data_3SMZ
# 
_entry.id   3SMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SMZ         
RCSB  RCSB066402   
WWPDB D_1000066402 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3h2u . unspecified 
PDB 3h2v . unspecified 
# 
_pdbx_database_status.entry_id                        3SMZ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rangarajan, E.S.' 1 
'Lee, J.H.'        2 
'Izard, T.'        3 
# 
_citation.id                        primary 
_citation.title                     'Apo raver1 structure reveals distinct RRM domain orientations.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            20 
_citation.page_first                1464 
_citation.page_last                 1470 
_citation.year                      2011 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21633983 
_citation.pdbx_database_id_DOI      10.1002/pro.664 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rangarajan, E.S.' 1 
primary 'Lee, J.H.'        2 
primary 'Izard, T.'        3 
# 
_cell.entry_id           3SMZ 
_cell.length_a           104.020 
_cell.length_b           104.020 
_cell.length_c           50.420 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SMZ 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonucleoprotein PTB-binding 1' 31587.953 1   ? ? 'Tandem RRM domains (UNP residues 39-320)' ? 
2 non-polymer syn 'SULFATE ION'                     96.063    2   ? ? ?                                          ? 
3 water       nat water                             18.015    235 ? ? ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein raver-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQS
RLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGK
PLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAE
EAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQS
RLRERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGK
PLGPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAE
EAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   LEU n 
1 4   ASP n 
1 5   PRO n 
1 6   GLU n 
1 7   GLU n 
1 8   ILE n 
1 9   ARG n 
1 10  LYS n 
1 11  ARG n 
1 12  LEU n 
1 13  GLU n 
1 14  HIS n 
1 15  THR n 
1 16  GLU n 
1 17  ARG n 
1 18  GLN n 
1 19  PHE n 
1 20  ARG n 
1 21  ASN n 
1 22  ARG n 
1 23  ARG n 
1 24  LYS n 
1 25  ILE n 
1 26  LEU n 
1 27  ILE n 
1 28  ARG n 
1 29  GLY n 
1 30  LEU n 
1 31  PRO n 
1 32  GLY n 
1 33  ASP n 
1 34  VAL n 
1 35  THR n 
1 36  ASN n 
1 37  GLN n 
1 38  GLU n 
1 39  VAL n 
1 40  HIS n 
1 41  ASP n 
1 42  LEU n 
1 43  LEU n 
1 44  SER n 
1 45  ASP n 
1 46  TYR n 
1 47  GLU n 
1 48  LEU n 
1 49  LYS n 
1 50  TYR n 
1 51  CYS n 
1 52  PHE n 
1 53  VAL n 
1 54  ASP n 
1 55  LYS n 
1 56  TYR n 
1 57  LYS n 
1 58  GLY n 
1 59  THR n 
1 60  ALA n 
1 61  PHE n 
1 62  VAL n 
1 63  THR n 
1 64  LEU n 
1 65  LEU n 
1 66  ASN n 
1 67  GLY n 
1 68  GLU n 
1 69  GLN n 
1 70  ALA n 
1 71  GLU n 
1 72  ALA n 
1 73  ALA n 
1 74  ILE n 
1 75  ASN n 
1 76  ALA n 
1 77  PHE n 
1 78  HIS n 
1 79  GLN n 
1 80  SER n 
1 81  ARG n 
1 82  LEU n 
1 83  ARG n 
1 84  GLU n 
1 85  ARG n 
1 86  GLU n 
1 87  LEU n 
1 88  SER n 
1 89  VAL n 
1 90  GLN n 
1 91  LEU n 
1 92  GLN n 
1 93  PRO n 
1 94  THR n 
1 95  ASP n 
1 96  ALA n 
1 97  LEU n 
1 98  LEU n 
1 99  CYS n 
1 100 VAL n 
1 101 ALA n 
1 102 ASN n 
1 103 LEU n 
1 104 PRO n 
1 105 PRO n 
1 106 SER n 
1 107 LEU n 
1 108 THR n 
1 109 GLN n 
1 110 GLN n 
1 111 GLN n 
1 112 PHE n 
1 113 GLU n 
1 114 GLU n 
1 115 LEU n 
1 116 VAL n 
1 117 ARG n 
1 118 PRO n 
1 119 PHE n 
1 120 GLY n 
1 121 SER n 
1 122 LEU n 
1 123 GLU n 
1 124 ARG n 
1 125 CYS n 
1 126 PHE n 
1 127 LEU n 
1 128 VAL n 
1 129 TYR n 
1 130 SER n 
1 131 GLU n 
1 132 ARG n 
1 133 THR n 
1 134 GLY n 
1 135 GLN n 
1 136 SER n 
1 137 LYS n 
1 138 GLY n 
1 139 TYR n 
1 140 GLY n 
1 141 PHE n 
1 142 ALA n 
1 143 GLU n 
1 144 TYR n 
1 145 MET n 
1 146 LYS n 
1 147 LYS n 
1 148 ASP n 
1 149 SER n 
1 150 ALA n 
1 151 ALA n 
1 152 ARG n 
1 153 ALA n 
1 154 LYS n 
1 155 SER n 
1 156 ASP n 
1 157 LEU n 
1 158 LEU n 
1 159 GLY n 
1 160 LYS n 
1 161 PRO n 
1 162 LEU n 
1 163 GLY n 
1 164 PRO n 
1 165 ARG n 
1 166 THR n 
1 167 LEU n 
1 168 TYR n 
1 169 VAL n 
1 170 HIS n 
1 171 TRP n 
1 172 THR n 
1 173 ASP n 
1 174 ALA n 
1 175 GLY n 
1 176 GLN n 
1 177 LEU n 
1 178 THR n 
1 179 PRO n 
1 180 ALA n 
1 181 LEU n 
1 182 LEU n 
1 183 HIS n 
1 184 SER n 
1 185 ARG n 
1 186 CYS n 
1 187 LEU n 
1 188 CYS n 
1 189 VAL n 
1 190 ASP n 
1 191 ARG n 
1 192 LEU n 
1 193 PRO n 
1 194 PRO n 
1 195 GLY n 
1 196 PHE n 
1 197 ASN n 
1 198 ASP n 
1 199 VAL n 
1 200 ASP n 
1 201 ALA n 
1 202 LEU n 
1 203 CYS n 
1 204 ARG n 
1 205 ALA n 
1 206 LEU n 
1 207 SER n 
1 208 ALA n 
1 209 VAL n 
1 210 HIS n 
1 211 SER n 
1 212 PRO n 
1 213 THR n 
1 214 PHE n 
1 215 CYS n 
1 216 GLN n 
1 217 LEU n 
1 218 ALA n 
1 219 CYS n 
1 220 GLY n 
1 221 GLN n 
1 222 ASP n 
1 223 GLY n 
1 224 GLN n 
1 225 LEU n 
1 226 LYS n 
1 227 GLY n 
1 228 PHE n 
1 229 ALA n 
1 230 VAL n 
1 231 LEU n 
1 232 GLU n 
1 233 TYR n 
1 234 GLU n 
1 235 THR n 
1 236 ALA n 
1 237 GLU n 
1 238 MET n 
1 239 ALA n 
1 240 GLU n 
1 241 GLU n 
1 242 ALA n 
1 243 GLN n 
1 244 GLN n 
1 245 GLN n 
1 246 ALA n 
1 247 ASP n 
1 248 GLY n 
1 249 LEU n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 GLY n 
1 254 SER n 
1 255 HIS n 
1 256 LEU n 
1 257 ARG n 
1 258 VAL n 
1 259 SER n 
1 260 PHE n 
1 261 CYS n 
1 262 ALA n 
1 263 PRO n 
1 264 GLY n 
1 265 PRO n 
1 266 PRO n 
1 267 GLY n 
1 268 ARG n 
1 269 SER n 
1 270 MET n 
1 271 LEU n 
1 272 ALA n 
1 273 ALA n 
1 274 LEU n 
1 275 ILE n 
1 276 ALA n 
1 277 ALA n 
1 278 GLN n 
1 279 ALA n 
1 280 THR n 
1 281 ALA n 
1 282 LEU n 
1 283 ASN n 
1 284 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KIAA1978, RAVER1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAVR1_HUMAN 
_struct_ref.pdbx_db_accession          Q8IY67 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;LDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINAFHQSRL
RERELSVQLQPTDALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPL
GPRTLYVHWTDAGQLTPALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEEA
QQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAAQATALNR
;
_struct_ref.pdbx_align_begin           39 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SMZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 284 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8IY67 
_struct_ref_seq.db_align_beg                  39 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  320 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       39 
_struct_ref_seq.pdbx_auth_seq_align_end       320 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SMZ HIS A 1 ? UNP Q8IY67 ? ? 'EXPRESSION TAG' 37 1 
1 3SMZ MET A 2 ? UNP Q8IY67 ? ? 'EXPRESSION TAG' 38 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SMZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   51.37 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 mM Tris-HCl (pH 8.5), 24% PEG 3350, 200 mM Lithium sulfate, Vapor diffusion, sitting drop, temperature 298K, VAPOR DIFFUSION, SITTING DROP
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-10-17 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     3SMZ 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             90.09 
_reflns.d_resolution_high            1.99 
_reflns.number_obs                   21054 
_reflns.number_all                   21480 
_reflns.percent_possible_obs         98.500 
_reflns.pdbx_Rmerge_I_obs            0.034 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        29.400 
_reflns.B_iso_Wilson_estimate        41.87 
_reflns.pdbx_redundancy              6.700 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.percent_possible_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_chi_squared 
1 1 1.99 2.1   90.0 0.503 ? 2.1  4.1 ? ? ? ? ? ? 
1 2 6.31 90.09 99.9 0.014 ? 94.8 6.9 ? ? ? ? ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3SMZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     21009 
_refine.ls_number_reflns_all                     21033 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.99 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1877 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1853 
_refine.ls_R_factor_R_free                       0.2327 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1051 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            0.500 
_refine.occupancy_max                            1.000 
_refine.correlation_coeff_Fo_to_Fc               0.9540 
_refine.correlation_coeff_Fo_to_Fc_free          0.9363 
_refine.B_iso_mean                               57.38 
_refine.aniso_B[1][1]                            -4.3112 
_refine.aniso_B[2][2]                            -4.3112 
_refine.aniso_B[3][3]                            8.6225 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'used TLS refinement' 
_refine.pdbx_starting_model                      'PDB ENTRY 3H2U, chain B' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3SMZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.306 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2183 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             235 
_refine_hist.number_atoms_total               2428 
_refine_hist.d_res_high                       1.99 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  2263 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.05  ? 2.00  3065 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1069 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  58   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  337  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 2263 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           3.580 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           2.900 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.000 281  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.000 2610 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   11 
_refine_ls_shell.d_res_high                       1.99 
_refine_ls_shell.d_res_low                        2.09 
_refine_ls_shell.number_reflns_R_work             2245 
_refine_ls_shell.R_factor_R_work                  0.2236 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2381 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.87 
_refine_ls_shell.number_reflns_R_free             115 
_refine_ls_shell.number_reflns_all                2360 
_refine_ls_shell.R_factor_all                     0.2243 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    3SMZ 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  3SMZ 
_struct.title                     'Human raver1 RRM1-3 domains (residues 39-320)' 
_struct.pdbx_descriptor           'Ribonucleoprotein PTB-binding 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SMZ 
_struct_keywords.text            
'RNA binding, ribonucleoprotein, RNA recognition motif, vinculin, alpha-actinin, nucleus, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4   ? ASN A 21  ? ASP A 40  ASN A 57  1 ? 18 
HELX_P HELX_P2  2  THR A 35  ? LEU A 43  ? THR A 71  LEU A 79  1 ? 9  
HELX_P HELX_P3  3  ASN A 66  ? HIS A 78  ? ASN A 102 HIS A 114 1 ? 13 
HELX_P HELX_P4  4  THR A 108 ? ARG A 117 ? THR A 144 ARG A 153 1 ? 10 
HELX_P HELX_P5  5  PRO A 118 ? GLY A 120 ? PRO A 154 GLY A 156 5 ? 3  
HELX_P HELX_P6  6  LYS A 146 ? LEU A 158 ? LYS A 182 LEU A 194 1 ? 13 
HELX_P HELX_P7  7  ASP A 173 ? LEU A 177 ? ASP A 209 LEU A 213 5 ? 5  
HELX_P HELX_P8  8  ASP A 198 ? LEU A 206 ? ASP A 234 LEU A 242 1 ? 9  
HELX_P HELX_P9  9  THR A 235 ? ASP A 247 ? THR A 271 ASP A 283 1 ? 13 
HELX_P HELX_P10 10 PRO A 266 ? GLN A 278 ? PRO A 302 GLN A 314 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            203 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            215 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             239 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             251 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.038 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 48  ? ASP A 54  ? LEU A 84  ASP A 90  
A 2 THR A 59  ? LEU A 64  ? THR A 95  LEU A 100 
A 3 LYS A 24  ? ARG A 28  ? LYS A 60  ARG A 64  
A 4 SER A 88  ? LEU A 91  ? SER A 124 LEU A 127 
B 1 ARG A 81  ? LEU A 82  ? ARG A 117 LEU A 118 
B 2 ARG A 85  ? GLU A 86  ? ARG A 121 GLU A 122 
C 1 LEU A 122 ? TYR A 129 ? LEU A 158 TYR A 165 
C 2 SER A 136 ? TYR A 144 ? SER A 172 TYR A 180 
C 3 LEU A 97  ? ALA A 101 ? LEU A 133 ALA A 137 
C 4 TYR A 168 ? TRP A 171 ? TYR A 204 TRP A 207 
D 1 PRO A 161 ? LEU A 162 ? PRO A 197 LEU A 198 
D 2 ARG A 165 ? THR A 166 ? ARG A 201 THR A 202 
E 1 PHE A 214 ? CYS A 219 ? PHE A 250 CYS A 255 
E 2 LEU A 225 ? GLU A 232 ? LEU A 261 GLU A 268 
E 3 CYS A 186 ? ASP A 190 ? CYS A 222 ASP A 226 
E 4 ARG A 257 ? PHE A 260 ? ARG A 293 PHE A 296 
F 1 SER A 250 ? LEU A 251 ? SER A 286 LEU A 287 
F 2 SER A 254 ? HIS A 255 ? SER A 290 HIS A 291 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASP A 54  ? N ASP A 90  O THR A 59  ? O THR A 95  
A 2 3 O VAL A 62  ? O VAL A 98  N ILE A 25  ? N ILE A 61  
A 3 4 N ARG A 28  ? N ARG A 64  O SER A 88  ? O SER A 124 
B 1 2 N LEU A 82  ? N LEU A 118 O ARG A 85  ? O ARG A 121 
C 1 2 N GLU A 123 ? N GLU A 159 O GLU A 143 ? O GLU A 179 
C 2 3 O GLY A 140 ? O GLY A 176 N VAL A 100 ? N VAL A 136 
C 3 4 N ALA A 101 ? N ALA A 137 O TYR A 168 ? O TYR A 204 
D 1 2 N LEU A 162 ? N LEU A 198 O ARG A 165 ? O ARG A 201 
E 1 2 N ALA A 218 ? N ALA A 254 O PHE A 228 ? O PHE A 264 
E 2 3 O ALA A 229 ? O ALA A 265 N VAL A 189 ? N VAL A 225 
E 3 4 N CYS A 188 ? N CYS A 224 O SER A 259 ? O SER A 295 
F 1 2 N LEU A 251 ? N LEU A 287 O SER A 254 ? O SER A 290 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 1' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLY A 32  ? GLY A 68  . ? 1_555 ? 
2 AC1 2 ARG A 85  ? ARG A 121 . ? 1_555 ? 
3 AC2 7 ARG A 23  ? ARG A 59  . ? 1_555 ? 
4 AC2 7 LYS A 24  ? LYS A 60  . ? 1_555 ? 
5 AC2 7 LYS A 49  ? LYS A 85  . ? 1_555 ? 
6 AC2 7 LYS A 160 ? LYS A 196 . ? 3_565 ? 
7 AC2 7 HOH D .   ? HOH A 516 . ? 1_555 ? 
8 AC2 7 HOH D .   ? HOH A 524 . ? 1_555 ? 
9 AC2 7 HOH D .   ? HOH A 537 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3SMZ 
_atom_sites.fract_transf_matrix[1][1]   0.009614 
_atom_sites.fract_transf_matrix[1][2]   0.005550 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011101 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019833 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 1   ? 20.780 90.268 4.130   1.00 100.31 ? 37  HIS A N   1 
ATOM   2    C CA  . HIS A 1 1   ? 21.215 88.908 3.826   1.00 97.37  ? 37  HIS A CA  1 
ATOM   3    C C   . HIS A 1 1   ? 21.991 88.286 4.994   1.00 98.95  ? 37  HIS A C   1 
ATOM   4    O O   . HIS A 1 1   ? 22.208 87.074 4.998   1.00 96.59  ? 37  HIS A O   1 
ATOM   5    C CB  . HIS A 1 1   ? 22.060 88.880 2.543   1.00 98.87  ? 37  HIS A CB  1 
ATOM   6    C CG  . HIS A 1 1   ? 21.548 87.910 1.524   1.00 99.09  ? 37  HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 1   ? 20.393 88.163 0.802   1.00 99.11  ? 37  HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 1   ? 22.044 86.710 1.147   1.00 99.32  ? 37  HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 1   ? 20.226 87.115 0.014   1.00 95.87  ? 37  HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 1   ? 21.194 86.215 0.185   1.00 96.29  ? 37  HIS A NE2 1 
ATOM   11   N N   . MET A 1 2   ? 22.393 89.104 5.982   1.00 95.73  ? 38  MET A N   1 
ATOM   12   C CA  . MET A 1 2   ? 23.108 88.626 7.163   1.00 95.42  ? 38  MET A CA  1 
ATOM   13   C C   . MET A 1 2   ? 22.120 88.503 8.331   1.00 92.90  ? 38  MET A C   1 
ATOM   14   O O   . MET A 1 2   ? 21.518 89.503 8.739   1.00 94.25  ? 38  MET A O   1 
ATOM   15   C CB  . MET A 1 2   ? 24.289 89.566 7.511   1.00 102.62 ? 38  MET A CB  1 
ATOM   16   C CG  . MET A 1 2   ? 25.269 89.003 8.546   1.00 108.29 ? 38  MET A CG  1 
ATOM   17   S SD  . MET A 1 2   ? 26.308 87.643 7.939   1.00 111.10 ? 38  MET A SD  1 
ATOM   18   C CE  . MET A 1 2   ? 27.206 87.228 9.442   1.00 109.83 ? 38  MET A CE  1 
ATOM   19   N N   . LEU A 1 3   ? 21.920 87.271 8.831   1.00 81.89  ? 39  LEU A N   1 
ATOM   20   C CA  . LEU A 1 3   ? 21.044 87.023 9.981   1.00 78.95  ? 39  LEU A CA  1 
ATOM   21   C C   . LEU A 1 3   ? 21.868 87.231 11.256  1.00 83.26  ? 39  LEU A C   1 
ATOM   22   O O   . LEU A 1 3   ? 23.097 87.210 11.171  1.00 83.31  ? 39  LEU A O   1 
ATOM   23   C CB  . LEU A 1 3   ? 20.430 85.606 9.920   1.00 74.42  ? 39  LEU A CB  1 
ATOM   24   C CG  . LEU A 1 3   ? 19.603 85.254 8.673   1.00 74.78  ? 39  LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 3   ? 19.367 83.758 8.586   1.00 71.40  ? 39  LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 3   ? 18.277 86.007 8.638   1.00 74.71  ? 39  LEU A CD2 1 
ATOM   27   N N   . ASP A 1 4   ? 21.227 87.469 12.423  1.00 81.22  ? 40  ASP A N   1 
ATOM   28   C CA  . ASP A 1 4   ? 21.997 87.674 13.656  1.00 85.13  ? 40  ASP A CA  1 
ATOM   29   C C   . ASP A 1 4   ? 22.714 86.369 14.067  1.00 86.70  ? 40  ASP A C   1 
ATOM   30   O O   . ASP A 1 4   ? 22.208 85.279 13.763  1.00 83.20  ? 40  ASP A O   1 
ATOM   31   C CB  . ASP A 1 4   ? 21.162 88.257 14.820  1.00 90.14  ? 40  ASP A CB  1 
ATOM   32   C CG  . ASP A 1 4   ? 19.827 87.604 15.098  1.00 103.78 ? 40  ASP A CG  1 
ATOM   33   O OD1 . ASP A 1 4   ? 19.805 86.383 15.345  1.00 102.44 ? 40  ASP A OD1 1 
ATOM   34   O OD2 . ASP A 1 4   ? 18.816 88.337 15.178  1.00 114.60 ? 40  ASP A OD2 1 
ATOM   35   N N   . PRO A 1 5   ? 23.921 86.465 14.684  1.00 84.08  ? 41  PRO A N   1 
ATOM   36   C CA  . PRO A 1 5   ? 24.683 85.252 15.033  1.00 82.68  ? 41  PRO A CA  1 
ATOM   37   C C   . PRO A 1 5   ? 23.917 84.208 15.858  1.00 83.27  ? 41  PRO A C   1 
ATOM   38   O O   . PRO A 1 5   ? 24.339 83.057 15.875  1.00 79.71  ? 41  PRO A O   1 
ATOM   39   C CB  . PRO A 1 5   ? 25.871 85.804 15.839  1.00 88.58  ? 41  PRO A CB  1 
ATOM   40   C CG  . PRO A 1 5   ? 25.478 87.197 16.217  1.00 96.20  ? 41  PRO A CG  1 
ATOM   41   C CD  . PRO A 1 5   ? 24.674 87.674 15.071  1.00 90.09  ? 41  PRO A CD  1 
ATOM   42   N N   . GLU A 1 6   ? 22.810 84.614 16.529  1.00 80.90  ? 42  GLU A N   1 
ATOM   43   C CA  . GLU A 1 6   ? 21.942 83.760 17.344  1.00 79.17  ? 42  GLU A CA  1 
ATOM   44   C C   . GLU A 1 6   ? 21.068 82.891 16.430  1.00 77.93  ? 42  GLU A C   1 
ATOM   45   O O   . GLU A 1 6   ? 20.914 81.705 16.700  1.00 74.25  ? 42  GLU A O   1 
ATOM   46   C CB  . GLU A 1 6   ? 21.075 84.611 18.299  1.00 82.89  ? 42  GLU A CB  1 
ATOM   47   C CG  . GLU A 1 6   ? 20.305 83.822 19.350  1.00 91.70  ? 42  GLU A CG  1 
ATOM   48   C CD  . GLU A 1 6   ? 19.357 84.654 20.194  1.00 115.24 ? 42  GLU A CD  1 
ATOM   49   O OE1 . GLU A 1 6   ? 19.843 85.412 21.065  1.00 119.17 ? 42  GLU A OE1 1 
ATOM   50   O OE2 . GLU A 1 6   ? 18.126 84.539 19.994  1.00 102.62 ? 42  GLU A OE2 1 
ATOM   51   N N   . GLU A 1 7   ? 20.500 83.484 15.360  1.00 74.90  ? 43  GLU A N   1 
ATOM   52   C CA  . GLU A 1 7   ? 19.665 82.772 14.388  1.00 71.26  ? 43  GLU A CA  1 
ATOM   53   C C   . GLU A 1 7   ? 20.504 81.766 13.614  1.00 71.41  ? 43  GLU A C   1 
ATOM   54   O O   . GLU A 1 7   ? 20.076 80.624 13.464  1.00 68.79  ? 43  GLU A O   1 
ATOM   55   C CB  . GLU A 1 7   ? 18.968 83.737 13.419  1.00 72.70  ? 43  GLU A CB  1 
ATOM   56   C CG  . GLU A 1 7   ? 17.444 83.727 13.478  1.00 82.99  ? 43  GLU A CG  1 
ATOM   57   C CD  . GLU A 1 7   ? 16.715 82.395 13.522  1.00 82.29  ? 43  GLU A CD  1 
ATOM   58   O OE1 . GLU A 1 7   ? 16.683 81.685 12.489  1.00 69.01  ? 43  GLU A OE1 1 
ATOM   59   O OE2 . GLU A 1 7   ? 16.115 82.096 14.580  1.00 63.12  ? 43  GLU A OE2 1 
ATOM   60   N N   . ILE A 1 8   ? 21.715 82.181 13.175  1.00 67.90  ? 44  ILE A N   1 
ATOM   61   C CA  . ILE A 1 8   ? 22.677 81.350 12.452  1.00 65.99  ? 44  ILE A CA  1 
ATOM   62   C C   . ILE A 1 8   ? 23.013 80.108 13.301  1.00 69.81  ? 44  ILE A C   1 
ATOM   63   O O   . ILE A 1 8   ? 22.902 78.993 12.786  1.00 68.11  ? 44  ILE A O   1 
ATOM   64   C CB  . ILE A 1 8   ? 23.939 82.156 12.037  1.00 71.28  ? 44  ILE A CB  1 
ATOM   65   C CG1 . ILE A 1 8   ? 23.570 83.240 10.991  1.00 71.66  ? 44  ILE A CG1 1 
ATOM   66   C CG2 . ILE A 1 8   ? 25.037 81.230 11.493  1.00 71.85  ? 44  ILE A CG2 1 
ATOM   67   C CD1 . ILE A 1 8   ? 24.649 84.300 10.723  1.00 81.11  ? 44  ILE A CD1 1 
ATOM   68   N N   . ARG A 1 9   ? 23.347 80.294 14.602  1.00 68.38  ? 45  ARG A N   1 
ATOM   69   C CA  . ARG A 1 9   ? 23.665 79.188 15.520  1.00 67.24  ? 45  ARG A CA  1 
ATOM   70   C C   . ARG A 1 9   ? 22.508 78.165 15.553  1.00 65.45  ? 45  ARG A C   1 
ATOM   71   O O   . ARG A 1 9   ? 22.742 76.996 15.256  1.00 62.47  ? 45  ARG A O   1 
ATOM   72   C CB  . ARG A 1 9   ? 24.002 79.687 16.937  1.00 68.62  ? 45  ARG A CB  1 
ATOM   73   C CG  . ARG A 1 9   ? 25.417 80.241 17.073  1.00 79.62  ? 45  ARG A CG  1 
ATOM   74   C CD  . ARG A 1 9   ? 25.846 80.505 18.516  1.00 81.26  ? 45  ARG A CD  1 
ATOM   75   N NE  . ARG A 1 9   ? 24.988 81.470 19.211  1.00 76.53  ? 45  ARG A NE  1 
ATOM   76   C CZ  . ARG A 1 9   ? 25.198 82.781 19.239  1.00 101.01 ? 45  ARG A CZ  1 
ATOM   77   N NH1 . ARG A 1 9   ? 26.236 83.309 18.602  1.00 97.65  ? 45  ARG A NH1 1 
ATOM   78   N NH2 . ARG A 1 9   ? 24.368 83.577 19.902  1.00 91.54  ? 45  ARG A NH2 1 
ATOM   79   N N   . LYS A 1 10  ? 21.266 78.639 15.822  1.00 60.13  ? 46  LYS A N   1 
ATOM   80   C CA  . LYS A 1 10  ? 20.031 77.858 15.899  1.00 56.70  ? 46  LYS A CA  1 
ATOM   81   C C   . LYS A 1 10  ? 19.811 77.024 14.619  1.00 56.66  ? 46  LYS A C   1 
ATOM   82   O O   . LYS A 1 10  ? 19.514 75.839 14.726  1.00 54.08  ? 46  LYS A O   1 
ATOM   83   C CB  . LYS A 1 10  ? 18.833 78.796 16.163  1.00 60.20  ? 46  LYS A CB  1 
ATOM   84   C CG  . LYS A 1 10  ? 17.469 78.101 16.178  1.00 68.69  ? 46  LYS A CG  1 
ATOM   85   C CD  . LYS A 1 10  ? 16.369 79.005 16.705  1.00 80.28  ? 46  LYS A CD  1 
ATOM   86   C CE  . LYS A 1 10  ? 15.024 78.319 16.654  1.00 85.98  ? 46  LYS A CE  1 
ATOM   87   N NZ  . LYS A 1 10  ? 13.953 79.165 17.238  1.00 99.05  ? 46  LYS A NZ  1 
ATOM   88   N N   . ARG A 1 11  ? 19.989 77.640 13.431  1.00 51.21  ? 47  ARG A N   1 
ATOM   89   C CA  . ARG A 1 11  ? 19.813 77.007 12.126  1.00 48.13  ? 47  ARG A CA  1 
ATOM   90   C C   . ARG A 1 11  ? 20.875 75.939 11.864  1.00 51.52  ? 47  ARG A C   1 
ATOM   91   O O   . ARG A 1 11  ? 20.520 74.785 11.599  1.00 45.55  ? 47  ARG A O   1 
ATOM   92   C CB  . ARG A 1 11  ? 19.827 78.068 11.005  1.00 46.12  ? 47  ARG A CB  1 
ATOM   93   C CG  . ARG A 1 11  ? 18.535 78.858 10.940  1.00 49.36  ? 47  ARG A CG  1 
ATOM   94   C CD  . ARG A 1 11  ? 18.585 79.977 9.924   1.00 50.15  ? 47  ARG A CD  1 
ATOM   95   N NE  . ARG A 1 11  ? 17.296 80.670 9.852   1.00 62.85  ? 47  ARG A NE  1 
ATOM   96   C CZ  . ARG A 1 11  ? 16.759 81.177 8.742   1.00 69.84  ? 47  ARG A CZ  1 
ATOM   97   N NH1 . ARG A 1 11  ? 17.407 81.100 7.584   1.00 45.93  ? 47  ARG A NH1 1 
ATOM   98   N NH2 . ARG A 1 11  ? 15.573 81.766 8.783   1.00 51.31  ? 47  ARG A NH2 1 
ATOM   99   N N   . LEU A 1 12  ? 22.174 76.297 12.014  1.00 52.71  ? 48  LEU A N   1 
ATOM   100  C CA  . LEU A 1 12  ? 23.266 75.362 11.732  1.00 52.38  ? 48  LEU A CA  1 
ATOM   101  C C   . LEU A 1 12  ? 23.237 74.139 12.637  1.00 57.25  ? 48  LEU A C   1 
ATOM   102  O O   . LEU A 1 12  ? 23.441 73.027 12.143  1.00 56.53  ? 48  LEU A O   1 
ATOM   103  C CB  . LEU A 1 12  ? 24.639 76.043 11.771  1.00 54.66  ? 48  LEU A CB  1 
ATOM   104  C CG  . LEU A 1 12  ? 24.872 77.137 10.702  1.00 59.57  ? 48  LEU A CG  1 
ATOM   105  C CD1 . LEU A 1 12  ? 26.278 77.730 10.826  1.00 62.69  ? 48  LEU A CD1 1 
ATOM   106  C CD2 . LEU A 1 12  ? 24.603 76.620 9.272   1.00 57.57  ? 48  LEU A CD2 1 
ATOM   107  N N   . GLU A 1 13  ? 22.880 74.334 13.912  1.00 54.01  ? 49  GLU A N   1 
ATOM   108  C CA  . GLU A 1 13  ? 22.777 73.278 14.914  1.00 52.75  ? 49  GLU A CA  1 
ATOM   109  C C   . GLU A 1 13  ? 21.587 72.368 14.656  1.00 51.59  ? 49  GLU A C   1 
ATOM   110  O O   . GLU A 1 13  ? 21.714 71.172 14.866  1.00 49.43  ? 49  GLU A O   1 
ATOM   111  C CB  . GLU A 1 13  ? 22.691 73.870 16.324  1.00 56.03  ? 49  GLU A CB  1 
ATOM   112  C CG  . GLU A 1 13  ? 24.057 74.187 16.899  1.00 70.92  ? 49  GLU A CG  1 
ATOM   113  C CD  . GLU A 1 13  ? 24.053 75.191 18.035  1.00 100.02 ? 49  GLU A CD  1 
ATOM   114  O OE1 . GLU A 1 13  ? 23.234 75.034 18.970  1.00 93.47  ? 49  GLU A OE1 1 
ATOM   115  O OE2 . GLU A 1 13  ? 24.880 76.131 17.995  1.00 100.29 ? 49  GLU A OE2 1 
ATOM   116  N N   . HIS A 1 14  ? 20.439 72.919 14.232  1.00 49.10  ? 50  HIS A N   1 
ATOM   117  C CA  . HIS A 1 14  ? 19.259 72.102 13.909  1.00 47.24  ? 50  HIS A CA  1 
ATOM   118  C C   . HIS A 1 14  ? 19.583 71.176 12.720  1.00 46.77  ? 50  HIS A C   1 
ATOM   119  O O   . HIS A 1 14  ? 19.331 69.975 12.806  1.00 43.36  ? 50  HIS A O   1 
ATOM   120  C CB  . HIS A 1 14  ? 18.023 72.972 13.619  1.00 48.67  ? 50  HIS A CB  1 
ATOM   121  C CG  . HIS A 1 14  ? 16.754 72.177 13.567  1.00 51.16  ? 50  HIS A CG  1 
ATOM   122  N ND1 . HIS A 1 14  ? 16.389 71.462 12.430  1.00 51.19  ? 50  HIS A ND1 1 
ATOM   123  C CD2 . HIS A 1 14  ? 15.822 71.974 14.528  1.00 53.84  ? 50  HIS A CD2 1 
ATOM   124  C CE1 . HIS A 1 14  ? 15.249 70.861 12.734  1.00 50.09  ? 50  HIS A CE1 1 
ATOM   125  N NE2 . HIS A 1 14  ? 14.864 71.144 13.984  1.00 51.91  ? 50  HIS A NE2 1 
ATOM   126  N N   . THR A 1 15  ? 20.173 71.725 11.635  1.00 43.67  ? 51  THR A N   1 
ATOM   127  C CA  . THR A 1 15  ? 20.565 70.930 10.457  1.00 40.95  ? 51  THR A CA  1 
ATOM   128  C C   . THR A 1 15  ? 21.573 69.836 10.858  1.00 43.31  ? 51  THR A C   1 
ATOM   129  O O   . THR A 1 15  ? 21.387 68.691 10.459  1.00 40.27  ? 51  THR A O   1 
ATOM   130  C CB  . THR A 1 15  ? 21.105 71.832 9.349   1.00 41.66  ? 51  THR A CB  1 
ATOM   131  O OG1 . THR A 1 15  ? 19.968 72.474 8.769   1.00 44.36  ? 51  THR A OG1 1 
ATOM   132  C CG2 . THR A 1 15  ? 21.856 71.047 8.247   1.00 38.63  ? 51  THR A CG2 1 
ATOM   133  N N   . GLU A 1 16  ? 22.627 70.198 11.629  1.00 43.85  ? 52  GLU A N   1 
ATOM   134  C CA  . GLU A 1 16  ? 23.664 69.278 12.101  1.00 45.34  ? 52  GLU A CA  1 
ATOM   135  C C   . GLU A 1 16  ? 23.036 68.101 12.860  1.00 47.40  ? 52  GLU A C   1 
ATOM   136  O O   . GLU A 1 16  ? 23.316 66.949 12.527  1.00 44.79  ? 52  GLU A O   1 
ATOM   137  C CB  . GLU A 1 16  ? 24.677 70.031 12.991  1.00 49.93  ? 52  GLU A CB  1 
ATOM   138  C CG  . GLU A 1 16  ? 26.001 69.311 13.201  1.00 67.61  ? 52  GLU A CG  1 
ATOM   139  C CD  . GLU A 1 16  ? 26.894 69.266 11.976  1.00 101.57 ? 52  GLU A CD  1 
ATOM   140  O OE1 . GLU A 1 16  ? 27.384 70.341 11.555  1.00 102.46 ? 52  GLU A OE1 1 
ATOM   141  O OE2 . GLU A 1 16  ? 27.090 68.157 11.426  1.00 99.04  ? 52  GLU A OE2 1 
ATOM   142  N N   . ARG A 1 17  ? 22.168 68.420 13.856  1.00 45.45  ? 53  ARG A N   1 
ATOM   143  C CA  A ARG A 1 17  ? 21.424 67.477 14.701  0.50 44.44  ? 53  ARG A CA  1 
ATOM   144  C CA  B ARG A 1 17  ? 21.463 67.439 14.691  0.50 44.62  ? 53  ARG A CA  1 
ATOM   145  C C   . ARG A 1 17  ? 20.567 66.546 13.815  1.00 44.78  ? 53  ARG A C   1 
ATOM   146  O O   . ARG A 1 17  ? 20.573 65.324 13.980  1.00 41.26  ? 53  ARG A O   1 
ATOM   147  C CB  A ARG A 1 17  ? 20.545 68.307 15.664  0.50 46.64  ? 53  ARG A CB  1 
ATOM   148  C CB  B ARG A 1 17  ? 20.634 68.161 15.774  0.50 47.91  ? 53  ARG A CB  1 
ATOM   149  C CG  A ARG A 1 17  ? 19.807 67.570 16.779  0.50 54.01  ? 53  ARG A CG  1 
ATOM   150  C CG  B ARG A 1 17  ? 20.241 67.297 16.966  0.50 59.44  ? 53  ARG A CG  1 
ATOM   151  C CD  A ARG A 1 17  ? 19.489 68.512 17.942  0.50 62.56  ? 53  ARG A CD  1 
ATOM   152  C CD  B ARG A 1 17  ? 19.490 68.109 18.006  0.50 68.95  ? 53  ARG A CD  1 
ATOM   153  N NE  A ARG A 1 17  ? 18.524 69.568 17.601  0.50 63.08  ? 53  ARG A NE  1 
ATOM   154  N NE  B ARG A 1 17  ? 19.327 67.380 19.266  0.50 73.40  ? 53  ARG A NE  1 
ATOM   155  C CZ  A ARG A 1 17  ? 18.834 70.851 17.416  0.50 76.80  ? 53  ARG A CZ  1 
ATOM   156  C CZ  B ARG A 1 17  ? 20.087 67.560 20.342  0.50 89.40  ? 53  ARG A CZ  1 
ATOM   157  N NH1 A ARG A 1 17  ? 20.092 71.261 17.527  0.50 70.45  ? 53  ARG A NH1 1 
ATOM   158  N NH1 B ARG A 1 17  ? 21.069 68.454 20.332  0.50 77.94  ? 53  ARG A NH1 1 
ATOM   159  N NH2 A ARG A 1 17  ? 17.889 71.730 17.118  0.50 59.91  ? 53  ARG A NH2 1 
ATOM   160  N NH2 B ARG A 1 17  ? 19.865 66.853 21.442  0.50 77.20  ? 53  ARG A NH2 1 
ATOM   161  N N   . GLN A 1 18  ? 19.833 67.136 12.860  1.00 41.74  ? 54  GLN A N   1 
ATOM   162  C CA  . GLN A 1 18  ? 18.985 66.372 11.957  1.00 39.26  ? 54  GLN A CA  1 
ATOM   163  C C   . GLN A 1 18  ? 19.829 65.434 11.087  1.00 40.45  ? 54  GLN A C   1 
ATOM   164  O O   . GLN A 1 18  ? 19.518 64.243 11.013  1.00 37.41  ? 54  GLN A O   1 
ATOM   165  C CB  . GLN A 1 18  ? 18.129 67.314 11.085  1.00 40.08  ? 54  GLN A CB  1 
ATOM   166  C CG  . GLN A 1 18  ? 16.879 67.843 11.797  1.00 44.97  ? 54  GLN A CG  1 
ATOM   167  C CD  . GLN A 1 18  ? 15.875 66.750 12.130  1.00 54.29  ? 54  GLN A CD  1 
ATOM   168  O OE1 . GLN A 1 18  ? 15.652 65.801 11.355  1.00 42.69  ? 54  GLN A OE1 1 
ATOM   169  N NE2 . GLN A 1 18  ? 15.234 66.861 13.295  1.00 43.97  ? 54  GLN A NE2 1 
ATOM   170  N N   . PHE A 1 19  ? 20.904 65.956 10.458  1.00 38.56  ? 55  PHE A N   1 
ATOM   171  C CA  . PHE A 1 19  ? 21.763 65.159 9.575   1.00 38.42  ? 55  PHE A CA  1 
ATOM   172  C C   . PHE A 1 19  ? 22.370 63.970 10.322  1.00 42.65  ? 55  PHE A C   1 
ATOM   173  O O   . PHE A 1 19  ? 22.335 62.858 9.801   1.00 41.29  ? 55  PHE A O   1 
ATOM   174  C CB  . PHE A 1 19  ? 22.886 66.017 8.936   1.00 41.76  ? 55  PHE A CB  1 
ATOM   175  C CG  . PHE A 1 19  ? 23.888 65.186 8.160   1.00 44.75  ? 55  PHE A CG  1 
ATOM   176  C CD1 . PHE A 1 19  ? 23.572 64.674 6.904   1.00 47.98  ? 55  PHE A CD1 1 
ATOM   177  C CD2 . PHE A 1 19  ? 25.131 64.878 8.704   1.00 50.04  ? 55  PHE A CD2 1 
ATOM   178  C CE1 . PHE A 1 19  ? 24.476 63.861 6.207   1.00 49.69  ? 55  PHE A CE1 1 
ATOM   179  C CE2 . PHE A 1 19  ? 26.038 64.069 8.005   1.00 54.38  ? 55  PHE A CE2 1 
ATOM   180  C CZ  . PHE A 1 19  ? 25.703 63.568 6.759   1.00 51.38  ? 55  PHE A CZ  1 
ATOM   181  N N   . ARG A 1 20  ? 22.930 64.215 11.534  1.00 41.56  ? 56  ARG A N   1 
ATOM   182  C CA  . ARG A 1 20  ? 23.602 63.206 12.350  1.00 42.40  ? 56  ARG A CA  1 
ATOM   183  C C   . ARG A 1 20  ? 22.637 62.228 13.016  1.00 47.27  ? 56  ARG A C   1 
ATOM   184  O O   . ARG A 1 20  ? 23.105 61.261 13.610  1.00 48.20  ? 56  ARG A O   1 
ATOM   185  C CB  . ARG A 1 20  ? 24.493 63.870 13.429  1.00 44.20  ? 56  ARG A CB  1 
ATOM   186  C CG  . ARG A 1 20  ? 25.635 64.699 12.844  1.00 56.28  ? 56  ARG A CG  1 
ATOM   187  C CD  . ARG A 1 20  ? 26.861 64.710 13.728  1.00 75.65  ? 56  ARG A CD  1 
ATOM   188  N NE  . ARG A 1 20  ? 27.925 65.582 13.222  1.00 92.32  ? 56  ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 20  ? 28.751 65.279 12.222  1.00 108.20 ? 56  ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 20  ? 28.615 64.136 11.557  1.00 88.62  ? 56  ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 20  ? 29.700 66.133 11.857  1.00 100.44 ? 56  ARG A NH2 1 
ATOM   192  N N   . ASN A 1 21  ? 21.314 62.449 12.923  1.00 43.33  ? 57  ASN A N   1 
ATOM   193  C CA  . ASN A 1 21  ? 20.335 61.569 13.549  1.00 42.80  ? 57  ASN A CA  1 
ATOM   194  C C   . ASN A 1 21  ? 20.098 60.286 12.719  1.00 44.14  ? 57  ASN A C   1 
ATOM   195  O O   . ASN A 1 21  ? 19.049 60.084 12.106  1.00 43.44  ? 57  ASN A O   1 
ATOM   196  C CB  . ASN A 1 21  ? 19.026 62.300 13.830  1.00 44.60  ? 57  ASN A CB  1 
ATOM   197  C CG  . ASN A 1 21  ? 18.117 61.491 14.721  1.00 65.88  ? 57  ASN A CG  1 
ATOM   198  O OD1 . ASN A 1 21  ? 18.540 60.930 15.740  1.00 64.84  ? 57  ASN A OD1 1 
ATOM   199  N ND2 . ASN A 1 21  ? 16.887 61.301 14.283  1.00 54.68  ? 57  ASN A ND2 1 
ATOM   200  N N   . ARG A 1 22  ? 21.108 59.432 12.706  1.00 40.62  ? 58  ARG A N   1 
ATOM   201  C CA  . ARG A 1 22  ? 21.148 58.140 12.018  1.00 38.79  ? 58  ARG A CA  1 
ATOM   202  C C   . ARG A 1 22  ? 21.568 57.153 13.105  1.00 40.62  ? 58  ARG A C   1 
ATOM   203  O O   . ARG A 1 22  ? 22.765 57.037 13.412  1.00 39.61  ? 58  ARG A O   1 
ATOM   204  C CB  . ARG A 1 22  ? 22.093 58.198 10.817  1.00 38.46  ? 58  ARG A CB  1 
ATOM   205  C CG  . ARG A 1 22  ? 21.495 58.985 9.660   1.00 49.28  ? 58  ARG A CG  1 
ATOM   206  C CD  . ARG A 1 22  ? 22.177 58.690 8.350   1.00 48.54  ? 58  ARG A CD  1 
ATOM   207  N NE  . ARG A 1 22  ? 21.719 57.444 7.732   1.00 50.59  ? 58  ARG A NE  1 
ATOM   208  C CZ  . ARG A 1 22  ? 22.336 56.858 6.709   1.00 50.52  ? 58  ARG A CZ  1 
ATOM   209  N NH1 . ARG A 1 22  ? 23.455 57.372 6.219   1.00 40.50  ? 58  ARG A NH1 1 
ATOM   210  N NH2 . ARG A 1 22  ? 21.851 55.741 6.185   1.00 46.42  ? 58  ARG A NH2 1 
ATOM   211  N N   . ARG A 1 23  ? 20.551 56.491 13.706  1.00 35.13  ? 59  ARG A N   1 
ATOM   212  C CA  A ARG A 1 23  ? 20.671 55.588 14.864  0.50 35.75  ? 59  ARG A CA  1 
ATOM   213  C CA  B ARG A 1 23  ? 20.700 55.597 14.863  0.50 35.55  ? 59  ARG A CA  1 
ATOM   214  C C   . ARG A 1 23  ? 20.792 54.094 14.519  1.00 39.95  ? 59  ARG A C   1 
ATOM   215  O O   . ARG A 1 23  ? 21.099 53.290 15.398  1.00 41.07  ? 59  ARG A O   1 
ATOM   216  C CB  A ARG A 1 23  ? 19.428 55.740 15.758  0.50 34.59  ? 59  ARG A CB  1 
ATOM   217  C CB  B ARG A 1 23  ? 19.510 55.807 15.816  0.50 33.39  ? 59  ARG A CB  1 
ATOM   218  C CG  A ARG A 1 23  ? 19.074 57.155 16.192  0.50 44.72  ? 59  ARG A CG  1 
ATOM   219  C CG  B ARG A 1 23  ? 19.210 57.264 16.138  0.50 40.11  ? 59  ARG A CG  1 
ATOM   220  C CD  A ARG A 1 23  ? 17.658 57.215 16.750  0.50 51.88  ? 59  ARG A CD  1 
ATOM   221  C CD  B ARG A 1 23  ? 18.192 57.420 17.256  0.50 43.03  ? 59  ARG A CD  1 
ATOM   222  N NE  A ARG A 1 23  ? 16.658 57.131 15.681  0.50 53.57  ? 59  ARG A NE  1 
ATOM   223  N NE  B ARG A 1 23  ? 17.913 58.831 17.527  0.50 44.58  ? 59  ARG A NE  1 
ATOM   224  C CZ  A ARG A 1 23  ? 15.639 56.277 15.652  0.50 59.89  ? 59  ARG A CZ  1 
ATOM   225  C CZ  B ARG A 1 23  ? 16.981 59.268 18.369  0.50 56.06  ? 59  ARG A CZ  1 
ATOM   226  N NH1 A ARG A 1 23  ? 15.443 55.429 16.657  0.50 39.17  ? 59  ARG A NH1 1 
ATOM   227  N NH1 B ARG A 1 23  ? 16.232 58.408 19.045  0.50 41.13  ? 59  ARG A NH1 1 
ATOM   228  N NH2 A ARG A 1 23  ? 14.794 56.282 14.634  0.50 49.41  ? 59  ARG A NH2 1 
ATOM   229  N NH2 B ARG A 1 23  ? 16.789 60.568 18.540  0.50 45.06  ? 59  ARG A NH2 1 
ATOM   230  N N   . LYS A 1 24  ? 20.497 53.716 13.279  1.00 36.24  ? 60  LYS A N   1 
ATOM   231  C CA  . LYS A 1 24  ? 20.453 52.327 12.835  1.00 35.81  ? 60  LYS A CA  1 
ATOM   232  C C   . LYS A 1 24  ? 21.711 51.867 12.123  1.00 39.01  ? 60  LYS A C   1 
ATOM   233  O O   . LYS A 1 24  ? 22.204 52.535 11.217  1.00 38.26  ? 60  LYS A O   1 
ATOM   234  C CB  . LYS A 1 24  ? 19.248 52.123 11.899  1.00 36.82  ? 60  LYS A CB  1 
ATOM   235  C CG  . LYS A 1 24  ? 17.898 52.302 12.603  1.00 32.28  ? 60  LYS A CG  1 
ATOM   236  C CD  . LYS A 1 24  ? 16.760 52.360 11.584  1.00 46.31  ? 60  LYS A CD  1 
ATOM   237  C CE  . LYS A 1 24  ? 15.392 52.493 12.210  1.00 64.71  ? 60  LYS A CE  1 
ATOM   238  N NZ  . LYS A 1 24  ? 15.206 53.784 12.911  1.00 68.99  ? 60  LYS A NZ  1 
ATOM   239  N N   . ILE A 1 25  ? 22.235 50.703 12.547  1.00 34.34  ? 61  ILE A N   1 
ATOM   240  C CA  . ILE A 1 25  ? 23.421 50.170 11.905  1.00 33.46  ? 61  ILE A CA  1 
ATOM   241  C C   . ILE A 1 25  ? 23.153 48.763 11.408  1.00 35.32  ? 61  ILE A C   1 
ATOM   242  O O   . ILE A 1 25  ? 22.247 48.080 11.878  1.00 34.33  ? 61  ILE A O   1 
ATOM   243  C CB  . ILE A 1 25  ? 24.689 50.240 12.827  1.00 35.78  ? 61  ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 25  ? 24.606 49.213 13.994  1.00 35.34  ? 61  ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 25  ? 24.951 51.695 13.291  1.00 36.66  ? 61  ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 25  ? 25.886 49.156 15.016  1.00 35.84  ? 61  ILE A CD1 1 
ATOM   247  N N   . LEU A 1 26  ? 23.987 48.324 10.481  1.00 33.09  ? 62  LEU A N   1 
ATOM   248  C CA  . LEU A 1 26  ? 23.914 46.990 9.938   1.00 33.76  ? 62  LEU A CA  1 
ATOM   249  C C   . LEU A 1 26  ? 25.260 46.334 10.141  1.00 37.04  ? 62  LEU A C   1 
ATOM   250  O O   . LEU A 1 26  ? 26.283 46.876 9.735   1.00 36.59  ? 62  LEU A O   1 
ATOM   251  C CB  . LEU A 1 26  ? 23.477 47.035 8.438   1.00 34.72  ? 62  LEU A CB  1 
ATOM   252  C CG  . LEU A 1 26  ? 23.214 45.690 7.752   1.00 42.70  ? 62  LEU A CG  1 
ATOM   253  C CD1 . LEU A 1 26  ? 22.016 45.005 8.369   1.00 44.85  ? 62  LEU A CD1 1 
ATOM   254  C CD2 . LEU A 1 26  ? 22.991 45.873 6.246   1.00 42.91  ? 62  LEU A CD2 1 
ATOM   255  N N   . ILE A 1 27  ? 25.269 45.203 10.846  1.00 33.66  ? 63  ILE A N   1 
ATOM   256  C CA  . ILE A 1 27  ? 26.490 44.420 11.054  1.00 32.26  ? 63  ILE A CA  1 
ATOM   257  C C   . ILE A 1 27  ? 26.420 43.212 10.139  1.00 36.62  ? 63  ILE A C   1 
ATOM   258  O O   . ILE A 1 27  ? 25.402 42.524 10.108  1.00 37.44  ? 63  ILE A O   1 
ATOM   259  C CB  . ILE A 1 27  ? 26.720 44.000 12.534  1.00 33.24  ? 63  ILE A CB  1 
ATOM   260  C CG1 . ILE A 1 27  ? 26.765 45.216 13.463  1.00 32.35  ? 63  ILE A CG1 1 
ATOM   261  C CG2 . ILE A 1 27  ? 28.020 43.143 12.685  1.00 34.82  ? 63  ILE A CG2 1 
ATOM   262  C CD1 . ILE A 1 27  ? 26.375 44.807 14.951  1.00 32.37  ? 63  ILE A CD1 1 
ATOM   263  N N   . ARG A 1 28  ? 27.498 42.954 9.402   1.00 33.89  ? 64  ARG A N   1 
ATOM   264  C CA  . ARG A 1 28  ? 27.579 41.826 8.486   1.00 34.58  ? 64  ARG A CA  1 
ATOM   265  C C   . ARG A 1 28  ? 28.817 41.009 8.829   1.00 39.72  ? 64  ARG A C   1 
ATOM   266  O O   . ARG A 1 28  ? 29.743 41.546 9.417   1.00 38.29  ? 64  ARG A O   1 
ATOM   267  C CB  . ARG A 1 28  ? 27.629 42.345 7.015   1.00 33.73  ? 64  ARG A CB  1 
ATOM   268  C CG  . ARG A 1 28  ? 26.293 42.880 6.503   1.00 40.02  ? 64  ARG A CG  1 
ATOM   269  C CD  . ARG A 1 28  ? 26.376 43.449 5.094   1.00 41.91  ? 64  ARG A CD  1 
ATOM   270  N NE  . ARG A 1 28  ? 26.697 42.407 4.115   1.00 49.22  ? 64  ARG A NE  1 
ATOM   271  C CZ  . ARG A 1 28  ? 27.029 42.625 2.844   1.00 57.88  ? 64  ARG A CZ  1 
ATOM   272  N NH1 . ARG A 1 28  ? 27.063 43.862 2.358   1.00 42.70  ? 64  ARG A NH1 1 
ATOM   273  N NH2 . ARG A 1 28  ? 27.302 41.609 2.044   1.00 44.84  ? 64  ARG A NH2 1 
ATOM   274  N N   . GLY A 1 29  ? 28.831 39.738 8.441   1.00 39.24  ? 65  GLY A N   1 
ATOM   275  C CA  . GLY A 1 29  ? 29.966 38.844 8.646   1.00 40.08  ? 65  GLY A CA  1 
ATOM   276  C C   . GLY A 1 29  ? 29.959 38.086 9.951   1.00 46.33  ? 65  GLY A C   1 
ATOM   277  O O   . GLY A 1 29  ? 30.978 37.497 10.315  1.00 48.00  ? 65  GLY A O   1 
ATOM   278  N N   . LEU A 1 30  ? 28.832 38.103 10.685  1.00 41.67  ? 66  LEU A N   1 
ATOM   279  C CA  . LEU A 1 30  ? 28.750 37.414 11.974  1.00 41.00  ? 66  LEU A CA  1 
ATOM   280  C C   . LEU A 1 30  ? 28.793 35.867 11.839  1.00 47.70  ? 66  LEU A C   1 
ATOM   281  O O   . LEU A 1 30  ? 28.337 35.345 10.827  1.00 47.11  ? 66  LEU A O   1 
ATOM   282  C CB  . LEU A 1 30  ? 27.471 37.811 12.731  1.00 39.00  ? 66  LEU A CB  1 
ATOM   283  C CG  . LEU A 1 30  ? 27.398 39.243 13.269  1.00 41.11  ? 66  LEU A CG  1 
ATOM   284  C CD1 . LEU A 1 30  ? 25.947 39.639 13.527  1.00 39.73  ? 66  LEU A CD1 1 
ATOM   285  C CD2 . LEU A 1 30  ? 28.272 39.409 14.514  1.00 38.26  ? 66  LEU A CD2 1 
ATOM   286  N N   . PRO A 1 31  ? 29.246 35.124 12.876  1.00 47.51  ? 67  PRO A N   1 
ATOM   287  C CA  . PRO A 1 31  ? 29.191 33.651 12.806  1.00 49.68  ? 67  PRO A CA  1 
ATOM   288  C C   . PRO A 1 31  ? 27.760 33.131 12.607  1.00 56.75  ? 67  PRO A C   1 
ATOM   289  O O   . PRO A 1 31  ? 26.803 33.733 13.112  1.00 55.78  ? 67  PRO A O   1 
ATOM   290  C CB  . PRO A 1 31  ? 29.734 33.213 14.166  1.00 50.99  ? 67  PRO A CB  1 
ATOM   291  C CG  . PRO A 1 31  ? 30.535 34.358 14.657  1.00 54.37  ? 67  PRO A CG  1 
ATOM   292  C CD  . PRO A 1 31  ? 29.795 35.573 14.169  1.00 48.39  ? 67  PRO A CD  1 
ATOM   293  N N   . GLY A 1 32  ? 27.633 32.032 11.865  1.00 54.47  ? 68  GLY A N   1 
ATOM   294  C CA  . GLY A 1 32  ? 26.358 31.384 11.565  1.00 55.11  ? 68  GLY A CA  1 
ATOM   295  C C   . GLY A 1 32  ? 25.583 30.900 12.782  1.00 59.60  ? 68  GLY A C   1 
ATOM   296  O O   . GLY A 1 32  ? 24.372 30.662 12.684  1.00 61.48  ? 68  GLY A O   1 
ATOM   297  N N   . ASP A 1 33  ? 26.262 30.795 13.943  1.00 53.29  ? 69  ASP A N   1 
ATOM   298  C CA  . ASP A 1 33  ? 25.675 30.414 15.227  1.00 52.52  ? 69  ASP A CA  1 
ATOM   299  C C   . ASP A 1 33  ? 25.549 31.628 16.231  1.00 52.87  ? 69  ASP A C   1 
ATOM   300  O O   . ASP A 1 33  ? 25.349 31.400 17.432  1.00 53.62  ? 69  ASP A O   1 
ATOM   301  C CB  . ASP A 1 33  ? 26.515 29.293 15.858  1.00 55.33  ? 69  ASP A CB  1 
ATOM   302  C CG  . ASP A 1 33  ? 27.892 29.727 16.333  1.00 65.35  ? 69  ASP A CG  1 
ATOM   303  O OD1 . ASP A 1 33  ? 28.442 30.697 15.762  1.00 63.51  ? 69  ASP A OD1 1 
ATOM   304  O OD2 . ASP A 1 33  ? 28.432 29.078 17.253  1.00 73.67  ? 69  ASP A OD2 1 
ATOM   305  N N   . VAL A 1 34  ? 25.678 32.889 15.745  1.00 45.37  ? 70  VAL A N   1 
ATOM   306  C CA  . VAL A 1 34  ? 25.569 34.132 16.552  1.00 42.47  ? 70  VAL A CA  1 
ATOM   307  C C   . VAL A 1 34  ? 24.154 34.262 17.179  1.00 45.65  ? 70  VAL A C   1 
ATOM   308  O O   . VAL A 1 34  ? 23.160 33.892 16.559  1.00 45.67  ? 70  VAL A O   1 
ATOM   309  C CB  . VAL A 1 34  ? 25.919 35.401 15.695  1.00 44.01  ? 70  VAL A CB  1 
ATOM   310  C CG1 . VAL A 1 34  ? 24.796 35.778 14.711  1.00 43.16  ? 70  VAL A CG1 1 
ATOM   311  C CG2 . VAL A 1 34  ? 26.298 36.595 16.566  1.00 42.74  ? 70  VAL A CG2 1 
ATOM   312  N N   . THR A 1 35  ? 24.068 34.857 18.365  1.00 41.76  ? 71  THR A N   1 
ATOM   313  C CA  . THR A 1 35  ? 22.774 35.098 19.011  1.00 40.58  ? 71  THR A CA  1 
ATOM   314  C C   . THR A 1 35  ? 22.545 36.616 19.214  1.00 40.97  ? 71  THR A C   1 
ATOM   315  O O   . THR A 1 35  ? 23.502 37.393 19.131  1.00 37.85  ? 71  THR A O   1 
ATOM   316  C CB  . THR A 1 35  ? 22.693 34.333 20.336  1.00 42.86  ? 71  THR A CB  1 
ATOM   317  O OG1 . THR A 1 35  ? 23.681 34.852 21.217  1.00 40.62  ? 71  THR A OG1 1 
ATOM   318  C CG2 . THR A 1 35  ? 22.858 32.815 20.157  1.00 42.67  ? 71  THR A CG2 1 
ATOM   319  N N   . ASN A 1 36  ? 21.289 37.032 19.521  1.00 37.95  ? 72  ASN A N   1 
ATOM   320  C CA  . ASN A 1 36  ? 21.000 38.439 19.833  1.00 37.05  ? 72  ASN A CA  1 
ATOM   321  C C   . ASN A 1 36  ? 21.790 38.853 21.073  1.00 39.46  ? 72  ASN A C   1 
ATOM   322  O O   . ASN A 1 36  ? 22.436 39.909 21.047  1.00 37.64  ? 72  ASN A O   1 
ATOM   323  C CB  . ASN A 1 36  ? 19.491 38.701 20.045  1.00 42.95  ? 72  ASN A CB  1 
ATOM   324  C CG  . ASN A 1 36  ? 18.698 38.641 18.777  1.00 59.26  ? 72  ASN A CG  1 
ATOM   325  O OD1 . ASN A 1 36  ? 19.075 39.202 17.746  1.00 49.85  ? 72  ASN A OD1 1 
ATOM   326  N ND2 . ASN A 1 36  ? 17.597 37.928 18.819  1.00 48.72  ? 72  ASN A ND2 1 
ATOM   327  N N   . GLN A 1 37  ? 21.798 37.993 22.137  1.00 36.79  ? 73  GLN A N   1 
ATOM   328  C CA  . GLN A 1 37  ? 22.565 38.272 23.356  1.00 36.16  ? 73  GLN A CA  1 
ATOM   329  C C   . GLN A 1 37  ? 24.050 38.509 23.061  1.00 38.47  ? 73  GLN A C   1 
ATOM   330  O O   . GLN A 1 37  ? 24.625 39.434 23.615  1.00 39.13  ? 73  GLN A O   1 
ATOM   331  C CB  . GLN A 1 37  ? 22.421 37.144 24.398  1.00 38.32  ? 73  GLN A CB  1 
ATOM   332  C CG  . GLN A 1 37  ? 22.936 37.540 25.788  1.00 46.94  ? 73  GLN A CG  1 
ATOM   333  C CD  . GLN A 1 37  ? 22.304 38.809 26.351  1.00 60.54  ? 73  GLN A CD  1 
ATOM   334  O OE1 . GLN A 1 37  ? 21.087 39.074 26.224  1.00 54.12  ? 73  GLN A OE1 1 
ATOM   335  N NE2 . GLN A 1 37  ? 23.136 39.637 26.971  1.00 48.72  ? 73  GLN A NE2 1 
ATOM   336  N N   . GLU A 1 38  ? 24.659 37.712 22.188  1.00 36.85  ? 74  GLU A N   1 
ATOM   337  C CA  . GLU A 1 38  ? 26.080 37.873 21.850  1.00 36.72  ? 74  GLU A CA  1 
ATOM   338  C C   . GLU A 1 38  ? 26.374 39.266 21.230  1.00 38.30  ? 74  GLU A C   1 
ATOM   339  O O   . GLU A 1 38  ? 27.388 39.894 21.563  1.00 36.81  ? 74  GLU A O   1 
ATOM   340  C CB  . GLU A 1 38  ? 26.529 36.756 20.908  1.00 38.08  ? 74  GLU A CB  1 
ATOM   341  C CG  . GLU A 1 38  ? 28.036 36.704 20.740  1.00 41.68  ? 74  GLU A CG  1 
ATOM   342  C CD  . GLU A 1 38  ? 28.602 35.506 20.020  1.00 46.95  ? 74  GLU A CD  1 
ATOM   343  O OE1 . GLU A 1 38  ? 27.846 34.821 19.294  1.00 41.16  ? 74  GLU A OE1 1 
ATOM   344  O OE2 . GLU A 1 38  ? 29.840 35.342 20.070  1.00 52.86  ? 74  GLU A OE2 1 
ATOM   345  N N   . VAL A 1 39  ? 25.497 39.740 20.350  1.00 33.95  ? 75  VAL A N   1 
ATOM   346  C CA  . VAL A 1 39  ? 25.647 41.071 19.725  1.00 34.00  ? 75  VAL A CA  1 
ATOM   347  C C   . VAL A 1 39  ? 25.419 42.134 20.808  1.00 35.18  ? 75  VAL A C   1 
ATOM   348  O O   . VAL A 1 39  ? 26.168 43.101 20.839  1.00 33.24  ? 75  VAL A O   1 
ATOM   349  C CB  . VAL A 1 39  ? 24.758 41.327 18.473  1.00 36.57  ? 75  VAL A CB  1 
ATOM   350  C CG1 . VAL A 1 39  ? 25.027 42.716 17.896  1.00 35.71  ? 75  VAL A CG1 1 
ATOM   351  C CG2 . VAL A 1 39  ? 25.020 40.275 17.388  1.00 36.84  ? 75  VAL A CG2 1 
ATOM   352  N N   . HIS A 1 40  ? 24.419 41.947 21.697  1.00 35.13  ? 76  HIS A N   1 
ATOM   353  C CA  . HIS A 1 40  ? 24.199 42.865 22.838  1.00 38.17  ? 76  HIS A CA  1 
ATOM   354  C C   . HIS A 1 40  ? 25.498 42.998 23.691  1.00 40.57  ? 76  HIS A C   1 
ATOM   355  O O   . HIS A 1 40  ? 25.914 44.114 24.022  1.00 38.96  ? 76  HIS A O   1 
ATOM   356  C CB  . HIS A 1 40  ? 23.062 42.364 23.752  1.00 41.66  ? 76  HIS A CB  1 
ATOM   357  C CG  . HIS A 1 40  ? 21.689 42.805 23.361  1.00 46.98  ? 76  HIS A CG  1 
ATOM   358  N ND1 . HIS A 1 40  ? 21.151 44.003 23.827  1.00 50.33  ? 76  HIS A ND1 1 
ATOM   359  C CD2 . HIS A 1 40  ? 20.751 42.161 22.625  1.00 49.24  ? 76  HIS A CD2 1 
ATOM   360  C CE1 . HIS A 1 40  ? 19.933 44.072 23.311  1.00 49.26  ? 76  HIS A CE1 1 
ATOM   361  N NE2 . HIS A 1 40  ? 19.645 42.983 22.589  1.00 49.31  ? 76  HIS A NE2 1 
ATOM   362  N N   . ASP A 1 41  ? 26.145 41.846 23.997  1.00 37.40  ? 77  ASP A N   1 
ATOM   363  C CA  . ASP A 1 41  ? 27.394 41.766 24.769  1.00 38.83  ? 77  ASP A CA  1 
ATOM   364  C C   . ASP A 1 41  ? 28.574 42.399 24.013  1.00 41.39  ? 77  ASP A C   1 
ATOM   365  O O   . ASP A 1 41  ? 29.376 43.101 24.620  1.00 40.60  ? 77  ASP A O   1 
ATOM   366  C CB  . ASP A 1 41  ? 27.733 40.292 25.126  1.00 40.87  ? 77  ASP A CB  1 
ATOM   367  C CG  . ASP A 1 41  ? 26.728 39.628 26.060  1.00 43.65  ? 77  ASP A CG  1 
ATOM   368  O OD1 . ASP A 1 41  ? 25.900 40.345 26.651  1.00 42.21  ? 77  ASP A OD1 1 
ATOM   369  O OD2 . ASP A 1 41  ? 26.771 38.388 26.191  1.00 47.38  ? 77  ASP A OD2 1 
ATOM   370  N N   . LEU A 1 42  ? 28.659 42.196 22.696  1.00 38.30  ? 78  LEU A N   1 
ATOM   371  C CA  . LEU A 1 42  ? 29.745 42.797 21.905  1.00 38.42  ? 78  LEU A CA  1 
ATOM   372  C C   . LEU A 1 42  ? 29.620 44.322 21.969  1.00 42.16  ? 78  LEU A C   1 
ATOM   373  O O   . LEU A 1 42  ? 30.617 45.018 22.117  1.00 45.44  ? 78  LEU A O   1 
ATOM   374  C CB  . LEU A 1 42  ? 29.697 42.301 20.439  1.00 37.56  ? 78  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 42  ? 30.770 42.855 19.491  1.00 43.18  ? 78  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 42  ? 32.089 42.100 19.672  1.00 45.02  ? 78  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 42  ? 30.313 42.762 18.056  1.00 45.22  ? 78  LEU A CD2 1 
ATOM   378  N N   . LEU A 1 43  ? 28.388 44.814 21.949  1.00 35.05  ? 79  LEU A N   1 
ATOM   379  C CA  . LEU A 1 43  ? 28.073 46.237 22.018  1.00 36.57  ? 79  LEU A CA  1 
ATOM   380  C C   . LEU A 1 43  ? 27.725 46.663 23.487  1.00 42.17  ? 79  LEU A C   1 
ATOM   381  O O   . LEU A 1 43  ? 26.898 47.556 23.679  1.00 42.13  ? 79  LEU A O   1 
ATOM   382  C CB  . LEU A 1 43  ? 26.908 46.574 21.036  1.00 35.71  ? 79  LEU A CB  1 
ATOM   383  C CG  . LEU A 1 43  ? 27.089 46.209 19.523  1.00 40.99  ? 79  LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 43  ? 25.811 46.532 18.710  1.00 39.05  ? 79  LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 43  ? 28.236 46.969 18.882  1.00 44.55  ? 79  LEU A CD2 1 
ATOM   386  N N   . SER A 1 44  ? 28.394 46.066 24.505  1.00 40.78  ? 80  SER A N   1 
ATOM   387  C CA  . SER A 1 44  ? 28.130 46.350 25.930  1.00 42.53  ? 80  SER A CA  1 
ATOM   388  C C   . SER A 1 44  ? 28.387 47.832 26.324  1.00 49.31  ? 80  SER A C   1 
ATOM   389  O O   . SER A 1 44  ? 27.764 48.309 27.269  1.00 49.32  ? 80  SER A O   1 
ATOM   390  C CB  . SER A 1 44  ? 28.907 45.408 26.849  1.00 47.49  ? 80  SER A CB  1 
ATOM   391  O OG  . SER A 1 44  ? 30.304 45.473 26.633  1.00 58.42  ? 80  SER A OG  1 
ATOM   392  N N   . ASP A 1 45  ? 29.204 48.580 25.559  1.00 47.07  ? 81  ASP A N   1 
ATOM   393  C CA  . ASP A 1 45  ? 29.435 50.008 25.835  1.00 48.61  ? 81  ASP A CA  1 
ATOM   394  C C   . ASP A 1 45  ? 28.301 50.912 25.324  1.00 50.25  ? 81  ASP A C   1 
ATOM   395  O O   . ASP A 1 45  ? 28.354 52.128 25.523  1.00 50.12  ? 81  ASP A O   1 
ATOM   396  C CB  . ASP A 1 45  ? 30.774 50.467 25.210  1.00 51.81  ? 81  ASP A CB  1 
ATOM   397  C CG  . ASP A 1 45  ? 31.999 49.860 25.865  1.00 62.03  ? 81  ASP A CG  1 
ATOM   398  O OD1 . ASP A 1 45  ? 31.949 49.590 27.087  1.00 61.80  ? 81  ASP A OD1 1 
ATOM   399  O OD2 . ASP A 1 45  ? 32.996 49.622 25.150  1.00 70.82  ? 81  ASP A OD2 1 
ATOM   400  N N   . TYR A 1 46  ? 27.283 50.327 24.658  1.00 45.44  ? 82  TYR A N   1 
ATOM   401  C CA  . TYR A 1 46  ? 26.182 51.060 24.049  1.00 43.88  ? 82  TYR A CA  1 
ATOM   402  C C   . TYR A 1 46  ? 24.834 50.559 24.507  1.00 48.21  ? 82  TYR A C   1 
ATOM   403  O O   . TYR A 1 46  ? 24.637 49.360 24.691  1.00 46.31  ? 82  TYR A O   1 
ATOM   404  C CB  . TYR A 1 46  ? 26.261 50.987 22.500  1.00 42.93  ? 82  TYR A CB  1 
ATOM   405  C CG  . TYR A 1 46  ? 27.613 51.412 21.966  1.00 45.08  ? 82  TYR A CG  1 
ATOM   406  C CD1 . TYR A 1 46  ? 27.941 52.757 21.843  1.00 47.99  ? 82  TYR A CD1 1 
ATOM   407  C CD2 . TYR A 1 46  ? 28.611 50.473 21.713  1.00 45.69  ? 82  TYR A CD2 1 
ATOM   408  C CE1 . TYR A 1 46  ? 29.220 53.159 21.465  1.00 50.17  ? 82  TYR A CE1 1 
ATOM   409  C CE2 . TYR A 1 46  ? 29.892 50.863 21.328  1.00 47.26  ? 82  TYR A CE2 1 
ATOM   410  C CZ  . TYR A 1 46  ? 30.190 52.207 21.201  1.00 52.52  ? 82  TYR A CZ  1 
ATOM   411  O OH  . TYR A 1 46  ? 31.441 52.607 20.821  1.00 50.55  ? 82  TYR A OH  1 
ATOM   412  N N   . GLU A 1 47  ? 23.893 51.493 24.660  1.00 47.95  ? 83  GLU A N   1 
ATOM   413  C CA  . GLU A 1 47  ? 22.517 51.200 25.039  1.00 48.67  ? 83  GLU A CA  1 
ATOM   414  C C   . GLU A 1 47  ? 21.748 50.909 23.761  1.00 48.18  ? 83  GLU A C   1 
ATOM   415  O O   . GLU A 1 47  ? 21.692 51.755 22.852  1.00 48.82  ? 83  GLU A O   1 
ATOM   416  C CB  . GLU A 1 47  ? 21.909 52.361 25.829  1.00 51.68  ? 83  GLU A CB  1 
ATOM   417  C CG  . GLU A 1 47  ? 21.126 51.908 27.045  1.00 70.06  ? 83  GLU A CG  1 
ATOM   418  C CD  . GLU A 1 47  ? 20.374 53.050 27.698  1.00 95.19  ? 83  GLU A CD  1 
ATOM   419  O OE1 . GLU A 1 47  ? 20.954 53.720 28.585  1.00 86.11  ? 83  GLU A OE1 1 
ATOM   420  O OE2 . GLU A 1 47  ? 19.230 53.321 27.266  1.00 83.74  ? 83  GLU A OE2 1 
ATOM   421  N N   . LEU A 1 48  ? 21.245 49.678 23.630  1.00 40.81  ? 84  LEU A N   1 
ATOM   422  C CA  . LEU A 1 48  ? 20.582 49.333 22.367  1.00 38.16  ? 84  LEU A CA  1 
ATOM   423  C C   . LEU A 1 48  ? 19.059 49.292 22.501  1.00 43.65  ? 84  LEU A C   1 
ATOM   424  O O   . LEU A 1 48  ? 18.533 48.612 23.394  1.00 45.16  ? 84  LEU A O   1 
ATOM   425  C CB  . LEU A 1 48  ? 21.077 48.009 21.781  1.00 36.38  ? 84  LEU A CB  1 
ATOM   426  C CG  . LEU A 1 48  ? 22.585 47.721 21.746  1.00 40.22  ? 84  LEU A CG  1 
ATOM   427  C CD1 . LEU A 1 48  ? 22.832 46.337 21.220  1.00 38.93  ? 84  LEU A CD1 1 
ATOM   428  C CD2 . LEU A 1 48  ? 23.358 48.770 20.913  1.00 39.73  ? 84  LEU A CD2 1 
ATOM   429  N N   . LYS A 1 49  ? 18.351 50.034 21.611  1.00 36.79  ? 85  LYS A N   1 
ATOM   430  C CA  . LYS A 1 49  ? 16.901 49.955 21.566  1.00 36.10  ? 85  LYS A CA  1 
ATOM   431  C C   . LYS A 1 49  ? 16.511 48.617 20.918  1.00 39.16  ? 85  LYS A C   1 
ATOM   432  O O   . LYS A 1 49  ? 15.669 47.891 21.435  1.00 37.80  ? 85  LYS A O   1 
ATOM   433  C CB  . LYS A 1 49  ? 16.288 51.120 20.784  1.00 36.77  ? 85  LYS A CB  1 
ATOM   434  C CG  . LYS A 1 49  ? 14.760 51.104 20.862  1.00 40.09  ? 85  LYS A CG  1 
ATOM   435  C CD  . LYS A 1 49  ? 14.149 52.173 19.989  1.00 50.87  ? 85  LYS A CD  1 
ATOM   436  C CE  . LYS A 1 49  ? 12.653 52.117 20.057  1.00 56.89  ? 85  LYS A CE  1 
ATOM   437  N NZ  . LYS A 1 49  ? 12.054 53.317 19.424  1.00 61.94  ? 85  LYS A NZ  1 
ATOM   438  N N   . TYR A 1 50  ? 17.150 48.296 19.794  1.00 34.67  ? 86  TYR A N   1 
ATOM   439  C CA  . TYR A 1 50  ? 16.846 47.081 19.052  1.00 34.75  ? 86  TYR A CA  1 
ATOM   440  C C   . TYR A 1 50  ? 18.090 46.361 18.650  1.00 40.27  ? 86  TYR A C   1 
ATOM   441  O O   . TYR A 1 50  ? 19.090 46.976 18.271  1.00 39.33  ? 86  TYR A O   1 
ATOM   442  C CB  . TYR A 1 50  ? 16.025 47.404 17.778  1.00 35.01  ? 86  TYR A CB  1 
ATOM   443  C CG  . TYR A 1 50  ? 14.622 47.922 18.018  1.00 37.36  ? 86  TYR A CG  1 
ATOM   444  C CD1 . TYR A 1 50  ? 13.760 47.281 18.904  1.00 39.20  ? 86  TYR A CD1 1 
ATOM   445  C CD2 . TYR A 1 50  ? 14.107 48.968 17.253  1.00 38.52  ? 86  TYR A CD2 1 
ATOM   446  C CE1 . TYR A 1 50  ? 12.457 47.728 19.094  1.00 36.95  ? 86  TYR A CE1 1 
ATOM   447  C CE2 . TYR A 1 50  ? 12.803 49.421 17.431  1.00 39.86  ? 86  TYR A CE2 1 
ATOM   448  C CZ  . TYR A 1 50  ? 11.975 48.779 18.336  1.00 42.36  ? 86  TYR A CZ  1 
ATOM   449  O OH  . TYR A 1 50  ? 10.695 49.225 18.519  1.00 40.60  ? 86  TYR A OH  1 
ATOM   450  N N   . CYS A 1 51  ? 17.997 45.047 18.664  1.00 38.47  ? 87  CYS A N   1 
ATOM   451  C CA  . CYS A 1 51  ? 19.048 44.187 18.214  1.00 38.87  ? 87  CYS A CA  1 
ATOM   452  C C   . CYS A 1 51  ? 18.435 42.917 17.627  1.00 41.82  ? 87  CYS A C   1 
ATOM   453  O O   . CYS A 1 51  ? 18.013 42.023 18.380  1.00 41.97  ? 87  CYS A O   1 
ATOM   454  C CB  . CYS A 1 51  ? 20.023 43.879 19.345  1.00 40.22  ? 87  CYS A CB  1 
ATOM   455  S SG  . CYS A 1 51  ? 21.434 42.897 18.816  1.00 44.49  ? 87  CYS A SG  1 
ATOM   456  N N   . PHE A 1 52  ? 18.382 42.830 16.284  1.00 35.00  ? 88  PHE A N   1 
ATOM   457  C CA  . PHE A 1 52  ? 17.789 41.639 15.658  1.00 36.00  ? 88  PHE A CA  1 
ATOM   458  C C   . PHE A 1 52  ? 18.783 40.920 14.710  1.00 39.84  ? 88  PHE A C   1 
ATOM   459  O O   . PHE A 1 52  ? 19.192 41.471 13.689  1.00 36.04  ? 88  PHE A O   1 
ATOM   460  C CB  . PHE A 1 52  ? 16.475 41.998 14.927  1.00 38.26  ? 88  PHE A CB  1 
