATOM   8173  C  CB  . SER G  1 116 ? -26.874 -0.290  53.513  1.00 45.92  ?  116 SER G CB  1 
ATOM   8174  O  OG  . SER G  1 116 ? -26.678 0.825   54.389  1.00 47.60  ?  116 SER G OG  1 
ATOM   8175  N  N   . ASN G  1 117 ? -26.947 2.200   50.917  1.00 44.04  ?  117 ASN G N   1 
ATOM   8176  C  CA  . ASN G  1 117 ? -27.884 3.195   50.323  1.00 43.35  ?  117 ASN G CA  1 
ATOM   8177  C  C   . ASN G  1 117 ? -27.923 3.417   48.793  1.00 42.94  ?  117 ASN G C   1 
ATOM   8178  O  O   . ASN G  1 117 ? -28.435 4.438   48.329  1.00 43.25  ?  117 ASN G O   1 
ATOM   8179  C  CB  . ASN G  1 117 ? -27.865 4.536   51.069  1.00 43.11  ?  117 ASN G CB  1 
ATOM   8180  C  CG  . ASN G  1 117 ? -26.672 5.379   50.733  1.00 43.11  ?  117 ASN G CG  1 
ATOM   8181  O  OD1 . ASN G  1 117 ? -25.541 4.878   50.658  1.00 43.74  ?  117 ASN G OD1 1 
ATOM   8182  N  ND2 . ASN G  1 117 ? -26.906 6.684   50.544  1.00 41.04  ?  117 ASN G ND2 1 
ATOM   8183  N  N   . LEU G  1 118 ? -27.427 2.461   48.009  1.00 42.22  ?  118 LEU G N   1 
ATOM   8184  C  CA  . LEU G  1 118 ? -27.472 2.571   46.557  1.00 40.68  ?  118 LEU G CA  1 
ATOM   8185  C  C   . LEU G  1 118 ? -28.915 2.516   46.139  1.00 40.63  ?  118 LEU G C   1 
ATOM   8186  O  O   . LEU G  1 118 ? -29.644 1.625   46.562  1.00 40.88  ?  118 LEU G O   1 
ATOM   8187  C  CB  . LEU G  1 118 ? -26.665 1.460   45.916  1.00 40.32  ?  118 LEU G CB  1 
ATOM   8188  C  CG  . LEU G  1 118 ? -25.252 1.428   46.487  1.00 40.30  ?  118 LEU G CG  1 
ATOM   8189  C  CD1 . LEU G  1 118 ? -24.465 0.225   45.988  1.00 38.85  ?  118 LEU G CD1 1 
ATOM   8190  C  CD2 . LEU G  1 118 ? -24.508 2.753   46.218  1.00 39.74  ?  118 LEU G CD2 1 
ATOM   8191  N  N   . ARG G  1 119 ? -29.338 3.506   45.355  1.00 40.13  ?  119 ARG G N   1 
ATOM   8192  C  CA  . ARG G  1 119 ? -30.732 3.655   44.962  1.00 39.76  ?  119 ARG G CA  1 
ATOM   8193  C  C   . ARG G  1 119 ? -31.296 2.381   44.321  1.00 38.79  ?  119 ARG G C   1 
ATOM   8194  O  O   . ARG G  1 119 ? -32.428 1.975   44.602  1.00 38.41  ?  119 ARG G O   1 
ATOM   8195  C  CB  . ARG G  1 119 ? -30.885 4.874   44.025  1.00 40.68  ?  119 ARG G CB  1 
ATOM   8196  C  CG  . ARG G  1 119 ? -32.278 5.052   43.378  1.00 42.80  ?  119 ARG G CG  1 
ATOM   8197  C  CD  . ARG G  1 119 ? -33.189 6.011   44.141  1.00 48.29  ?  119 ARG G CD  1 
ATOM   8198  N  NE  . ARG G  1 119 ? -34.261 6.523   43.275  1.00 53.25  ?  119 ARG G NE  1 
ATOM   8199  C  CZ  . ARG G  1 119 ? -34.086 7.454   42.324  1.00 55.78  ?  119 ARG G CZ  1 
ATOM   8200  N  NH1 . ARG G  1 119 ? -32.874 7.995   42.114  1.00 55.89  ?  119 ARG G NH1 1 
ATOM   8201  N  NH2 . ARG G  1 119 ? -35.121 7.849   41.577  1.00 54.25  ?  119 ARG G NH2 1 
ATOM   8202  N  N   . SER G  1 120 ? -30.517 1.766   43.439  1.00 37.37  ?  120 SER G N   1 
ATOM   8203  C  CA  . SER G  1 120 ? -30.987 0.576   42.763  1.00 37.02  ?  120 SER G CA  1 
ATOM   8204  C  C   . SER G  1 120 ? -29.842 -0.382  42.596  1.00 35.86  ?  120 SER G C   1 
ATOM   8205  O  O   . SER G  1 120 ? -28.673 0.023   42.688  1.00 35.86  ?  120 SER G O   1 
ATOM   8206  C  CB  . SER G  1 120 ? -31.725 0.868   41.411  1.00 37.44  ?  120 SER G CB  1 
ATOM   8207  O  OG  . SER G  1 120 ? -30.944 1.604   40.471  1.00 38.57  ?  120 SER G OG  1 
ATOM   8208  N  N   . PRO G  1 121 ? -30.185 -1.659  42.379  1.00 34.67  ?  121 PRO G N   1 
ATOM   8209  C  CA  . PRO G  1 121 ? -29.278 -2.713  41.955  1.00 34.34  ?  121 PRO G CA  1 
ATOM   8210  C  C   . PRO G  1 121 ? -28.446 -2.246  40.756  1.00 33.86  ?  121 PRO G C   1 
ATOM   8211  O  O   . PRO G  1 121 ? -27.370 -2.780  40.526  1.00 33.88  ?  121 PRO G O   1 
ATOM   8212  C  CB  . PRO G  1 121 ? -30.233 -3.832  41.507  1.00 34.25  ?  121 PRO G CB  1 
ATOM   8213  C  CG  . PRO G  1 121 ? -31.494 -3.594  42.276  1.00 34.11  ?  121 PRO G CG  1 
ATOM   8214  C  CD  . PRO G  1 121 ? -31.590 -2.113  42.451  1.00 34.58  ?  121 PRO G CD  1 
ATOM   8215  N  N   . LEU G  1 122 ? -28.940 -1.235  40.032  1.00 33.11  ?  122 LEU G N   1 
ATOM   8216  C  CA  . LEU G  1 122 ? -28.266 -0.745  38.841  1.00 33.07  ?  122 LEU G CA  1 
ATOM   8217  C  C   . LEU G  1 122 ? -26.996 0.063   39.097  1.00 32.88  ?  122 LEU G C   1 
ATOM   8218  O  O   . LEU G  1 122 ? -26.157 0.170   38.189  1.00 32.34  ?  122 LEU G O   1 
ATOM   8219  C  CB  . LEU G  1 122 ? -29.227 -0.001  37.889  1.00 32.77  ?  122 LEU G CB  1 
ATOM   8220  C  CG  . LEU G  1 122 ? -30.033 -0.997  37.034  1.00 32.73  ?  122 LEU G CG  1 
ATOM   8221  C  CD1 . LEU G  1 122 ? -31.247 -0.414  36.233  1.00 31.18  ?  122 LEU G CD1 1 
ATOM   8222  C  CD2 . LEU G  1 122 ? -29.102 -1.831  36.155  1.00 27.61  ?  122 LEU G CD2 1 
ATOM   8223  N  N   . VAL G  1 123 ? -26.852 0.593   40.322  1.00 32.14  ?  123 VAL G N   1 
ATOM   8224  C  CA  . VAL G  1 123 ? -25.788 1.583   40.655  1.00 31.11  ?  123 VAL G CA  1 
ATOM   8225  C  C   . VAL G  1 123 ? -24.405 0.937   40.815  1.00 30.55  ?  123 VAL G C   1 
ATOM   8226  O  O   . VAL G  1 123 ? -23.407 1.388   40.246  1.00 30.56  ?  123 VAL G O   1 
ATOM   8227  C  CB  . VAL G  1 123 ? -26.175 2.410   41.924  1.00 31.20  ?  123 VAL G CB  1 
ATOM   8228  C  CG1 . VAL G  1 123 ? -25.144 3.482   42.255  1.00 29.69  ?  123 VAL G CG1 1 
ATOM   8229  C  CG2 . VAL G  1 123 ? -27.537 3.053   41.723  1.00 30.42  ?  123 VAL G CG2 1 
ATOM   8230  N  N   . ALA G  1 124 ? -24.359 -0.129  41.597  1.00 30.44  ?  124 ALA G N   1 
ATOM   8231  C  CA  . ALA G  1 124 ? -23.176 -0.974  41.683  1.00 29.74  ?  124 ALA G CA  1 
ATOM   8232  C  C   . ALA G  1 124 ? -22.892 -1.593  40.311  1.00 29.37  ?  124 ALA G C   1 
ATOM   8233  O  O   . ALA G  1 124 ? -21.766 -1.522  39.809  1.00 29.67  ?  124 ALA G O   1 
ATOM   8234  C  CB  . ALA G  1 124 ? -23.402 -2.065  42.717  1.00 28.84  ?  124 ALA G CB  1 
ATOM   8235  N  N   . GLU G  1 125 ? -23.911 -2.210  39.708  1.00 29.19  ?  125 GLU G N   1 
ATOM   8236  C  CA  . GLU G  1 125 ? -23.735 -2.837  38.392  1.00 29.58  ?  125 GLU G CA  1 
ATOM   8237  C  C   . GLU G  1 125 ? -23.078 -1.846  37.406  1.00 29.15  ?  125 GLU G C   1 
ATOM   8238  O  O   . GLU G  1 125 ? -22.053 -2.157  36.758  1.00 28.16  ?  125 GLU G O   1 
ATOM   8239  C  CB  . GLU G  1 125 ? -25.066 -3.390  37.856  1.00 29.43  ?  125 GLU G CB  1 
ATOM   8240  C  CG  . GLU G  1 125 ? -24.910 -4.281  36.620  1.00 31.40  ?  125 GLU G CG  1 
ATOM   8241  C  CD  . GLU G  1 125 ? -23.979 -5.526  36.812  1.00 35.19  ?  125 GLU G CD  1 
ATOM   8242  O  OE1 . GLU G  1 125 ? -23.564 -6.115  35.773  1.00 35.11  ?  125 GLU G OE1 1 
ATOM   8243  O  OE2 . GLU G  1 125 ? -23.678 -5.931  37.978  1.00 35.70  -1 125 GLU G OE2 1 
ATOM   8244  N  N   . SER G  1 126 ? -23.648 -0.641  37.364  1.00 28.72  ?  126 SER G N   1 
ATOM   8245  C  CA  . SER G  1 126 ? -23.085 0.453   36.611  1.00 29.32  ?  126 SER G CA  1 
ATOM   8246  C  C   . SER G  1 126 ? -21.603 0.634   36.858  1.00 29.83  ?  126 SER G C   1 
ATOM   8247  O  O   . SER G  1 126 ? -20.854 0.723   35.890  1.00 29.80  ?  126 SER G O   1 
ATOM   8248  C  CB  . SER G  1 126 ? -23.865 1.738   36.852  1.00 30.32  ?  126 SER G CB  1 
ATOM   8249  O  OG  . SER G  1 126 ? -25.144 1.742   36.185  1.00 30.31  ?  126 SER G OG  1 
ATOM   8250  N  N   . ILE G  1 127 ? -21.147 0.653   38.117  1.00 30.85  ?  127 ILE G N   1 
ATOM   8251  C  CA  . ILE G  1 127 ? -19.682 0.753   38.347  1.00 31.81  ?  127 ILE G CA  1 
ATOM   8252  C  C   . ILE G  1 127 ? -18.965 -0.482  37.848  1.00 31.98  ?  127 ILE G C   1 
ATOM   8253  O  O   . ILE G  1 127 ? -17.917 -0.383  37.220  1.00 31.96  ?  127 ILE G O   1 
ATOM   8254  C  CB  . ILE G  1 127 ? -19.244 1.090   39.828  1.00 32.28  ?  127 ILE G CB  1 
ATOM   8255  C  CG1 . ILE G  1 127 ? -19.121 2.608   40.052  1.00 33.56  ?  127 ILE G CG1 1 
ATOM   8256  C  CG2 . ILE G  1 127 ? -17.810 0.655   40.080  1.00 31.32  ?  127 ILE G CG2 1 
ATOM   8257  C  CD1 . ILE G  1 127 ? -20.453 3.370   40.054  1.00 38.29  ?  127 ILE G CD1 1 
ATOM   8258  N  N   . ARG G  1 128 ? -19.542 -1.652  38.108  1.00 32.89  ?  128 ARG G N   1 
ATOM   8259  C  CA  . ARG G  1 128 ? -18.929 -2.904  37.632  1.00 33.04  ?  128 ARG G CA  1 
ATOM   8260  C  C   . ARG G  1 128 ? -18.815 -2.939  36.106  1.00 32.55  ?  128 ARG G C   1 
ATOM   8261  O  O   . ARG G  1 128 ? -17.778 -3.363  35.524  1.00 32.82  ?  128 ARG G O   1 
ATOM   8262  C  CB  . ARG G  1 128 ? -19.675 -4.119  38.173  1.00 32.90  ?  128 ARG G CB  1 
ATOM   8263  C  CG  . ARG G  1 128 ? -19.143 -4.527  39.532  1.00 34.79  ?  128 ARG G CG  1 
ATOM   8264  C  CD  . ARG G  1 128 ? -19.717 -5.839  39.972  1.00 33.54  ?  128 ARG G CD  1 
ATOM   8265  N  NE  . ARG G  1 128 ? -21.162 -5.730  40.059  1.00 31.31  ?  128 ARG G NE  1 
ATOM   8266  C  CZ  . ARG G  1 128 ? -21.829 -5.523  41.188  1.00 30.25  ?  128 ARG G CZ  1 
ATOM   8267  N  NH1 . ARG G  1 128 ? -21.184 -5.405  42.375  1.00 28.10  ?  128 ARG G NH1 1 
ATOM   8268  N  NH2 . ARG G  1 128 ? -23.153 -5.444  41.117  1.00 27.14  ?  128 ARG G NH2 1 
ATOM   8269  N  N   . CYS G  1 129 ? -19.873 -2.452  35.470  1.00 31.57  ?  129 CYS G N   1 
ATOM   8270  C  CA  . CYS G  1 129 ? -19.865 -2.309  34.021  1.00 30.89  ?  129 CYS G CA  1 
