data_3SPC
# 
_entry.id   3SPC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SPC         
RCSB  RCSB066485   
WWPDB D_1000066485 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SPG 'Kir2.2 R186A mutant in complex with PIP2' unspecified 
PDB 3SPH 'Kir2.2 I223L mutant in complex with PIP2' unspecified 
PDB 3SPI 'Kir2.2 in complex with PIP2'              unspecified 
PDB 3SPJ 'Apo Kir2.2 I223L mutant'                  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SPC 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hansen, S.B.'  1 
'Tao, X.'       2 
'MacKinnon, R.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            477 
_citation.page_first                495 
_citation.page_last                 498 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21874019 
_citation.pdbx_database_id_DOI      10.1038/nature10370 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hansen, S.B.'  1 
primary 'Tao, X.'       2 
primary 'Mackinnon, R.' 3 
# 
_cell.entry_id           3SPC 
_cell.length_a           82.904 
_cell.length_b           82.904 
_cell.length_c           191.159 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SPC 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Inward-rectifier K+ channel Kir2.2'                                            39361.723 1  ? ? ? ? 
2 non-polymer syn 'POTASSIUM ION'                                                                 39.098    6  ? ? ? ? 
3 non-polymer syn '(2R)-3-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}propane-1,2-diyl dioctanoate' 504.446   1  ? ? ? ? 
4 water       nat water                                                                           18.015    88 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'inward rectifier potassium channel 2.2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   ARG n 
1 5   LYS n 
1 6   CYS n 
1 7   ARG n 
1 8   ASN n 
1 9   ARG n 
1 10  PHE n 
1 11  VAL n 
1 12  LYS n 
1 13  LYS n 
1 14  ASN n 
1 15  GLY n 
1 16  GLN n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  PHE n 
1 22  THR n 
1 23  ASN n 
1 24  MET n 
1 25  ASP n 
1 26  ASP n 
1 27  LYS n 
1 28  PRO n 
1 29  GLN n 
1 30  ARG n 
1 31  TYR n 
1 32  ILE n 
1 33  ALA n 
1 34  ASP n 
1 35  MET n 
1 36  PHE n 
1 37  THR n 
1 38  THR n 
1 39  CYS n 
1 40  VAL n 
1 41  ASP n 
1 42  ILE n 
1 43  ARG n 
1 44  TRP n 
1 45  ARG n 
1 46  TYR n 
1 47  MET n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  PHE n 
1 52  SER n 
1 53  LEU n 
1 54  ALA n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  SER n 
1 59  TRP n 
1 60  LEU n 
1 61  LEU n 
1 62  PHE n 
1 63  GLY n 
1 64  LEU n 
1 65  ILE n 
1 66  PHE n 
1 67  TRP n 
1 68  LEU n 
1 69  ILE n 
1 70  ALA n 
1 71  LEU n 
1 72  ILE n 
1 73  HIS n 
1 74  GLY n 
1 75  ASP n 
1 76  LEU n 
1 77  GLU n 
1 78  ASN n 
1 79  PRO n 
1 80  GLY n 
1 81  GLY n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  LYS n 
1 87  PRO n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  GLN n 
1 92  VAL n 
1 93  ASN n 
1 94  GLY n 
1 95  PHE n 
1 96  VAL n 
1 97  ALA n 
1 98  ALA n 
1 99  PHE n 
1 100 LEU n 
1 101 PHE n 
1 102 SER n 
1 103 ILE n 
1 104 GLU n 
1 105 THR n 
1 106 GLN n 
1 107 THR n 
1 108 THR n 
1 109 ILE n 
1 110 GLY n 
1 111 TYR n 
1 112 GLY n 
1 113 PHE n 
1 114 ARG n 
1 115 CYS n 
1 116 VAL n 
1 117 THR n 
1 118 GLU n 
1 119 GLU n 
1 120 CYS n 
1 121 PRO n 
1 122 LEU n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 MET n 
1 127 VAL n 
1 128 VAL n 
1 129 VAL n 
1 130 GLN n 
1 131 SER n 
1 132 ILE n 
1 133 VAL n 
1 134 GLY n 
1 135 CYS n 
1 136 ILE n 
1 137 ILE n 
1 138 ASP n 
1 139 SER n 
1 140 PHE n 
1 141 MET n 
1 142 ILE n 
1 143 GLY n 
1 144 ALA n 
1 145 ILE n 
1 146 MET n 
1 147 ALA n 
1 148 LYS n 
1 149 MET n 
1 150 ALA n 
1 151 ARG n 
1 152 PRO n 
1 153 LYS n 
1 154 LYS n 
1 155 ARG n 
1 156 ALA n 
1 157 GLN n 
1 158 THR n 
1 159 LEU n 
1 160 LEU n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 ASN n 
1 165 ALA n 
1 166 VAL n 
1 167 VAL n 
1 168 ALA n 
1 169 MET n 
1 170 ARG n 
1 171 ASP n 
1 172 GLY n 
1 173 LYS n 
1 174 LEU n 
1 175 CYS n 
1 176 LEU n 
1 177 MET n 
1 178 TRP n 
1 179 ARG n 
1 180 VAL n 
1 181 GLY n 
1 182 ASN n 
1 183 LEU n 
1 184 ARG n 
1 185 LYS n 
1 186 SER n 
1 187 HIS n 
1 188 ILE n 
1 189 VAL n 
1 190 GLU n 
1 191 ALA n 
1 192 HIS n 
1 193 VAL n 
1 194 ARG n 
1 195 ALA n 
1 196 GLN n 
1 197 LEU n 
1 198 ILE n 
1 199 LYS n 
1 200 PRO n 
1 201 ARG n 
1 202 ILE n 
1 203 THR n 
1 204 GLU n 
1 205 GLU n 
1 206 GLY n 
1 207 GLU n 
1 208 TYR n 
1 209 ILE n 
1 210 PRO n 
1 211 LEU n 
1 212 ASP n 
1 213 GLN n 
1 214 ILE n 
1 215 ASP n 
1 216 ILE n 
1 217 ASP n 
1 218 VAL n 
1 219 GLY n 
1 220 PHE n 
1 221 ASP n 
1 222 LYS n 
1 223 GLY n 
1 224 LEU n 
1 225 ASP n 
1 226 ARG n 
1 227 ILE n 
1 228 PHE n 
1 229 LEU n 
1 230 VAL n 
1 231 SER n 
1 232 PRO n 
1 233 ILE n 
1 234 THR n 
1 235 ILE n 
1 236 LEU n 
1 237 HIS n 
1 238 GLU n 
1 239 ILE n 
1 240 ASN n 
1 241 GLU n 
1 242 ASP n 
1 243 SER n 
1 244 PRO n 
1 245 LEU n 
1 246 PHE n 
1 247 GLY n 
1 248 ILE n 
1 249 SER n 
1 250 ARG n 
1 251 GLN n 
1 252 ASP n 
1 253 LEU n 
1 254 GLU n 
1 255 THR n 
1 256 ASP n 
1 257 ASP n 
1 258 PHE n 
1 259 GLU n 
1 260 ILE n 
1 261 VAL n 
1 262 VAL n 
1 263 ILE n 
1 264 LEU n 
1 265 GLU n 
1 266 GLY n 
1 267 MET n 
1 268 VAL n 
1 269 GLU n 
1 270 ALA n 
1 271 THR n 
1 272 ALA n 
1 273 MET n 
1 274 THR n 
1 275 THR n 
1 276 GLN n 
1 277 ALA n 
1 278 ARG n 
1 279 SER n 
1 280 SER n 
1 281 TYR n 
1 282 LEU n 
1 283 ALA n 
1 284 SER n 
1 285 GLU n 
1 286 ILE n 
1 287 LEU n 
1 288 TRP n 
1 289 GLY n 
1 290 HIS n 
1 291 ARG n 
1 292 PHE n 
1 293 GLU n 
1 294 PRO n 
1 295 VAL n 
1 296 LEU n 
1 297 PHE n 
1 298 GLU n 
1 299 GLU n 
1 300 LYS n 
1 301 ASN n 
1 302 GLN n 
1 303 TYR n 
1 304 LYS n 
1 305 VAL n 
1 306 ASP n 
1 307 TYR n 
1 308 SER n 
1 309 HIS n 
1 310 PHE n 
1 311 HIS n 
1 312 LYS n 
1 313 THR n 
1 314 TYR n 
1 315 GLU n 
1 316 VAL n 
1 317 PRO n 
1 318 SER n 
1 319 THR n 
1 320 PRO n 
1 321 ARG n 
1 322 CYS n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 VAL n 
1 329 GLU n 
1 330 ASN n 
1 331 LYS n 
1 332 PHE n 
1 333 LEU n 
1 334 LEU n 
1 335 SER n 
1 336 ASN n 
1 337 SER n 
1 338 LEU n 
1 339 GLU n 
1 340 VAL n 
1 341 LEU n 
1 342 PHE n 
1 343 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Kir2.2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D2YW45_CHICK 
_struct_ref.pdbx_db_accession          D2YW45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SPC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 343 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             D2YW45 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  343 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       36 
_struct_ref_seq.pdbx_auth_seq_align_end       378 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                         ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                                        ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                      ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                 ? 'C4 H7 N O4'     
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                        ? 'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                       ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                 ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                                         ? 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                       ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                           ? 'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                      ? 'C6 H13 N O2'    
131.173 
K   non-polymer         . 'POTASSIUM ION'                                                                 ? 'K 1'            
39.098  
LEU 'L-peptide linking' y LEUCINE                                                                         ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                                          ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                                      ? 'C5 H11 N O2 S'  
149.211 
P8P non-polymer         . '(2R)-3-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}propane-1,2-diyl dioctanoate' 
'dioctanoylglycerol pyrophosphate' 'C19 H38 O11 P2' 504.446 
PHE 'L-peptide linking' y PHENYLALANINE                                                                   ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                                         ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                                          ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                                       ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                      ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                        ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                                          ? 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          3SPC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.17 
_exptl_crystal.density_percent_sol   70.52 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'HANGING DROP, VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '6.2% PEG400, 0.5 M potassium chloride, 0.1 M HEPES, pH 7.0, HANGING DROP, VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock double crystal sagittal focusing monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3SPC 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             16 
_reflns.d_resolution_high            2.45 
_reflns.number_obs                   23341 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.146 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.45 
_reflns_shell.d_res_low              2.6 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_redundancy        4.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SPC 
_refine.ls_number_reflns_obs                     22164 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.657 
_refine.ls_d_res_high                            2.454 
_refine.ls_percent_reflns_obs                    94.58 
_refine.ls_R_factor_obs                          0.1944 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1929 
_refine.ls_R_factor_R_free                       0.2237 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  1120 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            4.7079 
_refine.aniso_B[2][2]                            4.7079 
_refine.aniso_B[3][3]                            -9.4158 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.345 
_refine.solvent_model_param_bsol                 67.910 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.72 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3JYC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            
'R-Free values were generated from PDB entry 3JYC and extended to higher resolution frames.' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.36 
_refine.pdbx_overall_phase_error                 22.50 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2605 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               2727 
_refine_hist.d_res_high                       2.454 
_refine_hist.d_res_low                        15.657 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 2729 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.882  ? ? 3639 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 14.018 ? ? 983  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.064  ? ? 412  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.003  ? ? 459  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.4542 2.5654  2360 0.2857 85.00  0.3679 . . 129 . . . . 'X-RAY DIFFRACTION' 
. 2.5654 2.7000  2471 0.2451 89.00  0.2780 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 2.7000 2.8682  2557 0.2182 92.00  0.2520 . . 146 . . . . 'X-RAY DIFFRACTION' 
. 2.8682 3.0881  2638 0.2103 95.00  0.2331 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.0881 3.3960  2731 0.1948 98.00  0.2566 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 3.3960 3.8809  2763 0.1823 100.00 0.1959 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 3.8809 4.8650  2797 0.1610 100.00 0.1935 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 4.8650 15.6572 2727 0.2024 97.00  0.2279 . . 122 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SPC 
_struct.title                     
'Inward rectifier potassium channel Kir2.2 in complex with dioctanoylglycerol pyrophosphate (DGPP)' 
_struct.pdbx_descriptor           'Inward-rectifier K+ channel Kir2.2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SPC 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'PIP, membrane protein, lipid, receptor, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 34  ? ILE A 42  ? ASP A 69  ILE A 77  1 ? 9  
HELX_P HELX_P2 2 ARG A 43  ? GLY A 74  ? ARG A 78  GLY A 109 1 ? 32 
HELX_P HELX_P3 3 ASP A 75  ? ASN A 78  ? ASP A 110 ASN A 113 5 ? 4  
HELX_P HELX_P4 4 GLY A 94  ? THR A 107 ? GLY A 129 THR A 142 1 ? 14 
HELX_P HELX_P5 5 CYS A 120 ? ARG A 151 ? CYS A 155 ARG A 186 1 ? 32 
HELX_P HELX_P6 6 GLY A 219 ? GLY A 223 ? GLY A 254 GLY A 258 5 ? 5  
HELX_P HELX_P7 7 SER A 249 ? GLU A 254 ? SER A 284 GLU A 289 1 ? 6  
HELX_P HELX_P8 8 TYR A 307 ? PHE A 310 ? TYR A 342 PHE A 345 5 ? 4  
HELX_P HELX_P9 9 SER A 323 ? SER A 337 ? SER A 358 SER A 372 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 88  SG  ? ? ? 1_555 A CYS 120 SG ? ? A CYS 123 A CYS 155 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc1 metalc ? ? A THR 108 O   ? ? ? 1_555 D K   .   K  ? ? A THR 143 A K   503 1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc2 metalc ? ? A THR 108 OG1 ? ? ? 1_555 E K   .   K  ? ? A THR 143 A K   504 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc3 metalc ? ? A ILE 109 O   ? ? ? 1_555 D K   .   K  ? ? A ILE 144 A K   503 1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc4 metalc ? ? A GLY 110 O   ? ? ? 1_555 C K   .   K  ? ? A GLY 145 A K   502 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc5 metalc ? ? A THR 108 O   ? ? ? 1_555 E K   .   K  ? ? A THR 143 A K   504 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc6 metalc ? ? A TYR 111 O   ? ? ? 1_555 B K   .   K  ? ? A TYR 146 A K   501 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc7 metalc ? ? A ILE 109 O   ? ? ? 1_555 C K   .   K  ? ? A ILE 144 A K   502 1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc8 metalc ? ? A GLY 110 O   ? ? ? 1_555 B K   .   K  ? ? A GLY 145 A K   501 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc9 metalc ? ? G K   .   K   ? ? ? 1_555 I HOH .   O  ? ? A K   510 A HOH 404 1_555 ? ? ? ? ? ? ? 3.069 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 3 ? 
C ? 4 ? 
D ? 4 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 89  ? LEU A 90  ? VAL A 124 LEU A 125 
A 2 CYS A 115 ? VAL A 116 ? CYS A 150 VAL A 151 
B 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
B 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
B 3 ILE A 233 ? GLU A 238 ? ILE A 268 GLU A 273 
C 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
C 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
C 3 ALA A 165 ? ARG A 170 ? ALA A 200 ARG A 205 
C 4 ILE A 286 ? TRP A 288 ? ILE A 321 TRP A 323 
D 1 TYR A 208 ? ILE A 216 ? TYR A 243 ILE A 251 
D 2 ILE A 188 ? ILE A 202 ? ILE A 223 ILE A 237 
D 3 GLU A 259 ? VAL A 268 ? GLU A 294 VAL A 303 
D 4 THR A 274 ? LEU A 282 ? THR A 309 LEU A 317 
E 1 HIS A 290 ? PHE A 292 ? HIS A 325 PHE A 327 
E 2 THR A 313 ? GLU A 315 ? THR A 348 GLU A 350 
F 1 LEU A 296 ? GLU A 299 ? LEU A 331 GLU A 334 
F 2 GLN A 302 ? VAL A 305 ? GLN A 337 VAL A 340 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 90  ? N LEU A 125 O CYS A 115 ? O CYS A 150 
B 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
B 2 3 N TRP A 178 ? N TRP A 213 O ILE A 235 ? O ILE A 270 
C 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
C 2 3 O MET A 177 ? O MET A 212 N VAL A 166 ? N VAL A 201 
C 3 4 N ALA A 165 ? N ALA A 200 O LEU A 287 ? O LEU A 322 
D 1 2 O ILE A 209 ? O ILE A 244 N ARG A 201 ? N ARG A 236 
D 2 3 N ILE A 198 ? N ILE A 233 O GLU A 259 ? O GLU A 294 
D 3 4 N GLY A 266 ? N GLY A 301 O THR A 275 ? O THR A 310 
E 1 2 N ARG A 291 ? N ARG A 326 O TYR A 314 ? O TYR A 349 
F 1 2 N PHE A 297 ? N PHE A 332 O LYS A 304 ? O LYS A 339 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K A 501'   
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE K A 502'   
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE K A 503'   
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE K A 504'   
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE K A 510'   
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE P8P A 379' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY A 110 ? GLY A 145 . ? 2_555 ? 