ATOM   461  C CG  . PHE A 1 52  ? 15.459 42.701 15.799  1.00 41.74  ? 88  PHE A CG  1 
ATOM   462  C CD1 . PHE A 1 52  ? 14.851 42.042 16.858  1.00 46.95  ? 88  PHE A CD1 1 
ATOM   463  C CD2 . PHE A 1 52  ? 15.132 44.031 15.577  1.00 44.67  ? 88  PHE A CD2 1 
ATOM   464  C CE1 . PHE A 1 52  ? 13.939 42.705 17.684  1.00 49.08  ? 88  PHE A CE1 1 
ATOM   465  C CE2 . PHE A 1 52  ? 14.223 44.687 16.400  1.00 48.62  ? 88  PHE A CE2 1 
ATOM   466  C CZ  . PHE A 1 52  ? 13.651 44.024 17.462  1.00 47.60  ? 88  PHE A CZ  1 
ATOM   467  N N   . VAL A 1 53  ? 19.142 39.685 15.047  1.00 41.83  ? 89  VAL A N   1 
ATOM   468  C CA  . VAL A 1 53  ? 20.051 38.898 14.220  1.00 45.07  ? 89  VAL A CA  1 
ATOM   469  C C   . VAL A 1 53  ? 19.263 38.201 13.099  1.00 54.06  ? 89  VAL A C   1 
ATOM   470  O O   . VAL A 1 53  ? 18.102 37.832 13.278  1.00 55.02  ? 89  VAL A O   1 
ATOM   471  C CB  . VAL A 1 53  ? 20.947 37.886 14.990  1.00 50.84  ? 89  VAL A CB  1 
ATOM   472  C CG1 . VAL A 1 53  ? 21.906 38.592 15.954  1.00 49.46  ? 89  VAL A CG1 1 
ATOM   473  C CG2 . VAL A 1 53  ? 20.128 36.804 15.700  1.00 52.50  ? 89  VAL A CG2 1 
ATOM   474  N N   . ASP A 1 54  ? 19.891 38.119 11.924  1.00 52.20  ? 90  ASP A N   1 
ATOM   475  C CA  . ASP A 1 54  ? 19.440 37.436 10.712  1.00 53.49  ? 90  ASP A CA  1 
ATOM   476  C C   . ASP A 1 54  ? 20.491 36.347 10.593  1.00 60.06  ? 90  ASP A C   1 
ATOM   477  O O   . ASP A 1 54  ? 21.526 36.538 9.959   1.00 59.46  ? 90  ASP A O   1 
ATOM   478  C CB  . ASP A 1 54  ? 19.375 38.432 9.515   1.00 54.84  ? 90  ASP A CB  1 
ATOM   479  C CG  . ASP A 1 54  ? 18.222 38.283 8.515   1.00 60.26  ? 90  ASP A CG  1 
ATOM   480  O OD1 . ASP A 1 54  ? 17.386 37.352 8.684   1.00 62.05  ? 90  ASP A OD1 1 
ATOM   481  O OD2 . ASP A 1 54  ? 18.167 39.079 7.548   1.00 55.96  ? 90  ASP A OD2 1 
ATOM   482  N N   . LYS A 1 55  ? 20.307 35.302 11.414  1.00 58.85  ? 91  LYS A N   1 
ATOM   483  C CA  . LYS A 1 55  ? 21.159 34.143 11.646  1.00 60.33  ? 91  LYS A CA  1 
ATOM   484  C C   . LYS A 1 55  ? 21.683 33.459 10.357  1.00 67.28  ? 91  LYS A C   1 
ATOM   485  O O   . LYS A 1 55  ? 22.836 32.996 10.339  1.00 67.76  ? 91  LYS A O   1 
ATOM   486  C CB  . LYS A 1 55  ? 20.353 33.126 12.481  1.00 64.88  ? 91  LYS A CB  1 
ATOM   487  C CG  . LYS A 1 55  ? 21.085 31.850 12.900  1.00 78.89  ? 91  LYS A CG  1 
ATOM   488  C CD  . LYS A 1 55  ? 21.734 31.997 14.260  1.00 90.26  ? 91  LYS A CD  1 
ATOM   489  C CE  . LYS A 1 55  ? 21.699 30.720 15.065  1.00 105.49 ? 91  LYS A CE  1 
ATOM   490  N NZ  . LYS A 1 55  ? 20.350 30.467 15.639  1.00 114.64 ? 91  LYS A NZ  1 
ATOM   491  N N   . TYR A 1 56  ? 20.836 33.348 9.320   1.00 64.23  ? 92  TYR A N   1 
ATOM   492  C CA  . TYR A 1 56  ? 21.222 32.655 8.087   1.00 65.57  ? 92  TYR A CA  1 
ATOM   493  C C   . TYR A 1 56  ? 21.962 33.587 7.139   1.00 67.44  ? 92  TYR A C   1 
ATOM   494  O O   . TYR A 1 56  ? 22.551 33.120 6.158   1.00 69.39  ? 92  TYR A O   1 
ATOM   495  C CB  . TYR A 1 56  ? 19.995 32.026 7.400   1.00 68.05  ? 92  TYR A CB  1 
ATOM   496  C CG  . TYR A 1 56  ? 19.396 30.895 8.207   1.00 70.95  ? 92  TYR A CG  1 
ATOM   497  C CD1 . TYR A 1 56  ? 19.969 29.626 8.198   1.00 74.62  ? 92  TYR A CD1 1 
ATOM   498  C CD2 . TYR A 1 56  ? 18.276 31.099 9.007   1.00 71.32  ? 92  TYR A CD2 1 
ATOM   499  C CE1 . TYR A 1 56  ? 19.440 28.588 8.963   1.00 76.23  ? 92  TYR A CE1 1 
ATOM   500  C CE2 . TYR A 1 56  ? 17.735 30.067 9.772   1.00 73.31  ? 92  TYR A CE2 1 
ATOM   501  C CZ  . TYR A 1 56  ? 18.326 28.815 9.753   1.00 81.91  ? 92  TYR A CZ  1 
ATOM   502  O OH  . TYR A 1 56  ? 17.789 27.793 10.497  1.00 84.33  ? 92  TYR A OH  1 
ATOM   503  N N   . LYS A 1 57  ? 21.951 34.896 7.439   1.00 58.19  ? 93  LYS A N   1 
ATOM   504  C CA  . LYS A 1 57  ? 22.635 35.884 6.616   1.00 55.72  ? 93  LYS A CA  1 
ATOM   505  C C   . LYS A 1 57  ? 23.868 36.449 7.348   1.00 54.29  ? 93  LYS A C   1 
ATOM   506  O O   . LYS A 1 57  ? 24.575 37.270 6.765   1.00 54.79  ? 93  LYS A O   1 
ATOM   507  C CB  . LYS A 1 57  ? 21.664 37.008 6.196   1.00 57.26  ? 93  LYS A CB  1 
ATOM   508  C CG  . LYS A 1 57  ? 20.386 36.491 5.528   1.00 72.37  ? 93  LYS A CG  1 
ATOM   509  C CD  . LYS A 1 57  ? 19.904 37.378 4.398   1.00 83.43  ? 93  LYS A CD  1 
ATOM   510  C CE  . LYS A 1 57  ? 19.167 36.552 3.370   1.00 98.89  ? 93  LYS A CE  1 
ATOM   511  N NZ  . LYS A 1 57  ? 18.742 37.361 2.198   1.00 107.61 ? 93  LYS A NZ  1 
ATOM   512  N N   . GLY A 1 58  ? 24.117 35.990 8.589   1.00 46.63  ? 94  GLY A N   1 
ATOM   513  C CA  . GLY A 1 58  ? 25.194 36.450 9.470   1.00 43.60  ? 94  GLY A CA  1 
ATOM   514  C C   . GLY A 1 58  ? 25.123 37.953 9.702   1.00 44.71  ? 94  GLY A C   1 
ATOM   515  O O   . GLY A 1 58  ? 26.147 38.629 9.821   1.00 45.89  ? 94  GLY A O   1 
ATOM   516  N N   . THR A 1 59  ? 23.909 38.487 9.700   1.00 37.61  ? 95  THR A N   1 
ATOM   517  C CA  . THR A 1 59  ? 23.612 39.924 9.779   1.00 37.22  ? 95  THR A CA  1 
ATOM   518  C C   . THR A 1 59  ? 22.901 40.272 11.094  1.00 40.77  ? 95  THR A C   1 
ATOM   519  O O   . THR A 1 59  ? 22.194 39.436 11.631  1.00 43.24  ? 95  THR A O   1 
ATOM   520  C CB  . THR A 1 59  ? 22.741 40.289 8.546   1.00 46.28  ? 95  THR A CB  1 
ATOM   521  O OG1 . THR A 1 59  ? 23.468 39.991 7.346   1.00 49.97  ? 95  THR A OG1 1 
ATOM   522  C CG2 . THR A 1 59  ? 22.364 41.722 8.495   1.00 49.20  ? 95  THR A CG2 1 
ATOM   523  N N   . ALA A 1 60  ? 23.120 41.488 11.615  1.00 34.05  ? 96  ALA A N   1 
ATOM   524  C CA  . ALA A 1 60  ? 22.407 42.020 12.766  1.00 32.65  ? 96  ALA A CA  1 
ATOM   525  C C   . ALA A 1 60  ? 21.971 43.467 12.466  1.00 35.06  ? 96  ALA A C   1 
ATOM   526  O O   . ALA A 1 60  ? 22.737 44.263 11.911  1.00 33.35  ? 96  ALA A O   1 
ATOM   527  C CB  . ALA A 1 60  ? 23.222 41.941 14.034  1.00 33.23  ? 96  ALA A CB  1 
ATOM   528  N N   . PHE A 1 61  ? 20.710 43.766 12.773  1.00 31.44  ? 97  PHE A N   1 
ATOM   529  C CA  . PHE A 1 61  ? 20.095 45.101 12.602  1.00 30.06  ? 97  PHE A CA  1 
ATOM   530  C C   . PHE A 1 61  ? 20.033 45.703 13.952  1.00 34.21  ? 97  PHE A C   1 
ATOM   531  O O   . PHE A 1 61  ? 19.427 45.119 14.847  1.00 34.41  ? 97  PHE A O   1 
ATOM   532  C CB  . PHE A 1 61  ? 18.695 44.979 11.988  1.00 30.99  ? 97  PHE A CB  1 
ATOM   533  C CG  . PHE A 1 61  ? 18.678 44.460 10.572  1.00 32.76  ? 97  PHE A CG  1 
ATOM   534  C CD1 . PHE A 1 61  ? 18.438 45.316 9.507   1.00 36.26  ? 97  PHE A CD1 1 
ATOM   535  C CD2 . PHE A 1 61  ? 18.814 43.101 10.310  1.00 35.62  ? 97  PHE A CD2 1 
ATOM   536  C CE1 . PHE A 1 61  ? 18.411 44.828 8.198   1.00 39.37  ? 97  PHE A CE1 1 
ATOM   537  C CE2 . PHE A 1 61  ? 18.771 42.616 9.007   1.00 39.07  ? 97  PHE A CE2 1 
ATOM   538  C CZ  . PHE A 1 61  ? 18.570 43.477 7.960   1.00 37.92  ? 97  PHE A CZ  1 
ATOM   539  N N   . VAL A 1 62  ? 20.722 46.809 14.146  1.00 31.63  ? 98  VAL A N   1 
ATOM   540  C CA  . VAL A 1 62  ? 20.811 47.402 15.473  1.00 31.82  ? 98  VAL A CA  1 
ATOM   541  C C   . VAL A 1 62  ? 20.383 48.846 15.452  1.00 36.04  ? 98  VAL A C   1 
ATOM   542  O O   . VAL A 1 62  ? 20.846 49.599 14.595  1.00 36.85  ? 98  VAL A O   1 
ATOM   543  C CB  . VAL A 1 62  ? 22.262 47.265 16.049  1.00 34.87  ? 98  VAL A CB  1 
ATOM   544  C CG1 . VAL A 1 62  ? 22.395 47.950 17.412  1.00 34.83  ? 98  VAL A CG1 1 
ATOM   545  C CG2 . VAL A 1 62  ? 22.697 45.802 16.144  1.00 35.14  ? 98  VAL A CG2 1 
ATOM   546  N N   . THR A 1 63  ? 19.554 49.241 16.442  1.00 32.54  ? 99  THR A N   1 
ATOM   547  C CA  . THR A 1 63  ? 19.132 50.621 16.659  1.00 33.18  ? 99  THR A CA  1 
ATOM   548  C C   . THR A 1 63  ? 19.773 51.080 17.955  1.00 37.57  ? 99  THR A C   1 
ATOM   549  O O   . THR A 1 63  ? 19.508 50.490 18.994  1.00 36.97  ? 99  THR A O   1 
ATOM   550  C CB  . THR A 1 63  ? 17.566 50.772 16.702  1.00 37.15  ? 99  THR A CB  1 
ATOM   551  O OG1 . THR A 1 63  ? 17.031 50.379 15.442  1.00 34.76  ? 99  THR A OG1 1 
ATOM   552  C CG2 . THR A 1 63  ? 17.118 52.218 17.029  1.00 33.42  ? 99  THR A CG2 1 
ATOM   553  N N   . LEU A 1 64  ? 20.597 52.131 17.904  1.00 35.07  ? 100 LEU A N   1 
ATOM   554  C CA  . LEU A 1 64  ? 21.225 52.658 19.130  1.00 36.23  ? 100 LEU A CA  1 
ATOM   555  C C   . LEU A 1 64  ? 20.410 53.877 19.620  1.00 43.31  ? 100 LEU A C   1 
ATOM   556  O O   . LEU A 1 64  ? 19.453 54.247 18.950  1.00 41.98  ? 100 LEU A O   1 
ATOM   557  C CB  . LEU A 1 64  ? 22.725 52.984 18.884  1.00 36.01  ? 100 LEU A CB  1 
ATOM   558  C CG  . LEU A 1 64  ? 23.578 51.739 18.532  1.00 38.89  ? 100 LEU A CG  1 
ATOM   559  C CD1 . LEU A 1 64  ? 23.664 51.509 16.989  1.00 36.96  ? 100 LEU A CD1 1 
ATOM   560  C CD2 . LEU A 1 64  ? 24.951 51.836 19.138  1.00 41.27  ? 100 LEU A CD2 1 
ATOM   561  N N   . LEU A 1 65  ? 20.756 54.457 20.786  1.00 45.25  ? 101 LEU A N   1 
ATOM   562  C CA  . LEU A 1 65  ? 20.070 55.581 21.445  1.00 48.33  ? 101 LEU A CA  1 
ATOM   563  C C   . LEU A 1 65  ? 20.074 56.887 20.607  1.00 50.35  ? 101 LEU A C   1 
ATOM   564  O O   . LEU A 1 65  ? 19.124 57.669 20.691  1.00 50.43  ? 101 LEU A O   1 
ATOM   565  C CB  . LEU A 1 65  ? 20.765 55.843 22.803  1.00 51.21  ? 101 LEU A CB  1 
ATOM   566  C CG  . LEU A 1 65  ? 19.926 56.380 23.967  1.00 59.70  ? 101 LEU A CG  1 
ATOM   567  C CD1 . LEU A 1 65  ? 20.448 55.853 25.290  1.00 61.63  ? 101 LEU A CD1 1 
ATOM   568  C CD2 . LEU A 1 65  ? 19.980 57.898 24.042  1.00 65.90  ? 101 LEU A CD2 1 
ATOM   569  N N   . ASN A 1 66  ? 21.156 57.143 19.852  1.00 43.59  ? 102 ASN A N   1 
ATOM   570  C CA  . ASN A 1 66  ? 21.303 58.362 19.065  1.00 43.18  ? 102 ASN A CA  1 
ATOM   571  C C   . ASN A 1 66  ? 22.381 58.145 17.986  1.00 45.50  ? 102 ASN A C   1 
ATOM   572  O O   . ASN A 1 66  ? 22.989 57.077 17.941  1.00 43.55  ? 102 ASN A O   1 
ATOM   573  C CB  . ASN A 1 66  ? 21.628 59.579 19.979  1.00 44.72  ? 102 ASN A CB  1 
ATOM   574  C CG  . ASN A 1 66  ? 22.822 59.346 20.876  1.00 59.79  ? 102 ASN A CG  1 
ATOM   575  O OD1 . ASN A 1 66  ? 23.947 59.158 20.405  1.00 47.21  ? 102 ASN A OD1 1 
ATOM   576  N ND2 . ASN A 1 66  ? 22.592 59.274 22.183  1.00 51.45  ? 102 ASN A ND2 1 
ATOM   577  N N   . GLY A 1 67  ? 22.577 59.143 17.127  1.00 41.87  ? 103 GLY A N   1 
ATOM   578  C CA  . GLY A 1 67  ? 23.538 59.090 16.029  1.00 41.29  ? 103 GLY A CA  1 
ATOM   579  C C   . GLY A 1 67  ? 24.984 59.017 16.474  1.00 45.32  ? 103 GLY A C   1 
ATOM   580  O O   . GLY A 1 67  ? 25.797 58.346 15.823  1.00 43.87  ? 103 GLY A O   1 
ATOM   581  N N   . GLU A 1 68  ? 25.311 59.699 17.603  1.00 43.58  ? 104 GLU A N   1 
ATOM   582  C CA  . GLU A 1 68  ? 26.660 59.723 18.166  1.00 45.17  ? 104 GLU A CA  1 
ATOM   583  C C   . GLU A 1 68  ? 27.136 58.295 18.547  1.00 48.94  ? 104 GLU A C   1 
ATOM   584  O O   . GLU A 1 68  ? 28.250 57.899 18.188  1.00 48.80  ? 104 GLU A O   1 
ATOM   585  C CB  . GLU A 1 68  ? 26.716 60.667 19.382  1.00 49.11  ? 104 GLU A CB  1 
ATOM   586  C CG  . GLU A 1 68  ? 28.066 60.679 20.087  1.00 59.44  ? 104 GLU A CG  1 
ATOM   587  C CD  . GLU A 1 68  ? 28.163 61.571 21.308  1.00 91.64  ? 104 GLU A CD  1 
ATOM   588  O OE1 . GLU A 1 68  ? 28.468 61.045 22.404  1.00 90.47  ? 104 GLU A OE1 1 
ATOM   589  O OE2 . GLU A 1 68  ? 27.962 62.800 21.164  1.00 87.06  ? 104 GLU A OE2 1 
ATOM   590  N N   . GLN A 1 69  ? 26.297 57.548 19.287  1.00 44.02  ? 105 GLN A N   1 
ATOM   591  C CA  . GLN A 1 69  ? 26.583 56.174 19.729  1.00 42.86  ? 105 GLN A CA  1 
ATOM   592  C C   . GLN A 1 69  ? 26.673 55.238 18.507  1.00 44.75  ? 105 GLN A C   1 
ATOM   593  O O   . GLN A 1 69  ? 27.553 54.390 18.462  1.00 43.73  ? 105 GLN A O   1 
ATOM   594  C CB  . GLN A 1 69  ? 25.503 55.699 20.715  1.00 43.60  ? 105 GLN A CB  1 
ATOM   595  C CG  . GLN A 1 69  ? 25.466 56.522 21.995  1.00 58.83  ? 105 GLN A CG  1 
ATOM   596  C CD  . GLN A 1 69  ? 25.884 55.709 23.173  1.00 89.44  ? 105 GLN A CD  1 
ATOM   597  O OE1 . GLN A 1 69  ? 27.072 55.636 23.514  1.00 92.12  ? 105 GLN A OE1 1 
ATOM   598  N NE2 . GLN A 1 69  ? 24.914 55.078 23.818  1.00 81.73  ? 105 GLN A NE2 1 
ATOM   599  N N   . ALA A 1 70  ? 25.784 55.427 17.497  1.00 41.11  ? 106 ALA A N   1 
ATOM   600  C CA  . ALA A 1 70  ? 25.830 54.660 16.243  1.00 39.29  ? 106 ALA A CA  1 
ATOM   601  C C   . ALA A 1 70  ? 27.193 54.874 15.517  1.00 41.86  ? 106 ALA A C   1 
ATOM   602  O O   . ALA A 1 70  ? 27.847 53.897 15.162  1.00 38.76  ? 106 ALA A O   1 
ATOM   603  C CB  . ALA A 1 70  ? 24.664 55.043 15.349  1.00 39.17  ? 106 ALA A CB  1 
ATOM   604  N N   . GLU A 1 71  ? 27.667 56.132 15.403  1.00 41.32  ? 107 GLU A N   1 
ATOM   605  C CA  . GLU A 1 71  ? 28.966 56.456 14.788  1.00 42.65  ? 107 GLU A CA  1 
ATOM   606  C C   . GLU A 1 71  ? 30.129 55.859 15.595  1.00 45.09  ? 107 GLU A C   1 
ATOM   607  O O   . GLU A 1 71  ? 31.087 55.335 15.008  1.00 44.31  ? 107 GLU A O   1 
ATOM   608  C CB  . GLU A 1 71  ? 29.138 57.986 14.656  1.00 45.58  ? 107 GLU A CB  1 
ATOM   609  C CG  . GLU A 1 71  ? 30.366 58.427 13.870  1.00 58.43  ? 107 GLU A CG  1 
ATOM   610  C CD  . GLU A 1 71  ? 30.708 59.905 13.931  1.00 90.85  ? 107 GLU A CD  1 
ATOM   611  O OE1 . GLU A 1 71  ? 29.992 60.667 14.622  1.00 82.76  ? 107 GLU A OE1 1 
ATOM   612  O OE2 . GLU A 1 71  ? 31.710 60.300 13.290  1.00 92.84  ? 107 GLU A OE2 1 
ATOM   613  N N   . ALA A 1 72  ? 30.030 55.914 16.927  1.00 42.09  ? 108 ALA A N   1 
ATOM   614  C CA  . ALA A 1 72  ? 31.050 55.379 17.825  1.00 42.75  ? 108 ALA A CA  1 
ATOM   615  C C   . ALA A 1 72  ? 31.167 53.851 17.676  1.00 45.96  ? 108 ALA A C   1 
ATOM   616  O O   . ALA A 1 72  ? 32.282 53.335 17.529  1.00 45.50  ? 108 ALA A O   1 
ATOM   617  C CB  . ALA A 1 72  ? 30.742 55.761 19.269  1.00 44.11  ? 108 ALA A CB  1 
ATOM   618  N N   . ALA A 1 73  ? 30.014 53.151 17.653  1.00 41.15  ? 109 ALA A N   1 
ATOM   619  C CA  . ALA A 1 73  ? 29.901 51.698 17.476  1.00 39.68  ? 109 ALA A CA  1 
ATOM   620  C C   . ALA A 1 73  ? 30.501 51.260 16.131  1.00 39.60  ? 109 ALA A C   1 
ATOM   621  O O   . ALA A 1 73  ? 31.157 50.227 16.070  1.00 37.08  ? 109 ALA A O   1 
ATOM   622  C CB  . ALA A 1 73  ? 28.433 51.275 17.555  1.00 39.13  ? 109 ALA A CB  1 
ATOM   623  N N   . ILE A 1 74  ? 30.302 52.063 15.062  1.00 36.14  ? 110 ILE A N   1 
ATOM   624  C CA  . ILE A 1 74  ? 30.820 51.766 13.718  1.00 35.92  ? 110 ILE A CA  1 
ATOM   625  C C   . ILE A 1 74  ? 32.344 51.834 13.728  1.00 43.32  ? 110 ILE A C   1 
ATOM   626  O O   . ILE A 1 74  ? 33.006 50.891 13.266  1.00 43.63  ? 110 ILE A O   1 
ATOM   627  C CB  . ILE A 1 74  ? 30.216 52.735 12.645  1.00 37.89  ? 110 ILE A CB  1 
ATOM   628  C CG1 . ILE A 1 74  ? 28.745 52.411 12.382  1.00 36.24  ? 110 ILE A CG1 1 
ATOM   629  C CG2 . ILE A 1 74  ? 31.050 52.751 11.335  1.00 36.41  ? 110 ILE A CG2 1 
ATOM   630  C CD1 . ILE A 1 74  ? 28.007 53.538 11.613  1.00 42.64  ? 110 ILE A CD1 1 
ATOM   631  N N   . ASN A 1 75  ? 32.901 52.950 14.275  1.00 41.11  ? 111 ASN A N   1 
ATOM   632  C CA  . ASN A 1 75  ? 34.347 53.136 14.362  1.00 43.12  ? 111 ASN A CA  1 
ATOM   633  C C   . ASN A 1 75  ? 34.988 52.071 15.229  1.00 45.36  ? 111 ASN A C   1 
ATOM   634  O O   . ASN A 1 75  ? 36.097 51.651 14.928  1.00 45.28  ? 111 ASN A O   1 
ATOM   635  C CB  . ASN A 1 75  ? 34.694 54.520 14.885  1.00 47.15  ? 111 ASN A CB  1 
ATOM   636  C CG  . ASN A 1 75  ? 34.300 55.615 13.932  1.00 66.88  ? 111 ASN A CG  1 
ATOM   637  O OD1 . ASN A 1 75  ? 34.437 55.494 12.707  1.00 57.86  ? 111 ASN A OD1 1 
ATOM   638  N ND2 . ASN A 1 75  ? 33.771 56.694 14.475  1.00 58.49  ? 111 ASN A ND2 1 
ATOM   639  N N   . ALA A 1 76  ? 34.280 51.606 16.279  1.00 42.33  ? 112 ALA A N   1 
ATOM   640  C CA  . ALA A 1 76  ? 34.832 50.602 17.185  1.00 43.13  ? 112 ALA A CA  1 
ATOM   641  C C   . ALA A 1 76  ? 34.791 49.190 16.616  1.00 44.88  ? 112 ALA A C   1 
ATOM   642  O O   . ALA A 1 76  ? 35.715 48.439 16.885  1.00 45.88  ? 112 ALA A O   1 
ATOM   643  C CB  . ALA A 1 76  ? 34.094 50.628 18.521  1.00 43.81  ? 112 ALA A CB  1 
ATOM   644  N N   . PHE A 1 77  ? 33.733 48.816 15.852  1.00 39.89  ? 113 PHE A N   1 
ATOM   645  C CA  . PHE A 1 77  ? 33.564 47.423 15.431  1.00 37.86  ? 113 PHE A CA  1 
ATOM   646  C C   . PHE A 1 77  ? 33.710 47.146 13.937  1.00 40.70  ? 113 PHE A C   1 
ATOM   647  O O   . PHE A 1 77  ? 33.871 45.977 13.572  1.00 39.69  ? 113 PHE A O   1 
ATOM   648  C CB  . PHE A 1 77  ? 32.234 46.872 15.964  1.00 37.76  ? 113 PHE A CB  1 
ATOM   649  C CG  . PHE A 1 77  ? 32.268 46.865 17.482  1.00 40.14  ? 113 PHE A CG  1 
ATOM   650  C CD1 . PHE A 1 77  ? 33.023 45.925 18.174  1.00 43.76  ? 113 PHE A CD1 1 
ATOM   651  C CD2 . PHE A 1 77  ? 31.643 47.870 18.212  1.00 41.70  ? 113 PHE A CD2 1 
ATOM   652  C CE1 . PHE A 1 77  ? 33.093 45.951 19.567  1.00 45.40  ? 113 PHE A CE1 1 
ATOM   653  C CE2 . PHE A 1 77  ? 31.730 47.906 19.601  1.00 44.70  ? 113 PHE A CE2 1 
ATOM   654  C CZ  . PHE A 1 77  ? 32.439 46.942 20.272  1.00 43.31  ? 113 PHE A CZ  1 
ATOM   655  N N   . HIS A 1 78  ? 33.712 48.182 13.086  1.00 37.38  ? 114 HIS A N   1 
ATOM   656  C CA  . HIS A 1 78  ? 33.942 47.968 11.667  1.00 38.86  ? 114 HIS A CA  1 
ATOM   657  C C   . HIS A 1 78  ? 35.374 47.454 11.472  1.00 45.25  ? 114 HIS A C   1 
ATOM   658  O O   . HIS A 1 78  ? 36.320 48.033 12.010  1.00 43.89  ? 114 HIS A O   1 
ATOM   659  C CB  . HIS A 1 78  ? 33.697 49.232 10.843  1.00 39.60  ? 114 HIS A CB  1 
ATOM   660  C CG  . HIS A 1 78  ? 33.944 49.023 9.390   1.00 43.88  ? 114 HIS A CG  1 
ATOM   661  N ND1 . HIS A 1 78  ? 33.169 48.155 8.648   1.00 45.40  ? 114 HIS A ND1 1 
ATOM   662  C CD2 . HIS A 1 78  ? 34.897 49.552 8.590   1.00 47.35  ? 114 HIS A CD2 1 
ATOM   663  C CE1 . HIS A 1 78  ? 33.657 48.200 7.416   1.00 46.20  ? 114 HIS A CE1 1 
ATOM   664  N NE2 . HIS A 1 78  ? 34.697 49.027 7.335   1.00 47.59  ? 114 HIS A NE2 1 
ATOM   665  N N   . GLN A 1 79  ? 35.490 46.300 10.788  1.00 43.72  ? 115 GLN A N   1 
ATOM   666  C CA  . GLN A 1 79  ? 36.720 45.570 10.497  1.00 46.14  ? 115 GLN A CA  1 
ATOM   667  C C   . GLN A 1 79  ? 37.280 44.893 11.766  1.00 51.25  ? 115 GLN A C   1 
ATOM   668  O O   . GLN A 1 79  ? 38.315 44.253 11.685  1.00 53.84  ? 115 GLN A O   1 
ATOM   669  C CB  . GLN A 1 79  ? 37.764 46.447 9.767   1.00 49.48  ? 115 GLN A CB  1 
ATOM   670  C CG  . GLN A 1 79  ? 37.344 46.724 8.333   1.00 60.05  ? 115 GLN A CG  1 
ATOM   671  C CD  . GLN A 1 79  ? 38.085 47.845 7.653   1.00 76.42  ? 115 GLN A CD  1 
ATOM   672  O OE1 . GLN A 1 79  ? 38.903 48.554 8.243   1.00 70.41  ? 115 GLN A OE1 1 
ATOM   673  N NE2 . GLN A 1 79  ? 37.767 48.056 6.395   1.00 75.34  ? 115 GLN A NE2 1 
ATOM   674  N N   . SER A 1 80  ? 36.539 44.919 12.905  1.00 45.82  ? 116 SER A N   1 
ATOM   675  C CA  . SER A 1 80  ? 36.950 44.167 14.092  1.00 45.05  ? 116 SER A CA  1 
ATOM   676  C C   . SER A 1 80  ? 36.541 42.705 13.874  1.00 47.88  ? 116 SER A C   1 
ATOM   677  O O   . SER A 1 80  ? 35.905 42.392 12.872  1.00 45.26  ? 116 SER A O   1 
ATOM   678  C CB  . SER A 1 80  ? 36.312 44.726 15.361  1.00 44.76  ? 116 SER A CB  1 
ATOM   679  O OG  . SER A 1 80  ? 34.959 44.304 15.434  1.00 47.70  ? 116 SER A OG  1 
ATOM   680  N N   . ARG A 1 81  ? 36.844 41.836 14.825  1.00 45.85  ? 117 ARG A N   1 
ATOM   681  C CA  . ARG A 1 81  ? 36.567 40.408 14.710  1.00 45.52  ? 117 ARG A CA  1 
ATOM   682  C C   . ARG A 1 81  ? 35.785 39.858 15.867  1.00 48.77  ? 117 ARG A C   1 
ATOM   683  O O   . ARG A 1 81  ? 36.021 40.213 17.025  1.00 47.71  ? 117 ARG A O   1 
ATOM   684  C CB  . ARG A 1 81  ? 37.877 39.615 14.576  1.00 45.06  ? 117 ARG A CB  1 
ATOM   685  C CG  . ARG A 1 81  ? 38.481 39.719 13.168  1.00 53.31  ? 117 ARG A CG  1 
ATOM   686  C CD  . ARG A 1 81  ? 39.785 38.940 13.022  1.00 71.37  ? 117 ARG A CD  1 
ATOM   687  N NE  . ARG A 1 81  ? 39.716 37.956 11.935  1.00 88.54  ? 117 ARG A NE  1 
ATOM   688  C CZ  . ARG A 1 81  ? 39.895 38.233 10.643  1.00 105.23 ? 117 ARG A CZ  1 
ATOM   689  N NH1 . ARG A 1 81  ? 40.172 39.472 10.251  1.00 92.04  ? 117 ARG A NH1 1 
ATOM   690  N NH2 . ARG A 1 81  ? 39.791 37.272 9.732   1.00 91.26  ? 117 ARG A NH2 1 
ATOM   691  N N   . LEU A 1 82  ? 34.840 38.973 15.545  1.00 45.52  ? 118 LEU A N   1 
ATOM   692  C CA  . LEU A 1 82  ? 34.065 38.261 16.564  1.00 44.01  ? 118 LEU A CA  1 
ATOM   693  C C   . LEU A 1 82  ? 34.288 36.787 16.336  1.00 47.90  ? 118 LEU A C   1 
ATOM   694  O O   . LEU A 1 82  ? 33.889 36.270 15.283  1.00 47.90  ? 118 LEU A O   1 
ATOM   695  C CB  . LEU A 1 82  ? 32.549 38.605 16.534  1.00 41.36  ? 118 LEU A CB  1 
ATOM   696  C CG  . LEU A 1 82  ? 31.702 37.871 17.619  1.00 45.27  ? 118 LEU A CG  1 
ATOM   697  C CD1 . LEU A 1 82  ? 32.102 38.286 19.051  1.00 46.58  ? 118 LEU A CD1 1 
ATOM   698  C CD2 . LEU A 1 82  ? 30.212 38.083 17.418  1.00 42.21  ? 118 LEU A CD2 1 
ATOM   699  N N   . ARG A 1 83  ? 34.931 36.121 17.291  1.00 45.90  ? 119 ARG A N   1 
ATOM   700  C CA  . ARG A 1 83  ? 35.259 34.682 17.228  1.00 47.62  ? 119 ARG A CA  1 
ATOM   701  C C   . ARG A 1 83  ? 35.909 34.364 15.846  1.00 53.07  ? 119 ARG A C   1 
ATOM   702  O O   . ARG A 1 83  ? 35.486 33.464 15.111  1.00 53.50  ? 119 ARG A O   1 
ATOM   703  C CB  . ARG A 1 83  ? 34.008 33.832 17.543  1.00 45.98  ? 119 ARG A CB  1 
ATOM   704  C CG  . ARG A 1 83  ? 33.553 34.051 18.986  1.00 45.87  ? 119 ARG A CG  1 
ATOM   705  C CD  . ARG A 1 83  ? 32.477 33.088 19.439  1.00 49.48  ? 119 ARG A CD  1 
ATOM   706  N NE  . ARG A 1 83  ? 31.146 33.394 18.903  1.00 42.70  ? 119 ARG A NE  1 
ATOM   707  C CZ  . ARG A 1 83  ? 30.468 32.594 18.090  1.00 53.96  ? 119 ARG A CZ  1 
ATOM   708  N NH1 . ARG A 1 83  ? 31.002 31.459 17.668  1.00 53.24  ? 119 ARG A NH1 1 
ATOM   709  N NH2 . ARG A 1 83  ? 29.255 32.935 17.673  1.00 45.58  ? 119 ARG A NH2 1 
ATOM   710  N N   . GLU A 1 84  ? 36.895 35.220 15.487  1.00 50.25  ? 120 GLU A N   1 
ATOM   711  C CA  . GLU A 1 84  ? 37.739 35.238 14.284  1.00 51.12  ? 120 GLU A CA  1 
ATOM   712  C C   . GLU A 1 84  ? 36.995 35.631 12.980  1.00 54.75  ? 120 GLU A C   1 
ATOM   713  O O   . GLU A 1 84  ? 37.641 35.661 11.928  1.00 54.59  ? 120 GLU A O   1 
ATOM   714  C CB  . GLU A 1 84  ? 38.504 33.917 14.084  1.00 53.48  ? 120 GLU A CB  1 
ATOM   715  C CG  . GLU A 1 84  ? 39.521 33.652 15.182  1.00 60.39  ? 120 GLU A CG  1 
ATOM   716  C CD  . GLU A 1 84  ? 40.136 32.266 15.178  1.00 68.56  ? 120 GLU A CD  1 
ATOM   717  O OE1 . GLU A 1 84  ? 39.937 31.508 14.204  1.00 64.12  ? 120 GLU A OE1 1 
ATOM   718  O OE2 . GLU A 1 84  ? 40.845 31.944 16.152  1.00 56.13  ? 120 GLU A OE2 1 
ATOM   719  N N   . ARG A 1 85  ? 35.675 35.927 13.032  1.00 48.92  ? 121 ARG A N   1 
ATOM   720  C CA  . ARG A 1 85  ? 34.957 36.385 11.839  1.00 49.44  ? 121 ARG A CA  1 
ATOM   721  C C   . ARG A 1 85  ? 35.142 37.893 11.729  1.00 52.20  ? 121 ARG A C   1 
ATOM   722  O O   . ARG A 1 85  ? 34.864 38.596 12.698  1.00 51.90  ? 121 ARG A O   1 
ATOM   723  C CB  . ARG A 1 85  ? 33.437 36.021 11.880  1.00 47.94  ? 121 ARG A CB  1 
ATOM   724  C CG  . ARG A 1 85  ? 33.064 34.591 11.450  1.00 60.07  ? 121 ARG A CG  1 
ATOM   725  C CD  . ARG A 1 85  ? 33.456 33.543 12.486  1.00 69.71  ? 121 ARG A CD  1 
ATOM   726  N NE  . ARG A 1 85  ? 32.651 32.323 12.402  1.00 79.56  ? 121 ARG A NE  1 
ATOM   727  C CZ  . ARG A 1 85  ? 32.602 31.389 13.350  1.00 92.93  ? 121 ARG A CZ  1 
ATOM   728  N NH1 . ARG A 1 85  ? 33.289 31.539 14.479  1.00 69.29  ? 121 ARG A NH1 1 
ATOM   729  N NH2 . ARG A 1 85  ? 31.832 30.319 13.196  1.00 83.99  ? 121 ARG A NH2 1 
ATOM   730  N N   . GLU A 1 86  ? 35.623 38.398 10.591  1.00 48.74  ? 122 GLU A N   1 
ATOM   731  C CA  . GLU A 1 86  ? 35.751 39.849 10.451  1.00 47.64  ? 122 GLU A CA  1 
ATOM   732  C C   . GLU A 1 86  ? 34.372 40.479 10.159  1.00 47.48  ? 122 GLU A C   1 
ATOM   733  O O   . GLU A 1 86  ? 33.610 40.021 9.303   1.00 44.67  ? 122 GLU A O   1 
ATOM   734  C CB  . GLU A 1 86  ? 36.782 40.264 9.394   1.00 50.49  ? 122 GLU A CB  1 
ATOM   735  C CG  . GLU A 1 86  ? 37.157 41.735 9.528   1.00 62.77  ? 122 GLU A CG  1 
ATOM   736  C CD  . GLU A 1 86  ? 37.988 42.324 8.408   1.00 84.83  ? 122 GLU A CD  1 
ATOM   737  O OE1 . GLU A 1 86  ? 37.420 42.563 7.321   1.00 70.80  ? 122 GLU A OE1 1 
ATOM   738  O OE2 . GLU A 1 86  ? 39.192 42.589 8.630   1.00 86.11  ? 122 GLU A OE2 1 
ATOM   739  N N   . LEU A 1 87  ? 34.068 41.541 10.883  1.00 42.81  ? 123 LEU A N   1 
ATOM   740  C CA  . LEU A 1 87  ? 32.781 42.185 10.736  1.00 40.17  ? 123 LEU A CA  1 
ATOM   741  C C   . LEU A 1 87  ? 32.867 43.405 9.865   1.00 42.86  ? 123 LEU A C   1 
ATOM   742  O O   . LEU A 1 87  ? 33.923 44.033 9.769   1.00 43.22  ? 123 LEU A O   1 
ATOM   743  C CB  . LEU A 1 87  ? 32.236 42.557 12.130  1.00 38.42  ? 123 LEU A CB  1 
ATOM   744  C CG  . LEU A 1 87  ? 32.263 41.454 13.205  1.00 42.06  ? 123 LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 87  ? 31.719 41.975 14.539  1.00 41.25  ? 123 LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 87  ? 31.488 40.222 12.771  1.00 42.20  ? 123 LEU A CD2 1 
ATOM   747  N N   . SER A 1 88  ? 31.762 43.699 9.176   1.00 38.63  ? 124 SER A N   1 
ATOM   748  C CA  . SER A 1 88  ? 31.560 44.952 8.477   1.00 38.81  ? 124 SER A CA  1 
ATOM   749  C C   . SER A 1 88  ? 30.426 45.668 9.245   1.00 43.00  ? 124 SER A C   1 
ATOM   750  O O   . SER A 1 88  ? 29.406 45.044 9.584   1.00 42.84  ? 124 SER A O   1 
ATOM   751  C CB  . SER A 1 88  ? 31.269 44.754 6.988   1.00 42.23  ? 124 SER A CB  1 
ATOM   752  O OG  . SER A 1 88  ? 29.877 44.814 6.738   1.00 51.68  ? 124 SER A OG  1 
ATOM   753  N N   . VAL A 1 89  ? 30.653 46.931 9.629   1.00 38.18  ? 125 VAL A N   1 
ATOM   754  C CA  . VAL A 1 89  ? 29.674 47.689 10.407  1.00 35.68  ? 125 VAL A CA  1 
ATOM   755  C C   . VAL A 1 89  ? 29.510 49.040 9.739   1.00 40.89  ? 125 VAL A C   1 
ATOM   756  O O   . VAL A 1 89  ? 30.487 49.749 9.504   1.00 40.92  ? 125 VAL A O   1 
ATOM   757  C CB  . VAL A 1 89  ? 30.009 47.823 11.923  1.00 37.45  ? 125 VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 89  ? 28.805 48.382 12.687  1.00 35.46  ? 125 VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 89  ? 30.443 46.491 12.547  1.00 36.68  ? 125 VAL A CG2 1 
ATOM   760  N N   . GLN A 1 90  ? 28.271 49.396 9.431   1.00 37.72  ? 126 GLN A N   1 
ATOM   761  C CA  . GLN A 1 90  ? 27.983 50.660 8.756   1.00 37.86  ? 126 GLN A CA  1 
ATOM   762  C C   . GLN A 1 90  ? 26.608 51.154 9.142   1.00 39.00  ? 126 GLN A C   1 
ATOM   763  O O   . GLN A 1 90  ? 25.833 50.396 9.709   1.00 36.72  ? 126 GLN A O   1 
ATOM   764  C CB  . GLN A 1 90  ? 28.076 50.468 7.216   1.00 39.15  ? 126 GLN A CB  1 
ATOM   765  C CG  . GLN A 1 90  ? 27.118 49.410 6.648   1.00 47.41  ? 126 GLN A CG  1 
ATOM   766  C CD  . GLN A 1 90  ? 26.802 49.569 5.171   1.00 77.98  ? 126 GLN A CD  1 
ATOM   767  O OE1 . GLN A 1 90  ? 27.299 50.466 4.474   1.00 72.36  ? 126 GLN A OE1 1 
ATOM   768  N NE2 . GLN A 1 90  ? 25.918 48.719 4.671   1.00 76.53  ? 126 GLN A NE2 1 
ATOM   769  N N   . LEU A 1 91  ? 26.266 52.392 8.764   1.00 35.83  ? 127 LEU A N   1 
ATOM   770  C CA  . LEU A 1 91  ? 24.917 52.848 8.998   1.00 34.31  ? 127 LEU A CA  1 
ATOM   771  C C   . LEU A 1 91  ? 24.018 52.041 8.057   1.00 35.11  ? 127 LEU A C   1 
ATOM   772  O O   . LEU A 1 91  ? 24.442 51.692 6.957   1.00 34.99  ? 127 LEU A O   1 
ATOM   773  C CB  . LEU A 1 91  ? 24.777 54.369 8.787   1.00 35.15  ? 127 LEU A CB  1 
ATOM   774  C CG  . LEU A 1 91  ? 25.353 55.313 9.867   1.00 40.36  ? 127 LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 91  ? 25.398 56.764 9.369   1.00 41.06  ? 127 LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 91  ? 24.581 55.223 11.174  1.00 40.07  ? 127 LEU A CD2 1 
ATOM   777  N N   . GLN A 1 92  ? 22.839 51.649 8.510   1.00 33.20  ? 128 GLN A N   1 
ATOM   778  C CA  . GLN A 1 92  ? 21.952 50.887 7.630   1.00 33.48  ? 128 GLN A CA  1 
ATOM   779  C C   . GLN A 1 92  ? 21.574 51.714 6.387   1.00 39.33  ? 128 GLN A C   1 
ATOM   780  O O   . GLN A 1 92  ? 21.087 52.845 6.551   1.00 39.06  ? 128 GLN A O   1 
ATOM   781  C CB  . GLN A 1 92  ? 20.667 50.496 8.348   1.00 33.19  ? 128 GLN A CB  1 
ATOM   782  C CG  . GLN A 1 92  ? 19.851 49.495 7.527   1.00 39.19  ? 128 GLN A CG  1 
ATOM   783  C CD  . GLN A 1 92  ? 18.559 49.104 8.192   1.00 50.98  ? 128 GLN A CD  1 
ATOM   784  O OE1 . GLN A 1 92  ? 18.292 49.433 9.357   1.00 44.19  ? 128 GLN A OE1 1 
ATOM   785  N NE2 . GLN A 1 92  ? 17.731 48.370 7.466   1.00 44.07  ? 128 GLN A NE2 1 
ATOM   786  N N   . PRO A 1 93  ? 21.751 51.155 5.174   1.00 36.58  ? 129 PRO A N   1 
ATOM   787  C CA  . PRO A 1 93  ? 21.320 51.874 3.964   1.00 37.81  ? 129 PRO A CA  1 
ATOM   788  C C   . PRO A 1 93  ? 19.822 52.142 3.976   1.00 42.84  ? 129 PRO A C   1 
ATOM   789  O O   . PRO A 1 93  ? 19.056 51.366 4.562   1.00 42.57  ? 129 PRO A O   1 
ATOM   790  C CB  . PRO A 1 93  ? 21.668 50.891 2.832   1.00 39.93  ? 129 PRO A CB  1 
ATOM   791  C CG  . PRO A 1 93  ? 22.754 50.002 3.438   1.00 44.39  ? 129 PRO A CG  1 
ATOM   792  C CD  . PRO A 1 93  ? 22.291 49.818 4.831   1.00 38.64  ? 129 PRO A CD  1 
ATOM   793  N N   . THR A 1 94  ? 19.421 53.266 3.388   1.00 40.30  ? 130 THR A N   1 
ATOM   794  C CA  . THR A 1 94  ? 18.006 53.632 3.227   1.00 39.92  ? 130 THR A CA  1 
ATOM   795  C C   . THR A 1 94  ? 17.761 53.848 1.740   1.00 41.23  ? 130 THR A C   1 
ATOM   796  O O   . THR A 1 94  ? 18.665 54.266 1.025   1.00 42.39  ? 130 THR A O   1 
ATOM   797  C CB  . THR A 1 94  ? 17.566 54.843 4.089   1.00 44.47  ? 130 THR A CB  1 
ATOM   798  O OG1 . THR A 1 94  ? 16.216 55.201 3.743   1.00 40.58  ? 130 THR A OG1 1 
ATOM   799  C CG2 . THR A 1 94  ? 18.447 56.055 3.912   1.00 39.48  ? 130 THR A CG2 1 
ATOM   800  N N   . ASP A 1 95  ? 16.562 53.516 1.286   1.00 36.55  ? 131 ASP A N   1 
ATOM   801  C CA  . ASP A 1 95  ? 16.099 53.730 -0.092  1.00 37.39  ? 131 ASP A CA  1 
ATOM   802  C C   . ASP A 1 95  ? 14.982 54.802 -0.051  1.00 37.62  ? 131 ASP A C   1 
ATOM   803  O O   . ASP A 1 95  ? 14.225 54.917 -1.002  1.00 38.27  ? 131 ASP A O   1 
ATOM   804  C CB  . ASP A 1 95  ? 15.579 52.381 -0.699  1.00 40.13  ? 131 ASP A CB  1 
ATOM   805  C CG  . ASP A 1 95  ? 14.476 51.674 0.103   1.00 55.27  ? 131 ASP A CG  1 
ATOM   806  O OD1 . ASP A 1 95  ? 14.156 52.137 1.229   1.00 57.50  ? 131 ASP A OD1 1 
ATOM   807  O OD2 . ASP A 1 95  ? 13.999 50.615 -0.351  1.00 65.50  ? 131 ASP A OD2 1 
ATOM   808  N N   . ALA A 1 96  ? 14.865 55.552 1.071   1.00 33.00  ? 132 ALA A N   1 
ATOM   809  C CA  . ALA A 1 96  ? 13.785 56.526 1.288   1.00 32.45  ? 132 ALA A CA  1 
ATOM   810  C C   . ALA A 1 96  ? 14.282 57.999 1.474   1.00 33.47  ? 132 ALA A C   1 
ATOM   811  O O   . ALA A 1 96  ? 13.644 58.780 2.176   1.00 30.49  ? 132 ALA A O   1 
ATOM   812  C CB  . ALA A 1 96  ? 12.957 56.089 2.502   1.00 32.05  ? 132 ALA A CB  1 
ATOM   813  N N   . LEU A 1 97  ? 15.406 58.376 0.851   1.00 30.83  ? 133 LEU A N   1 
ATOM   814  C CA  . LEU A 1 97  ? 15.912 59.738 1.025   1.00 30.05  ? 133 LEU A CA  1 
ATOM   815  C C   . LEU A 1 97  ? 15.739 60.584 -0.260  1.00 32.02  ? 133 LEU A C   1 
ATOM   816  O O   . LEU A 1 97  ? 16.159 60.204 -1.350  1.00 31.73  ? 133 LEU A O   1 
ATOM   817  C CB  . LEU A 1 97  ? 17.384 59.761 1.490   1.00 30.87  ? 133 LEU A CB  1 
ATOM   818  C CG  . LEU A 1 97  ? 18.077 61.142 1.524   1.00 34.56  ? 133 LEU A CG  1 
ATOM   819  C CD1 . LEU A 1 97  ? 17.555 62.002 2.677   1.00 33.31  ? 133 LEU A CD1 1 
ATOM   820  C CD2 . LEU A 1 97  ? 19.559 61.000 1.701   1.00 37.40  ? 133 LEU A CD2 1 
ATOM   821  N N   . LEU A 1 98  ? 15.104 61.739 -0.094  1.00 28.65  ? 134 LEU A N   1 
ATOM   822  C CA  . LEU A 1 98  ? 14.928 62.692 -1.183  1.00 28.03  ? 134 LEU A CA  1 
ATOM   823  C C   . LEU A 1 98  ? 15.672 63.979 -0.923  1.00 31.59  ? 134 LEU A C   1 
ATOM   824  O O   . LEU A 1 98  ? 15.783 64.430 0.230   1.00 30.68  ? 134 LEU A O   1 
ATOM   825  C CB  . LEU A 1 98  ? 13.428 63.023 -1.346  1.00 27.13  ? 134 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 98  ? 12.425 61.875 -1.644  1.00 29.85  ? 134 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 98  ? 10.995 62.413 -1.632  1.00 28.40  ? 134 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 98  ? 12.745 61.180 -2.972  1.00 33.63  ? 134 LEU A CD2 1 
ATOM   829  N N   . CYS A 1 99  ? 16.120 64.615 -2.001  1.00 30.24  ? 135 CYS A N   1 
ATOM   830  C CA  . CYS A 1 99  ? 16.554 65.983 -1.937  1.00 30.62  ? 135 CYS A CA  1 
ATOM   831  C C   . CYS A 1 99  ? 15.466 66.795 -2.643  1.00 31.05  ? 135 CYS A C   1 
ATOM   832  O O   . CYS A 1 99  ? 15.075 66.443 -3.747  1.00 30.73  ? 135 CYS A O   1 
ATOM   833  C CB  . CYS A 1 99  ? 17.940 66.236 -2.528  1.00 32.69  ? 135 CYS A CB  1 
ATOM   834  S SG  . CYS A 1 99  ? 18.406 68.000 -2.524  1.00 36.85  ? 135 CYS A SG  1 
ATOM   835  N N   . VAL A 1 100 ? 14.915 67.798 -1.970  1.00 26.53  ? 136 VAL A N   1 
ATOM   836  C CA  . VAL A 1 100 ? 13.898 68.704 -2.523  1.00 27.76  ? 136 VAL A CA  1 
ATOM   837  C C   . VAL A 1 100 ? 14.642 69.990 -2.824  1.00 33.33  ? 136 VAL A C   1 
ATOM   838  O O   . VAL A 1 100 ? 15.180 70.599 -1.897  1.00 31.60  ? 136 VAL A O   1 
ATOM   839  C CB  . VAL A 1 100 ? 12.667 68.940 -1.600  1.00 29.58  ? 136 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 100 ? 11.614 69.845 -2.294  1.00 29.15  ? 136 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 100 ? 12.041 67.617 -1.182  1.00 29.35  ? 136 VAL A CG2 1 
ATOM   842  N N   . ALA A 1 101 ? 14.713 70.380 -4.105  1.00 31.02  ? 137 ALA A N   1 
ATOM   843  C CA  . ALA A 1 101 ? 15.478 71.567 -4.428  1.00 31.74  ? 137 ALA A CA  1 
ATOM   844  C C   . ALA A 1 101 ? 14.626 72.610 -5.173  1.00 34.77  ? 137 ALA A C   1 
ATOM   845  O O   . ALA A 1 101 ? 13.466 72.354 -5.521  1.00 32.66  ? 137 ALA A O   1 
ATOM   846  C CB  . ALA A 1 101 ? 16.715 71.174 -5.229  1.00 33.76  ? 137 ALA A CB  1 
ATOM   847  N N   . ASN A 1 102 ? 15.196 73.814 -5.324  1.00 32.76  ? 138 ASN A N   1 
ATOM   848  C CA  . ASN A 1 102 ? 14.617 75.003 -5.934  1.00 33.12  ? 138 ASN A CA  1 
ATOM   849  C C   . ASN A 1 102 ? 13.467 75.534 -5.070  1.00 35.92  ? 138 ASN A C   1 
ATOM   850  O O   . ASN A 1 102 ? 12.475 76.058 -5.570  1.00 35.45  ? 138 ASN A O   1 
ATOM   851  C CB  . ASN A 1 102 ? 14.225 74.819 -7.424  1.00 34.68  ? 138 ASN A CB  1 
ATOM   852  C CG  . ASN A 1 102 ? 14.157 76.129 -8.155  1.00 46.32  ? 138 ASN A CG  1 
ATOM   853  O OD1 . ASN A 1 102 ? 14.895 77.068 -7.839  1.00 40.32  ? 138 ASN A OD1 1 
ATOM   854  N ND2 . ASN A 1 102 ? 13.192 76.261 -9.072  1.00 39.45  ? 138 ASN A ND2 1 
ATOM   855  N N   . LEU A 1 103 ? 13.643 75.433 -3.744  1.00 32.97  ? 139 LEU A N   1 
ATOM   856  C CA  . LEU A 1 103 ? 12.726 76.020 -2.756  1.00 32.06  ? 139 LEU A CA  1 
ATOM   857  C C   . LEU A 1 103 ? 12.967 77.501 -2.681  1.00 36.55  ? 139 LEU A C   1 
ATOM   858  O O   . LEU A 1 103 ? 14.132 77.900 -2.774  1.00 36.40  ? 139 LEU A O   1 
ATOM   859  C CB  . LEU A 1 103 ? 12.939 75.431 -1.329  1.00 30.70  ? 139 LEU A CB  1 
ATOM   860  C CG  . LEU A 1 103 ? 12.724 73.925 -1.118  1.00 33.73  ? 139 LEU A CG  1 
ATOM   861  C CD1 . LEU A 1 103 ? 13.444 73.466 0.206   1.00 32.79  ? 139 LEU A CD1 1 
ATOM   862  C CD2 . LEU A 1 103 ? 11.232 73.581 -1.065  1.00 32.65  ? 139 LEU A CD2 1 
ATOM   863  N N   . PRO A 1 104 ? 11.941 78.343 -2.404  1.00 35.01  ? 140 PRO A N   1 
ATOM   864  C CA  . PRO A 1 104 ? 12.235 79.762 -2.150  1.00 36.59  ? 140 PRO A CA  1 
ATOM   865  C C   . PRO A 1 104 ? 13.209 79.847 -0.969  1.00 44.54  ? 140 PRO A C   1 
ATOM   866  O O   . PRO A 1 104 ? 13.005 79.146 0.022   1.00 43.88  ? 140 PRO A O   1 
ATOM   867  C CB  . PRO A 1 104 ? 10.857 80.364 -1.808  1.00 37.47  ? 140 PRO A CB  1 
ATOM   868  C CG  . PRO A 1 104 ? 9.868  79.394 -2.321  1.00 39.57  ? 140 PRO A CG  1 
ATOM   869  C CD  . PRO A 1 104 ? 10.506 78.048 -2.220  1.00 34.49  ? 140 PRO A CD  1 
ATOM   870  N N   . PRO A 1 105 ? 14.320 80.605 -1.045  1.00 44.88  ? 141 PRO A N   1 
ATOM   871  C CA  . PRO A 1 105 ? 15.271 80.625 0.093   1.00 45.85  ? 141 PRO A CA  1 
ATOM   872  C C   . PRO A 1 105 ? 14.674 81.176 1.408   1.00 48.57  ? 141 PRO A C   1 
ATOM   873  O O   . PRO A 1 105 ? 15.254 80.905 2.451   1.00 49.06  ? 141 PRO A O   1 
ATOM   874  C CB  . PRO A 1 105 ? 16.419 81.493 -0.423  1.00 49.59  ? 141 PRO A CB  1 
ATOM   875  C CG  . PRO A 1 105 ? 16.320 81.402 -1.904  1.00 53.89  ? 141 PRO A CG  1 
ATOM   876  C CD  . PRO A 1 105 ? 14.827 81.419 -2.163  1.00 48.26  ? 141 PRO A CD  1 
ATOM   877  N N   . SER A 1 106 ? 13.495 81.871 1.389   1.00 43.75  ? 142 SER A N   1 
ATOM   878  C CA  . SER A 1 106 ? 12.870 82.362 2.643   1.00 44.04  ? 142 SER A CA  1 
ATOM   879  C C   . SER A 1 106 ? 11.923 81.305 3.272   1.00 45.08  ? 142 SER A C   1 
ATOM   880  O O   . SER A 1 106 ? 11.388 81.537 4.358   1.00 45.78  ? 142 SER A O   1 
ATOM   881  C CB  . SER A 1 106 ? 12.133 83.686 2.429   1.00 47.36  ? 142 SER A CB  1 
ATOM   882  O OG  . SER A 1 106 ? 10.940 83.535 1.675   1.00 52.79  ? 142 SER A OG  1 
ATOM   883  N N   . LEU A 1 107 ? 11.706 80.172 2.578   1.00 39.36  ? 143 LEU A N   1 
ATOM   884  C CA  . LEU A 1 107 ? 10.929 79.023 3.070   1.00 37.56  ? 143 LEU A CA  1 
ATOM   885  C C   . LEU A 1 107 ? 11.718 78.482 4.278   1.00 40.10  ? 143 LEU A C   1 
ATOM   886  O O   . LEU A 1 107 ? 12.909 78.198 4.151   1.00 39.63  ? 143 LEU A O   1 
ATOM   887  C CB  . LEU A 1 107 ? 10.782 77.986 1.934   1.00 35.94  ? 143 LEU A CB  1 
ATOM   888  C CG  . LEU A 1 107 ? 9.879  76.725 2.060   1.00 40.38  ? 143 LEU A CG  1 
ATOM   889  C CD1 . LEU A 1 107 ? 10.389 75.719 3.025   1.00 40.71  ? 143 LEU A CD1 1 
ATOM   890  C CD2 . LEU A 1 107 ? 8.411  77.035 2.188   1.00 45.68  ? 143 LEU A CD2 1 
ATOM   891  N N   . THR A 1 108 ? 11.084 78.457 5.456   1.00 37.46  ? 144 THR A N   1 
ATOM   892  C CA  . THR A 1 108 ? 11.724 78.068 6.726   1.00 37.38  ? 144 THR A CA  1 
ATOM   893  C C   . THR A 1 108 ? 11.785 76.540 6.929   1.00 37.22  ? 144 THR A C   1 
ATOM   894  O O   . THR A 1 108 ? 11.091 75.781 6.264   1.00 33.86  ? 144 THR A O   1 
ATOM   895  C CB  . THR A 1 108 ? 10.972 78.712 7.910   1.00 41.74  ? 144 THR A CB  1 
ATOM   896  O OG1 . THR A 1 108 ? 9.698  78.079 8.041   1.00 43.56  ? 144 THR A OG1 1 
ATOM   897  C CG2 . THR A 1 108 ? 10.817 80.245 7.781   1.00 40.23  ? 144 THR A CG2 1 
ATOM   898  N N   . GLN A 1 109 ? 12.587 76.114 7.912   1.00 36.21  ? 145 GLN A N   1 
ATOM   899  C CA  . GLN A 1 109 ? 12.734 74.724 8.333   1.00 33.99  ? 145 GLN A CA  1 
ATOM   900  C C   . GLN A 1 109 ? 11.360 74.120 8.732   1.00 37.21  ? 145 GLN A C   1 
ATOM   901  O O   . GLN A 1 109 ? 11.039 73.006 8.327   1.00 33.81  ? 145 GLN A O   1 
ATOM   902  C CB  . GLN A 1 109 ? 13.739 74.659 9.492   1.00 35.53  ? 145 GLN A CB  1 
ATOM   903  C CG  . GLN A 1 109 ? 13.885 73.297 10.171  1.00 37.82  ? 145 GLN A CG  1 
ATOM   904  C CD  . GLN A 1 109 ? 14.332 72.197 9.239   1.00 50.25  ? 145 GLN A CD  1 
ATOM   905  O OE1 . GLN A 1 109 ? 15.198 72.389 8.385   1.00 43.18  ? 145 GLN A OE1 1 
ATOM   906  N NE2 . GLN A 1 109 ? 13.748 71.015 9.391   1.00 40.69  ? 145 GLN A NE2 1 
ATOM   907  N N   . GLN A 1 110 ? 10.553 74.876 9.493   1.00 38.01  ? 146 GLN A N   1 
ATOM   908  C CA  . GLN A 1 110 ? 9.225  74.458 9.948   1.00 37.25  ? 146 GLN A CA  1 
ATOM   909  C C   . GLN A 1 110 ? 8.296  74.281 8.750   1.00 37.23  ? 146 GLN A C   1 
ATOM   910  O O   . GLN A 1 110 ? 7.545  73.310 8.688   1.00 36.26  ? 146 GLN A O   1 
ATOM   911  C CB  . GLN A 1 110 ? 8.654  75.491 10.947  1.00 40.35  ? 146 GLN A CB  1 
ATOM   912  C CG  . GLN A 1 110 ? 7.266  75.134 11.477  1.00 50.13  ? 146 GLN A CG  1 
ATOM   913  C CD  . GLN A 1 110 ? 6.699  76.229 12.353  1.00 77.27  ? 146 GLN A CD  1 
ATOM   914  O OE1 . GLN A 1 110 ? 7.236  76.537 13.423  1.00 76.29  ? 146 GLN A OE1 1 
ATOM   915  N NE2 . GLN A 1 110 ? 5.601  76.848 11.910  1.00 68.49  ? 146 GLN A NE2 1 
ATOM   916  N N   . GLN A 1 111 ? 8.364  75.200 7.791   1.00 32.82  ? 147 GLN A N   1 
ATOM   917  C CA  . GLN A 1 111 ? 7.554  75.103 6.581   1.00 31.38  ? 147 GLN A CA  1 
ATOM   918  C C   . GLN A 1 111 ? 7.991  73.939 5.729   1.00 34.60  ? 147 GLN A C   1 
ATOM   919  O O   . GLN A 1 111 ? 7.140  73.332 5.084   1.00 32.02  ? 147 GLN A O   1 
ATOM   920  C CB  . GLN A 1 111 ? 7.614  76.402 5.762   1.00 32.26  ? 147 GLN A CB  1 
ATOM   921  C CG  . GLN A 1 111 ? 6.728  77.497 6.320   1.00 34.66  ? 147 GLN A CG  1 
ATOM   922  C CD  . GLN A 1 111 ? 6.918  78.770 5.539   1.00 44.60  ? 147 GLN A CD  1 
ATOM   923  O OE1 . GLN A 1 111 ? 8.042  79.165 5.226   1.00 37.40  ? 147 GLN A OE1 1 
ATOM   924  N NE2 . GLN A 1 111 ? 5.835  79.493 5.304   1.00 38.33  ? 147 GLN A NE2 1 
ATOM   925  N N   . PHE A 1 112 ? 9.306  73.627 5.709   1.00 33.66  ? 148 PHE A N   1 
ATOM   926  C CA  . PHE A 1 112 ? 9.826  72.507 4.917   1.00 32.67  ? 148 PHE A CA  1 
ATOM   927  C C   . PHE A 1 112 ? 9.329  71.174 5.506   1.00 35.98  ? 148 PHE A C   1 
ATOM   928  O O   . PHE A 1 112 ? 8.959  70.288 4.746   1.00 33.71  ? 148 PHE A O   1 
ATOM   929  C CB  . PHE A 1 112 ? 11.364 72.534 4.823   1.00 34.37  ? 148 PHE A CB  1 
ATOM   930  C CG  . PHE A 1 112 ? 11.938 71.397 3.991   1.00 35.00  ? 148 PHE A CG  1 
ATOM   931  C CD1 . PHE A 1 112 ? 11.579 71.237 2.649   1.00 36.58  ? 148 PHE A CD1 1 
ATOM   932  C CD2 . PHE A 1 112 ? 12.856 70.504 4.541   1.00 34.67  ? 148 PHE A CD2 1 
ATOM   933  C CE1 . PHE A 1 112 ? 12.118 70.186 1.880   1.00 36.19  ? 148 PHE A CE1 1 
ATOM   934  C CE2 . PHE A 1 112 ? 13.389 69.462 3.772   1.00 35.89  ? 148 PHE A CE2 1 
ATOM   935  C CZ  . PHE A 1 112 ? 13.009 69.299 2.457   1.00 32.91  ? 148 PHE A CZ  1 
ATOM   936  N N   . GLU A 1 113 ? 9.295  71.056 6.846   1.00 34.44  ? 149 GLU A N   1 
ATOM   937  C CA  . GLU A 1 113 ? 8.766  69.871 7.543   1.00 33.89  ? 149 GLU A CA  1 
ATOM   938  C C   . GLU A 1 113 ? 7.293  69.745 7.227   1.00 36.39  ? 149 GLU A C   1 
ATOM   939  O O   . GLU A 1 113 ? 6.820  68.649 6.969   1.00 34.23  ? 149 GLU A O   1 
ATOM   940  C CB  . GLU A 1 113 ? 8.945  69.985 9.083   1.00 36.27  ? 149 GLU A CB  1 
ATOM   941  C CG  . GLU A 1 113 ? 10.371 69.945 9.613   1.00 48.53  ? 149 GLU A CG  1 
ATOM   942  C CD  . GLU A 1 113 ? 10.580 70.528 11.004  1.00 65.44  ? 149 GLU A CD  1 
ATOM   943  O OE1 . GLU A 1 113 ? 9.589  70.682 11.755  1.00 56.46  ? 149 GLU A OE1 1 
ATOM   944  O OE2 . GLU A 1 113 ? 11.739 70.880 11.321  1.00 49.77  ? 149 GLU A OE2 1 
ATOM   945  N N   . GLU A 1 114 ? 6.558  70.885 7.247   1.00 33.85  ? 150 GLU A N   1 
ATOM   946  C CA  . GLU A 1 114 ? 5.122  70.886 6.959   1.00 34.81  ? 150 GLU A CA  1 
ATOM   947  C C   . GLU A 1 114 ? 4.820  70.520 5.474   1.00 35.73  ? 150 GLU A C   1 
ATOM   948  O O   . GLU A 1 114 ? 3.756  69.970 5.185   1.00 33.20  ? 150 GLU A O   1 
ATOM   949  C CB  . GLU A 1 114 ? 4.478  72.213 7.343   1.00 37.03  ? 150 GLU A CB  1 
ATOM   950  C CG  . GLU A 1 114 ? 4.373  72.364 8.852   1.00 46.63  ? 150 GLU A CG  1 
ATOM   951  C CD  . GLU A 1 114 ? 4.139  73.780 9.358   1.00 54.93  ? 150 GLU A CD  1 
ATOM   952  O OE1 . GLU A 1 114 ? 4.079  74.725 8.536   1.00 51.21  ? 150 GLU A OE1 1 
ATOM   953  O OE2 . GLU A 1 114 ? 4.057  73.945 10.593  1.00 44.23  ? 150 GLU A OE2 1 
ATOM   954  N N   . LEU A 1 115 ? 5.776  70.757 4.580   1.00 32.93  ? 151 LEU A N   1 
ATOM   955  C CA  . LEU A 1 115 ? 5.653  70.406 3.166   1.00 32.27  ? 151 LEU A CA  1 
ATOM   956  C C   . LEU A 1 115 ? 5.827  68.869 2.936   1.00 34.90  ? 151 LEU A C   1 
ATOM   957  O O   . LEU A 1 115 ? 5.110  68.286 2.135   1.00 35.26  ? 151 LEU A O   1 
ATOM   958  C CB  . LEU A 1 115 ? 6.697  71.181 2.324   1.00 31.76  ? 151 LEU A CB  1 
ATOM   959  C CG  . LEU A 1 115 ? 6.747  70.875 0.793   1.00 34.80  ? 151 LEU A CG  1 
ATOM   960  C CD1 . LEU A 1 115 ? 5.551  71.535 0.057   1.00 34.83  ? 151 LEU A CD1 1 
ATOM   961  C CD2 . LEU A 1 115 ? 8.048  71.375 0.191   1.00 35.66  ? 151 LEU A CD2 1 
ATOM   962  N N   . VAL A 1 116 ? 6.765  68.246 3.628   1.00 30.47  ? 152 VAL A N   1 
ATOM   963  C CA  . VAL A 1 116 ? 7.133  66.840 3.399   1.00 29.75  ? 152 VAL A CA  1 
ATOM   964  C C   . VAL A 1 116 ? 6.485  65.836 4.384   1.00 34.97  ? 152 VAL A C   1 
ATOM   965  O O   . VAL A 1 116 ? 6.246  64.684 3.993   1.00 33.58  ? 152 VAL A O   1 
ATOM   966  C CB  . VAL A 1 116 ? 8.685  66.672 3.348   1.00 31.40  ? 152 VAL A CB  1 
ATOM   967  C CG1 . VAL A 1 116 ? 9.289  67.475 2.179   1.00 30.67  ? 152 VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1 116 ? 9.357  67.026 4.672   1.00 30.61  ? 152 VAL A CG2 1 
ATOM   969  N N   . ARG A 1 117 ? 6.146  66.270 5.623   1.00 34.48  ? 153 ARG A N   1 
ATOM   970  C CA  . ARG A 1 117 ? 5.510  65.396 6.622   1.00 35.25  ? 153 ARG A CA  1 
ATOM   971  C C   . ARG A 1 117 ? 4.139  64.770 6.146   1.00 40.51  ? 153 ARG A C   1 
ATOM   972  O O   . ARG A 1 117 ? 3.849  63.659 6.585   1.00 41.21  ? 153 ARG A O   1 
ATOM   973  C CB  . ARG A 1 117 ? 5.305  66.159 7.964   1.00 37.55  ? 153 ARG A CB  1 
ATOM   974  C CG  . ARG A 1 117 ? 4.803  65.326 9.157   1.00 44.52  ? 153 ARG A CG  1 
ATOM   975  C CD  . ARG A 1 117 ? 5.556  64.018 9.354   1.00 47.23  ? 153 ARG A CD  1 
ATOM   976  N NE  . ARG A 1 117 ? 4.928  63.163 10.362  1.00 60.99  ? 153 ARG A NE  1 
ATOM   977  C CZ  . ARG A 1 117 ? 4.020  62.224 10.106  1.00 72.57  ? 153 ARG A CZ  1 
ATOM   978  N NH1 . ARG A 1 117 ? 3.612  62.004 8.860   1.00 48.86  ? 153 ARG A NH1 1 
ATOM   979  N NH2 . ARG A 1 117 ? 3.518  61.491 11.095  1.00 60.36  ? 153 ARG A NH2 1 
ATOM   980  N N   . PRO A 1 118 ? 3.266  65.406 5.317   1.00 38.98  ? 154 PRO A N   1 
ATOM   981  C CA  . PRO A 1 118 ? 1.983  64.741 4.982   1.00 39.86  ? 154 PRO A CA  1 
ATOM   982  C C   . PRO A 1 118 ? 2.142  63.385 4.303   1.00 43.50  ? 154 PRO A C   1 
ATOM   983  O O   . PRO A 1 118 ? 1.229  62.548 4.390   1.00 44.25  ? 154 PRO A O   1 
ATOM   984  C CB  . PRO A 1 118 ? 1.305  65.736 4.029   1.00 41.19  ? 154 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 118 ? 1.882  67.073 4.420   1.00 45.19  ? 154 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 118 ? 3.329  66.755 4.711   1.00 39.56  ? 154 PRO A CD  1 
ATOM   987  N N   . PHE A 1 119 ? 3.320  63.131 3.682   1.00 37.33  ? 155 PHE A N   1 
ATOM   988  C CA  . PHE A 1 119 ? 3.509  61.894 2.936   1.00 35.27  ? 155 PHE A CA  1 
ATOM   989  C C   . PHE A 1 119 ? 3.852  60.680 3.807   1.00 38.01  ? 155 PHE A C   1 
ATOM   990  O O   . PHE A 1 119 ? 3.677  59.562 3.348   1.00 36.42  ? 155 PHE A O   1 
ATOM   991  C CB  . PHE A 1 119 ? 4.533  62.090 1.828   1.00 35.32  ? 155 PHE A CB  1 
ATOM   992  C CG  . PHE A 1 119 ? 4.090  63.162 0.881   1.00 35.49  ? 155 PHE A CG  1 
ATOM   993  C CD1 . PHE A 1 119 ? 3.146  62.893 -0.107  1.00 37.24  ? 155 PHE A CD1 1 
ATOM   994  C CD2 . PHE A 1 119 ? 4.581  64.462 0.997   1.00 36.16  ? 155 PHE A CD2 1 
ATOM   995  C CE1 . PHE A 1 119 ? 2.709  63.906 -0.963  1.00 38.15  ? 155 PHE A CE1 1 
ATOM   996  C CE2 . PHE A 1 119 ? 4.150  65.467 0.131   1.00 38.17  ? 155 PHE A CE2 1 
ATOM   997  C CZ  . PHE A 1 119 ? 3.211  65.184 -0.831  1.00 36.60  ? 155 PHE A CZ  1 
ATOM   998  N N   . GLY A 1 120 ? 4.228  60.898 5.063   1.00 36.73  ? 156 GLY A N   1 
ATOM   999  C CA  . GLY A 1 120 ? 4.591  59.819 5.982   1.00 36.16  ? 156 GLY A CA  1 
ATOM   1000 C C   . GLY A 1 120 ? 5.607  60.285 6.995   1.00 39.52  ? 156 GLY A C   1 
ATOM   1001 O O   . GLY A 1 120 ? 6.154  61.390 6.852   1.00 37.73  ? 156 GLY A O   1 
ATOM   1002 N N   . SER A 1 121 ? 5.838  59.467 8.050   1.00 37.29  ? 157 SER A N   1 
ATOM   1003 C CA  . SER A 1 121 ? 6.750  59.831 9.142   1.00 37.15  ? 157 SER A CA  1 
ATOM   1004 C C   . SER A 1 121 ? 8.199  59.915 8.657   1.00 39.44  ? 157 SER A C   1 
ATOM   1005 O O   . SER A 1 121 ? 8.628  59.181 7.749   1.00 37.09  ? 157 SER A O   1 
ATOM   1006 C CB  . SER A 1 121 ? 6.611  58.897 10.344  1.00 40.34  ? 157 SER A CB  1 
ATOM   1007 O OG  . SER A 1 121 ? 6.561  57.544 9.946   1.00 51.61  ? 157 SER A OG  1 
ATOM   1008 N N   . LEU A 1 122 ? 8.941  60.834 9.271   1.00 36.48  ? 158 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 122 ? 10.310 61.144 8.874   1.00 35.45  ? 158 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 122 ? 11.344 60.713 9.867   1.00 40.24  ? 158 LEU A C   1 
ATOM   1011 O O   . LEU A 1 122 ? 11.154 60.841 11.077  1.00 40.27  ? 158 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 122 ? 10.434 62.663 8.656   1.00 34.66  ? 158 LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 122 ? 9.608  63.219 7.493   1.00 36.42  ? 158 LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 122 ? 9.018  64.568 7.859   1.00 36.23  ? 158 LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 122 ? 10.434 63.237 6.182   1.00 33.48  ? 158 LEU A CD2 1 
ATOM   1016 N N   . GLU A 1 123 ? 12.468 60.230 9.339   1.00 36.69  ? 159 GLU A N   1 
ATOM   1017 C CA  . GLU A 1 123 ? 13.641 59.879 10.120  1.00 36.01  ? 159 GLU A CA  1 
ATOM   1018 C C   . GLU A 1 123 ? 14.510 61.108 10.261  1.00 39.72  ? 159 GLU A C   1 
ATOM   1019 O O   . GLU A 1 123 ? 15.082 61.337 11.328  1.00 39.51  ? 159 GLU A O   1 
ATOM   1020 C CB  . GLU A 1 123 ? 14.422 58.733 9.439   1.00 36.43  ? 159 GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 123 ? 13.619 57.445 9.353   1.00 46.28  ? 159 GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 123 ? 13.226 56.875 10.702  1.00 72.36  ? 159 GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 123 ? 14.112 56.809 11.587  1.00 58.34  ? 159 GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 123 ? 12.021 56.579 10.900  1.00 65.80  ? 159 GLU A OE2 1 
ATOM   1025 N N   . ARG A 1 124 ? 14.659 61.878 9.149   1.00 34.14  ? 160 ARG A N   1 
ATOM   1026 C CA  . ARG A 1 124 ? 15.455 63.115 9.113   1.00 34.18  ? 160 ARG A CA  1 
ATOM   1027 C C   . ARG A 1 124 ? 14.773 64.118 8.208   1.00 35.23  ? 160 ARG A C   1 
ATOM   1028 O O   . ARG A 1 124 ? 14.176 63.731 7.215   1.00 34.46  ? 160 ARG A O   1 
ATOM   1029 C CB  . ARG A 1 124 ? 16.904 62.877 8.630   1.00 34.47  ? 160 ARG A CB  1 
ATOM   1030 C CG  . ARG A 1 124 ? 17.763 61.932 9.520   1.00 38.13  ? 160 ARG A CG  1 
ATOM   1031 C CD  . ARG A 1 124 ? 19.193 61.863 9.034   1.00 36.66  ? 160 ARG A CD  1 
ATOM   1032 N NE  . ARG A 1 124 ? 19.280 61.147 7.760   1.00 37.69  ? 160 ARG A NE  1 
ATOM   1033 C CZ  . ARG A 1 124 ? 20.271 61.267 6.888   1.00 45.25  ? 160 ARG A CZ  1 
ATOM   1034 N NH1 . ARG A 1 124 ? 21.291 62.081 7.135   1.00 40.65  ? 160 ARG A NH1 1 
ATOM   1035 N NH2 . ARG A 1 124 ? 20.269 60.550 5.774   1.00 38.98  ? 160 ARG A NH2 1 
ATOM   1036 N N   . CYS A 1 125 ? 14.843 65.388 8.555   1.00 32.07  ? 161 CYS A N   1 
ATOM   1037 C CA  . CYS A 1 125 ? 14.265 66.449 7.743   1.00 31.95  ? 161 CYS A CA  1 
ATOM   1038 C C   . CYS A 1 125 ? 15.018 67.739 7.983   1.00 35.65  ? 161 CYS A C   1 
ATOM   1039 O O   . CYS A 1 125 ? 14.941 68.312 9.076   1.00 35.11  ? 161 CYS A O   1 
ATOM   1040 C CB  . CYS A 1 125 ? 12.770 66.611 8.013   1.00 32.58  ? 161 CYS A CB  1 
ATOM   1041 S SG  . CYS A 1 125 ? 12.006 67.948 7.068   1.00 36.93  ? 161 CYS A SG  1 
ATOM   1042 N N   . PHE A 1 126 ? 15.715 68.242 6.949   1.00 31.07  ? 162 PHE A N   1 
ATOM   1043 C CA  . PHE A 1 126 ? 16.466 69.483 7.170   1.00 30.92  ? 162 PHE A CA  1 
ATOM   1044 C C   . PHE A 1 126 ? 16.753 70.247 5.909   1.00 33.31  ? 162 PHE A C   1 
ATOM   1045 O O   . PHE A 1 126 ? 17.066 69.658 4.870   1.00 32.89  ? 162 PHE A O   1 
ATOM   1046 C CB  . PHE A 1 126 ? 17.833 69.165 7.878   1.00 32.53  ? 162 PHE A CB  1 
ATOM   1047 C CG  . PHE A 1 126 ? 18.686 68.119 7.179   1.00 32.60  ? 162 PHE A CG  1 
ATOM   1048 C CD1 . PHE A 1 126 ? 19.716 68.496 6.318   1.00 35.86  ? 162 PHE A CD1 1 
ATOM   1049 C CD2 . PHE A 1 126 ? 18.446 66.757 7.367   1.00 33.19  ? 162 PHE A CD2 1 
ATOM   1050 C CE1 . PHE A 1 126 ? 20.485 67.531 5.655   1.00 36.63  ? 162 PHE A CE1 1 
ATOM   1051 C CE2 . PHE A 1 126 ? 19.205 65.791 6.690   1.00 34.32  ? 162 PHE A CE2 1 
ATOM   1052 C CZ  . PHE A 1 126 ? 20.221 66.186 5.842   1.00 33.91  ? 162 PHE A CZ  1 
ATOM   1053 N N   . LEU A 1 127 ? 16.768 71.561 6.035   1.00 32.72  ? 163 LEU A N   1 
ATOM   1054 C CA  . LEU A 1 127 ? 17.258 72.479 5.006   1.00 33.04  ? 163 LEU A CA  1 
ATOM   1055 C C   . LEU A 1 127 ? 18.777 72.532 5.158   1.00 40.70  ? 163 LEU A C   1 
ATOM   1056 O O   . LEU A 1 127 ? 19.290 72.244 6.242   1.00 41.61  ? 163 LEU A O   1 
ATOM   1057 C CB  . LEU A 1 127 ? 16.672 73.919 5.169   1.00 33.30  ? 163 LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 127 ? 15.180 74.146 4.930   1.00 35.52  ? 163 LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 127 ? 14.814 75.611 5.179   1.00 35.86  ? 163 LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 127 ? 14.778 73.727 3.543   1.00 32.98  ? 163 LEU A CD2 1 
ATOM   1061 N N   . VAL A 1 128 ? 19.487 72.902 4.103   1.00 38.00  ? 164 VAL A N   1 
ATOM   1062 C CA  . VAL A 1 128 ? 20.930 73.121 4.161   1.00 39.52  ? 164 VAL A CA  1 
ATOM   1063 C C   . VAL A 1 128 ? 21.119 74.641 4.081   1.00 45.44  ? 164 VAL A C   1 
ATOM   1064 O O   . VAL A 1 128 ? 20.523 75.313 3.228   1.00 44.05  ? 164 VAL A O   1 
ATOM   1065 C CB  . VAL A 1 128 ? 21.715 72.336 3.077   1.00 42.84  ? 164 VAL A CB  1 
ATOM   1066 C CG1 . VAL A 1 128 ? 23.196 72.729 3.053   1.00 44.88  ? 164 VAL A CG1 1 
ATOM   1067 C CG2 . VAL A 1 128 ? 21.544 70.827 3.257   1.00 40.41  ? 164 VAL A CG2 1 
ATOM   1068 N N   . TYR A 1 129 ? 21.890 75.181 5.016   1.00 44.89  ? 165 TYR A N   1 
ATOM   1069 C CA  . TYR A 1 129 ? 22.126 76.612 5.106   1.00 46.80  ? 165 TYR A CA  1 
ATOM   1070 C C   . TYR A 1 129 ? 23.568 76.987 4.834   1.00 53.51  ? 165 TYR A C   1 
ATOM   1071 O O   . TYR A 1 129 ? 24.486 76.205 5.096   1.00 52.31  ? 165 TYR A O   1 
ATOM   1072 C CB  . TYR A 1 129 ? 21.772 77.114 6.517   1.00 47.76  ? 165 TYR A CB  1 
ATOM   1073 C CG  . TYR A 1 129 ? 20.362 76.850 6.993   1.00 45.09  ? 165 TYR A CG  1 
ATOM   1074 C CD1 . TYR A 1 129 ? 19.317 77.704 6.649   1.00 45.40  ? 165 TYR A CD1 1 
ATOM   1075 C CD2 . TYR A 1 129 ? 20.091 75.812 7.875   1.00 45.01  ? 165 TYR A CD2 1 
ATOM   1076 C CE1 . TYR A 1 129 ? 18.028 77.497 7.132   1.00 42.15  ? 165 TYR A CE1 1 
ATOM   1077 C CE2 . TYR A 1 129 ? 18.803 75.586 8.353   1.00 44.23  ? 165 TYR A CE2 1 
ATOM   1078 C CZ  . TYR A 1 129 ? 17.782 76.446 7.998   1.00 46.93  ? 165 TYR A CZ  1 
ATOM   1079 O OH  . TYR A 1 129 ? 16.536 76.249 8.527   1.00 45.34  ? 165 TYR A OH  1 
ATOM   1080 N N   . SER A 1 130 ? 23.764 78.210 4.351   1.00 52.59  ? 166 SER A N   1 
ATOM   1081 C CA  . SER A 1 130 ? 25.086 78.793 4.208   1.00 56.33  ? 166 SER A CA  1 
ATOM   1082 C C   . SER A 1 130 ? 25.667 78.969 5.632   1.00 64.27  ? 166 SER A C   1 
ATOM   1083 O O   . SER A 1 130 ? 24.996 79.554 6.488   1.00 64.42  ? 166 SER A O   1 
ATOM   1084 C CB  . SER A 1 130 ? 25.001 80.129 3.470   1.00 60.21  ? 166 SER A CB  1 