ATOM   8271  C  C   . CYS G  1 129 ? -18.693 -1.446  33.605  1.00 30.08  ?  129 CYS G C   1 
ATOM   8272  O  O   . CYS G  1 129 ? -17.964 -1.828  32.722  1.00 29.17  ?  129 CYS G O   1 
ATOM   8273  C  CB  . CYS G  1 129 ? -21.203 -1.760  33.492  1.00 30.07  ?  129 CYS G CB  1 
ATOM   8274  S  SG  . CYS G  1 129 ? -22.449 -3.091  33.299  1.00 29.43  ?  129 CYS G SG  1 
ATOM   8275  N  N   . TYR G  1 130 ? -18.523 -0.301  34.262  1.00 29.89  ?  130 TYR G N   1 
ATOM   8276  C  CA  . TYR G  1 130 ? -17.564 0.690   33.815  1.00 30.32  ?  130 TYR G CA  1 
ATOM   8277  C  C   . TYR G  1 130 ? -16.173 0.151   34.049  1.00 31.04  ?  130 TYR G C   1 
ATOM   8278  O  O   . TYR G  1 130 ? -15.333 0.179   33.178  1.00 31.32  ?  130 TYR G O   1 
ATOM   8279  C  CB  . TYR G  1 130 ? -17.736 2.038   34.551  1.00 30.24  ?  130 TYR G CB  1 
ATOM   8280  C  CG  . TYR G  1 130 ? -16.490 2.873   34.436  1.00 30.29  ?  130 TYR G CG  1 
ATOM   8281  C  CD1 . TYR G  1 130 ? -16.297 3.738   33.366  1.00 28.07  ?  130 TYR G CD1 1 
ATOM   8282  C  CD2 . TYR G  1 130 ? -15.453 2.714   35.340  1.00 31.14  ?  130 TYR G CD2 1 
ATOM   8283  C  CE1 . TYR G  1 130 ? -15.125 4.448   33.228  1.00 26.15  ?  130 TYR G CE1 1 
ATOM   8284  C  CE2 . TYR G  1 130 ? -14.289 3.406   35.202  1.00 32.24  ?  130 TYR G CE2 1 
ATOM   8285  C  CZ  . TYR G  1 130 ? -14.131 4.290   34.142  1.00 30.04  ?  130 TYR G CZ  1 
ATOM   8286  O  OH  . TYR G  1 130 ? -12.940 4.983   34.039  1.00 31.60  ?  130 TYR G OH  1 
ATOM   8287  N  N   . GLN G  1 131 ? -15.950 -0.360  35.251  1.00 32.58  ?  131 GLN G N   1 
ATOM   8288  C  CA  . GLN G  1 131 ? -14.687 -0.954  35.651  1.00 33.45  ?  131 GLN G CA  1 
ATOM   8289  C  C   . GLN G  1 131 ? -14.224 -2.074  34.739  1.00 33.58  ?  131 GLN G C   1 
ATOM   8290  O  O   . GLN G  1 131 ? -13.025 -2.340  34.622  1.00 33.61  ?  131 GLN G O   1 
ATOM   8291  C  CB  . GLN G  1 131 ? -14.842 -1.496  37.055  1.00 33.61  ?  131 GLN G CB  1 
ATOM   8292  C  CG  . GLN G  1 131 ? -14.716 -0.446  38.123  1.00 36.73  ?  131 GLN G CG  1 
ATOM   8293  C  CD  . GLN G  1 131 ? -14.691 -1.033  39.543  1.00 41.10  ?  131 GLN G CD  1 
ATOM   8294  O  OE1 . GLN G  1 131 ? -15.429 -1.983  39.852  1.00 40.27  ?  131 GLN G OE1 1 
ATOM   8295  N  NE2 . GLN G  1 131 ? -13.842 -0.451  40.419  1.00 41.40  ?  131 GLN G NE2 1 
ATOM   8296  N  N   . SER G  1 132 ? -15.178 -2.752  34.109  1.00 34.47  ?  132 SER G N   1 
ATOM   8297  C  CA  . SER G  1 132 ? -14.850 -3.881  33.253  1.00 35.30  ?  132 SER G CA  1 
ATOM   8298  C  C   . SER G  1 132 ? -13.975 -3.401  32.100  1.00 36.25  ?  132 SER G C   1 
ATOM   8299  O  O   . SER G  1 132 ? -13.203 -4.182  31.507  1.00 36.24  ?  132 SER G O   1 
ATOM   8300  C  CB  . SER G  1 132 ? -16.117 -4.525  32.727  1.00 34.82  ?  132 SER G CB  1 
ATOM   8301  O  OG  . SER G  1 132 ? -16.648 -3.727  31.703  1.00 34.26  ?  132 SER G OG  1 
ATOM   8302  N  N   . GLY G  1 133 ? -14.108 -2.103  31.794  1.00 36.66  ?  133 GLY G N   1 
ATOM   8303  C  CA  . GLY G  1 133 ? -13.341 -1.470  30.733  1.00 36.32  ?  133 GLY G CA  1 
ATOM   8304  C  C   . GLY G  1 133 ? -14.063 -1.592  29.410  1.00 36.52  ?  133 GLY G C   1 
ATOM   8305  O  O   . GLY G  1 133 ? -13.504 -1.283  28.372  1.00 37.54  ?  133 GLY G O   1 
ATOM   8306  N  N   . GLN G  1 134 ? -15.307 -2.045  29.437  1.00 35.85  ?  134 GLN G N   1 
ATOM   8307  C  CA  . GLN G  1 134 ? -16.092 -2.129  28.237  1.00 35.36  ?  134 GLN G CA  1 
ATOM   8308  C  C   . GLN G  1 134 ? -16.610 -0.725  27.901  1.00 35.43  ?  134 GLN G C   1 
ATOM   8309  O  O   . GLN G  1 134 ? -17.023 0.028   28.797  1.00 36.01  ?  134 GLN G O   1 
ATOM   8310  C  CB  . GLN G  1 134 ? -17.210 -3.184  28.401  1.00 35.34  ?  134 GLN G CB  1 
ATOM   8311  C  CG  . GLN G  1 134 ? -18.584 -2.706  28.864  1.00 37.20  ?  134 GLN G CG  1 
ATOM   8312  C  CD  . GLN G  1 134 ? -19.718 -3.758  28.677  1.00 39.77  ?  134 GLN G CD  1 
ATOM   8313  O  OE1 . GLN G  1 134 ? -20.484 -3.704  27.714  1.00 40.73  ?  134 GLN G OE1 1 
ATOM   8314  N  NE2 . GLN G  1 134 ? -19.837 -4.683  29.626  1.00 41.58  ?  134 GLN G NE2 1 
ATOM   8315  N  N   . ARG G  1 135 ? -16.531 -0.366  26.624  1.00 35.03  ?  135 ARG G N   1 
ATOM   8316  C  CA  . ARG G  1 135 ? -17.036 0.903   26.099  0.50 34.45  ?  135 ARG G CA  1 
ATOM   8317  C  C   . ARG G  1 135 ? -17.188 0.835   24.583  1.00 35.57  ?  135 ARG G C   1 
ATOM   8318  O  O   . ARG G  1 135 ? -16.393 0.179   23.885  1.00 35.97  ?  135 ARG G O   1 
ATOM   8319  C  CB  . ARG G  1 135 ? -16.149 2.081   26.486  0.50 33.60  ?  135 ARG G CB  1 
ATOM   8320  C  CG  . ARG G  1 135 ? -14.675 1.904   26.245  0.50 30.17  ?  135 ARG G CG  1 
ATOM   8321  C  CD  . ARG G  1 135 ? -13.916 3.009   26.944  0.50 25.23  ?  135 ARG G CD  1 
ATOM   8322  N  NE  . ARG G  1 135 ? -13.405 3.995   26.014  0.50 22.42  ?  135 ARG G NE  1 
ATOM   8323  C  CZ  . ARG G  1 135 ? -12.712 5.073   26.368  0.50 23.02  ?  135 ARG G CZ  1 
ATOM   8324  N  NH1 . ARG G  1 135 ? -12.462 5.346   27.641  0.50 21.61  ?  135 ARG G NH1 1 
ATOM   8325  N  NH2 . ARG G  1 135 ? -12.269 5.897   25.441  0.50 22.37  ?  135 ARG G NH2 1 
ATOM   8326  N  N   . TYR G  1 136 ? -18.223 1.511   24.091  1.00 35.94  ?  136 TYR G N   1 
ATOM   8327  C  CA  . TYR G  1 136 ? -18.581 1.526   22.674  1.00 36.29  ?  136 TYR G CA  1 
ATOM   8328  C  C   . TYR G  1 136 ? -18.867 2.945   22.150  1.00 35.38  ?  136 TYR G C   1 
ATOM   8329  O  O   . TYR G  1 136 ? -19.248 3.832   22.900  1.00 36.26  ?  136 TYR G O   1 
ATOM   8330  C  CB  . TYR G  1 136 ? -19.809 0.645   22.471  1.00 36.97  ?  136 TYR G CB  1 
ATOM   8331  C  CG  . TYR G  1 136 ? -19.603 -0.772  22.955  1.00 40.31  ?  136 TYR G CG  1 
ATOM   8332  C  CD1 . TYR G  1 136 ? -18.767 -1.640  22.253  1.00 43.60  ?  136 TYR G CD1 1 
ATOM   8333  C  CD2 . TYR G  1 136 ? -20.227 -1.241  24.121  1.00 41.38  ?  136 TYR G CD2 1 
ATOM   8334  C  CE1 . TYR G  1 136 ? -18.558 -2.949  22.688  1.00 45.73  ?  136 TYR G CE1 1 
ATOM   8335  C  CE2 . TYR G  1 136 ? -20.029 -2.535  24.568  1.00 43.09  ?  136 TYR G CE2 1 
ATOM   8336  C  CZ  . TYR G  1 136 ? -19.194 -3.395  23.845  1.00 45.89  ?  136 TYR G CZ  1 
ATOM   8337  O  OH  . TYR G  1 136 ? -18.971 -4.701  24.253  1.00 45.21  ?  136 TYR G OH  1 
ATOM   8338  N  N   . PRO G  1 137 ? -18.705 3.162   20.852  1.00 34.25  ?  137 PRO G N   1 
ATOM   8339  C  CA  . PRO G  1 137 ? -18.991 4.455   20.303  1.00 33.39  ?  137 PRO G CA  1 
ATOM   8340  C  C   . PRO G  1 137 ? -20.392 4.890   20.564  1.00 32.91  ?  137 PRO G C   1 
ATOM   8341  O  O   . PRO G  1 137 ? -21.299 4.066   20.611  1.00 32.07  ?  137 PRO G O   1 
ATOM   8342  C  CB  . PRO G  1 137 ? -18.833 4.230   18.810  1.00 33.81  ?  137 PRO G CB  1 
ATOM   8343  C  CG  . PRO G  1 137 ? -18.721 2.767   18.628  1.00 33.93  ?  137 PRO G CG  1 
ATOM   8344  C  CD  . PRO G  1 137 ? -18.096 2.283   19.848  1.00 34.40  ?  137 PRO G CD  1 
ATOM   8345  N  N   . LEU G  1 138 ? -20.557 6.200   20.709  1.00 33.01  ?  138 LEU G N   1 
ATOM   8346  C  CA  . LEU G  1 138 ? -21.875 6.808   20.949  1.00 32.68  ?  138 LEU G CA  1 
ATOM   8347  C  C   . LEU G  1 138 ? -22.890 6.480   19.870  1.00 31.93  ?  138 LEU G C   1 
ATOM   8348  O  O   . LEU G  1 138 ? -24.100 6.530   20.116  1.00 31.60  ?  138 LEU G O   1 
ATOM   8349  C  CB  . LEU G  1 138 ? -21.751 8.330   21.098  1.00 32.60  ?  138 LEU G CB  1 
ATOM   8350  C  CG  . LEU G  1 138 ? -21.047 8.835   22.348  1.00 34.22  ?  138 LEU G CG  1 
ATOM   8351  C  CD1 . LEU G  1 138 ? -20.938 10.340  22.314  1.00 35.58  ?  138 LEU G CD1 1 
ATOM   8352  C  CD2 . LEU G  1 138 ? -21.818 8.384   23.600  1.00 34.79  ?  138 LEU G CD2 1 
ATOM   8353  N  N   . GLU G  1 139 ? -22.407 6.145   18.674  1.00 31.81  ?  139 GLU G N   1 
ATOM   8354  C  CA  . GLU G  1 139 ? -23.325 5.998   17.550  0.50 31.94  ?  139 GLU G CA  1 
ATOM   8355  C  C   . GLU G  1 139 ? -24.231 4.772   17.625  1.00 32.46  ?  139 GLU G C   1 
ATOM   8356  O  O   . GLU G  1 139 ? -25.270 4.756   16.949  1.00 33.52  ?  139 GLU G O   1 
ATOM   8357  C  CB  . GLU G  1 139 ? -22.615 6.134   16.207  0.50 31.46  ?  139 GLU G CB  1 
ATOM   8358  C  CG  . GLU G  1 139 ? -22.084 7.568   15.981  0.50 32.36  ?  139 GLU G CG  1 
ATOM   8359  C  CD  . GLU G  1 139 ? -23.061 8.661   16.476  0.50 31.75  ?  139 GLU G CD  1 
ATOM   8360  O  OE1 . GLU G  1 139 ? -22.707 9.473   17.362  0.50 29.91  ?  139 GLU G OE1 1 
ATOM   8361  O  OE2 . GLU G  1 139 ? -24.199 8.707   15.979  0.50 32.24  -1 139 GLU G OE2 1 
ATOM   8362  N  N   . MET G  1 140 ? -23.869 3.777   18.464  1.00 31.90  ?  140 MET G N   1 
ATOM   8363  C  CA  . MET G  1 140 ? -24.666 2.531   18.666  1.00 30.50  ?  140 MET G CA  1 
ATOM   8364  C  C   . MET G  1 140 ? -26.072 2.856   19.000  1.00 28.77  ?  140 MET G C   1 
ATOM   8365  O  O   . MET G  1 140 ? -26.975 2.102   18.683  1.00 29.31  ?  140 MET G O   1 
ATOM   8366  C  CB  . MET G  1 140 ? -24.185 1.668   19.838  1.00 30.77  ?  140 MET G CB  1 
ATOM   8367  C  CG  . MET G  1 140 ? -22.746 1.206   19.840  1.00 34.50  ?  140 MET G CG  1 
ATOM   8368  S  SD  . MET G  1 140 ? -22.415 -0.069  18.635  1.00 42.00  ?  140 MET G SD  1 