2  AC1 12 GLY A 110 ? GLY A 145 . ? 1_555 ? 
3  AC1 12 GLY A 110 ? GLY A 145 . ? 3_555 ? 
4  AC1 12 GLY A 110 ? GLY A 145 . ? 4_555 ? 
5  AC1 12 TYR A 111 ? TYR A 146 . ? 4_555 ? 
6  AC1 12 TYR A 111 ? TYR A 146 . ? 2_555 ? 
7  AC1 12 TYR A 111 ? TYR A 146 . ? 1_555 ? 
8  AC1 12 TYR A 111 ? TYR A 146 . ? 3_555 ? 
9  AC1 12 K   C .   ? K   A 502 . ? 2_555 ? 
10 AC1 12 K   C .   ? K   A 502 . ? 3_555 ? 
11 AC1 12 K   C .   ? K   A 502 . ? 4_555 ? 
12 AC1 12 K   C .   ? K   A 502 . ? 1_555 ? 
13 AC2 16 ILE A 109 ? ILE A 144 . ? 2_555 ? 
14 AC2 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
15 AC2 16 ILE A 109 ? ILE A 144 . ? 3_555 ? 
16 AC2 16 ILE A 109 ? ILE A 144 . ? 4_555 ? 
17 AC2 16 GLY A 110 ? GLY A 145 . ? 3_555 ? 
18 AC2 16 GLY A 110 ? GLY A 145 . ? 1_555 ? 
19 AC2 16 GLY A 110 ? GLY A 145 . ? 4_555 ? 
20 AC2 16 GLY A 110 ? GLY A 145 . ? 2_555 ? 
21 AC2 16 K   B .   ? K   A 501 . ? 4_555 ? 
22 AC2 16 K   B .   ? K   A 501 . ? 3_555 ? 
23 AC2 16 K   B .   ? K   A 501 . ? 2_555 ? 
24 AC2 16 K   B .   ? K   A 501 . ? 1_555 ? 
25 AC2 16 K   D .   ? K   A 503 . ? 2_555 ? 
26 AC2 16 K   D .   ? K   A 503 . ? 3_555 ? 
27 AC2 16 K   D .   ? K   A 503 . ? 4_555 ? 
28 AC2 16 K   D .   ? K   A 503 . ? 1_555 ? 
29 AC3 16 THR A 108 ? THR A 143 . ? 1_555 ? 
30 AC3 16 THR A 108 ? THR A 143 . ? 2_555 ? 
31 AC3 16 THR A 108 ? THR A 143 . ? 3_555 ? 
32 AC3 16 THR A 108 ? THR A 143 . ? 4_555 ? 
33 AC3 16 ILE A 109 ? ILE A 144 . ? 2_555 ? 
34 AC3 16 ILE A 109 ? ILE A 144 . ? 3_555 ? 
35 AC3 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
36 AC3 16 ILE A 109 ? ILE A 144 . ? 4_555 ? 
37 AC3 16 K   C .   ? K   A 502 . ? 2_555 ? 
38 AC3 16 K   C .   ? K   A 502 . ? 1_555 ? 
39 AC3 16 K   C .   ? K   A 502 . ? 4_555 ? 
40 AC3 16 K   C .   ? K   A 502 . ? 3_555 ? 
41 AC3 16 K   E .   ? K   A 504 . ? 2_555 ? 
42 AC3 16 K   E .   ? K   A 504 . ? 3_555 ? 
43 AC3 16 K   E .   ? K   A 504 . ? 4_555 ? 
44 AC3 16 K   E .   ? K   A 504 . ? 1_555 ? 
45 AC4 8  THR A 108 ? THR A 143 . ? 2_555 ? 
46 AC4 8  THR A 108 ? THR A 143 . ? 4_555 ? 
47 AC4 8  THR A 108 ? THR A 143 . ? 1_555 ? 
48 AC4 8  THR A 108 ? THR A 143 . ? 3_555 ? 
49 AC4 8  K   D .   ? K   A 503 . ? 2_555 ? 
50 AC4 8  K   D .   ? K   A 503 . ? 3_555 ? 
51 AC4 8  K   D .   ? K   A 503 . ? 4_555 ? 
52 AC4 8  K   D .   ? K   A 503 . ? 1_555 ? 
53 AC5 4  HOH I .   ? HOH A 404 . ? 2_555 ? 
54 AC5 4  HOH I .   ? HOH A 404 . ? 4_555 ? 
55 AC5 4  HOH I .   ? HOH A 404 . ? 1_555 ? 
56 AC5 4  HOH I .   ? HOH A 404 . ? 3_555 ? 
57 AC6 4  ARG A 43  ? ARG A 78  . ? 1_555 ? 
58 AC6 4  TRP A 44  ? TRP A 79  . ? 1_555 ? 
59 AC6 4  ARG A 45  ? ARG A 80  . ? 1_555 ? 
60 AC6 4  PHE A 140 ? PHE A 175 . ? 3_555 ? 
# 
_database_PDB_matrix.entry_id          3SPC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SPC 
_atom_sites.fract_transf_matrix[1][1]   0.012062 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012062 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005231 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 6   ? 34.304  12.602  96.335  1.00 96.49  ? 41  CYS A N   1 
ATOM   2    C CA  . CYS A 1 6   ? 35.121  12.459  95.135  1.00 96.15  ? 41  CYS A CA  1 
ATOM   3    C C   . CYS A 1 6   ? 35.007  11.060  94.528  1.00 92.15  ? 41  CYS A C   1 
ATOM   4    O O   . CYS A 1 6   ? 35.679  10.749  93.540  1.00 97.21  ? 41  CYS A O   1 
ATOM   5    C CB  . CYS A 1 6   ? 36.584  12.794  95.441  1.00 97.65  ? 41  CYS A CB  1 
ATOM   6    N N   . ARG A 1 7   ? 34.153  10.224  95.117  1.00 162.37 ? 42  ARG A N   1 
ATOM   7    C CA  . ARG A 1 7   ? 34.034  8.831   94.695  1.00 149.47 ? 42  ARG A CA  1 
ATOM   8    C C   . ARG A 1 7   ? 33.699  8.699   93.213  1.00 142.82 ? 42  ARG A C   1 
ATOM   9    O O   . ARG A 1 7   ? 34.570  8.379   92.407  1.00 146.99 ? 42  ARG A O   1 
ATOM   10   C CB  . ARG A 1 7   ? 32.965  8.124   95.531  1.00 141.02 ? 42  ARG A CB  1 
ATOM   11   C CG  . ARG A 1 7   ? 32.673  6.696   95.106  1.00 135.69 ? 42  ARG A CG  1 
ATOM   12   C CD  . ARG A 1 7   ? 31.650  6.048   96.030  1.00 128.45 ? 42  ARG A CD  1 
ATOM   13   N NE  . ARG A 1 7   ? 32.084  6.081   97.425  1.00 125.58 ? 42  ARG A NE  1 
ATOM   14   C CZ  . ARG A 1 7   ? 31.510  6.815   98.374  1.00 120.37 ? 42  ARG A CZ  1 
ATOM   15   N NH1 . ARG A 1 7   ? 30.461  7.573   98.087  1.00 115.64 ? 42  ARG A NH1 1 
ATOM   16   N NH2 . ARG A 1 7   ? 31.980  6.784   99.615  1.00 120.69 ? 42  ARG A NH2 1 
ATOM   17   N N   . ASN A 1 8   ? 32.445  8.963   92.860  1.00 132.60 ? 43  ASN A N   1 
ATOM   18   C CA  . ASN A 1 8   ? 32.018  9.001   91.460  1.00 126.14 ? 43  ASN A CA  1 
ATOM   19   C C   . ASN A 1 8   ? 30.503  9.123   91.314  1.00 115.66 ? 43  ASN A C   1 
ATOM   20   O O   . ASN A 1 8   ? 29.761  8.940   92.276  1.00 116.31 ? 43  ASN A O   1 
ATOM   21   C CB  . ASN A 1 8   ? 32.538  7.794   90.673  1.00 127.60 ? 43  ASN A CB  1 
ATOM   22   C CG  . ASN A 1 8   ? 32.655  8.078   89.186  1.00 127.96 ? 43  ASN A CG  1 
ATOM   23   O OD1 . ASN A 1 8   ? 31.777  7.718   88.403  1.00 127.71 ? 43  ASN A OD1 1 
ATOM   24   N ND2 . ASN A 1 8   ? 33.742  8.732   88.792  1.00 128.55 ? 43  ASN A ND2 1 
ATOM   25   N N   . ARG A 1 9   ? 30.052  9.414   90.100  1.00 105.48 ? 44  ARG A N   1 
ATOM   26   C CA  . ARG A 1 9   ? 28.635  9.611   89.820  1.00 94.31  ? 44  ARG A CA  1 
ATOM   27   C C   . ARG A 1 9   ? 27.959  8.318   89.349  1.00 87.13  ? 44  ARG A C   1 
ATOM   28   O O   . ARG A 1 9   ? 28.323  7.767   88.316  1.00 88.19  ? 44  ARG A O   1 
ATOM   29   C CB  . ARG A 1 9   ? 28.490  10.704  88.759  1.00 92.03  ? 44  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 9   ? 27.076  11.051  88.384  1.00 83.27  ? 44  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 9   ? 26.901  12.553  88.316  1.00 79.11  ? 44  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 9   ? 25.781  12.975  89.147  1.00 76.92  ? 44  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 9   ? 25.701  14.147  89.766  1.00 75.35  ? 44  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 9   ? 26.686  15.033  89.655  1.00 70.97  ? 44  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 9   ? 24.633  14.425  90.501  1.00 70.52  ? 44  ARG A NH2 1 
ATOM   36   N N   . PHE A 1 10  ? 26.984  7.831   90.111  1.00 80.45  ? 45  PHE A N   1 
ATOM   37   C CA  . PHE A 1 10  ? 26.242  6.631   89.724  1.00 77.22  ? 45  PHE A CA  1 
ATOM   38   C C   . PHE A 1 10  ? 25.186  6.950   88.667  1.00 71.98  ? 45  PHE A C   1 
ATOM   39   O O   . PHE A 1 10  ? 25.015  6.215   87.693  1.00 70.65  ? 45  PHE A O   1 
ATOM   40   C CB  . PHE A 1 10  ? 25.581  5.997   90.947  1.00 75.55  ? 45  PHE A CB  1 
ATOM   41   C CG  . PHE A 1 10  ? 24.892  4.691   90.664  1.00 73.39  ? 45  PHE A CG  1 
ATOM   42   C CD1 . PHE A 1 10  ? 23.550  4.523   90.955  1.00 70.45  ? 45  PHE A CD1 1 
ATOM   43   C CD2 . PHE A 1 10  ? 25.591  3.627   90.113  1.00 76.55  ? 45  PHE A CD2 1 
ATOM   44   C CE1 . PHE A 1 10  ? 22.916  3.316   90.709  1.00 72.01  ? 45  PHE A CE1 1 
ATOM   45   C CE2 . PHE A 1 10  ? 24.965  2.418   89.860  1.00 75.84  ? 45  PHE A CE2 1 
ATOM   46   C CZ  . PHE A 1 10  ? 23.626  2.262   90.157  1.00 74.97  ? 45  PHE A CZ  1 
ATOM   47   N N   . VAL A 1 11  ? 24.481  8.055   88.871  1.00 68.64  ? 46  VAL A N   1 
ATOM   48   C CA  . VAL A 1 11  ? 23.496  8.533   87.913  1.00 68.17  ? 46  VAL A CA  1 
ATOM   49   C C   . VAL A 1 11  ? 23.836  9.978   87.562  1.00 68.44  ? 46  VAL A C   1 
ATOM   50   O O   . VAL A 1 11  ? 24.087  10.790  88.452  1.00 65.77  ? 46  VAL A O   1 
ATOM   51   C CB  . VAL A 1 11  ? 22.063  8.452   88.494  1.00 65.53  ? 46  VAL A CB  1 
ATOM   52   C CG1 . VAL A 1 11  ? 21.065  9.128   87.569  1.00 61.83  ? 46  VAL A CG1 1 
ATOM   53   C CG2 . VAL A 1 11  ? 21.669  6.998   88.749  1.00 63.64  ? 46  VAL A CG2 1 
ATOM   54   N N   . LYS A 1 12  ? 23.863  10.294  86.270  1.00 68.91  ? 47  LYS A N   1 
ATOM   55   C CA  . LYS A 1 12  ? 24.173  11.653  85.829  1.00 70.67  ? 47  LYS A CA  1 
ATOM   56   C C   . LYS A 1 12  ? 23.009  12.603  86.076  1.00 70.54  ? 47  LYS A C   1 
ATOM   57   O O   . LYS A 1 12  ? 21.864  12.168  86.237  1.00 69.52  ? 47  LYS A O   1 
ATOM   58   C CB  . LYS A 1 12  ? 24.576  11.670  84.354  1.00 74.38  ? 47  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 12  ? 25.917  11.002  84.081  1.00 77.78  ? 47  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 12  ? 26.275  11.028  82.608  1.00 82.01  ? 47  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 12  ? 27.578  10.280  82.362  1.00 89.23  ? 47  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 12  ? 28.020  10.349  80.941  1.00 93.11  ? 47  LYS A NZ  1 
ATOM   63   N N   . LYS A 1 13  ? 23.309  13.899  86.117  1.00 67.98  ? 48  LYS A N   1 
ATOM   64   C CA  . LYS A 1 13  ? 22.285  14.918  86.335  1.00 72.52  ? 48  LYS A CA  1 
ATOM   65   C C   . LYS A 1 13  ? 21.127  14.764  85.350  1.00 73.84  ? 48  LYS A C   1 
ATOM   66   O O   . LYS A 1 13  ? 19.974  15.029  85.698  1.00 71.19  ? 48  LYS A O   1 
ATOM   67   C CB  . LYS A 1 13  ? 22.879  16.323  86.211  1.00 72.88  ? 48  LYS A CB  1 
ATOM   68   C CG  . LYS A 1 13  ? 24.052  16.600  87.135  1.00 76.41  ? 48  LYS A CG  1 
ATOM   69   C CD  . LYS A 1 13  ? 23.612  16.671  88.588  1.00 74.69  ? 48  LYS A CD  1 
ATOM   70   C CE  . LYS A 1 13  ? 22.866  17.958  88.885  1.00 72.36  ? 48  LYS A CE  1 
ATOM   71   N NZ  . LYS A 1 13  ? 22.252  17.902  90.240  1.00 72.38  ? 48  LYS A NZ  1 
ATOM   72   N N   . ASN A 1 14  ? 21.440  14.328  84.129  1.00 67.75  ? 49  ASN A N   1 
ATOM   73   C CA  . ASN A 1 14  ? 20.441  14.207  83.067  1.00 71.05  ? 49  ASN A CA  1 
ATOM   74   C C   . ASN A 1 14  ? 19.681  12.883  83.092  1.00 70.93  ? 49  ASN A C   1 
ATOM   75   O O   . ASN A 1 14  ? 18.874  12.605  82.202  1.00 74.63  ? 49  ASN A O   1 
ATOM   76   C CB  . ASN A 1 14  ? 21.063  14.442  81.679  1.00 70.44  ? 49  ASN A CB  1 
ATOM   77   C CG  . ASN A 1 14  ? 22.020  13.332  81.261  1.00 73.54  ? 49  ASN A CG  1 
ATOM   78   O OD1 . ASN A 1 14  ? 22.141  12.306  81.930  1.00 72.31  ? 49  ASN A OD1 1 
ATOM   79   N ND2 . ASN A 1 14  ? 22.702  13.536  80.143  1.00 74.46  ? 49  ASN A ND2 1 
ATOM   80   N N   . GLY A 1 15  ? 19.966  12.057  84.094  1.00 67.60  ? 50  GLY A N   1 
ATOM   81   C CA  . GLY A 1 15  ? 19.253  10.804  84.273  1.00 67.25  ? 50  GLY A CA  1 
ATOM   82   C C   . GLY A 1 15  ? 20.005  9.594   83.747  1.00 67.70  ? 50  GLY A C   1 
ATOM   83   O O   . GLY A 1 15  ? 19.734  8.467   84.144  1.00 67.91  ? 50  GLY A O   1 
ATOM   84   N N   . GLN A 1 16  ? 20.955  9.825   82.852  1.00 70.61  ? 51  GLN A N   1 
ATOM   85   C CA  . GLN A 1 16  ? 21.743  8.733   82.297  1.00 78.71  ? 51  GLN A CA  1 
ATOM   86   C C   . GLN A 1 16  ? 22.464  7.973   83.404  1.00 75.49  ? 51  GLN A C   1 
ATOM   87   O O   . GLN A 1 16  ? 23.017  8.574   84.321  1.00 73.49  ? 51  GLN A O   1 
ATOM   88   C CB  . GLN A 1 16  ? 22.751  9.270   81.280  1.00 89.58  ? 51  GLN A CB  1 
ATOM   89   C CG  . GLN A 1 16  ? 22.387  8.993   79.832  1.00 102.23 ? 51  GLN A CG  1 
ATOM   90   C CD  . GLN A 1 16  ? 22.899  7.647   79.355  1.00 113.45 ? 51  GLN A CD  1 
ATOM   91   O OE1 . GLN A 1 16  ? 23.728  7.017   80.017  1.00 118.15 ? 51  GLN A OE1 1 
ATOM   92   N NE2 . GLN A 1 16  ? 22.412  7.200   78.199  1.00 114.97 ? 51  GLN A NE2 1 
ATOM   93   N N   . CYS A 1 17  ? 22.453  6.649   83.322  1.00 75.78  ? 52  CYS A N   1 
ATOM   94   C CA  . CYS A 1 17  ? 23.166  5.842   84.302  1.00 79.10  ? 52  CYS A CA  1 
ATOM   95   C C   . CYS A 1 17  ? 24.624  5.633   83.904  1.00 82.03  ? 52  CYS A C   1 
ATOM   96   O O   . CYS A 1 17  ? 24.941  5.407   82.737  1.00 83.03  ? 52  CYS A O   1 
ATOM   97   C CB  . CYS A 1 17  ? 22.448  4.517   84.536  1.00 79.81  ? 52  CYS A CB  1 
ATOM   98   S SG  . CYS A 1 17  ? 20.825  4.751   85.293  1.00 79.05  ? 52  CYS A SG  1 
ATOM   99   N N   . ASN A 1 18  ? 25.501  5.714   84.895  1.00 80.29  ? 53  ASN A N   1 
ATOM   100  C CA  . ASN A 1 18  ? 26.944  5.778   84.679  1.00 79.24  ? 53  ASN A CA  1 
ATOM   101  C C   . ASN A 1 18  ? 27.658  4.430   84.643  1.00 78.00  ? 53  ASN A C   1 
ATOM   102  O O   . ASN A 1 18  ? 28.872  4.367   84.788  1.00 87.69  ? 53  ASN A O   1 
ATOM   103  C CB  . ASN A 1 18  ? 27.611  6.726   85.674  1.00 81.79  ? 53  ASN A CB  1 
ATOM   104  C CG  . ASN A 1 18  ? 28.850  7.389   85.100  1.00 88.16  ? 53  ASN A CG  1 
ATOM   105  O OD1 . ASN A 1 18  ? 29.019  7.460   83.881  1.00 90.23  ? 53  ASN A OD1 1 
ATOM   106  N ND2 . ASN A 1 18  ? 29.727  7.875   85.974  1.00 89.89  ? 53  ASN A ND2 1 
ATOM   107  N N   . VAL A 1 19  ? 26.895  3.350   84.555  1.00 75.52  ? 54  VAL A N   1 
ATOM   108  C CA  . VAL A 1 19  ? 27.459  2.004   84.562  1.00 77.30  ? 54  VAL A CA  1 
ATOM   109  C C   . VAL A 1 19  ? 27.616  1.380   83.171  1.00 81.41  ? 54  VAL A C   1 
ATOM   110  O O   . VAL A 1 19  ? 26.779  1.577   82.293  1.00 82.29  ? 54  VAL A O   1 
ATOM   111  C CB  . VAL A 1 19  ? 26.591  1.064   85.406  1.00 73.95  ? 54  VAL A CB  1 
ATOM   112  C CG1 . VAL A 1 19  ? 27.306  -0.255  85.633  1.00 78.01  ? 54  VAL A CG1 1 
ATOM   113  C CG2 . VAL A 1 19  ? 26.243  1.725   86.730  1.00 78.83  ? 54  VAL A CG2 1 
ATOM   114  N N   . GLU A 1 20  ? 28.694  0.623   82.983  1.00 86.88  ? 55  GLU A N   1 
ATOM   115  C CA  . GLU A 1 20  ? 28.854  -0.212  81.793  1.00 93.08  ? 55  GLU A CA  1 
ATOM   116  C C   . GLU A 1 20  ? 28.897  -1.699  82.155  1.00 91.21  ? 55  GLU A C   1 
ATOM   117  O O   . GLU A 1 20  ? 29.522  -2.091  83.140  1.00 91.63  ? 55  GLU A O   1 
ATOM   118  C CB  . GLU A 1 20  ? 30.110  0.176   81.005  1.00 102.27 ? 55  GLU A CB  1 
ATOM   119  C CG  . GLU A 1 20  ? 29.875  1.242   79.944  1.00 111.53 ? 55  GLU A CG  1 
ATOM   120  C CD  . GLU A 1 20  ? 31.060  1.402   78.994  1.00 122.80 ? 55  GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 20  ? 32.105  0.749   79.223  1.00 126.80 ? 55  GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 20  ? 30.943  2.179   78.018  1.00 125.25 ? 55  GLU A OE2 1 
ATOM   123  N N   . PHE A 1 21  ? 28.219  -2.519  81.357  1.00 88.90  ? 56  PHE A N   1 
ATOM   124  C CA  . PHE A 1 21  ? 28.222  -3.966  81.545  1.00 87.34  ? 56  PHE A CA  1 
ATOM   125  C C   . PHE A 1 21  ? 29.366  -4.601  80.762  1.00 91.83  ? 56  PHE A C   1 
ATOM   126  O O   . PHE A 1 21  ? 29.698  -4.150  79.668  1.00 94.68  ? 56  PHE A O   1 
ATOM   127  C CB  . PHE A 1 21  ? 26.889  -4.573  81.091  1.00 85.23  ? 56  PHE A CB  1 
ATOM   128  C CG  . PHE A 1 21  ? 25.684  -4.054  81.843  1.00 82.21  ? 56  PHE A CG  1 
ATOM   129  C CD1 . PHE A 1 21  ? 25.828  -3.210  82.932  1.00 79.87  ? 56  PHE A CD1 1 
ATOM   130  C CD2 . PHE A 1 21  ? 24.403  -4.422  81.458  1.00 81.60  ? 56  PHE A CD2 1 
ATOM   131  C CE1 . PHE A 1 21  ? 24.718  -2.737  83.618  1.00 77.28  ? 56  PHE A CE1 1 
ATOM   132  C CE2 . PHE A 1 21  ? 23.293  -3.956  82.137  1.00 77.82  ? 56  PHE A CE2 1 
ATOM   133  C CZ  . PHE A 1 21  ? 23.450  -3.112  83.220  1.00 76.31  ? 56  PHE A CZ  1 
ATOM   134  N N   . THR A 1 22  ? 29.976  -5.641  81.321  1.00 94.29  ? 57  THR A N   1 
ATOM   135  C CA  . THR A 1 22  ? 31.001  -6.394  80.598  1.00 100.62 ? 57  THR A CA  1 
ATOM   136  C C   . THR A 1 22  ? 30.882  -7.893  80.856  1.00 100.99 ? 57  THR A C   1 
ATOM   137  O O   . THR A 1 22  ? 30.216  -8.320  81.800  1.00 99.78  ? 57  THR A O   1 
ATOM   138  C CB  . THR A 1 22  ? 32.431  -5.933  80.957  1.00 103.61 ? 57  THR A CB  1 
ATOM   139  O OG1 . THR A 1 22  ? 32.718  -6.252  82.325  1.00 104.03 ? 57  THR A OG1 1 
ATOM   140  C CG2 . THR A 1 22  ? 32.577  -4.436  80.749  1.00 102.13 ? 57  THR A CG2 1 
ATOM   141  N N   . ASN A 1 23  ? 31.524  -8.683  80.002  1.00 102.57 ? 58  ASN A N   1 
ATOM   142  C CA  . ASN A 1 23  ? 31.578  -10.132 80.173  1.00 107.38 ? 58  ASN A CA  1 
ATOM   143  C C   . ASN A 1 23  ? 30.210  -10.806 80.262  1.00 111.42 ? 58  ASN A C   1 
ATOM   144  O O   . ASN A 1 23  ? 29.956  -11.581 81.183  1.00 111.98 ? 58  ASN A O   1 
ATOM   145  C CB  . ASN A 1 23  ? 32.416  -10.482 81.403  1.00 107.11 ? 58  ASN A CB  1 
ATOM   146  C CG  . ASN A 1 23  ? 33.822  -9.919  81.325  1.00 110.98 ? 58  ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 23  ? 34.421  -9.864  80.250  1.00 115.83 ? 58  ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 23  ? 34.355  -9.492  82.464  1.00 108.93 ? 58  ASN A ND2 1 
ATOM   149  N N   . MET A 1 24  ? 29.342  -10.518 79.297  1.00 116.69 ? 59  MET A N   1 
ATOM   150  C CA  . MET A 1 24  ? 27.993  -11.081 79.269  1.00 121.98 ? 59  MET A CA  1 
ATOM   151  C C   . MET A 1 24  ? 27.933  -12.342 78.410  1.00 135.36 ? 59  MET A C   1 
ATOM   152  O O   . MET A 1 24  ? 28.640  -12.451 77.409  1.00 138.32 ? 59  MET A O   1 
ATOM   153  C CB  . MET A 1 24  ? 26.982  -10.036 78.808  1.00 116.10 ? 59  MET A CB  1 
ATOM   154  C CG  . MET A 1 24  ? 27.007  -8.782  79.659  1.00 110.99 ? 59  MET A CG  1 
ATOM   155  S SD  . MET A 1 24  ? 25.705  -7.618  79.238  1.00 124.47 ? 59  MET A SD  1 
ATOM   156  C CE  . MET A 1 24  ? 24.249  -8.614  79.545  1.00 106.42 ? 59  MET A CE  1 
ATOM   157  N N   . ASP A 1 25  ? 27.082  -13.289 78.798  1.00 145.03 ? 60  ASP A N   1 
ATOM   158  C CA  . ASP A 1 25  ? 27.228  -14.664 78.327  1.00 157.63 ? 60  ASP A CA  1 
ATOM   159  C C   . ASP A 1 25  ? 26.679  -14.944 76.922  1.00 167.42 ? 60  ASP A C   1 
ATOM   160  O O   . ASP A 1 25  ? 27.458  -14.985 75.966  1.00 170.23 ? 60  ASP A O   1 
ATOM   161  C CB  . ASP A 1 25  ? 26.577  -15.607 79.348  1.00 157.90 ? 60  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 25  ? 26.524  -17.050 78.876  1.00 163.52 ? 60  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 25  ? 27.391  -17.460 78.075  1.00 169.25 ? 60  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 25  ? 25.609  -17.779 79.319  1.00 161.99 ? 60  ASP A OD2 1 
ATOM   165  N N   . ASP A 1 26  ? 25.364  -15.114 76.778  1.00 172.94 ? 61  ASP A N   1 
ATOM   166  C CA  . ASP A 1 26  ? 24.782  -15.314 75.446  1.00 181.73 ? 61  ASP A CA  1 
ATOM   167  C C   . ASP A 1 26  ? 23.304  -15.705 75.417  1.00 187.25 ? 61  ASP A C   1 
ATOM   168  O O   . ASP A 1 26  ? 22.737  -16.154 76.413  1.00 185.31 ? 61  ASP A O   1 
ATOM   169  C CB  . ASP A 1 26  ? 25.597  -16.339 74.653  1.00 185.86 ? 61  ASP A CB  1 
ATOM   170  N N   . LYS A 1 27  ? 22.700  -15.522 74.247  1.00 195.08 ? 62  LYS A N   1 
ATOM   171  C CA  . LYS A 1 27  ? 21.491  -16.229 73.847  1.00 201.55 ? 62  LYS A CA  1 
ATOM   172  C C   . LYS A 1 27  ? 21.616  -16.492 72.346  1.00 212.54 ? 62  LYS A C   1 
ATOM   173  O O   . LYS A 1 27  ? 21.892  -15.571 71.576  1.00 212.67 ? 62  LYS A O   1 
ATOM   174  C CB  . LYS A 1 27  ? 20.255  -15.408 74.162  1.00 196.94 ? 62  LYS A CB  1 
ATOM   175  N N   . PRO A 1 28  ? 21.416  -17.739 71.926  1.00 113.80 ? 63  PRO A N   1 
ATOM   176  C CA  . PRO A 1 28  ? 21.609  -18.097 70.519  1.00 118.77 ? 63  PRO A CA  1 
ATOM   177  C C   . PRO A 1 28  ? 20.315  -17.968 69.719  1.00 121.98 ? 63  PRO A C   1 
ATOM   178  O O   . PRO A 1 28  ? 20.021  -16.908 69.168  1.00 123.10 ? 63  PRO A O   1 
ATOM   179  C CB  . PRO A 1 28  ? 22.184  -19.507 70.392  1.00 118.03 ? 63  PRO A CB  1 
ATOM   180  N N   . ASP A 1 34  ? 15.195  -10.338 69.598  1.00 185.55 ? 69  ASP A N   1 
ATOM   181  C CA  . ASP A 1 34  ? 14.041  -10.746 68.802  1.00 181.61 ? 69  ASP A CA  1 
ATOM   182  C C   . ASP A 1 34  ? 13.751  -9.742  67.692  1.00 176.58 ? 69  ASP A C   1 
ATOM   183  O O   . ASP A 1 34  ? 14.246  -8.616  67.724  1.00 176.55 ? 69  ASP A O   1 
ATOM   184  C CB  . ASP A 1 34  ? 12.820  -10.930 69.692  1.00 183.55 ? 69  ASP A CB  1 
ATOM   185  N N   . MET A 1 35  ? 12.936  -10.147 66.723  1.00 173.53 ? 70  MET A N   1 
ATOM   186  C CA  . MET A 1 35  ? 12.681  -9.332  65.537  1.00 170.44 ? 70  MET A CA  1 
ATOM   187  C C   . MET A 1 35  ? 12.204  -7.906  65.832  1.00 171.48 ? 70  MET A C   1 
ATOM   188  O O   . MET A 1 35  ? 12.735  -6.945  65.273  1.00 169.20 ? 70  MET A O   1 
ATOM   189  C CB  . MET A 1 35  ? 11.689  -10.041 64.615  1.00 165.87 ? 70  MET A CB  1 
ATOM   190  N N   . PHE A 1 36  ? 11.209  -7.772  66.706  1.00 174.23 ? 71  PHE A N   1 
ATOM   191  C CA  . PHE A 1 36  ? 10.613  -6.467  66.990  1.00 174.64 ? 71  PHE A CA  1 
ATOM   192  C C   . PHE A 1 36  ? 11.578  -5.542  67.727  1.00 177.77 ? 71  PHE A C   1 
ATOM   193  O O   . PHE A 1 36  ? 11.640  -4.345  67.446  1.00 177.98 ? 71  PHE A O   1 
ATOM   194  C CB  . PHE A 1 36  ? 9.314   -6.620  67.786  1.00 176.81 ? 71  PHE A CB  1 
ATOM   195  C CG  . PHE A 1 36  ? 8.511   -5.350  67.884  1.00 176.58 ? 71  PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 36  ? 7.816   -4.870  66.786  1.00 171.02 ? 71  PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 36  ? 8.449   -4.639  69.072  1.00 181.28 ? 71  PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 36  ? 7.077   -3.704  66.867  1.00 169.96 ? 71  PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 36  ? 7.710   -3.470  69.160  1.00 180.30 ? 71  PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 36  ? 7.023   -3.003  68.056  1.00 174.20 ? 71  PHE A CZ  1 