ATOM   1085 O OG  . SER A 1 130 ? 26.117 80.943 3.787   1.00 73.41  ? 166 SER A OG  1 
ATOM   1086 N N   . GLU A 1 131 ? 26.863 78.414 5.906   1.00 63.20  ? 167 GLU A N   1 
ATOM   1087 C CA  . GLU A 1 131 ? 27.483 78.538 7.231   1.00 66.11  ? 167 GLU A CA  1 
ATOM   1088 C C   . GLU A 1 131 ? 27.855 79.996 7.568   1.00 74.72  ? 167 GLU A C   1 
ATOM   1089 O O   . GLU A 1 131 ? 27.845 80.363 8.745   1.00 77.61  ? 167 GLU A O   1 
ATOM   1090 C CB  . GLU A 1 131 ? 28.708 77.632 7.348   1.00 68.30  ? 167 GLU A CB  1 
ATOM   1091 C CG  . GLU A 1 131 ? 28.348 76.277 7.932   1.00 77.38  ? 167 GLU A CG  1 
ATOM   1092 C CD  . GLU A 1 131 ? 29.434 75.222 7.917   1.00 98.96  ? 167 GLU A CD  1 
ATOM   1093 O OE1 . GLU A 1 131 ? 30.557 75.511 8.391   1.00 101.79 ? 167 GLU A OE1 1 
ATOM   1094 O OE2 . GLU A 1 131 ? 29.138 74.082 7.490   1.00 87.28  ? 167 GLU A OE2 1 
ATOM   1095 N N   . ARG A 1 132 ? 28.156 80.814 6.534   1.00 72.17  ? 168 ARG A N   1 
ATOM   1096 C CA  A ARG A 1 132 ? 28.535 82.222 6.672   0.50 75.06  ? 168 ARG A CA  1 
ATOM   1097 C CA  B ARG A 1 132 ? 28.531 82.218 6.684   0.50 75.24  ? 168 ARG A CA  1 
ATOM   1098 C C   . ARG A 1 132 ? 27.326 83.090 7.070   1.00 78.35  ? 168 ARG A C   1 
ATOM   1099 O O   . ARG A 1 132 ? 27.371 83.760 8.102   1.00 80.26  ? 168 ARG A O   1 
ATOM   1100 C CB  A ARG A 1 132 ? 29.164 82.737 5.356   0.50 76.33  ? 168 ARG A CB  1 
ATOM   1101 C CB  B ARG A 1 132 ? 29.165 82.738 5.382   0.50 77.38  ? 168 ARG A CB  1 
ATOM   1102 C CG  A ARG A 1 132 ? 29.956 84.043 5.495   0.50 87.05  ? 168 ARG A CG  1 
ATOM   1103 C CG  B ARG A 1 132 ? 30.139 83.891 5.588   0.50 91.48  ? 168 ARG A CG  1 
ATOM   1104 C CD  A ARG A 1 132 ? 30.438 84.587 4.157   0.50 88.65  ? 168 ARG A CD  1 
ATOM   1105 C CD  B ARG A 1 132 ? 29.963 84.950 4.523   0.50 98.22  ? 168 ARG A CD  1 
ATOM   1106 N NE  A ARG A 1 132 ? 31.710 83.998 3.727   0.50 86.73  ? 168 ARG A NE  1 
ATOM   1107 N NE  B ARG A 1 132 ? 28.990 85.965 4.928   0.50 102.66 ? 168 ARG A NE  1 
ATOM   1108 C CZ  A ARG A 1 132 ? 31.845 83.134 2.724   0.50 94.27  ? 168 ARG A CZ  1 
ATOM   1109 C CZ  B ARG A 1 132 ? 28.467 86.872 4.110   0.50 112.59 ? 168 ARG A CZ  1 
ATOM   1110 N NH1 A ARG A 1 132 ? 30.785 82.742 2.026   0.50 75.07  ? 168 ARG A NH1 1 
ATOM   1111 N NH1 B ARG A 1 132 ? 28.785 86.877 2.822   0.50 97.67  ? 168 ARG A NH1 1 
ATOM   1112 N NH2 A ARG A 1 132 ? 33.042 82.659 2.407   0.50 79.73  ? 168 ARG A NH2 1 
ATOM   1113 N NH2 B ARG A 1 132 ? 27.597 87.761 4.567   0.50 98.57  ? 168 ARG A NH2 1 
ATOM   1114 N N   . THR A 1 133 ? 26.249 83.085 6.247   1.00 71.83  ? 169 THR A N   1 
ATOM   1115 C CA  . THR A 1 133 ? 25.044 83.909 6.447   1.00 70.52  ? 169 THR A CA  1 
ATOM   1116 C C   . THR A 1 133 ? 23.889 83.264 7.229   1.00 69.13  ? 169 THR A C   1 
ATOM   1117 O O   . THR A 1 133 ? 23.041 83.997 7.744   1.00 69.05  ? 169 THR A O   1 
ATOM   1118 C CB  . THR A 1 133 ? 24.459 84.341 5.089   1.00 76.49  ? 169 THR A CB  1 
ATOM   1119 O OG1 . THR A 1 133 ? 24.029 83.193 4.369   1.00 75.21  ? 169 THR A OG1 1 
ATOM   1120 C CG2 . THR A 1 133 ? 25.425 85.137 4.248   1.00 78.51  ? 169 THR A CG2 1 
ATOM   1121 N N   . GLY A 1 134 ? 23.804 81.937 7.238   1.00 61.29  ? 170 GLY A N   1 
ATOM   1122 C CA  . GLY A 1 134 ? 22.671 81.249 7.855   1.00 58.20  ? 170 GLY A CA  1 
ATOM   1123 C C   . GLY A 1 134 ? 21.458 81.218 6.931   1.00 57.00  ? 170 GLY A C   1 
ATOM   1124 O O   . GLY A 1 134 ? 20.388 80.732 7.313   1.00 54.68  ? 170 GLY A O   1 
ATOM   1125 N N   . GLN A 1 135 ? 21.614 81.720 5.695   1.00 51.79  ? 171 GLN A N   1 
ATOM   1126 C CA  . GLN A 1 135 ? 20.540 81.725 4.704   1.00 49.23  ? 171 GLN A CA  1 
ATOM   1127 C C   . GLN A 1 135 ? 20.362 80.343 4.071   1.00 49.85  ? 171 GLN A C   1 
ATOM   1128 O O   . GLN A 1 135 ? 21.342 79.643 3.816   1.00 49.97  ? 171 GLN A O   1 
ATOM   1129 C CB  . GLN A 1 135 ? 20.783 82.775 3.594   1.00 51.67  ? 171 GLN A CB  1 
ATOM   1130 C CG  . GLN A 1 135 ? 20.774 84.247 4.050   1.00 60.85  ? 171 GLN A CG  1 
ATOM   1131 C CD  . GLN A 1 135 ? 19.413 84.827 4.397   1.00 75.40  ? 171 GLN A CD  1 
ATOM   1132 O OE1 . GLN A 1 135 ? 18.346 84.228 4.187   1.00 62.93  ? 171 GLN A OE1 1 
ATOM   1133 N NE2 . GLN A 1 135 ? 19.421 86.036 4.926   1.00 73.75  ? 171 GLN A NE2 1 
ATOM   1134 N N   . SER A 1 136 ? 19.104 79.969 3.780   1.00 42.61  ? 172 SER A N   1 
ATOM   1135 C CA  . SER A 1 136 ? 18.804 78.710 3.112   1.00 40.14  ? 172 SER A CA  1 
ATOM   1136 C C   . SER A 1 136 ? 19.381 78.724 1.721   1.00 46.13  ? 172 SER A C   1 
ATOM   1137 O O   . SER A 1 136 ? 19.338 79.751 1.036   1.00 47.08  ? 172 SER A O   1 
ATOM   1138 C CB  . SER A 1 136 ? 17.295 78.465 3.043   1.00 40.31  ? 172 SER A CB  1 
ATOM   1139 O OG  . SER A 1 136 ? 16.982 77.227 2.417   1.00 44.43  ? 172 SER A OG  1 
ATOM   1140 N N   . LYS A 1 137 ? 19.946 77.585 1.315   1.00 43.97  ? 173 LYS A N   1 
ATOM   1141 C CA  . LYS A 1 137 ? 20.476 77.383 -0.032  1.00 43.93  ? 173 LYS A CA  1 
ATOM   1142 C C   . LYS A 1 137 ? 19.320 76.923 -0.985  1.00 45.07  ? 173 LYS A C   1 
ATOM   1143 O O   . LYS A 1 137 ? 19.553 76.622 -2.156  1.00 44.97  ? 173 LYS A O   1 
ATOM   1144 C CB  . LYS A 1 137 ? 21.637 76.371 0.012   1.00 46.35  ? 173 LYS A CB  1 
ATOM   1145 C CG  . LYS A 1 137 ? 22.857 76.911 0.743   1.00 47.98  ? 173 LYS A CG  1 
ATOM   1146 C CD  . LYS A 1 137 ? 24.095 76.099 0.451   1.00 51.78  ? 173 LYS A CD  1 
ATOM   1147 C CE  . LYS A 1 137 ? 25.322 76.832 0.905   1.00 62.60  ? 173 LYS A CE  1 
ATOM   1148 N NZ  . LYS A 1 137 ? 26.569 76.172 0.448   1.00 60.97  ? 173 LYS A NZ  1 
ATOM   1149 N N   . GLY A 1 138 ? 18.094 76.889 -0.459  1.00 39.85  ? 174 GLY A N   1 
ATOM   1150 C CA  . GLY A 1 138 ? 16.885 76.519 -1.193  1.00 37.50  ? 174 GLY A CA  1 
ATOM   1151 C C   . GLY A 1 138 ? 16.681 75.034 -1.399  1.00 38.86  ? 174 GLY A C   1 
ATOM   1152 O O   . GLY A 1 138 ? 15.871 74.633 -2.239  1.00 38.16  ? 174 GLY A O   1 
ATOM   1153 N N   . TYR A 1 139 ? 17.445 74.197 -0.691  1.00 34.58  ? 175 TYR A N   1 
ATOM   1154 C CA  . TYR A 1 139 ? 17.218 72.776 -0.819  1.00 33.30  ? 175 TYR A CA  1 
ATOM   1155 C C   . TYR A 1 139 ? 17.317 72.130 0.554   1.00 36.22  ? 175 TYR A C   1 
ATOM   1156 O O   . TYR A 1 139 ? 17.998 72.650 1.438   1.00 36.53  ? 175 TYR A O   1 
ATOM   1157 C CB  . TYR A 1 139 ? 18.131 72.092 -1.868  1.00 34.52  ? 175 TYR A CB  1 
ATOM   1158 C CG  . TYR A 1 139 ? 19.609 72.171 -1.572  1.00 38.73  ? 175 TYR A CG  1 
ATOM   1159 C CD1 . TYR A 1 139 ? 20.227 71.244 -0.730  1.00 40.52  ? 175 TYR A CD1 1 
ATOM   1160 C CD2 . TYR A 1 139 ? 20.405 73.145 -2.165  1.00 41.09  ? 175 TYR A CD2 1 
ATOM   1161 C CE1 . TYR A 1 139 ? 21.590 71.325 -0.443  1.00 39.77  ? 175 TYR A CE1 1 
ATOM   1162 C CE2 . TYR A 1 139 ? 21.775 73.212 -1.912  1.00 43.46  ? 175 TYR A CE2 1 
ATOM   1163 C CZ  . TYR A 1 139 ? 22.363 72.297 -1.058  1.00 48.15  ? 175 TYR A CZ  1 
ATOM   1164 O OH  . TYR A 1 139 ? 23.710 72.391 -0.812  1.00 49.33  ? 175 TYR A OH  1 
ATOM   1165 N N   . GLY A 1 140 ? 16.635 71.002 0.695   1.00 32.64  ? 176 GLY A N   1 
ATOM   1166 C CA  . GLY A 1 140 ? 16.616 70.214 1.920   1.00 32.58  ? 176 GLY A CA  1 
ATOM   1167 C C   . GLY A 1 140 ? 16.494 68.719 1.676   1.00 34.18  ? 176 GLY A C   1 
ATOM   1168 O O   . GLY A 1 140 ? 16.247 68.263 0.556   1.00 32.17  ? 176 GLY A O   1 
ATOM   1169 N N   . PHE A 1 141 ? 16.648 67.952 2.733   1.00 31.53  ? 177 PHE A N   1 
ATOM   1170 C CA  . PHE A 1 141 ? 16.578 66.509 2.652   1.00 30.71  ? 177 PHE A CA  1 
ATOM   1171 C C   . PHE A 1 141 ? 15.455 66.018 3.512   1.00 33.20  ? 177 PHE A C   1 
ATOM   1172 O O   . PHE A 1 141 ? 15.221 66.529 4.603   1.00 31.93  ? 177 PHE A O   1 
ATOM   1173 C CB  . PHE A 1 141 ? 17.920 65.847 3.046   1.00 32.64  ? 177 PHE A CB  1 
ATOM   1174 C CG  . PHE A 1 141 ? 19.013 66.074 2.020   1.00 34.07  ? 177 PHE A CG  1 
ATOM   1175 C CD1 . PHE A 1 141 ? 19.178 65.205 0.951   1.00 34.98  ? 177 PHE A CD1 1 
ATOM   1176 C CD2 . PHE A 1 141 ? 19.847 67.184 2.101   1.00 36.87  ? 177 PHE A CD2 1 
ATOM   1177 C CE1 . PHE A 1 141 ? 20.197 65.417 0.011   1.00 37.13  ? 177 PHE A CE1 1 
ATOM   1178 C CE2 . PHE A 1 141 ? 20.839 67.412 1.141   1.00 39.90  ? 177 PHE A CE2 1 
ATOM   1179 C CZ  . PHE A 1 141 ? 21.020 66.518 0.114   1.00 36.86  ? 177 PHE A CZ  1 
ATOM   1180 N N   . ALA A 1 142 ? 14.741 65.034 2.991   1.00 30.94  ? 178 ALA A N   1 
ATOM   1181 C CA  . ALA A 1 142 ? 13.628 64.413 3.667   1.00 30.63  ? 178 ALA A CA  1 
ATOM   1182 C C   . ALA A 1 142 ? 13.849 62.899 3.596   1.00 33.17  ? 178 ALA A C   1 
ATOM   1183 O O   . ALA A 1 142 ? 13.834 62.320 2.505   1.00 32.62  ? 178 ALA A O   1 
ATOM   1184 C CB  . ALA A 1 142 ? 12.306 64.846 3.012   1.00 30.47  ? 178 ALA A CB  1 
ATOM   1185 N N   . GLU A 1 143 ? 14.195 62.289 4.744   1.00 29.83  ? 179 GLU A N   1 
ATOM   1186 C CA  . GLU A 1 143 ? 14.399 60.840 4.818   1.00 30.12  ? 179 GLU A CA  1 
ATOM   1187 C C   . GLU A 1 143 ? 13.184 60.229 5.496   1.00 33.34  ? 179 GLU A C   1 
ATOM   1188 O O   . GLU A 1 143 ? 12.899 60.518 6.664   1.00 33.18  ? 179 GLU A O   1 
ATOM   1189 C CB  . GLU A 1 143 ? 15.683 60.461 5.562   1.00 32.22  ? 179 GLU A CB  1 
ATOM   1190 C CG  . GLU A 1 143 ? 15.858 58.953 5.591   1.00 36.49  ? 179 GLU A CG  1 
ATOM   1191 C CD  . GLU A 1 143 ? 16.922 58.414 6.529   1.00 42.06  ? 179 GLU A CD  1 
ATOM   1192 O OE1 . GLU A 1 143 ? 18.024 58.998 6.580   1.00 39.85  ? 179 GLU A OE1 1 
ATOM   1193 O OE2 . GLU A 1 143 ? 16.686 57.349 7.140   1.00 46.56  ? 179 GLU A OE2 1 
ATOM   1194 N N   . TYR A 1 144 ? 12.440 59.429 4.758   1.00 28.79  ? 180 TYR A N   1 
ATOM   1195 C CA  . TYR A 1 144 ? 11.238 58.853 5.356   1.00 28.94  ? 180 TYR A CA  1 
ATOM   1196 C C   . TYR A 1 144 ? 11.537 57.506 5.976   1.00 33.52  ? 180 TYR A C   1 
ATOM   1197 O O   . TYR A 1 144 ? 12.500 56.862 5.580   1.00 29.31  ? 180 TYR A O   1 
ATOM   1198 C CB  . TYR A 1 144 ? 10.159 58.703 4.287   1.00 29.51  ? 180 TYR A CB  1 
ATOM   1199 C CG  . TYR A 1 144 ? 9.633  60.026 3.795   1.00 28.46  ? 180 TYR A CG  1 
ATOM   1200 C CD1 . TYR A 1 144 ? 8.538  60.634 4.411   1.00 29.23  ? 180 TYR A CD1 1 
ATOM   1201 C CD2 . TYR A 1 144 ? 10.213 60.672 2.695   1.00 28.32  ? 180 TYR A CD2 1 
ATOM   1202 C CE1 . TYR A 1 144 ? 8.007  61.827 3.924   1.00 27.87  ? 180 TYR A CE1 1 
ATOM   1203 C CE2 . TYR A 1 144 ? 9.694  61.880 2.209   1.00 28.54  ? 180 TYR A CE2 1 
ATOM   1204 C CZ  . TYR A 1 144 ? 8.597  62.452 2.836   1.00 30.54  ? 180 TYR A CZ  1 
ATOM   1205 O OH  . TYR A 1 144 ? 8.061  63.631 2.387   1.00 30.40  ? 180 TYR A OH  1 
ATOM   1206 N N   . MET A 1 145 ? 10.680 57.070 6.926   1.00 33.83  ? 181 MET A N   1 
ATOM   1207 C CA  . MET A 1 145 ? 10.748 55.741 7.544   1.00 34.84  ? 181 MET A CA  1 
ATOM   1208 C C   . MET A 1 145 ? 10.473 54.655 6.478   1.00 36.51  ? 181 MET A C   1 
ATOM   1209 O O   . MET A 1 145 ? 11.077 53.584 6.502   1.00 36.37  ? 181 MET A O   1 
ATOM   1210 C CB  . MET A 1 145 ? 9.683  55.662 8.671   1.00 38.81  ? 181 MET A CB  1 
ATOM   1211 C CG  . MET A 1 145 ? 9.829  54.418 9.556   1.00 45.91  ? 181 MET A CG  1 
ATOM   1212 S SD  . MET A 1 145 ? 8.594  54.310 10.906  1.00 53.90  ? 181 MET A SD  1 
ATOM   1213 C CE  . MET A 1 145 ? 7.118  54.007 9.970   1.00 50.19  ? 181 MET A CE  1 
ATOM   1214 N N   . LYS A 1 146 ? 9.588  54.967 5.507   1.00 32.10  ? 182 LYS A N   1 
ATOM   1215 C CA  . LYS A 1 146 ? 9.166  54.009 4.500   1.00 32.39  ? 182 LYS A CA  1 
ATOM   1216 C C   . LYS A 1 146 ? 9.409  54.513 3.079   1.00 34.50  ? 182 LYS A C   1 
ATOM   1217 O O   . LYS A 1 146 ? 9.100  55.648 2.771   1.00 31.41  ? 182 LYS A O   1 
ATOM   1218 C CB  . LYS A 1 146 ? 7.669  53.688 4.684   1.00 35.45  ? 182 LYS A CB  1 
ATOM   1219 C CG  . LYS A 1 146 ? 7.338  53.086 6.053   1.00 39.60  ? 182 LYS A CG  1 
ATOM   1220 C CD  . LYS A 1 146 ? 5.842  52.813 6.242   1.00 48.12  ? 182 LYS A CD  1 
ATOM   1221 C CE  . LYS A 1 146 ? 5.066  53.983 6.768   1.00 47.60  ? 182 LYS A CE  1 
ATOM   1222 N NZ  . LYS A 1 146 ? 3.740  53.572 7.326   1.00 43.25  ? 182 LYS A NZ  1 
ATOM   1223 N N   . LYS A 1 147 ? 9.930  53.641 2.209   1.00 31.77  ? 183 LYS A N   1 
ATOM   1224 C CA  . LYS A 1 147 ? 10.170 53.940 0.794   1.00 32.75  ? 183 LYS A CA  1 
ATOM   1225 C C   . LYS A 1 147 ? 8.893  54.463 0.089   1.00 37.31  ? 183 LYS A C   1 
ATOM   1226 O O   . LYS A 1 147 ? 8.997  55.366 -0.747  1.00 37.55  ? 183 LYS A O   1 
ATOM   1227 C CB  . LYS A 1 147 ? 10.700 52.682 0.056   1.00 34.31  ? 183 LYS A CB  1 
ATOM   1228 C CG  . LYS A 1 147 ? 11.064 52.981 -1.407  1.00 43.44  ? 183 LYS A CG  1 
ATOM   1229 C CD  . LYS A 1 147 ? 11.418 51.726 -2.202  1.00 57.74  ? 183 LYS A CD  1 
ATOM   1230 C CE  . LYS A 1 147 ? 11.855 52.048 -3.615  1.00 79.79  ? 183 LYS A CE  1 
ATOM   1231 N NZ  . LYS A 1 147 ? 13.179 52.731 -3.656  1.00 90.98  ? 183 LYS A NZ  1 
ATOM   1232 N N   . ASP A 1 148 ? 7.707  53.880 0.395   1.00 33.75  ? 184 ASP A N   1 
ATOM   1233 C CA  . ASP A 1 148 ? 6.436  54.293 -0.223  1.00 34.62  ? 184 ASP A CA  1 
ATOM   1234 C C   . ASP A 1 148 ? 6.080  55.731 0.119   1.00 36.26  ? 184 ASP A C   1 
ATOM   1235 O O   . ASP A 1 148 ? 5.517  56.429 -0.727  1.00 34.23  ? 184 ASP A O   1 
ATOM   1236 C CB  . ASP A 1 148 ? 5.258  53.363 0.140   1.00 37.56  ? 184 ASP A CB  1 
ATOM   1237 C CG  . ASP A 1 148 ? 3.968  53.709 -0.625  1.00 54.86  ? 184 ASP A CG  1 
ATOM   1238 O OD1 . ASP A 1 148 ? 3.968  53.603 -1.879  1.00 56.16  ? 184 ASP A OD1 1 
ATOM   1239 O OD2 . ASP A 1 148 ? 2.990  54.176 0.023   1.00 59.21  ? 184 ASP A OD2 1 
ATOM   1240 N N   . SER A 1 149 ? 6.405  56.194 1.342   1.00 34.27  ? 185 SER A N   1 
ATOM   1241 C CA  . SER A 1 149 ? 6.158  57.597 1.703   1.00 33.35  ? 185 SER A CA  1 
ATOM   1242 C C   . SER A 1 149 ? 6.988  58.522 0.781   1.00 34.83  ? 185 SER A C   1 
ATOM   1243 O O   . SER A 1 149 ? 6.462  59.522 0.267   1.00 34.88  ? 185 SER A O   1 
ATOM   1244 C CB  . SER A 1 149 ? 6.533  57.850 3.164   1.00 36.68  ? 185 SER A CB  1 
ATOM   1245 O OG  . SER A 1 149 ? 5.821  57.000 4.044   1.00 45.48  ? 185 SER A OG  1 
ATOM   1246 N N   . ALA A 1 150 ? 8.286  58.164 0.583   1.00 30.26  ? 186 ALA A N   1 
ATOM   1247 C CA  . ALA A 1 150 ? 9.230  58.900 -0.272  1.00 30.49  ? 186 ALA A CA  1 
ATOM   1248 C C   . ALA A 1 150 ? 8.786  58.893 -1.735  1.00 33.87  ? 186 ALA A C   1 
ATOM   1249 O O   . ALA A 1 150 ? 8.883  59.923 -2.400  1.00 33.01  ? 186 ALA A O   1 
ATOM   1250 C CB  . ALA A 1 150 ? 10.636 58.330 -0.141  1.00 30.28  ? 186 ALA A CB  1 
ATOM   1251 N N   . ALA A 1 151 ? 8.277  57.749 -2.227  1.00 32.66  ? 187 ALA A N   1 
ATOM   1252 C CA  . ALA A 1 151 ? 7.794  57.619 -3.608  1.00 33.01  ? 187 ALA A CA  1 
ATOM   1253 C C   . ALA A 1 151 ? 6.617  58.572 -3.866  1.00 33.52  ? 187 ALA A C   1 
ATOM   1254 O O   . ALA A 1 151 ? 6.570  59.247 -4.905  1.00 30.80  ? 187 ALA A O   1 
ATOM   1255 C CB  . ALA A 1 151 ? 7.387  56.158 -3.903  1.00 34.07  ? 187 ALA A CB  1 
ATOM   1256 N N   . ARG A 1 152 ? 5.681  58.642 -2.908  1.00 31.92  ? 188 ARG A N   1 
ATOM   1257 C CA  . ARG A 1 152 ? 4.507  59.514 -3.012  1.00 32.31  ? 188 ARG A CA  1 
ATOM   1258 C C   . ARG A 1 152 ? 4.900  60.980 -2.876  1.00 34.13  ? 188 ARG A C   1 
ATOM   1259 O O   . ARG A 1 152 ? 4.380  61.820 -3.615  1.00 34.45  ? 188 ARG A O   1 
ATOM   1260 C CB  . ARG A 1 152 ? 3.434  59.136 -1.979  1.00 32.04  ? 188 ARG A CB  1 
ATOM   1261 C CG  . ARG A 1 152 ? 2.761  57.830 -2.361  1.00 43.40  ? 188 ARG A CG  1 
ATOM   1262 C CD  . ARG A 1 152 ? 1.567  57.506 -1.494  1.00 59.46  ? 188 ARG A CD  1 
ATOM   1263 N NE  . ARG A 1 152 ? 1.969  56.820 -0.271  1.00 61.66  ? 188 ARG A NE  1 
ATOM   1264 C CZ  . ARG A 1 152 ? 2.116  57.411 0.909   1.00 77.43  ? 188 ARG A CZ  1 
ATOM   1265 N NH1 . ARG A 1 152 ? 1.879  58.713 1.046   1.00 63.26  ? 188 ARG A NH1 1 
ATOM   1266 N NH2 . ARG A 1 152 ? 2.480  56.703 1.966   1.00 60.57  ? 188 ARG A NH2 1 
ATOM   1267 N N   . ALA A 1 153 ? 5.844  61.275 -1.988  1.00 30.51  ? 189 ALA A N   1 
ATOM   1268 C CA  . ALA A 1 153 ? 6.331  62.654 -1.813  1.00 30.08  ? 189 ALA A CA  1 
ATOM   1269 C C   . ALA A 1 153 ? 7.014  63.148 -3.099  1.00 31.98  ? 189 ALA A C   1 
ATOM   1270 O O   . ALA A 1 153 ? 6.764  64.267 -3.521  1.00 30.25  ? 189 ALA A O   1 
ATOM   1271 C CB  . ALA A 1 153 ? 7.300  62.730 -0.635  1.00 30.21  ? 189 ALA A CB  1 
ATOM   1272 N N   . LYS A 1 154 ? 7.842  62.307 -3.747  1.00 30.89  ? 190 LYS A N   1 
ATOM   1273 C CA  . LYS A 1 154 ? 8.528  62.734 -4.969  1.00 30.52  ? 190 LYS A CA  1 
ATOM   1274 C C   . LYS A 1 154 ? 7.513  62.960 -6.115  1.00 34.67  ? 190 LYS A C   1 
ATOM   1275 O O   . LYS A 1 154 ? 7.563  63.984 -6.814  1.00 33.69  ? 190 LYS A O   1 
ATOM   1276 C CB  . LYS A 1 154 ? 9.613  61.720 -5.378  1.00 32.99  ? 190 LYS A CB  1 
ATOM   1277 C CG  . LYS A 1 154 ? 10.278 62.101 -6.712  1.00 30.59  ? 190 LYS A CG  1 
ATOM   1278 C CD  . LYS A 1 154 ? 11.376 61.187 -7.132  1.00 37.00  ? 190 LYS A CD  1 
ATOM   1279 C CE  . LYS A 1 154 ? 11.908 61.578 -8.499  1.00 34.10  ? 190 LYS A CE  1 
ATOM   1280 N NZ  . LYS A 1 154 ? 11.091 61.004 -9.605  1.00 36.31  ? 190 LYS A NZ  1 
ATOM   1281 N N   . SER A 1 155 ? 6.562  62.038 -6.267  1.00 31.92  ? 191 SER A N   1 
ATOM   1282 C CA  . SER A 1 155 ? 5.563  62.137 -7.337  1.00 32.39  ? 191 SER A CA  1 
ATOM   1283 C C   . SER A 1 155 ? 4.735  63.431 -7.187  1.00 36.32  ? 191 SER A C   1 
ATOM   1284 O O   . SER A 1 155 ? 4.439  64.099 -8.179  1.00 35.06  ? 191 SER A O   1 
ATOM   1285 C CB  . SER A 1 155 ? 4.667  60.894 -7.354  1.00 35.43  ? 191 SER A CB  1 
ATOM   1286 O OG  . SER A 1 155 ? 3.636  61.007 -8.319  1.00 49.45  ? 191 SER A OG  1 
ATOM   1287 N N   . ASP A 1 156 ? 4.419  63.809 -5.951  1.00 34.11  ? 192 ASP A N   1 
ATOM   1288 C CA  . ASP A 1 156 ? 3.640  65.017 -5.737  1.00 33.80  ? 192 ASP A CA  1 
ATOM   1289 C C   . ASP A 1 156 ? 4.478  66.314 -5.916  1.00 35.27  ? 192 ASP A C   1 
ATOM   1290 O O   . ASP A 1 156 ? 4.046  67.234 -6.623  1.00 34.25  ? 192 ASP A O   1 
ATOM   1291 C CB  . ASP A 1 156 ? 3.019  64.979 -4.340  1.00 35.83  ? 192 ASP A CB  1 
ATOM   1292 C CG  . ASP A 1 156 ? 2.098  66.155 -4.055  1.00 49.01  ? 192 ASP A CG  1 
ATOM   1293 O OD1 . ASP A 1 156 ? 0.892  66.031 -4.311  1.00 51.48  ? 192 ASP A OD1 1 
ATOM   1294 O OD2 . ASP A 1 156 ? 2.604  67.216 -3.601  1.00 54.19  ? 192 ASP A OD2 1 
ATOM   1295 N N   . LEU A 1 157 ? 5.642  66.376 -5.266  1.00 29.05  ? 193 LEU A N   1 
ATOM   1296 C CA  . LEU A 1 157 ? 6.491  67.559 -5.170  1.00 28.21  ? 193 LEU A CA  1 
ATOM   1297 C C   . LEU A 1 157 ? 7.296  67.866 -6.424  1.00 32.24  ? 193 LEU A C   1 
ATOM   1298 O O   . LEU A 1 157 ? 7.571  69.045 -6.668  1.00 29.46  ? 193 LEU A O   1 
ATOM   1299 C CB  . LEU A 1 157 ? 7.432  67.454 -3.954  1.00 27.42  ? 193 LEU A CB  1 
ATOM   1300 C CG  . LEU A 1 157 ? 6.755  67.300 -2.540  1.00 30.54  ? 193 LEU A CG  1 
ATOM   1301 C CD1 . LEU A 1 157 ? 7.813  67.196 -1.449  1.00 29.42  ? 193 LEU A CD1 1 
ATOM   1302 C CD2 . LEU A 1 157 ? 5.784  68.483 -2.204  1.00 31.26  ? 193 LEU A CD2 1 
ATOM   1303 N N   . LEU A 1 158 ? 7.704  66.837 -7.201  1.00 31.04  ? 194 LEU A N   1 
ATOM   1304 C CA  . LEU A 1 158 ? 8.431  67.074 -8.451  1.00 31.32  ? 194 LEU A CA  1 
ATOM   1305 C C   . LEU A 1 158 ? 7.540  67.899 -9.422  1.00 33.85  ? 194 LEU A C   1 
ATOM   1306 O O   . LEU A 1 158 ? 6.459  67.468 -9.816  1.00 32.45  ? 194 LEU A O   1 
ATOM   1307 C CB  . LEU A 1 158 ? 8.885  65.744 -9.092  1.00 32.17  ? 194 LEU A CB  1 
ATOM   1308 C CG  . LEU A 1 158 ? 9.639  65.838 -10.442 1.00 37.65  ? 194 LEU A CG  1 
ATOM   1309 C CD1 . LEU A 1 158 ? 10.964 66.601 -10.288 1.00 37.87  ? 194 LEU A CD1 1 
ATOM   1310 C CD2 . LEU A 1 158 ? 9.930  64.442 -10.990 1.00 41.22  ? 194 LEU A CD2 1 
ATOM   1311 N N   . GLY A 1 159 ? 7.995  69.092 -9.757  1.00 31.53  ? 195 GLY A N   1 
ATOM   1312 C CA  . GLY A 1 159 ? 7.257  69.984 -10.650 1.00 30.91  ? 195 GLY A CA  1 
ATOM   1313 C C   . GLY A 1 159 ? 6.209  70.821 -9.942  1.00 34.11  ? 195 GLY A C   1 
ATOM   1314 O O   . GLY A 1 159 ? 5.484  71.569 -10.595 1.00 32.97  ? 195 GLY A O   1 
ATOM   1315 N N   . LYS A 1 160 ? 6.116  70.720 -8.602  1.00 31.16  ? 196 LYS A N   1 
ATOM   1316 C CA  . LYS A 1 160 ? 5.148  71.503 -7.844  1.00 31.05  ? 196 LYS A CA  1 
ATOM   1317 C C   . LYS A 1 160 ? 5.521  73.001 -7.878  1.00 34.04  ? 196 LYS A C   1 
ATOM   1318 O O   . LYS A 1 160 ? 6.670  73.353 -7.577  1.00 33.27  ? 196 LYS A O   1 
ATOM   1319 C CB  . LYS A 1 160 ? 5.055  71.016 -6.386  1.00 32.67  ? 196 LYS A CB  1 
ATOM   1320 C CG  . LYS A 1 160 ? 4.146  71.864 -5.473  1.00 29.86  ? 196 LYS A CG  1 
ATOM   1321 C CD  . LYS A 1 160 ? 4.101  71.345 -4.037  1.00 37.73  ? 196 LYS A CD  1 
ATOM   1322 C CE  . LYS A 1 160 ? 3.293  72.244 -3.102  1.00 47.23  ? 196 LYS A CE  1 
ATOM   1323 N NZ  . LYS A 1 160 ? 1.839  72.236 -3.449  1.00 45.62  ? 196 LYS A NZ  1 
ATOM   1324 N N   . PRO A 1 161 ? 4.550  73.881 -8.213  1.00 31.01  ? 197 PRO A N   1 
ATOM   1325 C CA  . PRO A 1 161 ? 4.806  75.330 -8.117  1.00 31.36  ? 197 PRO A CA  1 
ATOM   1326 C C   . PRO A 1 161 ? 4.747  75.792 -6.644  1.00 35.22  ? 197 PRO A C   1 
ATOM   1327 O O   . PRO A 1 161 ? 3.808  75.453 -5.911  1.00 33.25  ? 197 PRO A O   1 
ATOM   1328 C CB  . PRO A 1 161 ? 3.672  75.954 -8.952  1.00 33.62  ? 197 PRO A CB  1 
ATOM   1329 C CG  . PRO A 1 161 ? 2.839  74.768 -9.515  1.00 36.89  ? 197 PRO A CG  1 
ATOM   1330 C CD  . PRO A 1 161 ? 3.150  73.614 -8.622  1.00 32.75  ? 197 PRO A CD  1 
ATOM   1331 N N   . LEU A 1 162 ? 5.786  76.514 -6.191  1.00 32.47  ? 198 LEU A N   1 
ATOM   1332 C CA  . LEU A 1 162 ? 5.851  77.033 -4.824  1.00 33.20  ? 198 LEU A CA  1 
ATOM   1333 C C   . LEU A 1 162 ? 6.321  78.464 -4.914  1.00 36.85  ? 198 LEU A C   1 
ATOM   1334 O O   . LEU A 1 162 ? 7.506  78.720 -5.089  1.00 36.26  ? 198 LEU A O   1 
ATOM   1335 C CB  . LEU A 1 162 ? 6.748  76.136 -3.915  1.00 33.14  ? 198 LEU A CB  1 
ATOM   1336 C CG  . LEU A 1 162 ? 6.717  76.407 -2.381  1.00 39.07  ? 198 LEU A CG  1 
ATOM   1337 C CD1 . LEU A 1 162 ? 5.308  76.497 -1.856  1.00 39.74  ? 198 LEU A CD1 1 
ATOM   1338 C CD2 . LEU A 1 162 ? 7.513  75.338 -1.595  1.00 35.82  ? 198 LEU A CD2 1 
ATOM   1339 N N   . GLY A 1 163 ? 5.369  79.386 -4.871  1.00 36.58  ? 199 GLY A N   1 
ATOM   1340 C CA  . GLY A 1 163 ? 5.658  80.800 -5.066  1.00 38.00  ? 199 GLY A CA  1 
ATOM   1341 C C   . GLY A 1 163 ? 6.247  81.037 -6.455  1.00 42.49  ? 199 GLY A C   1 
ATOM   1342 O O   . GLY A 1 163 ? 5.732  80.481 -7.425  1.00 41.71  ? 199 GLY A O   1 
ATOM   1343 N N   . PRO A 1 164 ? 7.379  81.776 -6.595  1.00 40.80  ? 200 PRO A N   1 
ATOM   1344 C CA  . PRO A 1 164 ? 7.964  81.985 -7.945  1.00 40.91  ? 200 PRO A CA  1 
ATOM   1345 C C   . PRO A 1 164 ? 8.885  80.833 -8.390  1.00 42.83  ? 200 PRO A C   1 
ATOM   1346 O O   . PRO A 1 164 ? 9.743  81.006 -9.261  1.00 42.45  ? 200 PRO A O   1 
ATOM   1347 C CB  . PRO A 1 164 ? 8.767  83.277 -7.772  1.00 44.15  ? 200 PRO A CB  1 
ATOM   1348 C CG  . PRO A 1 164 ? 9.156  83.308 -6.337  1.00 48.67  ? 200 PRO A CG  1 
ATOM   1349 C CD  . PRO A 1 164 ? 8.160  82.481 -5.553  1.00 43.45  ? 200 PRO A CD  1 
ATOM   1350 N N   . ARG A 1 165 ? 8.726  79.663 -7.768  1.00 36.57  ? 201 ARG A N   1 
ATOM   1351 C CA  . ARG A 1 165 ? 9.579  78.530 -8.056  1.00 36.32  ? 201 ARG A CA  1 
ATOM   1352 C C   . ARG A 1 165 ? 8.781  77.301 -8.465  1.00 38.86  ? 201 ARG A C   1 
ATOM   1353 O O   . ARG A 1 165 ? 7.644  77.132 -8.047  1.00 38.19  ? 201 ARG A O   1 
ATOM   1354 C CB  . ARG A 1 165 ? 10.409 78.172 -6.799  1.00 36.34  ? 201 ARG A CB  1 
ATOM   1355 C CG  . ARG A 1 165 ? 11.164 79.315 -6.097  1.00 44.75  ? 201 ARG A CG  1 
ATOM   1356 C CD  . ARG A 1 165 ? 12.641 79.244 -6.412  1.00 45.38  ? 201 ARG A CD  1 
ATOM   1357 N NE  . ARG A 1 165 ? 13.401 80.374 -5.882  1.00 43.13  ? 201 ARG A NE  1 
ATOM   1358 C CZ  . ARG A 1 165 ? 14.678 80.605 -6.173  1.00 54.61  ? 201 ARG A CZ  1 
ATOM   1359 N NH1 . ARG A 1 165 ? 15.337 79.796 -6.991  1.00 44.08  ? 201 ARG A NH1 1 
ATOM   1360 N NH2 . ARG A 1 165 ? 15.303 81.652 -5.653  1.00 44.68  ? 201 ARG A NH2 1 
ATOM   1361 N N   . THR A 1 166 ? 9.416  76.427 -9.243  1.00 35.34  ? 202 THR A N   1 
ATOM   1362 C CA  . THR A 1 166 ? 8.962  75.087 -9.584  1.00 33.82  ? 202 THR A CA  1 
ATOM   1363 C C   . THR A 1 166 ? 9.946  74.143 -8.867  1.00 35.31  ? 202 THR A C   1 
ATOM   1364 O O   . THR A 1 166 ? 11.143 74.197 -9.149  1.00 34.59  ? 202 THR A O   1 
ATOM   1365 C CB  . THR A 1 166 ? 8.926  74.893 -11.106 1.00 37.72  ? 202 THR A CB  1 
ATOM   1366 O OG1 . THR A 1 166 ? 7.900  75.731 -11.626 1.00 40.90  ? 202 THR A OG1 1 
ATOM   1367 C CG2 . THR A 1 166 ? 8.665  73.446 -11.501 1.00 33.34  ? 202 THR A CG2 1 
ATOM   1368 N N   . LEU A 1 167 ? 9.455  73.273 -7.992  1.00 30.70  ? 203 LEU A N   1 
ATOM   1369 C CA  . LEU A 1 167 ? 10.332 72.366 -7.241  1.00 29.30  ? 203 LEU A CA  1 
ATOM   1370 C C   . LEU A 1 167 ? 10.932 71.245 -8.052  1.00 34.96  ? 203 LEU A C   1 
ATOM   1371 O O   . LEU A 1 167 ? 10.281 70.663 -8.916  1.00 35.07  ? 203 LEU A O   1 
ATOM   1372 C CB  . LEU A 1 167 ? 9.587  71.743 -6.065  1.00 27.43  ? 203 LEU A CB  1 
ATOM   1373 C CG  . LEU A 1 167 ? 8.921  72.702 -5.067  1.00 30.49  ? 203 LEU A CG  1 
ATOM   1374 C CD1 . LEU A 1 167 ? 8.414  71.936 -3.864  1.00 28.76  ? 203 LEU A CD1 1 
ATOM   1375 C CD2 . LEU A 1 167 ? 9.887  73.849 -4.645  1.00 28.97  ? 203 LEU A CD2 1 
ATOM   1376 N N   . TYR A 1 168 ? 12.178 70.910 -7.727  1.00 34.03  ? 204 TYR A N   1 
ATOM   1377 C CA  . TYR A 1 168 ? 12.882 69.763 -8.295  1.00 34.12  ? 204 TYR A CA  1 
ATOM   1378 C C   . TYR A 1 168 ? 13.085 68.720 -7.180  1.00 34.97  ? 204 TYR A C   1 
ATOM   1379 O O   . TYR A 1 168 ? 13.378 69.095 -6.044  1.00 34.96  ? 204 TYR A O   1 
ATOM   1380 C CB  . TYR A 1 168 ? 14.244 70.150 -8.941  1.00 36.66  ? 204 TYR A CB  1 
ATOM   1381 C CG  . TYR A 1 168 ? 14.933 68.930 -9.511  1.00 39.33  ? 204 TYR A CG  1 
ATOM   1382 C CD1 . TYR A 1 168 ? 14.334 68.173 -10.515 1.00 42.29  ? 204 TYR A CD1 1 
ATOM   1383 C CD2 . TYR A 1 168 ? 16.108 68.444 -8.948  1.00 40.30  ? 204 TYR A CD2 1 
ATOM   1384 C CE1 . TYR A 1 168 ? 14.918 67.000 -10.988 1.00 44.22  ? 204 TYR A CE1 1 
ATOM   1385 C CE2 . TYR A 1 168 ? 16.715 67.281 -9.428  1.00 41.99  ? 204 TYR A CE2 1 
ATOM   1386 C CZ  . TYR A 1 168 ? 16.115 66.562 -10.448 1.00 50.86  ? 204 TYR A CZ  1 
ATOM   1387 O OH  . TYR A 1 168 ? 16.692 65.406 -10.931 1.00 53.66  ? 204 TYR A OH  1 
ATOM   1388 N N   . VAL A 1 169 ? 12.936 67.428 -7.487  1.00 30.93  ? 205 VAL A N   1 
ATOM   1389 C CA  . VAL A 1 169 ? 13.153 66.396 -6.459  1.00 30.69  ? 205 VAL A CA  1 
ATOM   1390 C C   . VAL A 1 169 ? 13.971 65.265 -7.042  1.00 37.83  ? 205 VAL A C   1 
ATOM   1391 O O   . VAL A 1 169 ? 13.676 64.809 -8.149  1.00 38.15  ? 205 VAL A O   1 
ATOM   1392 C CB  . VAL A 1 169 ? 11.834 65.821 -5.826  1.00 33.48  ? 205 VAL A CB  1 
ATOM   1393 C CG1 . VAL A 1 169 ? 12.141 64.818 -4.711  1.00 32.35  ? 205 VAL A CG1 1 
ATOM   1394 C CG2 . VAL A 1 169 ? 10.889 66.909 -5.331  1.00 32.21  ? 205 VAL A CG2 1 
ATOM   1395 N N   . HIS A 1 170 ? 15.004 64.808 -6.319  1.00 36.91  ? 206 HIS A N   1 
ATOM   1396 C CA  . HIS A 1 170 ? 15.690 63.631 -6.785  1.00 39.13  ? 206 HIS A CA  1 
ATOM   1397 C C   . HIS A 1 170 ? 15.995 62.692 -5.633  1.00 39.27  ? 206 HIS A C   1 
ATOM   1398 O O   . HIS A 1 170 ? 16.102 63.115 -4.475  1.00 37.19  ? 206 HIS A O   1 
ATOM   1399 C CB  . HIS A 1 170 ? 16.912 63.904 -7.686  1.00 43.76  ? 206 HIS A CB  1 
ATOM   1400 C CG  . HIS A 1 170 ? 18.145 64.474 -7.067  1.00 48.86  ? 206 HIS A CG  1 
ATOM   1401 N ND1 . HIS A 1 170 ? 18.616 64.048 -5.839  1.00 51.78  ? 206 HIS A ND1 1 
ATOM   1402 C CD2 . HIS A 1 170 ? 19.057 65.305 -7.616  1.00 52.77  ? 206 HIS A CD2 1 
ATOM   1403 C CE1 . HIS A 1 170 ? 19.769 64.671 -5.662  1.00 52.27  ? 206 HIS A CE1 1 
ATOM   1404 N NE2 . HIS A 1 170 ? 20.074 65.441 -6.698  1.00 53.33  ? 206 HIS A NE2 1 
ATOM   1405 N N   . TRP A 1 171 ? 16.019 61.391 -5.941  1.00 36.77  ? 207 TRP A N   1 
ATOM   1406 C CA  . TRP A 1 171 ? 16.402 60.357 -4.958  1.00 36.40  ? 207 TRP A CA  1 
ATOM   1407 C C   . TRP A 1 171 ? 17.863 60.529 -4.652  1.00 39.44  ? 207 TRP A C   1 
ATOM   1408 O O   . TRP A 1 171 ? 18.643 60.722 -5.577  1.00 40.21  ? 207 TRP A O   1 
ATOM   1409 C CB  . TRP A 1 171 ? 16.174 58.951 -5.532  1.00 35.81  ? 207 TRP A CB  1 
ATOM   1410 C CG  . TRP A 1 171 ? 14.749 58.607 -5.779  1.00 35.59  ? 207 TRP A CG  1 
ATOM   1411 C CD1 . TRP A 1 171 ? 14.066 58.715 -6.956  1.00 38.94  ? 207 TRP A CD1 1 
ATOM   1412 C CD2 . TRP A 1 171 ? 13.824 58.098 -4.817  1.00 34.28  ? 207 TRP A CD2 1 
ATOM   1413 N NE1 . TRP A 1 171 ? 12.771 58.277 -6.791  1.00 37.50  ? 207 TRP A NE1 1 
ATOM   1414 C CE2 . TRP A 1 171 ? 12.599 57.881 -5.489  1.00 37.46  ? 207 TRP A CE2 1 
ATOM   1415 C CE3 . TRP A 1 171 ? 13.929 57.745 -3.462  1.00 35.01  ? 207 TRP A CE3 1 
ATOM   1416 C CZ2 . TRP A 1 171 ? 11.487 57.332 -4.853  1.00 36.47  ? 207 TRP A CZ2 1 
ATOM   1417 C CZ3 . TRP A 1 171 ? 12.822 57.208 -2.831  1.00 36.51  ? 207 TRP A CZ3 1 
ATOM   1418 C CH2 . TRP A 1 171 ? 11.615 57.017 -3.520  1.00 37.37  ? 207 TRP A CH2 1 
ATOM   1419 N N   . THR A 1 172 ? 18.247 60.496 -3.385  1.00 37.23  ? 208 THR A N   1 
ATOM   1420 C CA  . THR A 1 172 ? 19.659 60.664 -3.007  1.00 37.93  ? 208 THR A CA  1 
ATOM   1421 C C   . THR A 1 172 ? 20.104 59.453 -2.231  1.00 39.32  ? 208 THR A C   1 
ATOM   1422 O O   . THR A 1 172 ? 19.342 58.955 -1.400  1.00 37.28  ? 208 THR A O   1 
ATOM   1423 C CB  . THR A 1 172 ? 19.870 61.966 -2.173  1.00 46.54  ? 208 THR A CB  1 
ATOM   1424 O OG1 . THR A 1 172 ? 19.376 63.083 -2.902  1.00 53.39  ? 208 THR A OG1 1 
ATOM   1425 C CG2 . THR A 1 172 ? 21.341 62.237 -1.840  1.00 45.00  ? 208 THR A CG2 1 
ATOM   1426 N N   . ASP A 1 173 ? 21.346 59.006 -2.471  1.00 37.21  ? 209 ASP A N   1 
ATOM   1427 C CA  . ASP A 1 173 ? 21.960 57.920 -1.695  1.00 37.23  ? 209 ASP A CA  1 
ATOM   1428 C C   . ASP A 1 173 ? 22.500 58.530 -0.372  1.00 40.05  ? 209 ASP A C   1 
ATOM   1429 O O   . ASP A 1 173 ? 23.432 59.325 -0.409  1.00 38.78  ? 209 ASP A O   1 
ATOM   1430 C CB  . ASP A 1 173 ? 23.083 57.230 -2.508  1.00 40.20  ? 209 ASP A CB  1 
ATOM   1431 C CG  . ASP A 1 173 ? 23.958 56.250 -1.721  1.00 50.23  ? 209 ASP A CG  1 
ATOM   1432 O OD1 . ASP A 1 173 ? 23.435 55.603 -0.794  1.00 46.95  ? 209 ASP A OD1 1 
ATOM   1433 O OD2 . ASP A 1 173 ? 25.160 56.099 -2.079  1.00 52.08  ? 209 ASP A OD2 1 
ATOM   1434 N N   . ALA A 1 174 ? 21.897 58.177 0.769   1.00 40.01  ? 210 ALA A N   1 
ATOM   1435 C CA  . ALA A 1 174 ? 22.273 58.666 2.113   1.00 41.15  ? 210 ALA A CA  1 
ATOM   1436 C C   . ALA A 1 174 ? 23.703 58.324 2.500   1.00 51.41  ? 210 ALA A C   1 
ATOM   1437 O O   . ALA A 1 174 ? 24.350 59.117 3.194   1.00 53.16  ? 210 ALA A O   1 
ATOM   1438 C CB  . ALA A 1 174 ? 21.336 58.084 3.149   1.00 40.89  ? 210 ALA A CB  1 
ATOM   1439 N N   . GLY A 1 175 ? 24.178 57.153 2.050   1.00 49.44  ? 211 GLY A N   1 
ATOM   1440 C CA  . GLY A 1 175 ? 25.510 56.640 2.346   1.00 50.44  ? 211 GLY A CA  1 
ATOM   1441 C C   . GLY A 1 175 ? 26.635 57.539 1.881   1.00 57.61  ? 211 GLY A C   1 
ATOM   1442 O O   . GLY A 1 175 ? 27.710 57.540 2.485   1.00 59.16  ? 211 GLY A O   1 
ATOM   1443 N N   . GLN A 1 176 ? 26.376 58.364 0.857   1.00 54.69  ? 212 GLN A N   1 
ATOM   1444 C CA  . GLN A 1 176 ? 27.399 59.250 0.289   1.00 56.98  ? 212 GLN A CA  1 
ATOM   1445 C C   . GLN A 1 176 ? 27.338 60.725 0.768   1.00 59.80  ? 212 GLN A C   1 
ATOM   1446 O O   . GLN A 1 176 ? 28.155 61.530 0.314   1.00 61.69  ? 212 GLN A O   1 
ATOM   1447 C CB  . GLN A 1 176 ? 27.352 59.194 -1.248  1.00 59.48  ? 212 GLN A CB  1 
ATOM   1448 C CG  . GLN A 1 176 ? 27.941 57.889 -1.796  1.00 74.20  ? 212 GLN A CG  1 
ATOM   1449 C CD  . GLN A 1 176 ? 29.398 57.653 -1.448  1.00 93.97  ? 212 GLN A CD  1 
ATOM   1450 O OE1 . GLN A 1 176 ? 30.243 58.560 -1.487  1.00 93.83  ? 212 GLN A OE1 1 
ATOM   1451 N NE2 . GLN A 1 176 ? 29.731 56.409 -1.140  1.00 84.66  ? 212 GLN A NE2 1 
ATOM   1452 N N   . LEU A 1 177 ? 26.426 61.072 1.693   1.00 52.85  ? 213 LEU A N   1 
ATOM   1453 C CA  . LEU A 1 177 ? 26.380 62.436 2.222   1.00 52.23  ? 213 LEU A CA  1 
ATOM   1454 C C   . LEU A 1 177 ? 27.267 62.580 3.455   1.00 56.88  ? 213 LEU A C   1 
ATOM   1455 O O   . LEU A 1 177 ? 27.312 61.690 4.301   1.00 55.94  ? 213 LEU A O   1 
ATOM   1456 C CB  . LEU A 1 177 ? 24.952 62.859 2.594   1.00 50.52  ? 213 LEU A CB  1 
ATOM   1457 C CG  . LEU A 1 177 ? 23.948 63.156 1.485   1.00 53.30  ? 213 LEU A CG  1 
ATOM   1458 C CD1 . LEU A 1 177 ? 22.578 63.326 2.076   1.00 51.26  ? 213 LEU A CD1 1 
ATOM   1459 C CD2 . LEU A 1 177 ? 24.331 64.418 0.700   1.00 55.29  ? 213 LEU A CD2 1 
ATOM   1460 N N   . THR A 1 178 ? 27.979 63.704 3.542   1.00 55.13  ? 214 THR A N   1 
ATOM   1461 C CA  . THR A 1 178 ? 28.816 64.102 4.678   1.00 56.43  ? 214 THR A CA  1 
ATOM   1462 C C   . THR A 1 178 ? 28.453 65.560 4.979   1.00 61.09  ? 214 THR A C   1 
ATOM   1463 O O   . THR A 1 178 ? 27.859 66.193 4.088   1.00 58.27  ? 214 THR A O   1 
ATOM   1464 C CB  . THR A 1 178 ? 30.315 63.924 4.368   1.00 62.25  ? 214 THR A CB  1 
ATOM   1465 O OG1 . THR A 1 178 ? 30.634 64.665 3.195   1.00 60.33  ? 214 THR A OG1 1 
ATOM   1466 C CG2 . THR A 1 178 ? 30.744 62.455 4.256   1.00 60.47  ? 214 THR A CG2 1 
ATOM   1467 N N   . PRO A 1 179 ? 28.800 66.146 6.164   1.00 59.14  ? 215 PRO A N   1 
ATOM   1468 C CA  . PRO A 1 179 ? 28.463 67.566 6.401   1.00 59.88  ? 215 PRO A CA  1 
ATOM   1469 C C   . PRO A 1 179 ? 28.969 68.503 5.295   1.00 63.68  ? 215 PRO A C   1 
ATOM   1470 O O   . PRO A 1 179 ? 28.327 69.513 5.023   1.00 63.03  ? 215 PRO A O   1 
ATOM   1471 C CB  . PRO A 1 179 ? 29.147 67.872 7.734   1.00 63.63  ? 215 PRO A CB  1 
ATOM   1472 C CG  . PRO A 1 179 ? 29.173 66.547 8.434   1.00 67.20  ? 215 PRO A CG  1 
ATOM   1473 C CD  . PRO A 1 179 ? 29.481 65.565 7.342   1.00 61.89  ? 215 PRO A CD  1 
ATOM   1474 N N   . ALA A 1 180 ? 30.086 68.145 4.638   1.00 60.59  ? 216 ALA A N   1 
ATOM   1475 C CA  . ALA A 1 180 ? 30.677 68.934 3.558   1.00 61.81  ? 216 ALA A CA  1 
ATOM   1476 C C   . ALA A 1 180 ? 29.954 68.717 2.225   1.00 61.10  ? 216 ALA A C   1 
ATOM   1477 O O   . ALA A 1 180 ? 29.785 69.672 1.472   1.00 61.30  ? 216 ALA A O   1 
ATOM   1478 C CB  . ALA A 1 180 ? 32.152 68.585 3.407   1.00 65.02  ? 216 ALA A CB  1 
ATOM   1479 N N   . LEU A 1 181 ? 29.557 67.471 1.922   1.00 54.71  ? 217 LEU A N   1 
ATOM   1480 C CA  . LEU A 1 181 ? 28.894 67.128 0.665   1.00 53.84  ? 217 LEU A CA  1 
ATOM   1481 C C   . LEU A 1 181 ? 27.398 67.561 0.645   1.00 54.55  ? 217 LEU A C   1 
ATOM   1482 O O   . LEU A 1 181 ? 26.734 67.432 -0.386  1.00 52.69  ? 217 LEU A O   1 
ATOM   1483 C CB  . LEU A 1 181 ? 29.045 65.626 0.357   1.00 53.36  ? 217 LEU A CB  1 
ATOM   1484 C CG  . LEU A 1 181 ? 30.429 65.185 -0.141  1.00 60.52  ? 217 LEU A CG  1 
ATOM   1485 C CD1 . LEU A 1 181 ? 30.546 63.687 -0.133  1.00 59.91  ? 217 LEU A CD1 1 
ATOM   1486 C CD2 . LEU A 1 181 ? 30.731 65.714 -1.542  1.00 64.38  ? 217 LEU A CD2 1 
ATOM   1487 N N   . LEU A 1 182 ? 26.892 68.106 1.772   1.00 49.71  ? 218 LEU A N   1 
ATOM   1488 C CA  . LEU A 1 182 ? 25.548 68.667 1.862   1.00 47.80  ? 218 LEU A CA  1 
ATOM   1489 C C   . LEU A 1 182 ? 25.495 69.951 1.035   1.00 52.04  ? 218 LEU A C   1 
ATOM   1490 O O   . LEU A 1 182 ? 24.425 70.336 0.570   1.00 49.80  ? 218 LEU A O   1 
ATOM   1491 C CB  . LEU A 1 182 ? 25.149 68.964 3.324   1.00 47.06  ? 218 LEU A CB  1 
ATOM   1492 C CG  . LEU A 1 182 ? 24.866 67.797 4.272   1.00 48.99  ? 218 LEU A CG  1 
ATOM   1493 C CD1 . LEU A 1 182 ? 24.450 68.318 5.623   1.00 49.16  ? 218 LEU A CD1 1 
ATOM   1494 C CD2 . LEU A 1 182 ? 23.755 66.877 3.740   1.00 47.34  ? 218 LEU A CD2 1 
ATOM   1495 N N   . HIS A 1 183 ? 26.668 70.598 0.843   1.00 50.50  ? 219 HIS A N   1 
ATOM   1496 C CA  . HIS A 1 183 ? 26.799 71.857 0.106   1.00 51.79  ? 219 HIS A CA  1 
ATOM   1497 C C   . HIS A 1 183 ? 27.138 71.564 -1.337  1.00 55.75  ? 219 HIS A C   1 
ATOM   1498 O O   . HIS A 1 183 ? 28.146 70.932 -1.645  1.00 57.51  ? 219 HIS A O   1 
ATOM   1499 C CB  . HIS A 1 183 ? 27.806 72.794 0.784   1.00 54.92  ? 219 HIS A CB  1 
ATOM   1500 C CG  . HIS A 1 183 ? 27.471 73.017 2.229   1.00 58.10  ? 219 HIS A CG  1 
ATOM   1501 N ND1 . HIS A 1 183 ? 26.752 74.127 2.641   1.00 60.05  ? 219 HIS A ND1 1 
ATOM   1502 C CD2 . HIS A 1 183 ? 27.688 72.219 3.300   1.00 58.66  ? 219 HIS A CD2 1 
ATOM   1503 C CE1 . HIS A 1 183 ? 26.573 73.974 3.941   1.00 58.88  ? 219 HIS A CE1 1 
ATOM   1504 N NE2 . HIS A 1 183 ? 27.130 72.850 4.383   1.00 58.59  ? 219 HIS A NE2 1 
ATOM   1505 N N   . SER A 1 184 ? 26.214 71.945 -2.211  1.00 51.14  ? 220 SER A N   1 
ATOM   1506 C CA  . SER A 1 184 ? 26.262 71.735 -3.644  1.00 50.55  ? 220 SER A CA  1 
ATOM   1507 C C   . SER A 1 184 ? 27.399 72.488 -4.295  1.00 57.45  ? 220 SER A C   1 
ATOM   1508 O O   . SER A 1 184 ? 27.742 73.587 -3.866  1.00 55.71  ? 220 SER A O   1 
ATOM   1509 C CB  . SER A 1 184 ? 24.947 72.185 -4.271  1.00 50.75  ? 220 SER A CB  1 
ATOM   1510 O OG  . SER A 1 184 ? 24.849 71.787 -5.629  1.00 56.34  ? 220 SER A OG  1 
ATOM   1511 N N   . ARG A 1 185 ? 27.935 71.908 -5.369  1.00 44.77  ? 221 ARG A N   1 
ATOM   1512 C CA  . ARG A 1 185 ? 28.993 72.521 -6.186  1.00 50.10  ? 221 ARG A CA  1 
ATOM   1513 C C   . ARG A 1 185 ? 28.403 73.052 -7.519  1.00 57.68  ? 221 ARG A C   1 
ATOM   1514 O O   . ARG A 1 185 ? 29.100 73.759 -8.255  1.00 59.13  ? 221 ARG A O   1 
ATOM   1515 C CB  . ARG A 1 185 ? 30.137 71.525 -6.438  1.00 55.19  ? 221 ARG A CB  1 
ATOM   1516 C CG  . ARG A 1 185 ? 30.862 71.108 -5.162  1.00 63.69  ? 221 ARG A CG  1 
ATOM   1517 C CD  . ARG A 1 185 ? 31.996 70.148 -5.428  1.00 84.34  ? 221 ARG A CD  1 
ATOM   1518 N NE  . ARG A 1 185 ? 32.507 69.592 -4.171  1.00 100.08 ? 221 ARG A NE  1 
ATOM   1519 C CZ  . ARG A 1 185 ? 33.583 68.820 -4.066  1.00 118.23 ? 221 ARG A CZ  1 
ATOM   1520 N NH1 . ARG A 1 185 ? 34.293 68.507 -5.143  1.00 109.19 ? 221 ARG A NH1 1 
ATOM   1521 N NH2 . ARG A 1 185 ? 33.963 68.363 -2.882  1.00 109.14 ? 221 ARG A NH2 1 
ATOM   1522 N N   . CYS A 1 186 ? 27.113 72.729 -7.794  1.00 54.80  ? 222 CYS A N   1 
ATOM   1523 C CA  . CYS A 1 186 ? 26.348 73.102 -8.996  1.00 54.78  ? 222 CYS A CA  1 
ATOM   1524 C C   . CYS A 1 186 ? 25.346 74.228 -8.722  1.00 57.04  ? 222 CYS A C   1 
ATOM   1525 O O   . CYS A 1 186 ? 24.613 74.190 -7.731  1.00 54.25  ? 222 CYS A O   1 
ATOM   1526 C CB  . CYS A 1 186 ? 25.631 71.892 -9.596  1.00 55.13  ? 222 CYS A CB  1 
ATOM   1527 S SG  . CYS A 1 186 ? 26.714 70.734 -10.479 1.00 61.94  ? 222 CYS A SG  1 
ATOM   1528 N N   . LEU A 1 187 ? 25.282 75.199 -9.654  1.00 54.33  ? 223 LEU A N   1 
ATOM   1529 C CA  . LEU A 1 187 ? 24.337 76.318 -9.599  1.00 52.82  ? 223 LEU A CA  1 
ATOM   1530 C C   . LEU A 1 187 ? 23.401 76.291 -10.790 1.00 55.29  ? 223 LEU A C   1 
ATOM   1531 O O   . LEU A 1 187 ? 23.771 75.789 -11.858 1.00 55.00  ? 223 LEU A O   1 
ATOM   1532 C CB  . LEU A 1 187 ? 25.050 77.685 -9.561  1.00 54.17  ? 223 LEU A CB  1 
ATOM   1533 C CG  . LEU A 1 187 ? 25.993 78.000 -8.395  1.00 59.79  ? 223 LEU A CG  1 
ATOM   1534 C CD1 . LEU A 1 187 ? 26.566 79.404 -8.541  1.00 61.28  ? 223 LEU A CD1 1 
ATOM   1535 C CD2 . LEU A 1 187 ? 25.297 77.860 -7.038  1.00 58.25  ? 223 LEU A CD2 1 
ATOM   1536 N N   . CYS A 1 188 ? 22.187 76.829 -10.612 1.00 50.39  ? 224 CYS A N   1 
ATOM   1537 C CA  . CYS A 1 188 ? 21.235 76.968 -11.709 1.00 50.06  ? 224 CYS A CA  1 
ATOM   1538 C C   . CYS A 1 188 ? 20.969 78.446 -11.909 1.00 53.07  ? 224 CYS A C   1 
ATOM   1539 O O   . CYS A 1 188 ? 20.557 79.125 -10.967 1.00 53.75  ? 224 CYS A O   1 
ATOM   1540 C CB  . CYS A 1 188 ? 19.944 76.183 -11.475 1.00 49.43  ? 224 CYS A CB  1 
ATOM   1541 S SG  . CYS A 1 188 ? 18.725 76.358 -12.816 1.00 54.33  ? 224 CYS A SG  1 
ATOM   1542 N N   . VAL A 1 189 ? 21.286 78.956 -13.109 1.00 50.14  ? 225 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 189 ? 21.061 80.343 -13.520 1.00 50.16  ? 225 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 189 ? 19.816 80.355 -14.420 1.00 55.07  ? 225 VAL A C   1 
ATOM   1545 O O   . VAL A 1 189 ? 19.795 79.701 -15.459 1.00 54.26  ? 225 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 189 ? 22.279 81.038 -14.219 1.00 55.09  ? 225 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 189 ? 22.066 82.549 -14.323 1.00 56.59  ? 225 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 189 ? 23.603 80.745 -13.519 1.00 54.68  ? 225 VAL A CG2 1 
ATOM   1549 N N   . ASP A 1 190 ? 18.770 81.075 -14.010 1.00 53.07  ? 226 ASP A N   1 
ATOM   1550 C CA  . ASP A 1 190 ? 17.587 81.208 -14.858 1.00 54.62  ? 226 ASP A CA  1 
ATOM   1551 C C   . ASP A 1 190 ? 17.129 82.681 -14.794 1.00 60.07  ? 226 ASP A C   1 
ATOM   1552 O O   . ASP A 1 190 ? 17.911 83.533 -14.346 1.00 59.38  ? 226 ASP A O   1 
ATOM   1553 C CB  . ASP A 1 190 ? 16.495 80.161 -14.511 1.00 54.41  ? 226 ASP A CB  1 
ATOM   1554 C CG  . ASP A 1 190 ? 15.736 80.326 -13.208 1.00 56.75  ? 226 ASP A CG  1 
ATOM   1555 O OD1 . ASP A 1 190 ? 16.241 81.043 -12.303 1.00 55.45  ? 226 ASP A OD1 1 
ATOM   1556 O OD2 . ASP A 1 190 ? 14.630 79.746 -13.093 1.00 60.49  ? 226 ASP A OD2 1 
ATOM   1557 N N   . ARG A 1 191 ? 15.905 82.997 -15.280 1.00 59.64  ? 227 ARG A N   1 
ATOM   1558 C CA  . ARG A 1 191 ? 15.390 84.370 -15.390 1.00 61.55  ? 227 ARG A CA  1 
ATOM   1559 C C   . ARG A 1 191 ? 16.350 85.154 -16.289 1.00 67.86  ? 227 ARG A C   1 
ATOM   1560 O O   . ARG A 1 191 ? 16.620 86.346 -16.078 1.00 70.03  ? 227 ARG A O   1 
ATOM   1561 C CB  . ARG A 1 191 ? 15.175 85.044 -14.020 1.00 61.68  ? 227 ARG A CB  1 
ATOM   1562 C CG  . ARG A 1 191 ? 13.737 85.029 -13.556 1.00 67.14  ? 227 ARG A CG  1 
ATOM   1563 C CD  . ARG A 1 191 ? 13.667 84.941 -12.049 1.00 67.71  ? 227 ARG A CD  1 
ATOM   1564 N NE  . ARG A 1 191 ? 12.310 85.087 -11.503 1.00 70.45  ? 227 ARG A NE  1 
ATOM   1565 C CZ  . ARG A 1 191 ? 11.329 84.201 -11.650 1.00 83.47  ? 227 ARG A CZ  1 
ATOM   1566 N NH1 . ARG A 1 191 ? 11.505 83.121 -12.404 1.00 71.03  ? 227 ARG A NH1 1 
ATOM   1567 N NH2 . ARG A 1 191 ? 10.152 84.408 -11.081 1.00 71.97  ? 227 ARG A NH2 1 
ATOM   1568 N N   . LEU A 1 192 ? 16.890 84.431 -17.289 1.00 63.21  ? 228 LEU A N   1 
ATOM   1569 C CA  . LEU A 1 192 ? 17.753 84.960 -18.322 1.00 65.53  ? 228 LEU A CA  1 
ATOM   1570 C C   . LEU A 1 192 ? 16.901 85.828 -19.250 1.00 73.16  ? 228 LEU A C   1 
ATOM   1571 O O   . LEU A 1 192 ? 15.690 85.579 -19.342 1.00 72.27  ? 228 LEU A O   1 
ATOM   1572 C CB  . LEU A 1 192 ? 18.394 83.795 -19.122 1.00 65.18  ? 228 LEU A CB  1 
ATOM   1573 C CG  . LEU A 1 192 ? 19.195 82.701 -18.385 1.00 67.47  ? 228 LEU A CG  1 
ATOM   1574 C CD1 . LEU A 1 192 ? 19.584 81.592 -19.341 1.00 67.75  ? 228 LEU A CD1 1 
ATOM   1575 C CD2 . LEU A 1 192 ? 20.470 83.254 -17.791 1.00 70.79  ? 228 LEU A CD2 1 
ATOM   1576 N N   . PRO A 1 193 ? 17.457 86.813 -19.996 1.00 73.40  ? 229 PRO A N   1 
ATOM   1577 C CA  . PRO A 1 193 ? 16.614 87.514 -20.972 1.00 77.23  ? 229 PRO A CA  1 
ATOM   1578 C C   . PRO A 1 193 ? 16.023 86.478 -21.946 1.00 81.53  ? 229 PRO A C   1 
ATOM   1579 O O   . PRO A 1 193 ? 16.771 85.570 -22.338 1.00 78.56  ? 229 PRO A O   1 
ATOM   1580 C CB  . PRO A 1 193 ? 17.593 88.479 -21.665 1.00 81.77  ? 229 PRO A CB  1 
ATOM   1581 C CG  . PRO A 1 193 ? 18.740 88.604 -20.738 1.00 83.57  ? 229 PRO A CG  1 
ATOM   1582 C CD  . PRO A 1 193 ? 18.859 87.267 -20.082 1.00 75.26  ? 229 PRO A CD  1 
ATOM   1583 N N   . PRO A 1 194 ? 14.696 86.509 -22.275 1.00 80.20  ? 230 PRO A N   1 
ATOM   1584 C CA  . PRO A 1 194 ? 14.145 85.483 -23.188 1.00 80.77  ? 230 PRO A CA  1 
ATOM   1585 C C   . PRO A 1 194 ? 14.899 85.455 -24.519 1.00 88.66  ? 230 PRO A C   1 
ATOM   1586 O O   . PRO A 1 194 ? 15.174 86.506 -25.096 1.00 91.27  ? 230 PRO A O   1 
ATOM   1587 C CB  . PRO A 1 194 ? 12.675 85.888 -23.361 1.00 85.18  ? 230 PRO A CB  1 
ATOM   1588 C CG  . PRO A 1 194 ? 12.567 87.267 -22.840 1.00 91.09  ? 230 PRO A CG  1 
ATOM   1589 C CD  . PRO A 1 194 ? 13.659 87.468 -21.846 1.00 83.42  ? 230 PRO A CD  1 
ATOM   1590 N N   . GLY A 1 195 ? 15.299 84.262 -24.942 1.00 85.56  ? 231 GLY A N   1 
ATOM   1591 C CA  . GLY A 1 195 ? 16.075 84.085 -26.165 1.00 88.52  ? 231 GLY A CA  1 
ATOM   1592 C C   . GLY A 1 195 ? 17.567 84.313 -25.978 1.00 92.52  ? 231 GLY A C   1 
ATOM   1593 O O   . GLY A 1 195 ? 18.224 84.830 -26.881 1.00 95.43  ? 231 GLY A O   1 
ATOM   1594 N N   . PHE A 1 196 ? 18.118 83.946 -24.800 1.00 86.24  ? 232 PHE A N   1 
ATOM   1595 C CA  . PHE A 1 196 ? 19.552 84.076 -24.501 1.00 85.36  ? 232 PHE A CA  1 
ATOM   1596 C C   . PHE A 1 196 ? 20.271 82.832 -25.035 1.00 89.97  ? 232 PHE A C   1 
ATOM   1597 O O   . PHE A 1 196 ? 19.893 81.723 -24.665 1.00 87.51  ? 232 PHE A O   1 
ATOM   1598 C CB  . PHE A 1 196 ? 19.786 84.273 -22.988 1.00 83.86  ? 232 PHE A CB  1 
ATOM   1599 C CG  . PHE A 1 196 ? 21.190 84.688 -22.611 1.00 84.75  ? 232 PHE A CG  1 
ATOM   1600 C CD1 . PHE A 1 196 ? 21.600 86.012 -22.737 1.00 90.14  ? 232 PHE A CD1 1 
ATOM   1601 C CD2 . PHE A 1 196 ? 22.101 83.757 -22.125 1.00 83.53  ? 232 PHE A CD2 1 
ATOM   1602 C CE1 . PHE A 1 196 ? 22.902 86.394 -22.400 1.00 90.43  ? 232 PHE A CE1 1 
ATOM   1603 C CE2 . PHE A 1 196 ? 23.398 84.143 -21.774 1.00 86.13  ? 232 PHE A CE2 1 
ATOM   1604 C CZ  . PHE A 1 196 ? 23.787 85.461 -21.907 1.00 86.56  ? 232 PHE A CZ  1 
ATOM   1605 N N   . ASN A 1 197 ? 21.265 83.003 -25.943 1.00 90.05  ? 233 ASN A N   1 
ATOM   1606 C CA  . ASN A 1 197 ? 21.958 81.869 -26.569 1.00 90.83  ? 233 ASN A CA  1 
ATOM   1607 C C   . ASN A 1 197 ? 23.500 81.966 -26.516 1.00 97.16  ? 233 ASN A C   1 
ATOM   1608 O O   . ASN A 1 197 ? 24.170 80.931 -26.621 1.00 96.73  ? 233 ASN A O   1 
ATOM   1609 C CB  . ASN A 1 197 ? 21.503 81.706 -28.021 1.00 95.84  ? 233 ASN A CB  1 
ATOM   1610 C CG  . ASN A 1 197 ? 21.899 80.401 -28.676 1.00 109.72 ? 233 ASN A CG  1 
ATOM   1611 O OD1 . ASN A 1 197 ? 22.125 79.381 -28.013 1.00 96.22  ? 233 ASN A OD1 1 
ATOM   1612 N ND2 . ASN A 1 197 ? 21.975 80.406 -30.005 1.00 101.72 ? 233 ASN A ND2 1 
ATOM   1613 N N   . ASP A 1 198 ? 24.072 83.175 -26.359 1.00 95.58  ? 234 ASP A N   1 
ATOM   1614 C CA  . ASP A 1 198 ? 25.530 83.268 -26.297 1.00 96.11  ? 234 ASP A CA  1 
ATOM   1615 C C   . ASP A 1 198 ? 26.007 82.993 -24.854 1.00 95.61  ? 234 ASP A C   1 
ATOM   1616 O O   . ASP A 1 198 ? 25.888 83.842 -23.969 1.00 93.77  ? 234 ASP A O   1 
ATOM   1617 C CB  . ASP A 1 198 ? 26.059 84.604 -26.854 1.00 101.19 ? 234 ASP A CB  1 
ATOM   1618 C CG  . ASP A 1 198 ? 27.399 84.494 -27.569 1.00 112.45 ? 234 ASP A CG  1 
ATOM   1619 O OD1 . ASP A 1 198 ? 28.045 83.419 -27.473 1.00 110.69 ? 234 ASP A OD1 1 
ATOM   1620 O OD2 . ASP A 1 198 ? 27.831 85.501 -28.176 1.00 123.58 ? 234 ASP A OD2 1 
ATOM   1621 N N   . VAL A 1 199 ? 26.540 81.775 -24.653 1.00 91.04  ? 235 VAL A N   1 
ATOM   1622 C CA  . VAL A 1 199 ? 27.023 81.186 -23.393 1.00 88.22  ? 235 VAL A CA  1 
ATOM   1623 C C   . VAL A 1 199 ? 28.150 82.017 -22.729 1.00 91.30  ? 235 VAL A C   1 
ATOM   1624 O O   . VAL A 1 199 ? 28.077 82.300 -21.532 1.00 88.21  ? 235 VAL A O   1 
ATOM   1625 C CB  . VAL A 1 199 ? 27.514 79.723 -23.624 1.00 92.69  ? 235 VAL A CB  1 
ATOM   1626 C CG1 . VAL A 1 199 ? 27.465 78.914 -22.331 1.00 89.88  ? 235 VAL A CG1 1 
ATOM   1627 C CG2 . VAL A 1 199 ? 26.722 79.017 -24.728 1.00 94.11  ? 235 VAL A CG2 1 
ATOM   1628 N N   . ASP A 1 200 ? 29.191 82.364 -23.514 1.00 89.89  ? 236 ASP A N   1 
ATOM   1629 C CA  . ASP A 1 200 ? 30.431 83.045 -23.132 1.00 90.60  ? 236 ASP A CA  1 
ATOM   1630 C C   . ASP A 1 200 ? 30.294 84.262 -22.173 1.00 93.05  ? 236 ASP A C   1 
ATOM   1631 O O   . ASP A 1 200 ? 31.097 84.364 -21.245 1.00 91.77  ? 236 ASP A O   1 
ATOM   1632 C CB  . ASP A 1 200 ? 31.188 83.481 -24.400 1.00 96.15  ? 236 ASP A CB  1 
ATOM   1633 C CG  . ASP A 1 200 ? 31.846 82.341 -25.167 1.00 107.64 ? 236 ASP A CG  1 
ATOM   1634 O OD1 . ASP A 1 200 ? 31.191 81.282 -25.346 1.00 106.38 ? 236 ASP A OD1 1 
ATOM   1635 O OD2 . ASP A 1 200 ? 33.005 82.517 -25.612 1.00 116.56 ? 236 ASP A OD2 1 
ATOM   1636 N N   . ALA A 1 201 ? 29.340 85.190 -22.408 1.00 90.04  ? 237 ALA A N   1 
ATOM   1637 C CA  . ALA A 1 201 ? 29.174 86.399 -21.572 1.00 89.30  ? 237 ALA A CA  1 
ATOM   1638 C C   . ALA A 1 201 ? 28.609 86.073 -20.176 1.00 89.04  ? 237 ALA A C   1 
ATOM   1639 O O   . ALA A 1 201 ? 28.982 86.732 -19.204 1.00 88.75  ? 237 ALA A O   1 
ATOM   1640 C CB  . ALA A 1 201 ? 28.280 87.416 -22.271 1.00 91.80  ? 237 ALA A CB  1 
ATOM   1641 N N   . LEU A 1 202 ? 27.716 85.068 -20.085 1.00 82.13  ? 238 LEU A N   1 
ATOM   1642 C CA  . LEU A 1 202 ? 27.101 84.618 -18.821 1.00 78.85  ? 238 LEU A CA  1 
ATOM   1643 C C   . LEU A 1 202 ? 28.177 83.994 -17.900 1.00 80.70  ? 238 LEU A C   1 
ATOM   1644 O O   . LEU A 1 202 ? 28.312 84.393 -16.739 1.00 78.94  ? 238 LEU A O   1 
ATOM   1645 C CB  . LEU A 1 202 ? 25.957 83.615 -19.117 1.00 77.06  ? 238 LEU A CB  1 
ATOM   1646 C CG  . LEU A 1 202 ? 25.343 82.869 -17.925 1.00 78.33  ? 238 LEU A CG  1 
ATOM   1647 C CD1 . LEU A 1 202 ? 24.180 83.618 -17.347 1.00 77.92  ? 238 LEU A CD1 1 
ATOM   1648 C CD2 . LEU A 1 202 ? 24.913 81.489 -18.322 1.00 78.62  ? 238 LEU A CD2 1 
ATOM   1649 N N   . CYS A 1 203 ? 28.964 83.058 -18.450 1.00 77.62  ? 239 CYS A N   1 
ATOM   1650 C CA  . CYS A 1 203 ? 30.054 82.369 -17.765 1.00 77.39  ? 239 CYS A CA  1 
ATOM   1651 C C   . CYS A 1 203 ? 31.108 83.362 -17.252 1.00 82.25  ? 239 CYS A C   1 
ATOM   1652 O O   . CYS A 1 203 ? 31.551 83.220 -16.107 1.00 80.95  ? 239 CYS A O   1 
ATOM   1653 C CB  . CYS A 1 203 ? 30.661 81.313 -18.681 1.00 78.92  ? 239 CYS A CB  1 
ATOM   1654 S SG  . CYS A 1 203 ? 29.437 80.159 -19.362 1.00 81.59  ? 239 CYS A SG  1 
ATOM   1655 N N   . ARG A 1 204 ? 31.441 84.403 -18.055 1.00 80.37  ? 240 ARG A N   1 
ATOM   1656 C CA  . ARG A 1 204 ? 32.388 85.453 -17.660 1.00 82.63  ? 240 ARG A CA  1 
ATOM   1657 C C   . ARG A 1 204 ? 31.799 86.336 -16.535 1.00 86.02  ? 240 ARG A C   1 
ATOM   1658 O O   . ARG A 1 204 ? 32.538 86.760 -15.642 1.00 86.96  ? 240 ARG A O   1 
ATOM   1659 C CB  . ARG A 1 204 ? 32.802 86.318 -18.864 1.00 87.01  ? 240 ARG A CB  1 
ATOM   1660 C CG  . ARG A 1 204 ? 33.873 85.675 -19.740 1.00 102.62 ? 240 ARG A CG  1 
ATOM   1661 C CD  . ARG A 1 204 ? 34.423 86.650 -20.768 1.00 120.35 ? 240 ARG A CD  1 
ATOM   1662 N NE  . ARG A 1 204 ? 33.646 86.654 -22.010 1.00 130.67 ? 240 ARG A NE  1 
ATOM   1663 C CZ  . ARG A 1 204 ? 34.029 86.064 -23.140 1.00 147.98 ? 240 ARG A CZ  1 
ATOM   1664 N NH1 . ARG A 1 204 ? 33.263 86.128 -24.220 1.00 139.08 ? 240 ARG A NH1 1 
ATOM   1665 N NH2 . ARG A 1 204 ? 35.186 85.415 -23.200 1.00 134.63 ? 240 ARG A NH2 1 
ATOM   1666 N N   . ALA A 1 205 ? 30.468 86.584 -16.567 1.00 80.70  ? 241 ALA A N   1 
ATOM   1667 C CA  . ALA A 1 205 ? 29.763 87.362 -15.537 1.00 79.67  ? 241 ALA A CA  1 
ATOM   1668 C C   . ALA A 1 205 ? 29.695 86.574 -14.211 1.00 79.72  ? 241 ALA A C   1 
ATOM   1669 O O   . ALA A 1 205 ? 29.581 87.173 -13.140 1.00 80.71  ? 241 ALA A O   1 
ATOM   1670 C CB  . ALA A 1 205 ? 28.364 87.723 -16.013 1.00 79.97  ? 241 ALA A CB  1 
ATOM   1671 N N   . LEU A 1 206 ? 29.799 85.236 -14.291 1.00 72.06  ? 242 LEU A N   1 
ATOM   1672 C CA  . LEU A 1 206 ? 29.813 84.343 -13.126 1.00 69.42  ? 242 LEU A CA  1 
ATOM   1673 C C   . LEU A 1 206 ? 31.274 83.940 -12.765 1.00 74.89  ? 242 LEU A C   1 
ATOM   1674 O O   . LEU A 1 206 ? 31.501 83.078 -11.904 1.00 74.37  ? 242 LEU A O   1 
ATOM   1675 C CB  . LEU A 1 206 ? 28.924 83.118 -13.381 1.00 66.42  ? 242 LEU A CB  1 
ATOM   1676 C CG  . LEU A 1 206 ? 27.429 83.386 -13.140 1.00 68.91  ? 242 LEU A CG  1 
ATOM   1677 C CD1 . LEU A 1 206 ? 26.596 82.945 -14.307 1.00 68.41  ? 242 LEU A CD1 1 
ATOM   1678 C CD2 . LEU A 1 206 ? 26.956 82.763 -11.847 1.00 67.13  ? 242 LEU A CD2 1 
ATOM   1679 N N   . SER A 1 207 ? 32.256 84.615 -13.402 1.00 72.04  ? 243 SER A N   1 
ATOM   1680 C CA  . SER A 1 207 ? 33.683 84.412 -13.167 1.00 72.83  ? 243 SER A CA  1 
ATOM   1681 C C   . SER A 1 207 ? 34.269 85.591 -12.360 1.00 79.06  ? 243 SER A C   1 
ATOM   1682 O O   . SER A 1 207 ? 35.485 85.668 -12.162 1.00 80.22  ? 243 SER A O   1 
ATOM   1683 C CB  . SER A 1 207 ? 34.416 84.210 -14.487 1.00 75.71  ? 243 SER A CB  1 
ATOM   1684 O OG  . SER A 1 207 ? 34.096 82.950 -15.055 1.00 77.62  ? 243 SER A OG  1 
ATOM   1685 N N   . ALA A 1 208 ? 33.382 86.472 -11.843 1.00 76.38  ? 244 ALA A N   1 
ATOM   1686 C CA  . ALA A 1 208 ? 33.719 87.656 -11.042 1.00 79.13  ? 244 ALA A CA  1 
ATOM   1687 C C   . ALA A 1 208 ? 34.517 87.297 -9.770  1.00 84.25  ? 244 ALA A C   1 
ATOM   1688 O O   . ALA A 1 208 ? 35.472 88.010 -9.439  1.00 85.91  ? 244 ALA A O   1 
ATOM   1689 C CB  . ALA A 1 208 ? 32.452 88.409 -10.666 1.00 79.22  ? 244 ALA A CB  1 
ATOM   1690 N N   . VAL A 1 209 ? 34.139 86.186 -9.080  1.00 79.54  ? 245 VAL A N   1 
ATOM   1691 C CA  . VAL A 1 209 ? 34.825 85.727 -7.864  1.00 81.26  ? 245 VAL A CA  1 
ATOM   1692 C C   . VAL A 1 209 ? 35.690 84.494 -8.203  1.00 86.72  ? 245 VAL A C   1 
ATOM   1693 O O   . VAL A 1 209 ? 36.915 84.551 -8.034  1.00 89.09  ? 245 VAL A O   1 
ATOM   1694 C CB  . VAL A 1 209 ? 33.871 85.465 -6.662  1.00 83.43  ? 245 VAL A CB  1 
ATOM   1695 C CG1 . VAL A 1 209 ? 34.664 85.237 -5.374  1.00 85.78  ? 245 VAL A CG1 1 
ATOM   1696 C CG2 . VAL A 1 209 ? 32.905 86.620 -6.472  1.00 83.08  ? 245 VAL A CG2 1 
ATOM   1697 N N   . HIS A 1 210 ? 35.057 83.400 -8.688  1.00 80.57  ? 246 HIS A N   1 
ATOM   1698 C CA  . HIS A 1 210 ? 35.748 82.158 -9.059  1.00 80.56  ? 246 HIS A CA  1 
ATOM   1699 C C   . HIS A 1 210 ? 35.387 81.743 -10.491 1.00 83.06  ? 246 HIS A C   1 
ATOM   1700 O O   . HIS A 1 210 ? 34.340 82.134 -11.002 1.00 81.32  ? 246 HIS A O   1 
ATOM   1701 C CB  . HIS A 1 210 ? 35.432 81.021 -8.066  1.00 79.91  ? 246 HIS A CB  1 
ATOM   1702 C CG  . HIS A 1 210 ? 35.626 81.393 -6.625  1.00 84.84  ? 246 HIS A CG  1 
ATOM   1703 N ND1 . HIS A 1 210 ? 36.888 81.544 -6.080  1.00 90.16  ? 246 HIS A ND1 1 
ATOM   1704 C CD2 . HIS A 1 210 ? 34.705 81.629 -5.663  1.00 85.20  ? 246 HIS A CD2 1 
ATOM   1705 C CE1 . HIS A 1 210 ? 36.695 81.868 -4.812  1.00 90.45  ? 246 HIS A CE1 1 
ATOM   1706 N NE2 . HIS A 1 210 ? 35.400 81.924 -4.513  1.00 87.93  ? 246 HIS A NE2 1 
ATOM   1707 N N   . SER A 1 211 ? 36.259 80.948 -11.128 1.00 80.95  ? 247 SER A N   1 
ATOM   1708 C CA  . SER A 1 211 ? 36.104 80.464 -12.499 1.00 80.19  ? 247 SER A CA  1 
ATOM   1709 C C   . SER A 1 211 ? 35.391 79.104 -12.518 1.00 81.64  ? 247 SER A C   1 
ATOM   1710 O O   . SER A 1 211 ? 35.920 78.151 -11.941 1.00 82.52  ? 247 SER A O   1 
ATOM   1711 C CB  . SER A 1 211 ? 37.474 80.370 -13.181 1.00 87.23  ? 247 SER A CB  1 
ATOM   1712 O OG  . SER A 1 211 ? 37.393 80.026 -14.556 1.00 94.16  ? 247 SER A OG  1 