ATOM   8369  C  CE  . MET G  1 140 ? -23.767 -1.161  19.035  1.00 39.62  ?  140 MET G CE  1 
ATOM   8370  N  N   . ILE G  1 141 ? -26.262 3.970   19.668  1.00 27.08  ?  141 ILE G N   1 
ATOM   8371  C  CA  . ILE G  1 141 ? -27.582 4.303   20.142  1.00 26.14  ?  141 ILE G CA  1 
ATOM   8372  C  C   . ILE G  1 141 ? -28.030 5.635   19.540  1.00 25.38  ?  141 ILE G C   1 
ATOM   8373  O  O   . ILE G  1 141 ? -28.803 6.371   20.126  1.00 25.10  ?  141 ILE G O   1 
ATOM   8374  C  CB  . ILE G  1 141 ? -27.648 4.254   21.729  1.00 26.53  ?  141 ILE G CB  1 
ATOM   8375  C  CG1 . ILE G  1 141 ? -26.505 5.024   22.400  1.00 25.07  ?  141 ILE G CG1 1 
ATOM   8376  C  CG2 . ILE G  1 141 ? -27.558 2.834   22.213  1.00 25.87  ?  141 ILE G CG2 1 
ATOM   8377  C  CD1 . ILE G  1 141 ? -26.596 6.502   22.243  1.00 22.72  ?  141 ILE G CD1 1 
ATOM   8378  N  N   . GLY G  1 142 ? -27.563 5.911   18.332  1.00 25.13  ?  142 GLY G N   1 
ATOM   8379  C  CA  . GLY G  1 142 ? -27.652 7.252   17.746  1.00 24.23  ?  142 GLY G CA  1 
ATOM   8380  C  C   . GLY G  1 142 ? -28.974 7.601   17.100  1.00 23.83  ?  142 GLY G C   1 
ATOM   8381  O  O   . GLY G  1 142 ? -29.834 6.723   16.808  1.00 23.15  ?  142 GLY G O   1 
ATOM   8382  N  N   . ASP G  1 143 ? -29.148 8.904   16.906  1.00 23.35  ?  143 ASP G N   1 
ATOM   8383  C  CA  . ASP G  1 143 ? -30.299 9.441   16.196  1.00 23.61  ?  143 ASP G CA  1 
ATOM   8384  C  C   . ASP G  1 143 ? -30.018 9.200   14.719  1.00 23.15  ?  143 ASP G C   1 
ATOM   8385  O  O   . ASP G  1 143 ? -28.859 8.974   14.303  1.00 21.99  ?  143 ASP G O   1 
ATOM   8386  C  CB  . ASP G  1 143 ? -30.449 10.934  16.465  1.00 23.96  ?  143 ASP G CB  1 
ATOM   8387  C  CG  . ASP G  1 143 ? -29.098 11.652  16.504  1.00 26.48  ?  143 ASP G CG  1 
ATOM   8388  O  OD1 . ASP G  1 143 ? -28.378 11.535  17.521  1.00 28.03  ?  143 ASP G OD1 1 
ATOM   8389  O  OD2 . ASP G  1 143 ? -28.737 12.311  15.513  1.00 28.90  -1 143 ASP G OD2 1 
ATOM   8390  N  N   . PHE G  1 144 ? -31.074 9.183   13.930  1.00 22.78  ?  144 PHE G N   1 
ATOM   8391  C  CA  . PHE G  1 144 ? -30.892 8.972   12.513  1.00 22.92  ?  144 PHE G CA  1 
ATOM   8392  C  C   . PHE G  1 144 ? -31.869 9.882   11.819  1.00 23.41  ?  144 PHE G C   1 
ATOM   8393  O  O   . PHE G  1 144 ? -33.072 9.767   12.081  1.00 22.75  ?  144 PHE G O   1 
ATOM   8394  C  CB  . PHE G  1 144 ? -31.178 7.513   12.164  1.00 22.47  ?  144 PHE G CB  1 
ATOM   8395  C  CG  . PHE G  1 144 ? -31.497 7.290   10.718  1.00 20.30  ?  144 PHE G CG  1 
ATOM   8396  C  CD1 . PHE G  1 144 ? -30.460 7.155   9.795   1.00 18.17  ?  144 PHE G CD1 1 
ATOM   8397  C  CD2 . PHE G  1 144 ? -32.831 7.205   10.288  1.00 18.80  ?  144 PHE G CD2 1 
ATOM   8398  C  CE1 . PHE G  1 144 ? -30.725 6.972   8.451   1.00 19.76  ?  144 PHE G CE1 1 
ATOM   8399  C  CE2 . PHE G  1 144 ? -33.153 7.016   8.923   1.00 19.30  ?  144 PHE G CE2 1 
ATOM   8400  C  CZ  . PHE G  1 144 ? -32.090 6.884   8.000   1.00 22.81  ?  144 PHE G CZ  1 
ATOM   8401  N  N   . ASN G  1 145 ? -31.358 10.788  10.970  1.00 24.45  ?  145 ASN G N   1 
ATOM   8402  C  CA  . ASN G  1 145 ? -32.222 11.743  10.247  1.00 25.62  ?  145 ASN G CA  1 
ATOM   8403  C  C   . ASN G  1 145 ? -33.003 12.597  11.215  1.00 26.23  ?  145 ASN G C   1 
ATOM   8404  O  O   . ASN G  1 145 ? -34.229 12.771  11.111  1.00 25.81  ?  145 ASN G O   1 
ATOM   8405  C  CB  . ASN G  1 145 ? -33.209 10.988  9.353   1.00 25.15  ?  145 ASN G CB  1 
ATOM   8406  C  CG  . ASN G  1 145 ? -32.612 10.621  8.015   1.00 25.94  ?  145 ASN G CG  1 
ATOM   8407  O  OD1 . ASN G  1 145 ? -31.378 10.598  7.842   1.00 24.17  ?  145 ASN G OD1 1 
ATOM   8408  N  ND2 . ASN G  1 145 ? -33.489 10.320  7.052   1.00 22.42  ?  145 ASN G ND2 1 
ATOM   8409  N  N   . TRP G  1 146 ? -32.277 13.085  12.199  1.00 27.78  ?  146 TRP G N   1 
ATOM   8410  C  CA  . TRP G  1 146 ? -32.878 13.768  13.308  1.00 29.49  ?  146 TRP G CA  1 
ATOM   8411  C  C   . TRP G  1 146 ? -33.301 15.177  12.849  1.00 31.02  ?  146 TRP G C   1 
ATOM   8412  O  O   . TRP G  1 146 ? -32.510 15.877  12.224  1.00 30.76  ?  146 TRP G O   1 
ATOM   8413  C  CB  . TRP G  1 146 ? -31.840 13.808  14.395  1.00 29.33  ?  146 TRP G CB  1 
ATOM   8414  C  CG  . TRP G  1 146 ? -32.311 14.391  15.624  1.00 31.28  ?  146 TRP G CG  1 
ATOM   8415  C  CD1 . TRP G  1 146 ? -31.906 15.562  16.166  1.00 31.03  ?  146 TRP G CD1 1 
ATOM   8416  C  CD2 . TRP G  1 146 ? -33.284 13.839  16.517  1.00 33.11  ?  146 TRP G CD2 1 
ATOM   8417  N  NE1 . TRP G  1 146 ? -32.573 15.788  17.335  1.00 33.02  ?  146 TRP G NE1 1 
ATOM   8418  C  CE2 . TRP G  1 146 ? -33.415 14.740  17.587  1.00 32.15  ?  146 TRP G CE2 1 
ATOM   8419  C  CE3 . TRP G  1 146 ? -34.053 12.656  16.521  1.00 35.02  ?  146 TRP G CE3 1 
ATOM   8420  C  CZ2 . TRP G  1 146 ? -34.271 14.508  18.664  1.00 33.15  ?  146 TRP G CZ2 1 
ATOM   8421  C  CZ3 . TRP G  1 146 ? -34.927 12.427  17.592  1.00 34.62  ?  146 TRP G CZ3 1 
ATOM   8422  C  CH2 . TRP G  1 146 ? -35.032 13.357  18.644  1.00 34.30  ?  146 TRP G CH2 1 
ATOM   8423  N  N   . PRO G  1 147 ? -34.555 15.578  13.130  1.00 32.54  ?  147 PRO G N   1 
ATOM   8424  C  CA  . PRO G  1 147 ? -35.135 16.807  12.590  1.00 33.96  ?  147 PRO G CA  1 
ATOM   8425  C  C   . PRO G  1 147 ? -34.726 18.126  13.258  1.00 35.73  ?  147 PRO G C   1 
ATOM   8426  O  O   . PRO G  1 147 ? -34.723 19.153  12.577  1.00 36.34  ?  147 PRO G O   1 
ATOM   8427  C  CB  . PRO G  1 147 ? -36.646 16.602  12.758  1.00 33.46  ?  147 PRO G CB  1 
ATOM   8428  C  CG  . PRO G  1 147 ? -36.836 15.332  13.458  1.00 32.99  ?  147 PRO G CG  1 
ATOM   8429  C  CD  . PRO G  1 147 ? -35.522 14.862  13.975  1.00 32.90  ?  147 PRO G CD  1 
ATOM   8430  N  N   . PHE G  1 148 ? -34.423 18.110  14.557  1.00 37.61  ?  148 PHE G N   1 
ATOM   8431  C  CA  . PHE G  1 148 ? -34.174 19.331  15.344  1.00 39.21  ?  148 PHE G CA  1 
ATOM   8432  C  C   . PHE G  1 148 ? -32.691 19.512  15.392  1.00 40.86  ?  148 PHE G C   1 
ATOM   8433  O  O   . PHE G  1 148 ? -31.973 18.538  15.204  1.00 42.06  ?  148 PHE G O   1 
ATOM   8434  C  CB  . PHE G  1 148 ? -34.675 19.132  16.765  1.00 38.82  ?  148 PHE G CB  1 
ATOM   8435  C  CG  . PHE G  1 148 ? -36.066 18.534  16.859  1.00 38.91  ?  148 PHE G CG  1 
ATOM   8436  C  CD1 . PHE G  1 148 ? -36.245 17.200  17.245  1.00 38.23  ?  148 PHE G CD1 1 
ATOM   8437  C  CD2 . PHE G  1 148 ? -37.209 19.307  16.575  1.00 37.32  ?  148 PHE G CD2 1 
ATOM   8438  C  CE1 . PHE G  1 148 ? -37.555 16.639  17.344  1.00 36.14  ?  148 PHE G CE1 1 
ATOM   8439  C  CE2 . PHE G  1 148 ? -38.490 18.762  16.667  1.00 35.13  ?  148 PHE G CE2 1 
ATOM   8440  C  CZ  . PHE G  1 148 ? -38.666 17.432  17.053  1.00 34.56  ?  148 PHE G CZ  1 
ATOM   8441  N  N   . THR G  1 149 ? -32.198 20.715  15.662  1.00 42.70  ?  149 THR G N   1 
ATOM   8442  C  CA  . THR G  1 149 ? -30.741 20.939  15.570  1.00 44.22  ?  149 THR G CA  1 
ATOM   8443  C  C   . THR G  1 149 ? -30.000 20.431  16.774  1.00 45.85  ?  149 THR G C   1 
ATOM   8444  O  O   . THR G  1 149 ? -30.585 20.263  17.828  1.00 46.08  ?  149 THR G O   1 
ATOM   8445  C  CB  . THR G  1 149 ? -30.359 22.424  15.470  1.00 44.72  ?  149 THR G CB  1 
ATOM   8446  O  OG1 . THR G  1 149 ? -31.543 23.245  15.513  1.00 43.21  ?  149 THR G OG1 1 
ATOM   8447  C  CG2 . THR G  1 149 ? -29.373 22.706  14.191  1.00 44.24  ?  149 THR G CG2 1 
ATOM   8448  N  N   . LYS G  1 150 ? -28.703 20.188  16.597  1.00 47.86  ?  150 LYS G N   1 
ATOM   8449  C  CA  . LYS G  1 150 ? -27.771 19.938  17.700  1.00 49.41  ?  150 LYS G CA  1 
ATOM   8450  C  C   . LYS G  1 150 ? -26.403 20.546  17.362  1.00 50.10  ?  150 LYS G C   1 
ATOM   8451  O  O   . LYS G  1 150 ? -26.318 21.657  16.807  1.00 51.15  ?  150 LYS G O   1 
ATOM   8452  C  CB  . LYS G  1 150 ? -27.638 18.439  17.998  1.00 49.84  ?  150 LYS G CB  1 
ATOM   8453  C  CG  . LYS G  1 150 ? -26.459 17.730  17.279  1.00 51.33  ?  150 LYS G CG  1 
ATOM   8454  C  CD  . LYS G  1 150 ? -26.465 16.206  17.538  1.00 52.09  ?  150 LYS G CD  1 
ATOM   8455  C  CE  . LYS G  1 150 ? -27.872 15.577  17.329  1.00 48.99  ?  150 LYS G CE  1 
ATOM   8456  N  NZ  . LYS G  1 150 ? -28.122 15.167  15.928  1.00 46.80  ?  150 LYS G NZ  1 
ATOM   8457  N  N   . MET H  1 1   ? -1.055  -36.776 5.633   1.00 44.18  ?  1   MET H N   1 
ATOM   8458  C  CA  . MET H  1 1   ? -2.453  -36.284 5.730   1.00 44.63  ?  1   MET H CA  1 
ATOM   8459  C  C   . MET H  1 1   ? -2.883  -35.453 4.499   1.00 44.37  ?  1   MET H C   1 
ATOM   8460  O  O   . MET H  1 1   ? -2.040  -34.985 3.717   1.00 44.18  ?  1   MET H O   1 
ATOM   8461  C  CB  . MET H  1 1   ? -2.632  -35.471 7.011   1.00 45.20  ?  1   MET H CB  1 
ATOM   8462  C  CG  . MET H  1 1   ? -2.252  -33.995 6.911   1.00 46.31  ?  1   MET H CG  1 
ATOM   8463  S  SD  . MET H  1 1   ? -0.807  -33.553 7.903   1.00 51.25  ?  1   MET H SD  1 
ATOM   8464  C  CE  . MET H  1 1   ? -1.489  -33.757 9.565   1.00 50.44  ?  1   MET H CE  1 
ATOM   8465  N  N   . PHE H  1 2   ? -4.191  -35.259 4.335   1.00 43.68  ?  2   PHE H N   1 
ATOM   8466  C  CA  . PHE H  1 2   ? -4.684  -34.466 3.211   1.00 43.03  ?  2   PHE H CA  1 