ATOM   201  N N   . THR A 1 37  ? 12.323  -6.101  68.674  1.00 180.29 ? 72  THR A N   1 
ATOM   202  C CA  . THR A 1 37  ? 13.333  -5.343  69.403  1.00 182.33 ? 72  THR A CA  1 
ATOM   203  C C   . THR A 1 37  ? 14.515  -5.019  68.492  1.00 181.45 ? 72  THR A C   1 
ATOM   204  O O   . THR A 1 37  ? 15.007  -3.891  68.472  1.00 182.25 ? 72  THR A O   1 
ATOM   205  C CB  . THR A 1 37  ? 13.831  -6.116  70.639  1.00 184.21 ? 72  THR A CB  1 
ATOM   206  O OG1 . THR A 1 37  ? 12.727  -6.386  71.512  1.00 183.70 ? 72  THR A OG1 1 
ATOM   207  C CG2 . THR A 1 37  ? 14.880  -5.309  71.386  1.00 188.71 ? 72  THR A CG2 1 
ATOM   208  N N   . THR A 1 38  ? 14.958  -6.019  67.735  1.00 179.92 ? 73  THR A N   1 
ATOM   209  C CA  . THR A 1 38  ? 16.047  -5.850  66.779  1.00 178.39 ? 73  THR A CA  1 
ATOM   210  C C   . THR A 1 38  ? 15.734  -4.737  65.787  1.00 172.53 ? 73  THR A C   1 
ATOM   211  O O   . THR A 1 38  ? 16.608  -3.951  65.419  1.00 173.31 ? 73  THR A O   1 
ATOM   212  C CB  . THR A 1 38  ? 16.305  -7.154  65.997  1.00 177.24 ? 73  THR A CB  1 
ATOM   213  O OG1 . THR A 1 38  ? 16.902  -8.125  66.866  1.00 182.17 ? 73  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 38  ? 17.227  -6.900  64.815  1.00 174.67 ? 73  THR A CG2 1 
ATOM   215  N N   . CYS A 1 39  ? 14.476  -4.677  65.363  1.00 166.60 ? 74  CYS A N   1 
ATOM   216  C CA  . CYS A 1 39  ? 14.026  -3.693  64.388  1.00 160.94 ? 74  CYS A CA  1 
ATOM   217  C C   . CYS A 1 39  ? 14.152  -2.259  64.898  1.00 160.61 ? 74  CYS A C   1 
ATOM   218  O O   . CYS A 1 39  ? 14.716  -1.398  64.225  1.00 158.09 ? 74  CYS A O   1 
ATOM   219  C CB  . CYS A 1 39  ? 12.576  -3.977  63.986  1.00 158.00 ? 74  CYS A CB  1 
ATOM   220  S SG  . CYS A 1 39  ? 11.933  -2.880  62.705  1.00 179.59 ? 74  CYS A SG  1 
ATOM   221  N N   . VAL A 1 40  ? 13.620  -2.008  66.089  1.00 163.66 ? 75  VAL A N   1 
ATOM   222  C CA  . VAL A 1 40  ? 13.603  -0.663  66.655  1.00 165.58 ? 75  VAL A CA  1 
ATOM   223  C C   . VAL A 1 40  ? 14.985  -0.207  67.127  1.00 168.83 ? 75  VAL A C   1 
ATOM   224  O O   . VAL A 1 40  ? 15.210  0.983   67.350  1.00 172.20 ? 75  VAL A O   1 
ATOM   225  C CB  . VAL A 1 40  ? 12.594  -0.559  67.823  1.00 167.80 ? 75  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 40  ? 11.182  -0.861  67.333  1.00 163.32 ? 75  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 40  ? 12.984  -1.504  68.946  1.00 171.70 ? 75  VAL A CG2 1 
ATOM   228  N N   . ASP A 1 41  ? 15.904  -1.155  67.280  1.00 166.50 ? 76  ASP A N   1 
ATOM   229  C CA  . ASP A 1 41  ? 17.258  -0.842  67.732  1.00 166.22 ? 76  ASP A CA  1 
ATOM   230  C C   . ASP A 1 41  ? 18.164  -0.295  66.626  1.00 157.96 ? 76  ASP A C   1 
ATOM   231  O O   . ASP A 1 41  ? 19.114  0.437   66.907  1.00 159.54 ? 76  ASP A O   1 
ATOM   232  C CB  . ASP A 1 41  ? 17.900  -2.065  68.399  1.00 172.26 ? 76  ASP A CB  1 
ATOM   233  C CG  . ASP A 1 41  ? 17.413  -2.272  69.823  1.00 179.58 ? 76  ASP A CG  1 
ATOM   234  O OD1 . ASP A 1 41  ? 17.146  -1.261  70.513  1.00 184.16 ? 76  ASP A OD1 1 
ATOM   235  O OD2 . ASP A 1 41  ? 17.302  -3.439  70.256  1.00 180.44 ? 76  ASP A OD2 1 
ATOM   236  N N   . ILE A 1 42  ? 17.876  -0.656  65.376  1.00 147.12 ? 77  ILE A N   1 
ATOM   237  C CA  . ILE A 1 42  ? 18.677  -0.193  64.242  1.00 139.82 ? 77  ILE A CA  1 
ATOM   238  C C   . ILE A 1 42  ? 18.333  1.242   63.832  1.00 133.77 ? 77  ILE A C   1 
ATOM   239  O O   . ILE A 1 42  ? 17.206  1.696   64.027  1.00 130.24 ? 77  ILE A O   1 
ATOM   240  C CB  . ILE A 1 42  ? 18.541  -1.133  63.017  1.00 136.72 ? 77  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 42  ? 17.090  -1.206  62.542  1.00 129.31 ? 77  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 42  ? 19.060  -2.526  63.345  1.00 139.76 ? 77  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 42  ? 16.844  -2.300  61.529  1.00 124.59 ? 77  ILE A CD1 1 
ATOM   244  N N   . ARG A 1 43  ? 19.314  1.943   63.268  1.00 132.51 ? 78  ARG A N   1 
ATOM   245  C CA  . ARG A 1 43  ? 19.145  3.334   62.851  1.00 132.17 ? 78  ARG A CA  1 
ATOM   246  C C   . ARG A 1 43  ? 18.322  3.460   61.573  1.00 128.19 ? 78  ARG A C   1 
ATOM   247  O O   . ARG A 1 43  ? 18.206  2.504   60.804  1.00 126.18 ? 78  ARG A O   1 
ATOM   248  C CB  . ARG A 1 43  ? 20.506  4.009   62.663  1.00 136.20 ? 78  ARG A CB  1 
ATOM   249  C CG  . ARG A 1 43  ? 21.305  4.165   63.952  1.00 147.23 ? 78  ARG A CG  1 
ATOM   250  C CD  . ARG A 1 43  ? 22.608  4.918   63.718  1.00 151.96 ? 78  ARG A CD  1 
ATOM   251  N NE  . ARG A 1 43  ? 22.378  6.264   63.199  1.00 151.52 ? 78  ARG A NE  1 
ATOM   252  C CZ  . ARG A 1 43  ? 23.346  7.117   62.875  1.00 152.27 ? 78  ARG A CZ  1 
ATOM   253  N NH1 . ARG A 1 43  ? 24.617  6.765   63.014  1.00 154.87 ? 78  ARG A NH1 1 
ATOM   254  N NH2 . ARG A 1 43  ? 23.041  8.321   62.411  1.00 150.27 ? 78  ARG A NH2 1 
ATOM   255  N N   . TRP A 1 44  ? 17.754  4.643   61.355  1.00 127.14 ? 79  TRP A N   1 
ATOM   256  C CA  . TRP A 1 44  ? 16.975  4.918   60.150  1.00 121.36 ? 79  TRP A CA  1 
ATOM   257  C C   . TRP A 1 44  ? 17.756  4.608   58.881  1.00 121.57 ? 79  TRP A C   1 
ATOM   258  O O   . TRP A 1 44  ? 17.381  3.719   58.114  1.00 118.65 ? 79  TRP A O   1 
ATOM   259  C CB  . TRP A 1 44  ? 16.512  6.377   60.112  1.00 118.39 ? 79  TRP A CB  1 
ATOM   260  C CG  . TRP A 1 44  ? 15.414  6.699   61.075  1.00 118.67 ? 79  TRP A CG  1 
ATOM   261  C CD1 . TRP A 1 44  ? 15.501  7.493   62.179  1.00 122.77 ? 79  TRP A CD1 1 
ATOM   262  C CD2 . TRP A 1 44  ? 14.058  6.235   61.020  1.00 115.49 ? 79  TRP A CD2 1 
ATOM   263  N NE1 . TRP A 1 44  ? 14.284  7.555   62.815  1.00 121.82 ? 79  TRP A NE1 1 
ATOM   264  C CE2 . TRP A 1 44  ? 13.382  6.791   62.124  1.00 116.23 ? 79  TRP A CE2 1 
ATOM   265  C CE3 . TRP A 1 44  ? 13.351  5.405   60.142  1.00 111.12 ? 79  TRP A CE3 1 
ATOM   266  C CZ2 . TRP A 1 44  ? 12.036  6.545   62.378  1.00 113.71 ? 79  TRP A CZ2 1 
ATOM   267  C CZ3 . TRP A 1 44  ? 12.011  5.160   60.395  1.00 108.81 ? 79  TRP A CZ3 1 
ATOM   268  C CH2 . TRP A 1 44  ? 11.369  5.728   61.506  1.00 111.32 ? 79  TRP A CH2 1 
ATOM   269  N N   . ARG A 1 45  ? 18.838  5.352   58.665  1.00 124.51 ? 80  ARG A N   1 
ATOM   270  C CA  . ARG A 1 45  ? 19.611  5.246   57.432  1.00 124.19 ? 80  ARG A CA  1 
ATOM   271  C C   . ARG A 1 45  ? 19.985  3.801   57.100  1.00 121.14 ? 80  ARG A C   1 
ATOM   272  O O   . ARG A 1 45  ? 20.035  3.420   55.930  1.00 117.67 ? 80  ARG A O   1 
ATOM   273  C CB  . ARG A 1 45  ? 20.863  6.128   57.494  1.00 129.27 ? 80  ARG A CB  1 
ATOM   274  C CG  . ARG A 1 45  ? 21.923  5.655   58.476  1.00 137.43 ? 80  ARG A CG  1 
ATOM   275  C CD  . ARG A 1 45  ? 23.096  6.627   58.525  1.00 143.82 ? 80  ARG A CD  1 
ATOM   276  N NE  . ARG A 1 45  ? 22.699  7.939   59.030  1.00 147.30 ? 80  ARG A NE  1 
ATOM   277  C CZ  . ARG A 1 45  ? 23.422  9.045   58.888  1.00 150.72 ? 80  ARG A CZ  1 
ATOM   278  N NH1 . ARG A 1 45  ? 24.583  9.001   58.248  1.00 151.59 ? 80  ARG A NH1 1 
ATOM   279  N NH2 . ARG A 1 45  ? 22.983  10.196  59.380  1.00 152.89 ? 80  ARG A NH2 1 
ATOM   280  N N   . TYR A 1 46  ? 20.241  3.000   58.130  1.00 120.91 ? 81  TYR A N   1 
ATOM   281  C CA  . TYR A 1 46  ? 20.573  1.593   57.930  1.00 116.69 ? 81  TYR A CA  1 
ATOM   282  C C   . TYR A 1 46  ? 19.333  0.749   57.643  1.00 107.44 ? 81  TYR A C   1 
ATOM   283  O O   . TYR A 1 46  ? 19.386  -0.204  56.864  1.00 103.06 ? 81  TYR A O   1 
ATOM   284  C CB  . TYR A 1 46  ? 21.332  1.033   59.133  1.00 123.08 ? 81  TYR A CB  1 
ATOM   285  C CG  . TYR A 1 46  ? 22.737  1.576   59.271  1.00 130.94 ? 81  TYR A CG  1 
ATOM   286  C CD1 . TYR A 1 46  ? 23.765  1.102   58.467  1.00 132.27 ? 81  TYR A CD1 1 
ATOM   287  C CD2 . TYR A 1 46  ? 23.037  2.556   60.210  1.00 137.14 ? 81  TYR A CD2 1 
ATOM   288  C CE1 . TYR A 1 46  ? 25.052  1.592   58.589  1.00 137.57 ? 81  TYR A CE1 1 
ATOM   289  C CE2 . TYR A 1 46  ? 24.321  3.054   60.339  1.00 141.81 ? 81  TYR A CE2 1 
ATOM   290  C CZ  . TYR A 1 46  ? 25.325  2.567   59.526  1.00 142.10 ? 81  TYR A CZ  1 
ATOM   291  O OH  . TYR A 1 46  ? 26.606  3.058   59.650  1.00 146.08 ? 81  TYR A OH  1 
ATOM   292  N N   . MET A 1 47  ? 18.217  1.097   58.273  1.00 103.09 ? 82  MET A N   1 
ATOM   293  C CA  . MET A 1 47  ? 16.981  0.365   58.046  1.00 99.25  ? 82  MET A CA  1 
ATOM   294  C C   . MET A 1 47  ? 16.419  0.684   56.664  1.00 96.15  ? 82  MET A C   1 
ATOM   295  O O   . MET A 1 47  ? 15.842  -0.183  56.005  1.00 91.79  ? 82  MET A O   1 
ATOM   296  C CB  . MET A 1 47  ? 15.946  0.677   59.123  1.00 100.15 ? 82  MET A CB  1 
ATOM   297  C CG  . MET A 1 47  ? 14.713  -0.213  59.046  1.00 98.92  ? 82  MET A CG  1 
ATOM   298  S SD  . MET A 1 47  ? 13.402  0.283   60.176  1.00 206.35 ? 82  MET A SD  1 
ATOM   299  C CE  . MET A 1 47  ? 12.961  1.884   59.504  1.00 145.61 ? 82  MET A CE  1 
ATOM   300  N N   . LEU A 1 48  ? 16.590  1.931   56.231  1.00 96.90  ? 83  LEU A N   1 
ATOM   301  C CA  . LEU A 1 48  ? 16.151  2.341   54.902  1.00 96.20  ? 83  LEU A CA  1 
ATOM   302  C C   . LEU A 1 48  ? 17.076  1.756   53.840  1.00 94.18  ? 83  LEU A C   1 
ATOM   303  O O   . LEU A 1 48  ? 16.631  1.358   52.763  1.00 86.43  ? 83  LEU A O   1 
ATOM   304  C CB  . LEU A 1 48  ? 16.094  3.868   54.787  1.00 97.68  ? 83  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 48  ? 14.996  4.582   55.581  1.00 98.10  ? 83  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 48  ? 14.956  6.069   55.242  1.00 99.08  ? 83  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 48  ? 13.640  3.943   55.330  1.00 92.18  ? 83  LEU A CD2 1 
ATOM   308  N N   . LEU A 1 49  ? 18.367  1.711   54.153  1.00 97.74  ? 84  LEU A N   1 
ATOM   309  C CA  . LEU A 1 49  ? 19.342  1.081   53.277  1.00 97.01  ? 84  LEU A CA  1 
ATOM   310  C C   . LEU A 1 49  ? 19.008  -0.400  53.171  1.00 91.95  ? 84  LEU A C   1 
ATOM   311  O O   . LEU A 1 49  ? 19.094  -1.001  52.099  1.00 86.68  ? 84  LEU A O   1 
ATOM   312  C CB  . LEU A 1 49  ? 20.756  1.264   53.833  1.00 103.12 ? 84  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 49  ? 21.905  0.674   53.009  1.00 105.89 ? 84  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 49  ? 21.896  1.230   51.587  1.00 104.34 ? 84  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 49  ? 23.247  0.928   53.683  1.00 111.21 ? 84  LEU A CD2 1 
ATOM   316  N N   . LEU A 1 50  ? 18.619  -0.976  54.302  1.00 92.65  ? 85  LEU A N   1 
ATOM   317  C CA  . LEU A 1 50  ? 18.241  -2.379  54.373  1.00 93.29  ? 85  LEU A CA  1 
ATOM   318  C C   . LEU A 1 50  ? 17.078  -2.669  53.428  1.00 89.03  ? 85  LEU A C   1 
ATOM   319  O O   . LEU A 1 50  ? 17.144  -3.576  52.595  1.00 86.35  ? 85  LEU A O   1 
ATOM   320  C CB  . LEU A 1 50  ? 17.861  -2.735  55.811  1.00 99.30  ? 85  LEU A CB  1 
ATOM   321  C CG  . LEU A 1 50  ? 17.535  -4.189  56.148  1.00 103.02 ? 85  LEU A CG  1 
ATOM   322  C CD1 . LEU A 1 50  ? 18.168  -4.568  57.480  1.00 109.01 ? 85  LEU A CD1 1 
ATOM   323  C CD2 . LEU A 1 50  ? 16.031  -4.416  56.175  1.00 101.52 ? 85  LEU A CD2 1 
ATOM   324  N N   . PHE A 1 51  ? 16.013  -1.889  53.554  1.00 85.45  ? 86  PHE A N   1 
ATOM   325  C CA  . PHE A 1 51  ? 14.842  -2.102  52.724  1.00 83.59  ? 86  PHE A CA  1 
ATOM   326  C C   . PHE A 1 51  ? 15.122  -1.887  51.242  1.00 83.17  ? 86  PHE A C   1 
ATOM   327  O O   . PHE A 1 51  ? 14.661  -2.662  50.405  1.00 81.93  ? 86  PHE A O   1 
ATOM   328  C CB  . PHE A 1 51  ? 13.669  -1.252  53.203  1.00 84.19  ? 86  PHE A CB  1 
ATOM   329  C CG  . PHE A 1 51  ? 12.912  -1.876  54.331  1.00 88.44  ? 86  PHE A CG  1 
ATOM   330  C CD1 . PHE A 1 51  ? 12.920  -1.305  55.593  1.00 92.29  ? 86  PHE A CD1 1 
ATOM   331  C CD2 . PHE A 1 51  ? 12.218  -3.059  54.136  1.00 88.37  ? 86  PHE A CD2 1 
ATOM   332  C CE1 . PHE A 1 51  ? 12.233  -1.892  56.636  1.00 94.61  ? 86  PHE A CE1 1 
ATOM   333  C CE2 . PHE A 1 51  ? 11.528  -3.652  55.173  1.00 93.57  ? 86  PHE A CE2 1 
ATOM   334  C CZ  . PHE A 1 51  ? 11.537  -3.067  56.430  1.00 95.29  ? 86  PHE A CZ  1 
ATOM   335  N N   . SER A 1 52  ? 15.887  -0.852  50.915  1.00 83.30  ? 87  SER A N   1 
ATOM   336  C CA  . SER A 1 52  ? 16.245  -0.620  49.522  1.00 81.01  ? 87  SER A CA  1 
ATOM   337  C C   . SER A 1 52  ? 17.095  -1.779  48.996  1.00 80.61  ? 87  SER A C   1 
ATOM   338  O O   . SER A 1 52  ? 17.018  -2.144  47.824  1.00 78.57  ? 87  SER A O   1 
ATOM   339  C CB  . SER A 1 52  ? 16.953  0.722   49.350  1.00 80.91  ? 87  SER A CB  1 
ATOM   340  O OG  . SER A 1 52  ? 18.143  0.763   50.101  1.00 90.63  ? 87  SER A OG  1 
ATOM   341  N N   . LEU A 1 53  ? 17.889  -2.372  49.878  1.00 83.66  ? 88  LEU A N   1 
ATOM   342  C CA  . LEU A 1 53  ? 18.657  -3.557  49.528  1.00 83.03  ? 88  LEU A CA  1 
ATOM   343  C C   . LEU A 1 53  ? 17.714  -4.733  49.259  1.00 78.92  ? 88  LEU A C   1 
ATOM   344  O O   . LEU A 1 53  ? 17.928  -5.524  48.339  1.00 75.08  ? 88  LEU A O   1 
ATOM   345  C CB  . LEU A 1 53  ? 19.625  -3.904  50.659  1.00 88.20  ? 88  LEU A CB  1 
ATOM   346  C CG  . LEU A 1 53  ? 20.776  -4.857  50.334  1.00 88.49  ? 88  LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 53  ? 21.608  -4.322  49.175  1.00 84.35  ? 88  LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 53  ? 21.640  -5.064  51.568  1.00 91.86  ? 88  LEU A CD2 1 
ATOM   349  N N   . ALA A 1 54  ? 16.667  -4.842  50.069  1.00 79.20  ? 89  ALA A N   1 
ATOM   350  C CA  . ALA A 1 54  ? 15.683  -5.905  49.902  1.00 75.52  ? 89  ALA A CA  1 
ATOM   351  C C   . ALA A 1 54  ? 14.994  -5.802  48.543  1.00 74.16  ? 89  ALA A C   1 
ATOM   352  O O   . ALA A 1 54  ? 14.722  -6.817  47.900  1.00 75.37  ? 89  ALA A O   1 
ATOM   353  C CB  . ALA A 1 54  ? 14.655  -5.857  51.020  1.00 72.47  ? 89  ALA A CB  1 
ATOM   354  N N   . PHE A 1 55  ? 14.705  -4.575  48.118  1.00 69.09  ? 90  PHE A N   1 
ATOM   355  C CA  . PHE A 1 55  ? 14.090  -4.341  46.817  1.00 66.67  ? 90  PHE A CA  1 
ATOM   356  C C   . PHE A 1 55  ? 15.027  -4.728  45.685  1.00 63.98  ? 90  PHE A C   1 
ATOM   357  O O   . PHE A 1 55  ? 14.659  -5.496  44.798  1.00 61.83  ? 90  PHE A O   1 
ATOM   358  C CB  . PHE A 1 55  ? 13.677  -2.878  46.673  1.00 69.48  ? 90  PHE A CB  1 
ATOM   359  C CG  . PHE A 1 55  ? 12.421  -2.533  47.413  1.00 74.52  ? 90  PHE A CG  1 
ATOM   360  C CD1 . PHE A 1 55  ? 12.366  -1.418  48.230  1.00 79.08  ? 90  PHE A CD1 1 
ATOM   361  C CD2 . PHE A 1 55  ? 11.292  -3.329  47.292  1.00 76.10  ? 90  PHE A CD2 1 
ATOM   362  C CE1 . PHE A 1 55  ? 11.210  -1.103  48.914  1.00 81.67  ? 90  PHE A CE1 1 
ATOM   363  C CE2 . PHE A 1 55  ? 10.131  -3.018  47.972  1.00 77.66  ? 90  PHE A CE2 1 
ATOM   364  C CZ  . PHE A 1 55  ? 10.090  -1.903  48.786  1.00 80.35  ? 90  PHE A CZ  1 
ATOM   365  N N   . LEU A 1 56  ? 16.244  -4.195  45.729  1.00 66.82  ? 91  LEU A N   1 
ATOM   366  C CA  . LEU A 1 56  ? 17.243  -4.486  44.712  1.00 69.24  ? 91  LEU A CA  1 
ATOM   367  C C   . LEU A 1 56  ? 17.427  -5.982  44.516  1.00 71.01  ? 91  LEU A C   1 
ATOM   368  O O   . LEU A 1 56  ? 17.354  -6.484  43.396  1.00 73.68  ? 91  LEU A O   1 
ATOM   369  C CB  . LEU A 1 56  ? 18.579  -3.844  45.074  1.00 70.21  ? 91  LEU A CB  1 
ATOM   370  C CG  . LEU A 1 56  ? 18.875  -2.518  44.382  1.00 72.93  ? 91  LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 56  ? 20.308  -2.105  44.666  1.00 79.57  ? 91  LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 56  ? 18.642  -2.639  42.880  1.00 72.29  ? 91  LEU A CD2 1 
ATOM   373  N N   . VAL A 1 57  ? 17.658  -6.689  45.614  1.00 71.63  ? 92  VAL A N   1 
ATOM   374  C CA  . VAL A 1 57  ? 17.932  -8.116  45.561  1.00 71.76  ? 92  VAL A CA  1 
ATOM   375  C C   . VAL A 1 57  ? 16.792  -8.896  44.909  1.00 66.63  ? 92  VAL A C   1 
ATOM   376  O O   . VAL A 1 57  ? 17.029  -9.761  44.066  1.00 65.94  ? 92  VAL A O   1 
ATOM   377  C CB  . VAL A 1 57  ? 18.242  -8.678  46.967  1.00 72.82  ? 92  VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 57  ? 18.322  -10.199 46.935  1.00 66.11  ? 92  VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 57  ? 19.533  -8.082  47.479  1.00 73.52  ? 92  VAL A CG2 1 
ATOM   380  N N   . SER A 1 58  ? 15.560  -8.585  45.297  1.00 64.15  ? 93  SER A N   1 
ATOM   381  C CA  . SER A 1 58  ? 14.400  -9.287  44.756  1.00 64.67  ? 93  SER A CA  1 
ATOM   382  C C   . SER A 1 58  ? 14.140  -8.890  43.303  1.00 60.94  ? 93  SER A C   1 
ATOM   383  O O   . SER A 1 58  ? 13.761  -9.726  42.485  1.00 59.67  ? 93  SER A O   1 
ATOM   384  C CB  . SER A 1 58  ? 13.160  -9.036  45.616  1.00 66.52  ? 93  SER A CB  1 
ATOM   385  O OG  . SER A 1 58  ? 12.907  -7.648  45.747  1.00 69.06  ? 93  SER A OG  1 
ATOM   386  N N   . TRP A 1 59  ? 14.347  -7.615  42.987  1.00 60.09  ? 94  TRP A N   1 
ATOM   387  C CA  . TRP A 1 59  ? 14.243  -7.146  41.606  1.00 58.58  ? 94  TRP A CA  1 
ATOM   388  C C   . TRP A 1 59  ? 15.277  -7.849  40.721  1.00 61.53  ? 94  TRP A C   1 
ATOM   389  O O   . TRP A 1 59  ? 14.944  -8.358  39.653  1.00 60.10  ? 94  TRP A O   1 
ATOM   390  C CB  . TRP A 1 59  ? 14.403  -5.623  41.521  1.00 54.97  ? 94  TRP A CB  1 
ATOM   391  C CG  . TRP A 1 59  ? 13.269  -4.854  42.154  1.00 55.60  ? 94  TRP A CG  1 
ATOM   392  C CD1 . TRP A 1 59  ? 12.026  -5.329  42.455  1.00 56.59  ? 94  TRP A CD1 1 
ATOM   393  C CD2 . TRP A 1 59  ? 13.283  -3.479  42.565  1.00 58.35  ? 94  TRP A CD2 1 
ATOM   394  N NE1 . TRP A 1 59  ? 11.263  -4.337  43.023  1.00 58.32  ? 94  TRP A NE1 1 
ATOM   395  C CE2 . TRP A 1 59  ? 12.011  -3.192  43.106  1.00 57.66  ? 94  TRP A CE2 1 
ATOM   396  C CE3 . TRP A 1 59  ? 14.245  -2.462  42.531  1.00 61.18  ? 94  TRP A CE3 1 
ATOM   397  C CZ2 . TRP A 1 59  ? 11.677  -1.935  43.610  1.00 55.79  ? 94  TRP A CZ2 1 
ATOM   398  C CZ3 . TRP A 1 59  ? 13.910  -1.211  43.026  1.00 61.89  ? 94  TRP A CZ3 1 
ATOM   399  C CH2 . TRP A 1 59  ? 12.635  -0.959  43.559  1.00 57.13  ? 94  TRP A CH2 1 
ATOM   400  N N   . LEU A 1 60  ? 16.527  -7.883  41.176  1.00 65.19  ? 95  LEU A N   1 
ATOM   401  C CA  . LEU A 1 60  ? 17.596  -8.543  40.431  1.00 70.33  ? 95  LEU A CA  1 
ATOM   402  C C   . LEU A 1 60  ? 17.360  -10.047 40.280  1.00 70.54  ? 95  LEU A C   1 
ATOM   403  O O   . LEU A 1 60  ? 17.601  -10.620 39.214  1.00 70.17  ? 95  LEU A O   1 
ATOM   404  C CB  . LEU A 1 60  ? 18.951  -8.287  41.094  1.00 75.56  ? 95  LEU A CB  1 
ATOM   405  C CG  . LEU A 1 60  ? 19.550  -6.898  40.858  1.00 78.79  ? 95  LEU A CG  1 
ATOM   406  C CD1 . LEU A 1 60  ? 20.724  -6.645  41.792  1.00 80.67  ? 95  LEU A CD1 1 
ATOM   407  C CD2 . LEU A 1 60  ? 19.968  -6.733  39.401  1.00 78.42  ? 95  LEU A CD2 1 
ATOM   408  N N   . LEU A 1 61  ? 16.887  -10.683 41.345  1.00 70.77  ? 96  LEU A N   1 
ATOM   409  C CA  . LEU A 1 61  ? 16.659  -12.122 41.317  1.00 73.03  ? 96  LEU A CA  1 
ATOM   410  C C   . LEU A 1 61  ? 15.658  -12.516 40.227  1.00 68.90  ? 96  LEU A C   1 
ATOM   411  O O   . LEU A 1 61  ? 15.976  -13.296 39.331  1.00 65.66  ? 96  LEU A O   1 
ATOM   412  C CB  . LEU A 1 61  ? 16.167  -12.611 42.675  1.00 76.22  ? 96  LEU A CB  1 
ATOM   413  C CG  . LEU A 1 61  ? 16.296  -14.119 42.860  1.00 85.80  ? 96  LEU A CG  1 
ATOM   414  C CD1 . LEU A 1 61  ? 17.664  -14.447 43.450  1.00 90.47  ? 96  LEU A CD1 1 
ATOM   415  C CD2 . LEU A 1 61  ? 15.176  -14.649 43.745  1.00 88.53  ? 96  LEU A CD2 1 
ATOM   416  N N   . PHE A 1 62  ? 14.451  -11.962 40.307  1.00 67.63  ? 97  PHE A N   1 
ATOM   417  C CA  . PHE A 1 62  ? 13.400  -12.286 39.348  1.00 65.41  ? 97  PHE A CA  1 
ATOM   418  C C   . PHE A 1 62  ? 13.797  -11.855 37.944  1.00 62.19  ? 97  PHE A C   1 
ATOM   419  O O   . PHE A 1 62  ? 13.518  -12.554 36.973  1.00 63.76  ? 97  PHE A O   1 
ATOM   420  C CB  . PHE A 1 62  ? 12.059  -11.666 39.765  1.00 62.16  ? 97  PHE A CB  1 
ATOM   421  C CG  . PHE A 1 62  ? 11.412  -12.366 40.926  1.00 61.36  ? 97  PHE A CG  1 
ATOM   422  C CD1 . PHE A 1 62  ? 11.479  -11.830 42.206  1.00 59.39  ? 97  PHE A CD1 1 
ATOM   423  C CD2 . PHE A 1 62  ? 10.761  -13.580 40.742  1.00 61.51  ? 97  PHE A CD2 1 
ATOM   424  C CE1 . PHE A 1 62  ? 10.893  -12.487 43.282  1.00 63.38  ? 97  PHE A CE1 1 
ATOM   425  C CE2 . PHE A 1 62  ? 10.174  -14.243 41.813  1.00 63.93  ? 97  PHE A CE2 1 
ATOM   426  C CZ  . PHE A 1 62  ? 10.238  -13.697 43.085  1.00 64.14  ? 97  PHE A CZ  1 
ATOM   427  N N   . GLY A 1 63  ? 14.460  -10.708 37.844  1.00 59.04  ? 98  GLY A N   1 
ATOM   428  C CA  . GLY A 1 63  ? 15.001  -10.270 36.575  1.00 59.66  ? 98  GLY A CA  1 
ATOM   429  C C   . GLY A 1 63  ? 15.866  -11.361 35.969  1.00 62.06  ? 98  GLY A C   1 
ATOM   430  O O   . GLY A 1 63  ? 15.775  -11.653 34.780  1.00 62.46  ? 98  GLY A O   1 
ATOM   431  N N   . LEU A 1 64  ? 16.703  -11.971 36.801  1.00 65.32  ? 99  LEU A N   1 
ATOM   432  C CA  . LEU A 1 64  ? 17.580  -13.047 36.357  1.00 69.50  ? 99  LEU A CA  1 
ATOM   433  C C   . LEU A 1 64  ? 16.761  -14.241 35.871  1.00 66.72  ? 99  LEU A C   1 