ATOM   1713 N N   . PRO A 1 212 ? 34.209 78.978 -13.173 1.00 75.40  ? 248 PRO A N   1 
ATOM   1714 C CA  . PRO A 1 212 ? 33.505 77.678 -13.177 1.00 73.68  ? 248 PRO A CA  1 
ATOM   1715 C C   . PRO A 1 212 ? 34.190 76.576 -14.002 1.00 78.95  ? 248 PRO A C   1 
ATOM   1716 O O   . PRO A 1 212 ? 34.801 76.849 -15.034 1.00 79.43  ? 248 PRO A O   1 
ATOM   1717 C CB  . PRO A 1 212 ? 32.121 78.013 -13.753 1.00 73.07  ? 248 PRO A CB  1 
ATOM   1718 C CG  . PRO A 1 212 ? 32.302 79.269 -14.509 1.00 78.24  ? 248 PRO A CG  1 
ATOM   1719 C CD  . PRO A 1 212 ? 33.424 80.023 -13.861 1.00 76.00  ? 248 PRO A CD  1 
ATOM   1720 N N   . THR A 1 213 ? 34.040 75.316 -13.534 1.00 76.11  ? 249 THR A N   1 
ATOM   1721 C CA  . THR A 1 213 ? 34.581 74.080 -14.122 1.00 78.28  ? 249 THR A CA  1 
ATOM   1722 C C   . THR A 1 213 ? 33.610 73.566 -15.204 1.00 80.92  ? 249 THR A C   1 
ATOM   1723 O O   . THR A 1 213 ? 33.975 72.730 -16.031 1.00 81.74  ? 249 THR A O   1 
ATOM   1724 C CB  . THR A 1 213 ? 34.870 73.073 -12.972 1.00 89.61  ? 249 THR A CB  1 
ATOM   1725 O OG1 . THR A 1 213 ? 36.261 73.142 -12.641 1.00 89.57  ? 249 THR A OG1 1 
ATOM   1726 C CG2 . THR A 1 213 ? 34.476 71.619 -13.285 1.00 90.53  ? 249 THR A CG2 1 
ATOM   1727 N N   . PHE A 1 214 ? 32.382 74.100 -15.198 1.00 75.71  ? 250 PHE A N   1 
ATOM   1728 C CA  . PHE A 1 214 ? 31.299 73.796 -16.127 1.00 74.75  ? 250 PHE A CA  1 
ATOM   1729 C C   . PHE A 1 214 ? 30.360 75.004 -16.147 1.00 77.95  ? 250 PHE A C   1 
ATOM   1730 O O   . PHE A 1 214 ? 30.132 75.624 -15.103 1.00 75.62  ? 250 PHE A O   1 
ATOM   1731 C CB  . PHE A 1 214 ? 30.587 72.504 -15.688 1.00 75.42  ? 250 PHE A CB  1 
ATOM   1732 C CG  . PHE A 1 214 ? 29.474 71.950 -16.548 1.00 76.42  ? 250 PHE A CG  1 
ATOM   1733 C CD1 . PHE A 1 214 ? 29.684 70.833 -17.349 1.00 81.60  ? 250 PHE A CD1 1 
ATOM   1734 C CD2 . PHE A 1 214 ? 28.181 72.462 -16.458 1.00 75.36  ? 250 PHE A CD2 1 
ATOM   1735 C CE1 . PHE A 1 214 ? 28.635 70.275 -18.095 1.00 81.88  ? 250 PHE A CE1 1 
ATOM   1736 C CE2 . PHE A 1 214 ? 27.137 71.912 -17.214 1.00 77.65  ? 250 PHE A CE2 1 
ATOM   1737 C CZ  . PHE A 1 214 ? 27.372 70.827 -18.032 1.00 78.03  ? 250 PHE A CZ  1 
ATOM   1738 N N   . CYS A 1 215 ? 29.873 75.374 -17.346 1.00 75.34  ? 251 CYS A N   1 
ATOM   1739 C CA  . CYS A 1 215 ? 28.967 76.501 -17.572 1.00 73.60  ? 251 CYS A CA  1 
ATOM   1740 C C   . CYS A 1 215 ? 28.315 76.347 -18.944 1.00 76.65  ? 251 CYS A C   1 
ATOM   1741 O O   . CYS A 1 215 ? 28.822 76.843 -19.953 1.00 77.60  ? 251 CYS A O   1 
ATOM   1742 C CB  . CYS A 1 215 ? 29.693 77.837 -17.427 1.00 74.94  ? 251 CYS A CB  1 
ATOM   1743 S SG  . CYS A 1 215 ? 28.645 79.286 -17.699 1.00 78.01  ? 251 CYS A SG  1 
ATOM   1744 N N   . GLN A 1 216 ? 27.175 75.642 -18.958 1.00 71.62  ? 252 GLN A N   1 
ATOM   1745 C CA  . GLN A 1 216 ? 26.395 75.314 -20.144 1.00 71.52  ? 252 GLN A CA  1 
ATOM   1746 C C   . GLN A 1 216 ? 24.970 75.879 -20.080 1.00 74.24  ? 252 GLN A C   1 
ATOM   1747 O O   . GLN A 1 216 ? 24.388 75.987 -18.996 1.00 70.95  ? 252 GLN A O   1 
ATOM   1748 C CB  . GLN A 1 216 ? 26.322 73.785 -20.284 1.00 72.65  ? 252 GLN A CB  1 
ATOM   1749 C CG  . GLN A 1 216 ? 26.963 73.238 -21.542 1.00 85.88  ? 252 GLN A CG  1 
ATOM   1750 C CD  . GLN A 1 216 ? 26.402 71.876 -21.871 1.00 98.16  ? 252 GLN A CD  1 
ATOM   1751 O OE1 . GLN A 1 216 ? 26.918 70.843 -21.433 1.00 89.84  ? 252 GLN A OE1 1 
ATOM   1752 N NE2 . GLN A 1 216 ? 25.322 71.843 -22.647 1.00 90.07  ? 252 GLN A NE2 1 
ATOM   1753 N N   . LEU A 1 217 ? 24.401 76.182 -21.264 1.00 71.94  ? 253 LEU A N   1 
ATOM   1754 C CA  . LEU A 1 217 ? 23.031 76.652 -21.477 1.00 71.10  ? 253 LEU A CA  1 
ATOM   1755 C C   . LEU A 1 217 ? 22.144 75.456 -21.809 1.00 74.19  ? 253 LEU A C   1 
ATOM   1756 O O   . LEU A 1 217 ? 22.556 74.585 -22.584 1.00 74.70  ? 253 LEU A O   1 
ATOM   1757 C CB  . LEU A 1 217 ? 22.997 77.686 -22.622 1.00 74.00  ? 253 LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 217 ? 22.800 79.154 -22.243 1.00 78.70  ? 253 LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 217 ? 23.899 79.649 -21.318 1.00 78.10  ? 253 LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 217 ? 22.777 80.022 -23.477 1.00 83.79  ? 253 LEU A CD2 1 
ATOM   1761 N N   . ALA A 1 218 ? 20.939 75.403 -21.217 1.00 69.17  ? 254 ALA A N   1 
ATOM   1762 C CA  . ALA A 1 218 ? 19.996 74.306 -21.429 1.00 69.42  ? 254 ALA A CA  1 
ATOM   1763 C C   . ALA A 1 218 ? 19.158 74.463 -22.703 1.00 79.28  ? 254 ALA A C   1 
ATOM   1764 O O   . ALA A 1 218 ? 18.708 75.571 -23.041 1.00 77.62  ? 254 ALA A O   1 
ATOM   1765 C CB  . ALA A 1 218 ? 19.078 74.173 -20.236 1.00 67.05  ? 254 ALA A CB  1 
ATOM   1766 N N   . CYS A 1 219 ? 18.960 73.317 -23.397 1.00 82.22  ? 255 CYS A N   1 
ATOM   1767 C CA  . CYS A 1 219 ? 18.162 73.116 -24.613 1.00 87.30  ? 255 CYS A CA  1 
ATOM   1768 C C   . CYS A 1 219 ? 17.858 71.618 -24.770 1.00 92.55  ? 255 CYS A C   1 
ATOM   1769 O O   . CYS A 1 219 ? 18.725 70.784 -24.510 1.00 91.25  ? 255 CYS A O   1 
ATOM   1770 C CB  . CYS A 1 219 ? 18.825 73.704 -25.860 1.00 92.04  ? 255 CYS A CB  1 
ATOM   1771 S SG  . CYS A 1 219 ? 20.472 73.045 -26.226 1.00 97.75  ? 255 CYS A SG  1 
ATOM   1772 N N   . GLY A 1 220 ? 16.616 71.305 -25.139 1.00 91.97  ? 256 GLY A N   1 
ATOM   1773 C CA  . GLY A 1 220 ? 16.117 69.937 -25.256 1.00 93.63  ? 256 GLY A CA  1 
ATOM   1774 C C   . GLY A 1 220 ? 16.377 69.177 -26.545 1.00 103.61 ? 256 GLY A C   1 
ATOM   1775 O O   . GLY A 1 220 ? 17.252 69.545 -27.339 1.00 105.28 ? 256 GLY A O   1 
ATOM   1776 N N   . GLN A 1 221 ? 15.607 68.078 -26.730 1.00 102.93 ? 257 GLN A N   1 
ATOM   1777 C CA  . GLN A 1 221 ? 15.650 67.155 -27.876 1.00 108.15 ? 257 GLN A CA  1 
ATOM   1778 C C   . GLN A 1 221 ? 15.324 67.874 -29.192 1.00 117.05 ? 257 GLN A C   1 
ATOM   1779 O O   . GLN A 1 221 ? 15.843 67.498 -30.246 1.00 121.17 ? 257 GLN A O   1 
ATOM   1780 C CB  . GLN A 1 221 ? 14.694 65.958 -27.663 1.00 110.44 ? 257 GLN A CB  1 
ATOM   1781 C CG  . GLN A 1 221 ? 13.233 66.325 -27.356 1.00 127.67 ? 257 GLN A CG  1 
ATOM   1782 C CD  . GLN A 1 221 ? 12.474 65.216 -26.669 1.00 146.89 ? 257 GLN A CD  1 
ATOM   1783 O OE1 . GLN A 1 221 ? 12.809 64.789 -25.556 1.00 139.37 ? 257 GLN A OE1 1 
ATOM   1784 N NE2 . GLN A 1 221 ? 11.395 64.767 -27.293 1.00 141.65 ? 257 GLN A NE2 1 
ATOM   1785 N N   . ASP A 1 222 ? 14.468 68.906 -29.114 1.00 112.68 ? 258 ASP A N   1 
ATOM   1786 C CA  . ASP A 1 222 ? 14.053 69.758 -30.227 1.00 116.02 ? 258 ASP A CA  1 
ATOM   1787 C C   . ASP A 1 222 ? 15.201 70.697 -30.649 1.00 119.01 ? 258 ASP A C   1 
ATOM   1788 O O   . ASP A 1 222 ? 15.340 71.001 -31.836 1.00 122.50 ? 258 ASP A O   1 
ATOM   1789 C CB  . ASP A 1 222 ? 12.796 70.568 -29.842 1.00 116.79 ? 258 ASP A CB  1 
ATOM   1790 C CG  . ASP A 1 222 ? 12.710 70.943 -28.371 1.00 120.02 ? 258 ASP A CG  1 
ATOM   1791 O OD1 . ASP A 1 222 ? 13.468 71.839 -27.942 1.00 118.09 ? 258 ASP A OD1 1 
ATOM   1792 O OD2 . ASP A 1 222 ? 11.905 70.320 -27.646 1.00 123.14 ? 258 ASP A OD2 1 
ATOM   1793 N N   . GLY A 1 223 ? 16.006 71.124 -29.673 1.00 110.70 ? 259 GLY A N   1 
ATOM   1794 C CA  . GLY A 1 223 ? 17.137 72.025 -29.874 1.00 109.96 ? 259 GLY A CA  1 
ATOM   1795 C C   . GLY A 1 223 ? 16.853 73.459 -29.468 1.00 110.25 ? 259 GLY A C   1 
ATOM   1796 O O   . GLY A 1 223 ? 17.709 74.332 -29.644 1.00 110.10 ? 259 GLY A O   1 
ATOM   1797 N N   . GLN A 1 224 ? 15.640 73.710 -28.930 1.00 103.81 ? 260 GLN A N   1 
ATOM   1798 C CA  . GLN A 1 224 ? 15.163 75.021 -28.484 1.00 101.64 ? 260 GLN A CA  1 
ATOM   1799 C C   . GLN A 1 224 ? 15.589 75.274 -27.044 1.00 97.29  ? 260 GLN A C   1 
ATOM   1800 O O   . GLN A 1 224 ? 15.490 74.377 -26.196 1.00 92.97  ? 260 GLN A O   1 
ATOM   1801 C CB  . GLN A 1 224 ? 13.624 75.119 -28.626 1.00 104.90 ? 260 GLN A CB  1 
ATOM   1802 C CG  . GLN A 1 224 ? 13.001 76.492 -28.320 1.00 120.02 ? 260 GLN A CG  1 
ATOM   1803 C CD  . GLN A 1 224 ? 13.343 77.558 -29.337 1.00 142.28 ? 260 GLN A CD  1 
ATOM   1804 O OE1 . GLN A 1 224 ? 12.955 77.488 -30.509 1.00 142.76 ? 260 GLN A OE1 1 
ATOM   1805 N NE2 . GLN A 1 224 ? 14.051 78.588 -28.897 1.00 131.59 ? 260 GLN A NE2 1 
ATOM   1806 N N   . LEU A 1 225 ? 16.058 76.510 -26.780 1.00 91.53  ? 261 LEU A N   1 
ATOM   1807 C CA  . LEU A 1 225 ? 16.518 76.973 -25.467 1.00 86.23  ? 261 LEU A CA  1 
ATOM   1808 C C   . LEU A 1 225 ? 15.427 76.774 -24.432 1.00 84.79  ? 261 LEU A C   1 
ATOM   1809 O O   . LEU A 1 225 ? 14.288 77.208 -24.641 1.00 85.63  ? 261 LEU A O   1 
ATOM   1810 C CB  . LEU A 1 225 ? 16.946 78.454 -25.522 1.00 87.09  ? 261 LEU A CB  1 
ATOM   1811 C CG  . LEU A 1 225 ? 18.086 78.814 -26.482 1.00 94.07  ? 261 LEU A CG  1 
ATOM   1812 C CD1 . LEU A 1 225 ? 17.932 80.228 -27.001 1.00 96.83  ? 261 LEU A CD1 1 
ATOM   1813 C CD2 . LEU A 1 225 ? 19.452 78.610 -25.832 1.00 93.58  ? 261 LEU A CD2 1 
ATOM   1814 N N   . LYS A 1 226 ? 15.763 76.063 -23.340 1.00 75.64  ? 262 LYS A N   1 
ATOM   1815 C CA  . LYS A 1 226 ? 14.821 75.769 -22.263 1.00 71.59  ? 262 LYS A CA  1 
ATOM   1816 C C   . LYS A 1 226 ? 14.769 76.930 -21.252 1.00 70.97  ? 262 LYS A C   1 
ATOM   1817 O O   . LYS A 1 226 ? 13.922 76.930 -20.358 1.00 68.12  ? 262 LYS A O   1 
ATOM   1818 C CB  . LYS A 1 226 ? 15.149 74.425 -21.590 1.00 71.53  ? 262 LYS A CB  1 
ATOM   1819 C CG  . LYS A 1 226 ? 14.932 73.211 -22.507 1.00 84.48  ? 262 LYS A CG  1 
ATOM   1820 C CD  . LYS A 1 226 ? 13.450 72.930 -22.798 1.00 94.79  ? 262 LYS A CD  1 
ATOM   1821 C CE  . LYS A 1 226 ? 13.237 72.055 -24.011 1.00 107.45 ? 262 LYS A CE  1 
ATOM   1822 N NZ  . LYS A 1 226 ? 13.118 70.617 -23.650 1.00 116.05 ? 262 LYS A NZ  1 
ATOM   1823 N N   . GLY A 1 227 ? 15.623 77.934 -21.452 1.00 67.38  ? 263 GLY A N   1 
ATOM   1824 C CA  . GLY A 1 227 ? 15.646 79.142 -20.635 1.00 66.06  ? 263 GLY A CA  1 
ATOM   1825 C C   . GLY A 1 227 ? 16.489 79.117 -19.379 1.00 66.11  ? 263 GLY A C   1 
ATOM   1826 O O   . GLY A 1 227 ? 16.389 80.046 -18.577 1.00 65.68  ? 263 GLY A O   1 
ATOM   1827 N N   . PHE A 1 228 ? 17.326 78.087 -19.180 1.00 60.61  ? 264 PHE A N   1 
ATOM   1828 C CA  . PHE A 1 228 ? 18.148 78.065 -17.969 1.00 58.59  ? 264 PHE A CA  1 
ATOM   1829 C C   . PHE A 1 228 ? 19.579 77.586 -18.236 1.00 64.27  ? 264 PHE A C   1 
ATOM   1830 O O   . PHE A 1 228 ? 19.875 77.109 -19.328 1.00 64.75  ? 264 PHE A O   1 
ATOM   1831 C CB  . PHE A 1 228 ? 17.489 77.221 -16.859 1.00 57.42  ? 264 PHE A CB  1 
ATOM   1832 C CG  . PHE A 1 228 ? 17.368 75.740 -17.112 1.00 57.50  ? 264 PHE A CG  1 
ATOM   1833 C CD1 . PHE A 1 228 ? 18.323 74.856 -16.625 1.00 58.35  ? 264 PHE A CD1 1 
ATOM   1834 C CD2 . PHE A 1 228 ? 16.267 75.221 -17.784 1.00 59.57  ? 264 PHE A CD2 1 
ATOM   1835 C CE1 . PHE A 1 228 ? 18.186 73.481 -16.818 1.00 59.16  ? 264 PHE A CE1 1 
ATOM   1836 C CE2 . PHE A 1 228 ? 16.139 73.846 -17.995 1.00 61.64  ? 264 PHE A CE2 1 
ATOM   1837 C CZ  . PHE A 1 228 ? 17.093 72.985 -17.501 1.00 59.00  ? 264 PHE A CZ  1 
ATOM   1838 N N   . ALA A 1 229 ? 20.456 77.712 -17.217 1.00 61.69  ? 265 ALA A N   1 
ATOM   1839 C CA  . ALA A 1 229 ? 21.853 77.279 -17.276 1.00 63.23  ? 265 ALA A CA  1 
ATOM   1840 C C   . ALA A 1 229 ? 22.267 76.541 -16.001 1.00 65.45  ? 265 ALA A C   1 
ATOM   1841 O O   . ALA A 1 229 ? 21.855 76.927 -14.905 1.00 64.03  ? 265 ALA A O   1 
ATOM   1842 C CB  . ALA A 1 229 ? 22.763 78.480 -17.503 1.00 65.55  ? 265 ALA A CB  1 
ATOM   1843 N N   . VAL A 1 230 ? 23.091 75.488 -16.149 1.00 63.00  ? 266 VAL A N   1 
ATOM   1844 C CA  . VAL A 1 230 ? 23.648 74.673 -15.049 1.00 61.49  ? 266 VAL A CA  1 
ATOM   1845 C C   . VAL A 1 230 ? 25.174 74.851 -15.028 1.00 66.47  ? 266 VAL A C   1 
ATOM   1846 O O   . VAL A 1 230 ? 25.830 74.589 -16.037 1.00 69.73  ? 266 VAL A O   1 
ATOM   1847 C CB  . VAL A 1 230 ? 23.242 73.178 -15.154 1.00 65.66  ? 266 VAL A CB  1 
ATOM   1848 C CG1 . VAL A 1 230 ? 23.915 72.332 -14.062 1.00 64.91  ? 266 VAL A CG1 1 
ATOM   1849 C CG2 . VAL A 1 230 ? 21.727 73.022 -15.092 1.00 64.41  ? 266 VAL A CG2 1 
ATOM   1850 N N   . LEU A 1 231 ? 25.727 75.308 -13.886 1.00 60.80  ? 267 LEU A N   1 
ATOM   1851 C CA  . LEU A 1 231 ? 27.158 75.581 -13.681 1.00 61.64  ? 267 LEU A CA  1 
ATOM   1852 C C   . LEU A 1 231 ? 27.750 74.730 -12.562 1.00 66.10  ? 267 LEU A C   1 
ATOM   1853 O O   . LEU A 1 231 ? 27.069 74.468 -11.581 1.00 63.51  ? 267 LEU A O   1 
ATOM   1854 C CB  . LEU A 1 231 ? 27.360 77.068 -13.319 1.00 61.79  ? 267 LEU A CB  1 
ATOM   1855 C CG  . LEU A 1 231 ? 27.489 78.091 -14.459 1.00 67.81  ? 267 LEU A CG  1 
ATOM   1856 C CD1 . LEU A 1 231 ? 26.144 78.399 -15.110 1.00 67.04  ? 267 LEU A CD1 1 
ATOM   1857 C CD2 . LEU A 1 231 ? 28.096 79.391 -13.947 1.00 71.55  ? 267 LEU A CD2 1 
ATOM   1858 N N   . GLU A 1 232 ? 29.022 74.331 -12.693 1.00 65.55  ? 268 GLU A N   1 
ATOM   1859 C CA  . GLU A 1 232 ? 29.732 73.572 -11.664 1.00 66.30  ? 268 GLU A CA  1 
ATOM   1860 C C   . GLU A 1 232 ? 31.023 74.303 -11.291 1.00 70.64  ? 268 GLU A C   1 
ATOM   1861 O O   . GLU A 1 232 ? 31.646 74.926 -12.149 1.00 71.80  ? 268 GLU A O   1 
ATOM   1862 C CB  . GLU A 1 232 ? 30.023 72.124 -12.118 1.00 69.20  ? 268 GLU A CB  1 
ATOM   1863 C CG  . GLU A 1 232 ? 30.518 71.214 -10.995 1.00 78.33  ? 268 GLU A CG  1 
ATOM   1864 C CD  . GLU A 1 232 ? 30.453 69.709 -11.189 1.00 94.45  ? 268 GLU A CD  1 
ATOM   1865 O OE1 . GLU A 1 232 ? 30.311 69.248 -12.344 1.00 81.83  ? 268 GLU A OE1 1 
ATOM   1866 O OE2 . GLU A 1 232 ? 30.572 68.986 -10.174 1.00 92.06  ? 268 GLU A OE2 1 
ATOM   1867 N N   . TYR A 1 233 ? 31.382 74.267 -10.000 1.00 66.14  ? 269 TYR A N   1 
ATOM   1868 C CA  . TYR A 1 233 ? 32.609 74.847 -9.453  1.00 67.62  ? 269 TYR A CA  1 
ATOM   1869 C C   . TYR A 1 233 ? 33.389 73.749 -8.782  1.00 74.83  ? 269 TYR A C   1 
ATOM   1870 O O   . TYR A 1 233 ? 32.791 72.768 -8.334  1.00 73.94  ? 269 TYR A O   1 
ATOM   1871 C CB  . TYR A 1 233 ? 32.331 75.999 -8.472  1.00 67.28  ? 269 TYR A CB  1 
ATOM   1872 C CG  . TYR A 1 233 ? 31.693 77.205 -9.123  1.00 67.73  ? 269 TYR A CG  1 
ATOM   1873 C CD1 . TYR A 1 233 ? 32.471 78.236 -9.645  1.00 71.23  ? 269 TYR A CD1 1 
ATOM   1874 C CD2 . TYR A 1 233 ? 30.309 77.312 -9.233  1.00 65.91  ? 269 TYR A CD2 1 
ATOM   1875 C CE1 . TYR A 1 233 ? 31.887 79.348 -10.253 1.00 70.65  ? 269 TYR A CE1 1 
ATOM   1876 C CE2 . TYR A 1 233 ? 29.715 78.415 -9.841  1.00 66.27  ? 269 TYR A CE2 1 
ATOM   1877 C CZ  . TYR A 1 233 ? 30.507 79.433 -10.345 1.00 73.63  ? 269 TYR A CZ  1 
ATOM   1878 O OH  . TYR A 1 233 ? 29.908 80.511 -10.943 1.00 72.71  ? 269 TYR A OH  1 
ATOM   1879 N N   . GLU A 1 234 ? 34.725 73.908 -8.725  1.00 74.82  ? 270 GLU A N   1 
ATOM   1880 C CA  . GLU A 1 234 ? 35.688 72.973 -8.124  1.00 77.53  ? 270 GLU A CA  1 
ATOM   1881 C C   . GLU A 1 234 ? 35.279 72.593 -6.687  1.00 79.89  ? 270 GLU A C   1 
ATOM   1882 O O   . GLU A 1 234 ? 35.237 71.404 -6.366  1.00 80.40  ? 270 GLU A O   1 
ATOM   1883 C CB  . GLU A 1 234 ? 37.100 73.597 -8.150  1.00 82.32  ? 270 GLU A CB  1 
ATOM   1884 C CG  . GLU A 1 234 ? 38.218 72.708 -7.623  1.00 97.86  ? 270 GLU A CG  1 
ATOM   1885 C CD  . GLU A 1 234 ? 39.557 73.404 -7.451  1.00 120.67 ? 270 GLU A CD  1 
ATOM   1886 O OE1 . GLU A 1 234 ? 40.037 74.023 -8.429  1.00 119.89 ? 270 GLU A OE1 1 
ATOM   1887 O OE2 . GLU A 1 234 ? 40.139 73.314 -6.345  1.00 112.97 ? 270 GLU A OE2 1 
ATOM   1888 N N   . THR A 1 235 ? 34.968 73.601 -5.841  1.00 74.42  ? 271 THR A N   1 
ATOM   1889 C CA  . THR A 1 235 ? 34.573 73.392 -4.443  1.00 73.56  ? 271 THR A CA  1 
ATOM   1890 C C   . THR A 1 235 ? 33.153 73.953 -4.179  1.00 72.54  ? 271 THR A C   1 
ATOM   1891 O O   . THR A 1 235 ? 32.646 74.777 -4.951  1.00 69.62  ? 271 THR A O   1 
ATOM   1892 C CB  . THR A 1 235 ? 35.603 74.010 -3.444  1.00 80.43  ? 271 THR A CB  1 
ATOM   1893 O OG1 . THR A 1 235 ? 35.372 75.412 -3.285  1.00 79.93  ? 271 THR A OG1 1 
ATOM   1894 C CG2 . THR A 1 235 ? 37.084 73.741 -3.814  1.00 79.48  ? 271 THR A CG2 1 
ATOM   1895 N N   . ALA A 1 236 ? 32.547 73.514 -3.059  1.00 68.08  ? 272 ALA A N   1 
ATOM   1896 C CA  . ALA A 1 236 ? 31.251 73.948 -2.548  1.00 65.17  ? 272 ALA A CA  1 
ATOM   1897 C C   . ALA A 1 236 ? 31.312 75.432 -2.164  1.00 70.20  ? 272 ALA A C   1 
ATOM   1898 O O   . ALA A 1 236 ? 30.387 76.184 -2.477  1.00 67.71  ? 272 ALA A O   1 
ATOM   1899 C CB  . ALA A 1 236 ? 30.862 73.103 -1.339  1.00 66.17  ? 272 ALA A CB  1 
ATOM   1900 N N   . GLU A 1 237 ? 32.421 75.847 -1.508  1.00 70.17  ? 273 GLU A N   1 
ATOM   1901 C CA  . GLU A 1 237 ? 32.706 77.225 -1.073  1.00 71.73  ? 273 GLU A CA  1 
ATOM   1902 C C   . GLU A 1 237 ? 32.709 78.181 -2.269  1.00 73.96  ? 273 GLU A C   1 
ATOM   1903 O O   . GLU A 1 237 ? 32.136 79.272 -2.181  1.00 72.54  ? 273 GLU A O   1 
ATOM   1904 C CB  . GLU A 1 237 ? 34.066 77.311 -0.336  1.00 77.61  ? 273 GLU A CB  1 
ATOM   1905 C CG  . GLU A 1 237 ? 34.125 76.567 0.993   1.00 90.38  ? 273 GLU A CG  1 
ATOM   1906 C CD  . GLU A 1 237 ? 34.105 75.049 0.928   1.00 105.61 ? 273 GLU A CD  1 
ATOM   1907 O OE1 . GLU A 1 237 ? 34.603 74.482 -0.073  1.00 86.15  ? 273 GLU A OE1 1 
ATOM   1908 O OE2 . GLU A 1 237 ? 33.562 74.426 1.870   1.00 99.42  ? 273 GLU A OE2 1 
ATOM   1909 N N   . MET A 1 238 ? 33.355 77.753 -3.383  1.00 70.25  ? 274 MET A N   1 
ATOM   1910 C CA  . MET A 1 238 ? 33.469 78.490 -4.639  1.00 69.00  ? 274 MET A CA  1 
ATOM   1911 C C   . MET A 1 238 ? 32.075 78.772 -5.204  1.00 69.86  ? 274 MET A C   1 
ATOM   1912 O O   . MET A 1 238 ? 31.783 79.913 -5.571  1.00 69.33  ? 274 MET A O   1 
ATOM   1913 C CB  . MET A 1 238 ? 34.329 77.713 -5.647  1.00 72.16  ? 274 MET A CB  1 
ATOM   1914 C CG  . MET A 1 238 ? 35.823 77.933 -5.464  1.00 80.05  ? 274 MET A CG  1 
ATOM   1915 S SD  . MET A 1 238 ? 36.806 76.885 -6.566  1.00 85.62  ? 274 MET A SD  1 
ATOM   1916 C CE  . MET A 1 238 ? 38.378 76.912 -5.709  1.00 87.48  ? 274 MET A CE  1 
ATOM   1917 N N   . ALA A 1 239 ? 31.202 77.744 -5.202  1.00 63.59  ? 275 ALA A N   1 
ATOM   1918 C CA  . ALA A 1 239 ? 29.815 77.836 -5.633  1.00 59.62  ? 275 ALA A CA  1 
ATOM   1919 C C   . ALA A 1 239 ? 29.032 78.834 -4.757  1.00 61.74  ? 275 ALA A C   1 
ATOM   1920 O O   . ALA A 1 239 ? 28.361 79.716 -5.297  1.00 61.42  ? 275 ALA A O   1 
ATOM   1921 C CB  . ALA A 1 239 ? 29.168 76.463 -5.592  1.00 58.77  ? 275 ALA A CB  1 
ATOM   1922 N N   . GLU A 1 240 ? 29.157 78.733 -3.426  1.00 58.41  ? 276 GLU A N   1 
ATOM   1923 C CA  . GLU A 1 240 ? 28.471 79.620 -2.481  1.00 58.92  ? 276 GLU A CA  1 
ATOM   1924 C C   . GLU A 1 240 ? 28.818 81.122 -2.705  1.00 67.58  ? 276 GLU A C   1 
ATOM   1925 O O   . GLU A 1 240 ? 27.901 81.941 -2.831  1.00 66.63  ? 276 GLU A O   1 
ATOM   1926 C CB  . GLU A 1 240 ? 28.780 79.217 -1.041  1.00 61.73  ? 276 GLU A CB  1 
ATOM   1927 C CG  . GLU A 1 240 ? 27.936 79.967 -0.033  1.00 67.68  ? 276 GLU A CG  1 
ATOM   1928 C CD  . GLU A 1 240 ? 28.112 79.563 1.413   1.00 85.18  ? 276 GLU A CD  1 
ATOM   1929 O OE1 . GLU A 1 240 ? 28.233 78.348 1.691   1.00 84.61  ? 276 GLU A OE1 1 
ATOM   1930 O OE2 . GLU A 1 240 ? 28.075 80.467 2.276   1.00 79.47  ? 276 GLU A OE2 1 
ATOM   1931 N N   . GLU A 1 241 ? 30.128 81.462 -2.750  1.00 67.91  ? 277 GLU A N   1 
ATOM   1932 C CA  . GLU A 1 241 ? 30.662 82.817 -2.945  1.00 69.91  ? 277 GLU A CA  1 
ATOM   1933 C C   . GLU A 1 241 ? 30.220 83.409 -4.279  1.00 71.15  ? 277 GLU A C   1 
ATOM   1934 O O   . GLU A 1 241 ? 29.791 84.567 -4.324  1.00 71.58  ? 277 GLU A O   1 
ATOM   1935 C CB  . GLU A 1 241 ? 32.194 82.819 -2.858  1.00 74.57  ? 277 GLU A CB  1 
ATOM   1936 C CG  . GLU A 1 241 ? 32.739 82.579 -1.462  1.00 88.41  ? 277 GLU A CG  1 
ATOM   1937 C CD  . GLU A 1 241 ? 34.252 82.638 -1.392  1.00 113.44 ? 277 GLU A CD  1 
ATOM   1938 O OE1 . GLU A 1 241 ? 34.907 81.667 -1.832  1.00 100.32 ? 277 GLU A OE1 1 
ATOM   1939 O OE2 . GLU A 1 241 ? 34.784 83.666 -0.914  1.00 116.43 ? 277 GLU A OE2 1 
ATOM   1940 N N   . ALA A 1 242 ? 30.312 82.608 -5.356  1.00 64.81  ? 278 ALA A N   1 
ATOM   1941 C CA  . ALA A 1 242 ? 29.896 82.989 -6.693  1.00 63.26  ? 278 ALA A CA  1 
ATOM   1942 C C   . ALA A 1 242 ? 28.399 83.361 -6.739  1.00 67.94  ? 278 ALA A C   1 
ATOM   1943 O O   . ALA A 1 242 ? 28.081 84.447 -7.221  1.00 69.03  ? 278 ALA A O   1 
ATOM   1944 C CB  . ALA A 1 242 ? 30.182 81.860 -7.667  1.00 62.65  ? 278 ALA A CB  1 
ATOM   1945 N N   . GLN A 1 243 ? 27.493 82.509 -6.183  1.00 63.21  ? 279 GLN A N   1 
ATOM   1946 C CA  . GLN A 1 243 ? 26.051 82.778 -6.241  1.00 62.13  ? 279 GLN A CA  1 
ATOM   1947 C C   . GLN A 1 243 ? 25.647 83.991 -5.384  1.00 69.34  ? 279 GLN A C   1 
ATOM   1948 O O   . GLN A 1 243 ? 24.716 84.700 -5.776  1.00 69.01  ? 279 GLN A O   1 
ATOM   1949 C CB  . GLN A 1 243 ? 25.196 81.527 -5.910  1.00 60.91  ? 279 GLN A CB  1 
ATOM   1950 C CG  . GLN A 1 243 ? 24.650 81.370 -4.500  1.00 60.37  ? 279 GLN A CG  1 
ATOM   1951 C CD  . GLN A 1 243 ? 23.498 82.274 -4.108  1.00 69.45  ? 279 GLN A CD  1 
ATOM   1952 O OE1 . GLN A 1 243 ? 22.496 82.447 -4.818  1.00 64.07  ? 279 GLN A OE1 1 
ATOM   1953 N NE2 . GLN A 1 243 ? 23.638 82.887 -2.947  1.00 53.43  ? 279 GLN A NE2 1 
ATOM   1954 N N   . GLN A 1 244 ? 26.339 84.228 -4.245  1.00 68.48  ? 280 GLN A N   1 
ATOM   1955 C CA  . GLN A 1 244 ? 26.070 85.327 -3.312  1.00 70.74  ? 280 GLN A CA  1 
ATOM   1956 C C   . GLN A 1 244 ? 26.192 86.708 -3.966  1.00 77.65  ? 280 GLN A C   1 
ATOM   1957 O O   . GLN A 1 244 ? 25.359 87.571 -3.687  1.00 78.76  ? 280 GLN A O   1 
ATOM   1958 C CB  . GLN A 1 244 ? 26.989 85.244 -2.093  1.00 74.52  ? 280 GLN A CB  1 
ATOM   1959 C CG  . GLN A 1 244 ? 26.289 84.658 -0.870  1.00 92.27  ? 280 GLN A CG  1 
ATOM   1960 C CD  . GLN A 1 244 ? 27.232 84.389 0.278   1.00 115.80 ? 280 GLN A CD  1 
ATOM   1961 O OE1 . GLN A 1 244 ? 27.965 85.269 0.750   1.00 116.04 ? 280 GLN A OE1 1 
ATOM   1962 N NE2 . GLN A 1 244 ? 27.195 83.172 0.790   1.00 104.78 ? 280 GLN A NE2 1 
ATOM   1963 N N   . GLN A 1 245 ? 27.186 86.911 -4.852  1.00 75.21  ? 281 GLN A N   1 
ATOM   1964 C CA  . GLN A 1 245 ? 27.358 88.207 -5.514  1.00 77.09  ? 281 GLN A CA  1 
ATOM   1965 C C   . GLN A 1 245 ? 26.727 88.228 -6.922  1.00 77.70  ? 281 GLN A C   1 
ATOM   1966 O O   . GLN A 1 245 ? 26.435 89.314 -7.426  1.00 79.60  ? 281 GLN A O   1 
ATOM   1967 C CB  . GLN A 1 245 ? 28.838 88.630 -5.557  1.00 81.48  ? 281 GLN A CB  1 
ATOM   1968 C CG  . GLN A 1 245 ? 29.744 87.774 -6.447  1.00 99.53  ? 281 GLN A CG  1 
ATOM   1969 C CD  . GLN A 1 245 ? 29.794 88.210 -7.897  1.00 113.37 ? 281 GLN A CD  1 
ATOM   1970 O OE1 . GLN A 1 245 ? 29.947 89.393 -8.218  1.00 107.65 ? 281 GLN A OE1 1 
ATOM   1971 N NE2 . GLN A 1 245 ? 29.668 87.253 -8.806  1.00 103.78 ? 281 GLN A NE2 1 
ATOM   1972 N N   . ALA A 1 246 ? 26.538 87.053 -7.562  1.00 69.73  ? 282 ALA A N   1 
ATOM   1973 C CA  . ALA A 1 246 ? 25.936 86.989 -8.901  1.00 67.22  ? 282 ALA A CA  1 
ATOM   1974 C C   . ALA A 1 246 ? 24.390 86.964 -8.832  1.00 69.90  ? 282 ALA A C   1 
ATOM   1975 O O   . ALA A 1 246 ? 23.729 87.118 -9.864  1.00 68.31  ? 282 ALA A O   1 
ATOM   1976 C CB  . ALA A 1 246 ? 26.458 85.788 -9.674  1.00 65.58  ? 282 ALA A CB  1 
ATOM   1977 N N   . ASP A 1 247 ? 23.808 86.811 -7.622  1.00 67.03  ? 283 ASP A N   1 
ATOM   1978 C CA  . ASP A 1 247 ? 22.350 86.816 -7.509  1.00 66.09  ? 283 ASP A CA  1 
ATOM   1979 C C   . ASP A 1 247 ? 21.797 88.228 -7.675  1.00 74.87  ? 283 ASP A C   1 
ATOM   1980 O O   . ASP A 1 247 ? 22.236 89.164 -6.997  1.00 76.98  ? 283 ASP A O   1 
ATOM   1981 C CB  . ASP A 1 247 ? 21.852 86.200 -6.202  1.00 66.23  ? 283 ASP A CB  1 
ATOM   1982 C CG  . ASP A 1 247 ? 20.369 85.888 -6.265  1.00 67.09  ? 283 ASP A CG  1 
ATOM   1983 O OD1 . ASP A 1 247 ? 19.915 85.361 -7.314  1.00 62.96  ? 283 ASP A OD1 1 
ATOM   1984 O OD2 . ASP A 1 247 ? 19.652 86.219 -5.293  1.00 71.23  ? 283 ASP A OD2 1 
ATOM   1985 N N   . GLY A 1 248 ? 20.852 88.356 -8.598  1.00 72.71  ? 284 GLY A N   1 
ATOM   1986 C CA  . GLY A 1 248 ? 20.215 89.625 -8.920  1.00 75.98  ? 284 GLY A CA  1 
ATOM   1987 C C   . GLY A 1 248 ? 21.066 90.512 -9.802  1.00 82.67  ? 284 GLY A C   1 
ATOM   1988 O O   . GLY A 1 248 ? 20.778 91.702 -9.940  1.00 85.74  ? 284 GLY A O   1 
ATOM   1989 N N   . LEU A 1 249 ? 22.114 89.934 -10.417 1.00 78.79  ? 285 LEU A N   1 
ATOM   1990 C CA  . LEU A 1 249 ? 23.031 90.642 -11.311 1.00 80.66  ? 285 LEU A CA  1 
ATOM   1991 C C   . LEU A 1 249 ? 22.313 90.981 -12.615 1.00 85.51  ? 285 LEU A C   1 
ATOM   1992 O O   . LEU A 1 249 ? 21.723 90.098 -13.243 1.00 82.37  ? 285 LEU A O   1 
ATOM   1993 C CB  . LEU A 1 249 ? 24.298 89.787 -11.568 1.00 79.08  ? 285 LEU A CB  1 
ATOM   1994 C CG  . LEU A 1 249 ? 25.550 90.395 -12.242 1.00 85.58  ? 285 LEU A CG  1 
ATOM   1995 C CD1 . LEU A 1 249 ? 25.551 90.171 -13.742 1.00 87.86  ? 285 LEU A CD1 1 
ATOM   1996 C CD2 . LEU A 1 249 ? 25.786 91.851 -11.863 1.00 89.53  ? 285 LEU A CD2 1 
ATOM   1997 N N   . SER A 1 250 ? 22.354 92.273 -13.000 1.00 85.87  ? 286 SER A N   1 
ATOM   1998 C CA  . SER A 1 250 ? 21.747 92.782 -14.227 1.00 87.55  ? 286 SER A CA  1 
ATOM   1999 C C   . SER A 1 250 ? 22.577 92.342 -15.428 1.00 89.54  ? 286 SER A C   1 
ATOM   2000 O O   . SER A 1 250 ? 23.784 92.594 -15.472 1.00 90.16  ? 286 SER A O   1 
ATOM   2001 C CB  . SER A 1 250 ? 21.626 94.305 -14.174 1.00 96.03  ? 286 SER A CB  1 
ATOM   2002 O OG  . SER A 1 250 ? 20.873 94.821 -15.260 1.00 107.52 ? 286 SER A OG  1 
ATOM   2003 N N   . LEU A 1 251 ? 21.938 91.639 -16.370 1.00 83.85  ? 287 LEU A N   1 
ATOM   2004 C CA  . LEU A 1 251 ? 22.562 91.147 -17.596 1.00 83.41  ? 287 LEU A CA  1 
ATOM   2005 C C   . LEU A 1 251 ? 21.519 91.170 -18.697 1.00 89.09  ? 287 LEU A C   1 
ATOM   2006 O O   . LEU A 1 251 ? 20.558 90.401 -18.649 1.00 86.86  ? 287 LEU A O   1 
ATOM   2007 C CB  . LEU A 1 251 ? 23.154 89.739 -17.404 1.00 79.90  ? 287 LEU A CB  1 
ATOM   2008 C CG  . LEU A 1 251 ? 23.964 89.205 -18.584 1.00 84.64  ? 287 LEU A CG  1 
ATOM   2009 C CD1 . LEU A 1 251 ? 25.336 88.766 -18.147 1.00 83.61  ? 287 LEU A CD1 1 
ATOM   2010 C CD2 . LEU A 1 251 ? 23.234 88.087 -19.280 1.00 84.67  ? 287 LEU A CD2 1 
ATOM   2011 N N   . GLY A 1 252 ? 21.708 92.070 -19.660 1.00 89.73  ? 288 GLY A N   1 
ATOM   2012 C CA  . GLY A 1 252 ? 20.777 92.262 -20.764 1.00 92.20  ? 288 GLY A CA  1 
ATOM   2013 C C   . GLY A 1 252 ? 19.535 92.967 -20.268 1.00 98.29  ? 288 GLY A C   1 
ATOM   2014 O O   . GLY A 1 252 ? 19.633 93.991 -19.588 1.00 99.46  ? 288 GLY A O   1 
ATOM   2015 N N   . GLY A 1 253 ? 18.381 92.383 -20.548 1.00 95.97  ? 289 GLY A N   1 
ATOM   2016 C CA  . GLY A 1 253 ? 17.104 92.950 -20.129 1.00 98.62  ? 289 GLY A CA  1 
ATOM   2017 C C   . GLY A 1 253 ? 16.500 92.414 -18.843 1.00 100.99 ? 289 GLY A C   1 
ATOM   2018 O O   . GLY A 1 253 ? 15.329 92.707 -18.575 1.00 102.52 ? 289 GLY A O   1 
ATOM   2019 N N   . SER A 1 254 ? 17.271 91.627 -18.027 1.00 93.67  ? 290 SER A N   1 
ATOM   2020 C CA  . SER A 1 254 ? 16.736 91.047 -16.781 1.00 90.83  ? 290 SER A CA  1 
ATOM   2021 C C   . SER A 1 254 ? 17.791 90.673 -15.719 1.00 90.68  ? 290 SER A C   1 
ATOM   2022 O O   . SER A 1 254 ? 18.871 90.174 -16.051 1.00 88.06  ? 290 SER A O   1 
ATOM   2023 C CB  . SER A 1 254 ? 15.910 89.797 -17.082 1.00 93.38  ? 290 SER A CB  1 
ATOM   2024 O OG  . SER A 1 254 ? 16.665 88.833 -17.796 1.00 102.37 ? 290 SER A OG  1 
ATOM   2025 N N   . HIS A 1 255 ? 17.418 90.859 -14.424 1.00 85.66  ? 291 HIS A N   1 
ATOM   2026 C CA  . HIS A 1 255 ? 18.230 90.505 -13.260 1.00 82.49  ? 291 HIS A CA  1 
ATOM   2027 C C   . HIS A 1 255 ? 18.243 88.989 -13.147 1.00 81.01  ? 291 HIS A C   1 
ATOM   2028 O O   . HIS A 1 255 ? 17.188 88.375 -12.946 1.00 79.40  ? 291 HIS A O   1 
ATOM   2029 C CB  . HIS A 1 255 ? 17.686 91.145 -11.960 1.00 84.38  ? 291 HIS A CB  1 
ATOM   2030 C CG  . HIS A 1 255 ? 17.650 92.642 -11.950 1.00 92.07  ? 291 HIS A CG  1 
ATOM   2031 N ND1 . HIS A 1 255 ? 16.454 93.336 -12.057 1.00 96.67  ? 291 HIS A ND1 1 
ATOM   2032 C CD2 . HIS A 1 255 ? 18.657 93.531 -11.796 1.00 95.93  ? 291 HIS A CD2 1 
ATOM   2033 C CE1 . HIS A 1 255 ? 16.775 94.617 -11.990 1.00 99.85  ? 291 HIS A CE1 1 
ATOM   2034 N NE2 . HIS A 1 255 ? 18.089 94.784 -11.834 1.00 99.94  ? 291 HIS A NE2 1 
ATOM   2035 N N   . LEU A 1 256 ? 19.424 88.382 -13.319 1.00 75.07  ? 292 LEU A N   1 
ATOM   2036 C CA  . LEU A 1 256 ? 19.584 86.927 -13.283 1.00 70.93  ? 292 LEU A CA  1 
ATOM   2037 C C   . LEU A 1 256 ? 19.356 86.356 -11.910 1.00 68.83  ? 292 LEU A C   1 
ATOM   2038 O O   . LEU A 1 256 ? 19.813 86.912 -10.908 1.00 68.55  ? 292 LEU A O   1 
ATOM   2039 C CB  . LEU A 1 256 ? 20.973 86.476 -13.769 1.00 70.77  ? 292 LEU A CB  1 
ATOM   2040 C CG  . LEU A 1 256 ? 21.493 86.999 -15.099 1.00 78.06  ? 292 LEU A CG  1 
ATOM   2041 C CD1 . LEU A 1 256 ? 22.888 86.465 -15.355 1.00 78.07  ? 292 LEU A CD1 1 
ATOM   2042 C CD2 . LEU A 1 256 ? 20.545 86.664 -16.261 1.00 80.65  ? 292 LEU A CD2 1 
ATOM   2043 N N   . ARG A 1 257 ? 18.664 85.222 -11.876 1.00 61.69  ? 293 ARG A N   1 
ATOM   2044 C CA  . ARG A 1 257 ? 18.423 84.475 -10.647 1.00 58.33  ? 293 ARG A CA  1 
ATOM   2045 C C   . ARG A 1 257 ? 19.393 83.311 -10.630 1.00 58.49  ? 293 ARG A C   1 
ATOM   2046 O O   . ARG A 1 257 ? 19.444 82.541 -11.596 1.00 57.38  ? 293 ARG A O   1 
ATOM   2047 C CB  . ARG A 1 257 ? 16.966 84.013 -10.552 1.00 55.34  ? 293 ARG A CB  1 
ATOM   2048 C CG  . ARG A 1 257 ? 16.606 83.386 -9.201  1.00 55.45  ? 293 ARG A CG  1 
ATOM   2049 C CD  . ARG A 1 257 ? 15.117 83.156 -9.081  1.00 55.06  ? 293 ARG A CD  1 
ATOM   2050 N NE  . ARG A 1 257 ? 14.635 82.170 -10.048 1.00 47.55  ? 293 ARG A NE  1 
ATOM   2051 C CZ  . ARG A 1 257 ? 13.409 81.665 -10.065 1.00 56.92  ? 293 ARG A CZ  1 
ATOM   2052 N NH1 . ARG A 1 257 ? 12.500 82.081 -9.192  1.00 43.54  ? 293 ARG A NH1 1 
ATOM   2053 N NH2 . ARG A 1 257 ? 13.072 80.761 -10.973 1.00 47.35  ? 293 ARG A NH2 1 
ATOM   2054 N N   . VAL A 1 258 ? 20.214 83.226 -9.579  1.00 53.95  ? 294 VAL A N   1 
ATOM   2055 C CA  . VAL A 1 258 ? 21.192 82.142 -9.479  1.00 52.78  ? 294 VAL A CA  1 
ATOM   2056 C C   . VAL A 1 258 ? 20.899 81.388 -8.179  1.00 52.40  ? 294 VAL A C   1 
ATOM   2057 O O   . VAL A 1 258 ? 20.725 81.963 -7.099  1.00 52.18  ? 294 VAL A O   1 
ATOM   2058 C CB  . VAL A 1 258 ? 22.680 82.563 -9.681  1.00 59.20  ? 294 VAL A CB  1 
ATOM   2059 C CG1 . VAL A 1 258 ? 23.165 83.510 -8.595  1.00 61.10  ? 294 VAL A CG1 1 
ATOM   2060 C CG2 . VAL A 1 258 ? 23.599 81.343 -9.801  1.00 58.29  ? 294 VAL A CG2 1 
ATOM   2061 N N   . SER A 1 259 ? 20.732 80.097 -8.336  1.00 48.01  ? 295 SER A N   1 
ATOM   2062 C CA  . SER A 1 259 ? 20.298 79.222 -7.252  1.00 46.67  ? 295 SER A CA  1 
ATOM   2063 C C   . SER A 1 259 ? 21.149 77.985 -7.157  1.00 50.62  ? 295 SER A C   1 
ATOM   2064 O O   . SER A 1 259 ? 21.783 77.598 -8.132  1.00 48.56  ? 295 SER A O   1 
ATOM   2065 C CB  . SER A 1 259 ? 18.849 78.804 -7.490  1.00 46.56  ? 295 SER A CB  1 
ATOM   2066 O OG  . SER A 1 259 ? 18.040 79.888 -7.910  1.00 52.58  ? 295 SER A OG  1 
ATOM   2067 N N   . PHE A 1 260 ? 21.101 77.322 -5.996  1.00 47.85  ? 296 PHE A N   1 
ATOM   2068 C CA  . PHE A 1 260 ? 21.824 76.087 -5.808  1.00 47.72  ? 296 PHE A CA  1 
ATOM   2069 C C   . PHE A 1 260 ? 21.021 74.898 -6.344  1.00 51.99  ? 296 PHE A C   1 
ATOM   2070 O O   . PHE A 1 260 ? 19.819 74.776 -6.077  1.00 51.58  ? 296 PHE A O   1 
ATOM   2071 C CB  . PHE A 1 260 ? 22.147 75.877 -4.315  1.00 49.44  ? 296 PHE A CB  1 
ATOM   2072 C CG  . PHE A 1 260 ? 23.117 76.864 -3.700  1.00 52.35  ? 296 PHE A CG  1 
ATOM   2073 C CD1 . PHE A 1 260 ? 24.490 76.690 -3.832  1.00 56.31  ? 296 PHE A CD1 1 
ATOM   2074 C CD2 . PHE A 1 260 ? 22.658 77.933 -2.938  1.00 54.86  ? 296 PHE A CD2 1 
ATOM   2075 C CE1 . PHE A 1 260 ? 25.388 77.590 -3.250  1.00 59.25  ? 296 PHE A CE1 1 
ATOM   2076 C CE2 . PHE A 1 260 ? 23.557 78.812 -2.320  1.00 60.05  ? 296 PHE A CE2 1 
ATOM   2077 C CZ  . PHE A 1 260 ? 24.919 78.631 -2.478  1.00 59.61  ? 296 PHE A CZ  1 
ATOM   2078 N N   . CYS A 1 261 ? 21.706 73.997 -7.065  1.00 48.06  ? 297 CYS A N   1 
ATOM   2079 C CA  . CYS A 1 261 ? 21.155 72.729 -7.529  1.00 46.05  ? 297 CYS A CA  1 
ATOM   2080 C C   . CYS A 1 261 ? 21.216 71.724 -6.375  1.00 50.83  ? 297 CYS A C   1 
ATOM   2081 O O   . CYS A 1 261 ? 22.054 71.890 -5.486  1.00 51.04  ? 297 CYS A O   1 
ATOM   2082 C CB  . CYS A 1 261 ? 21.955 72.214 -8.724  1.00 46.45  ? 297 CYS A CB  1 
ATOM   2083 S SG  . CYS A 1 261 ? 21.771 73.186 -10.241 1.00 50.00  ? 297 CYS A SG  1 
ATOM   2084 N N   . ALA A 1 262 ? 20.413 70.627 -6.433  1.00 46.78  ? 298 ALA A N   1 
ATOM   2085 C CA  . ALA A 1 262 ? 20.524 69.523 -5.466  1.00 46.12  ? 298 ALA A CA  1 
ATOM   2086 C C   . ALA A 1 262 ? 21.961 68.991 -5.512  1.00 49.87  ? 298 ALA A C   1 
ATOM   2087 O O   . ALA A 1 262 ? 22.477 68.831 -6.622  1.00 49.61  ? 298 ALA A O   1 
ATOM   2088 C CB  . ALA A 1 262 ? 19.536 68.424 -5.807  1.00 46.09  ? 298 ALA A CB  1 
ATOM   2089 N N   . PRO A 1 263 ? 22.654 68.807 -4.352  1.00 46.83  ? 299 PRO A N   1 
ATOM   2090 C CA  . PRO A 1 263 ? 24.076 68.381 -4.383  1.00 49.25  ? 299 PRO A CA  1 
ATOM   2091 C C   . PRO A 1 263 ? 24.296 66.931 -4.794  1.00 56.26  ? 299 PRO A C   1 
ATOM   2092 O O   . PRO A 1 263 ? 23.432 66.091 -4.578  1.00 56.14  ? 299 PRO A O   1 
ATOM   2093 C CB  . PRO A 1 263 ? 24.539 68.565 -2.927  1.00 51.69  ? 299 PRO A CB  1 
ATOM   2094 C CG  . PRO A 1 263 ? 23.311 68.463 -2.117  1.00 53.96  ? 299 PRO A CG  1 
ATOM   2095 C CD  . PRO A 1 263 ? 22.175 68.985 -2.967  1.00 47.37  ? 299 PRO A CD  1 
ATOM   2096 N N   . GLY A 1 264 ? 25.466 66.644 -5.339  1.00 56.12  ? 300 GLY A N   1 
ATOM   2097 C CA  . GLY A 1 264 ? 25.815 65.281 -5.722  1.00 58.61  ? 300 GLY A CA  1 
ATOM   2098 C C   . GLY A 1 264 ? 26.118 65.082 -7.190  1.00 65.00  ? 300 GLY A C   1 
ATOM   2099 O O   . GLY A 1 264 ? 27.282 64.851 -7.521  1.00 68.91  ? 300 GLY A O   1 
ATOM   2100 N N   . PRO A 1 265 ? 25.113 65.148 -8.113  1.00 59.33  ? 301 PRO A N   1 
ATOM   2101 C CA  . PRO A 1 265 ? 25.416 64.918 -9.535  1.00 60.07  ? 301 PRO A CA  1 
ATOM   2102 C C   . PRO A 1 265 ? 26.275 66.020 -10.148 1.00 63.96  ? 301 PRO A C   1 
ATOM   2103 O O   . PRO A 1 265 ? 26.076 67.189 -9.814  1.00 60.98  ? 301 PRO A O   1 
ATOM   2104 C CB  . PRO A 1 265 ? 24.031 64.873 -10.193 1.00 59.25  ? 301 PRO A CB  1 
ATOM   2105 C CG  . PRO A 1 265 ? 23.062 64.630 -9.054  1.00 61.41  ? 301 PRO A CG  1 
ATOM   2106 C CD  . PRO A 1 265 ? 23.666 65.400 -7.930  1.00 56.98  ? 301 PRO A CD  1 
ATOM   2107 N N   . PRO A 1 266 ? 27.229 65.670 -11.051 1.00 64.54  ? 302 PRO A N   1 
ATOM   2108 C CA  . PRO A 1 266 ? 28.049 66.721 -11.699 1.00 65.29  ? 302 PRO A CA  1 
ATOM   2109 C C   . PRO A 1 266 ? 27.223 67.595 -12.658 1.00 69.20  ? 302 PRO A C   1 
ATOM   2110 O O   . PRO A 1 266 ? 26.097 67.230 -13.007 1.00 67.93  ? 302 PRO A O   1 
ATOM   2111 C CB  . PRO A 1 266 ? 29.125 65.926 -12.447 1.00 70.60  ? 302 PRO A CB  1 
ATOM   2112 C CG  . PRO A 1 266 ? 28.522 64.591 -12.689 1.00 75.70  ? 302 PRO A CG  1 
ATOM   2113 C CD  . PRO A 1 266 ? 27.583 64.320 -11.542 1.00 69.01  ? 302 PRO A CD  1 
ATOM   2114 N N   . GLY A 1 267 ? 27.786 68.734 -13.063 1.00 66.84  ? 303 GLY A N   1 
ATOM   2115 C CA  . GLY A 1 267 ? 27.167 69.702 -13.972 1.00 65.76  ? 303 GLY A CA  1 
ATOM   2116 C C   . GLY A 1 267 ? 26.393 69.112 -15.133 1.00 69.77  ? 303 GLY A C   1 
ATOM   2117 O O   . GLY A 1 267 ? 25.275 69.550 -15.417 1.00 67.63  ? 303 GLY A O   1 
ATOM   2118 N N   . ARG A 1 268 ? 26.975 68.095 -15.791 1.00 68.91  ? 304 ARG A N   1 
ATOM   2119 C CA  . ARG A 1 268 ? 26.402 67.390 -16.941 1.00 70.15  ? 304 ARG A CA  1 
ATOM   2120 C C   . ARG A 1 268 ? 25.135 66.608 -16.557 1.00 70.79  ? 304 ARG A C   1 
ATOM   2121 O O   . ARG A 1 268 ? 24.144 66.657 -17.289 1.00 69.32  ? 304 ARG A O   1 
ATOM   2122 C CB  . ARG A 1 268 ? 27.453 66.435 -17.555 1.00 74.70  ? 304 ARG A CB  1 
ATOM   2123 C CG  . ARG A 1 268 ? 27.081 65.876 -18.929 1.00 90.62  ? 304 ARG A CG  1 
ATOM   2124 C CD  . ARG A 1 268 ? 26.543 64.455 -18.863 1.00 106.91 ? 304 ARG A CD  1 
ATOM   2125 N NE  . ARG A 1 268 ? 25.690 64.147 -20.015 1.00 122.06 ? 304 ARG A NE  1 
ATOM   2126 C CZ  . ARG A 1 268 ? 24.540 63.482 -19.949 1.00 136.55 ? 304 ARG A CZ  1 
ATOM   2127 N NH1 . ARG A 1 268 ? 23.836 63.253 -21.050 1.00 126.10 ? 304 ARG A NH1 1 
ATOM   2128 N NH2 . ARG A 1 268 ? 24.084 63.039 -18.782 1.00 120.32 ? 304 ARG A NH2 1 
ATOM   2129 N N   . SER A 1 269 ? 25.216 65.830 -15.460 1.00 66.50  ? 305 SER A N   1 
ATOM   2130 C CA  . SER A 1 269 ? 24.149 64.973 -14.953 1.00 65.06  ? 305 SER A CA  1 
ATOM   2131 C C   . SER A 1 269 ? 22.967 65.803 -14.422 1.00 63.76  ? 305 SER A C   1 
ATOM   2132 O O   . SER A 1 269 ? 21.823 65.384 -14.604 1.00 63.35  ? 305 SER A O   1 
ATOM   2133 C CB  . SER A 1 269 ? 24.693 64.046 -13.874 1.00 71.39  ? 305 SER A CB  1 
ATOM   2134 O OG  . SER A 1 269 ? 23.683 63.238 -13.289 1.00 83.77  ? 305 SER A OG  1 
ATOM   2135 N N   . MET A 1 270 ? 23.237 66.971 -13.792 1.00 56.68  ? 306 MET A N   1 
ATOM   2136 C CA  . MET A 1 270 ? 22.194 67.867 -13.296 1.00 53.93  ? 306 MET A CA  1 
ATOM   2137 C C   . MET A 1 270 ? 21.476 68.564 -14.471 1.00 60.48  ? 306 MET A C   1 
ATOM   2138 O O   . MET A 1 270 ? 20.258 68.757 -14.412 1.00 58.93  ? 306 MET A O   1 
ATOM   2139 C CB  . MET A 1 270 ? 22.763 68.900 -12.318 1.00 54.55  ? 306 MET A CB  1 
ATOM   2140 C CG  . MET A 1 270 ? 21.685 69.754 -11.628 1.00 54.98  ? 306 MET A CG  1 
ATOM   2141 S SD  . MET A 1 270 ? 20.309 68.836 -10.843 1.00 56.41  ? 306 MET A SD  1 
ATOM   2142 C CE  . MET A 1 270 ? 21.232 67.821 -9.617  1.00 52.29  ? 306 MET A CE  1 
ATOM   2143 N N   . LEU A 1 271 ? 22.224 68.917 -15.542 1.00 58.98  ? 307 LEU A N   1 
ATOM   2144 C CA  . LEU A 1 271 ? 21.651 69.566 -16.726 1.00 59.57  ? 307 LEU A CA  1 
ATOM   2145 C C   . LEU A 1 271 ? 20.611 68.657 -17.389 1.00 64.61  ? 307 LEU A C   1 
ATOM   2146 O O   . LEU A 1 271 ? 19.482 69.093 -17.618 1.00 63.63  ? 307 LEU A O   1 
ATOM   2147 C CB  . LEU A 1 271 ? 22.751 69.966 -17.731 1.00 61.79  ? 307 LEU A CB  1 
ATOM   2148 C CG  . LEU A 1 271 ? 22.293 70.684 -19.002 1.00 67.51  ? 307 LEU A CG  1 
ATOM   2149 C CD1 . LEU A 1 271 ? 22.024 72.162 -18.744 1.00 66.46  ? 307 LEU A CD1 1 
ATOM   2150 C CD2 . LEU A 1 271 ? 23.288 70.484 -20.131 1.00 71.48  ? 307 LEU A CD2 1 
ATOM   2151 N N   . ALA A 1 272 ? 20.981 67.391 -17.653 1.00 62.80  ? 308 ALA A N   1 
ATOM   2152 C CA  . ALA A 1 272 ? 20.100 66.410 -18.283 1.00 62.97  ? 308 ALA A CA  1 
ATOM   2153 C C   . ALA A 1 272 ? 18.850 66.125 -17.443 1.00 62.92  ? 308 ALA A C   1 
ATOM   2154 O O   . ALA A 1 272 ? 17.771 65.985 -18.015 1.00 63.67  ? 308 ALA A O   1 
ATOM   2155 C CB  . ALA A 1 272 ? 20.855 65.120 -18.542 1.00 66.07  ? 308 ALA A CB  1 
ATOM   2156 N N   . ALA A 1 273 ? 18.994 66.031 -16.098 1.00 55.32  ? 309 ALA A N   1 
ATOM   2157 C CA  . ALA A 1 273 ? 17.907 65.733 -15.173 1.00 53.20  ? 309 ALA A CA  1 
ATOM   2158 C C   . ALA A 1 273 ? 16.885 66.861 -15.126 1.00 54.03  ? 309 ALA A C   1 
ATOM   2159 O O   . ALA A 1 273 ? 15.690 66.577 -15.121 1.00 54.03  ? 309 ALA A O   1 
ATOM   2160 C CB  . ALA A 1 273 ? 18.459 65.475 -13.770 1.00 52.82  ? 309 ALA A CB  1 
ATOM   2161 N N   . LEU A 1 274 ? 17.355 68.125 -15.105 1.00 49.68  ? 310 LEU A N   1 
ATOM   2162 C CA  . LEU A 1 274 ? 16.533 69.329 -15.042 1.00 49.36  ? 310 LEU A CA  1 
ATOM   2163 C C   . LEU A 1 274 ? 15.767 69.539 -16.360 1.00 56.43  ? 310 LEU A C   1 
ATOM   2164 O O   . LEU A 1 274 ? 14.659 70.073 -16.345 1.00 54.50  ? 310 LEU A O   1 
ATOM   2165 C CB  . LEU A 1 274 ? 17.393 70.563 -14.695 1.00 49.02  ? 310 LEU A CB  1 
ATOM   2166 C CG  . LEU A 1 274 ? 17.841 70.745 -13.219 1.00 51.29  ? 310 LEU A CG  1 
ATOM   2167 C CD1 . LEU A 1 274 ? 18.674 72.009 -13.052 1.00 49.97  ? 310 LEU A CD1 1 
ATOM   2168 C CD2 . LEU A 1 274 ? 16.648 70.818 -12.251 1.00 52.31  ? 310 LEU A CD2 1 
ATOM   2169 N N   . ILE A 1 275 ? 16.349 69.088 -17.492 1.00 56.38  ? 311 ILE A N   1 
ATOM   2170 C CA  . ILE A 1 275 ? 15.719 69.145 -18.808 1.00 58.35  ? 311 ILE A CA  1 
ATOM   2171 C C   . ILE A 1 275 ? 14.656 68.033 -18.831 1.00 61.94  ? 311 ILE A C   1 
ATOM   2172 O O   . ILE A 1 275 ? 13.520 68.283 -19.249 1.00 61.36  ? 311 ILE A O   1 
ATOM   2173 C CB  . ILE A 1 275 ? 16.785 69.060 -19.952 1.00 64.12  ? 311 ILE A CB  1 
ATOM   2174 C CG1 . ILE A 1 275 ? 17.536 70.413 -20.070 1.00 64.34  ? 311 ILE A CG1 1 
ATOM   2175 C CG2 . ILE A 1 275 ? 16.156 68.673 -21.301 1.00 67.80  ? 311 ILE A CG2 1 
ATOM   2176 C CD1 . ILE A 1 275 ? 18.904 70.379 -20.742 1.00 75.69  ? 311 ILE A CD1 1 
ATOM   2177 N N   . ALA A 1 276 ? 14.996 66.840 -18.294 1.00 58.42  ? 312 ALA A N   1 
ATOM   2178 C CA  . ALA A 1 276 ? 14.054 65.718 -18.213 1.00 59.95  ? 312 ALA A CA  1 
ATOM   2179 C C   . ALA A 1 276 ? 12.908 66.025 -17.230 1.00 63.60  ? 312 ALA A C   1 
ATOM   2180 O O   . ALA A 1 276 ? 11.821 65.464 -17.370 1.00 64.56  ? 312 ALA A O   1 
ATOM   2181 C CB  . ALA A 1 276 ? 14.773 64.449 -17.802 1.00 61.38  ? 312 ALA A CB  1 
ATOM   2182 N N   . ALA A 1 277 ? 13.154 66.926 -16.251 1.00 58.57  ? 313 ALA A N   1 
ATOM   2183 C CA  . ALA A 1 277 ? 12.142 67.371 -15.295 1.00 56.70  ? 313 ALA A CA  1 
ATOM   2184 C C   . ALA A 1 277 ? 11.042 68.185 -16.022 1.00 63.06  ? 313 ALA A C   1 
ATOM   2185 O O   . ALA A 1 277 ? 9.863  68.059 -15.682 1.00 61.90  ? 313 ALA A O   1 
ATOM   2186 C CB  . ALA A 1 277 ? 12.789 68.199 -14.192 1.00 55.08  ? 313 ALA A CB  1 
ATOM   2187 N N   . GLN A 1 278 ? 11.427 68.956 -17.061 1.00 62.88  ? 314 GLN A N   1 
ATOM   2188 C CA  . GLN A 1 278 ? 10.515 69.786 -17.855 1.00 65.78  ? 314 GLN A CA  1 
ATOM   2189 C C   . GLN A 1 278 ? 9.930  69.042 -19.078 1.00 76.10  ? 314 GLN A C   1 
ATOM   2190 O O   . GLN A 1 278 ? 9.210  69.659 -19.863 1.00 78.58  ? 314 GLN A O   1 
ATOM   2191 C CB  . GLN A 1 278 ? 11.238 71.055 -18.334 1.00 67.80  ? 314 GLN A CB  1 
ATOM   2192 C CG  . GLN A 1 278 ? 11.514 72.075 -17.236 1.00 79.89  ? 314 GLN A CG  1 
ATOM   2193 C CD  . GLN A 1 278 ? 12.222 73.308 -17.750 1.00 98.48  ? 314 GLN A CD  1 
ATOM   2194 O OE1 . GLN A 1 278 ? 12.149 73.667 -18.934 1.00 95.17  ? 314 GLN A OE1 1 
ATOM   2195 N NE2 . GLN A 1 278 ? 12.914 74.002 -16.856 1.00 89.78  ? 314 GLN A NE2 1 
ATOM   2196 N N   . ALA A 1 279 ? 10.234 67.737 -19.248 1.00 75.22  ? 315 ALA A N   1 
ATOM   2197 C CA  . ALA A 1 279 ? 9.753  66.957 -20.393 1.00 79.70  ? 315 ALA A CA  1 
ATOM   2198 C C   . ALA A 1 279 ? 8.260  66.625 -20.272 1.00 86.76  ? 315 ALA A C   1 
ATOM   2199 O O   . ALA A 1 279 ? 7.799  66.223 -19.201 1.00 84.69  ? 315 ALA A O   1 
ATOM   2200 C CB  . ALA A 1 279 ? 10.564 65.679 -20.548 1.00 81.25  ? 315 ALA A CB  1 
ATOM   2201 N N   . THR A 1 280 ? 7.516  66.792 -21.387 1.00 87.56  ? 316 THR A N   1 
ATOM   2202 C CA  . THR A 1 280 ? 6.075  66.535 -21.459 1.00 120.33 ? 316 THR A CA  1 
ATOM   2203 C C   . THR A 1 280 ? 5.806  65.187 -22.134 1.00 153.76 ? 316 THR A C   1 
ATOM   2204 O O   . THR A 1 280 ? 6.312  64.922 -23.222 1.00 119.51 ? 316 THR A O   1 
ATOM   2205 C CB  . THR A 1 280 ? 5.355  67.680 -22.191 1.00 131.45 ? 316 THR A CB  1 
ATOM   2206 O OG1 . THR A 1 280 ? 5.923  67.843 -23.493 1.00 134.29 ? 316 THR A OG1 1 
ATOM   2207 C CG2 . THR A 1 280 ? 5.414  68.997 -21.423 1.00 127.38 ? 316 THR A CG2 1 
HETATM 2208 S S   . SO4 B 2 .   ? 30.095 30.583 9.697   1.00 86.96  ? 1   SO4 A S   1 
HETATM 2209 O O1  . SO4 B 2 .   ? 30.755 29.444 9.021   1.00 92.22  ? 1   SO4 A O1  1 
HETATM 2210 O O2  . SO4 B 2 .   ? 28.820 30.868 8.995   1.00 90.82  ? 1   SO4 A O2  1 
HETATM 2211 O O3  . SO4 B 2 .   ? 29.830 30.232 11.102  1.00 92.30  ? 1   SO4 A O3  1 
HETATM 2212 O O4  . SO4 B 2 .   ? 31.003 31.762 9.658   1.00 91.49  ? 1   SO4 A O4  1 
HETATM 2213 S S   . SO4 C 2 .   ? 12.342 53.668 15.671  1.00 68.81  ? 2   SO4 A S   1 
HETATM 2214 O O1  . SO4 C 2 .   ? 12.983 54.325 14.540  1.00 74.06  ? 2   SO4 A O1  1 
HETATM 2215 O O2  . SO4 C 2 .   ? 11.723 52.414 15.215  1.00 72.18  ? 2   SO4 A O2  1 
HETATM 2216 O O3  . SO4 C 2 .   ? 13.346 53.358 16.714  1.00 72.88  ? 2   SO4 A O3  1 
HETATM 2217 O O4  . SO4 C 2 .   ? 11.332 54.611 16.222  1.00 74.94  ? 2   SO4 A O4  1 
HETATM 2218 O O   . HOH D 3 .   ? 17.338 57.171 -1.024  1.00 34.07  ? 400 HOH A O   1 
HETATM 2219 O O   . HOH D 3 .   ? 7.865  62.454 11.367  1.00 47.52  ? 401 HOH A O   1 
HETATM 2220 O O   . HOH D 3 .   ? 14.221 82.337 6.338   1.00 47.27  ? 402 HOH A O   1 
HETATM 2221 O O   . HOH D 3 .   ? 15.153 47.275 8.542   1.00 43.74  ? 403 HOH A O   1 
HETATM 2222 O O   . HOH D 3 .   ? 24.596 46.411 24.769  1.00 41.83  ? 404 HOH A O   1 
HETATM 2223 O O   . HOH D 3 .   ? 14.346 77.435 1.842   1.00 34.99  ? 405 HOH A O   1 
HETATM 2224 O O   . HOH D 3 .   ? 11.488 51.824 11.061  1.00 37.22  ? 406 HOH A O   1 
HETATM 2225 O O   . HOH D 3 .   ? 23.194 53.664 22.254  1.00 50.33  ? 407 HOH A O   1 
HETATM 2226 O O   . HOH D 3 .   ? 17.418 72.565 9.945   1.00 41.65  ? 408 HOH A O   1 
HETATM 2227 O O   . HOH D 3 .   ? 30.925 47.611 23.327  1.00 37.40  ? 409 HOH A O   1 
HETATM 2228 O O   . HOH D 3 .   ? 14.765 79.557 5.901   1.00 37.08  ? 410 HOH A O   1 
HETATM 2229 O O   . HOH D 3 .   ? 14.774 78.089 8.317   1.00 35.26  ? 411 HOH A O   1 
HETATM 2230 O O   . HOH D 3 .   ? 15.872 60.847 -8.771  1.00 35.13  ? 412 HOH A O   1 
HETATM 2231 O O   . HOH D 3 .   ? 17.906 79.679 -10.629 1.00 44.80  ? 413 HOH A O   1 
HETATM 2232 O O   . HOH D 3 .   ? 21.383 54.869 1.886   1.00 42.30  ? 414 HOH A O   1 
HETATM 2233 O O   . HOH D 3 .   ? 25.134 57.978 13.205  1.00 39.85  ? 415 HOH A O   1 
HETATM 2234 O O   . HOH D 3 .   ? 8.463  58.519 -10.721 1.00 73.06  ? 416 HOH A O   1 
HETATM 2235 O O   . HOH D 3 .   ? 14.379 63.442 -10.377 1.00 39.80  ? 417 HOH A O   1 
HETATM 2236 O O   . HOH D 3 .   ? 12.213 82.763 -4.549  1.00 39.78  ? 418 HOH A O   1 
HETATM 2237 O O   . HOH D 3 .   ? 27.710 75.500 -1.772  1.00 49.73  ? 419 HOH A O   1 
HETATM 2238 O O   . HOH D 3 .   ? 27.041 38.379 6.660   1.00 44.34  ? 420 HOH A O   1 
HETATM 2239 O O   . HOH D 3 .   ? 12.635 84.337 -7.251  1.00 45.02  ? 421 HOH A O   1 
HETATM 2240 O O   . HOH D 3 .   ? 7.906  58.662 -7.241  1.00 40.11  ? 422 HOH A O   1 
HETATM 2241 O O   . HOH D 3 .   ? 14.750 55.287 6.020   1.00 42.87  ? 423 HOH A O   1 
HETATM 2242 O O   . HOH D 3 .   ? 8.154  60.937 -9.539  1.00 52.30  ? 424 HOH A O   1 
HETATM 2243 O O   . HOH D 3 .   ? 10.734 51.034 3.249   1.00 43.75  ? 425 HOH A O   1 
HETATM 2244 O O   . HOH D 3 .   ? 15.758 84.620 5.880   1.00 56.04  ? 426 HOH A O   1 
HETATM 2245 O O   . HOH D 3 .   ? 29.225 65.373 -5.646  1.00 70.04  ? 427 HOH A O   1 
HETATM 2246 O O   . HOH D 3 .   ? 24.629 72.936 9.403   1.00 48.68  ? 428 HOH A O   1 
HETATM 2247 O O   . HOH D 3 .   ? 22.988 60.775 5.074   1.00 38.91  ? 429 HOH A O   1 
HETATM 2248 O O   . HOH D 3 .   ? 18.913 74.561 17.020  1.00 48.71  ? 430 HOH A O   1 
HETATM 2249 O O   . HOH D 3 .   ? 9.756  48.991 20.967  1.00 33.38  ? 431 HOH A O   1 
HETATM 2250 O O   . HOH D 3 .   ? 6.178  79.533 -10.234 1.00 48.32  ? 432 HOH A O   1 
HETATM 2251 O O   . HOH D 3 .   ? 24.983 68.986 -8.051  1.00 48.28  ? 433 HOH A O   1 
HETATM 2252 O O   . HOH D 3 .   ? 19.406 48.526 11.595  1.00 33.79  ? 434 HOH A O   1 
HETATM 2253 O O   . HOH D 3 .   ? 7.486  56.920 6.318   1.00 29.49  ? 435 HOH A O   1 
HETATM 2254 O O   . HOH D 3 .   ? 17.785 56.492 12.793  1.00 54.95  ? 436 HOH A O   1 
HETATM 2255 O O   . HOH D 3 .   ? 22.006 47.570 25.303  1.00 52.46  ? 437 HOH A O   1 
HETATM 2256 O O   . HOH D 3 .   ? 38.932 42.582 16.823  1.00 52.40  ? 438 HOH A O   1 
HETATM 2257 O O   . HOH D 3 .   ? 17.347 41.547 21.296  1.00 59.58  ? 439 HOH A O   1 
HETATM 2258 O O   . HOH D 3 .   ? 16.421 77.831 -4.385  1.00 46.27  ? 440 HOH A O   1 
HETATM 2259 O O   . HOH D 3 .   ? 23.581 74.017 6.843   1.00 43.58  ? 441 HOH A O   1 
HETATM 2260 O O   . HOH D 3 .   ? 25.034 77.227 20.471  1.00 74.38  ? 442 HOH A O   1 
HETATM 2261 O O   . HOH D 3 .   ? 1.839  61.401 -4.454  1.00 41.99  ? 443 HOH A O   1 
HETATM 2262 O O   . HOH D 3 .   ? 1.303  60.392 7.678   1.00 56.65  ? 444 HOH A O   1 
HETATM 2263 O O   . HOH D 3 .   ? 4.086  57.162 8.445   1.00 56.72  ? 445 HOH A O   1 
HETATM 2264 O O   . HOH D 3 .   ? 16.958 81.701 4.455   1.00 45.86  ? 446 HOH A O   1 
HETATM 2265 O O   . HOH D 3 .   ? 3.173  77.984 6.477   1.00 39.10  ? 447 HOH A O   1 
HETATM 2266 O O   . HOH D 3 .   ? 16.855 55.210 19.408  1.00 41.96  ? 448 HOH A O   1 
HETATM 2267 O O   . HOH D 3 .   ? 20.295 55.093 10.563  1.00 53.53  ? 449 HOH A O   1 
HETATM 2268 O O   . HOH D 3 .   ? 1.180  62.333 -7.816  1.00 57.14  ? 450 HOH A O   1 
HETATM 2269 O O   . HOH D 3 .   ? 7.211  67.548 -16.901 1.00 68.37  ? 451 HOH A O   1 
HETATM 2270 O O   . HOH D 3 .   ? 32.944 40.887 6.755   1.00 58.35  ? 452 HOH A O   1 
HETATM 2271 O O   . HOH D 3 .   ? 2.643  79.150 -4.505  1.00 39.43  ? 453 HOH A O   1 
HETATM 2272 O O   . HOH D 3 .   ? 12.386 83.405 -0.839  1.00 47.57  ? 454 HOH A O   1 
HETATM 2273 O O   . HOH D 3 .   ? 4.616  60.402 -11.237 1.00 71.86  ? 455 HOH A O   1 
HETATM 2274 O O   . HOH D 3 .   ? 28.736 67.675 -3.422  1.00 54.18  ? 456 HOH A O   1 
HETATM 2275 O O   . HOH D 3 .   ? 9.267  82.737 -14.850 1.00 75.17  ? 457 HOH A O   1 
HETATM 2276 O O   . HOH D 3 .   ? 34.944 80.205 -17.141 1.00 73.19  ? 458 HOH A O   1 
HETATM 2277 O O   . HOH D 3 .   ? 33.498 50.805 22.164  1.00 53.59  ? 459 HOH A O   1 
HETATM 2278 O O   . HOH D 3 .   ? 40.726 42.555 11.176  1.00 77.41  ? 460 HOH A O   1 
HETATM 2279 O O   . HOH D 3 .   ? 18.609 78.497 -21.894 1.00 61.75  ? 461 HOH A O   1 
HETATM 2280 O O   . HOH D 3 .   ? 15.906 44.049 20.533  1.00 46.86  ? 462 HOH A O   1 
HETATM 2281 O O   . HOH D 3 .   ? 11.631 77.215 11.091  1.00 42.30  ? 463 HOH A O   1 
HETATM 2282 O O   . HOH D 3 .   ? 34.697 42.528 17.490  1.00 45.47  ? 464 HOH A O   1 
HETATM 2283 O O   . HOH D 3 .   ? 14.718 64.493 -13.766 1.00 63.27  ? 465 HOH A O   1 
HETATM 2284 O O   . HOH D 3 .   ? 7.504  52.664 -3.183  1.00 61.43  ? 466 HOH A O   1 
HETATM 2285 O O   . HOH D 3 .   ? 3.371  75.332 6.032   1.00 35.74  ? 467 HOH A O   1 
HETATM 2286 O O   . HOH D 3 .   ? 2.785  68.881 1.046   1.00 43.89  ? 468 HOH A O   1 
HETATM 2287 O O   . HOH D 3 .   ? 1.993  72.032 3.699   1.00 55.50  ? 469 HOH A O   1 
HETATM 2288 O O   . HOH D 3 .   ? 41.764 36.941 15.008  1.00 64.42  ? 470 HOH A O   1 
HETATM 2289 O O   . HOH D 3 .   ? 7.935  79.142 9.630   1.00 49.17  ? 471 HOH A O   1 
HETATM 2290 O O   . HOH D 3 .   ? 8.415  81.819 5.267   1.00 47.30  ? 472 HOH A O   1 
HETATM 2291 O O   . HOH D 3 .   ? 16.779 75.185 10.958  1.00 41.29  ? 473 HOH A O   1 
HETATM 2292 O O   . HOH D 3 .   ? 20.839 61.337 17.147  1.00 55.41  ? 474 HOH A O   1 
HETATM 2293 O O   . HOH D 3 .   ? 21.826 72.080 -23.066 1.00 60.93  ? 475 HOH A O   1 
HETATM 2294 O O   . HOH D 3 .   ? 29.272 30.485 20.393  1.00 55.23  ? 476 HOH A O   1 
HETATM 2295 O O   . HOH D 3 .   ? 0.276  63.398 -5.682  1.00 74.32  ? 477 HOH A O   1 
HETATM 2296 O O   . HOH D 3 .   ? 6.854  82.085 -11.643 1.00 54.71  ? 478 HOH A O   1 
HETATM 2297 O O   . HOH D 3 .   ? 27.431 46.103 7.376   1.00 42.08  ? 479 HOH A O   1 
HETATM 2298 O O   . HOH D 3 .   ? 38.616 37.308 17.418  1.00 50.52  ? 480 HOH A O   1 
HETATM 2299 O O   . HOH D 3 .   ? 17.480 48.285 13.754  1.00 40.84  ? 481 HOH A O   1 
HETATM 2300 O O   . HOH D 3 .   ? 18.964 78.682 -3.949  1.00 48.86  ? 482 HOH A O   1 
HETATM 2301 O O   . HOH D 3 .   ? 19.620 56.660 0.497   1.00 50.77  ? 483 HOH A O   1 
HETATM 2302 O O   . HOH D 3 .   ? 11.365 77.509 -11.215 1.00 49.42  ? 484 HOH A O   1 
HETATM 2303 O O   . HOH D 3 .   ? 24.710 59.939 6.880   1.00 44.93  ? 485 HOH A O   1 
HETATM 2304 O O   . HOH D 3 .   ? 21.339 49.220 30.504  1.00 52.23  ? 486 HOH A O   1 
HETATM 2305 O O   . HOH D 3 .   ? 12.485 62.032 -11.787 1.00 49.22  ? 487 HOH A O   1 
HETATM 2306 O O   . HOH D 3 .   ? 30.092 79.593 4.503   1.00 60.47  ? 488 HOH A O   1 
HETATM 2307 O O   . HOH D 3 .   ? 26.651 53.084 2.876   1.00 48.88  ? 489 HOH A O   1 
HETATM 2308 O O   . HOH D 3 .   ? 15.798 81.097 -23.347 1.00 70.14  ? 490 HOH A O   1 
HETATM 2309 O O   . HOH D 3 .   ? 42.561 33.244 17.529  1.00 45.81  ? 491 HOH A O   1 
HETATM 2310 O O   . HOH D 3 .   ? 10.773 69.970 -11.527 1.00 43.20  ? 492 HOH A O   1 
HETATM 2311 O O   . HOH D 3 .   ? 17.759 75.206 -4.515  1.00 50.33  ? 493 HOH A O   1 
HETATM 2312 O O   . HOH D 3 .   ? 12.912 52.997 8.730   1.00 57.85  ? 494 HOH A O   1 
HETATM 2313 O O   . HOH D 3 .   ? 38.145 35.406 19.144  1.00 51.42  ? 495 HOH A O   1 
HETATM 2314 O O   . HOH D 3 .   ? 15.602 49.430 9.907   1.00 45.81  ? 496 HOH A O   1 
HETATM 2315 O O   . HOH D 3 .   ? 18.155 82.044 -5.571  1.00 55.39  ? 497 HOH A O   1 
HETATM 2316 O O   . HOH D 3 .   ? 2.292  69.199 -1.931  1.00 47.56  ? 498 HOH A O   1 
HETATM 2317 O O   . HOH D 3 .   ? 11.932 83.512 6.151   1.00 51.68  ? 499 HOH A O   1 
HETATM 2318 O O   . HOH D 3 .   ? 31.437 35.983 22.236  1.00 50.76  ? 500 HOH A O   1 
HETATM 2319 O O   . HOH D 3 .   ? 0.578  59.680 5.103   1.00 66.06  ? 501 HOH A O   1 
HETATM 2320 O O   . HOH D 3 .   ? 1.875  69.718 7.000   1.00 45.13  ? 502 HOH A O   1 
HETATM 2321 O O   . HOH D 3 .   ? 30.120 58.714 2.403   1.00 70.41  ? 503 HOH A O   1 
HETATM 2322 O O   . HOH D 3 .   ? 23.198 53.132 0.243   1.00 49.03  ? 504 HOH A O   1 
HETATM 2323 O O   . HOH D 3 .   ? 13.076 52.157 3.798   1.00 60.05  ? 505 HOH A O   1 
HETATM 2324 O O   . HOH D 3 .   ? 12.912 73.169 -10.915 1.00 44.78  ? 506 HOH A O   1 
HETATM 2325 O O   . HOH D 3 .   ? 25.173 53.556 5.066   1.00 55.67  ? 507 HOH A O   1 
HETATM 2326 O O   . HOH D 3 .   ? 18.666 70.801 -8.741  1.00 42.71  ? 508 HOH A O   1 
HETATM 2327 O O   . HOH D 3 .   ? 34.959 44.100 7.225   1.00 51.42  ? 509 HOH A O   1 
HETATM 2328 O O   . HOH D 3 .   ? 36.765 50.867 12.352  1.00 47.88  ? 510 HOH A O   1 
HETATM 2329 O O   . HOH D 3 .   ? 24.442 60.930 9.512   1.00 46.61  ? 511 HOH A O   1 
HETATM 2330 O O   . HOH D 3 .   ? 24.627 61.246 -2.290  1.00 59.93  ? 512 HOH A O   1 
HETATM 2331 O O   . HOH D 3 .   ? 1.883  64.394 -10.165 1.00 50.32  ? 513 HOH A O   1 
HETATM 2332 O O   . HOH D 3 .   ? 18.645 68.038 -24.307 1.00 65.94  ? 514 HOH A O   1 
HETATM 2333 O O   . HOH D 3 .   ? 3.308  56.308 4.245   1.00 62.03  ? 515 HOH A O   1 
HETATM 2334 O O   . HOH D 3 .   ? 14.308 51.122 14.948  1.00 45.35  ? 516 HOH A O   1 
HETATM 2335 O O   . HOH D 3 .   ? 33.131 44.566 22.973  1.00 58.42  ? 517 HOH A O   1 
HETATM 2336 O O   . HOH D 3 .   ? 40.547 39.025 17.773  1.00 82.52  ? 518 HOH A O   1 
HETATM 2337 O O   . HOH D 3 .   ? 18.091 57.206 9.490   1.00 66.95  ? 519 HOH A O   1 
HETATM 2338 O O   . HOH D 3 .   ? 15.494 86.562 11.916  1.00 69.66  ? 520 HOH A O   1 
HETATM 2339 O O   . HOH D 3 .   ? 13.046 55.665 20.568  1.00 49.14  ? 521 HOH A O   1 
HETATM 2340 O O   . HOH D 3 .   ? 18.422 34.771 8.721   1.00 64.30  ? 522 HOH A O   1 