ATOM   8467  C  C   . PHE H  1 2   ? -4.186  -33.046 3.302   1.00 41.80  ?  2   PHE H C   1 
ATOM   8468  O  O   . PHE H  1 2   ? -4.449  -32.386 4.298   1.00 41.95  ?  2   PHE H O   1 
ATOM   8469  C  CB  . PHE H  1 2   ? -6.212  -34.405 3.166   1.00 43.09  ?  2   PHE H CB  1 
ATOM   8470  C  CG  . PHE H  1 2   ? -6.712  -33.413 2.166   1.00 45.66  ?  2   PHE H CG  1 
ATOM   8471  C  CD1 . PHE H  1 2   ? -7.015  -33.812 0.859   1.00 47.14  ?  2   PHE H CD1 1 
ATOM   8472  C  CD2 . PHE H  1 2   ? -6.813  -32.054 2.497   1.00 47.34  ?  2   PHE H CD2 1 
ATOM   8473  C  CE1 . PHE H  1 2   ? -7.460  -32.888 -0.097  1.00 47.18  ?  2   PHE H CE1 1 
ATOM   8474  C  CE2 . PHE H  1 2   ? -7.231  -31.122 1.559   1.00 47.59  ?  2   PHE H CE2 1 
ATOM   8475  C  CZ  . PHE H  1 2   ? -7.557  -31.541 0.252   1.00 48.62  ?  2   PHE H CZ  1 
ATOM   8476  N  N   . LYS H  1 3   ? -3.500  -32.567 2.268   1.00 40.27  ?  3   LYS H N   1 
ATOM   8477  C  CA  . LYS H  1 3   ? -3.163  -31.126 2.149   1.00 38.71  ?  3   LYS H CA  1 
ATOM   8478  C  C   . LYS H  1 3   ? -3.414  -30.630 0.736   1.00 37.75  ?  3   LYS H C   1 
ATOM   8479  O  O   . LYS H  1 3   ? -3.056  -31.305 -0.213  1.00 37.80  ?  3   LYS H O   1 
ATOM   8480  C  CB  . LYS H  1 3   ? -1.719  -30.845 2.524   1.00 38.00  ?  3   LYS H CB  1 
ATOM   8481  C  CG  . LYS H  1 3   ? -1.424  -31.044 3.948   1.00 37.80  ?  3   LYS H CG  1 
ATOM   8482  C  CD  . LYS H  1 3   ? 0.063   -30.841 4.207   1.00 39.68  ?  3   LYS H CD  1 
ATOM   8483  C  CE  . LYS H  1 3   ? 0.928   -31.936 3.626   1.00 39.85  ?  3   LYS H CE  1 
ATOM   8484  N  NZ  . LYS H  1 3   ? 2.268   -31.837 4.280   1.00 41.54  ?  3   LYS H NZ  1 
ATOM   8485  N  N   . PRO H  1 4   ? -4.022  -29.446 0.587   1.00 37.05  ?  4   PRO H N   1 
ATOM   8486  C  CA  . PRO H  1 4   ? -4.455  -29.034 -0.736  1.00 36.70  ?  4   PRO H CA  1 
ATOM   8487  C  C   . PRO H  1 4   ? -3.421  -28.123 -1.372  1.00 36.59  ?  4   PRO H C   1 
ATOM   8488  O  O   . PRO H  1 4   ? -2.538  -27.596 -0.697  1.00 36.20  ?  4   PRO H O   1 
ATOM   8489  C  CB  . PRO H  1 4   ? -5.702  -28.215 -0.427  1.00 36.29  ?  4   PRO H CB  1 
ATOM   8490  C  CG  . PRO H  1 4   ? -5.297  -27.479 0.795   1.00 36.24  ?  4   PRO H CG  1 
ATOM   8491  C  CD  . PRO H  1 4   ? -4.364  -28.421 1.581   1.00 36.73  ?  4   PRO H CD  1 
ATOM   8492  N  N   . HIS H  1 5   ? -3.531  -27.952 -2.673  1.00 36.79  ?  5   HIS H N   1 
ATOM   8493  C  CA  . HIS H  1 5   ? -2.678  -27.042 -3.361  1.00 37.79  ?  5   HIS H CA  1 
ATOM   8494  C  C   . HIS H  1 5   ? -3.093  -25.635 -2.940  1.00 37.61  ?  5   HIS H C   1 
ATOM   8495  O  O   . HIS H  1 5   ? -4.285  -25.286 -2.981  1.00 38.05  ?  5   HIS H O   1 
ATOM   8496  C  CB  . HIS H  1 5   ? -2.858  -27.234 -4.862  1.00 38.37  ?  5   HIS H CB  1 
ATOM   8497  C  CG  . HIS H  1 5   ? -2.012  -28.326 -5.458  1.00 42.35  ?  5   HIS H CG  1 
ATOM   8498  N  ND1 . HIS H  1 5   ? -0.959  -28.073 -6.317  1.00 44.65  ?  5   HIS H ND1 1 
ATOM   8499  C  CD2 . HIS H  1 5   ? -2.086  -29.678 -5.348  1.00 45.21  ?  5   HIS H CD2 1 
ATOM   8500  C  CE1 . HIS H  1 5   ? -0.418  -29.219 -6.698  1.00 46.51  ?  5   HIS H CE1 1 
ATOM   8501  N  NE2 . HIS H  1 5   ? -1.082  -30.208 -6.123  1.00 45.69  ?  5   HIS H NE2 1 
ATOM   8502  N  N   . VAL H  1 6   ? -2.115  -24.824 -2.543  1.00 37.10  ?  6   VAL H N   1 
ATOM   8503  C  CA  . VAL H  1 6   ? -2.378  -23.424 -2.208  1.00 36.75  ?  6   VAL H CA  1 
ATOM   8504  C  C   . VAL H  1 6   ? -1.798  -22.443 -3.247  1.00 36.38  ?  6   VAL H C   1 
ATOM   8505  O  O   . VAL H  1 6   ? -0.583  -22.239 -3.330  1.00 35.97  ?  6   VAL H O   1 
ATOM   8506  C  CB  . VAL H  1 6   ? -1.947  -23.059 -0.745  1.00 36.55  ?  6   VAL H CB  1 
ATOM   8507  C  CG1 . VAL H  1 6   ? -2.156  -21.585 -0.480  1.00 36.99  ?  6   VAL H CG1 1 
ATOM   8508  C  CG2 . VAL H  1 6   ? -2.734  -23.876 0.270   1.00 36.31  ?  6   VAL H CG2 1 
ATOM   8509  N  N   . THR H  1 7   ? -2.688  -21.839 -4.036  1.00 36.06  ?  7   THR H N   1 
ATOM   8510  C  CA  . THR H  1 7   ? -2.275  -20.832 -5.021  1.00 35.88  ?  7   THR H CA  1 
ATOM   8511  C  C   . THR H  1 7   ? -2.764  -19.448 -4.657  1.00 35.68  ?  7   THR H C   1 
ATOM   8512  O  O   . THR H  1 7   ? -3.746  -19.292 -3.900  1.00 36.09  ?  7   THR H O   1 
ATOM   8513  C  CB  . THR H  1 7   ? -2.851  -21.084 -6.411  1.00 35.85  ?  7   THR H CB  1 
ATOM   8514  O  OG1 . THR H  1 7   ? -4.277  -21.202 -6.320  1.00 37.13  ?  7   THR H OG1 1 
ATOM   8515  C  CG2 . THR H  1 7   ? -2.264  -22.313 -7.032  1.00 35.11  ?  7   THR H CG2 1 
ATOM   8516  N  N   . VAL H  1 8   ? -2.084  -18.462 -5.238  1.00 34.36  ?  8   VAL H N   1 
ATOM   8517  C  CA  . VAL H  1 8   ? -2.454  -17.053 -5.174  1.00 33.45  ?  8   VAL H CA  1 
ATOM   8518  C  C   . VAL H  1 8   ? -2.829  -16.639 -6.588  1.00 33.05  ?  8   VAL H C   1 
ATOM   8519  O  O   . VAL H  1 8   ? -2.562  -17.385 -7.521  1.00 33.79  ?  8   VAL H O   1 
ATOM   8520  C  CB  . VAL H  1 8   ? -1.250  -16.198 -4.751  1.00 33.49  ?  8   VAL H CB  1 
ATOM   8521  C  CG1 . VAL H  1 8   ? -0.970  -16.348 -3.243  1.00 32.84  ?  8   VAL H CG1 1 
ATOM   8522  C  CG2 . VAL H  1 8   ? -0.027  -16.572 -5.584  1.00 32.32  ?  8   VAL H CG2 1 
ATOM   8523  N  N   . ALA H  1 9   ? -3.441  -15.469 -6.754  1.00 31.78  ?  9   ALA H N   1 
ATOM   8524  C  CA  . ALA H  1 9   ? -3.638  -14.870 -8.077  1.00 30.52  ?  9   ALA H CA  1 
ATOM   8525  C  C   . ALA H  1 9   ? -3.841  -13.378 -7.914  1.00 29.96  ?  9   ALA H C   1 
ATOM   8526  O  O   . ALA H  1 9   ? -4.014  -12.918 -6.781  1.00 30.59  ?  9   ALA H O   1 
ATOM   8527  C  CB  . ALA H  1 9   ? -4.794  -15.482 -8.755  1.00 30.39  ?  9   ALA H CB  1 
ATOM   8528  N  N   . CYS H  1 10  ? -3.803  -12.616 -9.014  1.00 29.17  ?  10  CYS H N   1 
ATOM   8529  C  CA  . CYS H  1 10  ? -4.037  -11.132 -8.972  1.00 28.68  ?  10  CYS H CA  1 
ATOM   8530  C  C   . CYS H  1 10  ? -4.915  -10.627 -10.083 1.00 27.47  ?  10  CYS H C   1 
ATOM   8531  O  O   . CYS H  1 10  ? -4.671  -10.927 -11.247 1.00 28.08  ?  10  CYS H O   1 
ATOM   8532  C  CB  . CYS H  1 10  ? -2.746  -10.308 -9.005  1.00 28.06  ?  10  CYS H CB  1 
ATOM   8533  S  SG  . CYS H  1 10  ? -1.723  -10.398 -7.504  1.00 31.06  ?  10  CYS H SG  1 
ATOM   8534  N  N   . VAL H  1 11  ? -5.939  -9.879  -9.697  1.00 25.93  ?  11  VAL H N   1 
ATOM   8535  C  CA  . VAL H  1 11  ? -6.684  -9.064  -10.604 1.00 25.22  ?  11  VAL H CA  1 
ATOM   8536  C  C   . VAL H  1 11  ? -5.985  -7.724  -10.574 1.00 24.57  ?  11  VAL H C   1 
ATOM   8537  O  O   . VAL H  1 11  ? -6.059  -7.004  -9.571  1.00 24.32  ?  11  VAL H O   1 
ATOM   8538  C  CB  . VAL H  1 11  ? -8.158  -8.923  -10.142 1.00 25.87  ?  11  VAL H CB  1 
ATOM   8539  C  CG1 . VAL H  1 11  ? -8.839  -7.667  -10.749 1.00 23.15  ?  11  VAL H CG1 1 
ATOM   8540  C  CG2 . VAL H  1 11  ? -8.909  -10.180 -10.475 1.00 25.86  ?  11  VAL H CG2 1 
ATOM   8541  N  N   . VAL H  1 12  ? -5.283  -7.404  -11.656 1.00 23.83  ?  12  VAL H N   1 
ATOM   8542  C  CA  . VAL H  1 12  ? -4.605  -6.099  -11.763 1.00 23.38  ?  12  VAL H CA  1 
ATOM   8543  C  C   . VAL H  1 12  ? -5.372  -5.302  -12.793 1.00 24.50  ?  12  VAL H C   1 
ATOM   8544  O  O   . VAL H  1 12  ? -5.650  -5.787  -13.902 1.00 24.95  ?  12  VAL H O   1 
ATOM   8545  C  CB  . VAL H  1 12  ? -3.130  -6.237  -12.200 1.00 23.23  ?  12  VAL H CB  1 
ATOM   8546  C  CG1 . VAL H  1 12  ? -2.415  -4.931  -12.112 1.00 19.55  ?  12  VAL H CG1 1 
ATOM   8547  C  CG2 . VAL H  1 12  ? -2.413  -7.323  -11.375 1.00 21.32  ?  12  VAL H CG2 1 
ATOM   8548  N  N   . HIS H  1 13  ? -5.746  -4.092  -12.422 1.00 25.52  ?  13  HIS H N   1 
ATOM   8549  C  CA  . HIS H  1 13  ? -6.762  -3.360  -13.160 1.00 26.73  ?  13  HIS H CA  1 
ATOM   8550  C  C   . HIS H  1 13  ? -6.276  -1.940  -13.355 1.00 28.17  ?  13  HIS H C   1 
ATOM   8551  O  O   . HIS H  1 13  ? -5.876  -1.267  -12.381 1.00 28.48  ?  13  HIS H O   1 
ATOM   8552  C  CB  . HIS H  1 13  ? -8.038  -3.372  -12.350 1.00 26.00  ?  13  HIS H CB  1 
ATOM   8553  C  CG  . HIS H  1 13  ? -9.115  -2.483  -12.867 1.00 25.87  ?  13  HIS H CG  1 
ATOM   8554  N  ND1 . HIS H  1 13  ? -9.848  -2.780  -13.993 1.00 25.71  ?  13  HIS H ND1 1 
ATOM   8555  C  CD2 . HIS H  1 13  ? -9.631  -1.333  -12.373 1.00 26.59  ?  13  HIS H CD2 1 
ATOM   8556  C  CE1 . HIS H  1 13  ? -10.759 -1.843  -14.184 1.00 27.19  ?  13  HIS H CE1 1 
ATOM   8557  N  NE2 . HIS H  1 13  ? -10.650 -0.953  -13.211 1.00 26.70  ?  13  HIS H NE2 1 
ATOM   8558  N  N   . ALA H  1 14  ? -6.284  -1.499  -14.613 1.00 29.21  ?  14  ALA H N   1 
ATOM   8559  C  CA  . ALA H  1 14  ? -5.851  -0.144  -14.951 1.00 30.83  ?  14  ALA H CA  1 
ATOM   8560  C  C   . ALA H  1 14  ? -6.576  0.329   -16.194 1.00 31.65  ?  14  ALA H C   1 
ATOM   8561  O  O   . ALA H  1 14  ? -6.775  -0.458  -17.100 1.00 31.55  ?  14  ALA H O   1 
ATOM   8562  C  CB  . ALA H  1 14  ? -4.351  -0.103  -15.158 1.00 30.50  ?  14  ALA H CB  1 
ATOM   8563  N  N   . GLU H  1 15  ? -6.998  1.600   -16.213 1.00 33.15  ?  15  GLU H N   1 
ATOM   8564  C  CA  . GLU H  1 15  ? -7.628  2.218   -17.400 1.00 34.10  ?  15  GLU H CA  1 
ATOM   8565  C  C   . GLU H  1 15  ? -8.676  1.311   -18.036 1.00 33.55  ?  15  GLU H C   1 