ATOM   434  O O   . LEU A 1 64  ? 17.046  -14.819 34.823  1.00 65.97  ? 99  LEU A O   1 
ATOM   435  C CB  . LEU A 1 64  ? 18.528  -13.465 37.485  1.00 73.11  ? 99  LEU A CB  1 
ATOM   436  C CG  . LEU A 1 64  ? 19.561  -14.535 37.130  1.00 80.39  ? 99  LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 64  ? 20.475  -14.049 36.016  1.00 81.54  ? 99  LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 64  ? 20.366  -14.932 38.358  1.00 83.34  ? 99  LEU A CD2 1 
ATOM   439  N N   . ILE A 1 65  ? 15.732  -14.592 36.633  1.00 63.95  ? 100 ILE A N   1 
ATOM   440  C CA  . ILE A 1 65  ? 14.857  -15.702 36.278  1.00 64.93  ? 100 ILE A CA  1 
ATOM   441  C C   . ILE A 1 65  ? 14.134  -15.461 34.946  1.00 66.18  ? 100 ILE A C   1 
ATOM   442  O O   . ILE A 1 65  ? 14.131  -16.328 34.068  1.00 65.86  ? 100 ILE A O   1 
ATOM   443  C CB  . ILE A 1 65  ? 13.850  -16.006 37.410  1.00 64.68  ? 100 ILE A CB  1 
ATOM   444  C CG1 . ILE A 1 65  ? 14.606  -16.474 38.664  1.00 65.85  ? 100 ILE A CG1 1 
ATOM   445  C CG2 . ILE A 1 65  ? 12.834  -17.051 36.962  1.00 61.54  ? 100 ILE A CG2 1 
ATOM   446  C CD1 . ILE A 1 65  ? 13.757  -16.570 39.925  1.00 62.30  ? 100 ILE A CD1 1 
ATOM   447  N N   . PHE A 1 66  ? 13.534  -14.286 34.787  1.00 55.30  ? 101 PHE A N   1 
ATOM   448  C CA  . PHE A 1 66  ? 12.851  -13.976 33.537  1.00 56.30  ? 101 PHE A CA  1 
ATOM   449  C C   . PHE A 1 66  ? 13.828  -13.968 32.371  1.00 60.24  ? 101 PHE A C   1 
ATOM   450  O O   . PHE A 1 66  ? 13.485  -14.379 31.260  1.00 60.50  ? 101 PHE A O   1 
ATOM   451  C CB  . PHE A 1 66  ? 12.095  -12.647 33.620  1.00 56.03  ? 101 PHE A CB  1 
ATOM   452  C CG  . PHE A 1 66  ? 10.835  -12.724 34.432  1.00 58.55  ? 101 PHE A CG  1 
ATOM   453  C CD1 . PHE A 1 66  ? 10.688  -11.965 35.587  1.00 56.95  ? 101 PHE A CD1 1 
ATOM   454  C CD2 . PHE A 1 66  ? 9.806   -13.575 34.056  1.00 57.93  ? 101 PHE A CD2 1 
ATOM   455  C CE1 . PHE A 1 66  ? 9.533   -12.042 36.344  1.00 55.12  ? 101 PHE A CE1 1 
ATOM   456  C CE2 . PHE A 1 66  ? 8.644   -13.656 34.810  1.00 59.67  ? 101 PHE A CE2 1 
ATOM   457  C CZ  . PHE A 1 66  ? 8.510   -12.888 35.958  1.00 58.10  ? 101 PHE A CZ  1 
ATOM   458  N N   . TRP A 1 67  ? 15.050  -13.509 32.628  1.00 59.88  ? 102 TRP A N   1 
ATOM   459  C CA  . TRP A 1 67  ? 16.085  -13.545 31.607  1.00 61.24  ? 102 TRP A CA  1 
ATOM   460  C C   . TRP A 1 67  ? 16.441  -14.988 31.204  1.00 62.93  ? 102 TRP A C   1 
ATOM   461  O O   . TRP A 1 67  ? 16.587  -15.284 30.019  1.00 61.90  ? 102 TRP A O   1 
ATOM   462  C CB  . TRP A 1 67  ? 17.327  -12.766 32.048  1.00 62.18  ? 102 TRP A CB  1 
ATOM   463  C CG  . TRP A 1 67  ? 18.404  -12.781 31.008  1.00 67.67  ? 102 TRP A CG  1 
ATOM   464  C CD1 . TRP A 1 67  ? 18.529  -11.936 29.937  1.00 64.49  ? 102 TRP A CD1 1 
ATOM   465  C CD2 . TRP A 1 67  ? 19.499  -13.703 30.921  1.00 70.29  ? 102 TRP A CD2 1 
ATOM   466  N NE1 . TRP A 1 67  ? 19.639  -12.271 29.199  1.00 61.58  ? 102 TRP A NE1 1 
ATOM   467  C CE2 . TRP A 1 67  ? 20.251  -13.351 29.781  1.00 74.69  ? 102 TRP A CE2 1 
ATOM   468  C CE3 . TRP A 1 67  ? 19.917  -14.785 31.701  1.00 73.92  ? 102 TRP A CE3 1 
ATOM   469  C CZ2 . TRP A 1 67  ? 21.402  -14.045 29.400  1.00 79.51  ? 102 TRP A CZ2 1 
ATOM   470  C CZ3 . TRP A 1 67  ? 21.066  -15.477 31.317  1.00 78.72  ? 102 TRP A CZ3 1 
ATOM   471  C CH2 . TRP A 1 67  ? 21.792  -15.102 30.179  1.00 79.52  ? 102 TRP A CH2 1 
ATOM   472  N N   . LEU A 1 68  ? 16.568  -15.883 32.179  1.00 60.47  ? 103 LEU A N   1 
ATOM   473  C CA  . LEU A 1 68  ? 16.842  -17.290 31.879  1.00 71.64  ? 103 LEU A CA  1 
ATOM   474  C C   . LEU A 1 68  ? 15.722  -17.907 31.050  1.00 68.86  ? 103 LEU A C   1 
ATOM   475  O O   . LEU A 1 68  ? 15.964  -18.565 30.038  1.00 69.83  ? 103 LEU A O   1 
ATOM   476  C CB  . LEU A 1 68  ? 17.019  -18.101 33.163  1.00 72.78  ? 103 LEU A CB  1 
ATOM   477  C CG  . LEU A 1 68  ? 18.411  -18.060 33.783  1.00 79.04  ? 103 LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 68  ? 18.532  -19.116 34.876  1.00 80.04  ? 103 LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 68  ? 19.442  -18.283 32.699  1.00 81.51  ? 103 LEU A CD2 1 
ATOM   480  N N   . ILE A 1 69  ? 14.496  -17.705 31.513  1.00 64.58  ? 104 ILE A N   1 
ATOM   481  C CA  . ILE A 1 69  ? 13.312  -18.162 30.812  1.00 66.61  ? 104 ILE A CA  1 
ATOM   482  C C   . ILE A 1 69  ? 13.300  -17.665 29.368  1.00 68.43  ? 104 ILE A C   1 
ATOM   483  O O   . ILE A 1 69  ? 13.077  -18.444 28.442  1.00 70.04  ? 104 ILE A O   1 
ATOM   484  C CB  . ILE A 1 69  ? 12.044  -17.675 31.531  1.00 67.54  ? 104 ILE A CB  1 
ATOM   485  C CG1 . ILE A 1 69  ? 11.913  -18.370 32.891  1.00 66.57  ? 104 ILE A CG1 1 
ATOM   486  C CG2 . ILE A 1 69  ? 10.810  -17.910 30.671  1.00 59.63  ? 104 ILE A CG2 1 
ATOM   487  C CD1 . ILE A 1 69  ? 10.785  -17.826 33.741  1.00 65.16  ? 104 ILE A CD1 1 
ATOM   488  N N   . ALA A 1 70  ? 13.544  -16.370 29.183  1.00 60.18  ? 105 ALA A N   1 
ATOM   489  C CA  . ALA A 1 70  ? 13.575  -15.779 27.850  1.00 63.42  ? 105 ALA A CA  1 
ATOM   490  C C   . ALA A 1 70  ? 14.671  -16.408 26.999  1.00 65.04  ? 105 ALA A C   1 
ATOM   491  O O   . ALA A 1 70  ? 14.441  -16.773 25.846  1.00 67.50  ? 105 ALA A O   1 
ATOM   492  C CB  . ALA A 1 70  ? 13.771  -14.274 27.935  1.00 58.78  ? 105 ALA A CB  1 
ATOM   493  N N   . LEU A 1 71  ? 15.861  -16.524 27.576  1.00 63.49  ? 106 LEU A N   1 
ATOM   494  C CA  . LEU A 1 71  ? 16.992  -17.141 26.899  1.00 65.91  ? 106 LEU A CA  1 
ATOM   495  C C   . LEU A 1 71  ? 16.651  -18.536 26.379  1.00 85.32  ? 106 LEU A C   1 
ATOM   496  O O   . LEU A 1 71  ? 16.852  -18.836 25.202  1.00 70.00  ? 106 LEU A O   1 
ATOM   497  C CB  . LEU A 1 71  ? 18.186  -17.225 27.848  1.00 75.48  ? 106 LEU A CB  1 
ATOM   498  C CG  . LEU A 1 71  ? 19.410  -17.963 27.306  1.00 80.04  ? 106 LEU A CG  1 
ATOM   499  C CD1 . LEU A 1 71  ? 20.002  -17.208 26.128  1.00 79.39  ? 106 LEU A CD1 1 
ATOM   500  C CD2 . LEU A 1 71  ? 20.445  -18.150 28.402  1.00 81.98  ? 106 LEU A CD2 1 
ATOM   501  N N   . ILE A 1 72  ? 16.135  -19.386 27.261  1.00 68.04  ? 107 ILE A N   1 
ATOM   502  C CA  . ILE A 1 72  ? 15.857  -20.773 26.903  1.00 80.40  ? 107 ILE A CA  1 
ATOM   503  C C   . ILE A 1 72  ? 14.712  -20.892 25.900  1.00 79.01  ? 107 ILE A C   1 
ATOM   504  O O   . ILE A 1 72  ? 14.715  -21.777 25.043  1.00 73.48  ? 107 ILE A O   1 
ATOM   505  C CB  . ILE A 1 72  ? 15.579  -21.642 28.153  1.00 83.18  ? 107 ILE A CB  1 
ATOM   506  C CG1 . ILE A 1 72  ? 16.894  -22.145 28.756  1.00 89.04  ? 107 ILE A CG1 1 
ATOM   507  C CG2 . ILE A 1 72  ? 14.728  -22.846 27.798  1.00 82.81  ? 107 ILE A CG2 1 
ATOM   508  C CD1 . ILE A 1 72  ? 17.815  -21.048 29.242  1.00 90.55  ? 107 ILE A CD1 1 
ATOM   509  N N   . HIS A 1 73  ? 13.739  -19.991 25.999  1.00 73.28  ? 108 HIS A N   1 
ATOM   510  C CA  . HIS A 1 73  ? 12.582  -20.031 25.114  1.00 69.26  ? 108 HIS A CA  1 
ATOM   511  C C   . HIS A 1 73  ? 12.928  -19.522 23.708  1.00 74.64  ? 108 HIS A C   1 
ATOM   512  O O   . HIS A 1 73  ? 12.241  -19.838 22.735  1.00 72.21  ? 108 HIS A O   1 
ATOM   513  C CB  . HIS A 1 73  ? 11.421  -19.233 25.713  1.00 66.69  ? 108 HIS A CB  1 
ATOM   514  C CG  . HIS A 1 73  ? 10.087  -19.573 25.125  1.00 73.53  ? 108 HIS A CG  1 
ATOM   515  N ND1 . HIS A 1 73  ? 9.338   -18.669 24.400  1.00 72.48  ? 108 HIS A ND1 1 
ATOM   516  C CD2 . HIS A 1 73  ? 9.367   -20.720 25.150  1.00 73.49  ? 108 HIS A CD2 1 
ATOM   517  C CE1 . HIS A 1 73  ? 8.216   -19.244 24.007  1.00 70.90  ? 108 HIS A CE1 1 
ATOM   518  N NE2 . HIS A 1 73  ? 8.208   -20.489 24.449  1.00 71.88  ? 108 HIS A NE2 1 
ATOM   519  N N   . GLY A 1 74  ? 14.003  -18.746 23.609  1.00 73.58  ? 109 GLY A N   1 
ATOM   520  C CA  . GLY A 1 74  ? 14.413  -18.169 22.340  1.00 73.39  ? 109 GLY A CA  1 
ATOM   521  C C   . GLY A 1 74  ? 13.833  -16.781 22.143  1.00 73.68  ? 109 GLY A C   1 
ATOM   522  O O   . GLY A 1 74  ? 13.823  -16.248 21.031  1.00 75.53  ? 109 GLY A O   1 
ATOM   523  N N   . ASP A 1 75  ? 13.353  -16.193 23.235  1.00 70.31  ? 110 ASP A N   1 
ATOM   524  C CA  . ASP A 1 75  ? 12.709  -14.883 23.200  1.00 71.63  ? 110 ASP A CA  1 
ATOM   525  C C   . ASP A 1 75  ? 13.673  -13.744 22.873  1.00 70.47  ? 110 ASP A C   1 
ATOM   526  O O   . ASP A 1 75  ? 13.279  -12.743 22.275  1.00 63.49  ? 110 ASP A O   1 
ATOM   527  C CB  . ASP A 1 75  ? 12.003  -14.603 24.528  1.00 71.47  ? 110 ASP A CB  1 
ATOM   528  C CG  . ASP A 1 75  ? 10.873  -15.572 24.798  1.00 77.39  ? 110 ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 75  ? 10.459  -16.276 23.855  1.00 79.24  ? 110 ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 75  ? 10.395  -15.627 25.949  1.00 80.93  ? 110 ASP A OD2 1 
ATOM   531  N N   . LEU A 1 76  ? 14.932  -13.898 23.267  1.00 68.20  ? 111 LEU A N   1 
ATOM   532  C CA  . LEU A 1 76  ? 15.922  -12.853 23.046  1.00 67.85  ? 111 LEU A CA  1 
ATOM   533  C C   . LEU A 1 76  ? 16.047  -12.514 21.568  1.00 73.14  ? 111 LEU A C   1 
ATOM   534  O O   . LEU A 1 76  ? 16.320  -11.368 21.213  1.00 76.28  ? 111 LEU A O   1 
ATOM   535  C CB  . LEU A 1 76  ? 17.279  -13.246 23.635  1.00 68.23  ? 111 LEU A CB  1 
ATOM   536  C CG  . LEU A 1 76  ? 17.288  -13.445 25.155  1.00 66.75  ? 111 LEU A CG  1 
ATOM   537  C CD1 . LEU A 1 76  ? 18.689  -13.768 25.677  1.00 67.13  ? 111 LEU A CD1 1 
ATOM   538  C CD2 . LEU A 1 76  ? 16.715  -12.222 25.862  1.00 62.05  ? 111 LEU A CD2 1 
ATOM   539  N N   . GLU A 1 77  ? 15.837  -13.506 20.707  1.00 76.51  ? 112 GLU A N   1 
ATOM   540  C CA  . GLU A 1 77  ? 15.914  -13.285 19.262  1.00 80.25  ? 112 GLU A CA  1 
ATOM   541  C C   . GLU A 1 77  ? 14.579  -12.908 18.607  1.00 78.18  ? 112 GLU A C   1 
ATOM   542  O O   . GLU A 1 77  ? 14.550  -12.565 17.420  1.00 78.83  ? 112 GLU A O   1 
ATOM   543  C CB  . GLU A 1 77  ? 16.522  -14.497 18.546  1.00 86.28  ? 112 GLU A CB  1 
ATOM   544  C CG  . GLU A 1 77  ? 18.034  -14.588 18.651  1.00 92.45  ? 112 GLU A CG  1 
ATOM   545  C CD  . GLU A 1 77  ? 18.490  -15.075 20.009  1.00 98.20  ? 112 GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 77  ? 17.938  -16.090 20.489  1.00 100.70 ? 112 GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 77  ? 19.391  -14.440 20.598  1.00 99.21  ? 112 GLU A OE2 1 
ATOM   548  N N   . ASN A 1 78  ? 13.483  -13.004 19.360  1.00 72.96  ? 113 ASN A N   1 
ATOM   549  C CA  . ASN A 1 78  ? 12.165  -12.600 18.862  1.00 71.62  ? 113 ASN A CA  1 
ATOM   550  C C   . ASN A 1 78  ? 11.296  -11.974 19.961  1.00 69.92  ? 113 ASN A C   1 
ATOM   551  O O   . ASN A 1 78  ? 10.238  -12.507 20.302  1.00 66.28  ? 113 ASN A O   1 
ATOM   552  C CB  . ASN A 1 78  ? 11.446  -13.811 18.259  1.00 72.18  ? 113 ASN A CB  1 
ATOM   553  C CG  . ASN A 1 78  ? 10.444  -13.430 17.184  1.00 75.22  ? 113 ASN A CG  1 
ATOM   554  O OD1 . ASN A 1 78  ? 10.051  -12.268 17.065  1.00 74.94  ? 113 ASN A OD1 1 
ATOM   555  N ND2 . ASN A 1 78  ? 10.017  -14.416 16.398  1.00 75.44  ? 113 ASN A ND2 1 
ATOM   556  N N   . PRO A 1 79  ? 11.728  -10.828 20.506  1.00 69.75  ? 114 PRO A N   1 
ATOM   557  C CA  . PRO A 1 79  ? 11.107  -10.288 21.722  1.00 63.71  ? 114 PRO A CA  1 
ATOM   558  C C   . PRO A 1 79  ? 9.646   -9.888  21.538  1.00 63.70  ? 114 PRO A C   1 
ATOM   559  O O   . PRO A 1 79  ? 8.855   -10.010 22.478  1.00 60.87  ? 114 PRO A O   1 
ATOM   560  C CB  . PRO A 1 79  ? 11.965  -9.059  22.040  1.00 64.67  ? 114 PRO A CB  1 
ATOM   561  C CG  . PRO A 1 79  ? 13.234  -9.257  21.271  1.00 69.17  ? 114 PRO A CG  1 
ATOM   562  C CD  . PRO A 1 79  ? 12.847  -9.995  20.041  1.00 70.68  ? 114 PRO A CD  1 
ATOM   563  N N   . GLY A 1 80  ? 9.290   -9.416  20.348  1.00 63.26  ? 115 GLY A N   1 
ATOM   564  C CA  . GLY A 1 80  ? 7.924   -8.992  20.094  1.00 62.34  ? 115 GLY A CA  1 
ATOM   565  C C   . GLY A 1 80  ? 7.039   -10.120 19.594  1.00 67.58  ? 115 GLY A C   1 
ATOM   566  O O   . GLY A 1 80  ? 5.818   -9.984  19.533  1.00 71.64  ? 115 GLY A O   1 
ATOM   567  N N   . GLY A 1 81  ? 7.656   -11.240 19.232  1.00 67.23  ? 116 GLY A N   1 
ATOM   568  C CA  . GLY A 1 81  ? 6.921   -12.371 18.700  1.00 67.39  ? 116 GLY A CA  1 
ATOM   569  C C   . GLY A 1 81  ? 6.363   -12.096 17.316  1.00 75.81  ? 116 GLY A C   1 
ATOM   570  O O   . GLY A 1 81  ? 6.541   -11.012 16.754  1.00 76.40  ? 116 GLY A O   1 
ATOM   571  N N   . ASP A 1 82  ? 5.689   -13.095 16.762  1.00 76.20  ? 117 ASP A N   1 
ATOM   572  C CA  . ASP A 1 82  ? 5.050   -12.971 15.461  1.00 80.36  ? 117 ASP A CA  1 
ATOM   573  C C   . ASP A 1 82  ? 3.909   -13.978 15.362  1.00 83.96  ? 117 ASP A C   1 
ATOM   574  O O   . ASP A 1 82  ? 3.481   -14.536 16.374  1.00 86.20  ? 117 ASP A O   1 
ATOM   575  C CB  . ASP A 1 82  ? 6.059   -13.133 14.315  1.00 84.10  ? 117 ASP A CB  1 
ATOM   576  C CG  . ASP A 1 82  ? 6.748   -14.489 14.316  1.00 88.96  ? 117 ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 82  ? 6.093   -15.502 14.643  1.00 90.38  ? 117 ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 82  ? 7.950   -14.542 13.974  1.00 91.52  ? 117 ASP A OD2 1 
ATOM   579  N N   . ASP A 1 83  ? 3.402   -14.176 14.150  1.00 84.61  ? 118 ASP A N   1 
ATOM   580  C CA  . ASP A 1 83  ? 2.290   -15.090 13.910  1.00 93.23  ? 118 ASP A CA  1 
ATOM   581  C C   . ASP A 1 83  ? 2.563   -16.522 14.379  1.00 95.30  ? 118 ASP A C   1 
ATOM   582  O O   . ASP A 1 83  ? 1.677   -17.181 14.930  1.00 95.02  ? 118 ASP A O   1 
ATOM   583  C CB  . ASP A 1 83  ? 1.913   -15.095 12.424  1.00 103.59 ? 118 ASP A CB  1 
ATOM   584  C CG  . ASP A 1 83  ? 1.452   -13.729 11.929  1.00 108.90 ? 118 ASP A CG  1 
ATOM   585  O OD1 . ASP A 1 83  ? 1.127   -12.866 12.776  1.00 107.46 ? 118 ASP A OD1 1 
ATOM   586  O OD2 . ASP A 1 83  ? 1.401   -13.522 10.693  1.00 112.14 ? 118 ASP A OD2 1 
ATOM   587  N N   . THR A 1 84  ? 3.777   -17.010 14.140  1.00 96.05  ? 119 THR A N   1 
ATOM   588  C CA  . THR A 1 84  ? 4.129   -18.383 14.494  1.00 95.78  ? 119 THR A CA  1 
ATOM   589  C C   . THR A 1 84  ? 4.795   -18.531 15.863  1.00 93.04  ? 119 THR A C   1 
ATOM   590  O O   . THR A 1 84  ? 4.987   -19.654 16.336  1.00 93.93  ? 119 THR A O   1 
ATOM   591  C CB  . THR A 1 84  ? 5.061   -19.025 13.436  1.00 98.63  ? 119 THR A CB  1 
ATOM   592  O OG1 . THR A 1 84  ? 6.312   -18.322 13.408  1.00 97.41  ? 119 THR A OG1 1 
ATOM   593  C CG2 . THR A 1 84  ? 4.418   -18.993 12.056  1.00 94.95  ? 119 THR A CG2 1 
ATOM   594  N N   . PHE A 1 85  ? 5.150   -17.416 16.497  1.00 79.95  ? 120 PHE A N   1 
ATOM   595  C CA  . PHE A 1 85  ? 5.920   -17.483 17.733  1.00 77.74  ? 120 PHE A CA  1 
ATOM   596  C C   . PHE A 1 85  ? 5.485   -16.470 18.789  1.00 73.72  ? 120 PHE A C   1 
ATOM   597  O O   . PHE A 1 85  ? 5.432   -15.267 18.524  1.00 76.61  ? 120 PHE A O   1 
ATOM   598  C CB  . PHE A 1 85  ? 7.409   -17.305 17.434  1.00 77.27  ? 120 PHE A CB  1 
ATOM   599  C CG  . PHE A 1 85  ? 8.273   -17.345 18.655  1.00 74.69  ? 120 PHE A CG  1 
ATOM   600  C CD1 . PHE A 1 85  ? 8.740   -18.552 19.147  1.00 75.83  ? 120 PHE A CD1 1 
ATOM   601  C CD2 . PHE A 1 85  ? 8.607   -16.174 19.328  1.00 71.51  ? 120 PHE A CD2 1 
ATOM   602  C CE1 . PHE A 1 85  ? 9.532   -18.588 20.284  1.00 76.96  ? 120 PHE A CE1 1 
ATOM   603  C CE2 . PHE A 1 85  ? 9.396   -16.206 20.451  1.00 69.52  ? 120 PHE A CE2 1 
ATOM   604  C CZ  . PHE A 1 85  ? 9.858   -17.412 20.934  1.00 70.57  ? 120 PHE A CZ  1 
ATOM   605  N N   . LYS A 1 86  ? 5.201   -16.964 19.992  1.00 71.47  ? 121 LYS A N   1 
ATOM   606  C CA  . LYS A 1 86  ? 4.845   -16.113 21.126  1.00 67.96  ? 121 LYS A CA  1 
ATOM   607  C C   . LYS A 1 86  ? 5.840   -16.224 22.286  1.00 74.21  ? 121 LYS A C   1 
ATOM   608  O O   . LYS A 1 86  ? 6.006   -17.296 22.865  1.00 66.67  ? 121 LYS A O   1 
ATOM   609  C CB  . LYS A 1 86  ? 3.422   -16.412 21.610  1.00 71.85  ? 121 LYS A CB  1 
ATOM   610  C CG  . LYS A 1 86  ? 3.031   -15.664 22.884  1.00 73.59  ? 121 LYS A CG  1 
ATOM   611  C CD  . LYS A 1 86  ? 1.623   -15.081 22.796  1.00 77.47  ? 121 LYS A CD  1 
ATOM   612  C CE  . LYS A 1 86  ? 0.581   -16.154 22.534  1.00 83.59  ? 121 LYS A CE  1 
ATOM   613  N NZ  . LYS A 1 86  ? -0.740  -15.574 22.160  1.00 85.39  ? 121 LYS A NZ  1 
ATOM   614  N N   . PRO A 1 87  ? 6.506   -15.111 22.627  1.00 72.38  ? 122 PRO A N   1 
ATOM   615  C CA  . PRO A 1 87  ? 7.446   -15.059 23.759  1.00 69.38  ? 122 PRO A CA  1 
ATOM   616  C C   . PRO A 1 87  ? 6.747   -15.292 25.101  1.00 65.36  ? 122 PRO A C   1 
ATOM   617  O O   . PRO A 1 87  ? 5.537   -15.089 25.202  1.00 63.84  ? 122 PRO A O   1 
ATOM   618  C CB  . PRO A 1 87  ? 7.986   -13.622 23.710  1.00 66.14  ? 122 PRO A CB  1 
ATOM   619  C CG  . PRO A 1 87  ? 7.633   -13.102 22.351  1.00 70.99  ? 122 PRO A CG  1 
ATOM   620  C CD  . PRO A 1 87  ? 6.385   -13.817 21.937  1.00 71.89  ? 122 PRO A CD  1 
ATOM   621  N N   . CYS A 1 88  ? 7.502   -15.712 26.112  1.00 60.98  ? 123 CYS A N   1 
ATOM   622  C CA  . CYS A 1 88  ? 6.975   -15.849 27.469  1.00 63.25  ? 123 CYS A CA  1 
ATOM   623  C C   . CYS A 1 88  ? 6.616   -14.480 28.055  1.00 60.19  ? 123 CYS A C   1 
ATOM   624  O O   . CYS A 1 88  ? 5.546   -14.297 28.632  1.00 57.61  ? 123 CYS A O   1 
ATOM   625  C CB  . CYS A 1 88  ? 7.995   -16.552 28.370  1.00 64.62  ? 123 CYS A CB  1 
ATOM   626  S SG  . CYS A 1 88  ? 8.531   -18.177 27.770  1.00 79.17  ? 123 CYS A SG  1 
ATOM   627  N N   . VAL A 1 89  ? 7.525   -13.523 27.900  1.00 58.14  ? 124 VAL A N   1 
ATOM   628  C CA  . VAL A 1 89  ? 7.269   -12.142 28.275  1.00 56.59  ? 124 VAL A CA  1 
ATOM   629  C C   . VAL A 1 89  ? 7.656   -11.254 27.102  1.00 54.76  ? 124 VAL A C   1 
ATOM   630  O O   . VAL A 1 89  ? 8.793   -11.291 26.640  1.00 57.59  ? 124 VAL A O   1 
ATOM   631  C CB  . VAL A 1 89  ? 8.084   -11.725 29.522  1.00 59.09  ? 124 VAL A CB  1 
ATOM   632  C CG1 . VAL A 1 89  ? 7.713   -10.302 29.965  1.00 49.67  ? 124 VAL A CG1 1 
ATOM   633  C CG2 . VAL A 1 89  ? 7.855   -12.710 30.650  1.00 51.70  ? 124 VAL A CG2 1 
ATOM   634  N N   . LEU A 1 90  ? 6.709   -10.459 26.620  1.00 53.47  ? 125 LEU A N   1 
ATOM   635  C CA  . LEU A 1 90  ? 6.964   -9.593  25.481  1.00 53.17  ? 125 LEU A CA  1 
ATOM   636  C C   . LEU A 1 90  ? 8.077   -8.600  25.783  1.00 56.65  ? 125 LEU A C   1 
ATOM   637  O O   . LEU A 1 90  ? 8.159   -8.050  26.887  1.00 56.27  ? 125 LEU A O   1 
ATOM   638  C CB  . LEU A 1 90  ? 5.694   -8.839  25.075  1.00 55.91  ? 125 LEU A CB  1 
ATOM   639  C CG  . LEU A 1 90  ? 4.550   -9.636  24.437  1.00 59.69  ? 125 LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 90  ? 3.255   -8.835  24.464  1.00 59.64  ? 125 LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 90  ? 4.883   -10.069 23.012  1.00 56.83  ? 125 LEU A CD2 1 
ATOM   642  N N   . GLN A 1 91  ? 8.923   -8.374  24.782  1.00 56.76  ? 126 GLN A N   1 
ATOM   643  C CA  . GLN A 1 91  ? 9.934   -7.322  24.821  1.00 55.57  ? 126 GLN A CA  1 
ATOM   644  C C   . GLN A 1 91  ? 11.047  -7.510  25.851  1.00 57.56  ? 126 GLN A C   1 
ATOM   645  O O   . GLN A 1 91  ? 11.659  -6.534  26.275  1.00 59.92  ? 126 GLN A O   1 
ATOM   646  C CB  . GLN A 1 91  ? 9.279   -5.946  25.032  1.00 51.70  ? 126 GLN A CB  1 
ATOM   647  C CG  . GLN A 1 91  ? 8.219   -5.581  24.004  1.00 52.32  ? 126 GLN A CG  1 
ATOM   648  C CD  . GLN A 1 91  ? 8.739   -5.594  22.572  1.00 55.37  ? 126 GLN A CD  1 
ATOM   649  O OE1 . GLN A 1 91  ? 7.961   -5.690  21.624  1.00 58.67  ? 126 GLN A OE1 1 
ATOM   650  N NE2 . GLN A 1 91  ? 10.054  -5.487  22.409  1.00 58.82  ? 126 GLN A NE2 1 
ATOM   651  N N   . VAL A 1 92  ? 11.344  -8.743  26.244  1.00 59.03  ? 127 VAL A N   1 
ATOM   652  C CA  . VAL A 1 92  ? 12.568  -8.940  27.005  1.00 60.59  ? 127 VAL A CA  1 
ATOM   653  C C   . VAL A 1 92  ? 13.654  -9.285  25.993  1.00 63.25  ? 127 VAL A C   1 
ATOM   654  O O   . VAL A 1 92  ? 13.739  -10.412 25.500  1.00 65.07  ? 127 VAL A O   1 
ATOM   655  C CB  . VAL A 1 92  ? 12.414  -10.073 28.042  1.00 61.33  ? 127 VAL A CB  1 
ATOM   656  C CG1 . VAL A 1 92  ? 13.706  -10.267 28.830  1.00 60.27  ? 127 VAL A CG1 1 
ATOM   657  C CG2 . VAL A 1 92  ? 11.259  -9.771  28.986  1.00 62.87  ? 127 VAL A CG2 1 
ATOM   658  N N   . ASN A 1 93  ? 14.492  -8.295  25.700  1.00 65.00  ? 128 ASN A N   1 
ATOM   659  C CA  . ASN A 1 93  ? 15.546  -8.434  24.695  1.00 64.86  ? 128 ASN A CA  1 
ATOM   660  C C   . ASN A 1 93  ? 16.941  -8.657  25.265  1.00 65.59  ? 128 ASN A C   1 
ATOM   661  O O   . ASN A 1 93  ? 17.913  -8.735  24.519  1.00 70.39  ? 128 ASN A O   1 
ATOM   662  C CB  . ASN A 1 93  ? 15.530  -7.256  23.716  1.00 64.51  ? 128 ASN A CB  1 
ATOM   663  C CG  . ASN A 1 93  ? 15.776  -5.931  24.397  1.00 70.03  ? 128 ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 93  ? 15.722  -5.832  25.619  1.00 73.78  ? 128 ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 93  ? 16.042  -4.898  23.606  1.00 73.58  ? 128 ASN A ND2 1 
ATOM   666  N N   . GLY A 1 94  ? 17.034  -8.732  26.589  1.00 66.28  ? 129 GLY A N   1 
ATOM   667  C CA  . GLY A 1 94  ? 18.310  -8.850  27.273  1.00 66.06  ? 129 GLY A CA  1 