HETATM 2341 O O   . HOH D 3 .   ? 18.755 60.173 -8.217  1.00 50.84  ? 523 HOH A O   1 
HETATM 2342 O O   . HOH D 3 .   ? 10.126 51.478 17.245  1.00 48.73  ? 524 HOH A O   1 
HETATM 2343 O O   . HOH D 3 .   ? 10.236 79.491 -12.019 1.00 53.24  ? 525 HOH A O   1 
HETATM 2344 O O   . HOH D 3 .   ? 16.118 96.647 -16.026 1.00 70.91  ? 526 HOH A O   1 
HETATM 2345 O O   . HOH D 3 .   ? 26.645 54.777 -0.209  1.00 53.43  ? 527 HOH A O   1 
HETATM 2346 O O   . HOH D 3 .   ? 20.765 47.813 27.650  1.00 72.64  ? 528 HOH A O   1 
HETATM 2347 O O   . HOH D 3 .   ? 28.928 54.932 3.043   1.00 72.63  ? 529 HOH A O   1 
HETATM 2348 O O   . HOH D 3 .   ? 17.666 87.211 -7.476  1.00 69.48  ? 530 HOH A O   1 
HETATM 2349 O O   . HOH D 3 .   ? 30.363 38.971 22.429  1.00 49.61  ? 531 HOH A O   1 
HETATM 2350 O O   . HOH D 3 .   ? 38.344 44.624 5.817   1.00 63.84  ? 532 HOH A O   1 
HETATM 2351 O O   . HOH D 3 .   ? 15.169 54.700 -3.817  1.00 51.10  ? 533 HOH A O   1 
HETATM 2352 O O   . HOH D 3 .   ? 27.157 59.336 5.752   1.00 86.01  ? 534 HOH A O   1 
HETATM 2353 O O   . HOH D 3 .   ? 33.045 37.374 8.539   1.00 51.79  ? 535 HOH A O   1 
HETATM 2354 O O   . HOH D 3 .   ? 9.792  54.154 -6.451  1.00 53.03  ? 536 HOH A O   1 
HETATM 2355 O O   . HOH D 3 .   ? 11.137 54.600 12.628  1.00 61.64  ? 537 HOH A O   1 
HETATM 2356 O O   . HOH D 3 .   ? 4.030  71.784 12.292  1.00 59.69  ? 538 HOH A O   1 
HETATM 2357 O O   . HOH D 3 .   ? 23.759 62.321 19.043  1.00 59.60  ? 539 HOH A O   1 
HETATM 2358 O O   . HOH D 3 .   ? 7.308  51.248 1.790   1.00 41.28  ? 540 HOH A O   1 
HETATM 2359 O O   . HOH D 3 .   ? 0.341  60.793 -0.042  1.00 59.97  ? 541 HOH A O   1 
HETATM 2360 O O   . HOH D 3 .   ? 24.336 42.519 27.029  1.00 55.69  ? 542 HOH A O   1 
HETATM 2361 O O   . HOH D 3 .   ? 20.929 87.255 -26.319 1.00 64.50  ? 543 HOH A O   1 
HETATM 2362 O O   . HOH D 3 .   ? 13.971 72.191 -14.893 1.00 54.83  ? 544 HOH A O   1 
HETATM 2363 O O   . HOH D 3 .   ? 22.035 61.897 -5.983  1.00 58.79  ? 545 HOH A O   1 
HETATM 2364 O O   . HOH D 3 .   ? 33.762 71.219 -0.288  1.00 67.11  ? 546 HOH A O   1 
HETATM 2365 O O   . HOH D 3 .   ? 20.339 80.649 -1.299  1.00 70.61  ? 547 HOH A O   1 
HETATM 2366 O O   . HOH D 3 .   ? 25.728 57.058 -4.669  1.00 68.78  ? 548 HOH A O   1 
HETATM 2367 O O   . HOH D 3 .   ? 30.808 59.688 17.710  1.00 52.01  ? 549 HOH A O   1 
HETATM 2368 O O   . HOH D 3 .   ? 14.982 51.101 7.655   1.00 47.31  ? 550 HOH A O   1 
HETATM 2369 O O   . HOH D 3 .   ? 27.216 71.146 6.734   1.00 60.43  ? 551 HOH A O   1 
HETATM 2370 O O   . HOH D 3 .   ? 26.968 38.518 3.449   1.00 65.98  ? 552 HOH A O   1 
HETATM 2371 O O   . HOH D 3 .   ? 0.067  67.063 0.656   1.00 71.33  ? 553 HOH A O   1 
HETATM 2372 O O   . HOH D 3 .   ? 8.510  49.524 3.845   1.00 47.98  ? 554 HOH A O   1 
HETATM 2373 O O   . HOH D 3 .   ? 36.062 44.031 19.332  1.00 61.31  ? 555 HOH A O   1 
HETATM 2374 O O   . HOH D 3 .   ? 13.434 79.124 10.706  1.00 41.77  ? 556 HOH A O   1 
HETATM 2375 O O   . HOH D 3 .   ? 19.683 35.631 22.267  1.00 50.17  ? 557 HOH A O   1 
HETATM 2376 O O   . HOH D 3 .   ? 19.066 34.814 19.442  1.00 72.11  ? 558 HOH A O   1 
HETATM 2377 O O   . HOH D 3 .   ? 36.216 36.491 8.398   1.00 56.20  ? 559 HOH A O   1 
HETATM 2378 O O   . HOH D 3 .   ? 19.825 25.793 11.306  1.00 68.18  ? 560 HOH A O   1 
HETATM 2379 O O   . HOH D 3 .   ? 15.510 74.332 -14.110 1.00 51.51  ? 561 HOH A O   1 
HETATM 2380 O O   . HOH D 3 .   ? 31.884 71.613 6.126   1.00 65.42  ? 562 HOH A O   1 
HETATM 2381 O O   . HOH D 3 .   ? 12.489 75.618 -12.838 1.00 62.37  ? 563 HOH A O   1 
HETATM 2382 O O   . HOH D 3 .   ? 28.798 61.800 7.937   1.00 57.82  ? 564 HOH A O   1 
HETATM 2383 O O   . HOH D 3 .   ? 15.429 74.067 -11.251 1.00 55.57  ? 565 HOH A O   1 
HETATM 2384 O O   . HOH D 3 .   ? 31.135 50.615 5.619   1.00 66.37  ? 566 HOH A O   1 
HETATM 2385 O O   . HOH D 3 .   ? 24.682 63.115 21.637  1.00 70.53  ? 567 HOH A O   1 
HETATM 2386 O O   . HOH D 3 .   ? 38.323 48.098 14.393  1.00 68.58  ? 568 HOH A O   1 
HETATM 2387 O O   . HOH D 3 .   ? 16.544 51.667 24.763  1.00 54.00  ? 569 HOH A O   1 
HETATM 2388 O O   . HOH D 3 .   ? 3.486  68.665 10.037  1.00 61.00  ? 570 HOH A O   1 
HETATM 2389 O O   . HOH D 3 .   ? 12.398 75.579 13.106  1.00 54.30  ? 571 HOH A O   1 
HETATM 2390 O O   . HOH D 3 .   ? 29.869 75.583 4.290   1.00 65.21  ? 572 HOH A O   1 
HETATM 2391 O O   . HOH D 3 .   ? 21.272 65.363 -3.245  1.00 46.39  ? 573 HOH A O   1 
HETATM 2392 O O   . HOH D 3 .   ? 16.997 35.425 21.010  1.00 72.53  ? 574 HOH A O   1 
HETATM 2393 O O   . HOH D 3 .   ? 8.180  82.868 7.654   1.00 59.44  ? 575 HOH A O   1 
HETATM 2394 O O   . HOH D 3 .   ? 18.526 81.289 -22.401 1.00 68.58  ? 576 HOH A O   1 
HETATM 2395 O O   . HOH D 3 .   ? 32.590 67.159 6.462   1.00 63.18  ? 577 HOH A O   1 
HETATM 2396 O O   . HOH D 3 .   ? 7.984  71.216 -14.750 1.00 54.45  ? 578 HOH A O   1 
HETATM 2397 O O   . HOH D 3 .   ? 13.640 57.719 18.543  1.00 62.47  ? 579 HOH A O   1 
HETATM 2398 O O   . HOH D 3 .   ? 9.280  78.821 12.197  1.00 59.36  ? 580 HOH A O   1 
HETATM 2399 O O   . HOH D 3 .   ? 32.411 37.220 5.967   1.00 74.54  ? 581 HOH A O   1 
HETATM 2400 O O   . HOH D 3 .   ? 24.820 59.711 24.596  1.00 69.73  ? 582 HOH A O   1 
HETATM 2401 O O   . HOH D 3 .   ? 11.248 83.331 9.038   1.00 56.69  ? 583 HOH A O   1 
HETATM 2402 O O   . HOH D 3 .   ? 1.526  59.013 -5.719  1.00 55.73  ? 584 HOH A O   1 
HETATM 2403 O O   . HOH D 3 .   ? 0.793  72.028 7.981   1.00 54.60  ? 585 HOH A O   1 
HETATM 2404 O O   . HOH D 3 .   ? 21.754 63.987 16.248  1.00 56.09  ? 586 HOH A O   1 
HETATM 2405 O O   . HOH D 3 .   ? 32.709 45.987 25.529  1.00 69.72  ? 587 HOH A O   1 
HETATM 2406 O O   . HOH D 3 .   ? 14.685 85.259 -0.713  1.00 59.59  ? 588 HOH A O   1 
HETATM 2407 O O   . HOH D 3 .   ? 23.685 75.329 23.085  1.00 73.43  ? 589 HOH A O   1 
HETATM 2408 O O   . HOH D 3 .   ? -1.064 61.781 7.893   1.00 70.15  ? 590 HOH A O   1 
HETATM 2409 O O   . HOH D 3 .   ? 24.986 74.202 -24.632 1.00 62.46  ? 591 HOH A O   1 
HETATM 2410 O O   . HOH D 3 .   ? 25.473 32.352 7.886   1.00 72.17  ? 592 HOH A O   1 
HETATM 2411 O O   . HOH D 3 .   ? 17.687 73.866 -9.072  1.00 57.37  ? 593 HOH A O   1 
HETATM 2412 O O   . HOH D 3 .   ? 26.862 55.750 5.579   1.00 63.95  ? 594 HOH A O   1 
HETATM 2413 O O   . HOH D 3 .   ? 16.420 35.599 12.215  1.00 61.23  ? 595 HOH A O   1 
HETATM 2414 O O   . HOH D 3 .   ? 12.572 81.672 10.872  1.00 59.61  ? 596 HOH A O   1 
HETATM 2415 O O   . HOH D 3 .   ? 4.193  50.843 3.194   1.00 59.94  ? 597 HOH A O   1 
HETATM 2416 O O   . HOH D 3 .   ? 8.942  68.550 -13.223 1.00 55.10  ? 598 HOH A O   1 
HETATM 2417 O O   . HOH D 3 .   ? 14.630 59.901 13.620  1.00 68.21  ? 599 HOH A O   1 
HETATM 2418 O O   . HOH D 3 .   ? 3.725  57.068 -6.112  1.00 71.44  ? 600 HOH A O   1 
HETATM 2419 O O   . HOH D 3 .   ? 17.974 86.011 17.160  1.00 53.12  ? 601 HOH A O   1 
HETATM 2420 O O   . HOH D 3 .   ? 37.113 67.449 -3.403  1.00 74.59  ? 602 HOH A O   1 
HETATM 2421 O O   . HOH D 3 .   ? 14.410 64.430 -21.439 1.00 63.48  ? 603 HOH A O   1 
HETATM 2422 O O   . HOH D 3 .   ? 27.002 65.792 -2.626  1.00 55.29  ? 604 HOH A O   1 
HETATM 2423 O O   . HOH D 3 .   ? 5.118  65.714 -12.356 1.00 59.48  ? 605 HOH A O   1 
HETATM 2424 O O   . HOH D 3 .   ? 28.575 54.063 7.836   1.00 52.92  ? 606 HOH A O   1 
HETATM 2425 O O   . HOH D 3 .   ? 26.068 59.861 -4.224  1.00 67.09  ? 607 HOH A O   1 
HETATM 2426 O O   . HOH D 3 .   ? 13.559 34.596 12.834  1.00 60.92  ? 608 HOH A O   1 
HETATM 2427 O O   . HOH D 3 .   ? 14.940 34.123 10.448  1.00 75.73  ? 609 HOH A O   1 
HETATM 2428 O O   . HOH D 3 .   ? 35.892 36.888 5.601   1.00 75.61  ? 610 HOH A O   1 
HETATM 2429 O O   . HOH D 3 .   ? 23.293 29.670 18.845  1.00 59.27  ? 611 HOH A O   1 
HETATM 2430 O O   . HOH D 3 .   ? 3.255  54.895 -4.070  1.00 61.50  ? 612 HOH A O   1 
HETATM 2431 O O   . HOH D 3 .   ? 11.027 86.138 6.221   1.00 68.00  ? 613 HOH A O   1 
HETATM 2432 O O   . HOH D 3 .   ? 9.090  67.510 -23.727 1.00 95.38  ? 614 HOH A O   1 
HETATM 2433 O O   . HOH D 3 .   ? 13.579 83.451 -20.463 1.00 68.85  ? 615 HOH A O   1 
HETATM 2434 O O   . HOH D 3 .   ? 31.397 81.608 8.722   1.00 81.20  ? 616 HOH A O   1 
HETATM 2435 O O   . HOH D 3 .   ? 18.458 88.459 -25.431 1.00 68.22  ? 617 HOH A O   1 
HETATM 2436 O O   . HOH D 3 .   ? 26.266 73.678 7.150   1.00 77.89  ? 618 HOH A O   1 
HETATM 2437 O O   . HOH D 3 .   ? 26.468 43.593 28.241  1.00 53.56  ? 619 HOH A O   1 
HETATM 2438 O O   . HOH D 3 .   ? 22.018 51.698 30.367  1.00 65.28  ? 620 HOH A O   1 
HETATM 2439 O O   . HOH D 3 .   ? 16.132 83.184 -21.341 1.00 73.17  ? 621 HOH A O   1 
HETATM 2440 O O   . HOH D 3 .   ? 28.625 85.581 -25.010 1.00 82.89  ? 622 HOH A O   1 
HETATM 2441 O O   . HOH D 3 .   ? 11.497 73.087 13.160  1.00 65.96  ? 623 HOH A O   1 
HETATM 2442 O O   . HOH D 3 .   ? 25.336 60.280 12.168  1.00 56.25  ? 624 HOH A O   1 
HETATM 2443 O O   . HOH D 3 .   ? 19.908 33.081 17.166  1.00 68.09  ? 625 HOH A O   1 
HETATM 2444 O O   . HOH D 3 .   ? 15.883 68.485 16.197  1.00 68.96  ? 626 HOH A O   1 
HETATM 2445 O O   . HOH D 3 .   ? 27.050 69.079 -6.150  1.00 53.30  ? 627 HOH A O   1 
HETATM 2446 O O   . HOH D 3 .   ? 2.251  76.424 -3.815  1.00 63.94  ? 628 HOH A O   1 
HETATM 2447 O O   . HOH D 3 .   ? 3.342  54.237 2.646   1.00 66.30  ? 629 HOH A O   1 
HETATM 2448 O O   . HOH D 3 .   ? 31.545 51.720 8.077   1.00 70.11  ? 630 HOH A O   1 
HETATM 2449 O O   . HOH D 3 .   ? 12.089 71.925 -13.029 1.00 49.90  ? 631 HOH A O   1 
HETATM 2450 O O   . HOH D 3 .   ? 14.299 76.514 -14.706 1.00 71.65  ? 632 HOH A O   1 
HETATM 2451 O O   . HOH D 3 .   ? 6.172  63.811 -10.660 1.00 59.72  ? 633 HOH A O   1 
HETATM 2452 O O   . HOH D 3 .   ? 12.315 64.542 11.433  1.00 55.15  ? 634 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 1   ? 1.4338 0.8863 1.4912 -0.2208 -0.4985 0.1145  37  HIS A N   
2    C CA  . HIS A 1   ? 1.3590 0.8883 1.4524 -0.2187 -0.4669 0.1249  37  HIS A CA  
3    C C   . HIS A 1   ? 1.3873 0.9027 1.4695 -0.2233 -0.4911 0.1181  37  HIS A C   
4    O O   . HIS A 1   ? 1.3359 0.9028 1.4314 -0.2162 -0.4652 0.1191  37  HIS A O   
5    C CB  . HIS A 1   ? 1.3247 0.9295 1.5022 -0.2384 -0.4551 0.1664  37  HIS A CB  
6    C CG  . HIS A 1   ? 1.2995 0.9737 1.4916 -0.2206 -0.4018 0.1693  37  HIS A CG  
7    N ND1 . HIS A 1   ? 1.3077 0.9805 1.4776 -0.2037 -0.3738 0.1581  37  HIS A ND1 
8    C CD2 . HIS A 1   ? 1.2695 1.0109 1.4931 -0.2166 -0.3752 0.1814  37  HIS A CD2 
9    C CE1 . HIS A 1   ? 1.2393 0.9759 1.4272 -0.1908 -0.3336 0.1631  37  HIS A CE1 
10   N NE2 . HIS A 1   ? 1.2207 0.9989 1.4392 -0.1971 -0.3326 0.1766  37  HIS A NE2 
11   N N   . MET A 2   ? 1.3799 0.8227 1.4347 -0.2340 -0.5418 0.1103  38  MET A N   
12   C CA  . MET A 2   ? 1.3894 0.8091 1.4270 -0.2376 -0.5703 0.1020  38  MET A CA  
13   C C   . MET A 2   ? 1.4122 0.7625 1.3551 -0.2065 -0.5704 0.0602  38  MET A C   
14   O O   . MET A 2   ? 1.4721 0.7472 1.3619 -0.1976 -0.5929 0.0426  38  MET A O   
15   C CB  . MET A 2   ? 1.4808 0.8654 1.5527 -0.2705 -0.6313 0.1235  38  MET A CB  
16   C CG  . MET A 2   ? 1.5548 0.9317 1.6281 -0.2799 -0.6621 0.1237  38  MET A CG  
17   S SD  . MET A 2   ? 1.5252 1.0153 1.6809 -0.2913 -0.6305 0.1568  38  MET A SD  
18   C CE  . MET A 2   ? 1.5290 0.9813 1.6628 -0.2983 -0.6756 0.1474  38  MET A CE  
19   N N   . LEU A 3   ? 1.2711 0.6480 1.1925 -0.1877 -0.5428 0.0459  39  LEU A N   
20   C CA  . LEU A 3   ? 1.2813 0.6012 1.1172 -0.1558 -0.5391 0.0106  39  LEU A CA  
21   C C   . LEU A 3   ? 1.3657 0.6267 1.1711 -0.1623 -0.5900 0.0024  39  LEU A C   
22   O O   . LEU A 3   ? 1.3396 0.6249 1.2009 -0.1915 -0.6177 0.0256  39  LEU A O   
23   C CB  . LEU A 3   ? 1.2073 0.5829 1.0375 -0.1332 -0.4870 0.0016  39  LEU A CB  
24   C CG  . LEU A 3   ? 1.1827 0.6170 1.0416 -0.1258 -0.4381 0.0087  39  LEU A CG  
25   C CD1 . LEU A 3   ? 1.1165 0.6106 0.9857 -0.1120 -0.3968 0.0061  39  LEU A CD1 
26   C CD2 . LEU A 3   ? 1.2143 0.6028 1.0217 -0.1037 -0.4269 -0.0093 39  LEU A CD2 
27   N N   . ASP A 4   ? 1.3948 0.5782 1.1130 -0.1348 -0.6043 -0.0284 40  ASP A N   
28   C CA  . ASP A 4   ? 1.4771 0.5983 1.1591 -0.1384 -0.6556 -0.0381 40  ASP A CA  
29   C C   . ASP A 4   ? 1.4708 0.6448 1.1785 -0.1416 -0.6445 -0.0325 40  ASP A C   
30   O O   . ASP A 4   ? 1.4031 0.6373 1.1206 -0.1261 -0.5936 -0.0340 40  ASP A O   
31   C CB  . ASP A 4   ? 1.6099 0.6306 1.1845 -0.1034 -0.6743 -0.0723 40  ASP A CB  
32   C CG  . ASP A 4   ? 1.7997 0.8258 1.3176 -0.0608 -0.6228 -0.0933 40  ASP A CG  
33   O OD1 . ASP A 4   ? 1.7632 0.8397 1.2894 -0.0505 -0.5910 -0.0943 40  ASP A OD1 
34   O OD2 . ASP A 4   ? 1.9731 0.9471 1.4339 -0.0362 -0.6178 -0.1088 40  ASP A OD2 
35   N N   . PRO A 5   ? 1.4381 0.5936 1.1630 -0.1636 -0.6925 -0.0235 41  PRO A N   
36   C CA  . PRO A 5   ? 1.3928 0.6015 1.1470 -0.1682 -0.6830 -0.0155 41  PRO A CA  
37   C C   . PRO A 5   ? 1.4223 0.6279 1.1137 -0.1308 -0.6486 -0.0416 41  PRO A C   
38   O O   . PRO A 5   ? 1.3469 0.6122 1.0695 -0.1321 -0.6257 -0.0335 41  PRO A O   
39   C CB  . PRO A 5   ? 1.4832 0.6421 1.2405 -0.1914 -0.7504 -0.0093 41  PRO A CB  
40   C CG  . PRO A 5   ? 1.6313 0.6921 1.3319 -0.1876 -0.7937 -0.0254 41  PRO A CG  
41   C CD  . PRO A 5   ? 1.5385 0.6241 1.2604 -0.1867 -0.7599 -0.0185 41  PRO A CD  
42   N N   . GLU A 6   ? 1.4438 0.5814 1.0488 -0.0965 -0.6444 -0.0704 42  GLU A N   
43   C CA  . GLU A 6   ? 1.4457 0.5752 0.9871 -0.0570 -0.6109 -0.0930 42  GLU A CA  
44   C C   . GLU A 6   ? 1.3935 0.5997 0.9676 -0.0465 -0.5463 -0.0868 42  GLU A C   
45   O O   . GLU A 6   ? 1.3329 0.5802 0.9081 -0.0327 -0.5147 -0.0891 42  GLU A O   
46   C CB  . GLU A 6   ? 1.5596 0.5903 0.9994 -0.0224 -0.6291 -0.1212 42  GLU A CB  
47   C CG  . GLU A 6   ? 1.7011 0.7140 1.0691 0.0210  -0.6021 -0.1420 42  GLU A CG  
48   C CD  . GLU A 6   ? 2.0638 0.9846 1.3301 0.0613  -0.6128 -0.1668 42  GLU A CD  
49   O OE1 . GLU A 6   ? 2.1603 0.9971 1.3705 0.0653  -0.6659 -0.1802 42  GLU A OE1 
50   O OE2 . GLU A 6   ? 1.9089 0.8402 1.1500 0.0902  -0.5688 -0.1721 42  GLU A OE2 
51   N N   . GLU A 7   ? 1.3411 0.5636 0.9411 -0.0529 -0.5293 -0.0790 43  GLU A N   
52   C CA  . GLU A 7   ? 1.2614 0.5521 0.8940 -0.0451 -0.4736 -0.0725 43  GLU A CA  
53   C C   . GLU A 7   ? 1.2083 0.5850 0.9198 -0.0686 -0.4557 -0.0499 43  GLU A C   
54   O O   . GLU A 7   ? 1.1558 0.5814 0.8765 -0.0554 -0.4158 -0.0508 43  GLU A O   
55   C CB  . GLU A 7   ? 1.2787 0.5629 0.9208 -0.0482 -0.4656 -0.0684 43  GLU A CB  
56   C CG  . GLU A 7   ? 1.4306 0.6996 1.0229 -0.0134 -0.4294 -0.0843 43  GLU A CG  
57   C CD  . GLU A 7   ? 1.4043 0.7246 0.9979 0.0078  -0.3812 -0.0872 43  GLU A CD  
58   O OE1 . GLU A 7   ? 1.1928 0.5843 0.8451 -0.0044 -0.3510 -0.0730 43  GLU A OE1 
59   O OE2 . GLU A 7   ? 1.1929 0.4791 0.7261 0.0386  -0.3739 -0.1032 43  GLU A OE2 
60   N N   . ILE A 8   ? 1.1399 0.5329 0.9070 -0.1020 -0.4869 -0.0283 44  ILE A N   
61   C CA  . ILE A 8   ? 1.0642 0.5363 0.9068 -0.1239 -0.4745 -0.0028 44  ILE A CA  
62   C C   . ILE A 8   ? 1.1108 0.6013 0.9406 -0.1128 -0.4654 -0.0098 44  ILE A C   
63   O O   . ILE A 8   ? 1.0586 0.6118 0.9174 -0.1076 -0.4268 -0.0033 44  ILE A O   
64   C CB  . ILE A 8   ? 1.1101 0.5878 1.0106 -0.1598 -0.5155 0.0242  44  ILE A CB  
65   C CG1 . ILE A 8   ? 1.1084 0.5825 1.0319 -0.1706 -0.5156 0.0353  44  ILE A CG1 
66   C CG2 . ILE A 8   ? 1.0662 0.6241 1.0396 -0.1780 -0.5042 0.0523  44  ILE A CG2 
67   C CD1 . ILE A 8   ? 1.2161 0.6779 1.1878 -0.2045 -0.5626 0.0610  44  ILE A CD1 
68   N N   . ARG A 9   ? 1.1284 0.5602 0.9095 -0.1065 -0.5005 -0.0245 45  ARG A N   
69   C CA  . ARG A 9   ? 1.1168 0.5587 0.8794 -0.0943 -0.4951 -0.0321 45  ARG A CA  
70   C C   . ARG A 9   ? 1.0951 0.5616 0.8301 -0.0636 -0.4431 -0.0460 45  ARG A C   
71   O O   . ARG A 9   ? 1.0257 0.5526 0.7953 -0.0642 -0.4151 -0.0371 45  ARG A O   
72   C CB  . ARG A 9   ? 1.1812 0.5441 0.8819 -0.0865 -0.5416 -0.0494 45  ARG A CB  
73   C CG  . ARG A 9   ? 1.3109 0.6635 1.0507 -0.1198 -0.5950 -0.0317 45  ARG A CG  
74   C CD  . ARG A 9   ? 1.3766 0.6551 1.0557 -0.1115 -0.6422 -0.0491 45  ARG A CD  
75   N NE  . ARG A 9   ? 1.3761 0.5624 0.9693 -0.0872 -0.6621 -0.0759 45  ARG A NE  
76   C CZ  . ARG A 9   ? 1.7119 0.8347 1.2913 -0.1007 -0.7094 -0.0769 45  ARG A CZ  
77   N NH1 . ARG A 9   ? 1.6381 0.7823 1.2899 -0.1408 -0.7422 -0.0504 45  ARG A NH1 
78   N NH2 . ARG A 9   ? 1.6493 0.6862 1.1426 -0.0730 -0.7242 -0.1029 45  ARG A NH2 
79   N N   . LYS A 10  ? 1.0617 0.4835 0.7396 -0.0378 -0.4307 -0.0649 46  LYS A N   
80   C CA  . LYS A 10  ? 1.0218 0.4599 0.6726 -0.0079 -0.3849 -0.0758 46  LYS A CA  
81   C C   . LYS A 10  ? 0.9740 0.4914 0.6874 -0.0171 -0.3441 -0.0606 46  LYS A C   
82   O O   . LYS A 10  ? 0.9276 0.4815 0.6459 -0.0047 -0.3138 -0.0614 46  LYS A O   
83   C CB  . LYS A 10  ? 1.1057 0.4852 0.6964 0.0167  -0.3827 -0.0918 46  LYS A CB  
84   C CG  . LYS A 10  ? 1.2143 0.6126 0.7831 0.0472  -0.3355 -0.0984 46  LYS A CG  
85   C CD  . LYS A 10  ? 1.4047 0.7401 0.9056 0.0768  -0.3356 -0.1132 46  LYS A CD  
86   C CE  . LYS A 10  ? 1.4715 0.8336 0.9618 0.1051  -0.2883 -0.1139 46  LYS A CE  
87   N NZ  . LYS A 10  ? 1.6797 0.9824 1.1013 0.1386  -0.2859 -0.1257 46  LYS A NZ  
88   N N   . ARG A 11  ? 0.8819 0.4228 0.6410 -0.0381 -0.3455 -0.0462 47  ARG A N   
89   C CA  . ARG A 11  ? 0.8022 0.4110 0.6154 -0.0457 -0.3114 -0.0318 47  ARG A CA  
90   C C   . ARG A 11  ? 0.8097 0.4763 0.6715 -0.0593 -0.3058 -0.0161 47  ARG A C   
91   O O   . ARG A 11  ? 0.7170 0.4243 0.5895 -0.0486 -0.2734 -0.0164 47  ARG A O   
92   C CB  . ARG A 11  ? 0.7650 0.3780 0.6095 -0.0629 -0.3186 -0.0195 47  ARG A CB  
93   C CG  . ARG A 11  ? 0.8328 0.4059 0.6367 -0.0456 -0.3096 -0.0333 47  ARG A CG  
94   C CD  . ARG A 11  ? 0.8340 0.4058 0.6656 -0.0625 -0.3197 -0.0214 47  ARG A CD  
95   N NE  . ARG A 11  ? 1.0199 0.5562 0.8121 -0.0439 -0.3082 -0.0345 47  ARG A NE  
96   C CZ  . ARG A 11  ? 1.0951 0.6488 0.9097 -0.0478 -0.2938 -0.0270 47  ARG A CZ  
97   N NH1 . ARG A 11  ? 0.7552 0.3602 0.6296 -0.0687 -0.2889 -0.0062 47  ARG A NH1 
98   N NH2 . ARG A 11  ? 0.8841 0.4048 0.6605 -0.0289 -0.2833 -0.0388 47  ARG A NH2 
99   N N   . LEU A 12  ? 0.8153 0.4827 0.7048 -0.0818 -0.3390 -0.0021 48  LEU A N   
100  C CA  . LEU A 12  ? 0.7758 0.5001 0.7143 -0.0944 -0.3346 0.0166  48  LEU A CA  
101  C C   . LEU A 12  ? 0.8438 0.5740 0.7576 -0.0778 -0.3215 0.0050  48  LEU A C   
102  O O   . LEU A 12  ? 0.8070 0.5905 0.7504 -0.0755 -0.2952 0.0137  48  LEU A O   
103  C CB  . LEU A 12  ? 0.7920 0.5163 0.7684 -0.1218 -0.3747 0.0373  48  LEU A CB  
104  C CG  . LEU A 12  ? 0.8375 0.5707 0.8553 -0.1420 -0.3858 0.0573  48  LEU A CG  
105  C CD1 . LEU A 12  ? 0.8610 0.5977 0.9232 -0.1703 -0.4274 0.0822  48  LEU A CD1 
106  C CD2 . LEU A 12  ? 0.7770 0.5743 0.8361 -0.1395 -0.3455 0.0721  48  LEU A CD2 
107  N N   . GLU A 13  ? 0.8408 0.5147 0.6966 -0.0628 -0.3373 -0.0150 49  GLU A N   
108  C CA  . GLU A 13  ? 0.8358 0.5077 0.6610 -0.0441 -0.3263 -0.0265 49  GLU A CA  
109  C C   . GLU A 13  ? 0.8171 0.5119 0.6313 -0.0220 -0.2821 -0.0347 49  GLU A C   
110  O O   . GLU A 13  ? 0.7764 0.5027 0.5989 -0.0147 -0.2633 -0.0334 49  GLU A O   
111  C CB  . GLU A 13  ? 0.9227 0.5229 0.6833 -0.0309 -0.3567 -0.0448 49  GLU A CB  
112  C CG  . GLU A 13  ? 1.1126 0.6975 0.8844 -0.0506 -0.4008 -0.0369 49  GLU A CG  
113  C CD  . GLU A 13  ? 1.5295 1.0317 1.2390 -0.0428 -0.4427 -0.0538 49  GLU A CD  
114  O OE1 . GLU A 13  ? 1.4823 0.9431 1.1259 -0.0124 -0.4340 -0.0742 49  GLU A OE1 
115  O OE2 . GLU A 13  ? 1.5357 1.0134 1.2616 -0.0661 -0.4853 -0.0452 49  GLU A OE2 
116  N N   . HIS A 14  ? 0.7968 0.4751 0.5937 -0.0115 -0.2671 -0.0420 50  HIS A N   
117  C CA  . HIS A 14  ? 0.7667 0.4683 0.5601 0.0073  -0.2276 -0.0466 50  HIS A CA  
118  C C   . HIS A 14  ? 0.7204 0.4867 0.5698 -0.0044 -0.2054 -0.0321 50  HIS A C   
119  O O   . HIS A 14  ? 0.6666 0.4598 0.5210 0.0059  -0.1827 -0.0328 50  HIS A O   
120  C CB  . HIS A 14  ? 0.8025 0.4756 0.5712 0.0190  -0.2186 -0.0542 50  HIS A CB  
121  C CG  . HIS A 14  ? 0.8314 0.5208 0.5916 0.0405  -0.1826 -0.0581 50  HIS A CG  
122  N ND1 . HIS A 14  ? 0.8013 0.5401 0.6036 0.0351  -0.1571 -0.0496 50  HIS A ND1 
123  C CD2 . HIS A 14  ? 0.8889 0.5519 0.6051 0.0673  -0.1701 -0.0675 50  HIS A CD2 
124  C CE1 . HIS A 14  ? 0.7920 0.5324 0.5787 0.0558  -0.1325 -0.0536 50  HIS A CE1 
125  N NE2 . HIS A 14  ? 0.8455 0.5441 0.5827 0.0760  -0.1374 -0.0628 50  HIS A NE2 
126  N N   . THR A 15  ? 0.6600 0.4494 0.5498 -0.0245 -0.2132 -0.0180 51  THR A N   
127  C CA  . THR A 15  ? 0.5901 0.4379 0.5280 -0.0322 -0.1936 -0.0031 51  THR A CA  
128  C C   . THR A 15  ? 0.6048 0.4817 0.5589 -0.0344 -0.1939 0.0040  51  THR A C   
129  O O   . THR A 15  ? 0.5513 0.4614 0.5174 -0.0259 -0.1696 0.0054  51  THR A O   
130  C CB  . THR A 15  ? 0.5813 0.4456 0.5560 -0.0508 -0.2037 0.0135  51  THR A CB  
131  O OG1 . THR A 15  ? 0.6249 0.4734 0.5872 -0.0444 -0.1926 0.0064  51  THR A OG1 
132  C CG2 . THR A 15  ? 0.5071 0.4312 0.5293 -0.0570 -0.1883 0.0328  51  THR A CG2 
133  N N   . GLU A 16  ? 0.6165 0.4790 0.5705 -0.0456 -0.2230 0.0088  52  GLU A N   
134  C CA  . GLU A 16  ? 0.6219 0.5098 0.5911 -0.0484 -0.2271 0.0168  52  GLU A CA  
135  C C   . GLU A 16  ? 0.6590 0.5439 0.5983 -0.0275 -0.2064 0.0023  52  GLU A C   
136  O O   . GLU A 16  ? 0.6060 0.5300 0.5658 -0.0237 -0.1876 0.0087  52  GLU A O   
137  C CB  . GLU A 16  ? 0.6909 0.5503 0.6560 -0.0627 -0.2672 0.0210  52  GLU A CB  
138  C CG  . GLU A 16  ? 0.8921 0.7874 0.8893 -0.0722 -0.2760 0.0374  52  GLU A CG  
139  C CD  . GLU A 16  ? 1.2831 1.2346 1.3415 -0.0877 -0.2707 0.0656  52  GLU A CD  
140  O OE1 . GLU A 16  ? 1.2866 1.2352 1.3714 -0.1060 -0.2927 0.0807  52  GLU A OE1 
141  O OE2 . GLU A 16  ? 1.2290 1.2263 1.3078 -0.0798 -0.2444 0.0738  52  GLU A OE2 
142  N N   . ARG A 17  ? 0.6665 0.5040 0.5565 -0.0125 -0.2097 -0.0157 53  ARG A N   
143  C CA  A ARG A 17  ? 0.6671 0.4960 0.5253 0.0097  -0.1906 -0.0276 53  ARG A CA  
144  C CA  B ARG A 17  ? 0.6684 0.4989 0.5280 0.0094  -0.1905 -0.0272 53  ARG A CA  
145  C C   . ARG A 17  ? 0.6531 0.5170 0.5312 0.0178  -0.1560 -0.0258 53  ARG A C   
146  O O   . ARG A 17  ? 0.5988 0.4857 0.4832 0.0259  -0.1395 -0.0247 53  ARG A O   
147  C CB  A ARG A 17  ? 0.7325 0.5039 0.5358 0.0261  -0.1992 -0.0433 53  ARG A CB  
148  C CB  B ARG A 17  ? 0.7480 0.5213 0.5510 0.0268  -0.1991 -0.0432 53  ARG A CB  
149  C CG  A ARG A 17  ? 0.8447 0.5992 0.6080 0.0523  -0.1836 -0.0534 53  ARG A CG  
150  C CG  B ARG A 17  ? 0.9101 0.6707 0.6775 0.0497  -0.1877 -0.0516 53  ARG A CG  
151  C CD  A ARG A 17  ? 0.9940 0.6861 0.6970 0.0685  -0.2034 -0.0665 53  ARG A CD  
152  C CD  B ARG A 17  ? 1.0702 0.7726 0.7772 0.0708  -0.1966 -0.0653 53  ARG A CD  
153  N NE  A ARG A 17  ? 1.0168 0.6799 0.7001 0.0751  -0.2014 -0.0719 53  ARG A NE  
154  N NE  B ARG A 17  ? 1.1438 0.8314 0.8136 0.0939  -0.1902 -0.0712 53  ARG A NE  
155  C CZ  A ARG A 17  ? 1.2048 0.8344 0.8788 0.0634  -0.2293 -0.0746 53  ARG A CZ  
156  C CZ  B ARG A 17  ? 1.3685 1.0236 1.0047 0.0981  -0.2164 -0.0773 53  ARG A CZ  
157  N NH1 A ARG A 17  ? 1.1229 0.7445 0.8094 0.0427  -0.2631 -0.0708 53  ARG A NH1 
158  N NH1 B ARG A 17  ? 1.2301 0.8631 0.8681 0.0788  -0.2537 -0.0779 53  ARG A NH1 
159  N NH2 A ARG A 17  ? 1.0060 0.6100 0.6603 0.0720  -0.2245 -0.0795 53  ARG A NH2 
160  N NH2 B ARG A 17  ? 1.2292 0.8732 0.8307 0.1218  -0.2070 -0.0817 53  ARG A NH2 
161  N N   . GLN A 18  ? 0.6109 0.4764 0.4987 0.0154  -0.1473 -0.0252 54  GLN A N   
162  C CA  . GLN A 18  ? 0.5643 0.4575 0.4699 0.0219  -0.1198 -0.0237 54  GLN A CA  
163  C C   . GLN A 18  ? 0.5515 0.4905 0.4949 0.0139  -0.1122 -0.0121 54  GLN A C   
164  O O   . GLN A 18  ? 0.5054 0.4624 0.4535 0.0233  -0.0945 -0.0130 54  GLN A O   
165  C CB  . GLN A 18  ? 0.5767 0.4612 0.4849 0.0198  -0.1159 -0.0248 54  GLN A CB  
166  C CG  . GLN A 18  ? 0.6637 0.5104 0.5344 0.0361  -0.1109 -0.0357 54  GLN A CG  
167  C CD  . GLN A 18  ? 0.7805 0.6365 0.6458 0.0536  -0.0867 -0.0379 54  GLN A CD  
168  O OE1 . GLN A 18  ? 0.6135 0.5017 0.5067 0.0522  -0.0711 -0.0330 54  GLN A OE1 
169  N NE2 . GLN A 18  ? 0.6720 0.4982 0.5004 0.0719  -0.0840 -0.0441 54  GLN A NE2 
170  N N   . PHE A 19  ? 0.5129 0.4696 0.4826 -0.0019 -0.1258 0.0005  55  PHE A N   
171  C CA  . PHE A 19  ? 0.4851 0.4862 0.4885 -0.0058 -0.1174 0.0145  55  PHE A CA  
172  C C   . PHE A 19  ? 0.5351 0.5490 0.5362 0.0004  -0.1143 0.0150  55  PHE A C   
173  O O   . PHE A 19  ? 0.5062 0.5451 0.5174 0.0087  -0.0969 0.0173  55  PHE A O   
174  C CB  . PHE A 19  ? 0.5110 0.5305 0.5453 -0.0228 -0.1335 0.0329  55  PHE A CB  
175  C CG  . PHE A 19  ? 0.5224 0.5892 0.5888 -0.0227 -0.1240 0.0508  55  PHE A CG  
176  C CD1 . PHE A 19  ? 0.5510 0.6432 0.6290 -0.0139 -0.1033 0.0552  55  PHE A CD1 
177  C CD2 . PHE A 19  ? 0.5785 0.6627 0.6603 -0.0289 -0.1359 0.0633  55  PHE A CD2 
178  C CE1 . PHE A 19  ? 0.5518 0.6842 0.6520 -0.0084 -0.0932 0.0713  55  PHE A CE1 
179  C CE2 . PHE A 19  ? 0.6093 0.7383 0.7186 -0.0250 -0.1246 0.0814  55  PHE A CE2 
180  C CZ  . PHE A 19  ? 0.5614 0.7133 0.6776 -0.0134 -0.1026 0.0851  55  PHE A CZ  
181  N N   . ARG A 20  ? 0.5332 0.5271 0.5188 -0.0027 -0.1330 0.0125  56  ARG A N   
182  C CA  . ARG A 20  ? 0.5415 0.5456 0.5240 0.0024  -0.1331 0.0137  56  ARG A CA  
183  C C   . ARG A 20  ? 0.6158 0.6076 0.5725 0.0204  -0.1151 0.0005  56  ARG A C   
184  O O   . ARG A 20  ? 0.6248 0.6271 0.5795 0.0263  -0.1118 0.0017  56  ARG A O   
185  C CB  . ARG A 20  ? 0.5746 0.5577 0.5471 -0.0067 -0.1626 0.0152  56  ARG A CB  
186  C CG  . ARG A 20  ? 0.7097 0.7110 0.7177 -0.0269 -0.1833 0.0340  56  ARG A CG  
187  C CD  . ARG A 20  ? 0.9526 0.9545 0.9671 -0.0362 -0.2087 0.0427  56  ARG A CD  
188  N NE  . ARG A 20  ? 1.1449 1.1639 1.1989 -0.0574 -0.2315 0.0645  56  ARG A NE  
189  C CZ  . ARG A 20  ? 1.3133 1.3838 1.4140 -0.0639 -0.2224 0.0886  56  ARG A CZ  
190  N NH1 . ARG A 20  ? 1.0513 1.1564 1.1595 -0.0497 -0.1917 0.0911  56  ARG A NH1 
191  N NH2 . ARG A 20  ? 1.1968 1.2831 1.3365 -0.0833 -0.2443 0.1119  56  ARG A NH2 
192  N N   . ASN A 21  ? 0.5781 0.5501 0.5181 0.0291  -0.1033 -0.0094 57  ASN A N   
193  C CA  . ASN A 21  ? 0.5805 0.5435 0.5021 0.0459  -0.0860 -0.0172 57  ASN A CA  
194  C C   . ASN A 21  ? 0.5800 0.5730 0.5243 0.0501  -0.0663 -0.0131 57  ASN A C   
195  O O   . ASN A 21  ? 0.5693 0.5625 0.5185 0.0548  -0.0532 -0.0154 57  ASN A O   
196  C CB  . ASN A 21  ? 0.6214 0.5540 0.5192 0.0550  -0.0812 -0.0256 57  ASN A CB  
197  C CG  . ASN A 21  ? 0.9001 0.8235 0.7794 0.0736  -0.0652 -0.0291 57  ASN A CG  
198  O OD1 . ASN A 21  ? 0.8937 0.8123 0.7577 0.0814  -0.0671 -0.0298 57  ASN A OD1 
199  N ND2 . ASN A 21  ? 0.7556 0.6810 0.6410 0.0807  -0.0485 -0.0286 57  ASN A ND2 
200  N N   . ARG A 22  ? 0.5233 0.5394 0.4806 0.0488  -0.0667 -0.0066 58  ARG A N   
201  C CA  . ARG A 22  ? 0.4868 0.5270 0.4602 0.0545  -0.0522 -0.0029 58  ARG A CA  
202  C C   . ARG A 22  ? 0.5126 0.5540 0.4766 0.0624  -0.0503 -0.0030 58  ARG A C   
203  O O   . ARG A 22  ? 0.4937 0.5484 0.4627 0.0583  -0.0594 0.0034  58  ARG A O   
204  C CB  . ARG A 22  ? 0.4653 0.5339 0.4622 0.0477  -0.0541 0.0076  58  ARG A CB  
205  C CG  . ARG A 22  ? 0.5998 0.6677 0.6048 0.0433  -0.0521 0.0076  58  ARG A CG  
206  C CD  . ARG A 22  ? 0.5745 0.6712 0.5987 0.0442  -0.0473 0.0184  58  ARG A CD  
207  N NE  . ARG A 22  ? 0.5997 0.7010 0.6215 0.0570  -0.0343 0.0146  58  ARG A NE  
208  C CZ  . ARG A 22  ? 0.5892 0.7118 0.6184 0.0648  -0.0285 0.0225  58  ARG A CZ  
209  N NH1 . ARG A 22  ? 0.4491 0.5966 0.4932 0.0614  -0.0315 0.0377  58  ARG A NH1 
210  N NH2 . ARG A 22  ? 0.5415 0.6595 0.5628 0.0773  -0.0205 0.0168  58  ARG A NH2 
211  N N   . ARG A 23  ? 0.4514 0.4794 0.4037 0.0737  -0.0387 -0.0083 59  ARG A N   
212  C CA  A ARG A 23  ? 0.4645 0.4891 0.4047 0.0839  -0.0345 -0.0083 59  ARG A CA  
213  C CA  B ARG A 23  ? 0.4618 0.4867 0.4021 0.0837  -0.0348 -0.0083 59  ARG A CA  
214  C C   . ARG A 23  ? 0.5070 0.5495 0.4615 0.0897  -0.0233 -0.0044 59  ARG A C   
215  O O   . ARG A 23  ? 0.5230 0.5668 0.4706 0.0971  -0.0204 -0.0027 59  ARG A O   
216  C CB  A ARG A 23  ? 0.4641 0.4650 0.3850 0.0954  -0.0265 -0.0123 59  ARG A CB  
217  C CB  B ARG A 23  ? 0.4497 0.4499 0.3691 0.0951  -0.0278 -0.0125 59  ARG A CB  
218  C CG  A ARG A 23  ? 0.6085 0.5838 0.5068 0.0953  -0.0359 -0.0176 59  ARG A CG  
219  C CG  B ARG A 23  ? 0.5500 0.5255 0.4486 0.0935  -0.0382 -0.0178 59  ARG A CG  
220  C CD  A ARG A 23  ? 0.7098 0.6675 0.5938 0.1101  -0.0223 -0.0180 59  ARG A CD  
221  C CD  B ARG A 23  ? 0.6042 0.5553 0.4752 0.1107  -0.0301 -0.0200 59  ARG A CD  
222  N NE  A ARG A 23  ? 0.7205 0.6871 0.6276 0.1067  -0.0119 -0.0154 59  ARG A NE  
223  N NE  B ARG A 23  ? 0.6420 0.5645 0.4873 0.1119  -0.0410 -0.0261 59  ARG A NE  
224  C CZ  A ARG A 23  ? 0.7936 0.7667 0.7150 0.1145  0.0033  -0.0090 59  ARG A CZ  
225  C CZ  B ARG A 23  ? 0.8058 0.7029 0.6213 0.1296  -0.0346 -0.0279 59  ARG A CZ  
226  N NH1 A ARG A 23  ? 0.5332 0.5063 0.4487 0.1273  0.0126  -0.0034 59  ARG A NH1 
227  N NH1 B ARG A 23  ? 0.6168 0.5174 0.4286 0.1469  -0.0161 -0.0216 59  ARG A NH1 
228  N NH2 A ARG A 23  ? 0.6518 0.6310 0.5946 0.1096  0.0081  -0.0068 59  ARG A NH2 
229  N NH2 B ARG A 23  ? 0.6852 0.5529 0.4741 0.1316  -0.0463 -0.0345 59  ARG A NH2 
230  N N   . LYS A 24  ? 0.4512 0.5036 0.4221 0.0880  -0.0179 -0.0035 60  LYS A N   
231  C CA  . LYS A 24  ? 0.4399 0.5009 0.4200 0.0949  -0.0100 -0.0015 60  LYS A CA  
232  C C   . LYS A 24  ? 0.4711 0.5533 0.4579 0.0953  -0.0124 0.0036  60  LYS A C   
233  O O   . LYS A 24  ? 0.4555 0.5491 0.4491 0.0900  -0.0165 0.0066  60  LYS A O   
234  C CB  . LYS A 24  ? 0.4522 0.5049 0.4419 0.0955  -0.0053 -0.0041 60  LYS A CB  
235  C CG  . LYS A 24  ? 0.4005 0.4369 0.3892 0.0981  0.0003  -0.0044 60  LYS A CG  
236  C CD  . LYS A 24  ? 0.5757 0.6060 0.5779 0.0957  0.0014  -0.0053 60  LYS A CD  
237  C CE  . LYS A 24  ? 0.8107 0.8301 0.8180 0.0991  0.0083  -0.0011 60  LYS A CE  
238  N NZ  . LYS A 24  ? 0.8730 0.8842 0.8643 0.0999  0.0093  -0.0024 60  LYS A NZ  
239  N N   . ILE A 25  ? 0.4103 0.4990 0.3955 0.1033  -0.0085 0.0064  61  ILE A N   
240  C CA  . ILE A 25  ? 0.3907 0.5003 0.3803 0.1077  -0.0085 0.0130  61  ILE A CA  
241  C C   . ILE A 25  ? 0.4169 0.5211 0.4042 0.1196  -0.0020 0.0113  61  ILE A C   
242  O O   . ILE A 25  ? 0.4104 0.4976 0.3964 0.1225  0.0010  0.0072  61  ILE A O   
243  C CB  . ILE A 25  ? 0.4148 0.5407 0.4040 0.1062  -0.0136 0.0206  61  ILE A CB  
244  C CG1 . ILE A 25  ? 0.4149 0.5331 0.3949 0.1141  -0.0092 0.0188  61  ILE A CG1 
245  C CG2 . ILE A 25  ? 0.4260 0.5508 0.4162 0.0931  -0.0257 0.0218  61  ILE A CG2 
246  C CD1 . ILE A 25  ? 0.4169 0.5503 0.3946 0.1140  -0.0156 0.0262  61  ILE A CD1 
247  N N   . LEU A 26  ? 0.3841 0.5024 0.3706 0.1279  -0.0006 0.0162  62  LEU A N   
248  C CA  . LEU A 26  ? 0.3985 0.5076 0.3767 0.1420  0.0028  0.0140  62  LEU A CA  
249  C C   . LEU A 26  ? 0.4344 0.5639 0.4089 0.1523  0.0064  0.0232  62  LEU A C   
250  O O   . LEU A 26  ? 0.4185 0.5733 0.3983 0.1533  0.0071  0.0334  62  LEU A O   
251  C CB  . LEU A 26  ? 0.4157 0.5154 0.3882 0.1481  0.0011  0.0100  62  LEU A CB  
252  C CG  . LEU A 26  ? 0.5288 0.6074 0.4863 0.1638  -0.0004 0.0047  62  LEU A CG  
253  C CD1 . LEU A 26  ? 0.5629 0.6152 0.5259 0.1586  -0.0046 -0.0019 62  LEU A CD1 
254  C CD2 . LEU A 26  ? 0.5383 0.6079 0.4841 0.1728  -0.0037 0.0011  62  LEU A CD2 
255  N N   . ILE A 27  ? 0.3964 0.5173 0.3652 0.1595  0.0088  0.0219  63  ILE A N   
256  C CA  . ILE A 27  ? 0.3745 0.5130 0.3384 0.1715  0.0130  0.0306  63  ILE A CA  
257  C C   . ILE A 27  ? 0.4407 0.5627 0.3881 0.1900  0.0150  0.0272  63  ILE A C   
258  O O   . ILE A 27  ? 0.4626 0.5550 0.4050 0.1910  0.0113  0.0180  63  ILE A O   
259  C CB  . ILE A 27  ? 0.3855 0.5262 0.3512 0.1689  0.0140  0.0326  63  ILE A CB  
260  C CG1 . ILE A 27  ? 0.3687 0.5178 0.3429 0.1533  0.0087  0.0340  63  ILE A CG1 
261  C CG2 . ILE A 27  ? 0.4004 0.5610 0.3617 0.1824  0.0185  0.0427  63  ILE A CG2 
262  C CD1 . ILE A 27  ? 0.3744 0.5118 0.3438 0.1526  0.0096  0.0314  63  ILE A CD1 
263  N N   . ARG A 28  ? 0.4029 0.5430 0.3416 0.2057  0.0197  0.0361  64  ARG A N   
264  C CA  . ARG A 28  ? 0.4259 0.5474 0.3405 0.2284  0.0210  0.0329  64  ARG A CA  
265  C C   . ARG A 28  ? 0.4871 0.6277 0.3946 0.2447  0.0285  0.0441  64  ARG A C   
266  O O   . ARG A 28  ? 0.4517 0.6271 0.3760 0.2387  0.0327  0.0573  64  ARG A O   
267  C CB  . ARG A 28  ? 0.4186 0.5412 0.3219 0.2390  0.0215  0.0339  64  ARG A CB  
268  C CG  . ARG A 28  ? 0.5064 0.6029 0.4113 0.2272  0.0127  0.0209  64  ARG A CG  
269  C CD  . ARG A 28  ? 0.5336 0.6327 0.4263 0.2383  0.0136  0.0226  64  ARG A CD  
270  N NE  . ARG A 28  ? 0.6441 0.7238 0.5023 0.2679  0.0138  0.0204  64  ARG A NE  
271  C CZ  . ARG A 28  ? 0.7600 0.8418 0.5975 0.2881  0.0172  0.0243  64  ARG A CZ  
272  N NH1 . ARG A 28  ? 0.5550 0.6599 0.4075 0.2796  0.0210  0.0316  64  ARG A NH1 
273  N NH2 . ARG A 28  ? 0.6155 0.6737 0.4146 0.3185  0.0164  0.0210  64  ARG A NH2 
274  N N   . GLY A 29  ? 0.4974 0.6135 0.3801 0.2654  0.0285  0.0394  65  GLY A N   
275  C CA  . GLY A 29  ? 0.5071 0.6374 0.3782 0.2853  0.0364  0.0497  65  GLY A CA  
276  C C   . GLY A 29  ? 0.5856 0.7112 0.4634 0.2794  0.0361  0.0487  65  GLY A C   
277  O O   . GLY A 29  ? 0.6020 0.7461 0.4756 0.2925  0.0432  0.0593  65  GLY A O   
278  N N   . LEU A 30  ? 0.5302 0.6336 0.4196 0.2609  0.0290  0.0384  66  LEU A N   
279  C CA  . LEU A 30  ? 0.5208 0.6199 0.4171 0.2561  0.0299  0.0391  66  LEU A CA  
280  C C   . LEU A 30  ? 0.6222 0.6929 0.4973 0.2755  0.0285  0.0360  66  LEU A C   
281  O O   . LEU A 30  ? 0.6319 0.6706 0.4875 0.2870  0.0214  0.0278  66  LEU A O   
282  C CB  . LEU A 30  ? 0.4948 0.5783 0.4086 0.2352  0.0247  0.0321  66  LEU A CB  
283  C CG  . LEU A 30  ? 0.5080 0.6143 0.4396 0.2165  0.0253  0.0345  66  LEU A CG  
284  C CD1 . LEU A 30  ? 0.4941 0.5789 0.4367 0.2021  0.0208  0.0270  66  LEU A CD1 
285  C CD2 . LEU A 30  ? 0.4613 0.5932 0.3993 0.2135  0.0292  0.0432  66  LEU A CD2 
286  N N   . PRO A 31  ? 0.6170 0.6939 0.4943 0.2790  0.0331  0.0417  67  PRO A N   
287  C CA  . PRO A 31  ? 0.6614 0.7068 0.5193 0.2960  0.0303  0.0387  67  PRO A CA  
288  C C   . PRO A 31  ? 0.7654 0.7655 0.6254 0.2883  0.0171  0.0279  67  PRO A C   
289  O O   . PRO A 31  ? 0.7454 0.7451 0.6290 0.2678  0.0145  0.0265  67  PRO A O   
290  C CB  . PRO A 31  ? 0.6685 0.7326 0.5364 0.2946  0.0377  0.0475  67  PRO A CB  
291  C CG  . PRO A 31  ? 0.6910 0.8000 0.5747 0.2849  0.0442  0.0566  67  PRO A CG  
292  C CD  . PRO A 31  ? 0.6116 0.7204 0.5067 0.2681  0.0391  0.0506  67  PRO A CD  
293  N N   . GLY A 32  ? 0.7577 0.7191 0.5928 0.3056  0.0078  0.0217  68  GLY A N   
294  C CA  . GLY A 32  ? 0.7810 0.6947 0.6182 0.2995  -0.0096 0.0131  68  GLY A CA  
295  C C   . GLY A 32  ? 0.8301 0.7378 0.6966 0.2836  -0.0109 0.0191  68  GLY A C   
296  O O   . GLY A 32  ? 0.8582 0.7367 0.7409 0.2715  -0.0246 0.0169  68  GLY A O   
297  N N   . ASP A 33  ? 0.7374 0.6747 0.6128 0.2837  0.0032  0.0288  69  ASP A N   
298  C CA  . ASP A 33  ? 0.7183 0.6574 0.6197 0.2722  0.0065  0.0376  69  ASP A CA  
299  C C   . ASP A 33  ? 0.7025 0.6798 0.6266 0.2561  0.0188  0.0437  69  ASP A C   
300  O O   . ASP A 33  ? 0.7040 0.6904 0.6429 0.2521  0.0260  0.0528  69  ASP A O   
301  C CB  . ASP A 33  ? 0.7582 0.6968 0.6474 0.2877  0.0122  0.0438  69  ASP A CB  
302  C CG  . ASP A 33  ? 0.8742 0.8550 0.7537 0.2964  0.0274  0.0492  69  ASP A CG  
303  O OD1 . ASP A 33  ? 0.8452 0.8494 0.7186 0.2965  0.0308  0.0470  69  ASP A OD1 
304  O OD2 . ASP A 33  ? 0.9764 0.9669 0.8558 0.3031  0.0349  0.0570  69  ASP A OD2 
305  N N   . VAL A 34  ? 0.6012 0.5978 0.5248 0.2490  0.0204  0.0392  70  VAL A N   
306  C CA  . VAL A 34  ? 0.5499 0.5754 0.4884 0.2353  0.0282  0.0425  70  VAL A CA  
307  C C   . VAL A 34  ? 0.5862 0.5997 0.5483 0.2223  0.0274  0.0464  70  VAL A C   
308  O O   . VAL A 34  ? 0.5920 0.5793 0.5642 0.2179  0.0178  0.0446  70  VAL A O   
309  C CB  . VAL A 34  ? 0.5654 0.6077 0.4990 0.2304  0.0269  0.0370  70  VAL A CB  
310  C CG1 . VAL A 34  ? 0.5602 0.5802 0.4995 0.2222  0.0175  0.0294  70  VAL A CG1 
311  C CG2 . VAL A 34  ? 0.5368 0.6093 0.4778 0.2204  0.0327  0.0408  70  VAL A CG2 
312  N N   . THR A 35  ? 0.5280 0.5606 0.4981 0.2173  0.0366  0.0528  71  THR A N   
313  C CA  . THR A 35  ? 0.5081 0.5348 0.4991 0.2089  0.0397  0.0598  71  THR A CA  
314  C C   . THR A 35  ? 0.5082 0.5500 0.4985 0.2004  0.0428  0.0566  71  THR A C   
315  O O   . THR A 35  ? 0.4681 0.5264 0.4435 0.2001  0.0423  0.0507  71  THR A O   
316  C CB  . THR A 35  ? 0.5336 0.5637 0.5311 0.2158  0.0491  0.0726  71  THR A CB  
317  O OG1 . THR A 35  ? 0.5035 0.5562 0.4838 0.2213  0.0565  0.0723  71  THR A OG1 
318  C CG2 . THR A 35  ? 0.5368 0.5484 0.5362 0.2237  0.0447  0.0766  71  THR A CG2 
319  N N   . ASN A 36  ? 0.4661 0.5023 0.4736 0.1940  0.0456  0.0625  72  ASN A N   
320  C CA  . ASN A 36  ? 0.4529 0.4991 0.4559 0.1888  0.0490  0.0598  72  ASN A CA  
321  C C   . ASN A 36  ? 0.4849 0.5457 0.4687 0.1961  0.0557  0.0614  72  ASN A C   
322  O O   . ASN A 36  ? 0.4639 0.5336 0.4326 0.1926  0.0516  0.0536  72  ASN A O   
323  C CB  . ASN A 36  ? 0.5228 0.5617 0.5474 0.1847  0.0532  0.0693  72  ASN A CB  
324  C CG  . ASN A 36  ? 0.7281 0.7529 0.7705 0.1749  0.0428  0.0661  72  ASN A CG  
325  O OD1 . ASN A 36  ? 0.6128 0.6360 0.6454 0.1695  0.0345  0.0536  72  ASN A OD1 
326  N ND2 . ASN A 36  ? 0.5887 0.6033 0.6590 0.1726  0.0419  0.0790  72  ASN A ND2 
327  N N   . GLN A 37  ? 0.4506 0.5126 0.4348 0.2064  0.0641  0.0720  73  GLN A N   
328  C CA  . GLN A 37  ? 0.4462 0.5189 0.4087 0.2157  0.0688  0.0734  73  GLN A CA  
329  C C   . GLN A 37  ? 0.4766 0.5618 0.4231 0.2139  0.0601  0.0644  73  GLN A C   
330  O O   . GLN A 37  ? 0.4884 0.5806 0.4178 0.2137  0.0559  0.0604  73  GLN A O   
331  C CB  . GLN A 37  ? 0.4724 0.5450 0.4387 0.2283  0.0794  0.0870  73  GLN A CB  
332  C CG  . GLN A 37  ? 0.5877 0.6675 0.5285 0.2406  0.0848  0.0894  73  GLN A CG  
333  C CD  . GLN A 37  ? 0.7665 0.8415 0.6921 0.2435  0.0870  0.0880  73  GLN A CD  
334  O OE1 . GLN A 37  ? 0.6826 0.7515 0.6223 0.2430  0.0938  0.0948  73  GLN A OE1 
335  N NE2 . GLN A 37  ? 0.6264 0.7026 0.5221 0.2472  0.0797  0.0797  73  GLN A NE2 
336  N N   . GLU A 38  ? 0.4537 0.5408 0.4056 0.2137  0.0564  0.0624  74  GLU A N   
337  C CA  . GLU A 38  ? 0.4500 0.5540 0.3913 0.2142  0.0503  0.0587  74  GLU A CA  
338  C C   . GLU A 38  ? 0.4679 0.5804 0.4071 0.2031  0.0417  0.0518  74  GLU A C   
339  O O   . GLU A 38  ? 0.4462 0.5747 0.3777 0.2011  0.0356  0.0522  74  GLU A O   
340  C CB  . GLU A 38  ? 0.4672 0.5683 0.4114 0.2201  0.0497  0.0589  74  GLU A CB  
341  C CG  . GLU A 38  ? 0.5084 0.6316 0.4436 0.2255  0.0475  0.0607  74  GLU A CG  
342  C CD  . GLU A 38  ? 0.5778 0.6976 0.5085 0.2377  0.0492  0.0626  74  GLU A CD  
343  O OE1 . GLU A 38  ? 0.5118 0.6075 0.4445 0.2400  0.0477  0.0590  74  GLU A OE1 
344  O OE2 . GLU A 38  ? 0.6476 0.7887 0.5722 0.2452  0.0501  0.0679  74  GLU A OE2 
345  N N   . VAL A 39  ? 0.4135 0.5151 0.3613 0.1953  0.0399  0.0468  75  VAL A N   
346  C CA  . VAL A 39  ? 0.4121 0.5200 0.3596 0.1845  0.0322  0.0411  75  VAL A CA  
347  C C   . VAL A 39  ? 0.4316 0.5366 0.3684 0.1814  0.0298  0.0400  75  VAL A C   
348  O O   . VAL A 39  ? 0.4058 0.5202 0.3369 0.1749  0.0202  0.0380  75  VAL A O   
349  C CB  . VAL A 39  ? 0.4452 0.5414 0.4029 0.1780  0.0305  0.0359  75  VAL A CB  
350  C CG1 . VAL A 39  ? 0.4316 0.5364 0.3889 0.1676  0.0233  0.0317  75  VAL A CG1 
351  C CG2 . VAL A 39  ? 0.4494 0.5414 0.4091 0.1846  0.0300  0.0354  75  VAL A CG2 
352  N N   . HIS A 40  ? 0.4366 0.5281 0.3702 0.1875  0.0377  0.0428  76  HIS A N   
353  C CA  . HIS A 40  ? 0.4840 0.5680 0.3985 0.1911  0.0364  0.0418  76  HIS A CA  
354  C C   . HIS A 40  ? 0.5172 0.6104 0.4139 0.1947  0.0277  0.0418  76  HIS A C   
355  O O   . HIS A 40  ? 0.5030 0.5926 0.3849 0.1901  0.0151  0.0369  76  HIS A O   
356  C CB  . HIS A 40  ? 0.5323 0.6050 0.4455 0.2033  0.0501  0.0499  76  HIS A CB  
357  C CG  . HIS A 40  ? 0.5993 0.6616 0.5243 0.2006  0.0558  0.0517  76  HIS A CG  
358  N ND1 . HIS A 40  ? 0.6509 0.7027 0.5586 0.2034  0.0553  0.0488  76  HIS A ND1 
359  C CD2 . HIS A 40  ? 0.6198 0.6795 0.5714 0.1967  0.0613  0.0573  76  HIS A CD2 
360  C CE1 . HIS A 40  ? 0.6326 0.6800 0.5592 0.2008  0.0623  0.0536  76  HIS A CE1 
361  N NE2 . HIS A 40  ? 0.6222 0.6743 0.5771 0.1958  0.0650  0.0592  76  HIS A NE2 
362  N N   . ASP A 41  ? 0.4727 0.5763 0.3720 0.2023  0.0323  0.0478  77  ASP A N   
363  C CA  . ASP A 41  ? 0.4912 0.6063 0.3778 0.2063  0.0244  0.0500  77  ASP A CA  
364  C C   . ASP A 41  ? 0.5147 0.6481 0.4099 0.1942  0.0100  0.0493  77  ASP A C   
365  O O   . ASP A 41  ? 0.5068 0.6442 0.3918 0.1909  -0.0045 0.0494  77  ASP A O   
366  C CB  . ASP A 41  ? 0.5132 0.6360 0.4037 0.2179  0.0347  0.0579  77  ASP A CB  
367  C CG  . ASP A 41  ? 0.5550 0.6639 0.4397 0.2310  0.0486  0.0634  77  ASP A CG  
368  O OD1 . ASP A 41  ? 0.5455 0.6406 0.4178 0.2347  0.0508  0.0622  77  ASP A OD1 
369  O OD2 . ASP A 41  ? 0.5984 0.7104 0.4912 0.2389  0.0578  0.0707  77  ASP A OD2 
370  N N   . LEU A 42  ? 0.4658 0.6096 0.3799 0.1882  0.0126  0.0500  78  LEU A N   
371  C CA  . LEU A 42  ? 0.4560 0.6215 0.3821 0.1787  0.0019  0.0538  78  LEU A CA  
372  C C   . LEU A 42  ? 0.5070 0.6650 0.4298 0.1658  -0.0125 0.0490  78  LEU A C   
373  O O   . LEU A 42  ? 0.5427 0.7142 0.4698 0.1577  -0.0278 0.0539  78  LEU A O   
374  C CB  . LEU A 42  ? 0.4376 0.6112 0.3785 0.1795  0.0096  0.0553  78  LEU A CB  
375  C CG  . LEU A 42  ? 0.4950 0.6951 0.4504 0.1735  0.0029  0.0634  78  LEU A CG  
376  C CD1 . LEU A 42  ? 0.5080 0.7344 0.4683 0.1824  0.0041  0.0760  78  LEU A CD1 
377  C CD2 . LEU A 42  ? 0.5196 0.7171 0.4814 0.1749  0.0094  0.0610  78  LEU A CD2 
378  N N   . LEU A 43  ? 0.4269 0.5624 0.3424 0.1643  -0.0088 0.0407  79  LEU A N   
379  C CA  . LEU A 43  ? 0.4533 0.5751 0.3611 0.1544  -0.0212 0.0347  79  LEU A CA  
380  C C   . LEU A 43  ? 0.5423 0.6401 0.4200 0.1625  -0.0269 0.0297  79  LEU A C   
381  O O   . LEU A 43  ? 0.5539 0.6296 0.4171 0.1622  -0.0296 0.0228  79  LEU A O   
382  C CB  . LEU A 43  ? 0.4430 0.5544 0.3593 0.1500  -0.0132 0.0294  79  LEU A CB  
383  C CG  . LEU A 43  ? 0.4969 0.6251 0.4354 0.1455  -0.0081 0.0325  79  LEU A CG  
384  C CD1 . LEU A 43  ? 0.4757 0.5891 0.4191 0.1422  -0.0022 0.0263  79  LEU A CD1 
385  C CD2 . LEU A 43  ? 0.5304 0.6803 0.4819 0.1352  -0.0202 0.0388  79  LEU A CD2 
386  N N   . SER A 44  ? 0.5277 0.6288 0.3930 0.1718  -0.0294 0.0333  80  SER A N   
387  C CA  . SER A 44  ? 0.5694 0.6464 0.4002 0.1843  -0.0342 0.0290  80  SER A CA  
388  C C   . SER A 44  ? 0.6695 0.7252 0.4789 0.1772  -0.0589 0.0216  80  SER A C   
389  O O   . SER A 44  ? 0.6910 0.7172 0.4656 0.1900  -0.0612 0.0151  80  SER A O   
390  C CB  . SER A 44  ? 0.6319 0.7182 0.4543 0.1954  -0.0336 0.0349  80  SER A CB  
391  O OG  . SER A 44  ? 0.7581 0.8665 0.5951 0.1847  -0.0499 0.0405  80  SER A OG  
392  N N   . ASP A 45  ? 0.6301 0.6985 0.4597 0.1585  -0.0768 0.0236  81  ASP A N   
393  C CA  . ASP A 45  ? 0.6627 0.7082 0.4760 0.1490  -0.1035 0.0175  81  ASP A CA  
394  C C   . ASP A 45  ? 0.6931 0.7169 0.4992 0.1466  -0.0994 0.0092  81  ASP A C   
395  O O   . ASP A 45  ? 0.7053 0.7045 0.4945 0.1402  -0.1211 0.0029  81  ASP A O   
396  C CB  . ASP A 45  ? 0.6844 0.7552 0.5291 0.1285  -0.1250 0.0275  81  ASP A CB  
397  C CG  . ASP A 45  ? 0.8060 0.8952 0.6557 0.1298  -0.1361 0.0368  81  ASP A CG  
398  O OD1 . ASP A 45  ? 0.8212 0.8894 0.6374 0.1441  -0.1404 0.0311  81  ASP A OD1 
399  O OD2 . ASP A 45  ? 0.8929 1.0186 0.7793 0.1185  -0.1391 0.0512  81  ASP A OD2 
400  N N   . TYR A 46  ? 0.6253 0.6567 0.4446 0.1515  -0.0737 0.0096  82  TYR A N   
401  C CA  . TYR A 46  ? 0.6107 0.6273 0.4292 0.1490  -0.0675 0.0040  82  TYR A CA  
402  C C   . TYR A 46  ? 0.6750 0.6780 0.4789 0.1672  -0.0448 0.0028  82  TYR A C   
403  O O   . TYR A 46  ? 0.6435 0.6596 0.4565 0.1764  -0.0277 0.0091  82  TYR A O   
404  C CB  . TYR A 46  ? 0.5771 0.6197 0.4345 0.1335  -0.0614 0.0086  82  TYR A CB  
405  C CG  . TYR A 46  ? 0.5900 0.6539 0.4689 0.1171  -0.0801 0.0156  82  TYR A CG  
406  C CD1 . TYR A 46  ? 0.6313 0.6833 0.5086 0.1037  -0.1025 0.0139  82  TYR A CD1 
407  C CD2 . TYR A 46  ? 0.5803 0.6755 0.4804 0.1164  -0.0767 0.0260  82  TYR A CD2 
408  C CE1 . TYR A 46  ? 0.6434 0.7173 0.5455 0.0881  -0.1213 0.0249  82  TYR A CE1 
409  C CE2 . TYR A 46  ? 0.5847 0.7036 0.5075 0.1032  -0.0931 0.0371  82  TYR A CE2 
410  C CZ  . TYR A 46  ? 0.6531 0.7628 0.5796 0.0882  -0.1156 0.0377  82  TYR A CZ  
411  O OH  . TYR A 46  ? 0.6096 0.7458 0.5652 0.0740  -0.1325 0.0530  82  TYR A OH  
412  N N   . GLU A 47  ? 0.6871 0.6643 0.4705 0.1724  -0.0449 -0.0031 83  GLU A N   
413  C CA  . GLU A 47  ? 0.7033 0.6696 0.4763 0.1902  -0.0230 -0.0004 83  GLU A CA  
414  C C   . GLU A 47  ? 0.6790 0.6626 0.4891 0.1798  -0.0089 0.0035  83  GLU A C   
415  O O   . GLU A 47  ? 0.6841 0.6665 0.5044 0.1658  -0.0172 -0.0012 83  GLU A O   
416  C CB  . GLU A 47  ? 0.7680 0.6978 0.4978 0.2043  -0.0297 -0.0074 83  GLU A CB  
417  C CG  . GLU A 47  ? 1.0154 0.9315 0.7152 0.2332  -0.0123 -0.0018 83  GLU A CG  
418  C CD  . GLU A 47  ? 1.3612 1.2402 1.0154 0.2519  -0.0152 -0.0075 83  GLU A CD  
419  O OE1 . GLU A 47  ? 1.2717 1.1198 0.8803 0.2617  -0.0355 -0.0169 83  GLU A OE1 
420  O OE2 . GLU A 47  ? 1.2132 1.0921 0.8766 0.2563  0.0006  -0.0029 83  GLU A OE2 
421  N N   . LEU A 48  ? 0.5731 0.5725 0.4050 0.1851  0.0097  0.0124  84  LEU A N   
422  C CA  . LEU A 48  ? 0.5237 0.5362 0.3901 0.1745  0.0183  0.0154  84  LEU A CA  
423  C C   . LEU A 48  ? 0.5941 0.5990 0.4656 0.1848  0.0348  0.0227  84  LEU A C   
424  O O   . LEU A 48  ? 0.6149 0.6190 0.4821 0.2008  0.0483  0.0327  84  LEU A O   
425  C CB  . LEU A 48  ? 0.4854 0.5187 0.3783 0.1696  0.0228  0.0203  84  LEU A CB  
426  C CG  . LEU A 48  ? 0.5296 0.5770 0.4217 0.1639  0.0115  0.0185  84  LEU A CG  
427  C CD1 . LEU A 48  ? 0.5009 0.5639 0.4142 0.1646  0.0193  0.0241  84  LEU A CD1 
428  C CD2 . LEU A 48  ? 0.5202 0.5731 0.4164 0.1484  -0.0045 0.0131  84  LEU A CD2 
429  N N   . LYS A 49  ? 0.5046 0.5060 0.3874 0.1761  0.0339  0.0200  85  LYS A N   
430  C CA  . LYS A 49  ? 0.4920 0.4914 0.3882 0.1836  0.0489  0.0299  85  LYS A CA  
431  C C   . LYS A 49  ? 0.5127 0.5281 0.4473 0.1779  0.0563  0.0394  85  LYS A C   
432  O O   . LYS A 49  ? 0.4897 0.5086 0.4379 0.1883  0.0697  0.0539  85  LYS A O   
433  C CB  . LYS A 49  ? 0.5029 0.4940 0.4003 0.1759  0.0446  0.0244  85  LYS A CB  
434  C CG  . LYS A 49  ? 0.5404 0.5311 0.4517 0.1858  0.0606  0.0375  85  LYS A CG  
435  C CD  . LYS A 49  ? 0.6777 0.6621 0.5932 0.1775  0.0566  0.0325  85  LYS A CD  
436  C CE  . LYS A 49  ? 0.7465 0.7345 0.6805 0.1872  0.0724  0.0485  85  LYS A CE  
437  N NZ  . LYS A 49  ? 0.8146 0.7938 0.7450 0.1832  0.0695  0.0437  85  LYS A NZ  
438  N N   . TYR A 50  ? 0.4477 0.4712 0.3984 0.1628  0.0464  0.0323  86  TYR A N   
439  C CA  . TYR A 50  ? 0.4362 0.4672 0.4170 0.1578  0.0483  0.0381  86  TYR A CA  
440  C C   . TYR A 50  ? 0.5039 0.5426 0.4835 0.1534  0.0407  0.0323  86  TYR A C   
441  O O   . TYR A 50  ? 0.4945 0.5377 0.4620 0.1474  0.0315  0.0233  86  TYR A O   
442  C CB  . TYR A 50  ? 0.4332 0.4619 0.4350 0.1469  0.0442  0.0364  86  TYR A CB  
443  C CG  . TYR A 50  ? 0.4610 0.4855 0.4731 0.1511  0.0529  0.0461  86  TYR A CG  
444  C CD1 . TYR A 50  ? 0.4790 0.5063 0.5043 0.1624  0.0659  0.0636  86  TYR A CD1 
445  C CD2 . TYR A 50  ? 0.4767 0.4969 0.4901 0.1441  0.0490  0.0409  86  TYR A CD2 
446  C CE1 . TYR A 50  ? 0.4457 0.4736 0.4845 0.1681  0.0757  0.0769  86  TYR A CE1 
447  C CE2 . TYR A 50  ? 0.4905 0.5089 0.5151 0.1492  0.0578  0.0517  86  TYR A CE2 
448  C CZ  . TYR A 50  ? 0.5158 0.5392 0.5544 0.1614  0.0714  0.0706  86  TYR A CZ  
449  O OH  . TYR A 50  ? 0.4882 0.5139 0.5406 0.1683  0.0818  0.0852  86  TYR A OH  
450  N N   . CYS A 51  ? 0.4755 0.5162 0.4702 0.1567  0.0442  0.0393  87  CYS A N   
451  C CA  . CYS A 51  ? 0.4790 0.5251 0.4729 0.1558  0.0386  0.0354  87  CYS A CA  
452  C C   . CYS A 51  ? 0.5115 0.5499 0.5275 0.1556  0.0377  0.0410  87  CYS A C   
453  O O   . CYS A 51  ? 0.5106 0.5471 0.5372 0.1619  0.0443  0.0522  87  CYS A O   
454  C CB  . CYS A 51  ? 0.4994 0.5527 0.4759 0.1645  0.0417  0.0374  87  CYS A CB  
455  S SG  . CYS A 51  ? 0.5509 0.6145 0.5250 0.1657  0.0361  0.0344  87  CYS A SG  
456  N N   . PHE A 52  ? 0.4251 0.4572 0.4474 0.1490  0.0282  0.0341  88  PHE A N   
457  C CA  . PHE A 52  ? 0.4370 0.4542 0.4767 0.1487  0.0218  0.0377  88  PHE A CA  
458  C C   . PHE A 52  ? 0.4923 0.5037 0.5179 0.1530  0.0130  0.0288  88  PHE A C   
459  O O   . PHE A 52  ? 0.4474 0.4596 0.4622 0.1514  0.0073  0.0197  88  PHE A O   
460  C CB  . PHE A 52  ? 0.4623 0.4690 0.5226 0.1402  0.0160  0.0398  88  PHE A CB  
461  C CG  . PHE A 52  ? 0.4995 0.5133 0.5733 0.1393  0.0266  0.0511  88  PHE A CG  
462  C CD1 . PHE A 52  ? 0.5589 0.5755 0.6496 0.1450  0.0360  0.0679  88  PHE A CD1 
463  C CD2 . PHE A 52  ? 0.5371 0.5549 0.6052 0.1351  0.0284  0.0464  88  PHE A CD2 
464  C CE1 . PHE A 52  ? 0.5802 0.6049 0.6798 0.1492  0.0485  0.0807  88  PHE A CE1 
465  C CE2 . PHE A 52  ? 0.5832 0.6058 0.6583 0.1385  0.0393  0.0571  88  PHE A CE2 
466  C CZ  . PHE A 52  ? 0.5642 0.5908 0.6535 0.1468  0.0502  0.0746  88  PHE A CZ  
467  N N   . VAL A 53  ? 0.5198 0.5249 0.5447 0.1604  0.0127  0.0329  89  VAL A N   
468  C CA  . VAL A 53  ? 0.5693 0.5660 0.5770 0.1689  0.0056  0.0259  89  VAL A CA  
469  C C   . VAL A 53  ? 0.6914 0.6581 0.7047 0.1681  -0.0098 0.0220  89  VAL A C   
470  O O   . VAL A 53  ? 0.7001 0.6528 0.7376 0.1610  -0.0152 0.0295  89  VAL A O   
471  C CB  . VAL A 53  ? 0.6439 0.6451 0.6426 0.1796  0.0110  0.0305  89  VAL A CB  
472  C CG1 . VAL A 53  ? 0.6205 0.6495 0.6092 0.1813  0.0218  0.0327  89  VAL A CG1 
473  C CG2 . VAL A 53  ? 0.6634 0.6499 0.6814 0.1798  0.0107  0.0412  89  VAL A CG2 
474  N N   . ASP A 54  ? 0.6784 0.6359 0.6691 0.1760  -0.0176 0.0118  90  ASP A N   
475  C CA  . ASP A 54  ? 0.7088 0.6325 0.6910 0.1806  -0.0353 0.0044  90  ASP A CA  
476  C C   . ASP A 54  ? 0.8039 0.7175 0.7604 0.1983  -0.0364 0.0019  90  ASP A C   
477  O O   . ASP A 54  ? 0.8026 0.7243 0.7323 0.2116  -0.0328 -0.0034 90  ASP A O   
478  C CB  . ASP A 54  ? 0.7296 0.6538 0.7001 0.1797  -0.0398 -0.0047 90  ASP A CB  
479  C CG  . ASP A 54  ? 0.8072 0.6992 0.7832 0.1750  -0.0591 -0.0101 90  ASP A CG  
480  O OD1 . ASP A 54  ? 0.8330 0.6992 0.8256 0.1705  -0.0723 -0.0060 90  ASP A OD1 
481  O OD2 . ASP A 54  ? 0.7565 0.6486 0.7214 0.1757  -0.0624 -0.0173 90  ASP A OD2 
482  N N   . LYS A 55  ? 0.7885 0.6917 0.7559 0.1989  -0.0372 0.0093  91  LYS A N   
483  C CA  . LYS A 55  ? 0.8166 0.7100 0.7657 0.2141  -0.0369 0.0100  91  LYS A CA  
484  C C   . LYS A 55  ? 0.9274 0.7895 0.8392 0.2334  -0.0501 -0.0013 91  LYS A C   
485  O O   . LYS A 55  ? 0.9400 0.8083 0.8262 0.2513  -0.0428 -0.0018 91  LYS A O   
486  C CB  . LYS A 55  ? 0.8716 0.7471 0.8463 0.2076  -0.0427 0.0203  91  LYS A CB  
487  C CG  . LYS A 55  ? 1.0580 0.9212 1.0184 0.2216  -0.0426 0.0231  91  LYS A CG  
488  C CD  . LYS A 55  ? 1.1872 1.0867 1.1554 0.2222  -0.0217 0.0333  91  LYS A CD  
489  C CE  . LYS A 55  ? 1.3818 1.2676 1.3586 0.2268  -0.0225 0.0431  91  LYS A CE  
490  N NZ  . LYS A 55  ? 1.4877 1.3641 1.5041 0.2121  -0.0275 0.0566  91  LYS A NZ  
491  N N   . TYR A 56  ? 0.9022 0.7290 0.8093 0.2318  -0.0701 -0.0095 92  TYR A N   
492  C CA  . TYR A 56  ? 0.9460 0.7345 0.8110 0.2535  -0.0854 -0.0214 92  TYR A CA  
493  C C   . TYR A 56  ? 0.9725 0.7797 0.8102 0.2662  -0.0766 -0.0276 92  TYR A C   
494  O O   . TYR A 56  ? 1.0189 0.8030 0.8148 0.2908  -0.0827 -0.0353 92  TYR A O   
495  C CB  . TYR A 56  ? 0.9936 0.7296 0.8625 0.2475  -0.1154 -0.0275 92  TYR A CB  
496  C CG  . TYR A 56  ? 1.0296 0.7425 0.9238 0.2386  -0.1270 -0.0186 92  TYR A CG  
497  C CD1 . TYR A 56  ? 1.0956 0.7766 0.9629 0.2563  -0.1357 -0.0213 92  TYR A CD1 
498  C CD2 . TYR A 56  ? 1.0131 0.7378 0.9589 0.2139  -0.1278 -0.0051 92  TYR A CD2 
499  C CE1 . TYR A 56  ? 1.1141 0.7747 1.0076 0.2474  -0.1464 -0.0111 92  TYR A CE1 
500  C CE2 . TYR A 56  ? 1.0344 0.7424 1.0086 0.2060  -0.1368 0.0074  92  TYR A CE2 
501  C CZ  . TYR A 56  ? 1.1625 0.8384 1.1115 0.2217  -0.1466 0.0043  92  TYR A CZ  
502  O OH  . TYR A 56  ? 1.1887 0.8474 1.1681 0.2132  -0.1563 0.0183  92  TYR A OH  
503  N N   . LYS A 57  ? 0.8342 0.6825 0.6942 0.2514  -0.0620 -0.0228 93  LYS A N   
504  C CA  . LYS A 57  ? 0.8011 0.6724 0.6434 0.2604  -0.0527 -0.0248 93  LYS A CA  
505  C C   . LYS A 57  ? 0.7645 0.6856 0.6127 0.2621  -0.0304 -0.0140 93  LYS A C   
506  O O   . LYS A 57  ? 0.7652 0.7119 0.6046 0.2689  -0.0213 -0.0110 93  LYS A O   
507  C CB  . LYS A 57  ? 0.8130 0.6880 0.6746 0.2425  -0.0574 -0.0279 93  LYS A CB  
508  C CG  . LYS A 57  ? 1.0199 0.8478 0.8820 0.2378  -0.0820 -0.0364 93  LYS A CG  
509  C CD  . LYS A 57  ? 1.1648 0.9866 1.0185 0.2372  -0.0893 -0.0436 93  LYS A CD  
510  C CE  . LYS A 57  ? 1.3867 1.1524 1.2182 0.2462  -0.1175 -0.0549 93  LYS A CE  
511  N NZ  . LYS A 57  ? 1.5046 1.2617 1.3226 0.2488  -0.1256 -0.0626 93  LYS A NZ  
512  N N   . GLY A 58  ? 0.6580 0.5919 0.5218 0.2564  -0.0231 -0.0068 94  GLY A N   
513  C CA  . GLY A 58  ? 0.6020 0.5797 0.4748 0.2552  -0.0061 0.0037  94  GLY A CA  
514  C C   . GLY A 58  ? 0.5983 0.6082 0.4923 0.2373  0.0005  0.0072  94  GLY A C   
515  O O   . GLY A 58  ? 0.6010 0.6458 0.4967 0.2390  0.0102  0.0152  94  GLY A O   
516  N N   . THR A 59  ? 0.5071 0.5041 0.4178 0.2207  -0.0062 0.0023  95  THR A N   
517  C CA  . THR A 59  ? 0.4897 0.5076 0.4168 0.2046  -0.0028 0.0033  95  THR A CA  
518  C C   . THR A 59  ? 0.5251 0.5484 0.4755 0.1879  0.0005  0.0068  95  THR A C   
519  O O   . THR A 59  ? 0.5598 0.5647 0.5187 0.1864  -0.0025 0.0078  95  THR A O   
520  C CB  . THR A 59  ? 0.6131 0.6095 0.5358 0.2031  -0.0129 -0.0050 95  THR A CB  
521  O OG1 . THR A 59  ? 0.6710 0.6619 0.5659 0.2233  -0.0145 -0.0075 95  THR A OG1 
522  C CG2 . THR A 59  ? 0.6395 0.6530 0.5770 0.1880  -0.0103 -0.0046 95  THR A CG2 
523  N N   . ALA A 60  ? 0.4290 0.4763 0.3883 0.1772  0.0061  0.0098  96  ALA A N   
524  C CA  . ALA A 60  ? 0.4056 0.4553 0.3795 0.1653  0.0093  0.0124  96  ALA A CA  
525  C C   . ALA A 60  ? 0.4323 0.4881 0.4119 0.1537  0.0080  0.0097  96  ALA A C   
526  O O   . ALA A 60  ? 0.4068 0.4785 0.3817 0.1525  0.0073  0.0097  96  ALA A O   
527  C CB  . ALA A 60  ? 0.4080 0.4750 0.3796 0.1672  0.0158  0.0185  96  ALA A CB  
528  N N   . PHE A 61  ? 0.3865 0.4298 0.3782 0.1460  0.0077  0.0093  97  PHE A N   
529  C CA  . PHE A 61  ? 0.3667 0.4118 0.3635 0.1360  0.0070  0.0070  97  PHE A CA  