ATOM   8566  O  O   . GLU H  1 15  ? -8.689  1.139   -19.252 1.00 34.07  ?  15  GLU H O   1 
ATOM   8567  C  CB  . GLU H  1 15  ? -6.558  2.581   -18.461 1.00 34.57  ?  15  GLU H CB  1 
ATOM   8568  C  CG  . GLU H  1 15  ? -5.661  3.771   -18.096 1.00 38.66  ?  15  GLU H CG  1 
ATOM   8569  C  CD  . GLU H  1 15  ? -4.604  4.100   -19.172 1.00 43.88  ?  15  GLU H CD  1 
ATOM   8570  O  OE1 . GLU H  1 15  ? -4.971  4.491   -20.318 1.00 45.46  ?  15  GLU H OE1 1 
ATOM   8571  O  OE2 . GLU H  1 15  ? -3.396  3.985   -18.854 1.00 44.43  -1 15  GLU H OE2 1 
ATOM   8572  N  N   . GLY H  1 16  ? -9.517  0.698   -17.214 1.00 33.09  ?  16  GLY H N   1 
ATOM   8573  C  CA  . GLY H  1 16  ? -10.600 -0.150  -17.702 1.00 32.65  ?  16  GLY H CA  1 
ATOM   8574  C  C   . GLY H  1 16  ? -10.203 -1.496  -18.302 1.00 32.62  ?  16  GLY H C   1 
ATOM   8575  O  O   . GLY H  1 16  ? -10.976 -2.093  -19.085 1.00 32.54  ?  16  GLY H O   1 
ATOM   8576  N  N   . LYS H  1 17  ? -9.026  -2.001  -17.925 1.00 32.28  ?  17  LYS H N   1 
ATOM   8577  C  CA  . LYS H  1 17  ? -8.550  -3.290  -18.454 1.00 32.32  ?  17  LYS H CA  1 
ATOM   8578  C  C   . LYS H  1 17  ? -7.812  -4.132  -17.426 1.00 31.67  ?  17  LYS H C   1 
ATOM   8579  O  O   . LYS H  1 17  ? -7.263  -3.610  -16.464 1.00 31.11  ?  17  LYS H O   1 
ATOM   8580  C  CB  . LYS H  1 17  ? -7.670  -3.112  -19.710 1.00 32.09  ?  17  LYS H CB  1 
ATOM   8581  C  CG  . LYS H  1 17  ? -7.978  -1.894  -20.544 1.00 33.28  ?  17  LYS H CG  1 
ATOM   8582  C  CD  . LYS H  1 17  ? -7.949  -2.169  -22.038 1.00 35.78  ?  17  LYS H CD  1 
ATOM   8583  C  CE  . LYS H  1 17  ? -9.357  -2.515  -22.536 1.00 37.17  ?  17  LYS H CE  1 
ATOM   8584  N  NZ  . LYS H  1 17  ? -9.429  -2.530  -24.018 1.00 35.57  ?  17  LYS H NZ  1 
ATOM   8585  N  N   . PHE H  1 18  ? -7.793  -5.442  -17.667 1.00 31.57  ?  18  PHE H N   1 
ATOM   8586  C  CA  . PHE H  1 18  ? -7.146  -6.390  -16.775 1.00 31.16  ?  18  PHE H CA  1 
ATOM   8587  C  C   . PHE H  1 18  ? -5.958  -7.142  -17.395 1.00 31.98  ?  18  PHE H C   1 
ATOM   8588  O  O   . PHE H  1 18  ? -5.945  -7.464  -18.595 1.00 31.13  ?  18  PHE H O   1 
ATOM   8589  C  CB  . PHE H  1 18  ? -8.167  -7.367  -16.297 1.00 29.99  ?  18  PHE H CB  1 
ATOM   8590  C  CG  . PHE H  1 18  ? -9.322  -6.726  -15.614 1.00 29.54  ?  18  PHE H CG  1 
ATOM   8591  C  CD1 . PHE H  1 18  ? -9.244  -6.406  -14.243 1.00 24.93  ?  18  PHE H CD1 1 
ATOM   8592  C  CD2 . PHE H  1 18  ? -10.511 -6.454  -16.334 1.00 25.12  ?  18  PHE H CD2 1 
ATOM   8593  C  CE1 . PHE H  1 18  ? -10.311 -5.832  -13.602 1.00 22.46  ?  18  PHE H CE1 1 
ATOM   8594  C  CE2 . PHE H  1 18  ? -11.587 -5.885  -15.701 1.00 25.75  ?  18  PHE H CE2 1 
ATOM   8595  C  CZ  . PHE H  1 18  ? -11.491 -5.561  -14.322 1.00 26.73  ?  18  PHE H CZ  1 
ATOM   8596  N  N   . LEU H  1 19  ? -4.967  -7.395  -16.548 1.00 32.89  ?  19  LEU H N   1 
ATOM   8597  C  CA  . LEU H  1 19  ? -3.698  -7.976  -16.954 1.00 34.40  ?  19  LEU H CA  1 
ATOM   8598  C  C   . LEU H  1 19  ? -3.819  -9.450  -16.911 1.00 35.45  ?  19  LEU H C   1 
ATOM   8599  O  O   . LEU H  1 19  ? -4.066  -10.026 -15.879 1.00 36.54  ?  19  LEU H O   1 
ATOM   8600  C  CB  . LEU H  1 19  ? -2.579  -7.538  -16.008 1.00 34.10  ?  19  LEU H CB  1 
ATOM   8601  C  CG  . LEU H  1 19  ? -1.188  -8.178  -16.120 1.00 34.14  ?  19  LEU H CG  1 
ATOM   8602  C  CD1 . LEU H  1 19  ? -0.767  -8.364  -17.574 1.00 34.20  ?  19  LEU H CD1 1 
ATOM   8603  C  CD2 . LEU H  1 19  ? -0.159  -7.331  -15.357 1.00 32.10  ?  19  LEU H CD2 1 
ATOM   8604  N  N   . VAL H  1 20  ? -3.618  -10.063 -18.052 1.00 37.47  ?  20  VAL H N   1 
ATOM   8605  C  CA  . VAL H  1 20  ? -3.784  -11.486 -18.209 1.00 39.02  ?  20  VAL H CA  1 
ATOM   8606  C  C   . VAL H  1 20  ? -2.490  -12.093 -18.760 1.00 40.23  ?  20  VAL H C   1 
ATOM   8607  O  O   . VAL H  1 20  ? -1.938  -11.588 -19.732 1.00 40.76  ?  20  VAL H O   1 
ATOM   8608  C  CB  . VAL H  1 20  ? -4.954  -11.703 -19.163 1.00 38.75  ?  20  VAL H CB  1 
ATOM   8609  C  CG1 . VAL H  1 20  ? -4.671  -12.818 -20.130 1.00 39.84  ?  20  VAL H CG1 1 
ATOM   8610  C  CG2 . VAL H  1 20  ? -6.257  -11.926 -18.365 1.00 38.77  ?  20  VAL H CG2 1 
ATOM   8611  N  N   . VAL H  1 21  ? -1.981  -13.154 -18.147 1.00 42.40  ?  21  VAL H N   1 
ATOM   8612  C  CA  . VAL H  1 21  ? -0.833  -13.878 -18.754 1.00 44.00  ?  21  VAL H CA  1 
ATOM   8613  C  C   . VAL H  1 21  ? -1.284  -15.040 -19.636 1.00 45.02  ?  21  VAL H C   1 
ATOM   8614  O  O   . VAL H  1 21  ? -2.198  -15.774 -19.273 1.00 44.50  ?  21  VAL H O   1 
ATOM   8615  C  CB  . VAL H  1 21  ? 0.266   -14.321 -17.729 1.00 43.80  ?  21  VAL H CB  1 
ATOM   8616  C  CG1 . VAL H  1 21  ? 0.917   -13.121 -17.113 1.00 43.73  ?  21  VAL H CG1 1 
ATOM   8617  C  CG2 . VAL H  1 21  ? -0.283  -15.206 -16.650 1.00 43.75  ?  21  VAL H CG2 1 
ATOM   8618  N  N   . GLU H  1 22  ? -0.652  -15.162 -20.806 1.00 47.18  ?  22  GLU H N   1 
ATOM   8619  C  CA  . GLU H  1 22  ? -0.941  -16.238 -21.778 1.00 49.26  ?  22  GLU H CA  1 
ATOM   8620  C  C   . GLU H  1 22  ? 0.179   -17.273 -21.803 1.00 50.17  ?  22  GLU H C   1 
ATOM   8621  O  O   . GLU H  1 22  ? 1.348   -16.934 -21.974 1.00 49.72  ?  22  GLU H O   1 
ATOM   8622  C  CB  . GLU H  1 22  ? -1.182  -15.649 -23.181 1.00 49.88  ?  22  GLU H CB  1 
ATOM   8623  C  CG  . GLU H  1 22  ? -1.581  -16.647 -24.315 1.00 50.72  ?  22  GLU H CG  1 
ATOM   8624  C  CD  . GLU H  1 22  ? -2.037  -15.930 -25.613 1.00 52.37  ?  22  GLU H CD  1 
ATOM   8625  O  OE1 . GLU H  1 22  ? -1.446  -16.178 -26.680 1.00 52.62  ?  22  GLU H OE1 1 
ATOM   8626  O  OE2 . GLU H  1 22  ? -2.986  -15.115 -25.574 1.00 52.64  -1 22  GLU H OE2 1 
ATOM   8627  N  N   . GLU H  1 23  ? -0.204  -18.535 -21.609 1.00 52.08  ?  23  GLU H N   1 
ATOM   8628  C  CA  . GLU H  1 23  ? 0.722   -19.678 -21.549 1.00 53.83  ?  23  GLU H CA  1 
ATOM   8629  C  C   . GLU H  1 23  ? 0.092   -20.853 -22.271 1.00 54.90  ?  23  GLU H C   1 
ATOM   8630  O  O   . GLU H  1 23  ? -1.114  -20.850 -22.519 1.00 55.08  ?  23  GLU H O   1 
ATOM   8631  C  CB  . GLU H  1 23  ? 0.989   -20.039 -20.108 1.00 54.04  ?  23  GLU H CB  1 
ATOM   8632  C  CG  . GLU H  1 23  ? -0.257  -19.921 -19.223 1.00 56.54  ?  23  GLU H CG  1 
ATOM   8633  C  CD  . GLU H  1 23  ? 0.039   -20.011 -17.729 1.00 60.11  ?  23  GLU H CD  1 
ATOM   8634  O  OE1 . GLU H  1 23  ? -0.927  -19.909 -16.933 1.00 61.36  ?  23  GLU H OE1 1 
ATOM   8635  O  OE2 . GLU H  1 23  ? 1.226   -20.188 -17.346 1.00 62.04  -1 23  GLU H OE2 1 
ATOM   8636  N  N   . THR H  1 24  ? 0.893   -21.853 -22.628 1.00 56.64  ?  24  THR H N   1 
ATOM   8637  C  CA  . THR H  1 24  ? 0.393   -22.963 -23.466 1.00 57.97  ?  24  THR H CA  1 
ATOM   8638  C  C   . THR H  1 24  ? 0.348   -24.296 -22.715 1.00 58.86  ?  24  THR H C   1 
ATOM   8639  O  O   . THR H  1 24  ? 1.287   -24.657 -21.995 1.00 58.71  ?  24  THR H O   1 
ATOM   8640  C  CB  . THR H  1 24  ? 1.233   -23.133 -24.737 1.00 58.03  ?  24  THR H CB  1 
ATOM   8641  O  OG1 . THR H  1 24  ? 2.037   -21.961 -24.948 1.00 58.47  ?  24  THR H OG1 1 
ATOM   8642  C  CG2 . THR H  1 24  ? 0.334   -23.365 -25.932 1.00 58.49  ?  24  THR H CG2 1 
ATOM   8643  N  N   . ILE H  1 25  ? -0.759  -25.013 -22.889 1.00 60.22  ?  25  ILE H N   1 
ATOM   8644  C  CA  . ILE H  1 25  ? -1.002  -26.282 -22.195 1.00 61.50  ?  25  ILE H CA  1 
ATOM   8645  C  C   . ILE H  1 25  ? -0.438  -27.425 -23.049 1.00 62.41  ?  25  ILE H C   1 
ATOM   8646  O  O   . ILE H  1 25  ? 0.134   -28.417 -22.534 1.00 62.98  ?  25  ILE H O   1 
ATOM   8647  C  CB  . ILE H  1 25  ? -2.546  -26.472 -21.821 1.00 61.90  ?  25  ILE H CB  1 
ATOM   8648  C  CG1 . ILE H  1 25  ? -2.726  -27.467 -20.645 1.00 62.09  ?  25  ILE H CG1 1 
ATOM   8649  C  CG2 . ILE H  1 25  ? -3.464  -26.712 -23.091 1.00 61.55  ?  25  ILE H CG2 1 
ATOM   8650  C  CD1 . ILE H  1 25  ? -4.183  -27.772 -20.255 1.00 62.20  ?  25  ILE H CD1 1 
ATOM   8651  N  N   . ASN H  1 26  ? -0.588  -27.245 -24.360 1.00 62.61  ?  26  ASN H N   1 
ATOM   8652  C  CA  . ASN H  1 26  ? -0.068  -28.120 -25.400 1.00 62.68  ?  26  ASN H CA  1 
ATOM   8653  C  C   . ASN H  1 26  ? -0.731  -27.638 -26.686 1.00 62.62  ?  26  ASN H C   1 
ATOM   8654  O  O   . ASN H  1 26  ? -1.802  -28.137 -27.100 1.00 62.63  ?  26  ASN H O   1 
ATOM   8655  C  CB  . ASN H  1 26  ? -0.366  -29.610 -25.133 1.00 62.90  ?  26  ASN H CB  1 
ATOM   8656  C  CG  . ASN H  1 26  ? -1.717  -29.834 -24.460 1.00 62.97  ?  26  ASN H CG  1 
ATOM   8657  O  OD1 . ASN H  1 26  ? -1.780  -30.364 -23.344 1.00 63.15  ?  26  ASN H OD1 1 
ATOM   8658  N  ND2 . ASN H  1 26  ? -2.802  -29.411 -25.125 1.00 62.11  ?  26  ASN H ND2 1 
ATOM   8659  N  N   . GLY H  1 27  ? -0.117  -26.610 -27.276 1.00 62.15  ?  27  GLY H N   1 
ATOM   8660  C  CA  . GLY H  1 27  ? -0.595  -26.021 -28.535 1.00 61.25  ?  27  GLY H CA  1 
ATOM   8661  C  C   . GLY H  1 27  ? -1.958  -25.352 -28.430 1.00 60.26  ?  27  GLY H C   1 
ATOM   8662  O  O   . GLY H  1 27  ? -2.597  -25.070 -29.452 1.00 60.39  ?  27  GLY H O   1 
ATOM   8663  N  N   . LYS H  1 28  ? -2.408  -25.135 -27.192 1.00 58.75  ?  28  LYS H N   1 