ATOM   668  C C   . GLY A 1 94  ? 18.140  -8.643  28.767  1.00 68.36  ? 129 GLY A C   1 
ATOM   669  O O   . GLY A 1 94  ? 17.015  -8.489  29.256  1.00 67.40  ? 129 GLY A O   1 
ATOM   670  N N   . PHE A 1 95  ? 19.244  -8.626  29.503  1.00 70.76  ? 130 PHE A N   1 
ATOM   671  C CA  . PHE A 1 95  ? 19.139  -8.560  30.955  1.00 75.77  ? 130 PHE A CA  1 
ATOM   672  C C   . PHE A 1 95  ? 18.543  -7.252  31.476  1.00 67.79  ? 130 PHE A C   1 
ATOM   673  O O   . PHE A 1 95  ? 17.800  -7.260  32.456  1.00 67.57  ? 130 PHE A O   1 
ATOM   674  C CB  . PHE A 1 95  ? 20.469  -8.851  31.660  1.00 85.28  ? 130 PHE A CB  1 
ATOM   675  C CG  . PHE A 1 95  ? 20.344  -8.870  33.158  1.00 95.69  ? 130 PHE A CG  1 
ATOM   676  C CD1 . PHE A 1 95  ? 19.857  -9.994  33.811  1.00 99.17  ? 130 PHE A CD1 1 
ATOM   677  C CD2 . PHE A 1 95  ? 20.664  -7.750  33.913  1.00 99.11  ? 130 PHE A CD2 1 
ATOM   678  C CE1 . PHE A 1 95  ? 19.716  -10.010 35.188  1.00 99.56  ? 130 PHE A CE1 1 
ATOM   679  C CE2 . PHE A 1 95  ? 20.526  -7.761  35.290  1.00 99.06  ? 130 PHE A CE2 1 
ATOM   680  C CZ  . PHE A 1 95  ? 20.053  -8.893  35.927  1.00 99.04  ? 130 PHE A CZ  1 
ATOM   681  N N   . VAL A 1 96  ? 18.874  -6.135  30.837  1.00 61.03  ? 131 VAL A N   1 
ATOM   682  C CA  . VAL A 1 96  ? 18.326  -4.850  31.264  1.00 58.11  ? 131 VAL A CA  1 
ATOM   683  C C   . VAL A 1 96  ? 16.809  -4.846  31.139  1.00 57.56  ? 131 VAL A C   1 
ATOM   684  O O   . VAL A 1 96  ? 16.112  -4.386  32.042  1.00 57.57  ? 131 VAL A O   1 
ATOM   685  C CB  . VAL A 1 96  ? 18.918  -3.648  30.488  1.00 56.84  ? 131 VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 96  ? 18.238  -2.367  30.916  1.00 54.83  ? 131 VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 96  ? 20.414  -3.541  30.725  1.00 60.54  ? 131 VAL A CG2 1 
ATOM   688  N N   . ALA A 1 97  ? 16.303  -5.366  30.023  1.00 59.01  ? 132 ALA A N   1 
ATOM   689  C CA  . ALA A 1 97  ? 14.858  -5.458  29.808  1.00 56.08  ? 132 ALA A CA  1 
ATOM   690  C C   . ALA A 1 97  ? 14.198  -6.374  30.840  1.00 57.25  ? 132 ALA A C   1 
ATOM   691  O O   . ALA A 1 97  ? 13.156  -6.036  31.404  1.00 56.02  ? 132 ALA A O   1 
ATOM   692  C CB  . ALA A 1 97  ? 14.549  -5.939  28.402  1.00 53.19  ? 132 ALA A CB  1 
ATOM   693  N N   . ALA A 1 98  ? 14.809  -7.532  31.083  1.00 55.86  ? 133 ALA A N   1 
ATOM   694  C CA  . ALA A 1 98  ? 14.301  -8.466  32.084  1.00 56.30  ? 133 ALA A CA  1 
ATOM   695  C C   . ALA A 1 98  ? 14.268  -7.798  33.447  1.00 56.10  ? 133 ALA A C   1 
ATOM   696  O O   . ALA A 1 98  ? 13.324  -7.974  34.217  1.00 56.23  ? 133 ALA A O   1 
ATOM   697  C CB  . ALA A 1 98  ? 15.161  -9.724  32.134  1.00 56.28  ? 133 ALA A CB  1 
ATOM   698  N N   . PHE A 1 99  ? 15.315  -7.034  33.740  1.00 56.77  ? 134 PHE A N   1 
ATOM   699  C CA  . PHE A 1 99  ? 15.419  -6.324  35.004  1.00 55.61  ? 134 PHE A CA  1 
ATOM   700  C C   . PHE A 1 99  ? 14.273  -5.330  35.128  1.00 50.69  ? 134 PHE A C   1 
ATOM   701  O O   . PHE A 1 99  ? 13.627  -5.241  36.163  1.00 52.15  ? 134 PHE A O   1 
ATOM   702  C CB  . PHE A 1 99  ? 16.773  -5.612  35.095  1.00 59.32  ? 134 PHE A CB  1 
ATOM   703  C CG  . PHE A 1 99  ? 17.005  -4.892  36.397  1.00 64.34  ? 134 PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 99  ? 16.904  -5.560  37.607  1.00 65.61  ? 134 PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 99  ? 17.355  -3.552  36.407  1.00 67.17  ? 134 PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 99  ? 17.129  -4.899  38.801  1.00 65.29  ? 134 PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 99  ? 17.587  -2.887  37.601  1.00 68.68  ? 134 PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 99  ? 17.473  -3.563  38.797  1.00 66.62  ? 134 PHE A CZ  1 
ATOM   709  N N   . LEU A 1 100 ? 14.019  -4.588  34.057  1.00 51.09  ? 135 LEU A N   1 
ATOM   710  C CA  . LEU A 1 100 ? 12.926  -3.626  34.047  1.00 53.58  ? 135 LEU A CA  1 
ATOM   711  C C   . LEU A 1 100 ? 11.589  -4.324  34.269  1.00 54.00  ? 135 LEU A C   1 
ATOM   712  O O   . LEU A 1 100 ? 10.769  -3.866  35.066  1.00 53.98  ? 135 LEU A O   1 
ATOM   713  C CB  . LEU A 1 100 ? 12.901  -2.842  32.736  1.00 57.69  ? 135 LEU A CB  1 
ATOM   714  C CG  . LEU A 1 100 ? 14.038  -1.843  32.521  1.00 61.84  ? 135 LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 100 ? 13.967  -1.229  31.130  1.00 60.87  ? 135 LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 100 ? 13.996  -0.760  33.601  1.00 64.38  ? 135 LEU A CD2 1 
ATOM   717  N N   . PHE A 1 101 ? 11.372  -5.437  33.571  1.00 51.95  ? 136 PHE A N   1 
ATOM   718  C CA  . PHE A 1 101 ? 10.114  -6.161  33.708  1.00 53.10  ? 136 PHE A CA  1 
ATOM   719  C C   . PHE A 1 101 ? 9.908   -6.638  35.142  1.00 52.80  ? 136 PHE A C   1 
ATOM   720  O O   . PHE A 1 101 ? 8.787   -6.664  35.644  1.00 50.25  ? 136 PHE A O   1 
ATOM   721  C CB  . PHE A 1 101 ? 10.021  -7.349  32.743  1.00 52.44  ? 136 PHE A CB  1 
ATOM   722  C CG  . PHE A 1 101 ? 8.778   -8.170  32.939  1.00 53.93  ? 136 PHE A CG  1 
ATOM   723  C CD1 . PHE A 1 101 ? 7.544   -7.692  32.506  1.00 46.06  ? 136 PHE A CD1 1 
ATOM   724  C CD2 . PHE A 1 101 ? 8.835   -9.400  33.587  1.00 50.86  ? 136 PHE A CD2 1 
ATOM   725  C CE1 . PHE A 1 101 ? 6.388   -8.430  32.705  1.00 49.89  ? 136 PHE A CE1 1 
ATOM   726  C CE2 . PHE A 1 101 ? 7.686   -10.148 33.790  1.00 50.20  ? 136 PHE A CE2 1 
ATOM   727  C CZ  . PHE A 1 101 ? 6.457   -9.664  33.350  1.00 51.20  ? 136 PHE A CZ  1 
ATOM   728  N N   . SER A 1 102 ? 11.002  -7.020  35.790  1.00 50.86  ? 137 SER A N   1 
ATOM   729  C CA  . SER A 1 102 ? 10.960  -7.440  37.181  1.00 53.44  ? 137 SER A CA  1 
ATOM   730  C C   . SER A 1 102 ? 10.484  -6.293  38.068  1.00 53.17  ? 137 SER A C   1 
ATOM   731  O O   . SER A 1 102 ? 9.508   -6.430  38.805  1.00 53.44  ? 137 SER A O   1 
ATOM   732  C CB  . SER A 1 102 ? 12.340  -7.912  37.638  1.00 53.82  ? 137 SER A CB  1 
ATOM   733  O OG  . SER A 1 102 ? 12.285  -8.388  38.967  1.00 56.13  ? 137 SER A OG  1 
ATOM   734  N N   . ILE A 1 103 ? 11.186  -5.168  37.986  1.00 47.96  ? 138 ILE A N   1 
ATOM   735  C CA  . ILE A 1 103 ? 10.818  -3.965  38.717  1.00 51.98  ? 138 ILE A CA  1 
ATOM   736  C C   . ILE A 1 103 ? 9.366   -3.588  38.457  1.00 49.66  ? 138 ILE A C   1 
ATOM   737  O O   . ILE A 1 103 ? 8.582   -3.389  39.387  1.00 49.01  ? 138 ILE A O   1 
ATOM   738  C CB  . ILE A 1 103 ? 11.703  -2.772  38.298  1.00 57.85  ? 138 ILE A CB  1 
ATOM   739  C CG1 . ILE A 1 103 ? 13.178  -3.073  38.575  1.00 57.64  ? 138 ILE A CG1 1 
ATOM   740  C CG2 . ILE A 1 103 ? 11.259  -1.498  39.014  1.00 59.60  ? 138 ILE A CG2 1 
ATOM   741  C CD1 . ILE A 1 103 ? 14.142  -2.040  38.013  1.00 57.61  ? 138 ILE A CD1 1 
ATOM   742  N N   . GLU A 1 104 ? 9.018   -3.484  37.180  1.00 51.31  ? 139 GLU A N   1 
ATOM   743  C CA  . GLU A 1 104 ? 7.692   -3.039  36.781  1.00 48.97  ? 139 GLU A CA  1 
ATOM   744  C C   . GLU A 1 104 ? 6.615   -3.966  37.332  1.00 49.56  ? 139 GLU A C   1 
ATOM   745  O O   . GLU A 1 104 ? 5.485   -3.539  37.589  1.00 48.66  ? 139 GLU A O   1 
ATOM   746  C CB  . GLU A 1 104 ? 7.607   -2.917  35.255  1.00 43.20  ? 139 GLU A CB  1 
ATOM   747  C CG  . GLU A 1 104 ? 8.449   -1.761  34.710  1.00 52.37  ? 139 GLU A CG  1 
ATOM   748  C CD  . GLU A 1 104 ? 8.885   -1.949  33.262  1.00 54.16  ? 139 GLU A CD  1 
ATOM   749  O OE1 . GLU A 1 104 ? 8.281   -2.776  32.548  1.00 52.10  ? 139 GLU A OE1 1 
ATOM   750  O OE2 . GLU A 1 104 ? 9.851   -1.273  32.844  1.00 57.93  ? 139 GLU A OE2 1 
ATOM   751  N N   . THR A 1 105 ? 6.970   -5.232  37.515  1.00 48.91  ? 140 THR A N   1 
ATOM   752  C CA  . THR A 1 105 ? 6.026   -6.212  38.034  1.00 52.03  ? 140 THR A CA  1 
ATOM   753  C C   . THR A 1 105 ? 5.872   -6.103  39.548  1.00 54.60  ? 140 THR A C   1 
ATOM   754  O O   . THR A 1 105 ? 4.753   -6.051  40.063  1.00 57.24  ? 140 THR A O   1 
ATOM   755  C CB  . THR A 1 105 ? 6.444   -7.648  37.653  1.00 53.66  ? 140 THR A CB  1 
ATOM   756  O OG1 . THR A 1 105 ? 6.417   -7.789  36.227  1.00 55.01  ? 140 THR A OG1 1 
ATOM   757  C CG2 . THR A 1 105 ? 5.505   -8.666  38.281  1.00 51.69  ? 140 THR A CG2 1 
ATOM   758  N N   . GLN A 1 106 ? 6.999   -6.043  40.255  1.00 54.65  ? 141 GLN A N   1 
ATOM   759  C CA  . GLN A 1 106 ? 6.985   -6.065  41.716  1.00 52.80  ? 141 GLN A CA  1 
ATOM   760  C C   . GLN A 1 106 ? 6.472   -4.760  42.305  1.00 51.36  ? 141 GLN A C   1 
ATOM   761  O O   . GLN A 1 106 ? 5.730   -4.770  43.280  1.00 54.27  ? 141 GLN A O   1 
ATOM   762  C CB  . GLN A 1 106 ? 8.366   -6.404  42.289  1.00 53.03  ? 141 GLN A CB  1 
ATOM   763  C CG  . GLN A 1 106 ? 8.290   -6.988  43.697  1.00 55.63  ? 141 GLN A CG  1 
ATOM   764  C CD  . GLN A 1 106 ? 9.642   -7.378  44.260  1.00 58.07  ? 141 GLN A CD  1 
ATOM   765  O OE1 . GLN A 1 106 ? 10.314  -8.273  43.741  1.00 55.98  ? 141 GLN A OE1 1 
ATOM   766  N NE2 . GLN A 1 106 ? 10.051  -6.703  45.331  1.00 60.94  ? 141 GLN A NE2 1 
ATOM   767  N N   . THR A 1 107 ? 6.876   -3.641  41.713  1.00 50.02  ? 142 THR A N   1 
ATOM   768  C CA  . THR A 1 107 ? 6.383   -2.330  42.130  1.00 44.78  ? 142 THR A CA  1 
ATOM   769  C C   . THR A 1 107 ? 4.904   -2.173  41.781  1.00 48.40  ? 142 THR A C   1 
ATOM   770  O O   . THR A 1 107 ? 4.197   -1.360  42.379  1.00 48.66  ? 142 THR A O   1 
ATOM   771  C CB  . THR A 1 107 ? 7.140   -1.209  41.412  1.00 46.99  ? 142 THR A CB  1 
ATOM   772  O OG1 . THR A 1 107 ? 7.010   -1.389  39.994  1.00 49.55  ? 142 THR A OG1 1 
ATOM   773  C CG2 . THR A 1 107 ? 8.628   -1.215  41.797  1.00 46.17  ? 142 THR A CG2 1 
ATOM   774  N N   . THR A 1 108 ? 4.455   -2.972  40.812  1.00 44.57  ? 143 THR A N   1 
ATOM   775  C CA  . THR A 1 108 ? 3.145   -2.850  40.160  1.00 42.77  ? 143 THR A CA  1 
ATOM   776  C C   . THR A 1 108 ? 2.973   -1.582  39.324  1.00 43.32  ? 143 THR A C   1 
ATOM   777  O O   . THR A 1 108 ? 1.847   -1.210  38.992  1.00 42.11  ? 143 THR A O   1 
ATOM   778  C CB  . THR A 1 108 ? 1.940   -2.942  41.169  1.00 49.22  ? 143 THR A CB  1 
ATOM   779  O OG1 . THR A 1 108 ? 1.722   -1.669  41.800  1.00 45.05  ? 143 THR A OG1 1 
ATOM   780  C CG2 . THR A 1 108 ? 2.181   -4.008  42.220  1.00 43.12  ? 143 THR A CG2 1 
ATOM   781  N N   . ILE A 1 109 ? 4.079   -0.959  38.926  1.00 44.22  ? 144 ILE A N   1 
ATOM   782  C CA  . ILE A 1 109 ? 4.008   0.113   37.935  1.00 46.28  ? 144 ILE A CA  1 
ATOM   783  C C   . ILE A 1 109 ? 3.340   -0.422  36.666  1.00 47.46  ? 144 ILE A C   1 
ATOM   784  O O   . ILE A 1 109 ? 2.361   0.143   36.181  1.00 49.26  ? 144 ILE A O   1 
ATOM   785  C CB  . ILE A 1 109 ? 5.399   0.653   37.550  1.00 46.33  ? 144 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 109 ? 6.117   1.246   38.760  1.00 42.47  ? 144 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 109 ? 5.286   1.695   36.431  1.00 41.37  ? 144 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 109 ? 7.568   1.659   38.465  1.00 43.44  ? 144 ILE A CD1 1 
ATOM   789  N N   . GLY A 1 110 ? 3.889   -1.511  36.130  1.00 46.86  ? 145 GLY A N   1 
ATOM   790  C CA  . GLY A 1 110 ? 3.340   -2.166  34.951  1.00 44.98  ? 145 GLY A CA  1 
ATOM   791  C C   . GLY A 1 110 ? 3.105   -1.295  33.726  1.00 45.17  ? 145 GLY A C   1 
ATOM   792  O O   . GLY A 1 110 ? 1.993   -1.280  33.189  1.00 45.69  ? 145 GLY A O   1 
ATOM   793  N N   . TYR A 1 111 ? 4.135   -0.583  33.268  1.00 43.09  ? 146 TYR A N   1 
ATOM   794  C CA  . TYR A 1 111 ? 4.011   0.224   32.054  1.00 44.91  ? 146 TYR A CA  1 
ATOM   795  C C   . TYR A 1 111 ? 3.341   -0.588  30.945  1.00 48.23  ? 146 TYR A C   1 
ATOM   796  O O   . TYR A 1 111 ? 2.454   -0.091  30.255  1.00 47.31  ? 146 TYR A O   1 
ATOM   797  C CB  . TYR A 1 111 ? 5.381   0.694   31.550  1.00 43.27  ? 146 TYR A CB  1 
ATOM   798  C CG  . TYR A 1 111 ? 6.155   1.565   32.509  1.00 46.88  ? 146 TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 111 ? 5.665   2.804   32.915  1.00 44.34  ? 146 TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 111 ? 7.399   1.162   32.985  1.00 49.18  ? 146 TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 111 ? 6.391   3.610   33.788  1.00 45.39  ? 146 TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 111 ? 8.127   1.952   33.853  1.00 48.04  ? 146 TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 111 ? 7.620   3.174   34.254  1.00 47.50  ? 146 TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 111 ? 8.353   3.953   35.118  1.00 49.52  ? 146 TYR A OH  1 
ATOM   805  N N   . GLY A 1 112 ? 3.793   -1.828  30.762  1.00 46.11  ? 147 GLY A N   1 
ATOM   806  C CA  . GLY A 1 112 ? 3.157   -2.745  29.840  1.00 43.83  ? 147 GLY A CA  1 
ATOM   807  C C   . GLY A 1 112 ? 3.856   -2.987  28.512  1.00 50.83  ? 147 GLY A C   1 
ATOM   808  O O   . GLY A 1 112 ? 3.395   -3.819  27.736  1.00 51.94  ? 147 GLY A O   1 
ATOM   809  N N   . PHE A 1 113 ? 4.944   -2.275  28.221  1.00 44.92  ? 148 PHE A N   1 
ATOM   810  C CA  . PHE A 1 113 ? 5.674   -2.565  26.992  1.00 46.41  ? 148 PHE A CA  1 
ATOM   811  C C   . PHE A 1 113 ? 6.265   -3.969  27.099  1.00 47.11  ? 148 PHE A C   1 
ATOM   812  O O   . PHE A 1 113 ? 6.112   -4.795  26.194  1.00 48.46  ? 148 PHE A O   1 
ATOM   813  C CB  . PHE A 1 113 ? 6.762   -1.530  26.709  1.00 56.73  ? 148 PHE A CB  1 
ATOM   814  C CG  . PHE A 1 113 ? 7.478   -1.750  25.404  1.00 56.82  ? 148 PHE A CG  1 
ATOM   815  C CD1 . PHE A 1 113 ? 6.815   -1.579  24.194  1.00 57.16  ? 148 PHE A CD1 1 
ATOM   816  C CD2 . PHE A 1 113 ? 8.814   -2.133  25.383  1.00 54.65  ? 148 PHE A CD2 1 
ATOM   817  C CE1 . PHE A 1 113 ? 7.477   -1.786  22.981  1.00 58.09  ? 148 PHE A CE1 1 
ATOM   818  C CE2 . PHE A 1 113 ? 9.480   -2.340  24.179  1.00 52.61  ? 148 PHE A CE2 1 
ATOM   819  C CZ  . PHE A 1 113 ? 8.812   -2.162  22.976  1.00 55.30  ? 148 PHE A CZ  1 
ATOM   820  N N   . ARG A 1 114 ? 6.930   -4.225  28.220  1.00 46.44  ? 149 ARG A N   1 
ATOM   821  C CA  . ARG A 1 114 ? 7.292   -5.577  28.614  1.00 55.76  ? 149 ARG A CA  1 
ATOM   822  C C   . ARG A 1 114 ? 6.086   -6.147  29.364  1.00 56.66  ? 149 ARG A C   1 
ATOM   823  O O   . ARG A 1 114 ? 5.655   -5.594  30.380  1.00 53.63  ? 149 ARG A O   1 
ATOM   824  C CB  . ARG A 1 114 ? 8.532   -5.555  29.508  1.00 50.40  ? 149 ARG A CB  1 
ATOM   825  C CG  . ARG A 1 114 ? 9.777   -5.030  28.816  1.00 50.38  ? 149 ARG A CG  1 
ATOM   826  C CD  . ARG A 1 114 ? 10.752  -4.446  29.813  1.00 49.84  ? 149 ARG A CD  1 
ATOM   827  N NE  . ARG A 1 114 ? 10.305  -3.145  30.293  1.00 51.65  ? 149 ARG A NE  1 
ATOM   828  C CZ  . ARG A 1 114 ? 10.568  -1.996  29.678  1.00 52.60  ? 149 ARG A CZ  1 
ATOM   829  N NH1 . ARG A 1 114 ? 11.280  -1.995  28.559  1.00 52.66  ? 149 ARG A NH1 1 
ATOM   830  N NH2 . ARG A 1 114 ? 10.121  -0.849  30.179  1.00 50.18  ? 149 ARG A NH2 1 
ATOM   831  N N   . CYS A 1 115 ? 5.515   -7.222  28.833  1.00 56.02  ? 150 CYS A N   1 
ATOM   832  C CA  . CYS A 1 115 ? 4.255   -7.760  29.343  1.00 55.01  ? 150 CYS A CA  1 
ATOM   833  C C   . CYS A 1 115 ? 4.241   -9.281  29.258  1.00 53.72  ? 150 CYS A C   1 
ATOM   834  O O   . CYS A 1 115 ? 4.573   -9.847  28.217  1.00 55.76  ? 150 CYS A O   1 
ATOM   835  C CB  . CYS A 1 115 ? 3.089   -7.183  28.533  1.00 47.15  ? 150 CYS A CB  1 
ATOM   836  S SG  . CYS A 1 115 ? 1.470   -7.829  28.960  1.00 58.93  ? 150 CYS A SG  1 
ATOM   837  N N   . VAL A 1 116 ? 3.850   -9.944  30.342  1.00 54.36  ? 151 VAL A N   1 
ATOM   838  C CA  . VAL A 1 116 ? 3.779   -11.403 30.345  1.00 59.05  ? 151 VAL A CA  1 
ATOM   839  C C   . VAL A 1 116 ? 2.659   -11.866 29.415  1.00 61.77  ? 151 VAL A C   1 
ATOM   840  O O   . VAL A 1 116 ? 1.679   -11.150 29.207  1.00 50.32  ? 151 VAL A O   1 
ATOM   841  C CB  . VAL A 1 116 ? 3.589   -11.982 31.776  1.00 55.36  ? 151 VAL A CB  1 
ATOM   842  C CG1 . VAL A 1 116 ? 2.280   -11.500 32.391  1.00 51.56  ? 151 VAL A CG1 1 
ATOM   843  C CG2 . VAL A 1 116 ? 3.667   -13.510 31.770  1.00 53.95  ? 151 VAL A CG2 1 
ATOM   844  N N   . THR A 1 117 ? 2.830   -13.053 28.840  1.00 52.84  ? 152 THR A N   1 
ATOM   845  C CA  . THR A 1 117 ? 1.828   -13.645 27.958  1.00 54.65  ? 152 THR A CA  1 
ATOM   846  C C   . THR A 1 117 ? 1.296   -14.956 28.547  1.00 59.10  ? 152 THR A C   1 
ATOM   847  O O   . THR A 1 117 ? 1.738   -15.391 29.613  1.00 56.51  ? 152 THR A O   1 
ATOM   848  C CB  . THR A 1 117 ? 2.419   -13.943 26.574  1.00 56.60  ? 152 THR A CB  1 
ATOM   849  O OG1 . THR A 1 117 ? 3.270   -15.092 26.661  1.00 57.98  ? 152 THR A OG1 1 
ATOM   850  C CG2 . THR A 1 117 ? 3.221   -12.753 26.057  1.00 55.61  ? 152 THR A CG2 1 
ATOM   851  N N   . GLU A 1 118 ? 0.361   -15.587 27.842  1.00 63.07  ? 153 GLU A N   1 
ATOM   852  C CA  . GLU A 1 118 ? -0.220  -16.854 28.287  1.00 67.51  ? 153 GLU A CA  1 
ATOM   853  C C   . GLU A 1 118 ? 0.642   -18.042 27.887  1.00 70.04  ? 153 GLU A C   1 
ATOM   854  O O   . GLU A 1 118 ? 0.327   -19.185 28.218  1.00 73.27  ? 153 GLU A O   1 
ATOM   855  C CB  . GLU A 1 118 ? -1.621  -17.052 27.697  1.00 70.93  ? 153 GLU A CB  1 
ATOM   856  C CG  . GLU A 1 118 ? -2.244  -15.805 27.093  1.00 76.66  ? 153 GLU A CG  1 
ATOM   857  C CD  . GLU A 1 118 ? -1.843  -15.586 25.646  1.00 83.41  ? 153 GLU A CD  1 
ATOM   858  O OE1 . GLU A 1 118 ? -2.074  -16.494 24.818  1.00 88.26  ? 153 GLU A OE1 1 
ATOM   859  O OE2 . GLU A 1 118 ? -1.298  -14.504 25.337  1.00 83.95  ? 153 GLU A OE2 1 
ATOM   860  N N   . GLU A 1 119 ? 1.730   -17.770 27.177  1.00 68.39  ? 154 GLU A N   1 
ATOM   861  C CA  . GLU A 1 119 ? 2.494   -18.824 26.513  1.00 70.47  ? 154 GLU A CA  1 
ATOM   862  C C   . GLU A 1 119 ? 3.204   -19.803 27.460  1.00 69.05  ? 154 GLU A C   1 
ATOM   863  O O   . GLU A 1 119 ? 3.192   -21.011 27.230  1.00 70.54  ? 154 GLU A O   1 
ATOM   864  C CB  . GLU A 1 119 ? 3.502   -18.205 25.536  1.00 70.43  ? 154 GLU A CB  1 
ATOM   865  C CG  . GLU A 1 119 ? 4.266   -19.217 24.691  1.00 67.17  ? 154 GLU A CG  1 
ATOM   866  C CD  . GLU A 1 119 ? 3.382   -19.924 23.687  1.00 73.24  ? 154 GLU A CD  1 
ATOM   867  O OE1 . GLU A 1 119 ? 2.247   -19.450 23.452  1.00 71.69  ? 154 GLU A OE1 1 
ATOM   868  O OE2 . GLU A 1 119 ? 3.823   -20.955 23.132  1.00 78.33  ? 154 GLU A OE2 1 
ATOM   869  N N   . CYS A 1 120 ? 3.832   -19.279 28.506  1.00 65.61  ? 155 CYS A N   1 
ATOM   870  C CA  . CYS A 1 120 ? 4.661   -20.103 29.386  1.00 67.35  ? 155 CYS A CA  1 
ATOM   871  C C   . CYS A 1 120 ? 4.129   -20.174 30.819  1.00 67.36  ? 155 CYS A C   1 
ATOM   872  O O   . CYS A 1 120 ? 4.125   -19.173 31.545  1.00 62.83  ? 155 CYS A O   1 
ATOM   873  C CB  . CYS A 1 120 ? 6.110   -19.600 29.393  1.00 64.26  ? 155 CYS A CB  1 
ATOM   874  S SG  . CYS A 1 120 ? 6.791   -19.235 27.750  1.00 98.64  ? 155 CYS A SG  1 
ATOM   875  N N   . PRO A 1 121 ? 3.682   -21.368 31.229  1.00 67.99  ? 156 PRO A N   1 
ATOM   876  C CA  . PRO A 1 121 ? 3.212   -21.614 32.598  1.00 70.18  ? 156 PRO A CA  1 
ATOM   877  C C   . PRO A 1 121 ? 4.216   -21.134 33.649  1.00 66.49  ? 156 PRO A C   1 
ATOM   878  O O   . PRO A 1 121 ? 3.830   -20.509 34.643  1.00 63.88  ? 156 PRO A O   1 
ATOM   879  C CB  . PRO A 1 121 ? 3.086   -23.136 32.641  1.00 75.12  ? 156 PRO A CB  1 
ATOM   880  C CG  . PRO A 1 121 ? 2.748   -23.505 31.231  1.00 72.94  ? 156 PRO A CG  1 
ATOM   881  C CD  . PRO A 1 121 ? 3.527   -22.553 30.368  1.00 67.92  ? 156 PRO A CD  1 
ATOM   882  N N   . LEU A 1 122 ? 5.496   -21.411 33.418  1.00 64.10  ? 157 LEU A N   1 
ATOM   883  C CA  . LEU A 1 122 ? 6.536   -21.022 34.361  1.00 65.10  ? 157 LEU A CA  1 
ATOM   884  C C   . LEU A 1 122 ? 6.618   -19.501 34.535  1.00 64.74  ? 157 LEU A C   1 
ATOM   885  O O   . LEU A 1 122 ? 6.792   -19.005 35.654  1.00 63.38  ? 157 LEU A O   1 
ATOM   886  C CB  . LEU A 1 122 ? 7.891   -21.584 33.933  1.00 68.90  ? 157 LEU A CB  1 
ATOM   887  C CG  . LEU A 1 122 ? 8.999   -21.427 34.975  1.00 72.80  ? 157 LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 122 ? 8.566   -22.032 36.303  1.00 72.24  ? 157 LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 122 ? 10.296  -22.057 34.486  1.00 75.62  ? 157 LEU A CD2 1 
ATOM   890  N N   . ALA A 1 123 ? 6.493   -18.767 33.432  1.00 60.56  ? 158 ALA A N   1 
ATOM   891  C CA  . ALA A 1 123 ? 6.561   -17.309 33.481  1.00 56.36  ? 158 ALA A CA  1 
ATOM   892  C C   . ALA A 1 123 ? 5.366   -16.736 34.226  1.00 60.14  ? 158 ALA A C   1 
ATOM   893  O O   . ALA A 1 123 ? 5.510   -15.791 35.006  1.00 61.24  ? 158 ALA A O   1 
ATOM   894  C CB  . ALA A 1 123 ? 6.640   -16.728 32.088  1.00 55.54  ? 158 ALA A CB  1 
ATOM   895  N N   . VAL A 1 124 ? 4.189   -17.306 33.979  1.00 60.65  ? 159 VAL A N   1 
ATOM   896  C CA  . VAL A 1 124 ? 2.984   -16.907 34.693  1.00 62.79  ? 159 VAL A CA  1 
ATOM   897  C C   . VAL A 1 124 ? 3.154   -17.185 36.181  1.00 64.87  ? 159 VAL A C   1 
ATOM   898  O O   . VAL A 1 124 ? 2.807   -16.359 37.028  1.00 62.84  ? 159 VAL A O   1 
ATOM   899  C CB  . VAL A 1 124 ? 1.749   -17.669 34.184  1.00 64.41  ? 159 VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 124 ? 0.548   -17.401 35.087  1.00 59.51  ? 159 VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 124 ? 1.447   -17.279 32.745  1.00 66.01  ? 159 VAL A CG2 1 