530  C C   . PHE A 61  ? 0.4178 0.4689 0.4132 0.1336  0.0128  0.0108  97  PHE A C   
531  O O   . PHE A 61  ? 0.4205 0.4654 0.4214 0.1372  0.0182  0.0163  97  PHE A O   
532  C CB  . PHE A 61  ? 0.3802 0.4068 0.3905 0.1319  0.0027  0.0058  97  PHE A CB  
533  C CG  . PHE A 61  ? 0.4084 0.4221 0.4142 0.1357  -0.0068 -0.0001 97  PHE A CG  
534  C CD1 . PHE A 61  ? 0.4540 0.4665 0.4574 0.1321  -0.0114 -0.0054 97  PHE A CD1 
535  C CD2 . PHE A 61  ? 0.4512 0.4496 0.4525 0.1446  -0.0123 -0.0006 97  PHE A CD2 
536  C CE1 . PHE A 61  ? 0.5018 0.4989 0.4950 0.1391  -0.0209 -0.0113 97  PHE A CE1 
537  C CE2 . PHE A 61  ? 0.5051 0.4846 0.4947 0.1515  -0.0235 -0.0075 97  PHE A CE2 
538  C CZ  . PHE A 61  ? 0.4925 0.4713 0.4769 0.1495  -0.0276 -0.0130 97  PHE A CZ  
539  N N   . VAL A 62  ? 0.3842 0.4465 0.3711 0.1290  0.0108  0.0091  98  VAL A N   
540  C CA  . VAL A 62  ? 0.3898 0.4524 0.3671 0.1293  0.0127  0.0110  98  VAL A CA  
541  C C   . VAL A 62  ? 0.4466 0.5035 0.4192 0.1220  0.0090  0.0073  98  VAL A C   
542  O O   . VAL A 62  ? 0.4539 0.5175 0.4285 0.1146  0.0024  0.0047  98  VAL A O   
543  C CB  . VAL A 62  ? 0.4266 0.5041 0.3943 0.1317  0.0093  0.0133  98  VAL A CB  
544  C CG1 . VAL A 62  ? 0.4330 0.5052 0.3850 0.1329  0.0069  0.0133  98  VAL A CG1 
545  C CG2 . VAL A 62  ? 0.4277 0.5097 0.3976 0.1409  0.0140  0.0172  98  VAL A CG2 
546  N N   . THR A 63  ? 0.4090 0.4537 0.3736 0.1263  0.0137  0.0086  99  THR A N   
547  C CA  . THR A 63  ? 0.4245 0.4586 0.3776 0.1233  0.0103  0.0049  99  THR A CA  
548  C C   . THR A 63  ? 0.4908 0.5179 0.4189 0.1290  0.0055  0.0038  99  THR A C   
549  O O   . THR A 63  ? 0.4879 0.5102 0.4065 0.1410  0.0133  0.0081  99  THR A O   
550  C CB  . THR A 63  ? 0.4762 0.4991 0.4363 0.1277  0.0198  0.0086  99  THR A CB  
551  O OG1 . THR A 63  ? 0.4370 0.4638 0.4199 0.1209  0.0195  0.0089  99  THR A OG1 
552  C CG2 . THR A 63  ? 0.4397 0.4482 0.3817 0.1285  0.0173  0.0049  99  THR A CG2 
553  N N   . LEU A 64  ? 0.4632 0.4884 0.3809 0.1209  -0.0086 -0.0009 100 LEU A N   
554  C CA  . LEU A 64  ? 0.4912 0.5037 0.3819 0.1256  -0.0189 -0.0033 100 LEU A CA  
555  C C   . LEU A 64  ? 0.5981 0.5832 0.4642 0.1307  -0.0223 -0.0087 100 LEU A C   
556  O O   . LEU A 64  ? 0.5793 0.5612 0.4546 0.1289  -0.0153 -0.0090 100 LEU A O   
557  C CB  . LEU A 64  ? 0.4819 0.5079 0.3784 0.1134  -0.0363 -0.0024 100 LEU A CB  
558  C CG  . LEU A 64  ? 0.5030 0.5559 0.4186 0.1135  -0.0311 0.0045  100 LEU A CG  
559  C CD1 . LEU A 64  ? 0.4634 0.5357 0.4050 0.1060  -0.0266 0.0076  100 LEU A CD1 
560  C CD2 . LEU A 64  ? 0.5315 0.5934 0.4430 0.1099  -0.0460 0.0083  100 LEU A CD2 
561  N N   . LEU A 65  ? 0.6411 0.6044 0.4736 0.1390  -0.0334 -0.0128 101 LEU A N   
562  C CA  . LEU A 65  ? 0.7028 0.6329 0.5006 0.1495  -0.0381 -0.0188 101 LEU A CA  
563  C C   . LEU A 65  ? 0.7308 0.6507 0.5317 0.1349  -0.0521 -0.0244 101 LEU A C   
564  O O   . LEU A 65  ? 0.7449 0.6433 0.5280 0.1430  -0.0484 -0.0276 101 LEU A O   
565  C CB  . LEU A 65  ? 0.7606 0.6669 0.5183 0.1608  -0.0534 -0.0236 101 LEU A CB  
566  C CG  . LEU A 65  ? 0.8963 0.7664 0.6056 0.1863  -0.0496 -0.0273 101 LEU A CG  
567  C CD1 . LEU A 65  ? 0.9349 0.7940 0.6127 0.2037  -0.0530 -0.0273 101 LEU A CD1 
568  C CD2 . LEU A 65  ? 0.9973 0.8310 0.6754 0.1842  -0.0719 -0.0379 101 LEU A CD2 
569  N N   . ASN A 66  ? 0.6326 0.5681 0.4554 0.1150  -0.0678 -0.0235 102 ASN A N   
570  C CA  . ASN A 66  ? 0.6275 0.5560 0.4572 0.0999  -0.0825 -0.0260 102 ASN A CA  
571  C C   . ASN A 66  ? 0.6326 0.5952 0.5011 0.0809  -0.0888 -0.0179 102 ASN A C   
572  O O   . ASN A 66  ? 0.5942 0.5819 0.4788 0.0815  -0.0823 -0.0119 102 ASN A O   
573  C CB  . ASN A 66  ? 0.6727 0.5619 0.4647 0.1017  -0.1077 -0.0337 102 ASN A CB  
574  C CG  . ASN A 66  ? 0.8685 0.7543 0.6490 0.1006  -0.1267 -0.0331 102 ASN A CG  
575  O OD1 . ASN A 66  ? 0.6905 0.6022 0.5011 0.0839  -0.1380 -0.0253 102 ASN A OD1 
576  N ND2 . ASN A 66  ? 0.7871 0.6433 0.5246 0.1204  -0.1293 -0.0395 102 ASN A ND2 
577  N N   . GLY A 67  ? 0.5816 0.5451 0.4641 0.0664  -0.0998 -0.0163 103 GLY A N   
578  C CA  . GLY A 67  ? 0.5509 0.5478 0.4702 0.0510  -0.1039 -0.0052 103 GLY A CA  
579  C C   . GLY A 67  ? 0.5943 0.6045 0.5233 0.0426  -0.1222 0.0037  103 GLY A C   
580  O O   . GLY A 67  ? 0.5543 0.6004 0.5122 0.0383  -0.1169 0.0156  103 GLY A O   
581  N N   . GLU A 68  ? 0.5910 0.5709 0.4940 0.0419  -0.1449 -0.0016 104 GLU A N   
582  C CA  . GLU A 68  ? 0.6058 0.5936 0.5170 0.0328  -0.1676 0.0070  104 GLU A CA  
583  C C   . GLU A 68  ? 0.6430 0.6566 0.5599 0.0426  -0.1538 0.0116  104 GLU A C   
584  O O   . GLU A 68  ? 0.6197 0.6673 0.5671 0.0342  -0.1579 0.0263  104 GLU A O   
585  C CB  . GLU A 68  ? 0.6846 0.6246 0.5569 0.0340  -0.1962 -0.0032 104 GLU A CB  
586  C CG  . GLU A 68  ? 0.8123 0.7555 0.6907 0.0246  -0.2242 0.0049  104 GLU A CG  
587  C CD  . GLU A 68  ? 1.2527 1.1423 1.0871 0.0274  -0.2569 -0.0067 104 GLU A CD  
588  O OE1 . GLU A 68  ? 1.2511 1.1277 1.0588 0.0391  -0.2637 -0.0116 104 GLU A OE1 
589  O OE2 . GLU A 68  ? 1.2084 1.0667 1.0328 0.0189  -0.2774 -0.0110 104 GLU A OE2 
590  N N   . GLN A 69  ? 0.5954 0.5934 0.4839 0.0612  -0.1371 0.0012  105 GLN A N   
591  C CA  . GLN A 69  ? 0.5737 0.5908 0.4638 0.0723  -0.1229 0.0044  105 GLN A CA  
592  C C   . GLN A 69  ? 0.5735 0.6290 0.4978 0.0709  -0.1020 0.0134  105 GLN A C   
593  O O   . GLN A 69  ? 0.5465 0.6287 0.4865 0.0718  -0.0992 0.0227  105 GLN A O   
594  C CB  . GLN A 69  ? 0.6037 0.5947 0.4583 0.0929  -0.1085 -0.0061 105 GLN A CB  
595  C CG  . GLN A 69  ? 0.8247 0.7744 0.6361 0.1008  -0.1284 -0.0153 105 GLN A CG  
596  C CD  . GLN A 69  ? 1.2205 1.1669 1.0111 0.1145  -0.1289 -0.0154 105 GLN A CD  
597  O OE1 . GLN A 69  ? 1.2492 1.2046 1.0462 0.1067  -0.1479 -0.0104 105 GLN A OE1 
598  N NE2 . GLN A 69  ? 1.1342 1.0694 0.9019 0.1357  -0.1079 -0.0189 105 GLN A NE2 
599  N N   . ALA A 70  ? 0.5241 0.5805 0.4576 0.0698  -0.0890 0.0108  106 ALA A N   
600  C CA  . ALA A 70  ? 0.4826 0.5683 0.4421 0.0702  -0.0728 0.0177  106 ALA A CA  
601  C C   . ALA A 70  ? 0.4946 0.6129 0.4829 0.0596  -0.0821 0.0334  106 ALA A C   
602  O O   . ALA A 70  ? 0.4420 0.5869 0.4437 0.0656  -0.0728 0.0423  106 ALA A O   
603  C CB  . ALA A 70  ? 0.4835 0.5596 0.4449 0.0700  -0.0628 0.0117  106 ALA A CB  
604  N N   . GLU A 71  ? 0.4854 0.6014 0.4831 0.0449  -0.1013 0.0389  107 GLU A N   
605  C CA  . GLU A 71  ? 0.4800 0.6296 0.5110 0.0337  -0.1117 0.0590  107 GLU A CA  
606  C C   . GLU A 71  ? 0.5029 0.6698 0.5405 0.0342  -0.1207 0.0692  107 GLU A C   
607  O O   . GLU A 71  ? 0.4712 0.6765 0.5357 0.0355  -0.1149 0.0873  107 GLU A O   
608  C CB  . GLU A 71  ? 0.5178 0.6556 0.5583 0.0161  -0.1342 0.0634  107 GLU A CB  
609  C CG  . GLU A 71  ? 0.6537 0.8299 0.7366 0.0033  -0.1435 0.0889  107 GLU A CG  
610  C CD  . GLU A 71  ? 1.0639 1.2273 1.1606 -0.0167 -0.1716 0.0964  107 GLU A CD  
611  O OE1 . GLU A 71  ? 0.9862 1.1051 1.0533 -0.0200 -0.1859 0.0790  107 GLU A OE1 
612  O OE2 . GLU A 71  ? 1.0640 1.2619 1.2015 -0.0282 -0.1798 0.1216  107 GLU A OE2 
613  N N   . ALA A 72  ? 0.4831 0.6218 0.4942 0.0359  -0.1338 0.0585  108 ALA A N   
614  C CA  . ALA A 72  ? 0.4871 0.6370 0.5000 0.0370  -0.1446 0.0661  108 ALA A CA  
615  C C   . ALA A 72  ? 0.5191 0.6931 0.5342 0.0530  -0.1201 0.0689  108 ALA A C   
616  O O   . ALA A 72  ? 0.4942 0.7021 0.5325 0.0529  -0.1206 0.0859  108 ALA A O   
617  C CB  . ALA A 72  ? 0.5312 0.6388 0.5060 0.0398  -0.1625 0.0510  108 ALA A CB  
618  N N   . ALA A 73  ? 0.4710 0.6279 0.4647 0.0666  -0.0993 0.0543  109 ALA A N   
619  C CA  . ALA A 73  ? 0.4481 0.6187 0.4407 0.0820  -0.0774 0.0545  109 ALA A CA  
620  C C   . ALA A 73  ? 0.4267 0.6323 0.4457 0.0841  -0.0660 0.0686  109 ALA A C   
621  O O   . ALA A 73  ? 0.3858 0.6125 0.4104 0.0943  -0.0569 0.0770  109 ALA A O   
622  C CB  . ALA A 73  ? 0.4572 0.6009 0.4287 0.0921  -0.0615 0.0389  109 ALA A CB  
623  N N   . ILE A 74  ? 0.3765 0.5875 0.4093 0.0767  -0.0663 0.0721  110 ILE A N   
624  C CA  . ILE A 74  ? 0.3563 0.5987 0.4097 0.0823  -0.0547 0.0864  110 ILE A CA  
625  C C   . ILE A 74  ? 0.4281 0.7089 0.5088 0.0786  -0.0627 0.1105  110 ILE A C   
626  O O   . ILE A 74  ? 0.4210 0.7283 0.5086 0.0927  -0.0496 0.1224  110 ILE A O   
627  C CB  . ILE A 74  ? 0.3804 0.6182 0.4409 0.0754  -0.0542 0.0852  110 ILE A CB  
628  C CG1 . ILE A 74  ? 0.3771 0.5844 0.4155 0.0824  -0.0428 0.0652  110 ILE A CG1 
629  C CG2 . ILE A 74  ? 0.3410 0.6165 0.4258 0.0805  -0.0463 0.1062  110 ILE A CG2 
630  C CD1 . ILE A 74  ? 0.4608 0.6568 0.5025 0.0734  -0.0457 0.0610  110 ILE A CD1 
631  N N   . ASN A 75  ? 0.3946 0.6768 0.4907 0.0603  -0.0858 0.1187  111 ASN A N   
632  C CA  . ASN A 75  ? 0.3964 0.7163 0.5257 0.0532  -0.0979 0.1451  111 ASN A CA  
633  C C   . ASN A 75  ? 0.4236 0.7534 0.5467 0.0629  -0.0961 0.1478  111 ASN A C   
634  O O   . ASN A 75  ? 0.4006 0.7706 0.5494 0.0676  -0.0924 0.1713  111 ASN A O   
635  C CB  . ASN A 75  ? 0.4457 0.7558 0.5902 0.0300  -0.1283 0.1508  111 ASN A CB  
636  C CG  . ASN A 75  ? 0.6914 0.9995 0.8500 0.0195  -0.1309 0.1545  111 ASN A CG  
637  O OD1 . ASN A 75  ? 0.5614 0.8983 0.7386 0.0266  -0.1137 0.1684  111 ASN A OD1 
638  N ND2 . ASN A 75  ? 0.6016 0.8731 0.7477 0.0049  -0.1521 0.1417  111 ASN A ND2 
639  N N   . ALA A 76  ? 0.4080 0.7032 0.4973 0.0680  -0.0965 0.1257  112 ALA A N   
640  C CA  . ALA A 76  ? 0.4187 0.7204 0.4996 0.0776  -0.0950 0.1273  112 ALA A CA  
641  C C   . ALA A 76  ? 0.4381 0.7545 0.5129 0.0989  -0.0684 0.1283  112 ALA A C   
642  O O   . ALA A 76  ? 0.4396 0.7807 0.5230 0.1069  -0.0656 0.1415  112 ALA A O   
643  C CB  . ALA A 76  ? 0.4530 0.7128 0.4989 0.0780  -0.1041 0.1057  112 ALA A CB  
644  N N   . PHE A 77  ? 0.3860 0.6848 0.4449 0.1083  -0.0510 0.1146  113 PHE A N   
645  C CA  . PHE A 77  ? 0.3639 0.6647 0.4101 0.1289  -0.0302 0.1117  113 PHE A CA  
646  C C   . PHE A 77  ? 0.3914 0.7104 0.4448 0.1410  -0.0156 0.1209  113 PHE A C   
647  O O   . PHE A 77  ? 0.3810 0.7038 0.4233 0.1603  -0.0015 0.1222  113 PHE A O   
648  C CB  . PHE A 77  ? 0.3851 0.6463 0.4033 0.1339  -0.0236 0.0889  113 PHE A CB  
649  C CG  . PHE A 77  ? 0.4239 0.6713 0.4301 0.1301  -0.0337 0.0834  113 PHE A CG  
650  C CD1 . PHE A 77  ? 0.4662 0.7264 0.4701 0.1397  -0.0313 0.0901  113 PHE A CD1 
651  C CD2 . PHE A 77  ? 0.4558 0.6777 0.4510 0.1187  -0.0469 0.0727  113 PHE A CD2 
652  C CE1 . PHE A 77  ? 0.4960 0.7430 0.4862 0.1380  -0.0414 0.0855  113 PHE A CE1 
653  C CE2 . PHE A 77  ? 0.5044 0.7112 0.4828 0.1189  -0.0572 0.0680  113 PHE A CE2 
654  C CZ  . PHE A 77  ? 0.4835 0.7029 0.4594 0.1284  -0.0544 0.0742  113 PHE A CZ  
655  N N   . HIS A 78  ? 0.3406 0.6697 0.4101 0.1320  -0.0194 0.1282  114 HIS A N   
656  C CA  . HIS A 78  ? 0.3515 0.6997 0.4254 0.1468  -0.0053 0.1393  114 HIS A CA  
657  C C   . HIS A 78  ? 0.4118 0.8036 0.5038 0.1597  0.0012  0.1662  114 HIS A C   
658  O O   . HIS A 78  ? 0.3760 0.7955 0.4963 0.1469  -0.0109 0.1849  114 HIS A O   
659  C CB  . HIS A 78  ? 0.3542 0.7069 0.4436 0.1348  -0.0102 0.1442  114 HIS A CB  
660  C CG  . HIS A 78  ? 0.4015 0.7738 0.4919 0.1532  0.0051  0.1568  114 HIS A CG  
661  N ND1 . HIS A 78  ? 0.4391 0.7869 0.4990 0.1727  0.0179  0.1413  114 HIS A ND1 
662  C CD2 . HIS A 78  ? 0.4230 0.8358 0.5403 0.1567  0.0088  0.1847  114 HIS A CD2 
663  C CE1 . HIS A 78  ? 0.4405 0.8114 0.5035 0.1894  0.0290  0.1578  114 HIS A CE1 
664  N NE2 . HIS A 78  ? 0.4323 0.8451 0.5307 0.1812  0.0259  0.1855  114 HIS A NE2 
665  N N   . GLN A 79  ? 0.3981 0.7919 0.4711 0.1860  0.0188  0.1673  115 GLN A N   
666  C CA  . GLN A 79  ? 0.4137 0.8448 0.4947 0.2064  0.0301  0.1913  115 GLN A CA  
667  C C   . GLN A 79  ? 0.4762 0.9124 0.5588 0.2048  0.0252  0.1927  115 GLN A C   
668  O O   . GLN A 79  ? 0.4961 0.9635 0.5862 0.2212  0.0339  0.2130  115 GLN A O   
669  C CB  . GLN A 79  ? 0.4271 0.9076 0.5454 0.2050  0.0312  0.2247  115 GLN A CB  
670  C CG  . GLN A 79  ? 0.5650 1.0435 0.6732 0.2189  0.0432  0.2261  115 GLN A CG  
671  C CD  . GLN A 79  ? 0.7447 1.2664 0.8925 0.2120  0.0423  0.2572  115 GLN A CD  
672  O OE1 . GLN A 79  ? 0.6444 1.1978 0.8329 0.1926  0.0294  0.2790  115 GLN A OE1 
673  N NE2 . GLN A 79  ? 0.7347 1.2562 0.8718 0.2271  0.0542  0.2600  115 GLN A NE2 
674  N N   . SER A 80  ? 0.4222 0.8256 0.4931 0.1893  0.0136  0.1710  116 SER A N   
675  C CA  . SER A 80  ? 0.4141 0.8174 0.4800 0.1912  0.0105  0.1699  116 SER A CA  
676  C C   . SER A 80  ? 0.4677 0.8491 0.5023 0.2152  0.0265  0.1579  116 SER A C   
677  O O   . SER A 80  ? 0.4466 0.8098 0.4634 0.2276  0.0359  0.1491  116 SER A O   
678  C CB  . SER A 80  ? 0.4215 0.7970 0.4822 0.1704  -0.0063 0.1529  116 SER A CB  
679  O OG  . SER A 80  ? 0.4822 0.8154 0.5150 0.1735  -0.0004 0.1279  116 SER A OG  
680  N N   . ARG A 81  ? 0.4455 0.8247 0.4720 0.2212  0.0273  0.1566  117 ARG A N   
681  C CA  . ARG A 81  ? 0.4575 0.8157 0.4565 0.2434  0.0401  0.1475  117 ARG A CA  
682  C C   . ARG A 81  ? 0.5145 0.8403 0.4984 0.2378  0.0363  0.1295  117 ARG A C   
683  O O   . ARG A 81  ? 0.4963 0.8279 0.4887 0.2251  0.0266  0.1308  117 ARG A O   
684  C CB  . ARG A 81  ? 0.4390 0.8313 0.4418 0.2645  0.0501  0.1693  117 ARG A CB  
685  C CG  . ARG A 81  ? 0.5338 0.9516 0.5401 0.2829  0.0615  0.1871  117 ARG A CG  
686  C CD  . ARG A 81  ? 0.7494 1.2035 0.7590 0.3074  0.0737  0.2118  117 ARG A CD  
687  N NE  . ARG A 81  ? 0.9836 1.4215 0.9588 0.3409  0.0896  0.2095  117 ARG A NE  
688  C CZ  . ARG A 81  ? 1.1931 1.6424 1.1629 0.3582  0.0993  0.2204  117 ARG A CZ  
689  N NH1 . ARG A 81  ? 1.0045 1.4861 1.0067 0.3433  0.0960  0.2366  117 ARG A NH1 
690  N NH2 . ARG A 81  ? 1.0372 1.4632 0.9671 0.3916  0.1113  0.2153  117 ARG A NH2 
691  N N   . LEU A 82  ? 0.4928 0.7830 0.4538 0.2485  0.0430  0.1139  118 LEU A N   
692  C CA  . LEU A 82  ? 0.4875 0.7483 0.4364 0.2467  0.0423  0.1007  118 LEU A CA  
693  C C   . LEU A 82  ? 0.5465 0.7961 0.4773 0.2695  0.0517  0.1014  118 LEU A C   
694  O O   . LEU A 82  ? 0.5586 0.7876 0.4739 0.2824  0.0554  0.0955  118 LEU A O   
695  C CB  . LEU A 82  ? 0.4674 0.6926 0.4116 0.2347  0.0384  0.0831  118 LEU A CB  
696  C CG  . LEU A 82  ? 0.5282 0.7269 0.4648 0.2341  0.0395  0.0744  118 LEU A CG  
697  C CD1 . LEU A 82  ? 0.5391 0.7508 0.4799 0.2261  0.0352  0.0786  118 LEU A CD1 
698  C CD2 . LEU A 82  ? 0.5002 0.6675 0.4362 0.2253  0.0376  0.0619  118 LEU A CD2 
699  N N   . ARG A 83  ? 0.5178 0.7784 0.4479 0.2757  0.0541  0.1084  119 ARG A N   
700  C CA  . ARG A 83  ? 0.5488 0.7994 0.4612 0.2982  0.0626  0.1105  119 ARG A CA  
701  C C   . ARG A 83  ? 0.6188 0.8782 0.5193 0.3200  0.0700  0.1185  119 ARG A C   
702  O O   . ARG A 83  ? 0.6430 0.8706 0.5192 0.3373  0.0729  0.1101  119 ARG A O   
703  C CB  . ARG A 83  ? 0.5474 0.7530 0.4466 0.2983  0.0618  0.0951  119 ARG A CB  
704  C CG  . ARG A 83  ? 0.5437 0.7469 0.4524 0.2836  0.0587  0.0925  119 ARG A CG  
705  C CD  . ARG A 83  ? 0.6037 0.7707 0.5056 0.2859  0.0602  0.0845  119 ARG A CD  
706  N NE  . ARG A 83  ? 0.5262 0.6647 0.4316 0.2756  0.0555  0.0737  119 ARG A NE  
707  C CZ  . ARG A 83  ? 0.6821 0.7885 0.5795 0.2825  0.0529  0.0673  119 ARG A CZ  
708  N NH1 . ARG A 83  ? 0.6824 0.7775 0.5631 0.3015  0.0546  0.0691  119 ARG A NH1 
709  N NH2 . ARG A 83  ? 0.5813 0.6647 0.4860 0.2713  0.0468  0.0593  119 ARG A NH2 
710  N N   . GLU A 84  ? 0.5629 0.8648 0.4815 0.3186  0.0714  0.1357  120 GLU A N   
711  C CA  . GLU A 84  ? 0.5671 0.8931 0.4822 0.3392  0.0805  0.1514  120 GLU A CA  
712  C C   . GLU A 84  ? 0.6248 0.9290 0.5266 0.3430  0.0805  0.1416  120 GLU A C   
713  O O   . GLU A 84  ? 0.6190 0.9414 0.5139 0.3634  0.0894  0.1550  120 GLU A O   
714  C CB  . GLU A 84  ? 0.6041 0.9311 0.4966 0.3709  0.0922  0.1601  120 GLU A CB  
715  C CG  . GLU A 84  ? 0.6746 1.0357 0.5843 0.3703  0.0940  0.1763  120 GLU A CG  
716  C CD  . GLU A 84  ? 0.7876 1.1442 0.6733 0.4006  0.1051  0.1825  120 GLU A CD  
717  O OE1 . GLU A 84  ? 0.7519 1.0801 0.6045 0.4262  0.1118  0.1764  120 GLU A OE1 
718  O OE2 . GLU A 84  ? 0.6186 0.9980 0.5161 0.3998  0.1059  0.1934  120 GLU A OE2 
719  N N   . ARG A 85  ? 0.5644 0.8318 0.4625 0.3256  0.0713  0.1206  121 ARG A N   
720  C CA  . ARG A 85  ? 0.5810 0.8287 0.4686 0.3272  0.0693  0.1115  121 ARG A CA  
721  C C   . ARG A 85  ? 0.5955 0.8753 0.5124 0.3067  0.0658  0.1207  121 ARG A C   
722  O O   . ARG A 85  ? 0.5833 0.8678 0.5207 0.2819  0.0574  0.1175  121 ARG A O   
723  C CB  . ARG A 85  ? 0.5840 0.7794 0.4582 0.3178  0.0600  0.0876  121 ARG A CB  
724  C CG  . ARG A 85  ? 0.7631 0.9154 0.6041 0.3402  0.0590  0.0771  121 ARG A CG  
725  C CD  . ARG A 85  ? 0.8866 1.0369 0.7250 0.3464  0.0620  0.0803  121 ARG A CD  
726  N NE  . ARG A 85  ? 1.0359 1.1352 0.8518 0.3556  0.0550  0.0666  121 ARG A NE  
727  C CZ  . ARG A 85  ? 1.2093 1.2964 1.0253 0.3565  0.0549  0.0664  121 ARG A CZ  
728  N NH1 . ARG A 85  ? 0.8924 1.0138 0.7266 0.3496  0.0619  0.0774  121 ARG A NH1 
729  N NH2 . ARG A 85  ? 1.1178 1.1566 0.9169 0.3632  0.0458  0.0556  121 ARG A NH2 
730  N N   . GLU A 86  ? 0.5445 0.8450 0.4623 0.3182  0.0718  0.1331  122 GLU A N   
731  C CA  . GLU A 86  ? 0.5111 0.8399 0.4592 0.2974  0.0670  0.1428  122 GLU A CA  
732  C C   . GLU A 86  ? 0.5223 0.8161 0.4655 0.2804  0.0582  0.1215  122 GLU A C   
733  O O   . GLU A 86  ? 0.5065 0.7670 0.4239 0.2930  0.0591  0.1077  122 GLU A O   
734  C CB  . GLU A 86  ? 0.5304 0.9000 0.4881 0.3145  0.0775  0.1685  122 GLU A CB  
735  C CG  . GLU A 86  ? 0.6600 1.0659 0.6589 0.2894  0.0701  0.1846  122 GLU A CG  
736  C CD  . GLU A 86  ? 0.9205 1.3673 0.9354 0.3029  0.0801  0.2122  122 GLU A CD  
737  O OE1 . GLU A 86  ? 0.7537 1.1847 0.7517 0.3126  0.0846  0.2057  122 GLU A OE1 
738  O OE2 . GLU A 86  ? 0.9095 1.4055 0.9566 0.3031  0.0828  0.2420  122 GLU A OE2 
739  N N   . LEU A 87  ? 0.4531 0.7532 0.4201 0.2527  0.0482  0.1192  123 LEU A N   
740  C CA  . LEU A 87  ? 0.4305 0.7006 0.3952 0.2364  0.0406  0.1010  123 LEU A CA  
741  C C   . LEU A 87  ? 0.4536 0.7417 0.4333 0.2289  0.0392  0.1094  123 LEU A C   
742  O O   . LEU A 87  ? 0.4373 0.7650 0.4399 0.2266  0.0401  0.1309  123 LEU A O   
743  C CB  . LEU A 87  ? 0.4091 0.6673 0.3835 0.2141  0.0310  0.0913  123 LEU A CB  
744  C CG  . LEU A 87  ? 0.4623 0.7091 0.4269 0.2198  0.0327  0.0870  123 LEU A CG  
745  C CD1 . LEU A 87  ? 0.4534 0.6895 0.4244 0.2009  0.0242  0.0793  123 LEU A CD1 
746  C CD2 . LEU A 87  ? 0.4834 0.6952 0.4247 0.2352  0.0373  0.0744  123 LEU A CD2 
747  N N   . SER A 88  ? 0.4132 0.6729 0.3817 0.2258  0.0367  0.0943  124 SER A N   
748  C CA  . SER A 88  ? 0.4076 0.6772 0.3899 0.2148  0.0338  0.0982  124 SER A CA  
749  C C   . SER A 88  ? 0.4669 0.7116 0.4552 0.1902  0.0230  0.0816  124 SER A C   
750  O O   . SER A 88  ? 0.4809 0.6923 0.4546 0.1899  0.0213  0.0645  124 SER A O   
751  C CB  . SER A 88  ? 0.4613 0.7201 0.4232 0.2347  0.0404  0.0962  124 SER A CB  
752  O OG  . SER A 88  ? 0.5985 0.8178 0.5474 0.2275  0.0336  0.0747  124 SER A OG  
753  N N   . VAL A 89  ? 0.3930 0.6542 0.4035 0.1704  0.0150  0.0886  125 VAL A N   
754  C CA  . VAL A 89  ? 0.3687 0.6063 0.3809 0.1505  0.0052  0.0745  125 VAL A CA  
755  C C   . VAL A 89  ? 0.4279 0.6720 0.4536 0.1382  -0.0001 0.0785  125 VAL A C   
756  O O   . VAL A 89  ? 0.4113 0.6858 0.4578 0.1331  -0.0034 0.0968  125 VAL A O   
757  C CB  . VAL A 89  ? 0.3891 0.6276 0.4061 0.1392  -0.0035 0.0748  125 VAL A CB  
758  C CG1 . VAL A 89  ? 0.3773 0.5843 0.3857 0.1268  -0.0099 0.0583  125 VAL A CG1 
759  C CG2 . VAL A 89  ? 0.3821 0.6223 0.3893 0.1527  0.0028  0.0757  125 VAL A CG2 
760  N N   . GLN A 90  ? 0.3999 0.6167 0.4167 0.1331  -0.0012 0.0633  126 GLN A N   
761  C CA  . GLN A 90  ? 0.3975 0.6166 0.4247 0.1222  -0.0057 0.0654  126 GLN A CA  
762  C C   . GLN A 90  ? 0.4254 0.6122 0.4444 0.1115  -0.0103 0.0479  126 GLN A C   
763  O O   . GLN A 90  ? 0.4080 0.5727 0.4145 0.1153  -0.0079 0.0362  126 GLN A O   
764  C CB  . GLN A 90  ? 0.4120 0.6404 0.4350 0.1378  0.0034  0.0712  126 GLN A CB  
765  C CG  . GLN A 90  ? 0.5348 0.7337 0.5330 0.1528  0.0086  0.0553  126 GLN A CG  
766  C CD  . GLN A 90  ? 0.9264 1.1216 0.9147 0.1648  0.0124  0.0551  126 GLN A CD  
767  O OE1 . GLN A 90  ? 0.8438 1.0615 0.8440 0.1638  0.0145  0.0683  126 GLN A OE1 
768  N NE2 . GLN A 90  ? 0.9257 1.0901 0.8921 0.1761  0.0118  0.0405  126 GLN A NE2 
769  N N   . LEU A 91  ? 0.3832 0.5678 0.4102 0.0997  -0.0160 0.0481  127 LEU A N   
770  C CA  . LEU A 91  ? 0.3766 0.5320 0.3950 0.0927  -0.0183 0.0333  127 LEU A CA  
771  C C   . LEU A 91  ? 0.3947 0.5360 0.4032 0.1044  -0.0106 0.0247  127 LEU A C   
772  O O   . LEU A 91  ? 0.3898 0.5426 0.3968 0.1155  -0.0060 0.0303  127 LEU A O   
773  C CB  . LEU A 91  ? 0.3845 0.5389 0.4120 0.0785  -0.0268 0.0356  127 LEU A CB  
774  C CG  . LEU A 91  ? 0.4491 0.6028 0.4815 0.0645  -0.0409 0.0397  127 LEU A CG  
775  C CD1 . LEU A 91  ? 0.4538 0.6084 0.4980 0.0514  -0.0506 0.0452  127 LEU A CD1 
776  C CD2 . LEU A 91  ? 0.4613 0.5864 0.4746 0.0642  -0.0438 0.0263  127 LEU A CD2 
777  N N   . GLN A 92  ? 0.3813 0.4976 0.3826 0.1041  -0.0098 0.0131  128 GLN A N   
778  C CA  . GLN A 92  ? 0.3923 0.4923 0.3874 0.1129  -0.0073 0.0059  128 GLN A CA  
779  C C   . GLN A 92  ? 0.4661 0.5656 0.4626 0.1113  -0.0089 0.0051  128 GLN A C   
780  O O   . GLN A 92  ? 0.4615 0.5579 0.4645 0.0996  -0.0117 0.0038  128 GLN A O   
781  C CB  . GLN A 92  ? 0.3962 0.4729 0.3918 0.1097  -0.0075 -0.0020 128 GLN A CB  
782  C CG  . GLN A 92  ? 0.4794 0.5376 0.4721 0.1178  -0.0094 -0.0075 128 GLN A CG  
783  C CD  . GLN A 92  ? 0.6319 0.6716 0.6335 0.1136  -0.0101 -0.0100 128 GLN A CD  
784  O OE1 . GLN A 92  ? 0.5440 0.5849 0.5502 0.1086  -0.0059 -0.0074 128 GLN A OE1 
785  N NE2 . GLN A 92  ? 0.5497 0.5711 0.5537 0.1170  -0.0161 -0.0135 128 GLN A NE2 
786  N N   . PRO A 93  ? 0.4343 0.5339 0.4215 0.1250  -0.0075 0.0054  129 PRO A N   
787  C CA  . PRO A 93  ? 0.4514 0.5485 0.4369 0.1260  -0.0089 0.0043  129 PRO A CA  
788  C C   . PRO A 93  ? 0.5221 0.5948 0.5107 0.1174  -0.0140 -0.0063 129 PRO A C   
789  O O   . PRO A 93  ? 0.5244 0.5793 0.5137 0.1165  -0.0164 -0.0123 129 PRO A O   
790  C CB  . PRO A 93  ? 0.4861 0.5789 0.4521 0.1476  -0.0076 0.0041  129 PRO A CB  
791  C CG  . PRO A 93  ? 0.5394 0.6454 0.5017 0.1567  -0.0028 0.0108  129 PRO A CG  
792  C CD  . PRO A 93  ? 0.4660 0.5634 0.4388 0.1428  -0.0052 0.0059  129 PRO A CD  
793  N N   . THR A 94  ? 0.4879 0.5621 0.4813 0.1107  -0.0152 -0.0060 130 THR A N   
794  C CA  . THR A 94  ? 0.4882 0.5426 0.4860 0.1038  -0.0194 -0.0138 130 THR A CA  
795  C C   . THR A 94  ? 0.5090 0.5592 0.4984 0.1118  -0.0223 -0.0156 130 THR A C   
796  O O   . THR A 94  ? 0.5195 0.5870 0.5041 0.1184  -0.0185 -0.0084 130 THR A O   
797  C CB  . THR A 94  ? 0.5420 0.5972 0.5506 0.0890  -0.0185 -0.0128 130 THR A CB  
798  O OG1 . THR A 94  ? 0.4964 0.5358 0.5096 0.0852  -0.0210 -0.0179 130 THR A OG1 
799  C CG2 . THR A 94  ? 0.4716 0.5445 0.4839 0.0828  -0.0181 -0.0053 130 THR A CG2 
800  N N   . ASP A 95  ? 0.4574 0.4855 0.4459 0.1123  -0.0294 -0.0235 131 ASP A N   
801  C CA  . ASP A 95  ? 0.4747 0.4928 0.4531 0.1198  -0.0351 -0.0273 131 ASP A CA  
802  C C   . ASP A 95  ? 0.4741 0.4879 0.4674 0.1063  -0.0366 -0.0286 131 ASP A C   
803  O O   . ASP A 95  ? 0.4880 0.4889 0.4774 0.1094  -0.0437 -0.0329 131 ASP A O   
804  C CB  . ASP A 95  ? 0.5236 0.5140 0.4873 0.1321  -0.0471 -0.0357 131 ASP A CB  
805  C CG  . ASP A 95  ? 0.7158 0.6878 0.6963 0.1221  -0.0550 -0.0388 131 ASP A CG  
806  O OD1 . ASP A 95  ? 0.7339 0.7163 0.7344 0.1088  -0.0480 -0.0342 131 ASP A OD1 
807  O OD2 . ASP A 95  ? 0.8564 0.8032 0.8292 0.1291  -0.0687 -0.0445 131 ASP A OD2 
808  N N   . ALA A 96  ? 0.4080 0.4301 0.4156 0.0931  -0.0309 -0.0250 132 ALA A N   
809  C CA  . ALA A 96  ? 0.3990 0.4155 0.4183 0.0827  -0.0308 -0.0254 132 ALA A CA  
810  C C   . ALA A 96  ? 0.4073 0.4363 0.4281 0.0749  -0.0259 -0.0208 132 ALA A C   
811  O O   . ALA A 96  ? 0.3695 0.3930 0.3960 0.0671  -0.0242 -0.0206 132 ALA A O   
812  C CB  . ALA A 96  ? 0.3928 0.4009 0.4240 0.0776  -0.0293 -0.0247 132 ALA A CB  
813  N N   . LEU A 97  ? 0.3701 0.4150 0.3861 0.0781  -0.0244 -0.0154 133 LEU A N   
814  C CA  . LEU A 97  ? 0.3550 0.4102 0.3766 0.0687  -0.0232 -0.0089 133 LEU A CA  
815  C C   . LEU A 97  ? 0.3785 0.4378 0.4005 0.0704  -0.0234 -0.0058 133 LEU A C   
816  O O   . LEU A 97  ? 0.3742 0.4418 0.3895 0.0820  -0.0219 -0.0027 133 LEU A O   
817  C CB  . LEU A 97  ? 0.3579 0.4325 0.3826 0.0670  -0.0223 0.0005  133 LEU A CB  
818  C CG  . LEU A 97  ? 0.3975 0.4833 0.4323 0.0561  -0.0254 0.0106  133 LEU A CG  
819  C CD1 . LEU A 97  ? 0.3884 0.4555 0.4217 0.0442  -0.0310 0.0053  133 LEU A CD1 
820  C CD2 . LEU A 97  ? 0.4225 0.5324 0.4662 0.0559  -0.0259 0.0240  133 LEU A CD2 
821  N N   . LEU A 98  ? 0.3366 0.3883 0.3637 0.0609  -0.0247 -0.0064 134 LEU A N   
822  C CA  . LEU A 98  ? 0.3269 0.3823 0.3559 0.0609  -0.0246 -0.0025 134 LEU A CA  
823  C C   . LEU A 98  ? 0.3662 0.4304 0.4039 0.0500  -0.0262 0.0072  134 LEU A C   
824  O O   . LEU A 98  ? 0.3571 0.4126 0.3959 0.0403  -0.0303 0.0061  134 LEU A O   
825  C CB  . LEU A 98  ? 0.3217 0.3587 0.3504 0.0591  -0.0261 -0.0104 134 LEU A CB  
826  C CG  . LEU A 98  ? 0.3611 0.3857 0.3873 0.0666  -0.0290 -0.0183 134 LEU A CG  
827  C CD1 . LEU A 98  ? 0.3448 0.3563 0.3780 0.0623  -0.0305 -0.0212 134 LEU A CD1 
828  C CD2 . LEU A 98  ? 0.4118 0.4391 0.4269 0.0800  -0.0320 -0.0192 134 LEU A CD2 
829  N N   . CYS A 99  ? 0.3424 0.4210 0.3854 0.0523  -0.0246 0.0173  135 CYS A N   
830  C CA  . CYS A 99  ? 0.3418 0.4248 0.3967 0.0404  -0.0285 0.0274  135 CYS A CA  
831  C C   . CYS A 99  ? 0.3525 0.4228 0.4043 0.0403  -0.0279 0.0230  135 CYS A C   
832  O O   . CYS A 99  ? 0.3490 0.4234 0.3952 0.0517  -0.0235 0.0220  135 CYS A O   
833  C CB  . CYS A 99  ? 0.3530 0.4658 0.4232 0.0413  -0.0269 0.0476  135 CYS A CB  
834  S SG  . CYS A 99  ? 0.3977 0.5138 0.4887 0.0239  -0.0355 0.0632  135 CYS A SG  
835  N N   . VAL A 100 ? 0.3017 0.3533 0.3531 0.0295  -0.0331 0.0192  136 VAL A N   
836  C CA  . VAL A 100 ? 0.3222 0.3613 0.3713 0.0288  -0.0326 0.0162  136 VAL A CA  
837  C C   . VAL A 100 ? 0.3867 0.4322 0.4476 0.0193  -0.0376 0.0298  136 VAL A C   
838  O O   . VAL A 100 ? 0.3669 0.4032 0.4307 0.0080  -0.0468 0.0326  136 VAL A O   
839  C CB  . VAL A 100 ? 0.3576 0.3700 0.3962 0.0270  -0.0336 0.0042  136 VAL A CB  
840  C CG1 . VAL A 100 ? 0.3559 0.3584 0.3933 0.0281  -0.0320 0.0029  136 VAL A CG1 
841  C CG2 . VAL A 100 ? 0.3572 0.3667 0.3912 0.0346  -0.0296 -0.0045 136 VAL A CG2 
842  N N   . ALA A 101 ? 0.3501 0.4105 0.4179 0.0243  -0.0330 0.0392  137 ALA A N   
843  C CA  . ALA A 101 ? 0.3504 0.4204 0.4350 0.0148  -0.0376 0.0562  137 ALA A CA  
844  C C   . ALA A 101 ? 0.3929 0.4523 0.4758 0.0146  -0.0365 0.0561  137 ALA A C   
845  O O   . ALA A 101 ? 0.3745 0.4224 0.4440 0.0229  -0.0317 0.0436  137 ALA A O   
846  C CB  . ALA A 101 ? 0.3590 0.4645 0.4593 0.0215  -0.0317 0.0758  137 ALA A CB  
847  N N   . ASN A 102 ? 0.3612 0.4233 0.4602 0.0036  -0.0430 0.0711  138 ASN A N   
848  C CA  . ASN A 102 ? 0.3685 0.4205 0.4694 0.0007  -0.0440 0.0748  138 ASN A CA  
849  C C   . ASN A 102 ? 0.4231 0.4371 0.5047 -0.0033 -0.0498 0.0569  138 ASN A C   
850  O O   . ASN A 102 ? 0.4234 0.4262 0.4972 0.0011  -0.0459 0.0519  138 ASN A O   
851  C CB  . ASN A 102 ? 0.3825 0.4531 0.4821 0.0160  -0.0314 0.0796  138 ASN A CB  
852  C CG  . ASN A 102 ? 0.5259 0.5971 0.6367 0.0116  -0.0323 0.0927  138 ASN A CG  
853  O OD1 . ASN A 102 ? 0.4438 0.5148 0.5734 -0.0028 -0.0417 0.1075  138 ASN A OD1 
854  N ND2 . ASN A 102 ? 0.4437 0.5119 0.5433 0.0228  -0.0250 0.0872  138 ASN A ND2 
855  N N   . LEU A 103 ? 0.3952 0.3894 0.4679 -0.0102 -0.0590 0.0487  139 LEU A N   
856  C CA  . LEU A 103 ? 0.4038 0.3599 0.4543 -0.0111 -0.0649 0.0345  139 LEU A CA  
857  C C   . LEU A 103 ? 0.4672 0.4019 0.5195 -0.0222 -0.0784 0.0417  139 LEU A C   
858  O O   . LEU A 103 ? 0.4551 0.4005 0.5277 -0.0342 -0.0893 0.0570  139 LEU A O   
859  C CB  . LEU A 103 ? 0.3969 0.3368 0.4326 -0.0118 -0.0710 0.0245  139 LEU A CB  
860  C CG  . LEU A 103 ? 0.4311 0.3865 0.4639 -0.0020 -0.0600 0.0169  139 LEU A CG  
861  C CD1 . LEU A 103 ? 0.4250 0.3711 0.4497 -0.0057 -0.0686 0.0133  139 LEU A CD1 
862  C CD2 . LEU A 103 ? 0.4258 0.3700 0.4449 0.0097  -0.0494 0.0053  139 LEU A CD2 
863  N N   . PRO A 104 ? 0.4652 0.3677 0.4973 -0.0187 -0.0801 0.0324  140 PRO A N   
864  C CA  . PRO A 104 ? 0.4960 0.3692 0.5249 -0.0293 -0.0973 0.0377  140 PRO A CA  
865  C C   . PRO A 104 ? 0.6051 0.4584 0.6287 -0.0397 -0.1173 0.0373  140 PRO A C   
866  O O   . PRO A 104 ? 0.6077 0.4490 0.6106 -0.0325 -0.1162 0.0245  140 PRO A O   
867  C CB  . PRO A 104 ? 0.5286 0.3675 0.5277 -0.0180 -0.0932 0.0242  140 PRO A CB  
868  C CG  . PRO A 104 ? 0.5473 0.4090 0.5471 -0.0044 -0.0726 0.0182  140 PRO A CG  
869  C CD  . PRO A 104 ? 0.4697 0.3594 0.4813 -0.0045 -0.0680 0.0185  140 PRO A CD  
870  N N   . PRO A 105 ? 0.6028 0.4550 0.6474 -0.0565 -0.1364 0.0529  141 PRO A N   
871  C CA  . PRO A 105 ? 0.6229 0.4556 0.6637 -0.0672 -0.1591 0.0529  141 PRO A CA  
872  C C   . PRO A 105 ? 0.6926 0.4659 0.6871 -0.0610 -0.1742 0.0332  141 PRO A C   
873  O O   . PRO A 105 ? 0.7087 0.4647 0.6906 -0.0639 -0.1894 0.0280  141 PRO A O   
874  C CB  . PRO A 105 ? 0.6542 0.4976 0.7325 -0.0874 -0.1779 0.0773  141 PRO A CB  
875  C CG  . PRO A 105 ? 0.6843 0.5716 0.7915 -0.0840 -0.1570 0.0928  141 PRO A CG  
876  C CD  . PRO A 105 ? 0.6285 0.4999 0.7053 -0.0671 -0.1394 0.0741  141 PRO A CD  
877  N N   . SER A 106 ? 0.6514 0.3937 0.6172 -0.0492 -0.1686 0.0221  142 SER A N   
878  C CA  . SER A 106 ? 0.6913 0.3759 0.6063 -0.0369 -0.1799 0.0040  142 SER A CA  
879  C C   . SER A 106 ? 0.7117 0.4004 0.6008 -0.0152 -0.1575 -0.0104 142 SER A C   
880  O O   . SER A 106 ? 0.7493 0.3956 0.5946 0.0000  -0.1621 -0.0236 142 SER A O   
881  C CB  . SER A 106 ? 0.7533 0.3988 0.6472 -0.0326 -0.1862 0.0012  142 SER A CB  
882  O OG  . SER A 106 ? 0.8157 0.4803 0.7097 -0.0187 -0.1593 -0.0009 142 SER A OG  
883  N N   . LEU A 107 ? 0.6140 0.3521 0.5295 -0.0124 -0.1342 -0.0064 143 LEU A N   
884  C CA  . LEU A 107 ? 0.5914 0.3411 0.4943 0.0043  -0.1143 -0.0155 143 LEU A CA  
885  C C   . LEU A 107 ? 0.6328 0.3697 0.5209 0.0037  -0.1265 -0.0207 143 LEU A C   
886  O O   . LEU A 107 ? 0.6126 0.3684 0.5246 -0.0116 -0.1378 -0.0126 143 LEU A O   
887  C CB  . LEU A 107 ? 0.5419 0.3437 0.4798 0.0031  -0.0944 -0.0085 143 LEU A CB  
888  C CG  . LEU A 107 ? 0.5918 0.4133 0.5292 0.0174  -0.0738 -0.0140 143 LEU A CG  
889  C CD1 . LEU A 107 ? 0.5967 0.4217 0.5283 0.0196  -0.0747 -0.0179 143 LEU A CD1 
890  C CD2 . LEU A 107 ? 0.6701 0.4758 0.5896 0.0333  -0.0615 -0.0186 143 LEU A CD2 
891  N N   . THR A 108 ? 0.6244 0.3272 0.4717 0.0214  -0.1254 -0.0324 144 THR A N   
892  C CA  . THR A 108 ? 0.6381 0.3202 0.4619 0.0246  -0.1383 -0.0390 144 THR A CA  
893  C C   . THR A 108 ? 0.6184 0.3380 0.4579 0.0290  -0.1210 -0.0382 144 THR A C   
894  O O   . THR A 108 ? 0.5577 0.3110 0.4180 0.0338  -0.0990 -0.0349 144 THR A O   
895  C CB  . THR A 108 ? 0.7307 0.3575 0.4975 0.0471  -0.1430 -0.0511 144 THR A CB  
896  O OG1 . THR A 108 ? 0.7520 0.3924 0.5106 0.0687  -0.1145 -0.0523 144 THR A OG1 
897  C CG2 . THR A 108 ? 0.7347 0.3158 0.4783 0.0460  -0.1613 -0.0537 144 THR A CG2 
898  N N   . GLN A 109 ? 0.6135 0.3226 0.4399 0.0283  -0.1334 -0.0418 145 GLN A N   
899  C CA  . GLN A 109 ? 0.5734 0.3099 0.4082 0.0336  -0.1204 -0.0419 145 GLN A CA  
900  C C   . GLN A 109 ? 0.6194 0.3570 0.4377 0.0568  -0.0955 -0.0457 145 GLN A C   
901  O O   . GLN A 109 ? 0.5555 0.3297 0.3993 0.0581  -0.0774 -0.0412 145 GLN A O   
902  C CB  . GLN A 109 ? 0.6077 0.3208 0.4214 0.0315  -0.1417 -0.0463 145 GLN A CB  
903  C CG  . GLN A 109 ? 0.6299 0.3632 0.4438 0.0399  -0.1298 -0.0476 145 GLN A CG  
904  C CD  . GLN A 109 ? 0.7539 0.5411 0.6141 0.0284  -0.1166 -0.0382 145 GLN A CD  
905  O OE1 . GLN A 109 ? 0.6468 0.4559 0.5381 0.0106  -0.1252 -0.0291 145 GLN A OE1 
906  N NE2 . GLN A 109 ? 0.6243 0.4326 0.4890 0.0401  -0.0957 -0.0388 145 GLN A NE2 
907  N N   . GLN A 110 ? 0.6569 0.3538 0.4334 0.0757  -0.0954 -0.0520 146 GLN A N   
908  C CA  . GLN A 110 ? 0.6522 0.3497 0.4133 0.1002  -0.0716 -0.0510 146 GLN A CA  
909  C C   . GLN A 110 ? 0.6292 0.3600 0.4254 0.0972  -0.0532 -0.0430 146 GLN A C   
910  O O   . GLN A 110 ? 0.6015 0.3600 0.4161 0.1053  -0.0337 -0.0368 146 GLN A O   
911  C CB  . GLN A 110 ? 0.7285 0.3719 0.4329 0.1237  -0.0769 -0.0580 146 GLN A CB  
912  C CG  . GLN A 110 ? 0.8569 0.5026 0.5451 0.1529  -0.0502 -0.0524 146 GLN A CG  
913  C CD  . GLN A 110 ? 1.2388 0.8301 0.8669 0.1800  -0.0539 -0.0582 146 GLN A CD  
914  O OE1 . GLN A 110 ? 1.2562 0.8052 0.8371 0.1918  -0.0700 -0.0676 146 GLN A OE1 
915  N NE2 . GLN A 110 ? 1.1292 0.7183 0.7549 0.1922  -0.0401 -0.0527 146 GLN A NE2 
916  N N   . GLN A 111 ? 0.5706 0.2986 0.3777 0.0851  -0.0610 -0.0422 147 GLN A N   
917  C CA  . GLN A 111 ? 0.5321 0.2896 0.3707 0.0817  -0.0466 -0.0353 147 GLN A CA  
918  C C   . GLN A 111 ? 0.5442 0.3462 0.4242 0.0678  -0.0414 -0.0305 147 GLN A C   
919  O O   . GLN A 111 ? 0.4958 0.3228 0.3982 0.0711  -0.0271 -0.0254 147 GLN A O   
920  C CB  . GLN A 111 ? 0.5482 0.2907 0.3867 0.0725  -0.0572 -0.0352 147 GLN A CB  
921  C CG  . GLN A 111 ? 0.6052 0.3070 0.4049 0.0910  -0.0563 -0.0386 147 GLN A CG  
922  C CD  . GLN A 111 ? 0.7367 0.4213 0.5366 0.0802  -0.0693 -0.0384 147 GLN A CD  
923  O OE1 . GLN A 111 ? 0.6429 0.3242 0.4538 0.0608  -0.0885 -0.0380 147 GLN A OE1 
924  N NE2 . GLN A 111 ? 0.6658 0.3374 0.4531 0.0934  -0.0598 -0.0369 147 GLN A NE2 
925  N N   . PHE A 112 ? 0.5261 0.3369 0.4160 0.0534  -0.0541 -0.0311 148 PHE A N   
926  C CA  . PHE A 112 ? 0.4892 0.3394 0.4127 0.0435  -0.0493 -0.0264 148 PHE A CA  
927  C C   . PHE A 112 ? 0.5256 0.3894 0.4521 0.0541  -0.0361 -0.0267 148 PHE A C   
928  O O   . PHE A 112 ? 0.4798 0.3701 0.4308 0.0531  -0.0272 -0.0232 148 PHE A O   
929  C CB  . PHE A 112 ? 0.5048 0.3628 0.4385 0.0280  -0.0648 -0.0237 148 PHE A CB  
930  C CG  . PHE A 112 ? 0.4898 0.3870 0.4530 0.0221  -0.0586 -0.0181 148 PHE A CG  
931  C CD1 . PHE A 112 ? 0.4954 0.4154 0.4792 0.0210  -0.0504 -0.0136 148 PHE A CD1 
932  C CD2 . PHE A 112 ? 0.4806 0.3894 0.4474 0.0198  -0.0616 -0.0174 148 PHE A CD2 
933  C CE1 . PHE A 112 ? 0.4738 0.4242 0.4770 0.0197  -0.0457 -0.0094 148 PHE A CE1 
934  C CE2 . PHE A 112 ? 0.4776 0.4193 0.4669 0.0176  -0.0556 -0.0122 148 PHE A CE2 
935  C CZ  . PHE A 112 ? 0.4283 0.3889 0.4335 0.0187  -0.0479 -0.0087 148 PHE A CZ  
936  N N   . GLU A 113 ? 0.5217 0.3648 0.4221 0.0653  -0.0362 -0.0302 149 GLU A N   
937  C CA  . GLU A 113 ? 0.5104 0.3645 0.4129 0.0773  -0.0228 -0.0278 149 GLU A CA  
938  C C   . GLU A 113 ? 0.5354 0.3980 0.4493 0.0881  -0.0069 -0.0211 149 GLU A C   
939  O O   . GLU A 113 ? 0.4917 0.3783 0.4307 0.0887  0.0023  -0.0152 149 GLU A O   
940  C CB  . GLU A 113 ? 0.5623 0.3881 0.4278 0.0913  -0.0255 -0.0319 149 GLU A CB  
941  C CG  . GLU A 113 ? 0.7240 0.5412 0.5789 0.0817  -0.0429 -0.0373 149 GLU A CG  
942  C CD  . GLU A 113 ? 0.9670 0.7436 0.7759 0.0953  -0.0530 -0.0440 149 GLU A CD  
943  O OE1 . GLU A 113 ? 0.8684 0.6265 0.6504 0.1177  -0.0412 -0.0436 149 GLU A OE1 
944  O OE2 . GLU A 113 ? 0.7767 0.5387 0.5755 0.0848  -0.0739 -0.0486 149 GLU A OE2 
945  N N   . GLU A 114 ? 0.5161 0.3578 0.4123 0.0966  -0.0050 -0.0209 150 GLU A N   
946  C CA  . GLU A 114 ? 0.5211 0.3719 0.4296 0.1078  0.0101  -0.0118 150 GLU A CA  
947  C C   . GLU A 114 ? 0.5105 0.3896 0.4573 0.0941  0.0101  -0.0082 150 GLU A C   
948  O O   . GLU A 114 ? 0.4651 0.3615 0.4350 0.0991  0.0201  0.0011  150 GLU A O   
949  C CB  . GLU A 114 ? 0.5699 0.3903 0.4468 0.1222  0.0120  -0.0123 150 GLU A CB  
950  C CG  . GLU A 114 ? 0.7145 0.5069 0.5504 0.1444  0.0164  -0.0132 150 GLU A CG  
951  C CD  . GLU A 114 ? 0.8495 0.5985 0.6393 0.1597  0.0115  -0.0186 150 GLU A CD  
952  O OE1 . GLU A 114 ? 0.8047 0.5449 0.5962 0.1511  0.0042  -0.0215 150 GLU A OE1 
953  O OE2 . GLU A 114 ? 0.7372 0.4579 0.4856 0.1817  0.0138  -0.0203 150 GLU A OE2 
954  N N   . LEU A 115 ? 0.4710 0.3551 0.4251 0.0781  -0.0017 -0.0140 151 LEU A N   
955  C CA  . LEU A 115 ? 0.4455 0.3527 0.4280 0.0682  -0.0031 -0.0120 151 LEU A CA  
956  C C   . LEU A 115 ? 0.4637 0.3937 0.4684 0.0649  -0.0022 -0.0105 151 LEU A C   
957  O O   . LEU A 115 ? 0.4563 0.4006 0.4827 0.0643  -0.0007 -0.0066 151 LEU A O   
958  C CB  . LEU A 115 ? 0.4399 0.3460 0.4208 0.0556  -0.0143 -0.0156 151 LEU A CB  
959  C CG  . LEU A 115 ? 0.4634 0.3919 0.4670 0.0486  -0.0159 -0.0135 151 LEU A CG  
960  C CD1 . LEU A 115 ? 0.4623 0.3892 0.4717 0.0527  -0.0116 -0.0104 151 LEU A CD1 
961  C CD2 . LEU A 115 ? 0.4724 0.4059 0.4767 0.0382  -0.0248 -0.0129 151 LEU A CD2 
962  N N   . VAL A 116 ? 0.4098 0.3404 0.4077 0.0632  -0.0050 -0.0135 152 VAL A N   
963  C CA  . VAL A 116 ? 0.3890 0.3377 0.4037 0.0602  -0.0058 -0.0132 152 VAL A CA  
964  C C   . VAL A 116 ? 0.4523 0.4034 0.4731 0.0688  0.0022  -0.0078 152 VAL A C   
965  O O   . VAL A 116 ? 0.4236 0.3878 0.4647 0.0673  0.0015  -0.0049 152 VAL A O   
966  C CB  . VAL A 116 ? 0.4103 0.3638 0.4189 0.0523  -0.0139 -0.0175 152 VAL A CB  
967  C CG1 . VAL A 116 ? 0.3982 0.3571 0.4099 0.0444  -0.0203 -0.0176 152 VAL A CG1 
968  C CG2 . VAL A 116 ? 0.4125 0.3507 0.3999 0.0540  -0.0165 -0.0199 152 VAL A CG2 
969  N N   . ARG A 117 ? 0.4569 0.3938 0.4594 0.0796  0.0094  -0.0052 153 ARG A N   
970  C CA  . ARG A 117 ? 0.4632 0.4044 0.4716 0.0906  0.0197  0.0037  153 ARG A CA  
971  C C   . ARG A 117 ? 0.5133 0.4706 0.5554 0.0930  0.0261  0.0169  153 ARG A C   
972  O O   . ARG A 117 ? 0.5125 0.4807 0.5727 0.0956  0.0300  0.0254  153 ARG A O   
973  C CB  . ARG A 117 ? 0.5102 0.4302 0.4862 0.1069  0.0274  0.0052  153 ARG A CB  
974  C CG  . ARG A 117 ? 0.5968 0.5213 0.5733 0.1222  0.0402  0.0162  153 ARG A CG  
975  C CD  . ARG A 117 ? 0.6227 0.5601 0.6119 0.1154  0.0368  0.0150  153 ARG A CD  
976  N NE  . ARG A 117 ? 0.7915 0.7370 0.7887 0.1295  0.0501  0.0291  153 ARG A NE  
977  C CZ  . ARG A 117 ? 0.9186 0.8847 0.9541 0.1288  0.0562  0.0443  153 ARG A CZ  
978  N NH1 . ARG A 117 ? 0.6045 0.5819 0.6702 0.1153  0.0483  0.0451  153 ARG A NH1 
979  N NH2 . ARG A 117 ? 0.7582 0.7328 0.8025 0.1421  0.0688  0.0600  153 ARG A NH2 
980  N N   . PRO A 118 ? 0.4892 0.4488 0.5432 0.0919  0.0262  0.0208  154 PRO A N   
981  C CA  . PRO A 118 ? 0.4829 0.4587 0.5730 0.0932  0.0295  0.0360  154 PRO A CA  
982  C C   . PRO A 118 ? 0.5161 0.5035 0.6332 0.0823  0.0182  0.0357  154 PRO A C   
983  O O   . PRO A 118 ? 0.5112 0.5102 0.6601 0.0830  0.0188  0.0504  154 PRO A O   
984  C CB  . PRO A 118 ? 0.4988 0.4733 0.5930 0.0914  0.0275  0.0364  154 PRO A CB  
985  C CG  . PRO A 118 ? 0.5688 0.5233 0.6250 0.0965  0.0304  0.0268  154 PRO A CG  
986  C CD  . PRO A 118 ? 0.5059 0.4538 0.5436 0.0897  0.0229  0.0140  154 PRO A CD  
987  N N   . PHE A 119 ? 0.4434 0.4270 0.5478 0.0736  0.0074  0.0209  155 PHE A N   
988  C CA  . PHE A 119 ? 0.4099 0.3985 0.5317 0.0664  -0.0049 0.0185  155 PHE A CA  
989  C C   . PHE A 119 ? 0.4415 0.4333 0.5695 0.0682  -0.0033 0.0223  155 PHE A C   
990  O O   . PHE A 119 ? 0.4146 0.4079 0.5614 0.0640  -0.0137 0.0242  155 PHE A O   
991  C CB  . PHE A 119 ? 0.4173 0.4022 0.5224 0.0609  -0.0150 0.0042  155 PHE A CB  
992  C CG  . PHE A 119 ? 0.4208 0.4037 0.5239 0.0594  -0.0171 0.0026  155 PHE A CG  
993  C CD1 . PHE A 119 ? 0.4361 0.4203 0.5586 0.0574  -0.0263 0.0060  155 PHE A CD1 
994  C CD2 . PHE A 119 ? 0.4378 0.4159 0.5204 0.0597  -0.0116 -0.0017 155 PHE A CD2 
995  C CE1 . PHE A 119 ? 0.4488 0.4317 0.5689 0.0570  -0.0277 0.0051  155 PHE A CE1 
996  C CE2 . PHE A 119 ? 0.4642 0.4404 0.5456 0.0587  -0.0130 -0.0021 155 PHE A CE2 
997  C CZ  . PHE A 119 ? 0.4371 0.4168 0.5368 0.0579  -0.0198 0.0012  155 PHE A CZ  
998  N N   . GLY A 120 ? 0.4312 0.4213 0.5430 0.0754  0.0083  0.0241  156 GLY A N   
999  C CA  . GLY A 120 ? 0.4218 0.4152 0.5368 0.0785  0.0115  0.0282  156 GLY A CA  
1000 C C   . GLY A 120 ? 0.4775 0.4637 0.5603 0.0842  0.0180  0.0210  156 GLY A C   
1001 O O   . GLY A 120 ? 0.4656 0.4429 0.5249 0.0830  0.0164  0.0117  156 GLY A O   
1002 N N   . SER A 121 ? 0.4487 0.4374 0.5308 0.0904  0.0240  0.0265  157 SER A N   
1003 C CA  . SER A 121 ? 0.4605 0.4403 0.5108 0.0974  0.0285  0.0206  157 SER A CA  
1004 C C   . SER A 121 ? 0.4955 0.4729 0.5301 0.0876  0.0171  0.0058  157 SER A C   
1005 O O   . SER A 121 ? 0.4588 0.4440 0.5064 0.0795  0.0091  0.0020  157 SER A O   
1006 C CB  . SER A 121 ? 0.4982 0.4825 0.5521 0.1077  0.0381  0.0312  157 SER A CB  
1007 O OG  . SER A 121 ? 0.6278 0.6231 0.7101 0.1009  0.0331  0.0359  157 SER A OG  
1008 N N   . LEU A 122 ? 0.4717 0.4371 0.4775 0.0898  0.0154  -0.0011 158 LEU A N   
1009 C CA  . LEU A 122 ? 0.4624 0.4278 0.4570 0.0801  0.0043  -0.0108 158 LEU A CA  
1010 C C   . LEU A 122 ? 0.5286 0.4923 0.5081 0.0825  0.0020  -0.0131 158 LEU A C   
1011 O O   . LEU A 122 ? 0.5391 0.4908 0.5000 0.0934  0.0069  -0.0113 158 LEU A O   
1012 C CB  . LEU A 122 ? 0.4626 0.4141 0.4404 0.0768  -0.0015 -0.0156 158 LEU A CB  
1013 C CG  . LEU A 122 ? 0.4792 0.4336 0.4711 0.0728  -0.0009 -0.0144 158 LEU A CG  
1014 C CD1 . LEU A 122 ? 0.4895 0.4245 0.4626 0.0784  0.0006  -0.0149 158 LEU A CD1 
1015 C CD2 . LEU A 122 ? 0.4342 0.4010 0.4368 0.0613  -0.0097 -0.0179 158 LEU A CD2 
1016 N N   . GLU A 123 ? 0.4776 0.4533 0.4631 0.0742  -0.0053 -0.0162 159 GLU A N   
1017 C CA  . GLU A 123 ? 0.4723 0.4496 0.4463 0.0742  -0.0099 -0.0178 159 GLU A CA  
1018 C C   . GLU A 123 ? 0.5276 0.4953 0.4861 0.0673  -0.0220 -0.0214 159 GLU A C   
1019 O O   . GLU A 123 ? 0.5355 0.4912 0.4746 0.0701  -0.0280 -0.0233 159 GLU A O   
1020 C CB  . GLU A 123 ? 0.4660 0.4626 0.4556 0.0705  -0.0113 -0.0167 159 GLU A CB  
1021 C CG  . GLU A 123 ? 0.5844 0.5852 0.5889 0.0763  -0.0040 -0.0132 159 GLU A CG  
1022 C CD  . GLU A 123 ? 0.9183 0.9136 0.9174 0.0857  0.0038  -0.0087 159 GLU A CD  
1023 O OE1 . GLU A 123 ? 0.7462 0.7405 0.7301 0.0882  0.0020  -0.0101 159 GLU A OE1 
1024 O OE2 . GLU A 123 ? 0.8323 0.8250 0.8428 0.0912  0.0115  -0.0020 159 GLU A OE2 
1025 N N   . ARG A 124 ? 0.4522 0.4247 0.4202 0.0580  -0.0274 -0.0214 160 ARG A N   
1026 C CA  . ARG A 124 ? 0.4580 0.4223 0.4183 0.0488  -0.0410 -0.0219 160 ARG A CA  
1027 C C   . ARG A 124 ? 0.4719 0.4305 0.4364 0.0450  -0.0411 -0.0221 160 ARG A C   
1028 O O   . ARG A 124 ? 0.4526 0.4239 0.4326 0.0457  -0.0333 -0.0207 160 ARG A O   
1029 C CB  . ARG A 124 ? 0.4493 0.4357 0.4247 0.0392  -0.0491 -0.0159 160 ARG A CB  
1030 C CG  . ARG A 124 ? 0.4943 0.4881 0.4663 0.0420  -0.0508 -0.0146 160 ARG A CG  
1031 C CD  . ARG A 124 ? 0.4620 0.4798 0.4512 0.0332  -0.0588 -0.0053 160 ARG A CD  
1032 N NE  . ARG A 124 ? 0.4608 0.5034 0.4679 0.0360  -0.0489 -0.0002 160 ARG A NE  
1033 C CZ  . ARG A 124 ? 0.5426 0.6096 0.5669 0.0317  -0.0512 0.0110  160 ARG A CZ  
1034 N NH1 . ARG A 124 ? 0.4792 0.5526 0.5128 0.0208  -0.0644 0.0208  160 ARG A NH1 
1035 N NH2 . ARG A 124 ? 0.4549 0.5393 0.4869 0.0396  -0.0414 0.0143  160 ARG A NH2 
1036 N N   . CYS A 125 ? 0.4443 0.3811 0.3933 0.0416  -0.0514 -0.0243 161 CYS A N   
1037 C CA  . CYS A 125 ? 0.4443 0.3737 0.3958 0.0378  -0.0526 -0.0241 161 CYS A CA  
1038 C C   . CYS A 125 ? 0.5011 0.4114 0.4421 0.0282  -0.0710 -0.0238 161 CYS A C   
1039 O O   . CYS A 125 ? 0.5142 0.3931 0.4267 0.0335  -0.0799 -0.0296 161 CYS A O   
1040 C CB  . CYS A 125 ? 0.4616 0.3753 0.4010 0.0503  -0.0410 -0.0273 161 CYS A CB  
1041 S SG  . CYS A 125 ? 0.5198 0.4231 0.4604 0.0471  -0.0419 -0.0271 161 CYS A SG  
1042 N N   . PHE A 126 ? 0.4303 0.3569 0.3931 0.0154  -0.0779 -0.0160 162 PHE A N   
1043 C CA  . PHE A 126 ? 0.4359 0.3442 0.3948 0.0036  -0.0987 -0.0127 162 PHE A CA  
1044 C C   . PHE A 126 ? 0.4528 0.3766 0.4361 -0.0076 -0.1016 -0.0024 162 PHE A C   
1045 O O   . PHE A 126 ? 0.4277 0.3860 0.4359 -0.0088 -0.0915 0.0063  162 PHE A O   
1046 C CB  . PHE A 126 ? 0.4526 0.3670 0.4165 -0.0044 -0.1138 -0.0075 162 PHE A CB  
1047 C CG  . PHE A 126 ? 0.4288 0.3868 0.4231 -0.0076 -0.1053 0.0036  162 PHE A CG  
1048 C CD1 . PHE A 126 ? 0.4512 0.4353 0.4759 -0.0200 -0.1123 0.0201  162 PHE A CD1 
1049 C CD2 . PHE A 126 ? 0.4321 0.4048 0.4243 0.0035  -0.0899 -0.0006 162 PHE A CD2 
1050 C CE1 . PHE A 126 ? 0.4397 0.4637 0.4882 -0.0182 -0.1023 0.0318  162 PHE A CE1 
1051 C CE2 . PHE A 126 ? 0.4270 0.4355 0.4417 0.0037  -0.0823 0.0088  162 PHE A CE2 
1052 C CZ  . PHE A 126 ? 0.4047 0.4385 0.4453 -0.0057 -0.0877 0.0247  162 PHE A CZ  
1053 N N   . LEU A 127 ? 0.4573 0.3541 0.4319 -0.0149 -0.1173 -0.0021 163 LEU A N   
1054 C CA  . LEU A 127 ? 0.4491 0.3574 0.4487 -0.0281 -0.1250 0.0110  163 LEU A CA  
1055 C C   . LEU A 127 ? 0.5327 0.4572 0.5563 -0.0430 -0.1426 0.0260  163 LEU A C   
1056 O O   . LEU A 127 ? 0.5530 0.4640 0.5641 -0.0440 -0.1549 0.0218  163 LEU A O   
1057 C CB  . LEU A 127 ? 0.4725 0.3402 0.4524 -0.0305 -0.1378 0.0059  163 LEU A CB  
1058 C CG  . LEU A 127 ? 0.5124 0.3647 0.4723 -0.0165 -0.1219 -0.0047 163 LEU A CG  
1059 C CD1 . LEU A 127 ? 0.5382 0.3477 0.4764 -0.0184 -0.1373 -0.0085 163 LEU A CD1 
1060 C CD2 . LEU A 127 ? 0.4598 0.3482 0.4453 -0.0149 -0.1031 0.0020  163 LEU A CD2 
1061 N N   . VAL A 128 ? 0.4770 0.4311 0.5356 -0.0535 -0.1440 0.0451  164 VAL A N   
1062 C CA  . VAL A 128 ? 0.4796 0.4529 0.5692 -0.0691 -0.1617 0.0654  164 VAL A CA  
1063 C C   . VAL A 128 ? 0.5601 0.5084 0.6579 -0.0848 -0.1851 0.0738  164 VAL A C   
1064 O O   . VAL A 128 ? 0.5416 0.4887 0.6433 -0.0842 -0.1781 0.0762  164 VAL A O   
1065 C CB  . VAL A 128 ? 0.4906 0.5202 0.6167 -0.0669 -0.1452 0.0861  164 VAL A CB  
1066 C CG1 . VAL A 128 ? 0.4950 0.5492 0.6609 -0.0836 -0.1632 0.1135  164 VAL A CG1 
1067 C CG2 . VAL A 128 ? 0.4586 0.5048 0.5721 -0.0512 -0.1262 0.0760  164 VAL A CG2 
1068 N N   . TYR A 129 ? 0.5615 0.4853 0.6588 -0.0984 -0.2148 0.0771  165 TYR A N   
1069 C CA  . TYR A 129 ? 0.5949 0.4861 0.6973 -0.1146 -0.2435 0.0841  165 TYR A CA  
1070 C C   . TYR A 129 ? 0.6531 0.5726 0.8073 -0.1364 -0.2647 0.1150  165 TYR A C   
1071 O O   . TYR A 129 ? 0.6207 0.5707 0.7961 -0.1395 -0.2658 0.1264  165 TYR A O   
1072 C CB  . TYR A 129 ? 0.6450 0.4712 0.6984 -0.1122 -0.2686 0.0618  165 TYR A CB  
1073 C CG  . TYR A 129 ? 0.6391 0.4338 0.6401 -0.0891 -0.2501 0.0344  165 TYR A CG  
1074 C CD1 . TYR A 129 ? 0.6598 0.4260 0.6393 -0.0824 -0.2454 0.0255  165 TYR A CD1 
1075 C CD2 . TYR A 129 ? 0.6487 0.4399 0.6216 -0.0738 -0.2391 0.0195  165 TYR A CD2 
1076 C CE1 . TYR A 129 ? 0.6425 0.3820 0.5770 -0.0602 -0.2285 0.0043  165 TYR A CE1 
1077 C CE2 . TYR A 129 ? 0.6621 0.4272 0.5914 -0.0520 -0.2220 -0.0009 165 TYR A CE2 
1078 C CZ  . TYR A 129 ? 0.7108 0.4505 0.6216 -0.0451 -0.2170 -0.0077 165 TYR A CZ  
1079 O OH  . TYR A 129 ? 0.7120 0.4283 0.5825 -0.0226 -0.2003 -0.0241 165 TYR A OH  
1080 N N   . SER A 130 ? 0.6378 0.5463 0.8139 -0.1518 -0.2828 0.1301  166 SER A N   
1081 C CA  . SER A 130 ? 0.6612 0.5892 0.8898 -0.1756 -0.3094 0.1624  166 SER A CA  
1082 C C   . SER A 130 ? 0.7821 0.6669 0.9930 -0.1867 -0.3479 0.1539  166 SER A C   
1083 O O   . SER A 130 ? 0.8223 0.6425 0.9829 -0.1829 -0.3667 0.1283  166 SER A O   
1084 C CB  . SER A 130 ? 0.7067 0.6234 0.9577 -0.1890 -0.3221 0.1781  166 SER A CB  
1085 O OG  . SER A 130 ? 0.8634 0.7724 1.1534 -0.2152 -0.3617 0.2030  166 SER A OG  
1086 N N   . GLU A 131 ? 0.7452 0.6640 0.9923 -0.1972 -0.3585 0.1742  167 GLU A N   
1087 C CA  . GLU A 131 ? 0.8001 0.6798 1.0320 -0.2080 -0.3972 0.1674  167 GLU A CA  
1088 C C   . GLU A 131 ? 0.9228 0.7529 1.1633 -0.2315 -0.4457 0.1760  167 GLU A C   
1089 O O   . GLU A 131 ? 0.9937 0.7620 1.1932 -0.2339 -0.4801 0.1565  167 GLU A O   
1090 C CB  . GLU A 131 ? 0.7957 0.7286 1.0709 -0.2146 -0.3972 0.1910  167 GLU A CB  
1091 C CG  . GLU A 131 ? 0.9209 0.8610 1.1581 -0.1923 -0.3718 0.1677  167 GLU A CG  
1092 C CD  . GLU A 131 ? 1.1623 1.1596 1.4382 -0.1935 -0.3633 0.1895  167 GLU A CD  
1093 O OE1 . GLU A 131 ? 1.1851 1.1873 1.4951 -0.2133 -0.3963 0.2107  167 GLU A OE1 
1094 O OE2 . GLU A 131 ? 1.0042 1.0381 1.2737 -0.1740 -0.3255 0.1844  167 GLU A OE2 
1095 N N   . ARG A 132 ? 0.8657 0.7200 1.1565 -0.2472 -0.4487 0.2048  168 ARG A N   
1096 C CA  A ARG A 132 ? 0.9106 0.7222 1.2191 -0.2717 -0.4945 0.2181  168 ARG A CA  
1097 C CA  B ARG A 132 ? 0.9132 0.7244 1.2211 -0.2716 -0.4946 0.2177  168 ARG A CA  
1098 C C   . ARG A 132 ? 1.0009 0.7341 1.2420 -0.2613 -0.5047 0.1836  168 ARG A C   
1099 O O   . ARG A 132 ? 1.0607 0.7237 1.2651 -0.2677 -0.5473 0.1678  168 ARG A O   
1100 C CB  A ARG A 132 ? 0.8815 0.7509 1.2676 -0.2886 -0.4879 0.2627  168 ARG A CB  
1101 C CB  B ARG A 132 ? 0.8955 0.7637 1.2807 -0.2887 -0.4886 0.2622  168 ARG A CB  
1102 C CG  A ARG A 132 ? 1.0128 0.8539 1.4408 -0.3208 -0.5403 0.2892  168 ARG A CG  
1103 C CG  B ARG A 132 ? 1.0652 0.9124 1.4983 -0.3219 -0.5418 0.2918  168 ARG A CG  
1104 C CD  A ARG A 132 ? 0.9890 0.8874 1.4920 -0.3344 -0.5294 0.3344  168 ARG A CD  
1105 C CD  B ARG A 132 ? 1.1363 0.9909 1.6048 -0.3326 -0.5409 0.3146  168 ARG A CD  
1106 N NE  A ARG A 132 ? 0.9128 0.8906 1.4920 -0.3448 -0.5228 0.3797  168 ARG A NE  
1107 N NE  B ARG A 132 ? 1.2398 1.0110 1.6497 -0.3303 -0.5622 0.2833  168 ARG A NE  
1108 C CZ  A ARG A 132 ? 0.9729 1.0278 1.5810 -0.3277 -0.4746 0.3993  168 ARG A CZ  
1109 C CZ  B ARG A 132 ? 1.3660 1.1282 1.7838 -0.3326 -0.5570 0.2903  168 ARG A CZ  
1110 N NH1 A ARG A 132 ? 0.7404 0.8027 1.3091 -0.3014 -0.4309 0.3768  168 ARG A NH1 
1111 N NH1 B ARG A 132 ? 1.1329 0.9651 1.6131 -0.3362 -0.5295 0.3269  168 ARG A NH1 
1112 N NH2 A ARG A 132 ? 0.7433 0.8671 1.4187 -0.3355 -0.4707 0.4423  168 ARG A NH2 
1113 N NH2 B ARG A 132 ? 1.2343 0.9171 1.5940 -0.3283 -0.5772 0.2606  168 ARG A NH2 
1114 N N   . THR A 133 ? 0.9209 0.6644 1.1439 -0.2436 -0.4668 0.1726  169 THR A N   
1115 C CA  . THR A 133 ? 0.9455 0.6239 1.1100 -0.2313 -0.4700 0.1442  169 THR A CA  
1116 C C   . THR A 133 ? 0.9646 0.6085 1.0534 -0.2009 -0.4485 0.1042  169 THR A C   
1117 O O   . THR A 133 ? 1.0040 0.5824 1.0370 -0.1898 -0.4605 0.0805  169 THR A O   
1118 C CB  . THR A 133 ? 1.0030 0.7118 1.1917 -0.2287 -0.4414 0.1566  169 THR A CB  
1119 O OG1 . THR A 133 ? 0.9649 0.7331 1.1597 -0.2099 -0.3924 0.1550  169 THR A OG1 
1120 C CG2 . THR A 133 ? 0.9941 0.7339 1.2551 -0.2557 -0.4598 0.1978  169 THR A CG2 
1121 N N   . GLY A 134 ? 0.8506 0.5392 0.9390 -0.1863 -0.4152 0.0990  170 GLY A N   
1122 C CA  . GLY A 134 ? 0.8394 0.5057 0.8662 -0.1577 -0.3903 0.0667  170 GLY A CA  
1123 C C   . GLY A 134 ? 0.8220 0.5041 0.8396 -0.1414 -0.3523 0.0593  170 GLY A C   
1124 O O   . GLY A 134 ? 0.8129 0.4794 0.7852 -0.1178 -0.3299 0.0362  170 GLY A O   
1125 N N   . GLN A 135 ? 0.7299 0.4452 0.7926 -0.1532 -0.3448 0.0811  171 GLN A N   
1126 C CA  . GLN A 135 ? 0.6928 0.4261 0.7515 -0.1394 -0.3111 0.0768  171 GLN A CA  
1127 C C   . GLN A 135 ? 0.6750 0.4688 0.7502 -0.1264 -0.2719 0.0788  171 GLN A C   
1128 O O   . GLN A 135 ? 0.6485 0.4882 0.7618 -0.1341 -0.2688 0.0970  171 GLN A O   
1129 C CB  . GLN A 135 ? 0.7059 0.4520 0.8051 -0.1552 -0.3176 0.1003  171 GLN A CB  
1130 C CG  . GLN A 135 ? 0.8498 0.5309 0.9313 -0.1673 -0.3560 0.0978  171 GLN A CG  
1131 C CD  . GLN A 135 ? 1.0733 0.6979 1.0937 -0.1478 -0.3511 0.0701  171 GLN A CD  
1132 O OE1 . GLN A 135 ? 0.9194 0.5564 0.9151 -0.1260 -0.3171 0.0547  171 GLN A OE1 
1133 N NE2 . GLN A 135 ? 1.0821 0.6424 1.0777 -0.1549 -0.3866 0.0649  171 GLN A NE2 
1134 N N   . SER A 136 ? 0.5928 0.3859 0.6401 -0.1063 -0.2433 0.0615  172 SER A N   
1135 C CA  . SER A 136 ? 0.5411 0.3838 0.6004 -0.0934 -0.2093 0.0617  172 SER A CA  
1136 C C   . SER A 136 ? 0.5836 0.4778 0.6913 -0.1009 -0.1978 0.0873  172 SER A C   
1137 O O   . SER A 136 ? 0.5919 0.4820 0.7150 -0.1090 -0.2039 0.0989  172 SER A O   
1138 C CB  . SER A 136 ? 0.5597 0.3878 0.5839 -0.0729 -0.1860 0.0410  172 SER A CB  
1139 O OG  . SER A 136 ? 0.5942 0.4646 0.6293 -0.0615 -0.1578 0.0406  172 SER A OG  
1140 N N   . LYS A 137 ? 0.5330 0.4749 0.6629 -0.0964 -0.1810 0.0970  173 LYS A N   
1141 C CA  . LYS A 137 ? 0.5017 0.4961 0.6713 -0.0961 -0.1649 0.1214  173 LYS A CA  
1142 C C   . LYS A 137 ? 0.5178 0.5234 0.6712 -0.0770 -0.1363 0.1100  173 LYS A C   
1143 O O   . LYS A 137 ? 0.4963 0.5413 0.6711 -0.0701 -0.1196 0.1256  173 LYS A O   
1144 C CB  . LYS A 137 ? 0.5095 0.5462 0.7053 -0.0966 -0.1610 0.1374  173 LYS A CB  
1145 C CG  . LYS A 137 ? 0.5226 0.5554 0.7449 -0.1176 -0.1909 0.1553  173 LYS A CG  
1146 C CD  . LYS A 137 ? 0.5402 0.6265 0.8008 -0.1183 -0.1844 0.1809  173 LYS A CD  
1147 C CE  . LYS A 137 ? 0.6630 0.7526 0.9629 -0.1420 -0.2154 0.2067  173 LYS A CE  
1148 N NZ  . LYS A 137 ? 0.6070 0.7569 0.9529 -0.1421 -0.2069 0.2394  173 LYS A NZ  
1149 N N   . GLY A 138 ? 0.4762 0.4464 0.5915 -0.0675 -0.1322 0.0843  174 GLY A N   
1150 C CA  . GLY A 138 ? 0.4503 0.4245 0.5501 -0.0516 -0.1104 0.0725  174 GLY A CA  
1151 C C   . GLY A 138 ? 0.4609 0.4598 0.5556 -0.0371 -0.0916 0.0652  174 GLY A C   
1152 O O   . GLY A 138 ? 0.4506 0.4595 0.5399 -0.0249 -0.0757 0.0600  174 GLY A O   
1153 N N   . TYR A 139 ? 0.4027 0.4113 0.5000 -0.0384 -0.0949 0.0657  175 TYR A N   
1154 C CA  . TYR A 139 ? 0.3828 0.4096 0.4730 -0.0245 -0.0790 0.0578  175 TYR A CA  
1155 C C   . TYR A 139 ? 0.4307 0.4408 0.5046 -0.0247 -0.0851 0.0457  175 TYR A C   
1156 O O   . TYR A 139 ? 0.4394 0.4347 0.5139 -0.0359 -0.1024 0.0487  175 TYR A O   
1157 C CB  . TYR A 139 ? 0.3760 0.4465 0.4890 -0.0184 -0.0684 0.0757  175 TYR A CB  
1158 C CG  . TYR A 139 ? 0.4134 0.5060 0.5523 -0.0289 -0.0784 0.0963  175 TYR A CG  
1159 C CD1 . TYR A 139 ? 0.4346 0.5332 0.5716 -0.0283 -0.0807 0.0938  175 TYR A CD1 
1160 C CD2 . TYR A 139 ? 0.4273 0.5376 0.5963 -0.0393 -0.0853 0.1209  175 TYR A CD2 
1161 C CE1 . TYR A 139 ? 0.4086 0.5295 0.5728 -0.0385 -0.0911 0.1147  175 TYR A CE1 
1162 C CE2 . TYR A 139 ? 0.4388 0.5736 0.6388 -0.0500 -0.0955 0.1442  175 TYR A CE2 
1163 C CZ  . TYR A 139 ? 0.4972 0.6376 0.6946 -0.0495 -0.0986 0.1408  175 TYR A CZ  
1164 O OH  . TYR A 139 ? 0.4923 0.6586 0.7234 -0.0606 -0.1098 0.1658  175 TYR A OH  
1165 N N   . GLY A 140 ? 0.3896 0.4011 0.4495 -0.0121 -0.0722 0.0330  176 GLY A N   
1166 C CA  . GLY A 140 ? 0.3981 0.3973 0.4425 -0.0088 -0.0739 0.0223  176 GLY A CA  
1167 C C   . GLY A 140 ? 0.4117 0.4306 0.4565 0.0028  -0.0602 0.0186  176 GLY A C   
1168 O O   . GLY A 140 ? 0.3782 0.4145 0.4296 0.0104  -0.0501 0.0210  176 GLY A O   
1169 N N   . PHE A 141 ? 0.3834 0.3961 0.4184 0.0053  -0.0612 0.0122  177 PHE A N   
1170 C CA  . PHE A 141 ? 0.3684 0.3954 0.4030 0.0155  -0.0507 0.0087  177 PHE A CA  
1171 C C   . PHE A 141 ? 0.4124 0.4185 0.4306 0.0226  -0.0458 -0.0039 177 PHE A C   
1172 O O   . PHE A 141 ? 0.4087 0.3923 0.4121 0.0214  -0.0511 -0.0089 177 PHE A O   