ATOM   8664  C  CA  . LYS H  1 28  ? -3.553  -24.283 -26.916 1.00 57.16  ?  28  LYS H CA  1 
ATOM   8665  C  C   . LYS H  1 28  ? -3.058  -23.233 -25.958 1.00 55.08  ?  28  LYS H C   1 
ATOM   8666  O  O   . LYS H  1 28  ? -2.738  -23.551 -24.806 1.00 54.89  ?  28  LYS H O   1 
ATOM   8667  C  CB  . LYS H  1 28  ? -4.728  -25.071 -26.307 1.00 57.75  ?  28  LYS H CB  1 
ATOM   8668  C  CG  . LYS H  1 28  ? -5.912  -25.327 -27.261 1.00 59.19  ?  28  LYS H CG  1 
ATOM   8669  C  CD  . LYS H  1 28  ? -6.371  -24.043 -28.012 1.00 62.63  ?  28  LYS H CD  1 
ATOM   8670  C  CE  . LYS H  1 28  ? -7.088  -22.986 -27.117 1.00 63.28  ?  28  LYS H CE  1 
ATOM   8671  N  NZ  . LYS H  1 28  ? -8.541  -23.264 -26.836 1.00 61.98  ?  28  LYS H NZ  1 
ATOM   8672  N  N   . ALA H  1 29  ? -2.938  -22.000 -26.451 1.00 52.41  ?  29  ALA H N   1 
ATOM   8673  C  CA  . ALA H  1 29  ? -2.553  -20.880 -25.593 1.00 50.02  ?  29  ALA H CA  1 
ATOM   8674  C  C   . ALA H  1 29  ? -3.745  -20.464 -24.717 1.00 48.21  ?  29  ALA H C   1 
ATOM   8675  O  O   . ALA H  1 29  ? -4.882  -20.276 -25.214 1.00 48.01  ?  29  ALA H O   1 
ATOM   8676  C  CB  . ALA H  1 29  ? -2.025  -19.716 -26.403 1.00 50.26  ?  29  ALA H CB  1 
ATOM   8677  N  N   . LEU H  1 30  ? -3.461  -20.336 -23.417 1.00 44.89  ?  30  LEU H N   1 
ATOM   8678  C  CA  . LEU H  1 30  ? -4.479  -20.243 -22.374 1.00 41.82  ?  30  LEU H CA  1 
ATOM   8679  C  C   . LEU H  1 30  ? -4.319  -19.016 -21.461 1.00 40.12  ?  30  LEU H C   1 
ATOM   8680  O  O   . LEU H  1 30  ? -3.184  -18.665 -21.047 1.00 39.73  ?  30  LEU H O   1 
ATOM   8681  C  CB  . LEU H  1 30  ? -4.408  -21.516 -21.545 1.00 41.54  ?  30  LEU H CB  1 
ATOM   8682  C  CG  . LEU H  1 30  ? -5.572  -22.500 -21.557 1.00 40.71  ?  30  LEU H CG  1 
ATOM   8683  C  CD1 . LEU H  1 30  ? -6.090  -22.798 -22.946 1.00 39.50  ?  30  LEU H CD1 1 
ATOM   8684  C  CD2 . LEU H  1 30  ? -5.098  -23.743 -20.839 1.00 40.34  ?  30  LEU H CD2 1 
ATOM   8685  N  N   . TRP H  1 31  ? -5.429  -18.354 -21.137 1.00 37.42  ?  31  TRP H N   1 
ATOM   8686  C  CA  . TRP H  1 31  ? -5.298  -17.143 -20.300 1.00 35.99  ?  31  TRP H CA  1 
ATOM   8687  C  C   . TRP H  1 31  ? -5.444  -17.445 -18.831 1.00 34.26  ?  31  TRP H C   1 
ATOM   8688  O  O   . TRP H  1 31  ? -6.236  -18.289 -18.442 1.00 34.38  ?  31  TRP H O   1 
ATOM   8689  C  CB  . TRP H  1 31  ? -6.256  -15.993 -20.695 1.00 35.68  ?  31  TRP H CB  1 
ATOM   8690  C  CG  . TRP H  1 31  ? -6.037  -15.411 -22.052 1.00 35.74  ?  31  TRP H CG  1 
ATOM   8691  C  CD1 . TRP H  1 31  ? -4.982  -15.647 -22.899 1.00 34.92  ?  31  TRP H CD1 1 
ATOM   8692  C  CD2 . TRP H  1 31  ? -6.875  -14.453 -22.714 1.00 36.57  ?  31  TRP H CD2 1 
ATOM   8693  N  NE1 . TRP H  1 31  ? -5.141  -14.934 -24.054 1.00 35.61  ?  31  TRP H NE1 1 
ATOM   8694  C  CE2 . TRP H  1 31  ? -6.290  -14.187 -23.971 1.00 37.04  ?  31  TRP H CE2 1 
ATOM   8695  C  CE3 . TRP H  1 31  ? -8.082  -13.809 -22.376 1.00 34.68  ?  31  TRP H CE3 1 
ATOM   8696  C  CZ2 . TRP H  1 31  ? -6.871  -13.290 -24.896 1.00 37.31  ?  31  TRP H CZ2 1 
ATOM   8697  C  CZ3 . TRP H  1 31  ? -8.656  -12.935 -23.283 1.00 34.31  ?  31  TRP H CZ3 1 
ATOM   8698  C  CH2 . TRP H  1 31  ? -8.050  -12.678 -24.532 1.00 35.82  ?  31  TRP H CH2 1 
ATOM   8699  N  N   . ASN H  1 32  ? -4.681  -16.739 -18.024 1.00 32.84  ?  32  ASN H N   1 
ATOM   8700  C  CA  . ASN H  1 32  ? -4.849  -16.781 -16.591 1.00 32.59  ?  32  ASN H CA  1 
ATOM   8701  C  C   . ASN H  1 32  ? -4.442  -15.445 -15.984 1.00 32.19  ?  32  ASN H C   1 
ATOM   8702  O  O   . ASN H  1 32  ? -3.588  -14.782 -16.572 1.00 32.52  ?  32  ASN H O   1 
ATOM   8703  C  CB  . ASN H  1 32  ? -4.020  -17.914 -16.009 1.00 32.29  ?  32  ASN H CB  1 
ATOM   8704  C  CG  . ASN H  1 32  ? -4.187  -18.068 -14.512 1.00 32.84  ?  32  ASN H CG  1 
ATOM   8705  O  OD1 . ASN H  1 32  ? -5.247  -17.798 -13.952 1.00 33.54  ?  32  ASN H OD1 1 
ATOM   8706  N  ND2 . ASN H  1 32  ? -3.128  -18.522 -13.851 1.00 33.91  ?  32  ASN H ND2 1 
ATOM   8707  N  N   . GLN H  1 33  ? -5.065  -15.042 -14.854 1.00 31.08  ?  33  GLN H N   1 
ATOM   8708  C  CA  . GLN H  1 33  ? -4.555  -13.938 -14.019 1.00 30.36  ?  33  GLN H CA  1 
ATOM   8709  C  C   . GLN H  1 33  ? -3.120  -14.255 -13.700 1.00 30.13  ?  33  GLN H C   1 
ATOM   8710  O  O   . GLN H  1 33  ? -2.728  -15.398 -13.765 1.00 29.78  ?  33  GLN H O   1 
ATOM   8711  C  CB  . GLN H  1 33  ? -5.282  -13.810 -12.680 1.00 29.99  ?  33  GLN H CB  1 
ATOM   8712  C  CG  . GLN H  1 33  ? -6.606  -13.135 -12.727 1.00 29.86  ?  33  GLN H CG  1 
ATOM   8713  C  CD  . GLN H  1 33  ? -7.703  -14.088 -13.129 1.00 31.85  ?  33  GLN H CD  1 
ATOM   8714  O  OE1 . GLN H  1 33  ? -7.606  -15.312 -12.897 1.00 32.44  ?  33  GLN H OE1 1 
ATOM   8715  N  NE2 . GLN H  1 33  ? -8.755  -13.550 -13.755 1.00 29.57  ?  33  GLN H NE2 1 
ATOM   8716  N  N   . PRO H  1 34  ? -2.322  -13.246 -13.364 1.00 30.59  ?  34  PRO H N   1 
ATOM   8717  C  CA  . PRO H  1 34  ? -0.968  -13.571 -12.925 1.00 31.78  ?  34  PRO H CA  1 
ATOM   8718  C  C   . PRO H  1 34  ? -1.023  -14.361 -11.623 1.00 32.48  ?  34  PRO H C   1 
ATOM   8719  O  O   . PRO H  1 34  ? -1.192  -13.782 -10.561 1.00 32.40  ?  34  PRO H O   1 
ATOM   8720  C  CB  . PRO H  1 34  ? -0.337  -12.192 -12.718 1.00 31.72  ?  34  PRO H CB  1 
ATOM   8721  C  CG  . PRO H  1 34  ? -1.102  -11.314 -13.701 1.00 30.11  ?  34  PRO H CG  1 
ATOM   8722  C  CD  . PRO H  1 34  ? -2.501  -11.804 -13.572 1.00 30.22  ?  34  PRO H CD  1 
ATOM   8723  N  N   . ALA H  1 35  ? -0.894  -15.681 -11.729 1.00 33.39  ?  35  ALA H N   1 
ATOM   8724  C  CA  . ALA H  1 35  ? -1.234  -16.586 -10.629 1.00 33.93  ?  35  ALA H CA  1 
ATOM   8725  C  C   . ALA H  1 35  ? -0.195  -17.707 -10.470 1.00 34.64  ?  35  ALA H C   1 
ATOM   8726  O  O   . ALA H  1 35  ? 0.535   -17.994 -11.414 1.00 34.73  ?  35  ALA H O   1 
ATOM   8727  C  CB  . ALA H  1 35  ? -2.584  -17.162 -10.894 1.00 33.59  ?  35  ALA H CB  1 
ATOM   8728  N  N   . GLY H  1 36  ? -0.114  -18.317 -9.289  1.00 35.08  ?  36  GLY H N   1 
ATOM   8729  C  CA  . GLY H  1 36  ? 0.786   -19.455 -9.067  1.00 36.26  ?  36  GLY H CA  1 
ATOM   8730  C  C   . GLY H  1 36  ? 0.817   -20.083 -7.676  1.00 36.82  ?  36  GLY H C   1 
ATOM   8731  O  O   . GLY H  1 36  ? -0.007  -19.776 -6.826  1.00 38.05  ?  36  GLY H O   1 
ATOM   8732  N  N   . HIS H  1 37  ? 1.781   -20.962 -7.422  1.00 37.16  ?  37  HIS H N   1 
ATOM   8733  C  CA  . HIS H  1 37  ? 1.869   -21.669 -6.123  1.00 36.63  ?  37  HIS H CA  1 
ATOM   8734  C  C   . HIS H  1 37  ? 2.603   -20.936 -5.017  1.00 36.84  ?  37  HIS H C   1 
ATOM   8735  O  O   . HIS H  1 37  ? 3.591   -20.235 -5.276  1.00 36.73  ?  37  HIS H O   1 
ATOM   8736  C  CB  . HIS H  1 37  ? 2.485   -23.044 -6.315  1.00 35.55  ?  37  HIS H CB  1 
ATOM   8737  C  CG  . HIS H  1 37  ? 1.592   -23.970 -7.055  1.00 33.84  ?  37  HIS H CG  1 
ATOM   8738  N  ND1 . HIS H  1 37  ? 1.374   -23.856 -8.407  1.00 33.33  ?  37  HIS H ND1 1 
ATOM   8739  C  CD2 . HIS H  1 37  ? 0.818   -24.995 -6.629  1.00 32.05  ?  37  HIS H CD2 1 
ATOM   8740  C  CE1 . HIS H  1 37  ? 0.515   -24.788 -8.786  1.00 34.40  ?  37  HIS H CE1 1 
ATOM   8741  N  NE2 . HIS H  1 37  ? 0.160   -25.490 -7.725  1.00 31.05  ?  37  HIS H NE2 1 
ATOM   8742  N  N   . LEU H  1 38  ? 2.086   -21.098 -3.799  1.00 37.49  ?  38  LEU H N   1 
ATOM   8743  C  CA  . LEU H  1 38  ? 2.733   -20.669 -2.573  1.00 38.36  ?  38  LEU H CA  1 
ATOM   8744  C  C   . LEU H  1 38  ? 3.901   -21.590 -2.299  1.00 39.90  ?  38  LEU H C   1 
ATOM   8745  O  O   . LEU H  1 38  ? 3.832   -22.805 -2.565  1.00 40.75  ?  38  LEU H O   1 
ATOM   8746  C  CB  . LEU H  1 38  ? 1.756   -20.734 -1.404  1.00 37.84  ?  38  LEU H CB  1 
ATOM   8747  C  CG  . LEU H  1 38  ? 2.253   -20.432 0.028   1.00 37.54  ?  38  LEU H CG  1 
ATOM   8748  C  CD1 . LEU H  1 38  ? 2.706   -18.993 0.248   1.00 35.74  ?  38  LEU H CD1 1 
ATOM   8749  C  CD2 . LEU H  1 38  ? 1.156   -20.755 1.015   1.00 36.69  ?  38  LEU H CD2 1 
ATOM   8750  N  N   . GLU H  1 39  ? 4.973   -21.007 -1.784  1.00 41.39  ?  39  GLU H N   1 
ATOM   8751  C  CA  . GLU H  1 39  ? 6.168   -21.749 -1.459  1.00 43.53  ?  39  GLU H CA  1 
ATOM   8752  C  C   . GLU H  1 39  ? 6.506   -21.579 0.015   1.00 43.72  ?  39  GLU H C   1 
ATOM   8753  O  O   . GLU H  1 39  ? 5.909   -20.735 0.712   1.00 44.08  ?  39  GLU H O   1 
ATOM   8754  C  CB  . GLU H  1 39  ? 7.331   -21.325 -2.364  1.00 44.42  ?  39  GLU H CB  1 
ATOM   8755  C  CG  . GLU H  1 39  ? 7.314   -21.983 -3.773  1.00 48.19  ?  39  GLU H CG  1 
ATOM   8756  C  CD  . GLU H  1 39  ? 8.517   -21.565 -4.662  1.00 56.00  ?  39  GLU H CD  1 
ATOM   8757  O  OE1 . GLU H  1 39  ? 9.047   -20.411 -4.477  1.00 55.97  ?  39  GLU H OE1 1 
ATOM   8758  O  OE2 . GLU H  1 39  ? 8.929   -22.398 -5.545  1.00 57.61  -1 39  GLU H OE2 1 
ATOM   8759  N  N   . ALA H  1 40  ? 7.429   -22.419 0.493   1.00 43.82  ?  40  ALA H N   1 
ATOM   8760  C  CA  . ALA H  1 40  ? 7.870   -22.392 1.889   1.00 43.80  ?  40  ALA H CA  1 
ATOM   8761  C  C   . ALA H  1 40  ? 8.278   -21.011 2.373   1.00 43.67  ?  40  ALA H C   1 