ATOM   902  N N   . PHE A 1 125 ? 3.697   -18.359 36.483  1.00 67.40  ? 160 PHE A N   1 
ATOM   903  C CA  . PHE A 1 125 ? 3.950   -18.776 37.853  1.00 70.49  ? 160 PHE A CA  1 
ATOM   904  C C   . PHE A 1 125 ? 4.850   -17.768 38.543  1.00 68.29  ? 160 PHE A C   1 
ATOM   905  O O   . PHE A 1 125 ? 4.568   -17.316 39.655  1.00 65.59  ? 160 PHE A O   1 
ATOM   906  C CB  . PHE A 1 125 ? 4.616   -20.152 37.846  1.00 76.23  ? 160 PHE A CB  1 
ATOM   907  C CG  . PHE A 1 125 ? 5.061   -20.628 39.200  1.00 82.65  ? 160 PHE A CG  1 
ATOM   908  C CD1 . PHE A 1 125 ? 4.138   -21.086 40.129  1.00 85.03  ? 160 PHE A CD1 1 
ATOM   909  C CD2 . PHE A 1 125 ? 6.408   -20.653 39.532  1.00 84.62  ? 160 PHE A CD2 1 
ATOM   910  C CE1 . PHE A 1 125 ? 4.548   -21.543 41.366  1.00 85.22  ? 160 PHE A CE1 1 
ATOM   911  C CE2 . PHE A 1 125 ? 6.825   -21.111 40.769  1.00 85.33  ? 160 PHE A CE2 1 
ATOM   912  C CZ  . PHE A 1 125 ? 5.894   -21.556 41.686  1.00 86.38  ? 160 PHE A CZ  1 
ATOM   913  N N   . MET A 1 126 ? 5.932   -17.410 37.864  1.00 67.17  ? 161 MET A N   1 
ATOM   914  C CA  . MET A 1 126 ? 6.914   -16.493 38.421  1.00 67.53  ? 161 MET A CA  1 
ATOM   915  C C   . MET A 1 126 ? 6.324   -15.109 38.708  1.00 63.84  ? 161 MET A C   1 
ATOM   916  O O   . MET A 1 126 ? 6.728   -14.447 39.665  1.00 63.11  ? 161 MET A O   1 
ATOM   917  C CB  . MET A 1 126 ? 8.131   -16.393 37.497  1.00 72.50  ? 161 MET A CB  1 
ATOM   918  C CG  . MET A 1 126 ? 9.468   -16.508 38.223  1.00 80.27  ? 161 MET A CG  1 
ATOM   919  S SD  . MET A 1 126 ? 9.661   -18.015 39.211  1.00 85.89  ? 161 MET A SD  1 
ATOM   920  C CE  . MET A 1 126 ? 9.853   -19.238 37.919  1.00 154.48 ? 161 MET A CE  1 
ATOM   921  N N   . VAL A 1 127 ? 5.364   -14.681 37.888  1.00 57.82  ? 162 VAL A N   1 
ATOM   922  C CA  . VAL A 1 127 ? 4.704   -13.396 38.098  1.00 51.83  ? 162 VAL A CA  1 
ATOM   923  C C   . VAL A 1 127 ? 3.820   -13.469 39.333  1.00 52.26  ? 162 VAL A C   1 
ATOM   924  O O   . VAL A 1 127 ? 3.737   -12.518 40.112  1.00 53.19  ? 162 VAL A O   1 
ATOM   925  C CB  . VAL A 1 127 ? 3.852   -12.969 36.875  1.00 57.29  ? 162 VAL A CB  1 
ATOM   926  C CG1 . VAL A 1 127 ? 2.914   -11.814 37.240  1.00 53.84  ? 162 VAL A CG1 1 
ATOM   927  C CG2 . VAL A 1 127 ? 4.748   -12.584 35.707  1.00 54.69  ? 162 VAL A CG2 1 
ATOM   928  N N   . VAL A 1 128 ? 3.153   -14.603 39.504  1.00 55.40  ? 163 VAL A N   1 
ATOM   929  C CA  . VAL A 1 128 ? 2.348   -14.832 40.693  1.00 60.25  ? 163 VAL A CA  1 
ATOM   930  C C   . VAL A 1 128 ? 3.234   -14.768 41.940  1.00 63.41  ? 163 VAL A C   1 
ATOM   931  O O   . VAL A 1 128 ? 2.954   -14.015 42.877  1.00 64.52  ? 163 VAL A O   1 
ATOM   932  C CB  . VAL A 1 128 ? 1.628   -16.192 40.624  1.00 61.72  ? 163 VAL A CB  1 
ATOM   933  C CG1 . VAL A 1 128 ? 1.280   -16.691 42.021  1.00 61.96  ? 163 VAL A CG1 1 
ATOM   934  C CG2 . VAL A 1 128 ? 0.385   -16.085 39.757  1.00 60.97  ? 163 VAL A CG2 1 
ATOM   935  N N   . VAL A 1 129 ? 4.311   -15.548 41.934  1.00 61.86  ? 164 VAL A N   1 
ATOM   936  C CA  . VAL A 1 129 ? 5.242   -15.585 43.055  1.00 63.85  ? 164 VAL A CA  1 
ATOM   937  C C   . VAL A 1 129 ? 5.791   -14.197 43.396  1.00 63.23  ? 164 VAL A C   1 
ATOM   938  O O   . VAL A 1 129 ? 5.720   -13.763 44.546  1.00 63.15  ? 164 VAL A O   1 
ATOM   939  C CB  . VAL A 1 129 ? 6.404   -16.564 42.784  1.00 67.65  ? 164 VAL A CB  1 
ATOM   940  C CG1 . VAL A 1 129 ? 7.492   -16.420 43.840  1.00 69.55  ? 164 VAL A CG1 1 
ATOM   941  C CG2 . VAL A 1 129 ? 5.881   -17.992 42.738  1.00 70.25  ? 164 VAL A CG2 1 
ATOM   942  N N   . GLN A 1 130 ? 6.325   -13.502 42.393  1.00 62.29  ? 165 GLN A N   1 
ATOM   943  C CA  . GLN A 1 130 ? 6.882   -12.167 42.603  1.00 58.55  ? 165 GLN A CA  1 
ATOM   944  C C   . GLN A 1 130 ? 5.840   -11.192 43.146  1.00 57.18  ? 165 GLN A C   1 
ATOM   945  O O   . GLN A 1 130 ? 6.161   -10.318 43.944  1.00 59.94  ? 165 GLN A O   1 
ATOM   946  C CB  . GLN A 1 130 ? 7.509   -11.612 41.316  1.00 53.01  ? 165 GLN A CB  1 
ATOM   947  C CG  . GLN A 1 130 ? 8.240   -10.291 41.524  1.00 52.63  ? 165 GLN A CG  1 
ATOM   948  C CD  . GLN A 1 130 ? 9.029   -9.839  40.308  1.00 57.90  ? 165 GLN A CD  1 
ATOM   949  O OE1 . GLN A 1 130 ? 8.711   -10.194 39.172  1.00 59.80  ? 165 GLN A OE1 1 
ATOM   950  N NE2 . GLN A 1 130 ? 10.069  -9.047  40.544  1.00 58.59  ? 165 GLN A NE2 1 
ATOM   951  N N   . SER A 1 131 ? 4.596   -11.341 42.707  1.00 55.60  ? 166 SER A N   1 
ATOM   952  C CA  . SER A 1 131 ? 3.511   -10.495 43.193  1.00 54.86  ? 166 SER A CA  1 
ATOM   953  C C   . SER A 1 131 ? 3.317   -10.687 44.688  1.00 57.89  ? 166 SER A C   1 
ATOM   954  O O   . SER A 1 131 ? 3.158   -9.726  45.438  1.00 56.81  ? 166 SER A O   1 
ATOM   955  C CB  . SER A 1 131 ? 2.206   -10.819 42.462  1.00 51.94  ? 166 SER A CB  1 
ATOM   956  O OG  . SER A 1 131 ? 2.253   -10.367 41.123  1.00 51.74  ? 166 SER A OG  1 
ATOM   957  N N   . ILE A 1 132 ? 3.325   -11.944 45.112  1.00 61.82  ? 167 ILE A N   1 
ATOM   958  C CA  . ILE A 1 132 ? 3.159   -12.266 46.516  1.00 67.70  ? 167 ILE A CA  1 
ATOM   959  C C   . ILE A 1 132 ? 4.349   -11.752 47.324  1.00 69.26  ? 167 ILE A C   1 
ATOM   960  O O   . ILE A 1 132 ? 4.174   -11.118 48.363  1.00 68.12  ? 167 ILE A O   1 
ATOM   961  C CB  . ILE A 1 132 ? 2.984   -13.779 46.715  1.00 70.72  ? 167 ILE A CB  1 
ATOM   962  C CG1 . ILE A 1 132 ? 1.673   -14.241 46.065  1.00 68.59  ? 167 ILE A CG1 1 
ATOM   963  C CG2 . ILE A 1 132 ? 3.028   -14.122 48.196  1.00 70.72  ? 167 ILE A CG2 1 
ATOM   964  C CD1 . ILE A 1 132 ? 1.507   -15.745 46.011  1.00 67.36  ? 167 ILE A CD1 1 
ATOM   965  N N   . VAL A 1 133 ? 5.556   -12.015 46.831  1.00 68.85  ? 168 VAL A N   1 
ATOM   966  C CA  . VAL A 1 133 ? 6.775   -11.560 47.495  1.00 69.64  ? 168 VAL A CA  1 
ATOM   967  C C   . VAL A 1 133 ? 6.823   -10.035 47.628  1.00 66.88  ? 168 VAL A C   1 
ATOM   968  O O   . VAL A 1 133 ? 7.059   -9.506  48.713  1.00 67.21  ? 168 VAL A O   1 
ATOM   969  C CB  . VAL A 1 133 ? 8.044   -12.067 46.768  1.00 68.70  ? 168 VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 133 ? 9.267   -11.267 47.189  1.00 66.82  ? 168 VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 133 ? 8.250   -13.556 47.031  1.00 67.75  ? 168 VAL A CG2 1 
ATOM   972  N N   . GLY A 1 134 ? 6.597   -9.334  46.524  1.00 63.98  ? 169 GLY A N   1 
ATOM   973  C CA  . GLY A 1 134 ? 6.572   -7.883  46.546  1.00 61.79  ? 169 GLY A CA  1 
ATOM   974  C C   . GLY A 1 134 ? 5.589   -7.357  47.574  1.00 62.96  ? 169 GLY A C   1 
ATOM   975  O O   . GLY A 1 134 ? 5.820   -6.332  48.220  1.00 60.20  ? 169 GLY A O   1 
ATOM   976  N N   . CYS A 1 135 ? 4.481   -8.070  47.728  1.00 65.47  ? 170 CYS A N   1 
ATOM   977  C CA  . CYS A 1 135 ? 3.429   -7.657  48.641  1.00 66.31  ? 170 CYS A CA  1 
ATOM   978  C C   . CYS A 1 135 ? 3.882   -7.883  50.081  1.00 69.42  ? 170 CYS A C   1 
ATOM   979  O O   . CYS A 1 135 ? 3.644   -7.058  50.964  1.00 70.38  ? 170 CYS A O   1 
ATOM   980  C CB  . CYS A 1 135 ? 2.154   -8.449  48.349  1.00 66.38  ? 170 CYS A CB  1 
ATOM   981  S SG  . CYS A 1 135 ? 0.656   -7.458  48.302  1.00 123.46 ? 170 CYS A SG  1 
ATOM   982  N N   . ILE A 1 136 ? 4.544   -9.011  50.309  1.00 69.39  ? 171 ILE A N   1 
ATOM   983  C CA  . ILE A 1 136 ? 5.070   -9.334  51.623  1.00 71.72  ? 171 ILE A CA  1 
ATOM   984  C C   . ILE A 1 136 ? 6.135   -8.331  52.033  1.00 74.31  ? 171 ILE A C   1 
ATOM   985  O O   . ILE A 1 136 ? 6.133   -7.828  53.161  1.00 75.31  ? 171 ILE A O   1 
ATOM   986  C CB  . ILE A 1 136 ? 5.698   -10.731 51.644  1.00 72.52  ? 171 ILE A CB  1 
ATOM   987  C CG1 . ILE A 1 136 ? 4.627   -11.803 51.437  1.00 72.88  ? 171 ILE A CG1 1 
ATOM   988  C CG2 . ILE A 1 136 ? 6.432   -10.954 52.954  1.00 74.89  ? 171 ILE A CG2 1 
ATOM   989  C CD1 . ILE A 1 136 ? 5.193   -13.204 51.325  1.00 75.89  ? 171 ILE A CD1 1 
ATOM   990  N N   . ILE A 1 137 ? 7.054   -8.047  51.117  1.00 72.53  ? 172 ILE A N   1 
ATOM   991  C CA  . ILE A 1 137 ? 8.131   -7.114  51.408  1.00 75.54  ? 172 ILE A CA  1 
ATOM   992  C C   . ILE A 1 137 ? 7.577   -5.751  51.813  1.00 76.29  ? 172 ILE A C   1 
ATOM   993  O O   . ILE A 1 137 ? 7.977   -5.187  52.830  1.00 75.75  ? 172 ILE A O   1 
ATOM   994  C CB  . ILE A 1 137 ? 9.086   -6.957  50.216  1.00 72.47  ? 172 ILE A CB  1 
ATOM   995  C CG1 . ILE A 1 137 ? 9.894   -8.241  50.016  1.00 73.02  ? 172 ILE A CG1 1 
ATOM   996  C CG2 . ILE A 1 137 ? 10.026  -5.779  50.438  1.00 70.71  ? 172 ILE A CG2 1 
ATOM   997  C CD1 . ILE A 1 137 ? 10.852  -8.176  48.840  1.00 73.00  ? 172 ILE A CD1 1 
ATOM   998  N N   . ASP A 1 138 ? 6.649   -5.234  51.014  1.00 75.19  ? 173 ASP A N   1 
ATOM   999  C CA  . ASP A 1 138 ? 6.026   -3.948  51.294  1.00 78.76  ? 173 ASP A CA  1 
ATOM   1000 C C   . ASP A 1 138 ? 5.420   -3.892  52.690  1.00 78.25  ? 173 ASP A C   1 
ATOM   1001 O O   . ASP A 1 138 ? 5.639   -2.938  53.434  1.00 76.64  ? 173 ASP A O   1 
ATOM   1002 C CB  . ASP A 1 138 ? 4.958   -3.636  50.249  1.00 85.21  ? 173 ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 138 ? 5.547   -3.090  48.964  1.00 93.92  ? 173 ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 138 ? 6.774   -3.221  48.764  1.00 98.96  ? 173 ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 138 ? 4.781   -2.531  48.152  1.00 96.70  ? 173 ASP A OD2 1 
ATOM   1006 N N   . SER A 1 139 ? 4.656   -4.920  53.036  1.00 79.16  ? 174 SER A N   1 
ATOM   1007 C CA  . SER A 1 139 ? 4.009   -4.990  54.337  1.00 80.53  ? 174 SER A CA  1 
ATOM   1008 C C   . SER A 1 139 ? 5.015   -4.956  55.486  1.00 82.36  ? 174 SER A C   1 
ATOM   1009 O O   . SER A 1 139 ? 4.771   -4.319  56.515  1.00 86.01  ? 174 SER A O   1 
ATOM   1010 C CB  . SER A 1 139 ? 3.149   -6.250  54.428  1.00 81.83  ? 174 SER A CB  1 
ATOM   1011 O OG  . SER A 1 139 ? 2.123   -6.229  53.451  1.00 78.02  ? 174 SER A OG  1 
ATOM   1012 N N   . PHE A 1 140 ? 6.139   -5.644  55.315  1.00 79.45  ? 175 PHE A N   1 
ATOM   1013 C CA  . PHE A 1 140 ? 7.183   -5.646  56.334  1.00 85.64  ? 175 PHE A CA  1 
ATOM   1014 C C   . PHE A 1 140 ? 7.828   -4.273  56.465  1.00 86.39  ? 175 PHE A C   1 
ATOM   1015 O O   . PHE A 1 140 ? 8.228   -3.868  57.558  1.00 90.37  ? 175 PHE A O   1 
ATOM   1016 C CB  . PHE A 1 140 ? 8.242   -6.709  56.040  1.00 90.49  ? 175 PHE A CB  1 
ATOM   1017 C CG  . PHE A 1 140 ? 7.924   -8.054  56.626  1.00 98.98  ? 175 PHE A CG  1 
ATOM   1018 C CD1 . PHE A 1 140 ? 7.086   -8.935  55.962  1.00 100.37 ? 175 PHE A CD1 1 
ATOM   1019 C CD2 . PHE A 1 140 ? 8.457   -8.437  57.846  1.00 104.68 ? 175 PHE A CD2 1 
ATOM   1020 C CE1 . PHE A 1 140 ? 6.787   -10.174 56.504  1.00 103.60 ? 175 PHE A CE1 1 
ATOM   1021 C CE2 . PHE A 1 140 ? 8.163   -9.672  58.391  1.00 107.57 ? 175 PHE A CE2 1 
ATOM   1022 C CZ  . PHE A 1 140 ? 7.327   -10.542 57.720  1.00 106.92 ? 175 PHE A CZ  1 
ATOM   1023 N N   . MET A 1 141 ? 7.925   -3.557  55.352  1.00 81.40  ? 176 MET A N   1 
ATOM   1024 C CA  . MET A 1 141 ? 8.488   -2.214  55.374  1.00 83.14  ? 176 MET A CA  1 
ATOM   1025 C C   . MET A 1 141 ? 7.549   -1.227  56.060  1.00 84.85  ? 176 MET A C   1 
ATOM   1026 O O   . MET A 1 141 ? 7.990   -0.350  56.801  1.00 88.98  ? 176 MET A O   1 
ATOM   1027 C CB  . MET A 1 141 ? 8.817   -1.741  53.962  1.00 81.29  ? 176 MET A CB  1 
ATOM   1028 C CG  . MET A 1 141 ? 9.399   -0.341  53.912  1.00 83.25  ? 176 MET A CG  1 
ATOM   1029 S SD  . MET A 1 141 ? 9.942   0.103   52.256  1.00 101.89 ? 176 MET A SD  1 
ATOM   1030 C CE  . MET A 1 141 ? 10.260  1.852   52.454  1.00 77.42  ? 176 MET A CE  1 
ATOM   1031 N N   . ILE A 1 142 ? 6.252   -1.378  55.812  1.00 83.13  ? 177 ILE A N   1 
ATOM   1032 C CA  . ILE A 1 142 ? 5.250   -0.529  56.447  1.00 85.92  ? 177 ILE A CA  1 
ATOM   1033 C C   . ILE A 1 142 ? 5.234   -0.747  57.957  1.00 92.43  ? 177 ILE A C   1 
ATOM   1034 O O   . ILE A 1 142 ? 5.082   0.198   58.729  1.00 98.21  ? 177 ILE A O   1 
ATOM   1035 C CB  . ILE A 1 142 ? 3.842   -0.792  55.874  1.00 83.67  ? 177 ILE A CB  1 
ATOM   1036 C CG1 . ILE A 1 142 ? 3.791   -0.415  54.392  1.00 79.45  ? 177 ILE A CG1 1 
ATOM   1037 C CG2 . ILE A 1 142 ? 2.801   -0.003  56.633  1.00 84.61  ? 177 ILE A CG2 1 
ATOM   1038 C CD1 . ILE A 1 142 ? 2.437   -0.630  53.752  1.00 73.33  ? 177 ILE A CD1 1 
ATOM   1039 N N   . GLY A 1 143 ? 5.401   -1.999  58.372  1.00 92.30  ? 178 GLY A N   1 
ATOM   1040 C CA  . GLY A 1 143 ? 5.395   -2.338  59.784  1.00 91.38  ? 178 GLY A CA  1 
ATOM   1041 C C   . GLY A 1 143 ? 6.657   -1.899  60.504  1.00 94.36  ? 178 GLY A C   1 
ATOM   1042 O O   . GLY A 1 143 ? 6.591   -1.318  61.588  1.00 99.44  ? 178 GLY A O   1 
ATOM   1043 N N   . ALA A 1 144 ? 7.810   -2.179  59.906  1.00 90.59  ? 179 ALA A N   1 
ATOM   1044 C CA  . ALA A 1 144 ? 9.084   -1.800  60.508  1.00 90.37  ? 179 ALA A CA  1 
ATOM   1045 C C   . ALA A 1 144 ? 9.169   -0.290  60.690  1.00 95.34  ? 179 ALA A C   1 
ATOM   1046 O O   . ALA A 1 144 ? 9.699   0.197   61.688  1.00 101.40 ? 179 ALA A O   1 
ATOM   1047 C CB  . ALA A 1 144 ? 10.243  -2.295  59.666  1.00 84.61  ? 179 ALA A CB  1 
ATOM   1048 N N   . ILE A 1 145 ? 8.640   0.446   59.719  1.00 94.31  ? 180 ILE A N   1 
ATOM   1049 C CA  . ILE A 1 145 ? 8.663   1.901   59.769  1.00 96.55  ? 180 ILE A CA  1 
ATOM   1050 C C   . ILE A 1 145 ? 7.784   2.443   60.894  1.00 104.60 ? 180 ILE A C   1 
ATOM   1051 O O   . ILE A 1 145 ? 8.059   3.512   61.434  1.00 107.52 ? 180 ILE A O   1 
ATOM   1052 C CB  . ILE A 1 145 ? 8.272   2.518   58.409  1.00 89.74  ? 180 ILE A CB  1 
ATOM   1053 C CG1 . ILE A 1 145 ? 9.458   2.442   57.447  1.00 89.45  ? 180 ILE A CG1 1 
ATOM   1054 C CG2 . ILE A 1 145 ? 7.833   3.961   58.569  1.00 88.51  ? 180 ILE A CG2 1 
ATOM   1055 C CD1 . ILE A 1 145 ? 9.200   3.088   56.101  1.00 88.64  ? 180 ILE A CD1 1 
ATOM   1056 N N   . MET A 1 146 ? 6.739   1.703   61.254  1.00 107.93 ? 181 MET A N   1 
ATOM   1057 C CA  . MET A 1 146 ? 5.901   2.081   62.392  1.00 113.27 ? 181 MET A CA  1 
ATOM   1058 C C   . MET A 1 146 ? 6.554   1.696   63.713  1.00 117.32 ? 181 MET A C   1 
ATOM   1059 O O   . MET A 1 146 ? 6.511   2.454   64.681  1.00 118.87 ? 181 MET A O   1 
ATOM   1060 C CB  . MET A 1 146 ? 4.518   1.443   62.288  1.00 114.10 ? 181 MET A CB  1 
ATOM   1061 C CG  . MET A 1 146 ? 3.774   1.829   61.031  1.00 111.62 ? 181 MET A CG  1 
ATOM   1062 S SD  . MET A 1 146 ? 2.080   1.230   61.002  1.00 186.67 ? 181 MET A SD  1 
ATOM   1063 C CE  . MET A 1 146 ? 1.610   1.732   59.352  1.00 135.75 ? 181 MET A CE  1 
ATOM   1064 N N   . ALA A 1 147 ? 7.149   0.510   63.748  1.00 119.05 ? 182 ALA A N   1 
ATOM   1065 C CA  . ALA A 1 147 ? 7.894   0.067   64.918  1.00 125.29 ? 182 ALA A CA  1 
ATOM   1066 C C   . ALA A 1 147 ? 8.880   1.150   65.342  1.00 132.24 ? 182 ALA A C   1 
ATOM   1067 O O   . ALA A 1 147 ? 8.786   1.692   66.444  1.00 138.09 ? 182 ALA A O   1 
ATOM   1068 C CB  . ALA A 1 147 ? 8.618   -1.241  64.630  1.00 124.08 ? 182 ALA A CB  1 
ATOM   1069 N N   . LYS A 1 148 ? 9.828   1.457   64.461  1.00 132.39 ? 183 LYS A N   1 
ATOM   1070 C CA  . LYS A 1 148 ? 10.813  2.499   64.723  1.00 137.07 ? 183 LYS A CA  1 
ATOM   1071 C C   . LYS A 1 148 ? 10.153  3.868   64.888  1.00 141.31 ? 183 LYS A C   1 
ATOM   1072 O O   . LYS A 1 148 ? 10.718  4.773   65.505  1.00 147.62 ? 183 LYS A O   1 
ATOM   1073 C CB  . LYS A 1 148 ? 11.865  2.538   63.609  1.00 132.50 ? 183 LYS A CB  1 
ATOM   1074 C CG  . LYS A 1 148 ? 13.015  3.492   63.886  1.00 136.34 ? 183 LYS A CG  1 
ATOM   1075 C CD  . LYS A 1 148 ? 14.202  3.226   62.979  1.00 135.01 ? 183 LYS A CD  1 
ATOM   1076 C CE  . LYS A 1 148 ? 15.405  4.049   63.413  1.00 139.03 ? 183 LYS A CE  1 
ATOM   1077 N NZ  . LYS A 1 148 ? 15.765  3.803   64.840  1.00 144.61 ? 183 LYS A NZ  1 
ATOM   1078 N N   . MET A 1 149 ? 8.944   4.003   64.355  1.00 137.21 ? 184 MET A N   1 
ATOM   1079 C CA  . MET A 1 149 ? 8.207   5.259   64.417  1.00 138.42 ? 184 MET A CA  1 
ATOM   1080 C C   . MET A 1 149 ? 7.650   5.480   65.816  1.00 146.92 ? 184 MET A C   1 
ATOM   1081 O O   . MET A 1 149 ? 7.981   6.462   66.476  1.00 150.75 ? 184 MET A O   1 
ATOM   1082 C CB  . MET A 1 149 ? 7.074   5.269   63.392  1.00 132.40 ? 184 MET A CB  1 
ATOM   1083 C CG  . MET A 1 149 ? 6.482   6.639   63.108  1.00 130.85 ? 184 MET A CG  1 
ATOM   1084 S SD  . MET A 1 149 ? 5.836   6.764   61.423  1.00 122.53 ? 184 MET A SD  1 
ATOM   1085 C CE  . MET A 1 149 ? 7.357   6.766   60.482  1.00 155.40 ? 184 MET A CE  1 
ATOM   1086 N N   . ALA A 1 150 ? 6.798   4.561   66.258  1.00 151.06 ? 185 ALA A N   1 
ATOM   1087 C CA  . ALA A 1 150 ? 6.112   4.694   67.539  1.00 159.24 ? 185 ALA A CA  1 
ATOM   1088 C C   . ALA A 1 150 ? 6.976   4.291   68.738  1.00 168.99 ? 185 ALA A C   1 
ATOM   1089 O O   . ALA A 1 150 ? 6.532   4.379   69.882  1.00 171.78 ? 185 ALA A O   1 
ATOM   1090 C CB  . ALA A 1 150 ? 4.818   3.890   67.528  1.00 156.60 ? 185 ALA A CB  1 
ATOM   1091 N N   . ARG A 1 151 ? 8.204   3.851   68.478  1.00 175.73 ? 186 ARG A N   1 
ATOM   1092 C CA  . ARG A 1 151 ? 9.104   3.432   69.554  1.00 187.86 ? 186 ARG A CA  1 
ATOM   1093 C C   . ARG A 1 151 ? 10.504  4.033   69.419  1.00 197.06 ? 186 ARG A C   1 
ATOM   1094 O O   . ARG A 1 151 ? 11.477  3.305   69.207  1.00 195.81 ? 186 ARG A O   1 
ATOM   1095 C CB  . ARG A 1 151 ? 9.193   1.904   69.612  1.00 187.29 ? 186 ARG A CB  1 
ATOM   1096 C CG  . ARG A 1 151 ? 7.850   1.216   69.785  1.00 186.05 ? 186 ARG A CG  1 
ATOM   1097 C CD  . ARG A 1 151 ? 7.259   1.478   71.162  1.00 191.05 ? 186 ARG A CD  1 
ATOM   1098 N NE  . ARG A 1 151 ? 5.851   1.096   71.237  1.00 189.23 ? 186 ARG A NE  1 
ATOM   1099 C CZ  . ARG A 1 151 ? 5.419   -0.152  71.385  1.00 188.47 ? 186 ARG A CZ  1 
ATOM   1100 N NH1 . ARG A 1 151 ? 6.288   -1.150  71.469  1.00 189.66 ? 186 ARG A NH1 1 
ATOM   1101 N NH2 . ARG A 1 151 ? 4.118   -0.403  71.443  1.00 186.63 ? 186 ARG A NH2 1 
ATOM   1102 N N   . PRO A 1 152 ? 10.605  5.368   69.540  1.00 207.80 ? 187 PRO A N   1 
ATOM   1103 C CA  . PRO A 1 152 ? 11.882  6.079   69.410  1.00 218.49 ? 187 PRO A CA  1 
ATOM   1104 C C   . PRO A 1 152 ? 12.745  5.976   70.665  1.00 236.67 ? 187 PRO A C   1 
ATOM   1105 O O   . PRO A 1 152 ? 12.210  5.868   71.768  1.00 239.66 ? 187 PRO A O   1 
ATOM   1106 C CB  . PRO A 1 152 ? 11.444  7.526   69.196  1.00 215.35 ? 187 PRO A CB  1 
ATOM   1107 C CG  . PRO A 1 152 ? 10.153  7.630   69.939  1.00 213.66 ? 187 PRO A CG  1 
ATOM   1108 C CD  . PRO A 1 152 ? 9.482   6.289   69.794  1.00 208.76 ? 187 PRO A CD  1 
ATOM   1109 N N   . LYS A 1 153 ? 14.065  6.009   70.496  1.00 120.79 ? 188 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 153 ? 14.982  5.959   71.632  1.00 131.94 ? 188 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 153 ? 15.294  7.341   72.213  1.00 137.79 ? 188 LYS A C   1 
ATOM   1112 O O   . LYS A 1 153 ? 15.770  7.456   73.343  1.00 137.72 ? 188 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 153 ? 16.287  5.264   71.232  1.00 135.56 ? 188 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 153 ? 16.159  3.763   71.001  1.00 137.86 ? 188 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 153 ? 15.598  3.061   72.233  1.00 139.58 ? 188 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 153 ? 16.351  3.452   73.502  1.00 140.41 ? 188 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 153 ? 17.795  3.088   73.456  1.00 141.08 ? 188 LYS A NZ  1 
ATOM   1118 N N   . LYS A 1 154 ? 15.020  8.385   71.440  1.00 142.82 ? 189 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 154 ? 15.431  9.741   71.806  1.00 147.40 ? 189 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 154 ? 14.386  10.638  72.486  1.00 149.29 ? 189 LYS A C   1 
ATOM   1121 O O   . LYS A 1 154 ? 14.646  11.828  72.694  1.00 150.46 ? 189 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 154 ? 16.081  10.461  70.625  1.00 149.35 ? 189 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 154 ? 17.594  10.571  70.754  1.00 150.70 ? 189 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 154 ? 18.226  9.214   71.050  1.00 151.52 ? 189 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 154 ? 19.728  9.340   71.282  1.00 151.75 ? 189 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 154 ? 20.394  8.013   71.425  1.00 151.58 ? 189 LYS A NZ  1 
ATOM   1127 N N   . ARG A 1 155 ? 13.228  10.088  72.852  1.00 148.61 ? 190 ARG A N   1 
ATOM   1128 C CA  . ARG A 1 155 ? 12.093  10.929  73.227  1.00 146.96 ? 190 ARG A CA  1 
ATOM   1129 C C   . ARG A 1 155 ? 12.554  12.017  74.188  1.00 141.82 ? 190 ARG A C   1 
ATOM   1130 O O   . ARG A 1 155 ? 13.203  11.738  75.198  1.00 142.96 ? 190 ARG A O   1 
ATOM   1131 C CB  . ARG A 1 155 ? 11.001  10.090  73.898  1.00 150.19 ? 190 ARG A CB  1 
ATOM   1132 C CG  . ARG A 1 155 ? 10.420  8.982   73.033  1.00 154.06 ? 190 ARG A CG  1 
ATOM   1133 C CD  . ARG A 1 155 ? 9.419   8.121   73.802  1.00 158.13 ? 190 ARG A CD  1 