1173 C CB  . PHE A 141 ? 0.3836 0.4299 0.4268 0.0135  -0.0542 0.0169  177 PHE A CB  
1174 C CG  . PHE A 141 ? 0.3844 0.4609 0.4492 0.0109  -0.0544 0.0346  177 PHE A CG  
1175 C CD1 . PHE A 141 ? 0.3871 0.4862 0.4559 0.0234  -0.0427 0.0393  177 PHE A CD1 
1176 C CD2 . PHE A 141 ? 0.4133 0.4940 0.4938 -0.0026 -0.0670 0.0481  177 PHE A CD2 
1177 C CE1 . PHE A 141 ? 0.3981 0.5274 0.4851 0.0254  -0.0400 0.0588  177 PHE A CE1 
1178 C CE2 . PHE A 141 ? 0.4324 0.5457 0.5380 -0.0041 -0.0654 0.0695  177 PHE A CE2 
1179 C CZ  . PHE A 141 ? 0.3844 0.5236 0.4925 0.0114  -0.0501 0.0754  177 PHE A CZ  
1180 N N   . ALA A 142 ? 0.3809 0.3933 0.4014 0.0314  -0.0363 -0.0077 178 ALA A N   
1181 C CA  . ALA A 142 ? 0.3838 0.3828 0.3972 0.0383  -0.0304 -0.0149 178 ALA A CA  
1182 C C   . ALA A 142 ? 0.4103 0.4215 0.4288 0.0446  -0.0264 -0.0154 178 ALA A C   
1183 O O   . ALA A 142 ? 0.3978 0.4192 0.4225 0.0486  -0.0251 -0.0148 178 ALA A O   
1184 C CB  . ALA A 142 ? 0.3835 0.3746 0.3995 0.0410  -0.0264 -0.0170 178 ALA A CB  
1185 N N   . GLU A 143 ? 0.3707 0.3792 0.3834 0.0464  -0.0259 -0.0165 179 GLU A N   
1186 C CA  . GLU A 143 ? 0.3703 0.3874 0.3868 0.0525  -0.0226 -0.0168 179 GLU A CA  
1187 C C   . GLU A 143 ? 0.4146 0.4201 0.4323 0.0580  -0.0171 -0.0187 179 GLU A C   
1188 O O   . GLU A 143 ? 0.4189 0.4139 0.4278 0.0601  -0.0143 -0.0185 179 GLU A O   
1189 C CB  . GLU A 143 ? 0.3952 0.4211 0.4078 0.0515  -0.0253 -0.0140 179 GLU A CB  
1190 C CG  . GLU A 143 ? 0.4460 0.4792 0.4611 0.0590  -0.0215 -0.0144 179 GLU A CG  
1191 C CD  . GLU A 143 ? 0.5155 0.5561 0.5264 0.0598  -0.0225 -0.0118 179 GLU A CD  
1192 O OE1 . GLU A 143 ? 0.4836 0.5350 0.4957 0.0543  -0.0280 -0.0064 179 GLU A OE1 
1193 O OE2 . GLU A 143 ? 0.5742 0.6115 0.5836 0.0658  -0.0186 -0.0134 179 GLU A OE2 
1194 N N   . TYR A 144 ? 0.3530 0.3593 0.3815 0.0613  -0.0164 -0.0190 180 TYR A N   
1195 C CA  . TYR A 144 ? 0.3542 0.3531 0.3921 0.0650  -0.0120 -0.0161 180 TYR A CA  
1196 C C   . TYR A 144 ? 0.4103 0.4119 0.4516 0.0691  -0.0108 -0.0144 180 TYR A C   
1197 O O   . TYR A 144 ? 0.3563 0.3641 0.3933 0.0701  -0.0146 -0.0170 180 TYR A O   
1198 C CB  . TYR A 144 ? 0.3575 0.3538 0.4100 0.0645  -0.0157 -0.0153 180 TYR A CB  
1199 C CG  . TYR A 144 ? 0.3458 0.3389 0.3966 0.0616  -0.0151 -0.0156 180 TYR A CG  
1200 C CD1 . TYR A 144 ? 0.3561 0.3432 0.4115 0.0635  -0.0087 -0.0103 180 TYR A CD1 
1201 C CD2 . TYR A 144 ? 0.3449 0.3418 0.3895 0.0588  -0.0197 -0.0193 180 TYR A CD2 
1202 C CE1 . TYR A 144 ? 0.3410 0.3240 0.3941 0.0620  -0.0082 -0.0104 180 TYR A CE1 
1203 C CE2 . TYR A 144 ? 0.3490 0.3423 0.3929 0.0561  -0.0194 -0.0189 180 TYR A CE2 
1204 C CZ  . TYR A 144 ? 0.3759 0.3611 0.4233 0.0573  -0.0141 -0.0154 180 TYR A CZ  
1205 O OH  . TYR A 144 ? 0.3764 0.3568 0.4219 0.0559  -0.0134 -0.0149 180 TYR A OH  
1206 N N   . MET A 145 ? 0.4127 0.4104 0.4624 0.0731  -0.0047 -0.0079 181 MET A N   
1207 C CA  . MET A 145 ? 0.4223 0.4218 0.4797 0.0771  -0.0031 -0.0037 181 MET A CA  
1208 C C   . MET A 145 ? 0.4394 0.4364 0.5114 0.0755  -0.0128 -0.0046 181 MET A C   
1209 O O   . MET A 145 ? 0.4384 0.4350 0.5086 0.0781  -0.0163 -0.0061 181 MET A O   
1210 C CB  . MET A 145 ? 0.4697 0.4678 0.5372 0.0831  0.0071  0.0078  181 MET A CB  
1211 C CG  . MET A 145 ? 0.5563 0.5574 0.6306 0.0882  0.0109  0.0146  181 MET A CG  
1212 S SD  . MET A 145 ? 0.6521 0.6560 0.7397 0.0992  0.0262  0.0334  181 MET A SD  
1213 C CE  . MET A 145 ? 0.5909 0.5982 0.7180 0.0931  0.0212  0.0454  181 MET A CE  
1214 N N   . LYS A 146 ? 0.3813 0.3738 0.4646 0.0722  -0.0189 -0.0045 182 LYS A N   
1215 C CA  . LYS A 146 ? 0.3843 0.3676 0.4787 0.0715  -0.0324 -0.0059 182 LYS A CA  
1216 C C   . LYS A 146 ? 0.4167 0.3957 0.4984 0.0716  -0.0410 -0.0151 182 LYS A C   
1217 O O   . LYS A 146 ? 0.3767 0.3593 0.4572 0.0689  -0.0377 -0.0154 182 LYS A O   
1218 C CB  . LYS A 146 ? 0.4138 0.3941 0.5392 0.0681  -0.0352 0.0064  182 LYS A CB  
1219 C CG  . LYS A 146 ? 0.4589 0.4456 0.6002 0.0705  -0.0253 0.0197  182 LYS A CG  
1220 C CD  . LYS A 146 ? 0.5533 0.5428 0.7321 0.0677  -0.0266 0.0378  182 LYS A CD  
1221 C CE  . LYS A 146 ? 0.5416 0.5416 0.7252 0.0711  -0.0120 0.0475  182 LYS A CE  
1222 N NZ  . LYS A 146 ? 0.4701 0.4800 0.6933 0.0720  -0.0075 0.0717  182 LYS A NZ  
1223 N N   . LYS A 147 ? 0.3891 0.3586 0.4593 0.0771  -0.0520 -0.0219 183 LYS A N   
1224 C CA  . LYS A 147 ? 0.4092 0.3723 0.4628 0.0821  -0.0603 -0.0297 183 LYS A CA  
1225 C C   . LYS A 147 ? 0.4649 0.4202 0.5325 0.0771  -0.0687 -0.0284 183 LYS A C   
1226 O O   . LYS A 147 ? 0.4706 0.4287 0.5275 0.0788  -0.0680 -0.0319 183 LYS A O   
1227 C CB  . LYS A 147 ? 0.4403 0.3872 0.4762 0.0931  -0.0728 -0.0365 183 LYS A CB  
1228 C CG  . LYS A 147 ? 0.5665 0.5064 0.5776 0.1039  -0.0795 -0.0438 183 LYS A CG  
1229 C CD  . LYS A 147 ? 0.7637 0.6797 0.7504 0.1191  -0.0942 -0.0515 183 LYS A CD  
1230 C CE  . LYS A 147 ? 1.0554 0.9649 1.0115 0.1350  -0.0981 -0.0575 183 LYS A CE  
1231 N NZ  . LYS A 147 ? 1.1922 1.1294 1.1353 0.1427  -0.0796 -0.0523 183 LYS A NZ  
1232 N N   . ASP A 148 ? 0.4139 0.3608 0.5077 0.0713  -0.0768 -0.0213 184 ASP A N   
1233 C CA  . ASP A 148 ? 0.4205 0.3619 0.5330 0.0660  -0.0862 -0.0172 184 ASP A CA  
1234 C C   . ASP A 148 ? 0.4341 0.3916 0.5521 0.0621  -0.0710 -0.0122 184 ASP A C   
1235 O O   . ASP A 148 ? 0.4087 0.3640 0.5279 0.0609  -0.0759 -0.0135 184 ASP A O   
1236 C CB  . ASP A 148 ? 0.4486 0.3823 0.5961 0.0593  -0.0983 -0.0053 184 ASP A CB  
1237 C CG  . ASP A 148 ? 0.6622 0.5905 0.8319 0.0534  -0.1118 0.0004  184 ASP A CG  
1238 O OD1 . ASP A 148 ? 0.6902 0.6002 0.8435 0.0568  -0.1297 -0.0103 184 ASP A OD1 
1239 O OD2 . ASP A 148 ? 0.7019 0.6451 0.9026 0.0475  -0.1031 0.0161  184 ASP A OD2 
1240 N N   . SER A 149 ? 0.4045 0.3752 0.5225 0.0616  -0.0536 -0.0071 185 SER A N   
1241 C CA  . SER A 149 ? 0.3906 0.3703 0.5062 0.0603  -0.0407 -0.0041 185 SER A CA  
1242 C C   . SER A 149 ? 0.4169 0.3973 0.5091 0.0613  -0.0412 -0.0141 185 SER A C   
1243 O O   . SER A 149 ? 0.4170 0.3978 0.5103 0.0597  -0.0404 -0.0135 185 SER A O   
1244 C CB  . SER A 149 ? 0.4322 0.4189 0.5424 0.0626  -0.0256 0.0006  185 SER A CB  
1245 O OG  . SER A 149 ? 0.5358 0.5249 0.6676 0.0640  -0.0225 0.0127  185 SER A OG  
1246 N N   . ALA A 150 ? 0.3648 0.3470 0.4379 0.0649  -0.0420 -0.0209 186 ALA A N   
1247 C CA  . ALA A 150 ? 0.3721 0.3597 0.4268 0.0673  -0.0413 -0.0259 186 ALA A CA  
1248 C C   . ALA A 150 ? 0.4189 0.3987 0.4695 0.0717  -0.0517 -0.0298 186 ALA A C   
1249 O O   . ALA A 150 ? 0.4085 0.3929 0.4529 0.0718  -0.0493 -0.0299 186 ALA A O   
1250 C CB  . ALA A 150 ? 0.3719 0.3665 0.4122 0.0723  -0.0393 -0.0279 186 ALA A CB  
1251 N N   . ALA A 151 ? 0.4074 0.3729 0.4605 0.0757  -0.0651 -0.0328 187 ALA A N   
1252 C CA  . ALA A 151 ? 0.4192 0.3709 0.4640 0.0817  -0.0794 -0.0379 187 ALA A CA  
1253 C C   . ALA A 151 ? 0.4198 0.3726 0.4814 0.0747  -0.0803 -0.0338 187 ALA A C   
1254 O O   . ALA A 151 ? 0.3896 0.3409 0.4397 0.0790  -0.0830 -0.0368 187 ALA A O   
1255 C CB  . ALA A 151 ? 0.4399 0.3696 0.4850 0.0858  -0.0982 -0.0418 187 ALA A CB  
1256 N N   . ARG A 152 ? 0.3893 0.3460 0.4774 0.0658  -0.0765 -0.0252 188 ARG A N   
1257 C CA  . ARG A 152 ? 0.3871 0.3470 0.4936 0.0606  -0.0753 -0.0183 188 ARG A CA  
1258 C C   . ARG A 152 ? 0.4103 0.3810 0.5056 0.0601  -0.0602 -0.0183 188 ARG A C   
1259 O O   . ARG A 152 ? 0.4143 0.3847 0.5099 0.0600  -0.0617 -0.0179 188 ARG A O   
1260 C CB  . ARG A 152 ? 0.3715 0.3357 0.5103 0.0547  -0.0729 -0.0051 188 ARG A CB  
1261 C CG  . ARG A 152 ? 0.5131 0.4647 0.6713 0.0523  -0.0935 -0.0021 188 ARG A CG  
1262 C CD  . ARG A 152 ? 0.7001 0.6604 0.8988 0.0461  -0.0919 0.0167  188 ARG A CD  
1263 N NE  . ARG A 152 ? 0.7240 0.6903 0.9283 0.0468  -0.0818 0.0226  188 ARG A NE  
1264 C CZ  . ARG A 152 ? 0.9196 0.9001 1.1220 0.0500  -0.0599 0.0293  188 ARG A CZ  
1265 N NH1 . ARG A 152 ? 0.7403 0.7283 0.9350 0.0527  -0.0466 0.0308  188 ARG A NH1 
1266 N NH2 . ARG A 152 ? 0.7037 0.6881 0.9094 0.0520  -0.0523 0.0345  188 ARG A NH2 
1267 N N   . ALA A 153 ? 0.3656 0.3435 0.4502 0.0597  -0.0481 -0.0188 189 ALA A N   
1268 C CA  . ALA A 153 ? 0.3621 0.3455 0.4353 0.0580  -0.0379 -0.0186 189 ALA A CA  
1269 C C   . ALA A 153 ? 0.3902 0.3760 0.4487 0.0612  -0.0415 -0.0229 189 ALA A C   
1270 O O   . ALA A 153 ? 0.3685 0.3554 0.4257 0.0596  -0.0388 -0.0212 189 ALA A O   
1271 C CB  . ALA A 153 ? 0.3656 0.3528 0.4296 0.0566  -0.0296 -0.0185 189 ALA A CB  
1272 N N   . LYS A 154 ? 0.3802 0.3668 0.4269 0.0678  -0.0470 -0.0270 190 LYS A N   
1273 C CA  . LYS A 154 ? 0.3790 0.3704 0.4103 0.0751  -0.0479 -0.0279 190 LYS A CA  
1274 C C   . LYS A 154 ? 0.4347 0.4168 0.4657 0.0791  -0.0567 -0.0302 190 LYS A C   
1275 O O   . LYS A 154 ? 0.4222 0.4094 0.4486 0.0805  -0.0532 -0.0276 190 LYS A O   
1276 C CB  . LYS A 154 ? 0.4149 0.4086 0.4298 0.0862  -0.0502 -0.0302 190 LYS A CB  
1277 C CG  . LYS A 154 ? 0.3882 0.3885 0.3854 0.0988  -0.0491 -0.0280 190 LYS A CG  
1278 C CD  . LYS A 154 ? 0.4746 0.4786 0.4525 0.1141  -0.0486 -0.0277 190 LYS A CD  
1279 C CE  . LYS A 154 ? 0.4420 0.4530 0.4007 0.1310  -0.0458 -0.0230 190 LYS A CE  
1280 N NZ  . LYS A 154 ? 0.4850 0.4717 0.4229 0.1450  -0.0597 -0.0327 190 LYS A NZ  
1281 N N   . SER A 155 ? 0.4022 0.3702 0.4404 0.0800  -0.0694 -0.0336 191 SER A N   
1282 C CA  . SER A 155 ? 0.4117 0.3684 0.4506 0.0832  -0.0820 -0.0357 191 SER A CA  
1283 C C   . SER A 155 ? 0.4539 0.4179 0.5083 0.0753  -0.0745 -0.0296 191 SER A C   
1284 O O   . SER A 155 ? 0.4406 0.4031 0.4883 0.0794  -0.0775 -0.0301 191 SER A O   
1285 C CB  . SER A 155 ? 0.4521 0.3914 0.5027 0.0821  -0.1004 -0.0380 191 SER A CB  
1286 O OG  . SER A 155 ? 0.6324 0.5598 0.6868 0.0835  -0.1159 -0.0390 191 SER A OG  
1287 N N   . ASP A 156 ? 0.4181 0.3887 0.4892 0.0665  -0.0641 -0.0235 192 ASP A N   
1288 C CA  . ASP A 156 ? 0.4095 0.3840 0.4910 0.0621  -0.0563 -0.0175 192 ASP A CA  
1289 C C   . ASP A 156 ? 0.4313 0.4115 0.4974 0.0621  -0.0460 -0.0176 192 ASP A C   
1290 O O   . ASP A 156 ? 0.4187 0.3988 0.4838 0.0630  -0.0456 -0.0158 192 ASP A O   
1291 C CB  . ASP A 156 ? 0.4285 0.4055 0.5275 0.0574  -0.0479 -0.0100 192 ASP A CB  
1292 C CG  . ASP A 156 ? 0.5922 0.5709 0.6992 0.0568  -0.0392 -0.0026 192 ASP A CG  
1293 O OD1 . ASP A 156 ? 0.6162 0.5962 0.7437 0.0566  -0.0440 0.0046  192 ASP A OD1 
1294 O OD2 . ASP A 156 ? 0.6631 0.6405 0.7556 0.0567  -0.0290 -0.0034 192 ASP A OD2 
1295 N N   . LEU A 157 ? 0.3540 0.3391 0.4109 0.0603  -0.0394 -0.0181 193 LEU A N   
1296 C CA  . LEU A 157 ? 0.3445 0.3343 0.3930 0.0571  -0.0323 -0.0152 193 LEU A CA  
1297 C C   . LEU A 157 ? 0.3959 0.3943 0.4349 0.0623  -0.0335 -0.0134 193 LEU A C   
1298 O O   . LEU A 157 ? 0.3599 0.3614 0.3982 0.0592  -0.0296 -0.0082 193 LEU A O   
1299 C CB  . LEU A 157 ? 0.3352 0.3264 0.3802 0.0524  -0.0281 -0.0147 193 LEU A CB  
1300 C CG  . LEU A 157 ? 0.3763 0.3586 0.4256 0.0504  -0.0241 -0.0147 193 LEU A CG  
1301 C CD1 . LEU A 157 ? 0.3649 0.3468 0.4060 0.0473  -0.0222 -0.0153 193 LEU A CD1 
1302 C CD2 . LEU A 157 ? 0.3888 0.3609 0.4378 0.0502  -0.0194 -0.0117 193 LEU A CD2 
1303 N N   . LEU A 158 ? 0.3826 0.3838 0.4131 0.0719  -0.0386 -0.0163 194 LEU A N   
1304 C CA  . LEU A 158 ? 0.3873 0.3975 0.4052 0.0823  -0.0377 -0.0125 194 LEU A CA  
1305 C C   . LEU A 158 ? 0.4211 0.4268 0.4382 0.0851  -0.0399 -0.0118 194 LEU A C   
1306 O O   . LEU A 158 ? 0.4074 0.4010 0.4248 0.0881  -0.0490 -0.0178 194 LEU A O   
1307 C CB  . LEU A 158 ? 0.4044 0.4123 0.4057 0.0970  -0.0436 -0.0171 194 LEU A CB  
1308 C CG  . LEU A 158 ? 0.4773 0.4939 0.4592 0.1147  -0.0411 -0.0118 194 LEU A CG  
1309 C CD1 . LEU A 158 ? 0.4697 0.5107 0.4585 0.1126  -0.0284 0.0030  194 LEU A CD1 
1310 C CD2 . LEU A 158 ? 0.5339 0.5398 0.4924 0.1327  -0.0488 -0.0188 194 LEU A CD2 
1311 N N   . GLY A 159 ? 0.3880 0.4034 0.4067 0.0830  -0.0329 -0.0032 195 GLY A N   
1312 C CA  . GLY A 159 ? 0.3813 0.3940 0.3992 0.0858  -0.0333 -0.0011 195 GLY A CA  
1313 C C   . GLY A 159 ? 0.4208 0.4237 0.4513 0.0744  -0.0325 -0.0021 195 GLY A C   
1314 O O   . GLY A 159 ? 0.4072 0.4071 0.4384 0.0763  -0.0329 -0.0004 195 GLY A O   
1315 N N   . LYS A 160 ? 0.3828 0.3802 0.4209 0.0650  -0.0306 -0.0041 196 LYS A N   
1316 C CA  . LYS A 160 ? 0.3826 0.3694 0.4278 0.0587  -0.0279 -0.0037 196 LYS A CA  
1317 C C   . LYS A 160 ? 0.4221 0.4065 0.4647 0.0539  -0.0235 0.0025  196 LYS A C   
1318 O O   . LYS A 160 ? 0.4116 0.4000 0.4526 0.0486  -0.0227 0.0068  196 LYS A O   
1319 C CB  . LYS A 160 ? 0.4040 0.3846 0.4526 0.0541  -0.0258 -0.0062 196 LYS A CB  
1320 C CG  . LYS A 160 ? 0.3721 0.3403 0.4220 0.0524  -0.0206 -0.0042 196 LYS A CG  
1321 C CD  . LYS A 160 ? 0.4741 0.4363 0.5231 0.0521  -0.0171 -0.0053 196 LYS A CD  
1322 C CE  . LYS A 160 ? 0.6014 0.5490 0.6440 0.0557  -0.0104 -0.0023 196 LYS A CE  
1323 N NZ  . LYS A 160 ? 0.5751 0.5263 0.6318 0.0614  -0.0073 0.0034  196 LYS A NZ  
1324 N N   . PRO A 161 ? 0.3856 0.3630 0.4296 0.0550  -0.0221 0.0041  197 PRO A N   
1325 C CA  . PRO A 161 ? 0.3938 0.3633 0.4343 0.0501  -0.0196 0.0096  197 PRO A CA  
1326 C C   . PRO A 161 ? 0.4510 0.4020 0.4851 0.0452  -0.0186 0.0074  197 PRO A C   
1327 O O   . PRO A 161 ? 0.4290 0.3722 0.4622 0.0493  -0.0156 0.0041  197 PRO A O   
1328 C CB  . PRO A 161 ? 0.4226 0.3898 0.4649 0.0554  -0.0183 0.0113  197 PRO A CB  
1329 C CG  . PRO A 161 ? 0.4597 0.4340 0.5080 0.0624  -0.0225 0.0069  197 PRO A CG  
1330 C CD  . PRO A 161 ? 0.4062 0.3813 0.4568 0.0603  -0.0242 0.0023  197 PRO A CD  
1331 N N   . LEU A 162 ? 0.4203 0.3639 0.4495 0.0374  -0.0222 0.0106  198 LEU A N   
1332 C CA  . LEU A 162 ? 0.4421 0.3615 0.4579 0.0345  -0.0249 0.0072  198 LEU A CA  
1333 C C   . LEU A 162 ? 0.4955 0.3986 0.5062 0.0277  -0.0316 0.0125  198 LEU A C   
1334 O O   . LEU A 162 ? 0.4832 0.3926 0.5019 0.0181  -0.0387 0.0194  198 LEU A O   
1335 C CB  . LEU A 162 ? 0.4408 0.3633 0.4553 0.0308  -0.0282 0.0041  198 LEU A CB  
1336 C CG  . LEU A 162 ? 0.5314 0.4267 0.5265 0.0318  -0.0315 -0.0014 198 LEU A CG  
1337 C CD1 . LEU A 162 ? 0.5480 0.4296 0.5322 0.0442  -0.0230 -0.0046 198 LEU A CD1 
1338 C CD2 . LEU A 162 ? 0.4876 0.3902 0.4832 0.0296  -0.0337 -0.0043 198 LEU A CD2 
1339 N N   . GLY A 163 ? 0.5020 0.3857 0.5020 0.0329  -0.0294 0.0115  199 GLY A N   
1340 C CA  . GLY A 163 ? 0.5283 0.3928 0.5227 0.0273  -0.0366 0.0166  199 GLY A CA  
1341 C C   . GLY A 163 ? 0.5701 0.4592 0.5852 0.0216  -0.0366 0.0278  199 GLY A C   
1342 O O   . GLY A 163 ? 0.5498 0.4612 0.5739 0.0285  -0.0283 0.0287  199 GLY A O   
1343 N N   . PRO A 164 ? 0.5462 0.4336 0.5705 0.0097  -0.0465 0.0381  200 PRO A N   
1344 C CA  . PRO A 164 ? 0.5310 0.4467 0.5769 0.0072  -0.0435 0.0531  200 PRO A CA  
1345 C C   . PRO A 164 ? 0.5388 0.4890 0.5997 0.0081  -0.0394 0.0591  200 PRO A C   
1346 O O   . PRO A 164 ? 0.5199 0.4941 0.5989 0.0062  -0.0379 0.0755  200 PRO A O   
1347 C CB  . PRO A 164 ? 0.5752 0.4737 0.6284 -0.0063 -0.0570 0.0651  200 PRO A CB  
1348 C CG  . PRO A 164 ? 0.6468 0.5164 0.6861 -0.0135 -0.0705 0.0568  200 PRO A CG  
1349 C CD  . PRO A 164 ? 0.5918 0.4508 0.6081 -0.0011 -0.0623 0.0388  200 PRO A CD  
1350 N N   . ARG A 165 ? 0.4611 0.4140 0.5145 0.0125  -0.0368 0.0477  201 ARG A N   
1351 C CA  . ARG A 165 ? 0.4455 0.4261 0.5084 0.0150  -0.0336 0.0517  201 ARG A CA  
1352 C C   . ARG A 165 ? 0.4771 0.4672 0.5321 0.0282  -0.0259 0.0408  201 ARG A C   
1353 O O   . ARG A 165 ? 0.4769 0.4517 0.5223 0.0319  -0.0246 0.0294  201 ARG A O   
1354 C CB  . ARG A 165 ? 0.4482 0.4215 0.5110 0.0058  -0.0418 0.0494  201 ARG A CB  
1355 C CG  . ARG A 165 ? 0.5594 0.5136 0.6271 -0.0091 -0.0562 0.0574  201 ARG A CG  
1356 C CD  . ARG A 165 ? 0.5500 0.5312 0.6432 -0.0177 -0.0607 0.0767  201 ARG A CD  
1357 N NE  . ARG A 165 ? 0.5234 0.4874 0.6278 -0.0344 -0.0785 0.0878  201 ARG A NE  
1358 C CZ  . ARG A 165 ? 0.6511 0.6383 0.7855 -0.0450 -0.0853 0.1105  201 ARG A CZ  
1359 N NH1 . ARG A 165 ? 0.4975 0.5273 0.6502 -0.0374 -0.0725 0.1245  201 ARG A NH1 
1360 N NH2 . ARG A 165 ? 0.5280 0.4951 0.6745 -0.0622 -0.1058 0.1209  201 ARG A NH2 
1361 N N   . THR A 166 ? 0.4229 0.4375 0.4823 0.0358  -0.0219 0.0460  202 THR A N   
1362 C CA  . THR A 166 ? 0.4044 0.4253 0.4552 0.0477  -0.0192 0.0362  202 THR A CA  
1363 C C   . THR A 166 ? 0.4197 0.4494 0.4725 0.0455  -0.0203 0.0361  202 THR A C   
1364 O O   . THR A 166 ? 0.4013 0.4498 0.4630 0.0450  -0.0188 0.0494  202 THR A O   
1365 C CB  . THR A 166 ? 0.4503 0.4864 0.4965 0.0624  -0.0150 0.0415  202 THR A CB  
1366 O OG1 . THR A 166 ? 0.4947 0.5206 0.5389 0.0636  -0.0149 0.0401  202 THR A OG1 
1367 C CG2 . THR A 166 ? 0.3984 0.4364 0.4319 0.0758  -0.0166 0.0315  202 THR A CG2 
1368 N N   . LEU A 167 ? 0.3669 0.3857 0.4139 0.0451  -0.0223 0.0236  203 LEU A N   
1369 C CA  . LEU A 167 ? 0.3466 0.3720 0.3946 0.0432  -0.0234 0.0228  203 LEU A CA  
1370 C C   . LEU A 167 ? 0.4137 0.4571 0.4576 0.0558  -0.0206 0.0250  203 LEU A C   
1371 O O   . LEU A 167 ? 0.4189 0.4604 0.4532 0.0678  -0.0207 0.0192  203 LEU A O   
1372 C CB  . LEU A 167 ? 0.3302 0.3389 0.3730 0.0408  -0.0252 0.0104  203 LEU A CB  
1373 C CG  . LEU A 167 ? 0.3775 0.3643 0.4167 0.0336  -0.0268 0.0071  203 LEU A CG  
1374 C CD1 . LEU A 167 ? 0.3610 0.3367 0.3949 0.0350  -0.0260 -0.0011 203 LEU A CD1 
1375 C CD2 . LEU A 167 ? 0.3596 0.3407 0.4005 0.0229  -0.0325 0.0150  203 LEU A CD2 
1376 N N   . TYR A 168 ? 0.3949 0.4534 0.4445 0.0542  -0.0196 0.0334  204 TYR A N   
1377 C CA  . TYR A 168 ? 0.3931 0.4676 0.4357 0.0685  -0.0159 0.0361  204 TYR A CA  
1378 C C   . TYR A 168 ? 0.4064 0.4755 0.4469 0.0652  -0.0186 0.0275  204 TYR A C   
1379 O O   . TYR A 168 ? 0.4050 0.4695 0.4540 0.0516  -0.0217 0.0280  204 TYR A O   
1380 C CB  . TYR A 168 ? 0.4123 0.5153 0.4655 0.0731  -0.0098 0.0578  204 TYR A CB  
1381 C CG  . TYR A 168 ? 0.4453 0.5631 0.4860 0.0926  -0.0043 0.0609  204 TYR A CG  
1382 C CD1 . TYR A 168 ? 0.4940 0.6029 0.5101 0.1129  -0.0037 0.0516  204 TYR A CD1 
1383 C CD2 . TYR A 168 ? 0.4486 0.5842 0.4985 0.0915  -0.0020 0.0709  204 TYR A CD2 
1384 C CE1 . TYR A 168 ? 0.5227 0.6375 0.5199 0.1336  -0.0006 0.0520  204 TYR A CE1 
1385 C CE2 . TYR A 168 ? 0.4713 0.6182 0.5061 0.1120  0.0037  0.0734  204 TYR A CE2 
1386 C CZ  . TYR A 168 ? 0.5972 0.7319 0.6034 0.1339  0.0045  0.0632  204 TYR A CZ  
1387 O OH  . TYR A 168 ? 0.6383 0.7776 0.6227 0.1572  0.0085  0.0642  204 TYR A OH  
1388 N N   . VAL A 169 ? 0.3605 0.4271 0.3876 0.0782  -0.0190 0.0194  205 VAL A N   
1389 C CA  . VAL A 169 ? 0.3593 0.4214 0.3852 0.0758  -0.0211 0.0125  205 VAL A CA  
1390 C C   . VAL A 169 ? 0.4501 0.5233 0.4639 0.0926  -0.0186 0.0152  205 VAL A C   
1391 O O   . VAL A 169 ? 0.4613 0.5298 0.4584 0.1089  -0.0195 0.0121  205 VAL A O   
1392 C CB  . VAL A 169 ? 0.4029 0.4424 0.4266 0.0722  -0.0265 -0.0022 205 VAL A CB  
1393 C CG1 . VAL A 169 ? 0.3892 0.4262 0.4136 0.0698  -0.0273 -0.0066 205 VAL A CG1 
1394 C CG2 . VAL A 169 ? 0.3882 0.4159 0.4198 0.0609  -0.0270 -0.0040 205 VAL A CG2 
1395 N N   . HIS A 170 ? 0.4325 0.5183 0.4515 0.0905  -0.0161 0.0210  206 HIS A N   
1396 C CA  . HIS A 170 ? 0.4632 0.5563 0.4674 0.1087  -0.0133 0.0225  206 HIS A CA  
1397 C C   . HIS A 170 ? 0.4656 0.5552 0.4714 0.1040  -0.0153 0.0169  206 HIS A C   
1398 O O   . HIS A 170 ? 0.4342 0.5242 0.4547 0.0873  -0.0168 0.0175  206 HIS A O   
1399 C CB  . HIS A 170 ? 0.5121 0.6339 0.5167 0.1226  -0.0039 0.0425  206 HIS A CB  
1400 C CG  . HIS A 170 ? 0.5593 0.7085 0.5887 0.1117  0.0004  0.0616  206 HIS A CG  
1401 N ND1 . HIS A 170 ? 0.5928 0.7431 0.6314 0.1005  -0.0029 0.0598  206 HIS A ND1 
1402 C CD2 . HIS A 170 ? 0.5935 0.7714 0.6402 0.1130  0.0070  0.0852  206 HIS A CD2 
1403 C CE1 . HIS A 170 ? 0.5822 0.7600 0.6438 0.0936  -0.0005 0.0811  206 HIS A CE1 
1404 N NE2 . HIS A 170 ? 0.5868 0.7829 0.6565 0.1000  0.0054  0.0982  206 HIS A NE2 
1405 N N   . TRP A 171 ? 0.4430 0.5239 0.4302 0.1198  -0.0170 0.0098  207 TRP A N   
1406 C CA  . TRP A 171 ? 0.4392 0.5177 0.4260 0.1185  -0.0181 0.0058  207 TRP A CA  
1407 C C   . TRP A 171 ? 0.4648 0.5723 0.4616 0.1191  -0.0103 0.0223  207 TRP A C   
1408 O O   . TRP A 171 ? 0.4693 0.5963 0.4623 0.1330  -0.0033 0.0360  207 TRP A O   
1409 C CB  . TRP A 171 ? 0.4461 0.5061 0.4082 0.1376  -0.0234 -0.0042 207 TRP A CB  
1410 C CG  . TRP A 171 ? 0.4551 0.4856 0.4117 0.1356  -0.0353 -0.0188 207 TRP A CG  
1411 C CD1 . TRP A 171 ? 0.5074 0.5231 0.4490 0.1460  -0.0422 -0.0239 207 TRP A CD1 
1412 C CD2 . TRP A 171 ? 0.4400 0.4535 0.4088 0.1227  -0.0426 -0.0276 207 TRP A CD2 
1413 N NE1 . TRP A 171 ? 0.4960 0.4864 0.4423 0.1387  -0.0555 -0.0353 207 TRP A NE1 
1414 C CE2 . TRP A 171 ? 0.4896 0.4798 0.4541 0.1246  -0.0549 -0.0363 207 TRP A CE2 
1415 C CE3 . TRP A 171 ? 0.4438 0.4600 0.4265 0.1114  -0.0401 -0.0273 207 TRP A CE3 
1416 C CZ2 . TRP A 171 ? 0.4778 0.4509 0.4571 0.1144  -0.0643 -0.0418 207 TRP A CZ2 
1417 C CZ3 . TRP A 171 ? 0.4650 0.4637 0.4587 0.1034  -0.0473 -0.0335 207 TRP A CZ3 
1418 C CH2 . TRP A 171 ? 0.4820 0.4610 0.4767 0.1043  -0.0590 -0.0392 207 TRP A CH2 
1419 N N   . THR A 172 ? 0.4308 0.5426 0.4411 0.1053  -0.0114 0.0233  208 THR A N   
1420 C CA  . THR A 172 ? 0.4255 0.5658 0.4498 0.1034  -0.0069 0.0406  208 THR A CA  
1421 C C   . THR A 172 ? 0.4456 0.5848 0.4636 0.1083  -0.0067 0.0366  208 THR A C   
1422 O O   . THR A 172 ? 0.4284 0.5460 0.4420 0.1016  -0.0116 0.0222  208 THR A O   
1423 C CB  . THR A 172 ? 0.5252 0.6709 0.5724 0.0806  -0.0122 0.0478  208 THR A CB  
1424 O OG1 . THR A 172 ? 0.6109 0.7545 0.6631 0.0763  -0.0128 0.0508  208 THR A OG1 
1425 C CG2 . THR A 172 ? 0.4888 0.6647 0.5565 0.0759  -0.0118 0.0688  208 THR A CG2 
1426 N N   . ASP A 173 ? 0.4100 0.5745 0.4294 0.1204  0.0000  0.0518  209 ASP A N   
1427 C CA  . ASP A 173 ? 0.4105 0.5783 0.4259 0.1252  0.0010  0.0510  209 ASP A CA  
1428 C C   . ASP A 173 ? 0.4349 0.6133 0.4737 0.1036  -0.0044 0.0573  209 ASP A C   
1429 O O   . ASP A 173 ? 0.4030 0.6075 0.4631 0.0968  -0.0044 0.0764  209 ASP A O   
1430 C CB  . ASP A 173 ? 0.4432 0.6347 0.4493 0.1497  0.0112  0.0666  209 ASP A CB  
1431 C CG  . ASP A 173 ? 0.5666 0.7689 0.5729 0.1548  0.0136  0.0710  209 ASP A CG  
1432 O OD1 . ASP A 173 ? 0.5342 0.7148 0.5348 0.1473  0.0076  0.0552  209 ASP A OD1 
1433 O OD2 . ASP A 173 ? 0.5775 0.8114 0.5897 0.1685  0.0227  0.0920  209 ASP A OD2 
1434 N N   . ALA A 174 ? 0.4429 0.5998 0.4776 0.0938  -0.0101 0.0427  210 ALA A N   
1435 C CA  . ALA A 174 ? 0.4527 0.6106 0.5002 0.0765  -0.0174 0.0447  210 ALA A CA  
1436 C C   . ALA A 174 ? 0.5694 0.7550 0.6291 0.0782  -0.0168 0.0609  210 ALA A C   
1437 O O   . ALA A 174 ? 0.5827 0.7776 0.6596 0.0633  -0.0257 0.0706  210 ALA A O   
1438 C CB  . ALA A 174 ? 0.4626 0.5932 0.4979 0.0734  -0.0200 0.0273  210 ALA A CB  
1439 N N   . GLY A 175 ? 0.5441 0.7406 0.5940 0.0970  -0.0080 0.0642  211 GLY A N   
1440 C CA  . GLY A 175 ? 0.5439 0.7688 0.6040 0.1028  -0.0049 0.0808  211 GLY A CA  
1441 C C   . GLY A 175 ? 0.6133 0.8747 0.7011 0.0987  -0.0046 0.1078  211 GLY A C   
1442 O O   . GLY A 175 ? 0.6184 0.9039 0.7258 0.0933  -0.0080 0.1240  211 GLY A O   
1443 N N   . GLN A 176 ? 0.5727 0.8393 0.6658 0.0997  -0.0019 0.1144  212 GLN A N   
1444 C CA  . GLN A 176 ? 0.5791 0.8831 0.7030 0.0967  -0.0005 0.1442  212 GLN A CA  
1445 C C   . GLN A 176 ? 0.6075 0.9078 0.7571 0.0691  -0.0163 0.1495  212 GLN A C   
1446 O O   . GLN A 176 ? 0.6108 0.9415 0.7915 0.0635  -0.0177 0.1765  212 GLN A O   
1447 C CB  . GLN A 176 ? 0.6097 0.9267 0.7236 0.1197  0.0142  0.1538  212 GLN A CB  
1448 C CG  . GLN A 176 ? 0.7985 1.1289 0.8918 0.1504  0.0288  0.1598  212 GLN A CG  
1449 C CD  . GLN A 176 ? 1.0263 1.3986 1.1456 0.1539  0.0332  0.1883  212 GLN A CD  
1450 O OE1 . GLN A 176 ? 0.9999 1.4071 1.1583 0.1425  0.0312  0.2168  212 GLN A OE1 
1451 N NE2 . GLN A 176 ? 0.9152 1.2858 1.0156 0.1703  0.0390  0.1833  212 GLN A NE2 
1452 N N   . LEU A 177 ? 0.5358 0.7993 0.6730 0.0533  -0.0284 0.1265  213 LEU A N   
1453 C CA  . LEU A 177 ? 0.5259 0.7784 0.6801 0.0297  -0.0457 0.1294  213 LEU A CA  
1454 C C   . LEU A 177 ? 0.5784 0.8347 0.7482 0.0144  -0.0624 0.1371  213 LEU A C   
1455 O O   . LEU A 177 ? 0.5741 0.8221 0.7291 0.0188  -0.0623 0.1261  213 LEU A O   
1456 C CB  . LEU A 177 ? 0.5268 0.7362 0.6565 0.0235  -0.0505 0.1026  213 LEU A CB  
1457 C CG  . LEU A 177 ? 0.5689 0.7686 0.6877 0.0312  -0.0412 0.0952  213 LEU A CG  
1458 C CD1 . LEU A 177 ? 0.5638 0.7240 0.6598 0.0269  -0.0449 0.0702  213 LEU A CD1 
1459 C CD2 . LEU A 177 ? 0.5805 0.7966 0.7238 0.0225  -0.0450 0.1149  213 LEU A CD2 
1460 N N   . THR A 178 ? 0.5422 0.8100 0.7426 -0.0036 -0.0784 0.1569  214 THR A N   
1461 C CA  . THR A 178 ? 0.5533 0.8196 0.7711 -0.0218 -0.1015 0.1655  214 THR A CA  
1462 C C   . THR A 178 ? 0.6210 0.8572 0.8428 -0.0425 -0.1238 0.1622  214 THR A C   
1463 O O   . THR A 178 ? 0.5862 0.8190 0.8088 -0.0415 -0.1171 0.1623  214 THR A O   
1464 C CB  . THR A 178 ? 0.5959 0.9135 0.8558 -0.0224 -0.1015 0.2015  214 THR A CB  
1465 O OG1 . THR A 178 ? 0.5519 0.8984 0.8422 -0.0231 -0.0958 0.2273  214 THR A OG1 
1466 C CG2 . THR A 178 ? 0.5681 0.9105 0.8188 -0.0003 -0.0815 0.2037  214 THR A CG2 
1467 N N   . PRO A 179 ? 0.6043 0.8160 0.8267 -0.0600 -0.1516 0.1594  215 PRO A N   
1468 C CA  . PRO A 179 ? 0.6252 0.8026 0.8472 -0.0778 -0.1752 0.1560  215 PRO A CA  
1469 C C   . PRO A 179 ? 0.6497 0.8555 0.9143 -0.0882 -0.1778 0.1851  215 PRO A C   
1470 O O   . PRO A 179 ? 0.6521 0.8322 0.9108 -0.0956 -0.1853 0.1791  215 PRO A O   
1471 C CB  . PRO A 179 ? 0.6803 0.8355 0.9019 -0.0928 -0.2070 0.1558  215 PRO A CB  
1472 C CG  . PRO A 179 ? 0.7316 0.8908 0.9309 -0.0782 -0.1947 0.1429  215 PRO A CG  
1473 C CD  . PRO A 179 ? 0.6410 0.8505 0.8601 -0.0630 -0.1647 0.1581  215 PRO A CD  
1474 N N   . ALA A 180 ? 0.5785 0.8385 0.8854 -0.0865 -0.1696 0.2179  216 ALA A N   
1475 C CA  . ALA A 180 ? 0.5666 0.8626 0.9194 -0.0935 -0.1686 0.2521  216 ALA A CA  
1476 C C   . ALA A 180 ? 0.5566 0.8672 0.8977 -0.0732 -0.1376 0.2498  216 ALA A C   
1477 O O   . ALA A 180 ? 0.5524 0.8659 0.9107 -0.0795 -0.1390 0.2621  216 ALA A O   
1478 C CB  . ALA A 180 ? 0.5719 0.9238 0.9748 -0.0958 -0.1695 0.2914  216 ALA A CB  
1479 N N   . LEU A 181 ? 0.4828 0.8011 0.7948 -0.0488 -0.1117 0.2349  217 LEU A N   
1480 C CA  . LEU A 181 ? 0.4739 0.8023 0.7696 -0.0270 -0.0850 0.2311  217 LEU A CA  
1481 C C   . LEU A 181 ? 0.5108 0.7920 0.7698 -0.0277 -0.0853 0.1986  217 LEU A C   
1482 O O   . LEU A 181 ? 0.4912 0.7748 0.7361 -0.0122 -0.0675 0.1937  217 LEU A O   
1483 C CB  . LEU A 181 ? 0.4676 0.8159 0.7438 -0.0005 -0.0618 0.2272  217 LEU A CB  
1484 C CG  . LEU A 181 ? 0.5283 0.9324 0.8389 0.0103  -0.0513 0.2648  217 LEU A CG  
1485 C CD1 . LEU A 181 ? 0.5269 0.9388 0.8108 0.0350  -0.0337 0.2554  217 LEU A CD1 
1486 C CD2 . LEU A 181 ? 0.5575 0.9971 0.8913 0.0217  -0.0364 0.2944  217 LEU A CD2 
1487 N N   . LEU A 182 ? 0.4693 0.7075 0.7122 -0.0440 -0.1060 0.1781  218 LEU A N   
1488 C CA  . LEU A 182 ? 0.4697 0.6646 0.6818 -0.0453 -0.1078 0.1519  218 LEU A CA  
1489 C C   . LEU A 182 ? 0.5153 0.7132 0.7488 -0.0550 -0.1131 0.1673  218 LEU A C   
1490 O O   . LEU A 182 ? 0.5006 0.6774 0.7144 -0.0501 -0.1061 0.1525  218 LEU A O   
1491 C CB  . LEU A 182 ? 0.4840 0.6330 0.6713 -0.0564 -0.1285 0.1299  218 LEU A CB  
1492 C CG  . LEU A 182 ? 0.5223 0.6582 0.6808 -0.0458 -0.1228 0.1096  218 LEU A CG  
1493 C CD1 . LEU A 182 ? 0.5490 0.6381 0.6808 -0.0541 -0.1432 0.0911  218 LEU A CD1 
1494 C CD2 . LEU A 182 ? 0.5109 0.6435 0.6442 -0.0264 -0.0986 0.0915  218 LEU A CD2 
1495 N N   . HIS A 183 ? 0.4718 0.6981 0.7490 -0.0689 -0.1256 0.1996  219 HIS A N   
1496 C CA  . HIS A 183 ? 0.4763 0.7091 0.7823 -0.0806 -0.1331 0.2204  219 HIS A CA  
1497 C C   . HIS A 183 ? 0.5032 0.7848 0.8303 -0.0635 -0.1075 0.2453  219 HIS A C   
1498 O O   . HIS A 183 ? 0.5024 0.8282 0.8545 -0.0552 -0.0977 0.2703  219 HIS A O   
1499 C CB  . HIS A 183 ? 0.5041 0.7353 0.8475 -0.1071 -0.1652 0.2427  219 HIS A CB  
1500 C CG  . HIS A 183 ? 0.5723 0.7499 0.8852 -0.1191 -0.1914 0.2158  219 HIS A CG  
1501 N ND1 . HIS A 183 ? 0.6209 0.7474 0.9132 -0.1305 -0.2114 0.1996  219 HIS A ND1 
1502 C CD2 . HIS A 183 ? 0.5896 0.7560 0.8834 -0.1171 -0.1977 0.2016  219 HIS A CD2 
1503 C CE1 . HIS A 183 ? 0.6306 0.7162 0.8903 -0.1333 -0.2292 0.1767  219 HIS A CE1 
1504 N NE2 . HIS A 183 ? 0.6190 0.7275 0.8798 -0.1262 -0.2220 0.1775  219 HIS A NE2 
1505 N N   . SER A 184 ? 0.4537 0.7249 0.7645 -0.0544 -0.0950 0.2364  220 SER A N   
1506 C CA  . SER A 184 ? 0.4318 0.7389 0.7498 -0.0338 -0.0703 0.2540  220 SER A CA  
1507 C C   . SER A 184 ? 0.4866 0.8379 0.8583 -0.0410 -0.0722 0.2993  220 SER A C   
1508 O O   . SER A 184 ? 0.4576 0.7997 0.8594 -0.0663 -0.0957 0.3130  220 SER A O   
1509 C CB  . SER A 184 ? 0.4536 0.7321 0.7426 -0.0272 -0.0631 0.2328  220 SER A CB  
1510 O OG  . SER A 184 ? 0.5169 0.8231 0.8006 -0.0024 -0.0390 0.2433  220 SER A OG  
1511 N N   . ARG A 185 ? 0.2924 0.8217 0.5870 0.0380  -0.0360 0.2598  221 ARG A N   
1512 C CA  . ARG A 185 ? 0.3427 0.8974 0.6633 0.0355  -0.0229 0.2664  221 ARG A CA  
1513 C C   . ARG A 185 ? 0.4663 0.9730 0.7524 0.0439  -0.0014 0.2429  221 ARG A C   
1514 O O   . ARG A 185 ? 0.4779 0.9959 0.7730 0.0378  0.0108  0.2447  221 ARG A O   
1515 C CB  . ARG A 185 ? 0.3698 0.9703 0.7569 0.0580  -0.0126 0.2938  221 ARG A CB  
1516 C CG  . ARG A 185 ? 0.4427 1.1047 0.8725 0.0481  -0.0373 0.3273  221 ARG A CG  
1517 C CD  . ARG A 185 ? 0.6620 1.3720 1.1707 0.0746  -0.0247 0.3600  221 ARG A CD  
1518 N NE  . ARG A 185 ? 0.8276 1.5968 1.3780 0.0689  -0.0515 0.3988  221 ARG A NE  
1519 C CZ  . ARG A 185 ? 1.0106 1.8387 1.6428 0.0883  -0.0485 0.4395  221 ARG A CZ  
1520 N NH1 . ARG A 185 ? 0.8781 1.7103 1.5603 0.1148  -0.0153 0.4423  221 ARG A NH1 
1521 N NH2 . ARG A 185 ? 0.8647 1.7506 1.5313 0.0806  -0.0775 0.4797  221 ARG A NH2 
1522 N N   . CYS A 186 ? 0.4591 0.9169 0.7060 0.0552  0.0016  0.2234  222 CYS A N   
1523 C CA  . CYS A 186 ? 0.4845 0.9017 0.6951 0.0623  0.0167  0.2052  222 CYS A CA  
1524 C C   . CYS A 186 ? 0.5370 0.9220 0.7084 0.0454  0.0069  0.1924  222 CYS A C   
1525 O O   . CYS A 186 ? 0.5101 0.8828 0.6682 0.0378  -0.0071 0.1861  222 CYS A O   
1526 C CB  . CYS A 186 ? 0.5010 0.8931 0.7008 0.0852  0.0287  0.1942  222 CYS A CB  
1527 S SG  . CYS A 186 ? 0.5667 0.9784 0.8084 0.1074  0.0577  0.2015  222 CYS A SG  
1528 N N   . LEU A 187 ? 0.5132 0.8827 0.6682 0.0407  0.0173  0.1898  223 LEU A N   
1529 C CA  . LEU A 187 ? 0.5147 0.8503 0.6419 0.0296  0.0142  0.1820  223 LEU A CA  
1530 C C   . LEU A 187 ? 0.5633 0.8734 0.6641 0.0442  0.0217  0.1784  223 LEU A C   
1531 O O   . LEU A 187 ? 0.5572 0.8771 0.6554 0.0545  0.0335  0.1811  223 LEU A O   
1532 C CB  . LEU A 187 ? 0.5284 0.8673 0.6626 0.0074  0.0193  0.1880  223 LEU A CB  
1533 C CG  . LEU A 187 ? 0.5827 0.9513 0.7378 -0.0178 0.0105  0.1909  223 LEU A CG  
1534 C CD1 . LEU A 187 ? 0.6026 0.9661 0.7598 -0.0422 0.0203  0.1927  223 LEU A CD1 
1535 C CD2 . LEU A 187 ? 0.5707 0.9295 0.7132 -0.0303 -0.0039 0.1797  223 LEU A CD2 
1536 N N   . CYS A 188 ? 0.5170 0.7979 0.5996 0.0431  0.0161  0.1731  224 CYS A N   
1537 C CA  . CYS A 188 ? 0.5254 0.7904 0.5860 0.0536  0.0188  0.1759  224 CYS A CA  
1538 C C   . CYS A 188 ? 0.5699 0.8154 0.6311 0.0453  0.0232  0.1871  224 CYS A C   
1539 O O   . CYS A 188 ? 0.5823 0.8079 0.6520 0.0367  0.0218  0.1822  224 CYS A O   
1540 C CB  . CYS A 188 ? 0.5259 0.7790 0.5733 0.0635  0.0093  0.1650  224 CYS A CB  
1541 S SG  . CYS A 188 ? 0.5983 0.8455 0.6206 0.0717  0.0075  0.1728  224 CYS A SG  
1542 N N   . VAL A 189 ? 0.5341 0.7839 0.5871 0.0462  0.0320  0.2023  225 VAL A N   
1543 C CA  . VAL A 189 ? 0.5398 0.7700 0.5959 0.0411  0.0389  0.2199  225 VAL A CA  
1544 C C   . VAL A 189 ? 0.6088 0.8350 0.6486 0.0538  0.0324  0.2337  225 VAL A C   
1545 O O   . VAL A 189 ? 0.5997 0.8459 0.6158 0.0579  0.0305  0.2380  225 VAL A O   
1546 C CB  . VAL A 189 ? 0.5978 0.8376 0.6577 0.0303  0.0529  0.2335  225 VAL A CB  
1547 C CG1 . VAL A 189 ? 0.6230 0.8337 0.6933 0.0229  0.0628  0.2509  225 VAL A CG1 
1548 C CG2 . VAL A 189 ? 0.5793 0.8404 0.6578 0.0181  0.0565  0.2225  225 VAL A CG2 
1549 N N   . ASP A 190 ? 0.5865 0.7896 0.6402 0.0583  0.0300  0.2406  226 ASP A N   
1550 C CA  . ASP A 190 ? 0.6067 0.8142 0.6544 0.0700  0.0216  0.2614  226 ASP A CA  
1551 C C   . ASP A 190 ? 0.6753 0.8547 0.7523 0.0727  0.0317  0.2854  226 ASP A C   
1552 O O   . ASP A 190 ? 0.6693 0.8258 0.7612 0.0618  0.0476  0.2836  226 ASP A O   
1553 C CB  . ASP A 190 ? 0.6030 0.8198 0.6444 0.0785  0.0069  0.2462  226 ASP A CB  
1554 C CG  . ASP A 190 ? 0.6323 0.8255 0.6984 0.0813  0.0074  0.2322  226 ASP A CG  
1555 O OD1 . ASP A 190 ? 0.6184 0.7868 0.7017 0.0724  0.0199  0.2237  226 ASP A OD1 
1556 O OD2 . ASP A 190 ? 0.6771 0.8775 0.7437 0.0892  -0.0032 0.2282  226 ASP A OD2 
1557 N N   . ARG A 191 ? 0.6648 0.8475 0.7536 0.0859  0.0241  0.3099  227 ARG A N   
1558 C CA  . ARG A 191 ? 0.6854 0.8425 0.8107 0.0936  0.0362  0.3410  227 ARG A CA  
1559 C C   . ARG A 191 ? 0.7685 0.9241 0.8856 0.0858  0.0466  0.3661  227 ARG A C   
1560 O O   . ARG A 191 ? 0.7984 0.9190 0.9436 0.0833  0.0670  0.3796  227 ARG A O   
1561 C CB  . ARG A 191 ? 0.6903 0.8024 0.8510 0.0914  0.0555  0.3214  227 ARG A CB  
1562 C CG  . ARG A 191 ? 0.7512 0.8575 0.9423 0.1071  0.0530  0.3240  227 ARG A CG  
1563 C CD  . ARG A 191 ? 0.7657 0.8399 0.9671 0.0976  0.0671  0.2849  227 ARG A CD  
1564 N NE  . ARG A 191 ? 0.7924 0.8548 1.0297 0.1116  0.0725  0.2857  227 ARG A NE  
1565 C CZ  . ARG A 191 ? 0.9472 1.0414 1.1828 0.1232  0.0525  0.2870  227 ARG A CZ  
1566 N NH1 . ARG A 191 ? 0.7882 0.9251 0.9856 0.1221  0.0266  0.2879  227 ARG A NH1 
1567 N NH2 . ARG A 191 ? 0.7923 0.8756 1.0667 0.1349  0.0612  0.2872  227 ARG A NH2 
1568 N N   . LEU A 192 ? 0.7111 0.9028 0.7877 0.0796  0.0359  0.3693  228 LEU A N   
1569 C CA  . LEU A 192 ? 0.7435 0.9431 0.8030 0.0707  0.0440  0.3932  228 LEU A CA  
1570 C C   . LEU A 192 ? 0.8341 1.0394 0.9062 0.0807  0.0391  0.4445  228 LEU A C   
1571 O O   . LEU A 192 ? 0.8139 1.0364 0.8957 0.0931  0.0224  0.4579  228 LEU A O   
1572 C CB  . LEU A 192 ? 0.7426 0.9803 0.7537 0.0610  0.0367  0.3784  228 LEU A CB  
1573 C CG  . LEU A 192 ? 0.7731 1.0152 0.7752 0.0551  0.0397  0.3345  228 LEU A CG  
1574 C CD1 . LEU A 192 ? 0.7798 1.0548 0.7395 0.0488  0.0378  0.3242  228 LEU A CD1 
1575 C CD2 . LEU A 192 ? 0.8145 1.0398 0.8354 0.0442  0.0575  0.3241  228 LEU A CD2 
1576 N N   . PRO A 193 ? 0.8393 1.0362 0.9134 0.0755  0.0516  0.4784  229 PRO A N   
1577 C CA  . PRO A 193 ? 0.8791 1.0910 0.9642 0.0858  0.0427  0.5349  229 PRO A CA  
1578 C C   . PRO A 193 ? 0.9295 1.1999 0.9683 0.0819  0.0144  0.5433  229 PRO A C   
1579 O O   . PRO A 193 ? 0.9014 1.1929 0.8906 0.0658  0.0132  0.5153  229 PRO A O   
1580 C CB  . PRO A 193 ? 0.9432 1.1401 1.0236 0.0750  0.0614  0.5634  229 PRO A CB  
1581 C CG  . PRO A 193 ? 0.9752 1.1371 1.0629 0.0623  0.0841  0.5217  229 PRO A CG  
1582 C CD  . PRO A 193 ? 0.8711 1.0519 0.9367 0.0591  0.0723  0.4713  229 PRO A CD  
1583 N N   . PRO A 194 ? 0.8977 1.1964 0.9532 0.0944  -0.0069 0.5767  230 PRO A N   
1584 C CA  . PRO A 194 ? 0.9018 1.2599 0.9071 0.0829  -0.0343 0.5801  230 PRO A CA  
1585 C C   . PRO A 194 ? 1.0116 1.3990 0.9581 0.0608  -0.0349 0.5994  230 PRO A C   
1586 O O   . PRO A 194 ? 1.0431 1.4247 1.0002 0.0613  -0.0276 0.6448  230 PRO A O   
1587 C CB  . PRO A 194 ? 0.9346 1.3206 0.9811 0.0994  -0.0554 0.6270  230 PRO A CB  
1588 C CG  . PRO A 194 ? 1.0014 1.3419 1.1178 0.1206  -0.0351 0.6592  230 PRO A CG  
1589 C CD  . PRO A 194 ? 0.9220 1.2021 1.0455 0.1174  -0.0047 0.6127  230 PRO A CD  
1590 N N   . GLY A 195 ? 0.9840 1.3968 0.8702 0.0407  -0.0385 0.5621  231 GLY A N   
1591 C CA  . GLY A 195 ? 1.0337 1.4726 0.8571 0.0155  -0.0333 0.5692  231 GLY A CA  
1592 C C   . GLY A 195 ? 1.0970 1.5013 0.9171 0.0099  -0.0025 0.5458  231 GLY A C   
1593 O O   . GLY A 195 ? 1.1401 1.5528 0.9329 -0.0044 0.0077  0.5711  231 GLY A O   
1594 N N   . PHE A 196 ? 1.0194 1.3888 0.8686 0.0194  0.0120  0.5001  232 PHE A N   
1595 C CA  . PHE A 196 ? 1.0149 1.3595 0.8689 0.0132  0.0390  0.4762  232 PHE A CA  
1596 C C   . PHE A 196 ? 1.0822 1.4495 0.8867 -0.0034 0.0490  0.4386  232 PHE A C   
1597 O O   . PHE A 196 ? 1.0519 1.4260 0.8472 -0.0011 0.0422  0.4047  232 PHE A O   
1598 C CB  . PHE A 196 ? 0.9910 1.2961 0.8992 0.0274  0.0472  0.4492  232 PHE A CB  
1599 C CG  . PHE A 196 ? 1.0040 1.2881 0.9281 0.0192  0.0716  0.4348  232 PHE A CG  
1600 C CD1 . PHE A 196 ? 1.0726 1.3332 1.0192 0.0158  0.0856  0.4653  232 PHE A CD1 
1601 C CD2 . PHE A 196 ? 0.9874 1.2773 0.9089 0.0145  0.0813  0.3931  232 PHE A CD2 
1602 C CE1 . PHE A 196 ? 1.0761 1.3221 1.0376 0.0040  0.1077  0.4512  232 PHE A CE1 
1603 C CE2 . PHE A 196 ? 1.0167 1.2972 0.9586 0.0054  0.1013  0.3833  232 PHE A CE2 
1604 C CZ  . PHE A 196 ? 1.0231 1.2828 0.9831 -0.0016 0.1137  0.4107  232 PHE A CZ  
1605 N N   . ASN A 197 ? 1.0904 1.4678 0.8635 -0.0208 0.0682  0.4451  233 ASN A N   
1606 C CA  . ASN A 197 ? 1.1090 1.5057 0.8363 -0.0377 0.0852  0.4101  233 ASN A CA  
1607 C C   . ASN A 197 ? 1.1879 1.5746 0.9291 -0.0432 0.1170  0.3935  233 ASN A C   
1608 O O   . ASN A 197 ? 1.1843 1.5786 0.9122 -0.0488 0.1362  0.3566  233 ASN A O   
1609 C CB  . ASN A 197 ? 1.1833 1.6161 0.8419 -0.0616 0.0790  0.4306  233 ASN A CB  
1610 C CG  . ASN A 197 ? 1.3714 1.8212 0.9761 -0.0821 0.0976  0.3884  233 ASN A CG  
1611 O OD1 . ASN A 197 ? 1.1996 1.6365 0.8198 -0.0739 0.1080  0.3440  233 ASN A OD1 
1612 N ND2 . ASN A 197 ? 1.2825 1.7605 0.8218 -0.1110 0.1042  0.4022  233 ASN A ND2 
1613 N N   . ASP A 198 ? 1.1633 1.5334 0.9350 -0.0422 0.1252  0.4203  234 ASP A N   
1614 C CA  . ASP A 198 ? 1.1651 1.5325 0.9541 -0.0498 0.1542  0.4055  234 ASP A CA  
1615 C C   . ASP A 198 ? 1.1448 1.4964 0.9915 -0.0355 0.1556  0.3756  234 ASP A C   
1616 O O   . ASP A 198 ? 1.1159 1.4439 1.0030 -0.0287 0.1481  0.3860  234 ASP A O   
1617 C CB  . ASP A 198 ? 1.2313 1.5909 1.0226 -0.0611 0.1661  0.4446  234 ASP A CB  
1618 C CG  . ASP A 198 ? 1.3739 1.7493 1.1495 -0.0794 0.1981  0.4357  234 ASP A CG  
1619 O OD1 . ASP A 198 ? 1.3468 1.7368 1.1222 -0.0800 0.2140  0.3974  234 ASP A OD1 
1620 O OD2 . ASP A 198 ? 1.5181 1.8895 1.2879 -0.0921 0.2100  0.4678  234 ASP A OD2 
1621 N N   . VAL A 199 ? 1.0816 1.4469 0.9304 -0.0331 0.1669  0.3390  235 VAL A N   
1622 C CA  . VAL A 199 ? 1.0306 1.3928 0.9284 -0.0208 0.1670  0.3112  235 VAL A CA  
1623 C C   . VAL A 199 ? 1.0541 1.4147 1.0003 -0.0261 0.1778  0.3171  235 VAL A C   
1624 O O   . VAL A 199 ? 1.0065 1.3550 0.9901 -0.0208 0.1651  0.3122  235 VAL A O   
1625 C CB  . VAL A 199 ? 1.0835 1.4636 0.9746 -0.0180 0.1850  0.2785  235 VAL A CB  
1626 C CG1 . VAL A 199 ? 1.0350 1.4117 0.9684 -0.0012 0.1750  0.2560  235 VAL A CG1 
1627 C CG2 . VAL A 199 ? 1.1205 1.5062 0.9491 -0.0260 0.1863  0.2715  235 VAL A CG2 
1628 N N   . ASP A 200 ? 1.0327 1.4078 0.9750 -0.0400 0.2023  0.3257  236 ASP A N   
1629 C CA  . ASP A 200 ? 1.0248 1.4081 1.0097 -0.0506 0.2176  0.3301  236 ASP A CA  
1630 C C   . ASP A 200 ? 1.0538 1.4117 1.0699 -0.0560 0.2050  0.3434  236 ASP A C   
1631 O O   . ASP A 200 ? 1.0193 1.3881 1.0793 -0.0621 0.2067  0.3326  236 ASP A O   
1632 C CB  . ASP A 200 ? 1.0991 1.4948 1.0596 -0.0676 0.2446  0.3458  236 ASP A CB  
1633 C CG  . ASP A 200 ? 1.2400 1.6636 1.1864 -0.0684 0.2706  0.3249  236 ASP A CG  
1634 O OD1 . ASP A 200 ? 1.2328 1.6566 1.1527 -0.0587 0.2663  0.3060  236 ASP A OD1 
1635 O OD2 . ASP A 200 ? 1.3410 1.7845 1.3033 -0.0802 0.2985  0.3264  236 ASP A OD2 
1636 N N   . ALA A 201 ? 1.0327 1.3591 1.0292 -0.0560 0.1949  0.3676  237 ALA A N   
1637 C CA  . ALA A 201 ? 1.0247 1.3175 1.0509 -0.0624 0.1913  0.3783  237 ALA A CA  
1638 C C   . ALA A 201 ? 1.0172 1.2977 1.0682 -0.0534 0.1727  0.3555  237 ALA A C   
1639 O O   . ALA A 201 ? 1.0081 1.2739 1.0901 -0.0662 0.1753  0.3480  237 ALA A O   
1640 C CB  . ALA A 201 ? 1.0733 1.3354 1.0794 -0.0606 0.1899  0.4146  237 ALA A CB  
1641 N N   . LEU A 202 ? 0.9333 1.2199 0.9673 -0.0354 0.1556  0.3435  238 LEU A N   
1642 C CA  . LEU A 202 ? 0.8890 1.1661 0.9408 -0.0265 0.1381  0.3222  238 LEU A CA  
1643 C C   . LEU A 202 ? 0.8930 1.1978 0.9753 -0.0338 0.1392  0.2989  238 LEU A C   
1644 O O   . LEU A 202 ? 0.8655 1.1614 0.9724 -0.0443 0.1337  0.2887  238 LEU A O   
1645 C CB  . LEU A 202 ? 0.8741 1.1555 0.8983 -0.0077 0.1219  0.3166  238 LEU A CB  
1646 C CG  . LEU A 202 ? 0.8872 1.1643 0.9249 0.0024  0.1052  0.2930  238 LEU A CG  
1647 C CD1 . LEU A 202 ? 0.8908 1.1339 0.9357 0.0072  0.0954  0.3004  238 LEU A CD1 
1648 C CD2 . LEU A 202 ? 0.8923 1.1882 0.9066 0.0150  0.0981  0.2791  238 LEU A CD2 
1649 N N   . CYS A 203 ? 0.8423 1.1824 0.9244 -0.0301 0.1484  0.2924  239 CYS A N   
1650 C CA  . CYS A 203 ? 0.8148 1.1912 0.9345 -0.0330 0.1509  0.2786  239 CYS A CA  
1651 C C   . CYS A 203 ? 0.8618 1.2489 1.0143 -0.0573 0.1581  0.2845  239 CYS A C   
1652 O O   . CYS A 203 ? 0.8285 1.2351 1.0123 -0.0662 0.1474  0.2752  239 CYS A O   
1653 C CB  . CYS A 203 ? 0.8254 1.2313 0.9421 -0.0231 0.1682  0.2740  239 CYS A CB  
1654 S SG  . CYS A 203 ? 0.8792 1.2707 0.9500 -0.0032 0.1636  0.2623  239 CYS A SG  
1655 N N   . ARG A 204 ? 0.8455 1.2197 0.9885 -0.0712 0.1750  0.3010  240 ARG A N   
1656 C CA  . ARG A 204 ? 0.8633 1.2422 1.0341 -0.0987 0.1850  0.3060  240 ARG A CA  
1657 C C   . ARG A 204 ? 0.9172 1.2589 1.0924 -0.1131 0.1745  0.2992  240 ARG A C   
1658 O O   . ARG A 204 ? 0.9153 1.2715 1.1174 -0.1386 0.1740  0.2904  240 ARG A O   
1659 C CB  . ARG A 204 ? 0.9271 1.2955 1.0833 -0.1093 0.2083  0.3269  240 ARG A CB  
1660 C CG  . ARG A 204 ? 1.1070 1.5202 1.2719 -0.1085 0.2272  0.3291  240 ARG A CG  
1661 C CD  . ARG A 204 ? 1.3381 1.7434 1.4913 -0.1259 0.2515  0.3497  240 ARG A CD  
1662 N NE  . ARG A 204 ? 1.4934 1.8769 1.5948 -0.1151 0.2572  0.3659  240 ARG A NE  
1663 C CZ  . ARG A 204 ? 1.7127 2.1195 1.7906 -0.1126 0.2753  0.3681  240 ARG A CZ  
1664 N NH1 . ARG A 204 ? 1.6233 2.0136 1.6477 -0.1089 0.2768  0.3842  240 ARG A NH1 
1665 N NH2 . ARG A 204 ? 1.5188 1.9683 1.6281 -0.1157 0.2933  0.3552  240 ARG A NH2 
1666 N N   . ALA A 205 ? 0.8731 1.1698 1.0232 -0.0989 0.1673  0.3022  241 ALA A N   
1667 C CA  . ALA A 205 ? 0.8727 1.1273 1.0273 -0.1094 0.1633  0.2931  241 ALA A CA  
1668 C C   . ALA A 205 ? 0.8629 1.1377 1.0283 -0.1121 0.1439  0.2684  241 ALA A C   
1669 O O   . ALA A 205 ? 0.8800 1.1342 1.0524 -0.1335 0.1435  0.2539  241 ALA A O   
1670 C CB  . ALA A 205 ? 0.8983 1.1078 1.0323 -0.0889 0.1623  0.3074  241 ALA A CB  
1671 N N   . LEU A 206 ? 0.7529 1.0666 0.9185 -0.0928 0.1306  0.2639  242 LEU A N   
1672 C CA  . LEU A 206 ? 0.7069 1.0462 0.8845 -0.0927 0.1115  0.2472  242 LEU A CA  
1673 C C   . LEU A 206 ? 0.7443 1.1438 0.9573 -0.1081 0.1099  0.2484  242 LEU A C   
1674 O O   . LEU A 206 ? 0.7205 1.1546 0.9506 -0.1067 0.0933  0.2428  242 LEU A O   
1675 C CB  . LEU A 206 ? 0.6742 1.0139 0.8353 -0.0611 0.0998  0.2438  242 LEU A CB  
1676 C CG  . LEU A 206 ? 0.7293 1.0222 0.8669 -0.0509 0.0929  0.2388  242 LEU A CG  
1677 C CD1 . LEU A 206 ? 0.7346 1.0173 0.8473 -0.0260 0.0935  0.2488  242 LEU A CD1 
1678 C CD2 . LEU A 206 ? 0.7049 1.0003 0.8452 -0.0516 0.0759  0.2212  242 LEU A CD2 
1679 N N   . SER A 207 ? 0.6985 1.1126 0.9260 -0.1240 0.1271  0.2592  243 SER A N   
1680 C CA  . SER A 207 ? 0.6744 1.1498 0.9429 -0.1408 0.1284  0.2644  243 SER A CA  
1681 C C   . SER A 207 ? 0.7491 1.2259 1.0289 -0.1846 0.1297  0.2591  243 SER A C   
1682 O O   . SER A 207 ? 0.7342 1.2643 1.0494 -0.2065 0.1308  0.2651  243 SER A O   
1683 C CB  . SER A 207 ? 0.7005 1.1970 0.9792 -0.1289 0.1498  0.2783  243 SER A CB  
1684 O OG  . SER A 207 ? 0.7232 1.2291 0.9968 -0.0953 0.1504  0.2780  243 SER A OG  
1685 N N   . ALA A 208 ? 0.7436 1.1628 0.9958 -0.1990 0.1309  0.2464  244 ALA A N   
1686 C CA  . ALA A 208 ? 0.7832 1.1865 1.0369 -0.2443 0.1380  0.2340  244 ALA A CA  
1687 C C   . ALA A 208 ? 0.8206 1.2852 1.0952 -0.2761 0.1170  0.2248  244 ALA A C   
1688 O O   . ALA A 208 ? 0.8276 1.3180 1.1187 -0.3173 0.1224  0.2222  244 ALA A O   
1689 C CB  . ALA A 208 ? 0.8199 1.1468 1.0433 -0.2461 0.1461  0.2199  244 ALA A CB  
1690 N N   . VAL A 209 ? 0.7521 1.2436 1.0264 -0.2589 0.0926  0.2225  245 VAL A N   
1691 C CA  . VAL A 209 ? 0.7457 1.3026 1.0393 -0.2866 0.0681  0.2212  245 VAL A CA  
1692 C C   . VAL A 209 ? 0.7741 1.4069 1.1139 -0.2599 0.0557  0.2462  245 VAL A C   
1693 O O   . VAL A 209 ? 0.7683 1.4683 1.1484 -0.2830 0.0511  0.2594  245 VAL A O   
1694 C CB  . VAL A 209 ? 0.7906 1.3262 1.0531 -0.2947 0.0509  0.2030  245 VAL A CB  
1695 C CG1 . VAL A 209 ? 0.7925 1.3986 1.0681 -0.3358 0.0256  0.2037  245 VAL A CG1 
1696 C CG2 . VAL A 209 ? 0.8270 1.2789 1.0506 -0.3123 0.0714  0.1781  245 VAL A CG2 
1697 N N   . HIS A 210 ? 0.7006 1.3225 1.0382 -0.2128 0.0532  0.2526  246 HIS A N   
1698 C CA  . HIS A 210 ? 0.6657 1.3461 1.0489 -0.1825 0.0493  0.2738  246 HIS A CA  
1699 C C   . HIS A 210 ? 0.7117 1.3580 1.0861 -0.1422 0.0728  0.2758  246 HIS A C   
1700 O O   . HIS A 210 ? 0.7264 1.3079 1.0556 -0.1319 0.0816  0.2637  246 HIS A O   
1701 C CB  . HIS A 210 ? 0.6451 1.3536 1.0376 -0.1696 0.0234  0.2794  246 HIS A CB  
1702 C CG  . HIS A 210 ? 0.6984 1.4389 1.0862 -0.2128 -0.0017 0.2765  246 HIS A CG  
1703 N ND1 . HIS A 210 ? 0.7248 1.5452 1.1558 -0.2449 -0.0149 0.2941  246 HIS A ND1 
1704 C CD2 . HIS A 210 ? 0.7295 1.4348 1.0728 -0.2312 -0.0145 0.2575  246 HIS A CD2 
1705 C CE1 . HIS A 210 ? 0.7332 1.5649 1.1387 -0.2847 -0.0367 0.2847  246 HIS A CE1 
1706 N NE2 . HIS A 210 ? 0.7425 1.5041 1.0944 -0.2778 -0.0353 0.2614  246 HIS A NE2 
1707 N N   . SER A 211 ? 0.6546 1.3474 1.0737 -0.1215 0.0839  0.2919  247 SER A N   
1708 C CA  . SER A 211 ? 0.6556 1.3250 1.0665 -0.0895 0.1100  0.2917  247 SER A CA  
1709 C C   . SER A 211 ? 0.6795 1.3366 1.0859 -0.0530 0.1065  0.2881  247 SER A C   
1710 O O   . SER A 211 ? 0.6592 1.3631 1.1131 -0.0412 0.0983  0.3005  247 SER A O   
1711 C CB  . SER A 211 ? 0.7093 1.4324 1.1728 -0.0900 0.1317  0.3071  247 SER A CB  
1712 O OG  . SER A 211 ? 0.8100 1.5093 1.2584 -0.0667 0.1618  0.3037  247 SER A OG  
1713 N N   . PRO A 212 ? 0.6378 1.2356 0.9915 -0.0359 0.1128  0.2737  248 PRO A N   
1714 C CA  . PRO A 212 ? 0.6226 1.2067 0.9700 -0.0057 0.1109  0.2671  248 PRO A CA  
1715 C C   . PRO A 212 ? 0.6697 1.2777 1.0521 0.0191  0.1375  0.2714  248 PRO A C   
1716 O O   . PRO A 212 ? 0.6726 1.2869 1.0585 0.0173  0.1635  0.2727  248 PRO A O   
1717 C CB  . PRO A 212 ? 0.6574 1.1789 0.9402 -0.0007 0.1110  0.2519  248 PRO A CB  
1718 C CG  . PRO A 212 ? 0.7350 1.2405 0.9971 -0.0185 0.1235  0.2556  248 PRO A CG  
1719 C CD  . PRO A 212 ? 0.6812 1.2246 0.9819 -0.0448 0.1201  0.2656  248 PRO A CD  
1720 N N   . THR A 213 ? 0.6225 1.2394 1.0301 0.0417  0.1341  0.2727  249 THR A N   
1721 C CA  . THR A 213 ? 0.6314 1.2633 1.0796 0.0687  0.1629  0.2748  249 THR A CA  
1722 C C   . THR A 213 ? 0.7023 1.2786 1.0936 0.0817  0.1841  0.2500  249 THR A C   
1723 O O   . THR A 213 ? 0.7082 1.2827 1.1150 0.0976  0.2182  0.2427  249 THR A O   
1724 C CB  . THR A 213 ? 0.7440 1.4109 1.2499 0.0840  0.1475  0.2930  249 THR A CB  
1725 O OG1 . THR A 213 ? 0.6952 1.4313 1.2766 0.0801  0.1492  0.3201  249 THR A OG1 
1726 C CG2 . THR A 213 ? 0.7602 1.4021 1.2772 0.1157  0.1694  0.2848  249 THR A CG2 
1727 N N   . PHE A 214 ? 0.6722 1.2055 0.9990 0.0724  0.1652  0.2371  250 PHE A N   
1728 C CA  . PHE A 214 ? 0.6957 1.1829 0.9617 0.0774  0.1755  0.2166  250 PHE A CA  
1729 C C   . PHE A 214 ? 0.7631 1.2224 0.9762 0.0602  0.1535  0.2159  250 PHE A C   
1730 O O   . PHE A 214 ? 0.7312 1.1913 0.9508 0.0509  0.1279  0.2225  250 PHE A O   
1731 C CB  . PHE A 214 ? 0.7100 1.1784 0.9770 0.0962  0.1727  0.2053  250 PHE A CB  
1732 C CG  . PHE A 214 ? 0.7559 1.1828 0.9651 0.0992  0.1832  0.1819  250 PHE A CG  
1733 C CD1 . PHE A 214 ? 0.8238 1.2409 1.0356 0.1099  0.2187  0.1656  250 PHE A CD1 
1734 C CD2 . PHE A 214 ? 0.7692 1.1682 0.9260 0.0904  0.1586  0.1756  250 PHE A CD2 
1735 C CE1 . PHE A 214 ? 0.8585 1.2400 1.0127 0.1063  0.2274  0.1412  250 PHE A CE1 
1736 C CE2 . PHE A 214 ? 0.8247 1.1947 0.9309 0.0901  0.1647  0.1562  250 PHE A CE2 
1737 C CZ  . PHE A 214 ? 0.8337 1.1959 0.9351 0.0955  0.1979  0.1381  250 PHE A CZ  
1738 N N   . CYS A 215 ? 0.7542 1.1909 0.9174 0.0543  0.1658  0.2099  251 CYS A N   
1739 C CA  . CYS A 215 ? 0.7556 1.1665 0.8744 0.0417  0.1495  0.2154  251 CYS A CA  
1740 C C   . CYS A 215 ? 0.8182 1.2122 0.8820 0.0397  0.1624  0.2093  251 CYS A C   
1741 O O   . CYS A 215 ? 0.8335 1.2343 0.8806 0.0291  0.1806  0.2166  251 CYS A O   
1742 C CB  . CYS A 215 ? 0.7636 1.1850 0.8990 0.0242  0.1485  0.2321  251 CYS A CB  
1743 S SG  . CYS A 215 ? 0.8286 1.2130 0.9222 0.0119  0.1351  0.2442  251 CYS A SG  
1744 N N   . GLN A 216 ? 0.7707 1.1457 0.8048 0.0468  0.1520  0.1962  252 GLN A N   
1745 C CA  . GLN A 216 ? 0.7918 1.1561 0.7696 0.0409  0.1592  0.1880  252 GLN A CA  
1746 C C   . GLN A 216 ? 0.8425 1.1905 0.7877 0.0382  0.1308  0.1968  252 GLN A C   
1747 O O   . GLN A 216 ? 0.7977 1.1349 0.7631 0.0461  0.1098  0.1972  252 GLN A O   
1748 C CB  . GLN A 216 ? 0.8084 1.1683 0.7835 0.0492  0.1767  0.1616  252 GLN A CB  
1749 C CG  . GLN A 216 ? 0.9818 1.3475 0.9336 0.0403  0.2141  0.1477  252 GLN A CG  
1750 C CD  . GLN A 216 ? 1.1511 1.5000 1.0785 0.0413  0.2300  0.1181  252 GLN A CD  
1751 O OE1 . GLN A 216 ? 1.0340 1.3780 1.0017 0.0559  0.2505  0.1037  252 GLN A OE1 
1752 N NE2 . GLN A 216 ? 1.0726 1.4137 0.9360 0.0245  0.2212  0.1102  252 GLN A NE2 
1753 N N   . LEU A 217 ? 0.8293 1.1791 0.7248 0.0259  0.1315  0.2049  253 LEU A N   
1754 C CA  . LEU A 217 ? 0.8305 1.1746 0.6965 0.0230  0.1064  0.2190  253 LEU A CA  
1755 C C   . LEU A 217 ? 0.8807 1.2257 0.7126 0.0203  0.1036  0.1964  253 LEU A C   
1756 O O   . LEU A 217 ? 0.8943 1.2448 0.6992 0.0107  0.1269  0.1759  253 LEU A O   
1757 C CB  . LEU A 217 ? 0.8747 1.2289 0.7082 0.0086  0.1072  0.2481  253 LEU A CB  
1758 C CG  . LEU A 217 ? 0.9295 1.2725 0.7880 0.0121  0.0936  0.2810  253 LEU A CG  
1759 C CD1 . LEU A 217 ? 0.9092 1.2425 0.8157 0.0156  0.1043  0.2781  253 LEU A CD1 
1760 C CD2 . LEU A 217 ? 1.0014 1.3555 0.8265 -0.0017 0.0962  0.3134  253 LEU A CD2 
1761 N N   . ALA A 218 ? 0.8184 1.1568 0.6531 0.0267  0.0785  0.1979  254 ALA A N   
1762 C CA  . ALA A 218 ? 0.8308 1.1706 0.6362 0.0217  0.0734  0.1764  254 ALA A CA  
1763 C C   . ALA A 218 ? 0.9668 1.3290 0.7166 0.0011  0.0637  0.1883  254 ALA A C   
1764 O O   . ALA A 218 ? 0.9425 1.3174 0.6892 -0.0009 0.0459  0.2231  254 ALA A O   
1765 C CB  . ALA A 218 ? 0.7953 1.1225 0.6296 0.0354  0.0519  0.1733  254 ALA A CB  
1766 N N   . CYS A 219 ? 1.0167 1.3839 0.7236 -0.0159 0.0770  0.1597  255 CYS A N   
1767 C CA  . CYS A 219 ? 1.0933 1.4869 0.7367 -0.0442 0.0695  0.1611  255 CYS A CA  
1768 C C   . CYS A 219 ? 1.1727 1.5568 0.7868 -0.0586 0.0860  0.1167  255 CYS A C   
1769 O O   . CYS A 219 ? 1.1597 1.5184 0.7889 -0.0520 0.1182  0.0865  255 CYS A O   
1770 C CB  . CYS A 219 ? 1.1608 1.5735 0.7626 -0.0645 0.0832  0.1775  255 CYS A CB  
1771 S SG  . CYS A 219 ? 1.2404 1.6345 0.8391 -0.0686 0.1348  0.1444  255 CYS A SG  
1772 N N   . GLY A 220 ? 1.1701 1.5750 0.7492 -0.0774 0.0644  0.1151  256 GLY A N   
1773 C CA  . GLY A 220 ? 1.2042 1.5994 0.7538 -0.0956 0.0771  0.0730  256 GLY A CA  
1774 C C   . GLY A 220 ? 1.3524 1.7538 0.8306 -0.1346 0.1064  0.0420  256 GLY A C   
1775 O O   . GLY A 220 ? 1.3801 1.7871 0.8331 -0.1454 0.1272  0.0464  256 GLY A O   
1776 N N   . GLN A 221 ? 1.3562 1.7543 0.8003 -0.1588 0.1113  0.0072  257 GLN A N   
1777 C CA  . GLN A 221 ? 1.4470 1.8456 0.8166 -0.2037 0.1424  -0.0334 257 GLN A CA  
1778 C C   . GLN A 221 ? 1.5655 2.0174 0.8645 -0.2426 0.1239  -0.0090 257 GLN A C   
1779 O O   . GLN A 221 ? 1.6383 2.0910 0.8747 -0.2780 0.1565  -0.0346 257 GLN A O   
1780 C CB  . GLN A 221 ? 1.4859 1.8719 0.8383 -0.2232 0.1444  -0.0715 257 GLN A CB  
1781 C CG  . GLN A 221 ? 1.6889 2.1159 1.0460 -0.2276 0.0917  -0.0445 257 GLN A CG  
1782 C CD  . GLN A 221 ? 1.9362 2.3389 1.3062 -0.2306 0.0952  -0.0783 257 GLN A CD  
1783 O OE1 . GLN A 221 ? 1.8365 2.1945 1.2643 -0.1961 0.1093  -0.0893 257 GLN A OE1 
1784 N NE2 . GLN A 221 ? 1.8760 2.3125 1.1935 -0.2737 0.0794  -0.0917 257 GLN A NE2 
1785 N N   . ASP A 222 ? 1.4912 1.9875 0.8028 -0.2361 0.0737  0.0422  258 ASP A N   
1786 C CA  . ASP A 222 ? 1.5315 2.0863 0.7903 -0.2663 0.0465  0.0820  258 ASP A CA  
1787 C C   . ASP A 222 ? 1.5699 2.1214 0.8304 -0.2558 0.0620  0.1085  258 ASP A C   
1788 O O   . ASP A 222 ? 1.6250 2.2101 0.8194 -0.2918 0.0641  0.1210  258 ASP A O   
1789 C CB  . ASP A 222 ? 1.5148 2.1139 0.8089 -0.2529 -0.0089 0.1334  258 ASP A CB  
1790 C CG  . ASP A 222 ? 1.5360 2.1021 0.9221 -0.1999 -0.0197 0.1466  258 ASP A CG  
1791 O OD1 . ASP A 222 ? 1.5033 2.0496 0.9338 -0.1681 -0.0153 0.1720  258 ASP A OD1 
1792 O OD2 . ASP A 222 ? 1.5695 2.1289 0.9802 -0.1937 -0.0305 0.1291  258 ASP A OD2 
1793 N N   . GLY A 223 ? 1.4533 1.9665 0.7863 -0.2105 0.0728  0.1163  259 GLY A N   
1794 C CA  . GLY A 223 ? 1.4413 1.9472 0.7895 -0.1969 0.0884  0.1402  259 GLY A CA  
1795 C C   . GLY A 223 ? 1.4237 1.9461 0.8192 -0.1703 0.0525  0.2004  259 GLY A C   
1796 O O   . GLY A 223 ? 1.4188 1.9366 0.8277 -0.1611 0.0626  0.2252  259 GLY A O   
1797 N N   . GLN A 224 ? 1.3267 1.8670 0.7506 -0.1588 0.0139  0.2238  260 GLN A N   
1798 C CA  . GLN A 224 ? 1.2777 1.8302 0.7540 -0.1324 -0.0178 0.2798  260 GLN A CA  
1799 C C   . GLN A 224 ? 1.2120 1.7179 0.7665 -0.0908 -0.0104 0.2723  260 GLN A C   
1800 O O   . GLN A 224 ? 1.1588 1.6394 0.7344 -0.0802 -0.0028 0.2349  260 GLN A O   
1801 C CB  . GLN A 224 ? 1.3044 1.9026 0.7785 -0.1410 -0.0592 0.3080  260 GLN A CB  
1802 C CG  . GLN A 224 ? 1.4713 2.0864 1.0026 -0.1148 -0.0892 0.3715  260 GLN A CG  
1803 C CD  . GLN A 224 ? 1.7518 2.3940 1.2599 -0.1257 -0.0943 0.4232  260 GLN A CD  
1804 O OE1 . GLN A 224 ? 1.7610 2.4552 1.2079 -0.1608 -0.1091 0.4436  260 GLN A OE1 
1805 N NE2 . GLN A 224 ? 1.6117 2.2207 1.1675 -0.0985 -0.0826 0.4472  260 GLN A NE2 
1806 N N   . LEU A 225 ? 1.1292 1.6245 0.7240 -0.0705 -0.0122 0.3092  261 LEU A N   
1807 C CA  . LEU A 225 ? 1.0525 1.5076 0.7163 -0.0377 -0.0057 0.3066  261 LEU A CA  
1808 C C   . LEU A 225 ? 1.0228 1.4715 0.7272 -0.0199 -0.0267 0.3026  261 LEU A C   
1809 O O   . LEU A 225 ? 1.0223 1.4984 0.7329 -0.0200 -0.0531 0.3341  261 LEU A O   
1810 C CB  . LEU A 225 ? 1.0556 1.5045 0.7491 -0.0265 -0.0065 0.3514  261 LEU A CB  
1811 C CG  . LEU A 225 ? 1.1538 1.6074 0.8132 -0.0431 0.0158  0.3598  261 LEU A CG  
1812 C CD1 . LEU A 225 ? 1.1820 1.6465 0.8506 -0.0418 0.0046  0.4177  261 LEU A CD1 
1813 C CD2 . LEU A 225 ? 1.1492 1.5705 0.8361 -0.0335 0.0460  0.3290  261 LEU A CD2 
1814 N N   . LYS A 226 ? 0.9082 1.3248 0.6409 -0.0059 -0.0144 0.2656  262 LYS A N   
1815 C CA  . LYS A 226 ? 0.8484 1.2548 0.6168 0.0092  -0.0296 0.2563  262 LYS A CA  
1816 C C   . LYS A 226 ? 0.8282 1.2124 0.6559 0.0328  -0.0348 0.2797  262 LYS A C   