ATOM   8762  O  O   . ALA H  1 40  ? 8.835   -20.223 1.619   1.00 44.06  ?  40  ALA H O   1 
ATOM   8763  C  CB  . ALA H  1 40  ? 9.018   -23.340 2.074   1.00 43.70  ?  40  ALA H CB  1 
ATOM   8764  N  N   . ASP H  1 41  ? 8.010   -20.706 3.627   1.00 43.49  ?  41  ASP H N   1 
ATOM   8765  C  CA  . ASP H  1 41  ? 8.666   -19.555 4.213   1.00 44.14  ?  41  ASP H CA  1 
ATOM   8766  C  C   . ASP H  1 41  ? 8.323   -18.227 3.527   1.00 43.82  ?  41  ASP H C   1 
ATOM   8767  O  O   . ASP H  1 41  ? 9.115   -17.279 3.568   1.00 43.53  ?  41  ASP H O   1 
ATOM   8768  C  CB  . ASP H  1 41  ? 10.179  -19.785 4.185   1.00 44.37  ?  41  ASP H CB  1 
ATOM   8769  C  CG  . ASP H  1 41  ? 10.660  -20.670 5.342   1.00 48.00  ?  41  ASP H CG  1 
ATOM   8770  O  OD1 . ASP H  1 41  ? 11.903  -20.836 5.494   1.00 49.22  ?  41  ASP H OD1 1 
ATOM   8771  O  OD2 . ASP H  1 41  ? 9.794   -21.167 6.124   1.00 50.54  -1 41  ASP H OD2 1 
ATOM   8772  N  N   . GLU H  1 42  ? 7.154   -18.165 2.879   1.00 43.48  ?  42  GLU H N   1 
ATOM   8773  C  CA  . GLU H  1 42  ? 6.604   -16.879 2.418   1.00 42.59  ?  42  GLU H CA  1 
ATOM   8774  C  C   . GLU H  1 42  ? 5.136   -16.747 2.738   1.00 42.23  ?  42  GLU H C   1 
ATOM   8775  O  O   . GLU H  1 42  ? 4.390   -17.732 2.761   1.00 42.55  ?  42  GLU H O   1 
ATOM   8776  C  CB  . GLU H  1 42  ? 6.850   -16.620 0.921   1.00 42.58  ?  42  GLU H CB  1 
ATOM   8777  C  CG  . GLU H  1 42  ? 5.782   -17.134 -0.024  1.00 41.50  ?  42  GLU H CG  1 
ATOM   8778  C  CD  . GLU H  1 42  ? 6.251   -17.268 -1.472  1.00 42.94  ?  42  GLU H CD  1 
ATOM   8779  O  OE1 . GLU H  1 42  ? 6.971   -16.384 -1.999  1.00 43.37  ?  42  GLU H OE1 1 
ATOM   8780  O  OE2 . GLU H  1 42  ? 5.877   -18.275 -2.109  1.00 43.77  -1 42  GLU H OE2 1 
ATOM   8781  N  N   . THR H  1 43  ? 4.755   -15.504 2.988   1.00 41.67  ?  43  THR H N   1 
ATOM   8782  C  CA  . THR H  1 43  ? 3.380   -15.060 3.148   1.00 40.86  ?  43  THR H CA  1 
ATOM   8783  C  C   . THR H  1 43  ? 2.583   -15.227 1.870   1.00 39.87  ?  43  THR H C   1 
ATOM   8784  O  O   . THR H  1 43  ? 3.138   -15.274 0.760   1.00 39.76  ?  43  THR H O   1 
ATOM   8785  C  CB  . THR H  1 43  ? 3.417   -13.584 3.548   1.00 40.96  ?  43  THR H CB  1 
ATOM   8786  O  OG1 . THR H  1 43  ? 4.125   -13.505 4.786   1.00 43.84  ?  43  THR H OG1 1 
ATOM   8787  C  CG2 . THR H  1 43  ? 2.021   -12.975 3.767   1.00 42.25  ?  43  THR H CG2 1 
ATOM   8788  N  N   . LEU H  1 44  ? 1.269   -15.309 2.018   1.00 38.53  ?  44  LEU H N   1 
ATOM   8789  C  CA  . LEU H  1 44  ? 0.410   -15.202 0.859   1.00 37.38  ?  44  LEU H CA  1 
ATOM   8790  C  C   . LEU H  1 44  ? 0.665   -13.932 0.049   1.00 36.87  ?  44  LEU H C   1 
ATOM   8791  O  O   . LEU H  1 44  ? 0.877   -14.019 -1.171  1.00 36.14  ?  44  LEU H O   1 
ATOM   8792  C  CB  . LEU H  1 44  ? -1.049  -15.309 1.246   1.00 36.86  ?  44  LEU H CB  1 
ATOM   8793  C  CG  . LEU H  1 44  ? -1.475  -16.724 1.594   1.00 35.90  ?  44  LEU H CG  1 
ATOM   8794  C  CD1 . LEU H  1 44  ? -2.831  -16.648 2.267   1.00 36.07  ?  44  LEU H CD1 1 
ATOM   8795  C  CD2 . LEU H  1 44  ? -1.489  -17.660 0.378   1.00 34.63  ?  44  LEU H CD2 1 
ATOM   8796  N  N   . VAL H  1 45  ? 0.661   -12.768 0.697   1.00 36.36  ?  45  VAL H N   1 
ATOM   8797  C  CA  . VAL H  1 45  ? 0.810   -11.540 -0.084  1.00 37.44  ?  45  VAL H CA  1 
ATOM   8798  C  C   . VAL H  1 45  ? 2.142   -11.602 -0.788  1.00 37.95  ?  45  VAL H C   1 
ATOM   8799  O  O   . VAL H  1 45  ? 2.190   -11.377 -2.003  1.00 38.81  ?  45  VAL H O   1 
ATOM   8800  C  CB  . VAL H  1 45  ? 0.629   -10.179 0.680   1.00 37.04  ?  45  VAL H CB  1 
ATOM   8801  C  CG1 . VAL H  1 45  ? -0.732  -10.102 1.360   1.00 36.89  ?  45  VAL H CG1 1 
ATOM   8802  C  CG2 . VAL H  1 45  ? 1.769   -9.919  1.660   1.00 38.23  ?  45  VAL H CG2 1 
ATOM   8803  N  N   . GLU H  1 46  ? 3.193   -11.964 -0.043  1.00 38.02  ?  46  GLU H N   1 
ATOM   8804  C  CA  . GLU H  1 46  ? 4.542   -12.092 -0.586  1.00 38.34  ?  46  GLU H CA  1 
ATOM   8805  C  C   . GLU H  1 46  ? 4.543   -12.935 -1.846  1.00 38.23  ?  46  GLU H C   1 
ATOM   8806  O  O   . GLU H  1 46  ? 5.133   -12.556 -2.855  1.00 38.95  ?  46  GLU H O   1 
ATOM   8807  C  CB  . GLU H  1 46  ? 5.471   -12.733 0.437   1.00 38.83  ?  46  GLU H CB  1 
ATOM   8808  C  CG  . GLU H  1 46  ? 6.486   -11.800 1.100   1.00 40.50  ?  46  GLU H CG  1 
ATOM   8809  C  CD  . GLU H  1 46  ? 7.280   -12.508 2.197   1.00 42.83  ?  46  GLU H CD  1 
ATOM   8810  O  OE1 . GLU H  1 46  ? 8.281   -11.939 2.686   1.00 44.27  ?  46  GLU H OE1 1 
ATOM   8811  O  OE2 . GLU H  1 46  ? 6.888   -13.632 2.581   1.00 43.23  -1 46  GLU H OE2 1 
ATOM   8812  N  N   . ALA H  1 47  ? 3.873   -14.070 -1.782  1.00 37.58  ?  47  ALA H N   1 
ATOM   8813  C  CA  . ALA H  1 47  ? 3.761   -14.946 -2.901  1.00 37.93  ?  47  ALA H CA  1 
ATOM   8814  C  C   . ALA H  1 47  ? 2.916   -14.322 -4.025  1.00 38.88  ?  47  ALA H C   1 
ATOM   8815  O  O   . ALA H  1 47  ? 3.208   -14.499 -5.233  1.00 39.28  ?  47  ALA H O   1 
ATOM   8816  C  CB  . ALA H  1 47  ? 3.147   -16.255 -2.450  1.00 37.91  ?  47  ALA H CB  1 
ATOM   8817  N  N   . ALA H  1 48  ? 1.853   -13.613 -3.653  1.00 39.18  ?  48  ALA H N   1 
ATOM   8818  C  CA  . ALA H  1 48  ? 1.011   -13.006 -4.685  1.00 39.36  ?  48  ALA H CA  1 
ATOM   8819  C  C   . ALA H  1 48  ? 1.845   -12.028 -5.540  1.00 39.46  ?  48  ALA H C   1 
ATOM   8820  O  O   . ALA H  1 48  ? 1.758   -12.057 -6.789  1.00 39.26  ?  48  ALA H O   1 
ATOM   8821  C  CB  . ALA H  1 48  ? -0.179  -12.340 -4.085  1.00 39.02  ?  48  ALA H CB  1 
ATOM   8822  N  N   . ALA H  1 49  ? 2.678   -11.230 -4.853  1.00 38.71  ?  49  ALA H N   1 
ATOM   8823  C  CA  . ALA H  1 49  ? 3.625   -10.317 -5.481  1.00 38.76  ?  49  ALA H CA  1 
ATOM   8824  C  C   . ALA H  1 49  ? 4.598   -11.061 -6.348  1.00 39.33  ?  49  ALA H C   1 
ATOM   8825  O  O   . ALA H  1 49  ? 4.847   -10.674 -7.516  1.00 39.59  ?  49  ALA H O   1 
ATOM   8826  C  CB  . ALA H  1 49  ? 4.390   -9.548  -4.442  1.00 38.33  ?  49  ALA H CB  1 
ATOM   8827  N  N   . ARG H  1 50  ? 5.158   -12.126 -5.771  1.00 39.35  ?  50  ARG H N   1 
ATOM   8828  C  CA  . ARG H  1 50  ? 6.242   -12.843 -6.410  1.00 39.35  ?  50  ARG H CA  1 
ATOM   8829  C  C   . ARG H  1 50  ? 5.746   -13.354 -7.774  1.00 39.56  ?  50  ARG H C   1 
ATOM   8830  O  O   . ARG H  1 50  ? 6.263   -12.965 -8.819  1.00 39.18  ?  50  ARG H O   1 
ATOM   8831  C  CB  . ARG H  1 50  ? 6.761   -13.966 -5.493  1.00 39.67  ?  50  ARG H CB  1 
ATOM   8832  C  CG  . ARG H  1 50  ? 8.001   -14.739 -5.995  1.00 38.49  ?  50  ARG H CG  1 
ATOM   8833  C  CD  . ARG H  1 50  ? 8.441   -15.904 -5.057  1.00 37.22  ?  50  ARG H CD  1 
ATOM   8834  N  NE  . ARG H  1 50  ? 7.333   -16.743 -4.607  1.00 35.31  ?  50  ARG H NE  1 
ATOM   8835  C  CZ  . ARG H  1 50  ? 6.657   -17.585 -5.390  1.00 38.17  ?  50  ARG H CZ  1 
ATOM   8836  N  NH1 . ARG H  1 50  ? 6.950   -17.735 -6.690  1.00 37.26  ?  50  ARG H NH1 1 
ATOM   8837  N  NH2 . ARG H  1 50  ? 5.655   -18.285 -4.873  1.00 39.01  ?  50  ARG H NH2 1 
ATOM   8838  N  N   . GLU H  1 51  ? 4.705   -14.172 -7.772  1.00 39.64  ?  51  GLU H N   1 
ATOM   8839  C  CA  . GLU H  1 51  ? 4.263   -14.760 -9.012  1.00 39.88  ?  51  GLU H CA  1 
ATOM   8840  C  C   . GLU H  1 51  ? 3.825   -13.681 -9.995  1.00 39.90  ?  51  GLU H C   1 
ATOM   8841  O  O   . GLU H  1 51  ? 3.780   -13.951 -11.185 1.00 39.51  ?  51  GLU H O   1 
ATOM   8842  C  CB  . GLU H  1 51  ? 3.146   -15.780 -8.785  1.00 40.65  ?  51  GLU H CB  1 
ATOM   8843  C  CG  . GLU H  1 51  ? 3.619   -17.125 -8.229  1.00 42.54  ?  51  GLU H CG  1 
ATOM   8844  C  CD  . GLU H  1 51  ? 4.280   -18.020 -9.266  1.00 44.52  ?  51  GLU H CD  1 
ATOM   8845  O  OE1 . GLU H  1 51  ? 3.840   -18.009 -10.445 1.00 43.04  ?  51  GLU H OE1 1 
ATOM   8846  O  OE2 . GLU H  1 51  ? 5.237   -18.748 -8.877  1.00 47.31  -1 51  GLU H OE2 1 
ATOM   8847  N  N   . LEU H  1 52  ? 3.528   -12.469 -9.506  1.00 39.87  ?  52  LEU H N   1 
ATOM   8848  C  CA  . LEU H  1 52  ? 3.135   -11.353 -10.364 1.00 39.90  ?  52  LEU H CA  1 
ATOM   8849  C  C   . LEU H  1 52  ? 4.333   -10.955 -11.178 1.00 40.70  ?  52  LEU H C   1 
ATOM   8850  O  O   . LEU H  1 52  ? 4.270   -10.813 -12.401 1.00 40.32  ?  52  LEU H O   1 
ATOM   8851  C  CB  . LEU H  1 52  ? 2.742   -10.141 -9.525  1.00 39.81  ?  52  LEU H CB  1 
ATOM   8852  C  CG  . LEU H  1 52  ? 1.781   -9.078  -10.080 1.00 39.36  ?  52  LEU H CG  1 
ATOM   8853  C  CD1 . LEU H  1 52  ? 2.211   -7.735  -9.617  1.00 38.48  ?  52  LEU H CD1 1 
ATOM   8854  C  CD2 . LEU H  1 52  ? 1.674   -9.070  -11.590 1.00 39.46  ?  52  LEU H CD2 1 
ATOM   8855  N  N   . TRP H  1 53  ? 5.427   -10.756 -10.464 1.00 41.66  ?  53  TRP H N   1 
ATOM   8856  C  CA  . TRP H  1 53  ? 6.677   -10.369 -11.060 1.00 43.04  ?  53  TRP H CA  1 
ATOM   8857  C  C   . TRP H  1 53  ? 7.152   -11.477 -11.959 1.00 43.03  ?  53  TRP H C   1 
ATOM   8858  O  O   . TRP H  1 53  ? 7.384   -11.285 -13.154 1.00 43.69  ?  53  TRP H O   1 
ATOM   8859  C  CB  . TRP H  1 53  ? 7.711   -10.119 -9.968  1.00 43.73  ?  53  TRP H CB  1 