ATOM   1134 N NE  . ARG A 1 155 ? 10.050  7.338   74.864  1.00 162.18 ? 190 ARG A NE  1 
ATOM   1135 C CZ  . ARG A 1 155 ? 9.895   7.568   76.166  1.00 164.76 ? 190 ARG A CZ  1 
ATOM   1136 N NH1 . ARG A 1 155 ? 9.119   8.561   76.581  1.00 165.04 ? 190 ARG A NH1 1 
ATOM   1137 N NH2 . ARG A 1 155 ? 10.513  6.799   77.056  1.00 165.60 ? 190 ARG A NH2 1 
ATOM   1138 N N   . ALA A 1 156 ? 12.217  13.262  73.857  1.00 135.06 ? 191 ALA A N   1 
ATOM   1139 C CA  . ALA A 1 156 ? 12.673  14.416  74.621  1.00 127.69 ? 191 ALA A CA  1 
ATOM   1140 C C   . ALA A 1 156 ? 12.169  14.345  76.057  1.00 122.17 ? 191 ALA A C   1 
ATOM   1141 O O   . ALA A 1 156 ? 10.989  14.073  76.295  1.00 121.88 ? 191 ALA A O   1 
ATOM   1142 C CB  . ALA A 1 156 ? 12.214  15.709  73.955  1.00 124.98 ? 191 ALA A CB  1 
ATOM   1143 N N   . GLN A 1 157 ? 13.064  14.577  77.014  1.00 114.83 ? 192 GLN A N   1 
ATOM   1144 C CA  . GLN A 1 157 ? 12.679  14.525  78.418  1.00 106.58 ? 192 GLN A CA  1 
ATOM   1145 C C   . GLN A 1 157 ? 11.510  15.475  78.642  1.00 90.95  ? 192 GLN A C   1 
ATOM   1146 O O   . GLN A 1 157 ? 11.575  16.651  78.287  1.00 91.25  ? 192 GLN A O   1 
ATOM   1147 C CB  . GLN A 1 157 ? 13.855  14.894  79.331  1.00 112.09 ? 192 GLN A CB  1 
ATOM   1148 C CG  . GLN A 1 157 ? 14.298  16.349  79.237  1.00 116.36 ? 192 GLN A CG  1 
ATOM   1149 C CD  . GLN A 1 157 ? 15.242  16.745  80.360  1.00 120.31 ? 192 GLN A CD  1 
ATOM   1150 O OE1 . GLN A 1 157 ? 16.464  16.695  80.208  1.00 123.86 ? 192 GLN A OE1 1 
ATOM   1151 N NE2 . GLN A 1 157 ? 14.678  17.143  81.494  1.00 118.72 ? 192 GLN A NE2 1 
ATOM   1152 N N   . THR A 1 158 ? 10.428  14.956  79.205  1.00 140.58 ? 193 THR A N   1 
ATOM   1153 C CA  . THR A 1 158 ? 9.258   15.780  79.454  1.00 125.99 ? 193 THR A CA  1 
ATOM   1154 C C   . THR A 1 158 ? 9.233   16.290  80.895  1.00 109.46 ? 193 THR A C   1 
ATOM   1155 O O   . THR A 1 158 ? 8.376   17.091  81.264  1.00 109.08 ? 193 THR A O   1 
ATOM   1156 C CB  . THR A 1 158 ? 7.961   15.007  79.135  1.00 125.96 ? 193 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 158 ? 6.824   15.844  79.385  1.00 127.60 ? 193 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 158 ? 7.872   13.740  79.978  1.00 121.58 ? 193 THR A CG2 1 
ATOM   1159 N N   . LEU A 1 159 ? 10.196  15.844  81.696  1.00 93.34  ? 194 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 159 ? 10.213  16.169  83.118  1.00 83.50  ? 194 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 159 ? 11.531  16.786  83.563  1.00 76.72  ? 194 LEU A C   1 
ATOM   1162 O O   . LEU A 1 159 ? 12.604  16.345  83.155  1.00 78.45  ? 194 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 159 ? 9.905   14.922  83.946  1.00 80.46  ? 194 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 159 ? 8.539   14.343  83.587  1.00 80.49  ? 194 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 159 ? 8.307   12.999  84.251  1.00 76.21  ? 194 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 159 ? 7.453   15.351  83.951  1.00 81.11  ? 194 LEU A CD2 1 
ATOM   1167 N N   . LEU A 1 160 ? 11.437  17.803  84.411  1.00 70.04  ? 195 LEU A N   1 
ATOM   1168 C CA  . LEU A 1 160 ? 12.614  18.536  84.865  1.00 69.99  ? 195 LEU A CA  1 
ATOM   1169 C C   . LEU A 1 160 ? 12.830  18.404  86.373  1.00 65.23  ? 195 LEU A C   1 
ATOM   1170 O O   . LEU A 1 160 ? 11.895  18.544  87.161  1.00 61.88  ? 195 LEU A O   1 
ATOM   1171 C CB  . LEU A 1 160 ? 12.484  20.015  84.485  1.00 72.60  ? 195 LEU A CB  1 
ATOM   1172 C CG  . LEU A 1 160 ? 13.703  20.915  84.705  1.00 75.80  ? 195 LEU A CG  1 
ATOM   1173 C CD1 . LEU A 1 160 ? 14.890  20.410  83.909  1.00 76.64  ? 195 LEU A CD1 1 
ATOM   1174 C CD2 . LEU A 1 160 ? 13.389  22.358  84.328  1.00 76.13  ? 195 LEU A CD2 1 
ATOM   1175 N N   . PHE A 1 161 ? 14.066  18.126  86.769  1.00 65.79  ? 196 PHE A N   1 
ATOM   1176 C CA  . PHE A 1 161 ? 14.448  18.162  88.175  1.00 59.43  ? 196 PHE A CA  1 
ATOM   1177 C C   . PHE A 1 161 ? 15.281  19.416  88.408  1.00 67.79  ? 196 PHE A C   1 
ATOM   1178 O O   . PHE A 1 161 ? 16.003  19.857  87.517  1.00 62.76  ? 196 PHE A O   1 
ATOM   1179 C CB  . PHE A 1 161 ? 15.283  16.938  88.549  1.00 58.72  ? 196 PHE A CB  1 
ATOM   1180 C CG  . PHE A 1 161 ? 14.512  15.653  88.578  1.00 61.01  ? 196 PHE A CG  1 
ATOM   1181 C CD1 . PHE A 1 161 ? 14.508  14.803  87.481  1.00 57.51  ? 196 PHE A CD1 1 
ATOM   1182 C CD2 . PHE A 1 161 ? 13.806  15.281  89.710  1.00 59.41  ? 196 PHE A CD2 1 
ATOM   1183 C CE1 . PHE A 1 161 ? 13.805  13.613  87.512  1.00 63.02  ? 196 PHE A CE1 1 
ATOM   1184 C CE2 . PHE A 1 161 ? 13.099  14.087  89.746  1.00 57.91  ? 196 PHE A CE2 1 
ATOM   1185 C CZ  . PHE A 1 161 ? 13.102  13.253  88.649  1.00 59.18  ? 196 PHE A CZ  1 
ATOM   1186 N N   . SER A 1 162 ? 15.182  19.994  89.599  1.00 66.33  ? 197 SER A N   1 
ATOM   1187 C CA  . SER A 1 162 ? 16.000  21.152  89.930  1.00 62.28  ? 197 SER A CA  1 
ATOM   1188 C C   . SER A 1 162 ? 17.481  20.773  89.922  1.00 63.15  ? 197 SER A C   1 
ATOM   1189 O O   . SER A 1 162 ? 17.837  19.627  90.196  1.00 62.13  ? 197 SER A O   1 
ATOM   1190 C CB  . SER A 1 162 ? 15.590  21.731  91.286  1.00 61.78  ? 197 SER A CB  1 
ATOM   1191 O OG  . SER A 1 162 ? 15.644  20.750  92.308  1.00 60.20  ? 197 SER A OG  1 
ATOM   1192 N N   . HIS A 1 163 ? 18.342  21.733  89.591  1.00 69.44  ? 198 HIS A N   1 
ATOM   1193 C CA  . HIS A 1 163 ? 19.784  21.491  89.576  1.00 73.16  ? 198 HIS A CA  1 
ATOM   1194 C C   . HIS A 1 163 ? 20.320  21.086  90.949  1.00 69.92  ? 198 HIS A C   1 
ATOM   1195 O O   . HIS A 1 163 ? 21.257  20.298  91.053  1.00 66.07  ? 198 HIS A O   1 
ATOM   1196 C CB  . HIS A 1 163 ? 20.536  22.723  89.066  1.00 83.03  ? 198 HIS A CB  1 
ATOM   1197 C CG  . HIS A 1 163 ? 20.409  22.937  87.589  1.00 93.51  ? 198 HIS A CG  1 
ATOM   1198 N ND1 . HIS A 1 163 ? 20.214  21.901  86.702  1.00 95.29  ? 198 HIS A ND1 1 
ATOM   1199 C CD2 . HIS A 1 163 ? 20.442  24.070  86.847  1.00 97.12  ? 198 HIS A CD2 1 
ATOM   1200 C CE1 . HIS A 1 163 ? 20.135  22.386  85.473  1.00 96.68  ? 198 HIS A CE1 1 
ATOM   1201 N NE2 . HIS A 1 163 ? 20.270  23.698  85.534  1.00 97.12  ? 198 HIS A NE2 1 
ATOM   1202 N N   . ASN A 1 164 ? 19.725  21.635  91.999  1.00 67.90  ? 199 ASN A N   1 
ATOM   1203 C CA  . ASN A 1 164 ? 20.154  21.332  93.356  1.00 66.59  ? 199 ASN A CA  1 
ATOM   1204 C C   . ASN A 1 164 ? 19.010  20.792  94.203  1.00 65.75  ? 199 ASN A C   1 
ATOM   1205 O O   . ASN A 1 164 ? 17.836  20.994  93.884  1.00 63.85  ? 199 ASN A O   1 
ATOM   1206 C CB  . ASN A 1 164 ? 20.717  22.582  94.033  1.00 68.64  ? 199 ASN A CB  1 
ATOM   1207 C CG  . ASN A 1 164 ? 21.952  23.121  93.340  1.00 73.65  ? 199 ASN A CG  1 
ATOM   1208 O OD1 . ASN A 1 164 ? 21.860  23.955  92.437  1.00 76.11  ? 199 ASN A OD1 1 
ATOM   1209 N ND2 . ASN A 1 164 ? 23.118  22.656  93.768  1.00 69.78  ? 199 ASN A ND2 1 
ATOM   1210 N N   . ALA A 1 165 ? 19.362  20.084  95.270  1.00 63.56  ? 200 ALA A N   1 
ATOM   1211 C CA  . ALA A 1 165 ? 18.421  19.839  96.347  1.00 62.49  ? 200 ALA A CA  1 
ATOM   1212 C C   . ALA A 1 165 ? 18.789  20.825  97.444  1.00 64.46  ? 200 ALA A C   1 
ATOM   1213 O O   . ALA A 1 165 ? 19.803  21.523  97.339  1.00 63.53  ? 200 ALA A O   1 
ATOM   1214 C CB  . ALA A 1 165 ? 18.540  18.414  96.849  1.00 59.17  ? 200 ALA A CB  1 
ATOM   1215 N N   . VAL A 1 166 ? 17.993  20.871  98.506  1.00 64.84  ? 201 VAL A N   1 
ATOM   1216 C CA  . VAL A 1 166 ? 18.265  21.803  99.595  1.00 68.83  ? 201 VAL A CA  1 
ATOM   1217 C C   . VAL A 1 166 ? 17.805  21.235  100.920 1.00 68.50  ? 201 VAL A C   1 
ATOM   1218 O O   . VAL A 1 166 ? 16.935  20.361  100.967 1.00 67.45  ? 201 VAL A O   1 
ATOM   1219 C CB  . VAL A 1 166 ? 17.564  23.169  99.392  1.00 71.17  ? 201 VAL A CB  1 
ATOM   1220 C CG1 . VAL A 1 166 ? 17.891  23.753  98.025  1.00 64.26  ? 201 VAL A CG1 1 
ATOM   1221 C CG2 . VAL A 1 166 ? 16.060  23.030  99.574  1.00 69.90  ? 201 VAL A CG2 1 
ATOM   1222 N N   . VAL A 1 167 ? 18.385  21.747  101.998 1.00 62.91  ? 202 VAL A N   1 
ATOM   1223 C CA  . VAL A 1 167 ? 17.964  21.377  103.341 1.00 62.62  ? 202 VAL A CA  1 
ATOM   1224 C C   . VAL A 1 167 ? 17.494  22.612  104.102 1.00 64.52  ? 202 VAL A C   1 
ATOM   1225 O O   . VAL A 1 167 ? 18.241  23.580  104.265 1.00 65.91  ? 202 VAL A O   1 
ATOM   1226 C CB  . VAL A 1 167 ? 19.091  20.663  104.110 1.00 63.28  ? 202 VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 167 ? 18.784  20.617  105.601 1.00 63.77  ? 202 VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 167 ? 19.297  19.264  103.556 1.00 67.34  ? 202 VAL A CG2 1 
ATOM   1229 N N   . ALA A 1 168 ? 16.246  22.574  104.558 1.00 64.25  ? 203 ALA A N   1 
ATOM   1230 C CA  . ALA A 1 168 ? 15.651  23.692  105.282 1.00 68.26  ? 203 ALA A CA  1 
ATOM   1231 C C   . ALA A 1 168 ? 14.524  23.221  106.195 1.00 68.28  ? 203 ALA A C   1 
ATOM   1232 O O   . ALA A 1 168 ? 14.046  22.093  106.083 1.00 66.13  ? 203 ALA A O   1 
ATOM   1233 C CB  . ALA A 1 168 ? 15.143  24.750  104.308 1.00 70.17  ? 203 ALA A CB  1 
ATOM   1234 N N   . MET A 1 169 ? 14.117  24.080  107.119 1.00 71.53  ? 204 MET A N   1 
ATOM   1235 C CA  . MET A 1 169 ? 13.006  23.761  108.004 1.00 70.67  ? 204 MET A CA  1 
ATOM   1236 C C   . MET A 1 169 ? 11.680  23.998  107.293 1.00 70.01  ? 204 MET A C   1 
ATOM   1237 O O   . MET A 1 169 ? 11.487  25.027  106.646 1.00 70.05  ? 204 MET A O   1 
ATOM   1238 C CB  . MET A 1 169 ? 13.066  24.617  109.273 1.00 70.53  ? 204 MET A CB  1 
ATOM   1239 C CG  . MET A 1 169 ? 14.338  24.452  110.085 1.00 68.68  ? 204 MET A CG  1 
ATOM   1240 S SD  . MET A 1 169 ? 14.528  22.803  110.796 1.00 81.14  ? 204 MET A SD  1 
ATOM   1241 C CE  . MET A 1 169 ? 13.126  22.733  111.909 1.00 67.91  ? 204 MET A CE  1 
ATOM   1242 N N   . ARG A 1 170 ? 10.773  23.034  107.393 1.00 69.03  ? 205 ARG A N   1 
ATOM   1243 C CA  . ARG A 1 170 ? 9.388   23.286  107.026 1.00 69.43  ? 205 ARG A CA  1 
ATOM   1244 C C   . ARG A 1 170 ? 8.430   22.687  108.040 1.00 72.11  ? 205 ARG A C   1 
ATOM   1245 O O   . ARG A 1 170 ? 8.457   21.484  108.298 1.00 73.04  ? 205 ARG A O   1 
ATOM   1246 C CB  . ARG A 1 170 ? 9.057   22.771  105.632 1.00 68.96  ? 205 ARG A CB  1 
ATOM   1247 C CG  . ARG A 1 170 ? 7.645   23.149  105.240 1.00 72.15  ? 205 ARG A CG  1 
ATOM   1248 C CD  . ARG A 1 170 ? 7.296   22.693  103.862 1.00 72.42  ? 205 ARG A CD  1 
ATOM   1249 N NE  . ARG A 1 170 ? 7.989   23.453  102.832 1.00 73.71  ? 205 ARG A NE  1 
ATOM   1250 C CZ  . ARG A 1 170 ? 7.726   23.319  101.538 1.00 71.53  ? 205 ARG A CZ  1 
ATOM   1251 N NH1 . ARG A 1 170 ? 6.785   22.464  101.158 1.00 65.94  ? 205 ARG A NH1 1 
ATOM   1252 N NH2 . ARG A 1 170 ? 8.389   24.032  100.633 1.00 69.30  ? 205 ARG A NH2 1 
ATOM   1253 N N   . ASP A 1 171 ? 7.583   23.535  108.611 1.00 74.27  ? 206 ASP A N   1 
ATOM   1254 C CA  . ASP A 1 171 ? 6.625   23.095  109.616 1.00 76.81  ? 206 ASP A CA  1 
ATOM   1255 C C   . ASP A 1 171 ? 7.305   22.334  110.753 1.00 79.00  ? 206 ASP A C   1 
ATOM   1256 O O   . ASP A 1 171 ? 6.913   21.215  111.093 1.00 80.23  ? 206 ASP A O   1 
ATOM   1257 C CB  . ASP A 1 171 ? 5.530   22.248  108.967 1.00 73.91  ? 206 ASP A CB  1 
ATOM   1258 C CG  . ASP A 1 171 ? 4.792   23.002  107.878 1.00 75.42  ? 206 ASP A CG  1 
ATOM   1259 O OD1 . ASP A 1 171 ? 4.566   22.421  106.794 1.00 71.21  ? 206 ASP A OD1 1 
ATOM   1260 O OD2 . ASP A 1 171 ? 4.448   24.183  108.109 1.00 78.33  ? 206 ASP A OD2 1 
ATOM   1261 N N   . GLY A 1 172 ? 8.331   22.953  111.331 1.00 77.79  ? 207 GLY A N   1 
ATOM   1262 C CA  . GLY A 1 172 ? 9.005   22.413  112.499 1.00 75.19  ? 207 GLY A CA  1 
ATOM   1263 C C   . GLY A 1 172 ? 9.940   21.251  112.224 1.00 76.93  ? 207 GLY A C   1 
ATOM   1264 O O   . GLY A 1 172 ? 10.517  20.688  113.151 1.00 77.01  ? 207 GLY A O   1 
ATOM   1265 N N   . LYS A 1 173 ? 10.102  20.888  110.956 1.00 78.31  ? 208 LYS A N   1 
ATOM   1266 C CA  . LYS A 1 173 ? 10.908  19.721  110.609 1.00 78.72  ? 208 LYS A CA  1 
ATOM   1267 C C   . LYS A 1 173 ? 12.021  20.032  109.605 1.00 73.39  ? 208 LYS A C   1 
ATOM   1268 O O   . LYS A 1 173 ? 11.810  20.751  108.631 1.00 72.98  ? 208 LYS A O   1 
ATOM   1269 C CB  . LYS A 1 173 ? 10.009  18.598  110.082 1.00 83.00  ? 208 LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 173 ? 9.004   18.078  111.106 1.00 89.90  ? 208 LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 173 ? 8.054   17.056  110.493 1.00 95.48  ? 208 LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 173 ? 7.054   16.529  111.521 1.00 99.61  ? 208 LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 173 ? 6.029   15.632  110.899 1.00 98.61  ? 208 LYS A NZ  1 
ATOM   1274 N N   . LEU A 1 174 ? 13.209  19.488  109.857 1.00 70.48  ? 209 LEU A N   1 
ATOM   1275 C CA  . LEU A 1 174 ? 14.333  19.640  108.939 1.00 68.41  ? 209 LEU A CA  1 
ATOM   1276 C C   . LEU A 1 174 ? 14.139  18.702  107.746 1.00 67.78  ? 209 LEU A C   1 
ATOM   1277 O O   . LEU A 1 174 ? 13.959  17.498  107.923 1.00 58.99  ? 209 LEU A O   1 
ATOM   1278 C CB  . LEU A 1 174 ? 15.649  19.334  109.652 1.00 67.02  ? 209 LEU A CB  1 
ATOM   1279 C CG  . LEU A 1 174 ? 16.933  19.665  108.888 1.00 69.32  ? 209 LEU A CG  1 
ATOM   1280 C CD1 . LEU A 1 174 ? 17.037  21.161  108.626 1.00 65.09  ? 209 LEU A CD1 1 
ATOM   1281 C CD2 . LEU A 1 174 ? 18.152  19.167  109.648 1.00 70.07  ? 209 LEU A CD2 1 
ATOM   1282 N N   . CYS A 1 175 ? 14.169  19.258  106.536 1.00 65.63  ? 210 CYS A N   1 
ATOM   1283 C CA  . CYS A 1 175 ? 13.825  18.491  105.339 1.00 62.64  ? 210 CYS A CA  1 
ATOM   1284 C C   . CYS A 1 175 ? 14.849  18.570  104.217 1.00 63.19  ? 210 CYS A C   1 
ATOM   1285 O O   . CYS A 1 175 ? 15.499  19.592  104.016 1.00 65.78  ? 210 CYS A O   1 
ATOM   1286 C CB  . CYS A 1 175 ? 12.472  18.943  104.783 1.00 61.39  ? 210 CYS A CB  1 
ATOM   1287 S SG  . CYS A 1 175 ? 11.068  18.687  105.891 1.00 72.71  ? 210 CYS A SG  1 
ATOM   1288 N N   . LEU A 1 176 ? 14.973  17.474  103.482 1.00 60.87  ? 211 LEU A N   1 
ATOM   1289 C CA  . LEU A 1 176 ? 15.673  17.478  102.213 1.00 59.75  ? 211 LEU A CA  1 
ATOM   1290 C C   . LEU A 1 176 ? 14.619  17.743  101.138 1.00 61.56  ? 211 LEU A C   1 
ATOM   1291 O O   . LEU A 1 176 ? 13.557  17.119  101.136 1.00 54.64  ? 211 LEU A O   1 
ATOM   1292 C CB  . LEU A 1 176 ? 16.348  16.131  101.986 1.00 58.77  ? 211 LEU A CB  1 
ATOM   1293 C CG  . LEU A 1 176 ? 17.116  15.983  100.676 1.00 60.10  ? 211 LEU A CG  1 
ATOM   1294 C CD1 . LEU A 1 176 ? 18.365  16.851  100.676 1.00 57.94  ? 211 LEU A CD1 1 
ATOM   1295 C CD2 . LEU A 1 176 ? 17.468  14.523  100.449 1.00 59.98  ? 211 LEU A CD2 1 
ATOM   1296 N N   . MET A 1 177 ? 14.898  18.685  100.245 1.00 62.25  ? 212 MET A N   1 
ATOM   1297 C CA  . MET A 1 177 ? 13.907  19.117  99.265  1.00 61.61  ? 212 MET A CA  1 
ATOM   1298 C C   . MET A 1 177 ? 14.500  19.257  97.873  1.00 59.84  ? 212 MET A C   1 
ATOM   1299 O O   . MET A 1 177 ? 15.631  19.715  97.710  1.00 58.63  ? 212 MET A O   1 
ATOM   1300 C CB  . MET A 1 177 ? 13.296  20.464  99.670  1.00 63.11  ? 212 MET A CB  1 
ATOM   1301 C CG  . MET A 1 177 ? 12.515  20.451  100.966 1.00 63.04  ? 212 MET A CG  1 
ATOM   1302 S SD  . MET A 1 177 ? 11.891  22.088  101.449 1.00 72.53  ? 212 MET A SD  1 
ATOM   1303 C CE  . MET A 1 177 ? 13.419  22.927  101.858 1.00 131.28 ? 212 MET A CE  1 
ATOM   1304 N N   . TRP A 1 178 ? 13.720  18.870  96.872  1.00 55.79  ? 213 TRP A N   1 
ATOM   1305 C CA  . TRP A 1 178 ? 14.081  19.104  95.484  1.00 56.41  ? 213 TRP A CA  1 
ATOM   1306 C C   . TRP A 1 178 ? 12.810  19.324  94.691  1.00 60.50  ? 213 TRP A C   1 
ATOM   1307 O O   . TRP A 1 178 ? 11.725  18.919  95.115  1.00 58.95  ? 213 TRP A O   1 
ATOM   1308 C CB  . TRP A 1 178 ? 14.884  17.943  94.908  1.00 56.01  ? 213 TRP A CB  1 
ATOM   1309 C CG  . TRP A 1 178 ? 14.162  16.644  94.936  1.00 54.48  ? 213 TRP A CG  1 
ATOM   1310 C CD1 . TRP A 1 178 ? 13.436  16.084  93.923  1.00 55.67  ? 213 TRP A CD1 1 
ATOM   1311 C CD2 . TRP A 1 178 ? 14.098  15.726  96.031  1.00 53.57  ? 213 TRP A CD2 1 
ATOM   1312 N NE1 . TRP A 1 178 ? 12.924  14.873  94.321  1.00 55.15  ? 213 TRP A NE1 1 
ATOM   1313 C CE2 . TRP A 1 178 ? 13.315  14.630  95.612  1.00 56.68  ? 213 TRP A CE2 1 
ATOM   1314 C CE3 . TRP A 1 178 ? 14.632  15.719  97.323  1.00 53.79  ? 213 TRP A CE3 1 
ATOM   1315 C CZ2 . TRP A 1 178 ? 13.052  13.539  96.443  1.00 56.00  ? 213 TRP A CZ2 1 
ATOM   1316 C CZ3 . TRP A 1 178 ? 14.365  14.640  98.146  1.00 54.95  ? 213 TRP A CZ3 1 
ATOM   1317 C CH2 . TRP A 1 178 ? 13.584  13.566  97.705  1.00 54.74  ? 213 TRP A CH2 1 
ATOM   1318 N N   . ARG A 1 179 ? 12.949  19.968  93.541  1.00 57.15  ? 214 ARG A N   1 
ATOM   1319 C CA  . ARG A 1 179 ? 11.801  20.411  92.777  1.00 57.36  ? 214 ARG A CA  1 
ATOM   1320 C C   . ARG A 1 179 ? 11.660  19.629  91.468  1.00 59.78  ? 214 ARG A C   1 
ATOM   1321 O O   . ARG A 1 179 ? 12.649  19.362  90.782  1.00 61.36  ? 214 ARG A O   1 
ATOM   1322 C CB  . ARG A 1 179 ? 11.926  21.915  92.528  1.00 59.20  ? 214 ARG A CB  1 
ATOM   1323 C CG  . ARG A 1 179 ? 11.015  22.484  91.464  1.00 60.03  ? 214 ARG A CG  1 
ATOM   1324 C CD  . ARG A 1 179 ? 11.264  23.982  91.312  1.00 65.45  ? 214 ARG A CD  1 
ATOM   1325 N NE  . ARG A 1 179 ? 10.516  24.758  92.299  1.00 66.80  ? 214 ARG A NE  1 
ATOM   1326 C CZ  . ARG A 1 179 ? 10.701  26.051  92.547  1.00 68.45  ? 214 ARG A CZ  1 
ATOM   1327 N NH1 . ARG A 1 179 ? 11.632  26.739  91.893  1.00 68.79  ? 214 ARG A NH1 1 
ATOM   1328 N NH2 . ARG A 1 179 ? 9.953   26.656  93.460  1.00 64.66  ? 214 ARG A NH2 1 
ATOM   1329 N N   . VAL A 1 180 ? 10.428  19.240  91.143  1.00 56.42  ? 215 VAL A N   1 
ATOM   1330 C CA  . VAL A 1 180 ? 10.140  18.582  89.874  1.00 56.44  ? 215 VAL A CA  1 
ATOM   1331 C C   . VAL A 1 180 ? 9.115   19.384  89.093  1.00 57.47  ? 215 VAL A C   1 
ATOM   1332 O O   . VAL A 1 180 ? 8.277   20.075  89.674  1.00 57.64  ? 215 VAL A O   1 
ATOM   1333 C CB  . VAL A 1 180 ? 9.602   17.149  90.060  1.00 59.59  ? 215 VAL A CB  1 
ATOM   1334 C CG1 . VAL A 1 180 ? 10.665  16.263  90.669  1.00 59.37  ? 215 VAL A CG1 1 
ATOM   1335 C CG2 . VAL A 1 180 ? 8.335   17.156  90.912  1.00 57.51  ? 215 VAL A CG2 1 
ATOM   1336 N N   . GLY A 1 181 ? 9.177   19.281  87.770  1.00 61.23  ? 216 GLY A N   1 
ATOM   1337 C CA  . GLY A 1 181 ? 8.271   20.026  86.923  1.00 64.54  ? 216 GLY A CA  1 
ATOM   1338 C C   . GLY A 1 181 ? 8.002   19.355  85.596  1.00 68.29  ? 216 GLY A C   1 
ATOM   1339 O O   . GLY A 1 181 ? 8.806   18.558  85.101  1.00 66.64  ? 216 GLY A O   1 
ATOM   1340 N N   . ASN A 1 182 ? 6.850   19.690  85.026  1.00 73.14  ? 217 ASN A N   1 
ATOM   1341 C CA  . ASN A 1 182 ? 6.424   19.173  83.736  1.00 75.83  ? 217 ASN A CA  1 
ATOM   1342 C C   . ASN A 1 182 ? 6.657   20.254  82.694  1.00 78.27  ? 217 ASN A C   1 
ATOM   1343 O O   . ASN A 1 182 ? 6.129   21.355  82.819  1.00 79.90  ? 217 ASN A O   1 
ATOM   1344 C CB  . ASN A 1 182 ? 4.938   18.797  83.794  1.00 77.07  ? 217 ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 182 ? 4.504   17.916  82.631  1.00 84.57  ? 217 ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 182 ? 5.140   17.889  81.574  1.00 85.06  ? 217 ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 182 ? 3.409   17.191  82.825  1.00 87.61  ? 217 ASN A ND2 1 
ATOM   1348 N N   . LEU A 1 183 ? 7.456   19.952  81.676  1.00 82.67  ? 218 LEU A N   1 
ATOM   1349 C CA  . LEU A 1 183 ? 7.746   20.927  80.625  1.00 89.05  ? 218 LEU A CA  1 
ATOM   1350 C C   . LEU A 1 183 ? 6.605   21.089  79.611  1.00 93.00  ? 218 LEU A C   1 
ATOM   1351 O O   . LEU A 1 183 ? 6.638   21.985  78.768  1.00 94.77  ? 218 LEU A O   1 
ATOM   1352 C CB  . LEU A 1 183 ? 9.040   20.563  79.898  1.00 91.88  ? 218 LEU A CB  1 
ATOM   1353 C CG  . LEU A 1 183 ? 10.313  20.596  80.747  1.00 93.92  ? 218 LEU A CG  1 
ATOM   1354 C CD1 . LEU A 1 183 ? 11.511  20.150  79.922  1.00 96.80  ? 218 LEU A CD1 1 
ATOM   1355 C CD2 . LEU A 1 183 ? 10.544  21.983  81.335  1.00 92.91  ? 218 LEU A CD2 1 
ATOM   1356 N N   . ARG A 1 184 ? 5.596   20.229  79.701  1.00 95.92  ? 219 ARG A N   1 
ATOM   1357 C CA  . ARG A 1 184 ? 4.461   20.284  78.786  1.00 100.66 ? 219 ARG A CA  1 
ATOM   1358 C C   . ARG A 1 184 ? 3.143   20.513  79.521  1.00 99.83  ? 219 ARG A C   1 
ATOM   1359 O O   . ARG A 1 184 ? 3.023   20.226  80.715  1.00 94.41  ? 219 ARG A O   1 
ATOM   1360 C CB  . ARG A 1 184 ? 4.373   18.991  77.975  1.00 104.82 ? 219 ARG A CB  1 
ATOM   1361 C CG  . ARG A 1 184 ? 5.650   18.635  77.242  1.00 109.79 ? 219 ARG A CG  1 
ATOM   1362 C CD  . ARG A 1 184 ? 6.037   19.722  76.260  1.00 115.20 ? 219 ARG A CD  1 
ATOM   1363 N NE  . ARG A 1 184 ? 7.263   19.397  75.537  1.00 120.89 ? 219 ARG A NE  1 
ATOM   1364 C CZ  . ARG A 1 184 ? 7.322   18.563  74.502  1.00 126.86 ? 219 ARG A CZ  1 
ATOM   1365 N NH1 . ARG A 1 184 ? 6.223   17.957  74.070  1.00 127.63 ? 219 ARG A NH1 1 
ATOM   1366 N NH2 . ARG A 1 184 ? 8.482   18.329  73.902  1.00 129.98 ? 219 ARG A NH2 1 
ATOM   1367 N N   . LYS A 1 185 ? 2.157   21.033  78.797  1.00 104.36 ? 220 LYS A N   1 