1817 O O   . LYS A 226 ? 0.7839 1.1598 0.6445 0.0453  -0.0461 0.2776  262 LYS A O   
1818 C CB  . LYS A 226 ? 0.8555 1.2392 0.6231 0.0105  -0.0140 0.2091  262 LYS A CB  
1819 C CG  . LYS A 226 ? 1.0331 1.4321 0.7448 -0.0148 -0.0060 0.1809  262 LYS A CG  
1820 C CD  . LYS A 226 ? 1.1596 1.5891 0.8529 -0.0286 -0.0322 0.1866  262 LYS A CD  
1821 C CE  . LYS A 226 ? 1.3344 1.7886 0.9596 -0.0644 -0.0263 0.1663  262 LYS A CE  
1822 N NZ  . LYS A 226 ? 1.4550 1.8858 1.0686 -0.0725 -0.0090 0.1179  262 LYS A NZ  
1823 N N   . GLY A 227 ? 0.7824 1.1567 0.6210 0.0356  -0.0240 0.3013  263 GLY A N   
1824 C CA  . GLY A 227 ? 0.7571 1.1062 0.6468 0.0522  -0.0231 0.3227  263 GLY A CA  
1825 C C   . GLY A 227 ? 0.7586 1.0735 0.6798 0.0603  -0.0082 0.2965  263 GLY A C   
1826 O O   . GLY A 227 ? 0.7481 1.0391 0.7084 0.0695  -0.0058 0.3071  263 GLY A O   
1827 N N   . PHE A 228 ? 0.6943 1.0075 0.6013 0.0557  0.0035  0.2637  264 PHE A N   
1828 C CA  . PHE A 228 ? 0.6655 0.9564 0.6044 0.0613  0.0136  0.2450  264 PHE A CA  
1829 C C   . PHE A 228 ? 0.7374 1.0348 0.6697 0.0551  0.0326  0.2313  264 PHE A C   
1830 O O   . PHE A 228 ? 0.7490 1.0626 0.6486 0.0469  0.0417  0.2292  264 PHE A O   
1831 C CB  . PHE A 228 ? 0.6493 0.9305 0.6017 0.0686  0.0050  0.2210  264 PHE A CB  
1832 C CG  . PHE A 228 ? 0.6552 0.9465 0.5829 0.0663  0.0064  0.1960  264 PHE A CG  
1833 C CD1 . PHE A 228 ? 0.6647 0.9513 0.6009 0.0682  0.0196  0.1746  264 PHE A CD1 
1834 C CD2 . PHE A 228 ? 0.6857 0.9916 0.5862 0.0614  -0.0047 0.1949  264 PHE A CD2 
1835 C CE1 . PHE A 228 ? 0.6803 0.9681 0.5994 0.0674  0.0263  0.1514  264 PHE A CE1 
1836 C CE2 . PHE A 228 ? 0.7188 1.0277 0.5954 0.0555  0.0008  0.1677  264 PHE A CE2 
1837 C CZ  . PHE A 228 ? 0.6864 0.9818 0.5734 0.0597  0.0184  0.1454  264 PHE A CZ  
1838 N N   . ALA A 229 ? 0.6973 0.9849 0.6619 0.0572  0.0394  0.2223  265 ALA A N   
1839 C CA  . ALA A 229 ? 0.7097 1.0091 0.6838 0.0539  0.0567  0.2129  265 ALA A CA  
1840 C C   . ALA A 229 ? 0.7278 1.0268 0.7324 0.0597  0.0547  0.1956  265 ALA A C   
1841 O O   . ALA A 229 ? 0.7081 0.9946 0.7300 0.0599  0.0425  0.1948  265 ALA A O   
1842 C CB  . ALA A 229 ? 0.7344 1.0347 0.7217 0.0449  0.0666  0.2316  265 ALA A CB  
1843 N N   . VAL A 230 ? 0.6893 1.0025 0.7018 0.0636  0.0688  0.1836  266 VAL A N   
1844 C CA  . VAL A 230 ? 0.6563 0.9767 0.7034 0.0707  0.0680  0.1748  266 VAL A CA  
1845 C C   . VAL A 230 ? 0.6995 1.0451 0.7809 0.0676  0.0823  0.1836  266 VAL A C   
1846 O O   . VAL A 230 ? 0.7386 1.0948 0.8160 0.0680  0.1037  0.1830  266 VAL A O   
1847 C CB  . VAL A 230 ? 0.7134 1.0283 0.7530 0.0814  0.0746  0.1569  266 VAL A CB  
1848 C CG1 . VAL A 230 ? 0.6863 1.0115 0.7684 0.0909  0.0752  0.1560  266 VAL A CG1 
1849 C CG2 . VAL A 230 ? 0.7139 1.0098 0.7236 0.0813  0.0586  0.1487  266 VAL A CG2 
1850 N N   . LEU A 231 ? 0.6128 0.9708 0.7267 0.0613  0.0712  0.1913  267 LEU A N   
1851 C CA  . LEU A 231 ? 0.5994 0.9901 0.7525 0.0544  0.0793  0.2028  267 LEU A CA  
1852 C C   . LEU A 231 ? 0.6327 1.0507 0.8280 0.0600  0.0714  0.2069  267 LEU A C   
1853 O O   . LEU A 231 ? 0.6047 1.0129 0.7955 0.0599  0.0533  0.2029  267 LEU A O   
1854 C CB  . LEU A 231 ? 0.6023 0.9901 0.7556 0.0334  0.0717  0.2117  267 LEU A CB  
1855 C CG  . LEU A 231 ? 0.6888 1.0657 0.8221 0.0251  0.0857  0.2200  267 LEU A CG  
1856 C CD1 . LEU A 231 ? 0.7044 1.0470 0.7958 0.0303  0.0814  0.2192  267 LEU A CD1 
1857 C CD2 . LEU A 231 ? 0.7299 1.1094 0.8794 0.0025  0.0845  0.2287  267 LEU A CD2 
1858 N N   . GLU A 232 ? 0.5986 1.0539 0.8380 0.0641  0.0849  0.2179  268 GLU A N   
1859 C CA  . GLU A 232 ? 0.5788 1.0710 0.8692 0.0699  0.0763  0.2316  268 GLU A CA  
1860 C C   . GLU A 232 ? 0.6037 1.1446 0.9355 0.0524  0.0727  0.2503  268 GLU A C   
1861 O O   . GLU A 232 ? 0.6150 1.1634 0.9498 0.0459  0.0899  0.2520  268 GLU A O   
1862 C CB  . GLU A 232 ? 0.6044 1.1007 0.9242 0.0965  0.0987  0.2313  268 GLU A CB  
1863 C CG  . GLU A 232 ? 0.6907 1.2203 1.0650 0.1074  0.0878  0.2512  268 GLU A CG  
1864 C CD  . GLU A 232 ? 0.8899 1.4076 1.2911 0.1354  0.1089  0.2501  268 GLU A CD  
1865 O OE1 . GLU A 232 ? 0.7446 1.2342 1.1304 0.1462  0.1403  0.2314  268 GLU A OE1 
1866 O OE2 . GLU A 232 ? 0.8411 1.3777 1.2789 0.1445  0.0956  0.2688  268 GLU A OE2 
1867 N N   . TYR A 233 ? 0.5259 1.1015 0.8857 0.0409  0.0492  0.2645  269 TYR A N   
1868 C CA  . TYR A 233 ? 0.5112 1.1443 0.9136 0.0193  0.0403  0.2842  269 TYR A CA  
1869 C C   . TYR A 233 ? 0.5630 1.2512 1.0291 0.0334  0.0333  0.3107  269 TYR A C   
1870 O O   . TYR A 233 ? 0.5563 1.2309 1.0220 0.0516  0.0269  0.3123  269 TYR A O   
1871 C CB  . TYR A 233 ? 0.5180 1.1478 0.8904 -0.0177 0.0169  0.2781  269 TYR A CB  
1872 C CG  . TYR A 233 ? 0.5574 1.1351 0.8808 -0.0310 0.0275  0.2583  269 TYR A CG  
1873 C CD1 . TYR A 233 ? 0.5953 1.1842 0.9267 -0.0506 0.0396  0.2615  269 TYR A CD1 
1874 C CD2 . TYR A 233 ? 0.5704 1.0893 0.8447 -0.0233 0.0265  0.2399  269 TYR A CD2 
1875 C CE1 . TYR A 233 ? 0.6180 1.1571 0.9092 -0.0609 0.0509  0.2489  269 TYR A CE1 
1876 C CE2 . TYR A 233 ? 0.6016 1.0761 0.8403 -0.0322 0.0364  0.2289  269 TYR A CE2 
1877 C CZ  . TYR A 233 ? 0.6891 1.1719 0.9363 -0.0504 0.0490  0.2346  269 TYR A CZ  
1878 O OH  . TYR A 233 ? 0.7031 1.1401 0.9196 -0.0572 0.0601  0.2290  269 TYR A OH  
1879 N N   . GLU A 234 ? 0.5217 1.2740 1.0469 0.0256  0.0351  0.3343  270 GLU A N   
1880 C CA  . GLU A 234 ? 0.5074 1.3278 1.1106 0.0390  0.0284  0.3697  270 GLU A CA  
1881 C C   . GLU A 234 ? 0.5326 1.3719 1.1311 0.0284  -0.0074 0.3843  270 GLU A C   
1882 O O   . GLU A 234 ? 0.5237 1.3732 1.1580 0.0554  -0.0077 0.4036  270 GLU A O   
1883 C CB  . GLU A 234 ? 0.5251 1.4180 1.1847 0.0195  0.0284  0.3921  270 GLU A CB  
1884 C CG  . GLU A 234 ? 0.6624 1.6385 1.4173 0.0343  0.0223  0.4360  270 GLU A CG  
1885 C CD  . GLU A 234 ? 0.9049 1.9641 1.7159 0.0078  0.0145  0.4606  270 GLU A CD  
1886 O OE1 . GLU A 234 ? 0.8960 1.9492 1.7099 0.0035  0.0408  0.4481  270 GLU A OE1 
1887 O OE2 . GLU A 234 ? 0.7685 1.9028 1.6209 -0.0107 -0.0184 0.4941  270 GLU A OE2 
1888 N N   . THR A 235 ? 0.4781 1.3185 1.0310 -0.0122 -0.0339 0.3745  271 THR A N   
1889 C CA  . THR A 235 ? 0.4664 1.3255 1.0030 -0.0316 -0.0673 0.3848  271 THR A CA  
1890 C C   . THR A 235 ? 0.5062 1.2908 0.9590 -0.0464 -0.0714 0.3475  271 THR A C   
1891 O O   . THR A 235 ? 0.5003 1.2318 0.9130 -0.0499 -0.0540 0.3187  271 THR A O   
1892 C CB  . THR A 235 ? 0.5168 1.4592 1.0801 -0.0750 -0.0960 0.4093  271 THR A CB  
1893 O OG1 . THR A 235 ? 0.5374 1.4551 1.0446 -0.1190 -0.0990 0.3795  271 THR A OG1 
1894 C CG2 . THR A 235 ? 0.4483 1.4713 1.1003 -0.0652 -0.0904 0.4461  271 THR A CG2 
1895 N N   . ALA A 236 ? 0.4566 1.2422 0.8879 -0.0557 -0.0941 0.3518  272 ALA A N   
1896 C CA  . ALA A 236 ? 0.4630 1.1893 0.8239 -0.0721 -0.0995 0.3208  272 ALA A CA  
1897 C C   . ALA A 236 ? 0.5412 1.2620 0.8639 -0.1198 -0.1036 0.2993  272 ALA A C   
1898 O O   . ALA A 236 ? 0.5471 1.2030 0.8227 -0.1248 -0.0897 0.2673  272 ALA A O   
1899 C CB  . ALA A 236 ? 0.4715 1.2159 0.8268 -0.0759 -0.1228 0.3368  272 ALA A CB  
1900 N N   . GLU A 237 ? 0.5092 1.3001 0.8568 -0.1554 -0.1211 0.3185  273 GLU A N   
1901 C CA  . GLU A 237 ? 0.5378 1.3327 0.8551 -0.2084 -0.1236 0.2993  273 GLU A CA  
1902 C C   . GLU A 237 ? 0.5839 1.3314 0.8949 -0.2023 -0.0944 0.2779  273 GLU A C   
1903 O O   . GLU A 237 ? 0.5983 1.2938 0.8641 -0.2284 -0.0828 0.2475  273 GLU A O   
1904 C CB  . GLU A 237 ? 0.5660 1.4595 0.9233 -0.2450 -0.1483 0.3300  273 GLU A CB  
1905 C CG  . GLU A 237 ? 0.7088 1.6591 1.0663 -0.2633 -0.1820 0.3557  273 GLU A CG  
1906 C CD  . GLU A 237 ? 0.8784 1.8511 1.2831 -0.2131 -0.1893 0.3923  273 GLU A CD  
1907 O OE1 . GLU A 237 ? 0.6102 1.5905 1.0725 -0.1695 -0.1724 0.4097  273 GLU A OE1 
1908 O OE2 . GLU A 237 ? 0.8057 1.7834 1.1883 -0.2182 -0.2084 0.4021  273 GLU A OE2 
1909 N N   . MET A 238 ? 0.5155 1.2801 0.8735 -0.1679 -0.0799 0.2952  274 MET A N   
1910 C CA  . MET A 238 ? 0.5124 1.2408 0.8687 -0.1586 -0.0522 0.2825  274 MET A CA  
1911 C C   . MET A 238 ? 0.5699 1.2103 0.8743 -0.1401 -0.0356 0.2547  274 MET A C   
1912 O O   . MET A 238 ? 0.5867 1.1839 0.8635 -0.1566 -0.0207 0.2366  274 MET A O   
1913 C CB  . MET A 238 ? 0.5213 1.2855 0.9351 -0.1229 -0.0383 0.3060  274 MET A CB  
1914 C CG  . MET A 238 ? 0.5744 1.4217 1.0456 -0.1451 -0.0451 0.3314  274 MET A CG  
1915 S SD  . MET A 238 ? 0.6048 1.4946 1.1536 -0.0992 -0.0230 0.3593  274 MET A SD  
1916 C CE  . MET A 238 ? 0.5639 1.5714 1.1887 -0.1289 -0.0465 0.3985  274 MET A CE  
1917 N N   . ALA A 239 ? 0.5019 1.1183 0.7961 -0.1079 -0.0389 0.2537  275 ALA A N   
1918 C CA  . ALA A 239 ? 0.4900 1.0346 0.7406 -0.0899 -0.0280 0.2314  275 ALA A CA  
1919 C C   . ALA A 239 ? 0.5437 1.0504 0.7519 -0.1226 -0.0315 0.2085  275 ALA A C   
1920 O O   . ALA A 239 ? 0.5655 1.0190 0.7493 -0.1228 -0.0149 0.1926  275 ALA A O   
1921 C CB  . ALA A 239 ? 0.4807 1.0185 0.7337 -0.0566 -0.0332 0.2357  275 ALA A CB  
1922 N N   . GLU A 240 ? 0.4943 1.0293 0.6955 -0.1520 -0.0508 0.2085  276 GLU A N   
1923 C CA  . GLU A 240 ? 0.5265 1.0266 0.6857 -0.1884 -0.0498 0.1829  276 GLU A CA  
1924 C C   . GLU A 240 ? 0.6470 1.1235 0.7973 -0.2209 -0.0311 0.1673  276 GLU A C   
1925 O O   . GLU A 240 ? 0.6652 1.0773 0.7893 -0.2238 -0.0117 0.1452  276 GLU A O   
1926 C CB  . GLU A 240 ? 0.5488 1.0965 0.7001 -0.2213 -0.0745 0.1886  276 GLU A CB  
1927 C CG  . GLU A 240 ? 0.6546 1.1608 0.7561 -0.2585 -0.0692 0.1574  276 GLU A CG  
1928 C CD  . GLU A 240 ? 0.8679 1.4191 0.9493 -0.2960 -0.0932 0.1612  276 GLU A CD  
1929 O OE1 . GLU A 240 ? 0.8411 1.4335 0.9404 -0.2754 -0.1148 0.1880  276 GLU A OE1 
1930 O OE2 . GLU A 240 ? 0.8109 1.3524 0.8561 -0.3478 -0.0882 0.1367  276 GLU A OE2 
1931 N N   . GLU A 241 ? 0.6247 1.1538 0.8019 -0.2447 -0.0354 0.1808  277 GLU A N   
1932 C CA  . GLU A 241 ? 0.6560 1.1704 0.8298 -0.2799 -0.0176 0.1685  277 GLU A CA  
1933 C C   . GLU A 241 ? 0.6910 1.1469 0.8654 -0.2509 0.0095  0.1659  277 GLU A C   
1934 O O   . GLU A 241 ? 0.7214 1.1218 0.8762 -0.2699 0.0313  0.1470  277 GLU A O   
1935 C CB  . GLU A 241 ? 0.6758 1.2701 0.8874 -0.3048 -0.0301 0.1893  277 GLU A CB  
1936 C CG  . GLU A 241 ? 0.8308 1.4896 1.0386 -0.3489 -0.0578 0.1937  277 GLU A CG  
1937 C CD  . GLU A 241 ? 1.1039 1.8504 1.3559 -0.3755 -0.0719 0.2179  277 GLU A CD  
1938 O OE1 . GLU A 241 ? 0.9017 1.7051 1.2051 -0.3418 -0.0835 0.2516  277 GLU A OE1 
1939 O OE2 . GLU A 241 ? 1.1427 1.9004 1.3808 -0.4309 -0.0685 0.2028  277 GLU A OE2 
1940 N N   . ALA A 242 ? 0.5992 1.0672 0.7960 -0.2065 0.0099  0.1856  278 ALA A N   
1941 C CA  . ALA A 242 ? 0.5955 1.0191 0.7892 -0.1785 0.0314  0.1885  278 ALA A CA  
1942 C C   . ALA A 242 ? 0.6889 1.0418 0.8508 -0.1649 0.0414  0.1730  278 ALA A C   
1943 O O   . ALA A 242 ? 0.7205 1.0273 0.8749 -0.1706 0.0618  0.1690  278 ALA A O   
1944 C CB  . ALA A 242 ? 0.5708 1.0233 0.7862 -0.1385 0.0293  0.2075  278 ALA A CB  
1945 N N   . GLN A 243 ? 0.6361 0.9817 0.7841 -0.1486 0.0282  0.1661  279 GLN A N   
1946 C CA  . GLN A 243 ? 0.6494 0.9358 0.7753 -0.1334 0.0373  0.1538  279 GLN A CA  
1947 C C   . GLN A 243 ? 0.7604 1.0031 0.8713 -0.1677 0.0529  0.1319  279 GLN A C   
1948 O O   . GLN A 243 ? 0.7754 0.9641 0.8823 -0.1565 0.0715  0.1277  279 GLN A O   
1949 C CB  . GLN A 243 ? 0.6354 0.9266 0.7522 -0.1085 0.0213  0.1517  279 GLN A CB  
1950 C CG  . GLN A 243 ? 0.6366 0.9216 0.7354 -0.1294 0.0127  0.1339  279 GLN A CG  
1951 C CD  . GLN A 243 ? 0.7775 1.0029 0.8585 -0.1382 0.0306  0.1131  279 GLN A CD  
1952 O OE1 . GLN A 243 ? 0.7211 0.9096 0.8036 -0.1112 0.0410  0.1152  279 GLN A OE1 
1953 N NE2 . GLN A 243 ? 0.5823 0.7998 0.6479 -0.1788 0.0360  0.0932  279 GLN A NE2 
1954 N N   . GLN A 244 ? 0.7433 1.0108 0.8479 -0.2105 0.0471  0.1190  280 GLN A N   
1955 C CA  . GLN A 244 ? 0.7918 1.0192 0.8769 -0.2524 0.0657  0.0915  280 GLN A CA  
1956 C C   . GLN A 244 ? 0.8923 1.0715 0.9864 -0.2628 0.0968  0.0887  280 GLN A C   
1957 O O   . GLN A 244 ? 0.9300 1.0465 1.0161 -0.2712 0.1229  0.0701  280 GLN A O   
1958 C CB  . GLN A 244 ? 0.8270 1.1043 0.9002 -0.3023 0.0501  0.0815  280 GLN A CB  
1959 C CG  . GLN A 244 ? 1.0608 1.3398 1.1053 -0.3155 0.0382  0.0652  280 GLN A CG  
1960 C CD  . GLN A 244 ? 1.3415 1.6854 1.3730 -0.3636 0.0151  0.0642  280 GLN A CD  
1961 O OE1 . GLN A 244 ? 1.3446 1.6983 1.3663 -0.4146 0.0228  0.0502  280 GLN A OE1 
1962 N NE2 . GLN A 244 ? 1.1869 1.5771 1.2170 -0.3513 -0.0135 0.0800  280 GLN A NE2 
1963 N N   . GLN A 245 ? 0.8459 1.0514 0.9602 -0.2604 0.0974  0.1082  281 GLN A N   
1964 C CA  . GLN A 245 ? 0.8817 1.0420 1.0055 -0.2707 0.1274  0.1098  281 GLN A CA  
1965 C C   . GLN A 245 ? 0.8946 1.0270 1.0306 -0.2226 0.1357  0.1355  281 GLN A C   
1966 O O   . GLN A 245 ? 0.9336 1.0137 1.0773 -0.2231 0.1626  0.1401  281 GLN A O   
1967 C CB  . GLN A 245 ? 0.9191 1.1215 1.0552 -0.3070 0.1276  0.1137  281 GLN A CB  
1968 C CG  . GLN A 245 ? 1.1185 1.3856 1.2775 -0.2824 0.1087  0.1425  281 GLN A CG  
1969 C CD  . GLN A 245 ? 1.2976 1.5412 1.4689 -0.2560 0.1266  0.1643  281 GLN A CD  
1970 O OE1 . GLN A 245 ? 1.2376 1.4408 1.4119 -0.2746 0.1523  0.1634  281 GLN A OE1 
1971 N NE2 . GLN A 245 ? 1.1661 1.4339 1.3430 -0.2143 0.1150  0.1845  281 GLN A NE2 
1972 N N   . ALA A 246 ? 0.7814 0.9489 0.9189 -0.1842 0.1140  0.1532  282 ALA A N   
1973 C CA  . ALA A 246 ? 0.7543 0.9043 0.8955 -0.1447 0.1185  0.1770  282 ALA A CA  
1974 C C   . ALA A 246 ? 0.8044 0.9117 0.9397 -0.1198 0.1210  0.1746  282 ALA A C   
1975 O O   . ALA A 246 ? 0.7888 0.8789 0.9277 -0.0917 0.1253  0.1963  282 ALA A O   
1976 C CB  . ALA A 246 ? 0.7149 0.9188 0.8580 -0.1206 0.0999  0.1930  282 ALA A CB  
1977 N N   . ASP A 247 ? 0.7755 0.8688 0.9023 -0.1324 0.1189  0.1502  283 ASP A N   
1978 C CA  . ASP A 247 ? 0.7760 0.8314 0.9037 -0.1098 0.1242  0.1474  283 ASP A CA  
1979 C C   . ASP A 247 ? 0.9020 0.8949 1.0479 -0.1131 0.1570  0.1506  283 ASP A C   
1980 O O   . ASP A 247 ? 0.9382 0.9011 1.0858 -0.1478 0.1800  0.1317  283 ASP A O   
1981 C CB  . ASP A 247 ? 0.7818 0.8402 0.8946 -0.1218 0.1151  0.1207  283 ASP A CB  
1982 C CG  . ASP A 247 ? 0.7992 0.8336 0.9164 -0.0919 0.1154  0.1220  283 ASP A CG  
1983 O OD1 . ASP A 247 ? 0.7402 0.7894 0.8628 -0.0581 0.1032  0.1449  283 ASP A OD1 
1984 O OD2 . ASP A 247 ? 0.8633 0.8647 0.9786 -0.1049 0.1300  0.0996  283 ASP A OD2 
1985 N N   . GLY A 248 ? 0.8751 0.8511 1.0363 -0.0781 0.1596  0.1763  284 GLY A N   
1986 C CA  . GLY A 248 ? 0.9259 0.8455 1.1156 -0.0713 0.1902  0.1907  284 GLY A CA  
1987 C C   . GLY A 248 ? 1.0107 0.9206 1.2097 -0.0789 0.2048  0.2139  284 GLY A C   
1988 O O   . GLY A 248 ? 1.0585 0.9155 1.2838 -0.0806 0.2359  0.2246  284 GLY A O   
1989 N N   . LEU A 249 ? 0.9513 0.9102 1.1323 -0.0828 0.1856  0.2228  285 LEU A N   
1990 C CA  . LEU A 249 ? 0.9734 0.9319 1.1594 -0.0917 0.1976  0.2449  285 LEU A CA  
1991 C C   . LEU A 249 ? 1.0345 0.9823 1.2320 -0.0591 0.1997  0.2884  285 LEU A C   
1992 O O   . LEU A 249 ? 0.9877 0.9688 1.1733 -0.0324 0.1760  0.3036  285 LEU A O   
1993 C CB  . LEU A 249 ? 0.9390 0.9591 1.1064 -0.1027 0.1774  0.2412  285 LEU A CB  
1994 C CG  . LEU A 249 ? 1.0166 1.0474 1.1878 -0.1221 0.1901  0.2548  285 LEU A CG  
1995 C CD1 . LEU A 249 ? 1.0411 1.0920 1.2050 -0.0965 0.1847  0.2905  285 LEU A CD1 
1996 C CD2 . LEU A 249 ? 1.0794 1.0548 1.2675 -0.1512 0.2235  0.2493  285 LEU A CD2 
1997 N N   . SER A 250 ? 1.0468 0.9483 1.2675 -0.0642 0.2287  0.3095  286 SER A N   
1998 C CA  . SER A 250 ? 1.0665 0.9575 1.3024 -0.0370 0.2325  0.3589  286 SER A CA  
1999 C C   . SER A 250 ? 1.0847 1.0239 1.2935 -0.0360 0.2166  0.3823  286 SER A C   
2000 O O   . SER A 250 ? 1.0930 1.0387 1.2941 -0.0614 0.2266  0.3737  286 SER A O   
2001 C CB  . SER A 250 ? 1.1843 1.0065 1.4578 -0.0443 0.2726  0.3746  286 SER A CB  
2002 O OG  . SER A 250 ? 1.3253 1.1381 1.6217 -0.0145 0.2751  0.4294  286 SER A OG  
2003 N N   . LEU A 251 ? 1.0057 0.9818 1.1984 -0.0100 0.1927  0.4091  287 LEU A N   
2004 C CA  . LEU A 251 ? 0.9955 1.0172 1.1564 -0.0091 0.1798  0.4302  287 LEU A CA  
2005 C C   . LEU A 251 ? 1.0645 1.0995 1.2211 0.0157  0.1665  0.4761  287 LEU A C   
2006 O O   . LEU A 251 ? 1.0309 1.0873 1.1819 0.0333  0.1451  0.4739  287 LEU A O   
2007 C CB  . LEU A 251 ? 0.9443 1.0165 1.0748 -0.0139 0.1592  0.3970  287 LEU A CB  
2008 C CG  . LEU A 251 ? 1.0006 1.1161 1.0992 -0.0176 0.1544  0.4097  287 LEU A CG  
2009 C CD1 . LEU A 251 ? 0.9799 1.1192 1.0775 -0.0379 0.1600  0.3799  287 LEU A CD1 
2010 C CD2 . LEU A 251 ? 0.9989 1.1514 1.0669 0.0002  0.1314  0.4145  287 LEU A CD2 
2011 N N   . GLY A 252 ? 1.0748 1.0992 1.2354 0.0148  0.1790  0.5196  288 GLY A N   
2012 C CA  . GLY A 252 ? 1.1009 1.1426 1.2595 0.0346  0.1659  0.5733  288 GLY A CA  
2013 C C   . GLY A 252 ? 1.1728 1.1776 1.3841 0.0566  0.1725  0.5946  288 GLY A C   
2014 O O   . GLY A 252 ? 1.1932 1.1398 1.4461 0.0529  0.2030  0.5915  288 GLY A O   
2015 N N   . GLY A 253 ? 1.1322 1.1703 1.3437 0.0773  0.1467  0.6119  289 GLY A N   
2016 C CA  . GLY A 253 ? 1.1552 1.1681 1.4240 0.1019  0.1517  0.6356  289 GLY A CA  
2017 C C   . GLY A 253 ? 1.1837 1.1823 1.4710 0.1077  0.1514  0.5885  289 GLY A C   
2018 O O   . GLY A 253 ? 1.1910 1.1793 1.5252 0.1300  0.1531  0.6080  289 GLY A O   
2019 N N   . SER A 254 ? 1.1014 1.1019 1.3558 0.0881  0.1498  0.5292  290 SER A N   
2020 C CA  . SER A 254 ? 1.0654 1.0553 1.3302 0.0903  0.1482  0.4847  290 SER A CA  
2021 C C   . SER A 254 ? 1.0756 1.0521 1.3176 0.0636  0.1571  0.4278  290 SER A C   
2022 O O   . SER A 254 ? 1.0456 1.0494 1.2510 0.0476  0.1488  0.4157  290 SER A O   
2023 C CB  . SER A 254 ? 1.0873 1.1317 1.3291 0.1037  0.1133  0.4834  290 SER A CB  
2024 O OG  . SER A 254 ? 1.2044 1.2945 1.3907 0.0917  0.0930  0.4737  290 SER A OG  
2025 N N   . HIS A 255 ? 1.0169 0.9562 1.2816 0.0585  0.1732  0.3940  291 HIS A N   
2026 C CA  . HIS A 255 ? 0.9860 0.9175 1.2306 0.0309  0.1786  0.3423  291 HIS A CA  
2027 C C   . HIS A 255 ? 0.9618 0.9459 1.1705 0.0340  0.1457  0.3211  291 HIS A C   
2028 O O   . HIS A 255 ? 0.9361 0.9315 1.1493 0.0513  0.1321  0.3187  291 HIS A O   
2029 C CB  . HIS A 255 ? 1.0184 0.8955 1.2923 0.0217  0.2069  0.3137  291 HIS A CB  
2030 C CG  . HIS A 255 ? 1.1234 0.9375 1.4374 0.0171  0.2476  0.3288  291 HIS A CG  
2031 N ND1 . HIS A 255 ? 1.1762 0.9555 1.5412 0.0433  0.2671  0.3558  291 HIS A ND1 
2032 C CD2 . HIS A 255 ? 1.1838 0.9635 1.4978 -0.0114 0.2741  0.3194  291 HIS A CD2 
2033 C CE1 . HIS A 255 ? 1.2263 0.9464 1.6213 0.0318  0.3071  0.3628  291 HIS A CE1 
2034 N NE2 . HIS A 255 ? 1.2391 0.9561 1.6020 -0.0029 0.3126  0.3398  291 HIS A NE2 
2035 N N   . LEU A 256 ? 0.8860 0.9023 1.0639 0.0182  0.1351  0.3080  292 LEU A N   
2036 C CA  . LEU A 256 ? 0.8279 0.8908 0.9762 0.0217  0.1089  0.2901  292 LEU A CA  
2037 C C   . LEU A 256 ? 0.8032 0.8613 0.9506 0.0132  0.1048  0.2535  292 LEU A C   
2038 O O   . LEU A 256 ? 0.8054 0.8390 0.9600 -0.0101 0.1201  0.2316  292 LEU A O   
2039 C CB  . LEU A 256 ? 0.8217 0.9187 0.9484 0.0084  0.1047  0.2871  292 LEU A CB  
2040 C CG  . LEU A 256 ? 0.9136 1.0189 1.0336 0.0093  0.1116  0.3192  292 LEU A CG  
2041 C CD1 . LEU A 256 ? 0.9074 1.0468 1.0122 -0.0053 0.1115  0.3088  292 LEU A CD1 
2042 C CD2 . LEU A 256 ? 0.9449 1.0693 1.0503 0.0312  0.0974  0.3486  292 LEU A CD2 
2043 N N   . ARG A 257 ? 0.7087 0.7918 0.8434 0.0283  0.0844  0.2467  293 ARG A N   
2044 C CA  . ARG A 257 ? 0.6675 0.7524 0.7965 0.0214  0.0772  0.2154  293 ARG A CA  
2045 C C   . ARG A 257 ? 0.6631 0.7888 0.7703 0.0158  0.0611  0.2039  293 ARG A C   
2046 O O   . ARG A 257 ? 0.6443 0.7979 0.7378 0.0299  0.0498  0.2151  293 ARG A O   
2047 C CB  . ARG A 257 ? 0.6282 0.7105 0.7638 0.0416  0.0687  0.2163  293 ARG A CB  
2048 C CG  . ARG A 257 ? 0.6331 0.7102 0.7635 0.0326  0.0656  0.1849  293 ARG A CG  
2049 C CD  . ARG A 257 ? 0.6258 0.6958 0.7703 0.0508  0.0629  0.1867  293 ARG A CD  
2050 N NE  . ARG A 257 ? 0.5228 0.6288 0.6549 0.0694  0.0409  0.2010  293 ARG A NE  
2051 C CZ  . ARG A 257 ? 0.6361 0.7507 0.7759 0.0832  0.0319  0.2025  293 ARG A CZ  
2052 N NH1 . ARG A 257 ? 0.4667 0.5561 0.6317 0.0848  0.0446  0.1930  293 ARG A NH1 
2053 N NH2 . ARG A 257 ? 0.5092 0.6579 0.6320 0.0932  0.0126  0.2123  293 ARG A NH2 
2054 N N   . VAL A 258 ? 0.6044 0.7351 0.7102 -0.0067 0.0622  0.1836  294 VAL A N   
2055 C CA  . VAL A 258 ? 0.5786 0.7513 0.6757 -0.0101 0.0482  0.1782  294 VAL A CA  
2056 C C   . VAL A 258 ? 0.5736 0.7520 0.6653 -0.0176 0.0372  0.1578  294 VAL A C   
2057 O O   . VAL A 258 ? 0.5778 0.7357 0.6693 -0.0386 0.0439  0.1422  294 VAL A O   
2058 C CB  . VAL A 258 ? 0.6502 0.8440 0.7552 -0.0287 0.0546  0.1840  294 VAL A CB  
2059 C CG1 . VAL A 258 ? 0.6771 0.8558 0.7885 -0.0619 0.0644  0.1700  294 VAL A CG1 
2060 C CG2 . VAL A 258 ? 0.6221 0.8633 0.7293 -0.0235 0.0425  0.1853  294 VAL A CG2 
2061 N N   . SER A 259 ? 0.5124 0.7143 0.5973 -0.0010 0.0231  0.1576  295 SER A N   
2062 C CA  . SER A 259 ? 0.4960 0.7028 0.5745 -0.0033 0.0119  0.1433  295 SER A CA  
2063 C C   . SER A 259 ? 0.5318 0.7772 0.6144 0.0014  0.0001  0.1474  295 SER A C   
2064 O O   . SER A 259 ? 0.4972 0.7615 0.5862 0.0136  0.0026  0.1583  295 SER A O   
2065 C CB  . SER A 259 ? 0.5031 0.6912 0.5747 0.0163  0.0093  0.1398  295 SER A CB  
2066 O OG  . SER A 259 ? 0.5869 0.7454 0.6657 0.0207  0.0210  0.1455  295 SER A OG  
2067 N N   . PHE A 260 ? 0.4941 0.7500 0.5742 -0.0074 -0.0106 0.1399  296 PHE A N   
2068 C CA  . PHE A 260 ? 0.4767 0.7679 0.5687 0.0002  -0.0209 0.1490  296 PHE A CA  
2069 C C   . PHE A 260 ? 0.5355 0.8178 0.6220 0.0264  -0.0217 0.1467  296 PHE A C   
2070 O O   . PHE A 260 ? 0.5438 0.8013 0.6148 0.0299  -0.0234 0.1354  296 PHE A O   
2071 C CB  . PHE A 260 ? 0.4922 0.8031 0.5834 -0.0230 -0.0338 0.1478  296 PHE A CB  
2072 C CG  . PHE A 260 ? 0.5210 0.8518 0.6162 -0.0562 -0.0351 0.1493  296 PHE A CG  
2073 C CD1 . PHE A 260 ? 0.5465 0.9246 0.6685 -0.0613 -0.0409 0.1679  296 PHE A CD1 
2074 C CD2 . PHE A 260 ? 0.5688 0.8725 0.6430 -0.0850 -0.0284 0.1309  296 PHE A CD2 
2075 C CE1 . PHE A 260 ? 0.5745 0.9768 0.6999 -0.0970 -0.0436 0.1688  296 PHE A CE1 
2076 C CE2 . PHE A 260 ? 0.6290 0.9504 0.7021 -0.1227 -0.0281 0.1281  296 PHE A CE2 
2077 C CZ  . PHE A 260 ? 0.5980 0.9714 0.6956 -0.1297 -0.0378 0.1476  296 PHE A CZ  
2078 N N   . CYS A 261 ? 0.4741 0.7766 0.5753 0.0427  -0.0178 0.1560  297 CYS A N   
2079 C CA  . CYS A 261 ? 0.4527 0.7471 0.5498 0.0631  -0.0145 0.1513  297 CYS A CA  
2080 C C   . CYS A 261 ? 0.5058 0.8107 0.6146 0.0633  -0.0240 0.1555  297 CYS A C   
2081 O O   . CYS A 261 ? 0.4939 0.8259 0.6194 0.0501  -0.0333 0.1681  297 CYS A O   
2082 C CB  . CYS A 261 ? 0.4494 0.7568 0.5588 0.0770  0.0006  0.1568  297 CYS A CB  
2083 S SG  . CYS A 261 ? 0.5054 0.8017 0.5927 0.0764  0.0120  0.1549  297 CYS A SG  
2084 N N   . ALA A 262 ? 0.4628 0.7504 0.5641 0.0768  -0.0217 0.1476  298 ALA A N   
2085 C CA  . ALA A 262 ? 0.4469 0.7427 0.5627 0.0803  -0.0278 0.1564  298 ALA A CA  
2086 C C   . ALA A 262 ? 0.4693 0.7993 0.6262 0.0891  -0.0233 0.1790  298 ALA A C   
2087 O O   . ALA A 262 ? 0.4614 0.7928 0.6306 0.1019  -0.0062 0.1781  298 ALA A O   
2088 C CB  . ALA A 262 ? 0.4598 0.7278 0.5638 0.0939  -0.0198 0.1433  298 ALA A CB  
2089 N N   . PRO A 263 ? 0.4123 0.7750 0.5919 0.0801  -0.0379 0.2011  299 PRO A N   
2090 C CA  . PRO A 263 ? 0.4118 0.8176 0.6420 0.0892  -0.0352 0.2292  299 PRO A CA  
2091 C C   . PRO A 263 ? 0.4911 0.8901 0.7564 0.1182  -0.0167 0.2393  299 PRO A C   
2092 O O   . PRO A 263 ? 0.5042 0.8726 0.7564 0.1262  -0.0132 0.2313  299 PRO A O   
2093 C CB  . PRO A 263 ? 0.4261 0.8725 0.6653 0.0671  -0.0607 0.2522  299 PRO A CB  
2094 C CG  . PRO A 263 ? 0.4786 0.8949 0.6768 0.0557  -0.0703 0.2375  299 PRO A CG  
2095 C CD  . PRO A 263 ? 0.4242 0.7910 0.5847 0.0590  -0.0574 0.2034  299 PRO A CD  
2096 N N   . GLY A 264 ? 0.4641 0.8909 0.7775 0.1327  -0.0021 0.2568  300 GLY A N   
2097 C CA  . GLY A 264 ? 0.4836 0.9024 0.8409 0.1612  0.0228  0.2675  300 GLY A CA  
2098 C C   . GLY A 264 ? 0.5690 0.9677 0.9330 0.1761  0.0578  0.2487  300 GLY A C   
2099 O O   . GLY A 264 ? 0.5904 1.0191 1.0086 0.1893  0.0744  0.2676  300 GLY A O   
2100 N N   . PRO A 265 ? 0.5303 0.8826 0.8414 0.1727  0.0710  0.2125  301 PRO A N   
2101 C CA  . PRO A 265 ? 0.5458 0.8811 0.8555 0.1813  0.1059  0.1934  301 PRO A CA  
2102 C C   . PRO A 265 ? 0.5838 0.9492 0.8972 0.1725  0.1071  0.1978  301 PRO A C   
2103 O O   . PRO A 265 ? 0.5506 0.9288 0.8378 0.1540  0.0814  0.1996  301 PRO A O   
2104 C CB  . PRO A 265 ? 0.5721 0.8620 0.8169 0.1715  0.1090  0.1583  301 PRO A CB  
2105 C CG  . PRO A 265 ? 0.6086 0.8862 0.8387 0.1668  0.0842  0.1609  301 PRO A CG  
2106 C CD  . PRO A 265 ? 0.5315 0.8495 0.7839 0.1592  0.0558  0.1889  301 PRO A CD  
2107 N N   . PRO A 266 ? 0.5771 0.9510 0.9241 0.1845  0.1405  0.1984  302 PRO A N   
2108 C CA  . PRO A 266 ? 0.5765 0.9785 0.9258 0.1745  0.1443  0.2022  302 PRO A CA  
2109 C C   . PRO A 266 ? 0.6587 1.0340 0.9364 0.1563  0.1426  0.1761  302 PRO A C   
2110 O O   . PRO A 266 ? 0.6703 1.0088 0.9017 0.1533  0.1439  0.1535  302 PRO A O   
2111 C CB  . PRO A 266 ? 0.6228 1.0341 1.0256 0.1934  0.1868  0.2059  302 PRO A CB  
2112 C CG  . PRO A 266 ? 0.7035 1.0701 1.1028 0.2079  0.2132  0.1873  302 PRO A CG  
2113 C CD  . PRO A 266 ? 0.6276 0.9819 1.0123 0.2065  0.1809  0.1937  302 PRO A CD  
2114 N N   . GLY A 267 ? 0.6233 1.0206 0.8957 0.1435  0.1391  0.1826  303 GLY A N   
2115 C CA  . GLY A 267 ? 0.6351 1.0147 0.8487 0.1269  0.1367  0.1682  303 GLY A CA  
2116 C C   . GLY A 267 ? 0.7129 1.0591 0.8788 0.1261  0.1578  0.1420  303 GLY A C   
2117 O O   . GLY A 267 ? 0.7094 1.0363 0.8237 0.1148  0.1423  0.1319  303 GLY A O   
2118 N N   . ARG A 268 ? 0.6973 1.0384 0.8825 0.1364  0.1949  0.1311  304 ARG A N   
2119 C CA  . ARG A 268 ? 0.7388 1.0489 0.8778 0.1302  0.2227  0.1014  304 ARG A CA  
2120 C C   . ARG A 268 ? 0.7663 1.0452 0.8781 0.1303  0.2115  0.0848  304 ARG A C   
2121 O O   . ARG A 268 ? 0.7734 1.0351 0.8253 0.1138  0.2084  0.0655  304 ARG A O   
2122 C CB  . ARG A 268 ? 0.7839 1.0925 0.9618 0.1418  0.2721  0.0922  304 ARG A CB  
2123 C CG  . ARG A 268 ? 1.0137 1.2930 1.1364 0.1266  0.3088  0.0571  304 ARG A CG  
2124 C CD  . ARG A 268 ? 1.2329 1.4733 1.3560 0.1329  0.3329  0.0320  304 ARG A CD  
2125 N NE  . ARG A 268 ? 1.4598 1.6730 1.5050 0.1063  0.3502  -0.0043 304 ARG A NE  
2126 C CZ  . ARG A 268 ? 1.6654 1.8500 1.6729 0.0962  0.3438  -0.0259 304 ARG A CZ  
2127 N NH1 . ARG A 268 ? 1.5626 1.7314 1.4973 0.0663  0.3583  -0.0580 304 ARG A NH1 
2128 N NH2 . ARG A 268 ? 1.4522 1.6268 1.4926 0.1127  0.3225  -0.0151 304 ARG A NH2 
2129 N N   . SER A 269 ? 0.6979 0.9730 0.8556 0.1474  0.2071  0.0942  305 SER A N   
2130 C CA  . SER A 269 ? 0.6947 0.9401 0.8371 0.1492  0.1999  0.0811  305 SER A CA  
2131 C C   . SER A 269 ? 0.6914 0.9371 0.7941 0.1365  0.1581  0.0836  305 SER A C   
2132 O O   . SER A 269 ? 0.7067 0.9291 0.7711 0.1278  0.1540  0.0643  305 SER A O   
2133 C CB  . SER A 269 ? 0.7527 0.9995 0.9604 0.1714  0.2053  0.0993  305 SER A CB  
2134 O OG  . SER A 269 ? 0.9237 1.1407 1.1185 0.1726  0.1984  0.0894  305 SER A OG  
2135 N N   . MET A 270 ? 0.5894 0.8610 0.7033 0.1337  0.1303  0.1059  306 MET A N   
2136 C CA  . MET A 270 ? 0.5653 0.8347 0.6491 0.1226  0.0973  0.1085  306 MET A CA  
2137 C C   . MET A 270 ? 0.6670 0.9316 0.6993 0.1080  0.0956  0.0983  306 MET A C   
2138 O O   . MET A 270 ? 0.6605 0.9151 0.6635 0.1009  0.0780  0.0922  306 MET A O   
2139 C CB  . MET A 270 ? 0.5563 0.8497 0.6665 0.1200  0.0754  0.1314  306 MET A CB  
2140 C CG  . MET A 270 ? 0.5726 0.8572 0.6592 0.1096  0.0478  0.1317  306 MET A CG  
2141 S SD  . MET A 270 ? 0.6037 0.8634 0.6760 0.1120  0.0366  0.1183  306 MET A SD  
2142 C CE  . MET A 270 ? 0.5314 0.8036 0.6518 0.1232  0.0381  0.1337  306 MET A CE  
2143 N N   . LEU A 271 ? 0.6473 0.9228 0.6709 0.1030  0.1142  0.0990  307 LEU A N   
2144 C CA  . LEU A 271 ? 0.6709 0.9481 0.6445 0.0872  0.1126  0.0953  307 LEU A CA  
2145 C C   . LEU A 271 ? 0.7541 1.0155 0.6852 0.0773  0.1189  0.0712  307 LEU A C   
2146 O O   . LEU A 271 ? 0.7516 1.0157 0.6503 0.0668  0.0974  0.0731  307 LEU A O   
2147 C CB  . LEU A 271 ? 0.6950 0.9868 0.6661 0.0818  0.1359  0.0999  307 LEU A CB  
2148 C CG  . LEU A 271 ? 0.7831 1.0816 0.7005 0.0631  0.1344  0.1022  307 LEU A CG  
2149 C CD1 . LEU A 271 ? 0.7659 1.0740 0.6852 0.0606  0.1077  0.1295  307 LEU A CD1 
2150 C CD2 . LEU A 271 ? 0.8350 1.1410 0.7398 0.0548  0.1692  0.0944  307 LEU A CD2 
2151 N N   . ALA A 272 ? 0.7350 0.9805 0.6707 0.0799  0.1495  0.0493  308 ALA A N   
2152 C CA  . ALA A 272 ? 0.7571 0.9838 0.6517 0.0655  0.1619  0.0206  308 ALA A CA  
2153 C C   . ALA A 272 ? 0.7606 0.9773 0.6526 0.0662  0.1358  0.0178  308 ALA A C   
2154 O O   . ALA A 272 ? 0.7842 1.0021 0.6327 0.0475  0.1269  0.0047  308 ALA A O   
2155 C CB  . ALA A 272 ? 0.7981 1.0015 0.7107 0.0709  0.2062  -0.0022 308 ALA A CB  
2156 N N   . ALA A 273 ? 0.6510 0.8622 0.5887 0.0850  0.1236  0.0309  309 ALA A N   
2157 C CA  . ALA A 273 ? 0.6270 0.8276 0.5666 0.0863  0.1024  0.0288  309 ALA A CA  
2158 C C   . ALA A 273 ? 0.6388 0.8563 0.5578 0.0777  0.0697  0.0410  309 ALA A C   
2159 O O   . ALA A 273 ? 0.6467 0.8611 0.5452 0.0684  0.0579  0.0310  309 ALA A O   
2160 C CB  . ALA A 273 ? 0.6069 0.8030 0.5970 0.1052  0.0978  0.0442  309 ALA A CB  
2161 N N   . LEU A 274 ? 0.5745 0.8096 0.5034 0.0807  0.0576  0.0633  310 LEU A N   
2162 C CA  . LEU A 274 ? 0.5690 0.8166 0.4900 0.0764  0.0321  0.0797  310 LEU A CA  
2163 C C   . LEU A 274 ? 0.6673 0.9306 0.5460 0.0603  0.0277  0.0789  310 LEU A C   
2164 O O   . LEU A 274 ? 0.6412 0.9155 0.5143 0.0565  0.0067  0.0890  310 LEU A O   
2165 C CB  . LEU A 274 ? 0.5539 0.8098 0.4989 0.0820  0.0275  0.1019  310 LEU A CB  
2166 C CG  . LEU A 274 ? 0.5722 0.8220 0.5545 0.0904  0.0208  0.1082  310 LEU A CG  
2167 C CD1 . LEU A 274 ? 0.5468 0.8059 0.5460 0.0884  0.0187  0.1263  310 LEU A CD1 
2168 C CD2 . LEU A 274 ? 0.5877 0.8269 0.5729 0.0903  0.0036  0.1053  310 LEU A CD2 
2169 N N   . ILE A 275 ? 0.6749 0.9423 0.5251 0.0493  0.0486  0.0675  311 ILE A N   
2170 C CA  . ILE A 275 ? 0.7098 0.9969 0.5104 0.0271  0.0457  0.0652  311 ILE A CA  
2171 C C   . ILE A 275 ? 0.7644 1.0460 0.5432 0.0140  0.0443  0.0400  311 ILE A C   
2172 O O   . ILE A 275 ? 0.7567 1.0620 0.5128 -0.0004 0.0226  0.0469  311 ILE A O   
2173 C CB  . ILE A 275 ? 0.7903 1.0820 0.5639 0.0157  0.0729  0.0587  311 ILE A CB  
2174 C CG1 . ILE A 275 ? 0.7834 1.0884 0.5729 0.0233  0.0671  0.0898  311 ILE A CG1 
2175 C CG2 . ILE A 275 ? 0.8521 1.1613 0.5627 -0.0154 0.0764  0.0450  311 ILE A CG2 
2176 C CD1 . ILE A 275 ? 0.9285 1.2333 0.7140 0.0204  0.0976  0.0853  311 ILE A CD1 
2177 N N   . ALA A 276 ? 0.7251 0.9769 0.5176 0.0198  0.0664  0.0145  312 ALA A N   
2178 C CA  . ALA A 276 ? 0.7544 0.9933 0.5300 0.0067  0.0697  -0.0118 312 ALA A CA  
2179 C C   . ALA A 276 ? 0.7912 1.0367 0.5887 0.0139  0.0393  0.0003  312 ALA A C   
2180 O O   . ALA A 276 ? 0.8081 1.0586 0.5863 -0.0025 0.0319  -0.0140 312 ALA A O   
2181 C CB  . ALA A 276 ? 0.7789 0.9795 0.5739 0.0155  0.1039  -0.0359 312 ALA A CB  
2182 N N   . ALA A 277 ? 0.7141 0.9601 0.5510 0.0354  0.0242  0.0248  313 ALA A N   
2183 C CA  . ALA A 277 ? 0.6814 0.9319 0.5412 0.0423  0.0004  0.0362  313 ALA A CA  
2184 C C   . ALA A 277 ? 0.7552 1.0410 0.5999 0.0307  -0.0230 0.0530  313 ALA A C   
2185 O O   . ALA A 277 ? 0.7348 1.0306 0.5865 0.0267  -0.0379 0.0523  313 ALA A O   
2186 C CB  . ALA A 277 ? 0.6509 0.8924 0.5495 0.0619  -0.0045 0.0547  313 ALA A CB  
2187 N N   . GLN A 278 ? 0.7520 1.0596 0.5777 0.0245  -0.0254 0.0701  314 GLN A N   
2188 C CA  . GLN A 278 ? 0.7792 1.1264 0.5939 0.0145  -0.0483 0.0955  314 GLN A CA  
2189 C C   . GLN A 278 ? 0.9176 1.2931 0.6807 -0.0166 -0.0506 0.0817  314 GLN A C   
2190 O O   . GLN A 278 ? 0.9392 1.3573 0.6892 -0.0290 -0.0720 0.1068  314 GLN A O   
2191 C CB  . GLN A 278 ? 0.7998 1.1563 0.6199 0.0221  -0.0498 0.1261  314 GLN A CB  
2192 C CG  . GLN A 278 ? 0.9431 1.2801 0.8123 0.0457  -0.0522 0.1443  314 GLN A CG  
2193 C CD  . GLN A 278 ? 1.1750 1.5174 1.0493 0.0502  -0.0506 0.1732  314 GLN A CD  
2194 O OE1 . GLN A 278 ? 1.1330 1.5028 0.9801 0.0382  -0.0563 0.1920  314 GLN A OE1 
2195 N NE2 . GLN A 278 ? 1.0620 1.3796 0.9695 0.0645  -0.0430 0.1783  314 GLN A NE2 
2196 N N   . ALA A 279 ? 0.9233 1.2765 0.6580 -0.0312 -0.0277 0.0436  315 ALA A N   
2197 C CA  . ALA A 279 ? 0.9919 1.3662 0.6704 -0.0678 -0.0239 0.0222  315 ALA A CA  
2198 C C   . ALA A 279 ? 1.0719 1.4746 0.7501 -0.0837 -0.0475 0.0206  315 ALA A C   
2199 O O   . ALA A 279 ? 1.0412 1.4229 0.7536 -0.0699 -0.0486 0.0114  315 ALA A O   
2200 C CB  . ALA A 279 ? 1.0330 1.3658 0.6882 -0.0775 0.0154  -0.0205 315 ALA A CB  
2201 N N   . THR A 280 ? 1.0777 1.5328 0.7165 -0.1151 -0.0670 0.0312  316 THR A N   
2202 C CA  . THR A 280 ? 1.4788 1.9762 1.1168 -0.1357 -0.0929 0.0342  316 THR A CA  
2203 C C   . THR A 280 ? 1.9224 2.4179 1.5019 -0.1798 -0.0764 -0.0117 316 THR A C   
2204 O O   . THR A 280 ? 1.5059 2.0078 1.0270 -0.2095 -0.0618 -0.0273 316 THR A O   
2205 C CB  . THR A 280 ? 1.5951 2.1621 1.2372 -0.1419 -0.1298 0.0845  316 THR A CB  
2206 O OG1 . THR A 280 ? 1.6430 2.2335 1.2260 -0.1688 -0.1265 0.0891  316 THR A OG1 
2207 C CG2 . THR A 280 ? 1.5224 2.0861 1.2312 -0.0989 -0.1426 0.1280  316 THR A CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   37  37  HIS HIS A . n 
A 1 2   MET 2   38  38  MET MET A . n 
A 1 3   LEU 3   39  39  LEU LEU A . n 
A 1 4   ASP 4   40  40  ASP ASP A . n 
A 1 5   PRO 5   41  41  PRO PRO A . n 
A 1 6   GLU 6   42  42  GLU GLU A . n 
A 1 7   GLU 7   43  43  GLU GLU A . n 
A 1 8   ILE 8   44  44  ILE ILE A . n 
A 1 9   ARG 9   45  45  ARG ARG A . n 
A 1 10  LYS 10  46  46  LYS LYS A . n 
A 1 11  ARG 11  47  47  ARG ARG A . n 
A 1 12  LEU 12  48  48  LEU LEU A . n 
A 1 13  GLU 13  49  49  GLU GLU A . n 
A 1 14  HIS 14  50  50  HIS HIS A . n 
A 1 15  THR 15  51  51  THR THR A . n 
A 1 16  GLU 16  52  52  GLU GLU A . n 
A 1 17  ARG 17  53  53  ARG ARG A . n 
A 1 18  GLN 18  54  54  GLN GLN A . n 
A 1 19  PHE 19  55  55  PHE PHE A . n 
A 1 20  ARG 20  56  56  ARG ARG A . n 
A 1 21  ASN 21  57  57  ASN ASN A . n 
A 1 22  ARG 22  58  58  ARG ARG A . n 
A 1 23  ARG 23  59  59  ARG ARG A . n 
A 1 24  LYS 24  60  60  LYS LYS A . n 
A 1 25  ILE 25  61  61  ILE ILE A . n 
A 1 26  LEU 26  62  62  LEU LEU A . n 
A 1 27  ILE 27  63  63  ILE ILE A . n 
A 1 28  ARG 28  64  64  ARG ARG A . n 
A 1 29  GLY 29  65  65  GLY GLY A . n 
A 1 30  LEU 30  66  66  LEU LEU A . n 
A 1 31  PRO 31  67  67  PRO PRO A . n 
A 1 32  GLY 32  68  68  GLY GLY A . n 
A 1 33  ASP 33  69  69  ASP ASP A . n 
A 1 34  VAL 34  70  70  VAL VAL A . n 
A 1 35  THR 35  71  71  THR THR A . n 
A 1 36  ASN 36  72  72  ASN ASN A . n 
A 1 37  GLN 37  73  73  GLN GLN A . n 
A 1 38  GLU 38  74  74  GLU GLU A . n 
A 1 39  VAL 39  75  75  VAL VAL A . n 
A 1 40  HIS 40  76  76  HIS HIS A . n 
A 1 41  ASP 41  77  77  ASP ASP A . n 
A 1 42  LEU 42  78  78  LEU LEU A . n 
A 1 43  LEU 43  79  79  LEU LEU A . n 
A 1 44  SER 44  80  80  SER SER A . n 
A 1 45  ASP 45  81  81  ASP ASP A . n 
A 1 46  TYR 46  82  82  TYR TYR A . n 
A 1 47  GLU 47  83  83  GLU GLU A . n 
A 1 48  LEU 48  84  84  LEU LEU A . n 
A 1 49  LYS 49  85  85  LYS LYS A . n 
A 1 50  TYR 50  86  86  TYR TYR A . n 
A 1 51  CYS 51  87  87  CYS CYS A . n 
A 1 52  PHE 52  88  88  PHE PHE A . n 
A 1 53  VAL 53  89  89  VAL VAL A . n 
A 1 54  ASP 54  90  90  ASP ASP A . n 
A 1 55  LYS 55  91  91  LYS LYS A . n 
A 1 56  TYR 56  92  92  TYR TYR A . n 
A 1 57  LYS 57  93  93  LYS LYS A . n 
A 1 58  GLY 58  94  94  GLY GLY A . n 
A 1 59  THR 59  95  95  THR THR A . n 
A 1 60  ALA 60  96  96  ALA ALA A . n 
A 1 61  PHE 61  97  97  PHE PHE A . n 
A 1 62  VAL 62  98  98  VAL VAL A . n 
A 1 63  THR 63  99  99  THR THR A . n 
A 1 64  LEU 64  100 100 LEU LEU A . n 
A 1 65  LEU 65  101 101 LEU LEU A . n 
A 1 66  ASN 66  102 102 ASN ASN A . n 
A 1 67  GLY 67  103 103 GLY GLY A . n 
A 1 68  GLU 68  104 104 GLU GLU A . n 
A 1 69  GLN 69  105 105 GLN GLN A . n 
A 1 70  ALA 70  106 106 ALA ALA A . n 
A 1 71  GLU 71  107 107 GLU GLU A . n 
A 1 72  ALA 72  108 108 ALA ALA A . n 
A 1 73  ALA 73  109 109 ALA ALA A . n 
A 1 74  ILE 74  110 110 ILE ILE A . n 
A 1 75  ASN 75  111 111 ASN ASN A . n 
A 1 76  ALA 76  112 112 ALA ALA A . n 
A 1 77  PHE 77  113 113 PHE PHE A . n 
A 1 78  HIS 78  114 114 HIS HIS A . n 
A 1 79  GLN 79  115 115 GLN GLN A . n 
A 1 80  SER 80  116 116 SER SER A . n 
A 1 81  ARG 81  117 117 ARG ARG A . n 
A 1 82  LEU 82  118 118 LEU LEU A . n 
A 1 83  ARG 83  119 119 ARG ARG A . n 
A 1 84  GLU 84  120 120 GLU GLU A . n 
A 1 85  ARG 85  121 121 ARG ARG A . n 
A 1 86  GLU 86  122 122 GLU GLU A . n 
A 1 87  LEU 87  123 123 LEU LEU A . n 
A 1 88  SER 88  124 124 SER SER A . n 
A 1 89  VAL 89  125 125 VAL VAL A . n 
A 1 90  GLN 90  126 126 GLN GLN A . n 
A 1 91  LEU 91  127 127 LEU LEU A . n 
A 1 92  GLN 92  128 128 GLN GLN A . n 
A 1 93  PRO 93  129 129 PRO PRO A . n 
A 1 94  THR 94  130 130 THR THR A . n 
A 1 95  ASP 95  131 131 ASP ASP A . n 
A 1 96  ALA 96  132 132 ALA ALA A . n 
A 1 97  LEU 97  133 133 LEU LEU A . n 
A 1 98  LEU 98  134 134 LEU LEU A . n 
A 1 99  CYS 99  135 135 CYS CYS A . n 
A 1 100 VAL 100 136 136 VAL VAL A . n 
A 1 101 ALA 101 137 137 ALA ALA A . n 
A 1 102 ASN 102 138 138 ASN ASN A . n 
A 1 103 LEU 103 139 139 LEU LEU A . n 
A 1 104 PRO 104 140 140 PRO PRO A . n 
A 1 105 PRO 105 141 141 PRO PRO A . n 
A 1 106 SER 106 142 142 SER SER A . n 
A 1 107 LEU 107 143 143 LEU LEU A . n 
A 1 108 THR 108 144 144 THR THR A . n 
A 1 109 GLN 109 145 145 GLN GLN A . n 
A 1 110 GLN 110 146 146 GLN GLN A . n 
A 1 111 GLN 111 147 147 GLN GLN A . n 
A 1 112 PHE 112 148 148 PHE PHE A . n 
A 1 113 GLU 113 149 149 GLU GLU A . n 
A 1 114 GLU 114 150 150 GLU GLU A . n 
A 1 115 LEU 115 151 151 LEU LEU A . n 
A 1 116 VAL 116 152 152 VAL VAL A . n 
A 1 117 ARG 117 153 153 ARG ARG A . n 
A 1 118 PRO 118 154 154 PRO PRO A . n 
A 1 119 PHE 119 155 155 PHE PHE A . n 
A 1 120 GLY 120 156 156 GLY GLY A . n 
A 1 121 SER 121 157 157 SER SER A . n 
A 1 122 LEU 122 158 158 LEU LEU A . n 
A 1 123 GLU 123 159 159 GLU GLU A . n 
A 1 124 ARG 124 160 160 ARG ARG A . n 
A 1 125 CYS 125 161 161 CYS CYS A . n 
A 1 126 PHE 126 162 162 PHE PHE A . n 
A 1 127 LEU 127 163 163 LEU LEU A . n 
A 1 128 VAL 128 164 164 VAL VAL A . n 
A 1 129 TYR 129 165 165 TYR TYR A . n 
A 1 130 SER 130 166 166 SER SER A . n 
A 1 131 GLU 131 167 167 GLU GLU A . n 
A 1 132 ARG 132 168 168 ARG ARG A . n 
A 1 133 THR 133 169 169 THR THR A . n 
A 1 134 GLY 134 170 170 GLY GLY A . n 
A 1 135 GLN 135 171 171 GLN GLN A . n 
A 1 136 SER 136 172 172 SER SER A . n 
A 1 137 LYS 137 173 173 LYS LYS A . n 
A 1 138 GLY 138 174 174 GLY GLY A . n 
A 1 139 TYR 139 175 175 TYR TYR A . n 
A 1 140 GLY 140 176 176 GLY GLY A . n 
A 1 141 PHE 141 177 177 PHE PHE A . n 
A 1 142 ALA 142 178 178 ALA ALA A . n 
A 1 143 GLU 143 179 179 GLU GLU A . n 
A 1 144 TYR 144 180 180 TYR TYR A . n 
A 1 145 MET 145 181 181 MET MET A . n 
A 1 146 LYS 146 182 182 LYS LYS A . n 
A 1 147 LYS 147 183 183 LYS LYS A . n 
A 1 148 ASP 148 184 184 ASP ASP A . n 
A 1 149 SER 149 185 185 SER SER A . n 
A 1 150 ALA 150 186 186 ALA ALA A . n 
A 1 151 ALA 151 187 187 ALA ALA A . n 
A 1 152 ARG 152 188 188 ARG ARG A . n 
A 1 153 ALA 153 189 189 ALA ALA A . n 
A 1 154 LYS 154 190 190 LYS LYS A . n 
A 1 155 SER 155 191 191 SER SER A . n 
A 1 156 ASP 156 192 192 ASP ASP A . n 
A 1 157 LEU 157 193 193 LEU LEU A . n 
A 1 158 LEU 158 194 194 LEU LEU A . n 
A 1 159 GLY 159 195 195 GLY GLY A . n 
A 1 160 LYS 160 196 196 LYS LYS A . n 
A 1 161 PRO 161 197 197 PRO PRO A . n 
A 1 162 LEU 162 198 198 LEU LEU A . n 
A 1 163 GLY 163 199 199 GLY GLY A . n 
A 1 164 PRO 164 200 200 PRO PRO A . n 
A 1 165 ARG 165 201 201 ARG ARG A . n 
A 1 166 THR 166 202 202 THR THR A . n 
A 1 167 LEU 167 203 203 LEU LEU A . n 
A 1 168 TYR 168 204 204 TYR TYR A . n 
A 1 169 VAL 169 205 205 VAL VAL A . n 
A 1 170 HIS 170 206 206 HIS HIS A . n 
A 1 171 TRP 171 207 207 TRP TRP A . n 
A 1 172 THR 172 208 208 THR THR A . n 
A 1 173 ASP 173 209 209 ASP ASP A . n 
A 1 174 ALA 174 210 210 ALA ALA A . n 
A 1 175 GLY 175 211 211 GLY GLY A . n 
A 1 176 GLN 176 212 212 GLN GLN A . n 
A 1 177 LEU 177 213 213 LEU LEU A . n 
A 1 178 THR 178 214 214 THR THR A . n 
A 1 179 PRO 179 215 215 PRO PRO A . n 
A 1 180 ALA 180 216 216 ALA ALA A . n 
A 1 181 LEU 181 217 217 LEU LEU A . n 
A 1 182 LEU 182 218 218 LEU LEU A . n 
A 1 183 HIS 183 219 219 HIS HIS A . n 
A 1 184 SER 184 220 220 SER SER A . n 
A 1 185 ARG 185 221 221 ARG ARG A . n 
A 1 186 CYS 186 222 222 CYS CYS A . n 
A 1 187 LEU 187 223 223 LEU LEU A . n 
A 1 188 CYS 188 224 224 CYS CYS A . n 
A 1 189 VAL 189 225 225 VAL VAL A . n 
A 1 190 ASP 190 226 226 ASP ASP A . n 
A 1 191 ARG 191 227 227 ARG ARG A . n 
A 1 192 LEU 192 228 228 LEU LEU A . n 
A 1 193 PRO 193 229 229 PRO PRO A . n 
A 1 194 PRO 194 230 230 PRO PRO A . n 
A 1 195 GLY 195 231 231 GLY GLY A . n 
A 1 196 PHE 196 232 232 PHE PHE A . n 
A 1 197 ASN 197 233 233 ASN ASN A . n 
A 1 198 ASP 198 234 234 ASP ASP A . n 
A 1 199 VAL 199 235 235 VAL VAL A . n 
A 1 200 ASP 200 236 236 ASP ASP A . n 
A 1 201 ALA 201 237 237 ALA ALA A . n 
A 1 202 LEU 202 238 238 LEU LEU A . n 
A 1 203 CYS 203 239 239 CYS CYS A . n 
A 1 204 ARG 204 240 240 ARG ARG A . n 
A 1 205 ALA 205 241 241 ALA ALA A . n 
A 1 206 LEU 206 242 242 LEU LEU A . n 
A 1 207 SER 207 243 243 SER SER A . n 
A 1 208 ALA 208 244 244 ALA ALA A . n 
A 1 209 VAL 209 245 245 VAL VAL A . n 
A 1 210 HIS 210 246 246 HIS HIS A . n 
A 1 211 SER 211 247 247 SER SER A . n 
A 1 212 PRO 212 248 248 PRO PRO A . n 
A 1 213 THR 213 249 249 THR THR A . n 
A 1 214 PHE 214 250 250 PHE PHE A . n 
A 1 215 CYS 215 251 251 CYS CYS A . n 
A 1 216 GLN 216 252 252 GLN GLN A . n 
A 1 217 LEU 217 253 253 LEU LEU A . n 
A 1 218 ALA 218 254 254 ALA ALA A . n 
A 1 219 CYS 219 255 255 CYS CYS A . n 
A 1 220 GLY 220 256 256 GLY GLY A . n 
A 1 221 GLN 221 257 257 GLN GLN A . n 
A 1 222 ASP 222 258 258 ASP ASP A . n 
A 1 223 GLY 223 259 259 GLY GLY A . n 
A 1 224 GLN 224 260 260 GLN GLN A . n 
A 1 225 LEU 225 261 261 LEU LEU A . n 
A 1 226 LYS 226 262 262 LYS LYS A . n 
A 1 227 GLY 227 263 263 GLY GLY A . n 
A 1 228 PHE 228 264 264 PHE PHE A . n 
A 1 229 ALA 229 265 265 ALA ALA A . n 
A 1 230 VAL 230 266 266 VAL VAL A . n 
A 1 231 LEU 231 267 267 LEU LEU A . n 
A 1 232 GLU 232 268 268 GLU GLU A . n 
A 1 233 TYR 233 269 269 TYR TYR A . n 
A 1 234 GLU 234 270 270 GLU GLU A . n 
A 1 235 THR 235 271 271 THR THR A . n 
A 1 236 ALA 236 272 272 ALA ALA A . n 
A 1 237 GLU 237 273 273 GLU GLU A . n 
A 1 238 MET 238 274 274 MET MET A . n 
A 1 239 ALA 239 275 275 ALA ALA A . n 
A 1 240 GLU 240 276 276 GLU GLU A . n 
A 1 241 GLU 241 277 277 GLU GLU A . n 
A 1 242 ALA 242 278 278 ALA ALA A . n 
A 1 243 GLN 243 279 279 GLN GLN A . n 
A 1 244 GLN 244 280 280 GLN GLN A . n 
A 1 245 GLN 245 281 281 GLN GLN A . n 
A 1 246 ALA 246 282 282 ALA ALA A . n 
A 1 247 ASP 247 283 283 ASP ASP A . n 
A 1 248 GLY 248 284 284 GLY GLY A . n 
A 1 249 LEU 249 285 285 LEU LEU A . n 
A 1 250 SER 250 286 286 SER SER A . n 
A 1 251 LEU 251 287 287 LEU LEU A . n 
A 1 252 GLY 252 288 288 GLY GLY A . n 
A 1 253 GLY 253 289 289 GLY GLY A . n 
A 1 254 SER 254 290 290 SER SER A . n 
A 1 255 HIS 255 291 291 HIS HIS A . n 
A 1 256 LEU 256 292 292 LEU LEU A . n 
A 1 257 ARG 257 293 293 ARG ARG A . n 
A 1 258 VAL 258 294 294 VAL VAL A . n 
A 1 259 SER 259 295 295 SER SER A . n 
A 1 260 PHE 260 296 296 PHE PHE A . n 
A 1 261 CYS 261 297 297 CYS CYS A . n 
A 1 262 ALA 262 298 298 ALA ALA A . n 
A 1 263 PRO 263 299 299 PRO PRO A . n 
A 1 264 GLY 264 300 300 GLY GLY A . n 
A 1 265 PRO 265 301 301 PRO PRO A . n 
A 1 266 PRO 266 302 302 PRO PRO A . n 
A 1 267 GLY 267 303 303 GLY GLY A . n 
A 1 268 ARG 268 304 304 ARG ARG A . n 
A 1 269 SER 269 305 305 SER SER A . n 
A 1 270 MET 270 306 306 MET MET A . n 
A 1 271 LEU 271 307 307 LEU LEU A . n 
A 1 272 ALA 272 308 308 ALA ALA A . n 
A 1 273 ALA 273 309 309 ALA ALA A . n 
A 1 274 LEU 274 310 310 LEU LEU A . n 
A 1 275 ILE 275 311 311 ILE ILE A . n 
A 1 276 ALA 276 312 312 ALA ALA A . n 
A 1 277 ALA 277 313 313 ALA ALA A . n 
A 1 278 GLN 278 314 314 GLN GLN A . n 
A 1 279 ALA 279 315 315 ALA ALA A . n 
A 1 280 THR 280 316 316 THR THR A . n 
A 1 281 ALA 281 317 ?   ?   ?   A . n 
A 1 282 LEU 282 318 ?   ?   ?   A . n 
A 1 283 ASN 283 319 ?   ?   ?   A . n 
A 1 284 ARG 284 320 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2011-08-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 19.8610 60.2610 8.2090   -0.0909 -0.0387 -0.0836 0.0399 -0.0473 0.0016 1.5740 2.7453 2.1194 
-1.8254 1.0889  -2.0376 -0.1408 0.0419 0.2005 0.3024  -0.1329 -0.2123 -0.2186 0.4011 0.2736 
'X-RAY DIFFRACTION' 2 ? refined 23.7762 78.1182 -14.4566 -0.2012 0.1002  -0.1413 0.0430 0.0556  0.2076 5.5125 3.8977 3.5636 2.7872 
-2.6144 -1.2926 0.0593  0.5360 0.3273 -0.4637 -0.0849 -0.4395 -0.2821 0.4656 0.0255 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 38  ? ? A 220 ? ? ? '{A|38 - A|220}'  
'X-RAY DIFFRACTION' 2 2 A 221 ? ? A 316 ? ? ? '{A|221 - A|316}' 
# 
_pdbx_phasing_MR.entry_id                     3SMZ 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     29.440 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          2.500 
_pdbx_phasing_MR.d_res_low_rotation           34.020 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        34.020 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALA       .     ?                          other   'Phil R. Evans'   pre@mrc-lmb.cam.ac.uk            'data scaling'    
http://www.ccp4.ac.uk/dist/html/scala.html  Fortran_77 ? 
2 PHASER      2.1.4 'Wed Jun 24 14:00:05 2009' program 'Randy J. Read'   cimr-phaser@lists.cam.ac.uk      phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/ ?          ? 
3 BUSTER-TNT  .     ?                          program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement        
http://www.globalphasing.com/buster/        ?          ? 
4 PDB_EXTRACT 3.10  'June 10, 2010'            package PDB               deposit@deposit.rcsb.org         'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/   C++        ? 
5 SERGUI      .     ?                          ?       ?                 ?                                'data collection' ? ? ? 
6 XDS         .     ?                          ?       ?                 ?                                'data reduction'  ? ? ? 
7 BUSTER      2.9.2 ?                          ?       ?                 ?                                refinement        ? ? ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 79  ? ? -96.85  35.54  
2 1 ASP A 90  ? ? -114.71 78.47  
3 1 VAL A 245 ? ? -105.05 -60.34 
4 1 CYS A 251 ? ? -162.94 88.97  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ALA 317 ? A ALA 281 
2 1 Y 1 A LEU 318 ? A LEU 282 
3 1 Y 1 A ASN 319 ? A ASN 283 
4 1 Y 1 A ARG 320 ? A ARG 284 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   1   1   SO4 SO4 A . 
C 2 SO4 1   2   2   SO4 SO4 A . 
D 3 HOH 1   400 400 HOH HOH A . 
D 3 HOH 2   401 401 HOH HOH A . 
D 3 HOH 3   402 402 HOH HOH A . 
D 3 HOH 4   403 403 HOH HOH A . 
D 3 HOH 5   404 404 HOH HOH A . 
D 3 HOH 6   405 405 HOH HOH A . 
D 3 HOH 7   406 406 HOH HOH A . 
D 3 HOH 8   407 407 HOH HOH A . 
D 3 HOH 9   408 408 HOH HOH A . 
D 3 HOH 10  409 409 HOH HOH A . 
D 3 HOH 11  410 410 HOH HOH A . 
D 3 HOH 12  411 411 HOH HOH A . 
D 3 HOH 13  412 412 HOH HOH A . 
D 3 HOH 14  413 413 HOH HOH A . 
D 3 HOH 15  414 414 HOH HOH A . 
D 3 HOH 16  415 415 HOH HOH A . 
D 3 HOH 17  416 416 HOH HOH A . 
D 3 HOH 18  417 417 HOH HOH A . 
D 3 HOH 19  418 418 HOH HOH A . 
D 3 HOH 20  419 419 HOH HOH A . 
D 3 HOH 21  420 420 HOH HOH A . 
D 3 HOH 22  421 421 HOH HOH A . 
D 3 HOH 23  422 422 HOH HOH A . 
D 3 HOH 24  423 423 HOH HOH A . 
D 3 HOH 25  424 424 HOH HOH A . 
D 3 HOH 26  425 425 HOH HOH A . 
D 3 HOH 27  426 426 HOH HOH A . 
D 3 HOH 28  427 427 HOH HOH A . 
D 3 HOH 29  428 428 HOH HOH A . 
D 3 HOH 30  429 429 HOH HOH A . 
D 3 HOH 31  430 430 HOH HOH A . 
D 3 HOH 32  431 431 HOH HOH A . 
D 3 HOH 33  432 432 HOH HOH A . 
D 3 HOH 34  433 433 HOH HOH A . 
D 3 HOH 35  434 434 HOH HOH A . 
D 3 HOH 36  435 435 HOH HOH A . 
D 3 HOH 37  436 436 HOH HOH A . 
D 3 HOH 38  437 437 HOH HOH A . 
D 3 HOH 39  438 438 HOH HOH A . 
D 3 HOH 40  439 439 HOH HOH A . 
D 3 HOH 41  440 440 HOH HOH A . 
D 3 HOH 42  441 441 HOH HOH A . 
D 3 HOH 43  442 442 HOH HOH A . 
D 3 HOH 44  443 443 HOH HOH A . 
D 3 HOH 45  444 444 HOH HOH A . 
D 3 HOH 46  445 445 HOH HOH A . 
D 3 HOH 47  446 446 HOH HOH A . 
D 3 HOH 48  447 447 HOH HOH A . 
D 3 HOH 49  448 448 HOH HOH A . 
D 3 HOH 50  449 449 HOH HOH A . 
D 3 HOH 51  450 450 HOH HOH A . 
D 3 HOH 52  451 451 HOH HOH A . 
D 3 HOH 53  452 452 HOH HOH A . 
D 3 HOH 54  453 453 HOH HOH A . 
D 3 HOH 55  454 454 HOH HOH A . 
D 3 HOH 56  455 455 HOH HOH A . 
D 3 HOH 57  456 456 HOH HOH A . 
D 3 HOH 58  457 457 HOH HOH A . 
D 3 HOH 59  458 458 HOH HOH A . 
D 3 HOH 60  459 459 HOH HOH A . 
D 3 HOH 61  460 460 HOH HOH A . 
D 3 HOH 62  461 461 HOH HOH A . 
D 3 HOH 63  462 462 HOH HOH A . 
D 3 HOH 64  463 463 HOH HOH A . 
D 3 HOH 65  464 464 HOH HOH A . 
D 3 HOH 66  465 465 HOH HOH A . 
D 3 HOH 67  466 466 HOH HOH A . 
D 3 HOH 68  467 467 HOH HOH A . 
D 3 HOH 69  468 468 HOH HOH A . 
D 3 HOH 70  469 469 HOH HOH A . 
D 3 HOH 71  470 470 HOH HOH A . 
D 3 HOH 72  471 471 HOH HOH A . 
D 3 HOH 73  472 472 HOH HOH A . 
D 3 HOH 74  473 473 HOH HOH A . 
D 3 HOH 75  474 474 HOH HOH A . 
D 3 HOH 76  475 475 HOH HOH A . 
D 3 HOH 77  476 476 HOH HOH A . 
D 3 HOH 78  477 477 HOH HOH A . 
D 3 HOH 79  478 478 HOH HOH A . 
D 3 HOH 80  479 479 HOH HOH A . 
D 3 HOH 81  480 480 HOH HOH A . 
D 3 HOH 82  481 481 HOH HOH A . 
D 3 HOH 83  482 482 HOH HOH A . 
D 3 HOH 84  483 483 HOH HOH A . 
D 3 HOH 85  484 484 HOH HOH A . 
D 3 HOH 86  485 485 HOH HOH A . 
D 3 HOH 87  486 486 HOH HOH A . 
D 3 HOH 88  487 487 HOH HOH A . 
D 3 HOH 89  488 488 HOH HOH A . 
D 3 HOH 90  489 489 HOH HOH A . 
D 3 HOH 91  490 490 HOH HOH A . 
D 3 HOH 92  491 491 HOH HOH A . 
D 3 HOH 93  492 492 HOH HOH A . 
D 3 HOH 94  493 493 HOH HOH A . 
D 3 HOH 95  494 494 HOH HOH A . 
D 3 HOH 96  495 495 HOH HOH A . 
D 3 HOH 97  496 496 HOH HOH A . 
D 3 HOH 98  497 497 HOH HOH A . 
D 3 HOH 99  498 498 HOH HOH A . 
D 3 HOH 100 499 499 HOH HOH A . 
D 3 HOH 101 500 500 HOH HOH A . 
D 3 HOH 102 501 501 HOH HOH A . 
D 3 HOH 103 502 502 HOH HOH A . 
D 3 HOH 104 503 503 HOH HOH A . 
D 3 HOH 105 504 504 HOH HOH A . 
D 3 HOH 106 505 505 HOH HOH A . 
D 3 HOH 107 506 506 HOH HOH A . 
D 3 HOH 108 507 507 HOH HOH A . 
D 3 HOH 109 508 508 HOH HOH A . 
D 3 HOH 110 509 509 HOH HOH A . 
D 3 HOH 111 510 510 HOH HOH A . 
D 3 HOH 112 511 511 HOH HOH A . 
D 3 HOH 113 512 512 HOH HOH A . 
D 3 HOH 114 513 513 HOH HOH A . 
D 3 HOH 115 514 514 HOH HOH A . 
D 3 HOH 116 515 515 HOH HOH A . 
D 3 HOH 117 516 516 HOH HOH A . 
D 3 HOH 118 517 517 HOH HOH A . 
D 3 HOH 119 518 518 HOH HOH A . 
D 3 HOH 120 519 519 HOH HOH A . 
D 3 HOH 121 520 520 HOH HOH A . 
D 3 HOH 122 521 521 HOH HOH A . 
D 3 HOH 123 522 522 HOH HOH A . 
D 3 HOH 124 523 523 HOH HOH A . 
D 3 HOH 125 524 524 HOH HOH A . 
D 3 HOH 126 525 525 HOH HOH A . 
D 3 HOH 127 526 526 HOH HOH A . 
D 3 HOH 128 527 527 HOH HOH A . 
D 3 HOH 129 528 528 HOH HOH A . 
D 3 HOH 130 529 529 HOH HOH A . 
D 3 HOH 131 530 530 HOH HOH A . 
D 3 HOH 132 531 531 HOH HOH A . 
D 3 HOH 133 532 532 HOH HOH A . 
D 3 HOH 134 533 533 HOH HOH A . 
D 3 HOH 135 534 534 HOH HOH A . 
D 3 HOH 136 535 535 HOH HOH A . 
D 3 HOH 137 536 536 HOH HOH A . 
D 3 HOH 138 537 537 HOH HOH A . 
D 3 HOH 139 538 538 HOH HOH A . 
D 3 HOH 140 539 539 HOH HOH A . 
D 3 HOH 141 540 540 HOH HOH A . 
D 3 HOH 142 541 541 HOH HOH A . 
D 3 HOH 143 542 542 HOH HOH A . 
D 3 HOH 144 543 543 HOH HOH A . 
D 3 HOH 145 544 544 HOH HOH A . 
D 3 HOH 146 545 545 HOH HOH A . 
D 3 HOH 147 546 546 HOH HOH A . 
D 3 HOH 148 547 547 HOH HOH A . 
D 3 HOH 149 548 548 HOH HOH A . 
D 3 HOH 150 549 549 HOH HOH A . 
D 3 HOH 151 550 550 HOH HOH A . 
D 3 HOH 152 551 551 HOH HOH A . 
D 3 HOH 153 552 552 HOH HOH A . 
D 3 HOH 154 553 553 HOH HOH A . 
D 3 HOH 155 554 554 HOH HOH A . 
D 3 HOH 156 555 555 HOH HOH A . 
D 3 HOH 157 556 556 HOH HOH A . 
D 3 HOH 158 557 557 HOH HOH A . 
D 3 HOH 159 558 558 HOH HOH A . 
D 3 HOH 160 559 559 HOH HOH A . 
D 3 HOH 161 560 560 HOH HOH A . 
D 3 HOH 162 561 561 HOH HOH A . 
D 3 HOH 163 562 562 HOH HOH A . 
D 3 HOH 164 563 563 HOH HOH A . 
D 3 HOH 165 564 564 HOH HOH A . 
D 3 HOH 166 565 565 HOH HOH A . 
D 3 HOH 167 566 566 HOH HOH A . 
D 3 HOH 168 567 567 HOH HOH A . 
D 3 HOH 169 568 568 HOH HOH A . 
D 3 HOH 170 569 569 HOH HOH A . 
D 3 HOH 171 570 570 HOH HOH A . 
D 3 HOH 172 571 571 HOH HOH A . 
D 3 HOH 173 572 572 HOH HOH A . 
D 3 HOH 174 573 573 HOH HOH A . 
D 3 HOH 175 574 574 HOH HOH A . 
D 3 HOH 176 575 575 HOH HOH A . 
D 3 HOH 177 576 576 HOH HOH A . 
D 3 HOH 178 577 577 HOH HOH A . 
D 3 HOH 179 578 578 HOH HOH A . 
D 3 HOH 180 579 579 HOH HOH A . 
D 3 HOH 181 580 580 HOH HOH A . 
D 3 HOH 182 581 581 HOH HOH A . 
D 3 HOH 183 582 582 HOH HOH A . 
D 3 HOH 184 583 583 HOH HOH A . 
D 3 HOH 185 584 584 HOH HOH A . 
D 3 HOH 186 585 585 HOH HOH A . 
D 3 HOH 187 586 586 HOH HOH A . 
D 3 HOH 188 587 587 HOH HOH A . 
D 3 HOH 189 588 588 HOH HOH A . 
D 3 HOH 190 589 589 HOH HOH A . 
D 3 HOH 191 590 590 HOH HOH A . 
D 3 HOH 192 591 591 HOH HOH A . 
D 3 HOH 193 592 592 HOH HOH A . 
D 3 HOH 194 593 593 HOH HOH A . 
D 3 HOH 195 594 594 HOH HOH A . 
D 3 HOH 196 595 595 HOH HOH A . 
D 3 HOH 197 596 596 HOH HOH A . 
D 3 HOH 198 597 597 HOH HOH A . 
D 3 HOH 199 598 598 HOH HOH A . 
D 3 HOH 200 599 599 HOH HOH A . 
D 3 HOH 201 600 600 HOH HOH A . 
D 3 HOH 202 601 601 HOH HOH A . 
D 3 HOH 203 602 602 HOH HOH A . 
D 3 HOH 204 603 603 HOH HOH A . 
D 3 HOH 205 604 604 HOH HOH A . 
D 3 HOH 206 605 605 HOH HOH A . 
D 3 HOH 207 606 606 HOH HOH A . 
D 3 HOH 208 607 607 HOH HOH A . 
D 3 HOH 209 608 608 HOH HOH A . 
D 3 HOH 210 609 609 HOH HOH A . 
D 3 HOH 211 610 610 HOH HOH A . 
D 3 HOH 212 611 611 HOH HOH A . 
D 3 HOH 213 612 612 HOH HOH A . 
D 3 HOH 214 613 613 HOH HOH A . 
D 3 HOH 215 614 614 HOH HOH A . 
D 3 HOH 216 615 615 HOH HOH A . 
D 3 HOH 217 616 616 HOH HOH A . 
D 3 HOH 218 617 617 HOH HOH A . 
D 3 HOH 219 618 618 HOH HOH A . 
D 3 HOH 220 619 619 HOH HOH A . 
D 3 HOH 221 620 620 HOH HOH A . 
D 3 HOH 222 621 621 HOH HOH A . 
D 3 HOH 223 622 622 HOH HOH A . 
D 3 HOH 224 623 623 HOH HOH A . 
D 3 HOH 225 624 624 HOH HOH A . 
D 3 HOH 226 625 625 HOH HOH A . 
D 3 HOH 227 626 626 HOH HOH A . 
D 3 HOH 228 627 627 HOH HOH A . 
D 3 HOH 229 628 628 HOH HOH A . 
D 3 HOH 230 629 629 HOH HOH A . 
D 3 HOH 231 630 630 HOH HOH A . 
D 3 HOH 232 631 631 HOH HOH A . 
D 3 HOH 233 632 632 HOH HOH A . 
D 3 HOH 234 633 633 HOH HOH A . 
D 3 HOH 235 634 634 HOH HOH A . 
#