ATOM   8860  C  CG  . TRP H  1 53  ? 8.953   -9.566  -10.506 1.00 47.28  ?  53  TRP H CG  1 
ATOM   8861  C  CD1 . TRP H  1 53  ? 9.207   -8.256  -10.776 1.00 48.61  ?  53  TRP H CD1 1 
ATOM   8862  C  CD2 . TRP H  1 53  ? 10.127  -10.295 -10.879 1.00 51.07  ?  53  TRP H CD2 1 
ATOM   8863  N  NE1 . TRP H  1 53  ? 10.468  -8.121  -11.287 1.00 51.19  ?  53  TRP H NE1 1 
ATOM   8864  C  CE2 . TRP H  1 53  ? 11.062  -9.352  -11.360 1.00 51.02  ?  53  TRP H CE2 1 
ATOM   8865  C  CE3 . TRP H  1 53  ? 10.487  -11.653 -10.840 1.00 53.37  ?  53  TRP H CE3 1 
ATOM   8866  C  CZ2 . TRP H  1 53  ? 12.342  -9.712  -11.799 1.00 52.61  ?  53  TRP H CZ2 1 
ATOM   8867  C  CZ3 . TRP H  1 53  ? 11.767  -12.018 -11.280 1.00 54.98  ?  53  TRP H CZ3 1 
ATOM   8868  C  CH2 . TRP H  1 53  ? 12.677  -11.045 -11.755 1.00 54.51  ?  53  TRP H CH2 1 
ATOM   8869  N  N   . GLU H  1 54  ? 7.266   -12.660 -11.390 1.00 42.90  ?  54  GLU H N   1 
ATOM   8870  C  CA  . GLU H  1 54  ? 7.738   -13.796 -12.150 1.00 42.91  ?  54  GLU H CA  1 
ATOM   8871  C  C   . GLU H  1 54  ? 6.960   -13.948 -13.432 1.00 42.27  ?  54  GLU H C   1 
ATOM   8872  O  O   . GLU H  1 54  ? 7.350   -14.709 -14.301 1.00 42.49  ?  54  GLU H O   1 
ATOM   8873  C  CB  . GLU H  1 54  ? 7.630   -15.086 -11.332 1.00 42.93  ?  54  GLU H CB  1 
ATOM   8874  C  CG  . GLU H  1 54  ? 8.468   -15.069 -10.063 1.00 44.68  ?  54  GLU H CG  1 
ATOM   8875  C  CD  . GLU H  1 54  ? 8.509   -16.415 -9.377  1.00 46.92  ?  54  GLU H CD  1 
ATOM   8876  O  OE1 . GLU H  1 54  ? 8.167   -17.430 -10.034 1.00 48.23  ?  54  GLU H OE1 1 
ATOM   8877  O  OE2 . GLU H  1 54  ? 8.899   -16.455 -8.191  1.00 46.94  -1 54  GLU H OE2 1 
ATOM   8878  N  N   . GLU H  1 55  ? 5.849   -13.242 -13.557 1.00 41.81  ?  55  GLU H N   1 
ATOM   8879  C  CA  . GLU H  1 55  ? 4.950   -13.552 -14.664 1.00 41.89  ?  55  GLU H CA  1 
ATOM   8880  C  C   . GLU H  1 55  ? 4.659   -12.384 -15.575 1.00 41.37  ?  55  GLU H C   1 
ATOM   8881  O  O   . GLU H  1 55  ? 4.288   -12.581 -16.725 1.00 40.95  ?  55  GLU H O   1 
ATOM   8882  C  CB  . GLU H  1 55  ? 3.642   -14.241 -14.180 1.00 41.88  ?  55  GLU H CB  1 
ATOM   8883  C  CG  . GLU H  1 55  ? 3.873   -15.669 -13.658 1.00 41.45  ?  55  GLU H CG  1 
ATOM   8884  C  CD  . GLU H  1 55  ? 2.653   -16.562 -13.683 1.00 41.59  ?  55  GLU H CD  1 
ATOM   8885  O  OE1 . GLU H  1 55  ? 1.505   -16.088 -13.782 1.00 43.95  ?  55  GLU H OE1 1 
ATOM   8886  O  OE2 . GLU H  1 55  ? 2.849   -17.782 -13.573 1.00 43.51  -1 55  GLU H OE2 1 
ATOM   8887  N  N   . THR H  1 56  ? 4.825   -11.171 -15.066 1.00 41.23  ?  56  THR H N   1 
ATOM   8888  C  CA  . THR H  1 56  ? 4.458   -10.015 -15.844 1.00 41.17  ?  56  THR H CA  1 
ATOM   8889  C  C   . THR H  1 56  ? 5.563   -9.031  -15.775 1.00 41.84  ?  56  THR H C   1 
ATOM   8890  O  O   . THR H  1 56  ? 5.548   -8.038  -16.487 1.00 41.95  ?  56  THR H O   1 
ATOM   8891  C  CB  . THR H  1 56  ? 3.210   -9.318  -15.295 1.00 40.72  ?  56  THR H CB  1 
ATOM   8892  O  OG1 . THR H  1 56  ? 3.523   -8.731  -14.027 1.00 40.41  ?  56  THR H OG1 1 
ATOM   8893  C  CG2 . THR H  1 56  ? 2.058   -10.286 -15.176 1.00 38.75  ?  56  THR H CG2 1 
ATOM   8894  N  N   . GLY H  1 57  ? 6.498   -9.279  -14.871 1.00 42.47  ?  57  GLY H N   1 
ATOM   8895  C  CA  . GLY H  1 57  ? 7.621   -8.388  -14.715 1.00 43.77  ?  57  GLY H CA  1 
ATOM   8896  C  C   . GLY H  1 57  ? 7.279   -7.146  -13.935 1.00 44.72  ?  57  GLY H C   1 
ATOM   8897  O  O   . GLY H  1 57  ? 8.166   -6.359  -13.602 1.00 45.56  ?  57  GLY H O   1 
ATOM   8898  N  N   . ILE H  1 58  ? 6.003   -6.960  -13.634 1.00 45.30  ?  58  ILE H N   1 
ATOM   8899  C  CA  . ILE H  1 58  ? 5.618   -5.910  -12.715 1.00 46.09  ?  58  ILE H CA  1 
ATOM   8900  C  C   . ILE H  1 58  ? 6.005   -6.284  -11.301 1.00 46.17  ?  58  ILE H C   1 
ATOM   8901  O  O   . ILE H  1 58  ? 5.873   -7.447  -10.886 1.00 46.40  ?  58  ILE H O   1 
ATOM   8902  C  CB  . ILE H  1 58  ? 4.088   -5.661  -12.729 1.00 46.87  ?  58  ILE H CB  1 
ATOM   8903  C  CG1 . ILE H  1 58  ? 3.692   -4.852  -13.966 1.00 47.39  ?  58  ILE H CG1 1 
ATOM   8904  C  CG2 . ILE H  1 58  ? 3.633   -4.913  -11.441 1.00 46.73  ?  58  ILE H CG2 1 
ATOM   8905  C  CD1 . ILE H  1 58  ? 2.656   -5.521  -14.826 1.00 50.10  ?  58  ILE H CD1 1 
ATOM   8906  N  N   . SER H  1 59  ? 6.469   -5.286  -10.560 1.00 46.09  ?  59  SER H N   1 
ATOM   8907  C  CA  . SER H  1 59  ? 6.478   -5.385  -9.112  1.00 45.61  ?  59  SER H CA  1 
ATOM   8908  C  C   . SER H  1 59  ? 5.511   -4.373  -8.491  1.00 45.43  ?  59  SER H C   1 
ATOM   8909  O  O   . SER H  1 59  ? 5.752   -3.156  -8.467  1.00 45.23  ?  59  SER H O   1 
ATOM   8910  C  CB  . SER H  1 59  ? 7.901   -5.292  -8.529  1.00 45.75  ?  59  SER H CB  1 
ATOM   8911  O  OG  . SER H  1 59  ? 8.549   -4.088  -8.878  1.00 45.43  ?  59  SER H OG  1 
ATOM   8912  N  N   . ALA H  1 60  ? 4.387   -4.899  -8.022  1.00 44.87  ?  60  ALA H N   1 
ATOM   8913  C  CA  . ALA H  1 60  ? 3.485   -4.136  -7.172  1.00 44.08  ?  60  ALA H CA  1 
ATOM   8914  C  C   . ALA H  1 60  ? 2.926   -4.988  -6.024  1.00 43.48  ?  60  ALA H C   1 
ATOM   8915  O  O   . ALA H  1 60  ? 2.740   -6.204  -6.168  1.00 43.70  ?  60  ALA H O   1 
ATOM   8916  C  CB  . ALA H  1 60  ? 2.374   -3.529  -7.988  1.00 44.11  ?  60  ALA H CB  1 
ATOM   8917  N  N   . GLN H  1 61  ? 2.702   -4.330  -4.884  1.00 42.42  ?  61  GLN H N   1 
ATOM   8918  C  CA  . GLN H  1 61  ? 2.078   -4.911  -3.703  1.00 41.31  ?  61  GLN H CA  1 
ATOM   8919  C  C   . GLN H  1 61  ? 0.595   -5.207  -3.926  1.00 39.39  ?  61  GLN H C   1 
ATOM   8920  O  O   . GLN H  1 61  ? -0.129  -4.347  -4.421  1.00 39.85  ?  61  GLN H O   1 
ATOM   8921  C  CB  . GLN H  1 61  ? 2.217   -3.919  -2.527  1.00 42.13  ?  61  GLN H CB  1 
ATOM   8922  C  CG  . GLN H  1 61  ? 2.793   -4.543  -1.275  1.00 45.11  ?  61  GLN H CG  1 
ATOM   8923  C  CD  . GLN H  1 61  ? 3.798   -5.628  -1.668  1.00 49.44  ?  61  GLN H CD  1 
ATOM   8924  O  OE1 . GLN H  1 61  ? 3.513   -6.829  -1.549  1.00 50.53  ?  61  GLN H OE1 1 
ATOM   8925  N  NE2 . GLN H  1 61  ? 4.944   -5.206  -2.221  1.00 48.06  ?  61  GLN H NE2 1 
ATOM   8926  N  N   . PRO H  1 62  ? 0.131   -6.417  -3.565  1.00 37.58  ?  62  PRO H N   1 
ATOM   8927  C  CA  . PRO H  1 62  ? -1.318  -6.636  -3.486  1.00 35.86  ?  62  PRO H CA  1 
ATOM   8928  C  C   . PRO H  1 62  ? -1.945  -5.556  -2.627  1.00 34.35  ?  62  PRO H C   1 
ATOM   8929  O  O   . PRO H  1 62  ? -1.290  -5.054  -1.696  1.00 34.79  ?  62  PRO H O   1 
ATOM   8930  C  CB  . PRO H  1 62  ? -1.423  -7.998  -2.793  1.00 35.43  ?  62  PRO H CB  1 
ATOM   8931  C  CG  . PRO H  1 62  ? -0.253  -8.716  -3.267  1.00 35.91  ?  62  PRO H CG  1 
ATOM   8932  C  CD  . PRO H  1 62  ? 0.867   -7.678  -3.378  1.00 37.53  ?  62  PRO H CD  1 
ATOM   8933  N  N   . GLN H  1 63  ? -3.175  -5.174  -2.945  1.00 32.28  ?  63  GLN H N   1 
ATOM   8934  C  CA  . GLN H  1 63  ? -3.840  -4.113  -2.197  1.00 30.16  ?  63  GLN H CA  1 
ATOM   8935  C  C   . GLN H  1 63  ? -5.067  -4.529  -1.413  1.00 29.21  ?  63  GLN H C   1 
ATOM   8936  O  O   . GLN H  1 63  ? -5.354  -3.943  -0.392  1.00 29.64  ?  63  GLN H O   1 
ATOM   8937  C  CB  . GLN H  1 63  ? -4.211  -2.973  -3.125  1.00 29.87  ?  63  GLN H CB  1 
ATOM   8938  C  CG  . GLN H  1 63  ? -3.121  -1.969  -3.344  1.00 28.82  ?  63  GLN H CG  1 
ATOM   8939  C  CD  . GLN H  1 63  ? -3.145  -1.400  -4.728  1.00 28.91  ?  63  GLN H CD  1 
ATOM   8940  O  OE1 . GLN H  1 63  ? -2.083  -1.213  -5.335  1.00 31.29  ?  63  GLN H OE1 1 
ATOM   8941  N  NE2 . GLN H  1 63  ? -4.349  -1.158  -5.270  1.00 22.21  ?  63  GLN H NE2 1 
ATOM   8942  N  N   . HIS H  1 64  ? -5.814  -5.500  -1.895  1.00 27.34  ?  64  HIS H N   1 
ATOM   8943  C  CA  . HIS H  1 64  ? -6.949  -5.966  -1.167  1.00 27.34  ?  64  HIS H CA  1 
ATOM   8944  C  C   . HIS H  1 64  ? -7.131  -7.426  -1.453  1.00 27.12  ?  64  HIS H C   1 
ATOM   8945  O  O   . HIS H  1 64  ? -6.740  -7.902  -2.519  1.00 28.01  ?  64  HIS H O   1 
ATOM   8946  C  CB  . HIS H  1 64  ? -8.227  -5.264  -1.602  1.00 27.89  ?  64  HIS H CB  1 
ATOM   8947  C  CG  . HIS H  1 64  ? -8.293  -3.826  -1.206  1.00 29.97  ?  64  HIS H CG  1 
ATOM   8948  N  ND1 . HIS H  1 64  ? -7.967  -2.805  -2.073  1.00 32.66  ?  64  HIS H ND1 1 
ATOM   8949  C  CD2 . HIS H  1 64  ? -8.637  -3.235  -0.036  1.00 30.96  ?  64  HIS H CD2 1 
ATOM   8950  C  CE1 . HIS H  1 64  ? -8.118  -1.644  -1.453  1.00 34.52  ?  64  HIS H CE1 1 
ATOM   8951  N  NE2 . HIS H  1 64  ? -8.519  -1.878  -0.215  1.00 32.74  ?  64  HIS H NE2 1 
ATOM   8952  N  N   . PHE H  1 65  ? -7.738  -8.133  -0.508  1.00 25.32  ?  65  PHE H N   1 
ATOM   8953  C  CA  . PHE H  1 65  ? -8.088  -9.504  -0.697  1.00 23.78  ?  65  PHE H CA  1 
ATOM   8954  C  C   . PHE H  1 65  ? -9.545  -9.555  -1.136  1.00 23.59  ?  65  PHE H C   1 
ATOM   8955  O  O   . PHE H  1 65  ? -10.403 -8.852  -0.594  1.00 22.35  ?  65  PHE H O   1 
ATOM   8956  C  CB  . PHE H  1 65  ? -7.883  -10.231 0.614   1.00 23.85  ?  65  PHE H CB  1 
ATOM   8957  C  CG  . PHE H  1 65  ? -8.312  -11.644 0.584   1.00 24.58  ?  65  PHE H CG  1 
ATO