ATOM   1368 C CA  . LYS A 1 185 ? 0.809   21.185  79.331  1.00 106.61 ? 220 LYS A CA  1 
ATOM   1369 C C   . LYS A 1 185 ? 0.162   19.815  79.516  1.00 105.20 ? 220 LYS A C   1 
ATOM   1370 O O   . LYS A 1 185 ? -0.811  19.670  80.260  1.00 106.75 ? 220 LYS A O   1 
ATOM   1371 C CB  . LYS A 1 185 ? -0.047  22.044  78.398  1.00 110.38 ? 220 LYS A CB  1 
ATOM   1372 C CG  . LYS A 1 185 ? 0.271   23.532  78.423  1.00 113.02 ? 220 LYS A CG  1 
ATOM   1373 C CD  . LYS A 1 185 ? -0.211  24.186  79.708  1.00 112.20 ? 220 LYS A CD  1 
ATOM   1374 C CE  . LYS A 1 185 ? -0.530  25.659  79.489  1.00 115.17 ? 220 LYS A CE  1 
ATOM   1375 N NZ  . LYS A 1 185 ? -1.701  25.850  78.586  1.00 117.21 ? 220 LYS A NZ  1 
ATOM   1376 N N   . SER A 1 186 ? 0.705   18.813  78.830  1.00 101.67 ? 221 SER A N   1 
ATOM   1377 C CA  . SER A 1 186 ? 0.246   17.437  78.985  1.00 101.22 ? 221 SER A CA  1 
ATOM   1378 C C   . SER A 1 186 ? 0.468   16.952  80.422  1.00 93.46  ? 221 SER A C   1 
ATOM   1379 O O   . SER A 1 186 ? 1.393   17.399  81.102  1.00 90.04  ? 221 SER A O   1 
ATOM   1380 C CB  . SER A 1 186 ? 0.969   16.521  77.992  1.00 106.21 ? 221 SER A CB  1 
ATOM   1381 O OG  . SER A 1 186 ? 0.578   15.166  78.155  1.00 108.11 ? 221 SER A OG  1 
ATOM   1382 N N   . HIS A 1 187 ? -0.381  16.037  80.880  1.00 88.60  ? 222 HIS A N   1 
ATOM   1383 C CA  . HIS A 1 187 ? -0.324  15.587  82.265  1.00 84.49  ? 222 HIS A CA  1 
ATOM   1384 C C   . HIS A 1 187 ? 0.463   14.290  82.439  1.00 78.39  ? 222 HIS A C   1 
ATOM   1385 O O   . HIS A 1 187 ? 0.886   13.664  81.468  1.00 78.20  ? 222 HIS A O   1 
ATOM   1386 C CB  . HIS A 1 187 ? -1.742  15.381  82.807  1.00 88.16  ? 222 HIS A CB  1 
ATOM   1387 C CG  . HIS A 1 187 ? -2.640  16.564  82.623  1.00 93.74  ? 222 HIS A CG  1 
ATOM   1388 N ND1 . HIS A 1 187 ? -2.725  17.585  83.547  1.00 94.48  ? 222 HIS A ND1 1 
ATOM   1389 C CD2 . HIS A 1 187 ? -3.496  16.886  81.626  1.00 96.47  ? 222 HIS A CD2 1 
ATOM   1390 C CE1 . HIS A 1 187 ? -3.592  18.487  83.121  1.00 97.07  ? 222 HIS A CE1 1 
ATOM   1391 N NE2 . HIS A 1 187 ? -4.075  18.087  81.959  1.00 98.51  ? 222 HIS A NE2 1 
ATOM   1392 N N   . ILE A 1 188 ? 0.629   13.885  83.692  1.00 75.29  ? 223 ILE A N   1 
ATOM   1393 C CA  . ILE A 1 188 ? 1.214   12.595  84.010  1.00 72.25  ? 223 ILE A CA  1 
ATOM   1394 C C   . ILE A 1 188 ? 0.248   11.851  84.901  1.00 67.20  ? 223 ILE A C   1 
ATOM   1395 O O   . ILE A 1 188 ? -0.066  12.296  86.001  1.00 67.95  ? 223 ILE A O   1 
ATOM   1396 C CB  . ILE A 1 188 ? 2.541   12.725  84.749  1.00 77.98  ? 223 ILE A CB  1 
ATOM   1397 C CG1 . ILE A 1 188 ? 3.486   13.652  83.994  1.00 88.29  ? 223 ILE A CG1 1 
ATOM   1398 C CG2 . ILE A 1 188 ? 3.192   11.360  84.913  1.00 74.36  ? 223 ILE A CG2 1 
ATOM   1399 C CD1 . ILE A 1 188 ? 4.833   13.747  84.649  1.00 92.44  ? 223 ILE A CD1 1 
ATOM   1400 N N   . VAL A 1 189 ? -0.225  10.715  84.414  1.00 63.69  ? 224 VAL A N   1 
ATOM   1401 C CA  . VAL A 1 189 ? -1.226  9.933   85.114  1.00 56.59  ? 224 VAL A CA  1 
ATOM   1402 C C   . VAL A 1 189 ? -0.553  9.025   86.135  1.00 60.04  ? 224 VAL A C   1 
ATOM   1403 O O   . VAL A 1 189 ? 0.473   8.408   85.844  1.00 55.20  ? 224 VAL A O   1 
ATOM   1404 C CB  . VAL A 1 189 ? -2.070  9.112   84.108  1.00 57.90  ? 224 VAL A CB  1 
ATOM   1405 C CG1 . VAL A 1 189 ? -3.150  8.314   84.827  1.00 61.54  ? 224 VAL A CG1 1 
ATOM   1406 C CG2 . VAL A 1 189 ? -2.688  10.037  83.073  1.00 59.73  ? 224 VAL A CG2 1 
ATOM   1407 N N   . GLU A 1 190 ? -1.131  8.960   87.332  1.00 54.34  ? 225 GLU A N   1 
ATOM   1408 C CA  . GLU A 1 190 ? -0.601  8.128   88.404  1.00 53.07  ? 225 GLU A CA  1 
ATOM   1409 C C   . GLU A 1 190 ? 0.892   8.375   88.610  1.00 60.02  ? 225 GLU A C   1 
ATOM   1410 O O   . GLU A 1 190 ? 1.684   7.440   88.747  1.00 51.66  ? 225 GLU A O   1 
ATOM   1411 C CB  . GLU A 1 190 ? -0.903  6.650   88.148  1.00 53.25  ? 225 GLU A CB  1 
ATOM   1412 C CG  . GLU A 1 190 ? -2.391  6.336   88.150  1.00 57.67  ? 225 GLU A CG  1 
ATOM   1413 C CD  . GLU A 1 190 ? -2.719  4.945   87.611  1.00 63.42  ? 225 GLU A CD  1 
ATOM   1414 O OE1 . GLU A 1 190 ? -1.804  4.255   87.111  1.00 70.26  ? 225 GLU A OE1 1 
ATOM   1415 O OE2 . GLU A 1 190 ? -3.900  4.540   87.684  1.00 60.16  ? 225 GLU A OE2 1 
ATOM   1416 N N   . ALA A 1 191 ? 1.262   9.651   88.636  1.00 52.33  ? 226 ALA A N   1 
ATOM   1417 C CA  . ALA A 1 191 ? 2.642   10.050  88.866  1.00 51.80  ? 226 ALA A CA  1 
ATOM   1418 C C   . ALA A 1 191 ? 3.012   9.825   90.329  1.00 50.74  ? 226 ALA A C   1 
ATOM   1419 O O   . ALA A 1 191 ? 2.203   10.054  91.224  1.00 50.61  ? 226 ALA A O   1 
ATOM   1420 C CB  . ALA A 1 191 ? 2.839   11.504  88.485  1.00 52.53  ? 226 ALA A CB  1 
ATOM   1421 N N   . HIS A 1 192 ? 4.232   9.365   90.566  1.00 50.21  ? 227 HIS A N   1 
ATOM   1422 C CA  . HIS A 1 192 ? 4.713   9.171   91.928  1.00 51.71  ? 227 HIS A CA  1 
ATOM   1423 C C   . HIS A 1 192 ? 6.227   9.290   91.974  1.00 51.09  ? 227 HIS A C   1 
ATOM   1424 O O   . HIS A 1 192 ? 6.895   9.131   90.957  1.00 49.80  ? 227 HIS A O   1 
ATOM   1425 C CB  . HIS A 1 192 ? 4.234   7.836   92.514  1.00 49.05  ? 227 HIS A CB  1 
ATOM   1426 C CG  . HIS A 1 192 ? 4.813   6.632   91.839  1.00 51.79  ? 227 HIS A CG  1 
ATOM   1427 N ND1 . HIS A 1 192 ? 4.358   6.168   90.622  1.00 53.81  ? 227 HIS A ND1 1 
ATOM   1428 C CD2 . HIS A 1 192 ? 5.794   5.782   92.223  1.00 48.91  ? 227 HIS A CD2 1 
ATOM   1429 C CE1 . HIS A 1 192 ? 5.045   5.093   90.279  1.00 54.00  ? 227 HIS A CE1 1 
ATOM   1430 N NE2 . HIS A 1 192 ? 5.922   4.837   91.233  1.00 56.68  ? 227 HIS A NE2 1 
ATOM   1431 N N   . VAL A 1 193 ? 6.764   9.584   93.153  1.00 48.97  ? 228 VAL A N   1 
ATOM   1432 C CA  . VAL A 1 193 ? 8.190   9.872   93.275  1.00 49.13  ? 228 VAL A CA  1 
ATOM   1433 C C   . VAL A 1 193 ? 8.913   8.934   94.235  1.00 51.71  ? 228 VAL A C   1 
ATOM   1434 O O   . VAL A 1 193 ? 8.306   8.335   95.123  1.00 48.37  ? 228 VAL A O   1 
ATOM   1435 C CB  . VAL A 1 193 ? 8.439   11.331  93.711  1.00 53.06  ? 228 VAL A CB  1 
ATOM   1436 C CG1 . VAL A 1 193 ? 8.001   12.299  92.617  1.00 50.21  ? 228 VAL A CG1 1 
ATOM   1437 C CG2 . VAL A 1 193 ? 7.728   11.624  95.033  1.00 49.20  ? 228 VAL A CG2 1 
ATOM   1438 N N   . ARG A 1 194 ? 10.218  8.811   94.036  1.00 49.16  ? 229 ARG A N   1 
ATOM   1439 C CA  . ARG A 1 194 ? 11.059  7.987   94.889  1.00 51.45  ? 229 ARG A CA  1 
ATOM   1440 C C   . ARG A 1 194 ? 12.423  8.641   95.002  1.00 53.95  ? 229 ARG A C   1 
ATOM   1441 O O   . ARG A 1 194 ? 12.804  9.466   94.160  1.00 50.39  ? 229 ARG A O   1 
ATOM   1442 C CB  . ARG A 1 194 ? 11.247  6.589   94.298  1.00 52.99  ? 229 ARG A CB  1 
ATOM   1443 C CG  . ARG A 1 194 ? 10.001  5.738   94.200  1.00 59.86  ? 229 ARG A CG  1 
ATOM   1444 C CD  . ARG A 1 194 ? 10.344  4.421   93.506  1.00 67.24  ? 229 ARG A CD  1 
ATOM   1445 N NE  . ARG A 1 194 ? 11.348  3.684   94.273  1.00 75.51  ? 229 ARG A NE  1 
ATOM   1446 C CZ  . ARG A 1 194 ? 12.007  2.613   93.838  1.00 75.10  ? 229 ARG A CZ  1 
ATOM   1447 N NH1 . ARG A 1 194 ? 11.779  2.132   92.618  1.00 73.04  ? 229 ARG A NH1 1 
ATOM   1448 N NH2 . ARG A 1 194 ? 12.901  2.025   94.629  1.00 69.79  ? 229 ARG A NH2 1 
ATOM   1449 N N   . ALA A 1 195 ? 13.165  8.257   96.033  1.00 50.01  ? 230 ALA A N   1 
ATOM   1450 C CA  . ALA A 1 195 ? 14.540  8.708   96.166  1.00 57.37  ? 230 ALA A CA  1 
ATOM   1451 C C   . ALA A 1 195 ? 15.391  7.671   96.890  1.00 56.49  ? 230 ALA A C   1 
ATOM   1452 O O   . ALA A 1 195 ? 14.890  6.908   97.726  1.00 53.72  ? 230 ALA A O   1 
ATOM   1453 C CB  . ALA A 1 195 ? 14.597  10.053  96.872  1.00 51.16  ? 230 ALA A CB  1 
ATOM   1454 N N   . GLN A 1 196 ? 16.678  7.645   96.555  1.00 56.19  ? 231 GLN A N   1 
ATOM   1455 C CA  . GLN A 1 196 ? 17.615  6.714   97.171  1.00 57.32  ? 231 GLN A CA  1 
ATOM   1456 C C   . GLN A 1 196 ? 18.943  7.370   97.515  1.00 58.20  ? 231 GLN A C   1 
ATOM   1457 O O   . GLN A 1 196 ? 19.457  8.192   96.759  1.00 59.89  ? 231 GLN A O   1 
ATOM   1458 C CB  . GLN A 1 196 ? 17.880  5.527   96.248  1.00 58.63  ? 231 GLN A CB  1 
ATOM   1459 C CG  . GLN A 1 196 ? 16.682  4.645   95.997  1.00 57.64  ? 231 GLN A CG  1 
ATOM   1460 C CD  . GLN A 1 196 ? 17.052  3.400   95.228  1.00 62.21  ? 231 GLN A CD  1 
ATOM   1461 O OE1 . GLN A 1 196 ? 16.437  2.341   95.404  1.00 68.17  ? 231 GLN A OE1 1 
ATOM   1462 N NE2 . GLN A 1 196 ? 18.067  3.512   94.368  1.00 58.37  ? 231 GLN A NE2 1 
ATOM   1463 N N   . LEU A 1 197 ? 19.497  7.000   98.662  1.00 59.13  ? 232 LEU A N   1 
ATOM   1464 C CA  . LEU A 1 197 ? 20.862  7.378   98.986  1.00 58.98  ? 232 LEU A CA  1 
ATOM   1465 C C   . LEU A 1 197 ? 21.799  6.266   98.516  1.00 59.93  ? 232 LEU A C   1 
ATOM   1466 O O   . LEU A 1 197 ? 21.649  5.105   98.906  1.00 58.95  ? 232 LEU A O   1 
ATOM   1467 C CB  . LEU A 1 197 ? 21.018  7.635   100.487 1.00 61.55  ? 232 LEU A CB  1 
ATOM   1468 C CG  . LEU A 1 197 ? 22.371  8.218   100.919 1.00 66.76  ? 232 LEU A CG  1 
ATOM   1469 C CD1 . LEU A 1 197 ? 22.243  9.041   102.199 1.00 71.22  ? 232 LEU A CD1 1 
ATOM   1470 C CD2 . LEU A 1 197 ? 23.418  7.128   101.078 1.00 65.72  ? 232 LEU A CD2 1 
ATOM   1471 N N   . ILE A 1 198 ? 22.756  6.627   97.667  1.00 63.02  ? 233 ILE A N   1 
ATOM   1472 C CA  . ILE A 1 198 ? 23.697  5.669   97.099  1.00 66.85  ? 233 ILE A CA  1 
ATOM   1473 C C   . ILE A 1 198 ? 25.079  5.842   97.706  1.00 69.48  ? 233 ILE A C   1 
ATOM   1474 O O   . ILE A 1 198 ? 25.730  6.864   97.492  1.00 71.49  ? 233 ILE A O   1 
ATOM   1475 C CB  . ILE A 1 198 ? 23.846  5.857   95.571  1.00 68.76  ? 233 ILE A CB  1 
ATOM   1476 C CG1 . ILE A 1 198 ? 22.481  5.970   94.894  1.00 65.31  ? 233 ILE A CG1 1 
ATOM   1477 C CG2 . ILE A 1 198 ? 24.664  4.725   94.968  1.00 70.60  ? 233 ILE A CG2 1 
ATOM   1478 C CD1 . ILE A 1 198 ? 21.683  4.702   94.919  1.00 63.98  ? 233 ILE A CD1 1 
ATOM   1479 N N   . LYS A 1 199 ? 25.516  4.861   98.489  1.00 70.95  ? 234 LYS A N   1 
ATOM   1480 C CA  . LYS A 1 199 ? 26.902  4.814   98.943  1.00 75.66  ? 234 LYS A CA  1 
ATOM   1481 C C   . LYS A 1 199 ? 27.360  3.376   99.142  1.00 73.29  ? 234 LYS A C   1 
ATOM   1482 O O   . LYS A 1 199 ? 26.536  2.488   99.363  1.00 71.07  ? 234 LYS A O   1 
ATOM   1483 C CB  . LYS A 1 199 ? 27.099  5.628   100.227 1.00 81.09  ? 234 LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 199 ? 26.434  5.045   101.460 1.00 86.55  ? 234 LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 199 ? 26.819  5.829   102.706 1.00 94.32  ? 234 LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 199 ? 26.185  5.234   103.959 1.00 99.94  ? 234 LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 199 ? 26.627  5.934   105.202 1.00 103.58 ? 234 LYS A NZ  1 
ATOM   1488 N N   . PRO A 1 200 ? 28.677  3.137   99.053  1.00 73.85  ? 235 PRO A N   1 
ATOM   1489 C CA  . PRO A 1 200 ? 29.193  1.817   99.419  1.00 74.53  ? 235 PRO A CA  1 
ATOM   1490 C C   . PRO A 1 200 ? 29.121  1.657   100.927 1.00 74.11  ? 235 PRO A C   1 
ATOM   1491 O O   . PRO A 1 200 ? 29.138  2.655   101.648 1.00 74.22  ? 235 PRO A O   1 
ATOM   1492 C CB  . PRO A 1 200 ? 30.655  1.876   98.968  1.00 76.22  ? 235 PRO A CB  1 
ATOM   1493 C CG  . PRO A 1 200 ? 30.997  3.318   98.998  1.00 74.57  ? 235 PRO A CG  1 
ATOM   1494 C CD  . PRO A 1 200 ? 29.745  4.041   98.595  1.00 71.74  ? 235 PRO A CD  1 
ATOM   1495 N N   . ARG A 1 201 ? 29.016  0.426   101.405 1.00 74.18  ? 236 ARG A N   1 
ATOM   1496 C CA  . ARG A 1 201 ? 29.045  0.201   102.841 1.00 75.79  ? 236 ARG A CA  1 
ATOM   1497 C C   . ARG A 1 201 ? 29.472  -1.218  103.188 1.00 78.27  ? 236 ARG A C   1 
ATOM   1498 O O   . ARG A 1 201 ? 29.408  -2.125  102.354 1.00 74.91  ? 236 ARG A O   1 
ATOM   1499 C CB  . ARG A 1 201 ? 27.694  0.549   103.479 1.00 74.24  ? 236 ARG A CB  1 
ATOM   1500 C CG  . ARG A 1 201 ? 26.845  -0.641  103.855 1.00 69.64  ? 236 ARG A CG  1 
ATOM   1501 C CD  . ARG A 1 201 ? 25.570  -0.209  104.569 1.00 69.87  ? 236 ARG A CD  1 
ATOM   1502 N NE  . ARG A 1 201 ? 24.466  -1.111  104.249 1.00 67.78  ? 236 ARG A NE  1 
ATOM   1503 C CZ  . ARG A 1 201 ? 24.184  -2.217  104.928 1.00 69.32  ? 236 ARG A CZ  1 
ATOM   1504 N NH1 . ARG A 1 201 ? 24.914  -2.558  105.986 1.00 70.43  ? 236 ARG A NH1 1 
ATOM   1505 N NH2 . ARG A 1 201 ? 23.168  -2.980  104.553 1.00 67.47  ? 236 ARG A NH2 1 
ATOM   1506 N N   . ILE A 1 202 ? 29.927  -1.389  104.425 1.00 79.72  ? 237 ILE A N   1 
ATOM   1507 C CA  . ILE A 1 202 ? 30.324  -2.692  104.934 1.00 82.04  ? 237 ILE A CA  1 
ATOM   1508 C C   . ILE A 1 202 ? 29.391  -3.091  106.069 1.00 81.11  ? 237 ILE A C   1 
ATOM   1509 O O   . ILE A 1 202 ? 29.246  -2.360  107.049 1.00 80.21  ? 237 ILE A O   1 
ATOM   1510 C CB  . ILE A 1 202 ? 31.776  -2.675  105.451 1.00 86.20  ? 237 ILE A CB  1 
ATOM   1511 C CG1 . ILE A 1 202 ? 32.732  -2.243  104.335 1.00 87.91  ? 237 ILE A CG1 1 
ATOM   1512 C CG2 . ILE A 1 202 ? 32.161  -4.038  106.011 1.00 86.01  ? 237 ILE A CG2 1 
ATOM   1513 C CD1 . ILE A 1 202 ? 34.196  -2.246  104.739 1.00 90.97  ? 237 ILE A CD1 1 
ATOM   1514 N N   . THR A 1 203 ? 28.745  -4.242  105.926 1.00 81.86  ? 238 THR A N   1 
ATOM   1515 C CA  . THR A 1 203 ? 27.844  -4.733  106.960 1.00 82.49  ? 238 THR A CA  1 
ATOM   1516 C C   . THR A 1 203 ? 28.646  -5.136  108.189 1.00 87.73  ? 238 THR A C   1 
ATOM   1517 O O   . THR A 1 203 ? 29.856  -5.359  108.105 1.00 91.62  ? 238 THR A O   1 
ATOM   1518 C CB  . THR A 1 203 ? 26.999  -5.923  106.468 1.00 80.06  ? 238 THR A CB  1 
ATOM   1519 O OG1 . THR A 1 203 ? 27.835  -7.072  106.278 1.00 78.55  ? 238 THR A OG1 1 
ATOM   1520 C CG2 . THR A 1 203 ? 26.310  -5.573  105.158 1.00 76.18  ? 238 THR A CG2 1 
ATOM   1521 N N   . GLU A 1 204 ? 27.978  -5.212  109.334 1.00 87.09  ? 239 GLU A N   1 
ATOM   1522 C CA  . GLU A 1 204 ? 28.649  -5.580  110.574 1.00 90.10  ? 239 GLU A CA  1 
ATOM   1523 C C   . GLU A 1 204 ? 29.319  -6.952  110.470 1.00 91.44  ? 239 GLU A C   1 
ATOM   1524 O O   . GLU A 1 204 ? 30.220  -7.268  111.249 1.00 95.21  ? 239 GLU A O   1 
ATOM   1525 C CB  . GLU A 1 204 ? 27.666  -5.552  111.746 1.00 90.50  ? 239 GLU A CB  1 
ATOM   1526 C CG  . GLU A 1 204 ? 26.575  -6.602  111.668 1.00 92.05  ? 239 GLU A CG  1 
ATOM   1527 C CD  . GLU A 1 204 ? 25.533  -6.437  112.756 1.00 94.14  ? 239 GLU A CD  1 
ATOM   1528 O OE1 . GLU A 1 204 ? 25.595  -7.178  113.762 1.00 95.76  ? 239 GLU A OE1 1 
ATOM   1529 O OE2 . GLU A 1 204 ? 24.650  -5.564  112.601 1.00 93.18  ? 239 GLU A OE2 1 
ATOM   1530 N N   . GLU A 1 205 ? 28.876  -7.761  109.510 1.00 89.41  ? 240 GLU A N   1 
ATOM   1531 C CA  . GLU A 1 205 ? 29.451  -9.088  109.293 1.00 86.51  ? 240 GLU A CA  1 
ATOM   1532 C C   . GLU A 1 205 ? 30.658  -9.043  108.358 1.00 88.11  ? 240 GLU A C   1 
ATOM   1533 O O   . GLU A 1 205 ? 31.254  -10.074 108.051 1.00 90.53  ? 240 GLU A O   1 
ATOM   1534 C CB  . GLU A 1 205 ? 28.404  -10.066 108.743 1.00 85.30  ? 240 GLU A CB  1 
ATOM   1535 C CG  . GLU A 1 205 ? 27.257  -10.393 109.697 1.00 84.50  ? 240 GLU A CG  1 
ATOM   1536 C CD  . GLU A 1 205 ? 26.060  -9.470  109.522 1.00 82.40  ? 240 GLU A CD  1 
ATOM   1537 O OE1 . GLU A 1 205 ? 26.158  -8.502  108.737 1.00 79.52  ? 240 GLU A OE1 1 
ATOM   1538 O OE2 . GLU A 1 205 ? 25.016  -9.720  110.163 1.00 80.72  ? 240 GLU A OE2 1 
ATOM   1539 N N   . GLY A 1 206 ? 31.006  -7.849  107.892 1.00 90.35  ? 241 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 206 ? 32.192  -7.676  107.071 1.00 93.22  ? 241 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 206 ? 31.966  -7.773  105.572 1.00 92.59  ? 241 GLY A C   1 
ATOM   1542 O O   . GLY A 1 206 ? 32.924  -7.794  104.797 1.00 94.95  ? 241 GLY A O   1 
ATOM   1543 N N   . GLU A 1 207 ? 30.705  -7.832  105.156 1.00 87.26  ? 242 GLU A N   1 
ATOM   1544 C CA  . GLU A 1 207 ? 30.388  -7.911  103.734 1.00 86.21  ? 242 GLU A CA  1 
ATOM   1545 C C   . GLU A 1 207 ? 30.424  -6.527  103.089 1.00 85.40  ? 242 GLU A C   1 
ATOM   1546 O O   . GLU A 1 207 ? 29.804  -5.581  103.583 1.00 79.29  ? 242 GLU A O   1 
ATOM   1547 C CB  . GLU A 1 207 ? 29.024  -8.571  103.508 1.00 83.83  ? 242 GLU A CB  1 
ATOM   1548 C CG  . GLU A 1 207 ? 28.690  -8.820  102.046 1.00 86.14  ? 242 GLU A CG  1 
ATOM   1549 C CD  . GLU A 1 207 ? 27.315  -9.440  101.851 1.00 90.04  ? 242 GLU A CD  1 
ATOM   1550 O OE1 . GLU A 1 207 ? 27.015  -9.879  100.720 1.00 92.83  ? 242 GLU A OE1 1 
ATOM   1551 O OE2 . GLU A 1 207 ? 26.532  -9.486  102.824 1.00 91.32  ? 242 GLU A OE2 1 
ATOM   1552 N N   . TYR A 1 208 ? 31.162  -6.415  101.990 1.00 85.51  ? 243 TYR A N   1 
ATOM   1553 C CA  . TYR A 1 208 ? 31.265  -5.156  101.263 1.00 84.58  ? 243 TYR A CA  1 
ATOM   1554 C C   . TYR A 1 208 ? 30.177  -5.027  100.196 1.00 82.39  ? 243 TYR A C   1 
ATOM   1555 O O   . TYR A 1 208 ? 30.044  -5.883  99.318  1.00 82.07  ? 243 TYR A O   1 
ATOM   1556 C CB  . TYR A 1 208 ? 32.647  -5.016  100.622 1.00 85.75  ? 243 TYR A CB  1 
ATOM   1557 C CG  . TYR A 1 208 ? 32.832  -3.728  99.850  1.00 85.40  ? 243 TYR A CG  1 
ATOM   1558 C CD1 . TYR A 1 208 ? 32.857  -2.503  100.504 1.00 82.89  ? 243 TYR A CD1 1 
ATOM   1559 C CD2 . TYR A 1 208 ? 32.990  -3.737  98.468  1.00 85.49  ? 243 TYR A CD2 1 
ATOM   1560 C CE1 . TYR A 1 208 ? 33.028  -1.324  99.808  1.00 83.28  ? 243 TYR A CE1 1 
ATOM   1561 C CE2 . TYR A 1 208 ? 33.162  -2.560  97.759  1.00 84.66  ? 243 TYR A CE2 1 
ATOM   1562 C CZ  . TYR A 1 208 ? 33.181  -1.355  98.435  1.00 85.16  ? 243 TYR A CZ  1 
ATOM   1563 O OH  . TYR A 1 208 ? 33.353  -0.176  97.740  1.00 84.42  ? 243 TYR A OH  1 
ATOM   1564 N N   . ILE A 1 209 ? 29.395  -3.957  100.283 1.00 75.92  ? 244 ILE A N   1 
ATOM   1565 C CA  . ILE A 1 209 ? 28.404  -3.664  99.255  1.00 78.03  ? 244 ILE A CA  1 
ATOM   1566 C C   . ILE A 1 209 ? 28.869  -2.443  98.463  1.00 77.06  ? 244 ILE A C   1 
ATOM   1567 O O   . ILE A 1 209 ? 28.793  -1.318  98.957  1.00 72.49  ? 244 ILE A O   1 
ATOM   1568 C CB  . ILE A 1 209 ? 27.020  -3.404  99.885  1.00 75.22  ? 244 ILE A CB  1 
ATOM   1569 C CG1 . ILE A 1 209 ? 26.681  -4.518  100.885 1.00 74.07  ? 244 ILE A CG1 1 
ATOM   1570 C CG2 . ILE A 1 209 ? 25.950  -3.272  98.808  1.00 70.83  ? 244 ILE A CG2 1 
ATOM   1571 C CD1 . ILE A 1 209 ? 25.431  -4.260  101.713 1.00 71.24  ? 244 ILE A CD1 1 
ATOM   1572 N N   . PRO A 1 210 ? 29.348  -2.666  97.226  1.00 78.57  ? 245 PRO A N   1 
ATOM   1573 C CA  . PRO A 1 210 ? 29.985  -1.617  96.416  1.00 80.11  ? 245 PRO A CA  1 
ATOM   1574 C C   . PRO A 1 210 ? 29.134  -0.358  96.289  1.00 77.85  ? 245 PRO A C   1 
ATOM   1575 O O   . PRO A 1 210 ? 29.658  0.737   96.478  1.00 80.93  ? 245 PRO A O   1 
ATOM   1576 C CB  . PRO A 1 210 ? 30.157  -2.289  95.054  1.00 76.46  ? 245 PRO A CB  1 
ATOM   1577 C CG  . PRO A 1 210 ? 30.307  -3.732  95.381  1.00 80.63  ? 245 PRO A CG  1 
ATOM   1578 C CD  . PRO A 1 210 ? 29.400  -3.980  96.562  1.00 78.93  ? 245 PRO A CD  1 
ATOM   1579 N N   . LEU A 1 211 ? 27.853  -0.506  95.965  1.00 74.76  ? 246 LEU A N   1 
ATOM   1580 C CA  . LEU A 1 211 ? 26.905  0.596   96.098  1.00 72.93  ? 246 LEU A CA  1 
ATOM   1581 C C   . LEU A 1 211 ? 25.618  0.089   96.724  1.00 72.26  ? 246 LEU A C   1 
ATOM   1582 O O   . LEU A 1 211 ? 24.909  -0.713  96.124  1.00 73.54  ? 246 LEU A O   1 
ATOM   1583 C CB  . LEU A 1 211 ? 26.609  1.258   94.746  1.00 73.15  ? 246 LEU A CB  1 
ATOM   1584 C CG  . LEU A 1 211 ? 27.728  2.083   94.095  1.00 76.08  ? 246 LEU A CG  1 
ATOM   1585 C CD1 . LEU A 1 211 ? 27.259  2.706   92.789  1.00 75.57  ? 246 LEU A CD1 1 
ATOM   1586 C CD2 . LEU A 1 211 ? 28.245  3.163   95.039  1.00 73.31  ? 246 LEU A CD2 1 
ATOM   1587 N N   . ASP A 1 212 ? 25.305  0.564   97.923  1.00 72.86  ? 247 ASP A N   1 
ATOM   1588 C CA  . ASP A 1 212 ? 24.062  0.175   98.568  1.00 73.14  ? 247 ASP A CA  1 
ATOM   1589 C C   . ASP A 1 212 ? 22.997  1.196   98.221  1.00 68.36  ? 247 ASP A C   1 
ATOM   1590 O O   . ASP A 1 212 ? 23.273  2.389   98.162  1.00 69.13  ? 247 ASP A O   1 
ATOM   1591 C CB  . ASP A 1 212 ? 24.232  0.067   100.083 1.00 76.36  ? 247 ASP A CB  1 
ATOM   1592 C CG  . ASP A 1 212 ? 23.108  -0.720  100.737 1.00 77.26  ? 247 ASP A CG  1 
ATOM   1593 O OD1 . ASP A 1 212 ? 22.313  -1.345  99.999  1.00 78.69  ? 247 ASP A OD1 1 
ATOM   1594 O OD2 . ASP A 1 212 ? 23.025  -0.725  101.982 1.00 76.56  ? 247 ASP A OD2 1 
ATOM   1595 N N   . GLN A 1 213 ? 21.783  0.728   97.968  1.00 67.21  ? 248 GLN A N   1 
ATOM   1596 C CA  . GLN A 1 213 ? 20.704  1.633   97.597  1.00 65.08  ? 248 GLN A CA  1 
ATOM   1597 C C   . GLN A 1 213 ? 19.689  1.686   98.724  1.00 67.19  ? 248 GLN A C   1 
ATOM   1598 O O   . GLN A 1 213 ? 18.984  0.715   98.986  1.00 71.80  ? 248 GLN A O   1 
ATOM   1599 C CB  . GLN A 1 213 ? 20.072  1.205   96.270  1.00 61.16  ? 248 GLN A CB  1 
ATOM   1600 C CG  . GLN A 1 213 ? 21.085  1.148   95.118  1.00 65.26  ? 248 GLN A CG  1 
ATOM   1601 C CD  . GLN A 1 213 ? 20.463  0.740   93.796  1.00 67.20  ? 248 GLN A CD  1 
ATOM   1602 O OE1 . GLN A 1 213 ? 19.467  1.318   93.362  1.00 68.75  ? 248 GLN A OE1 1 
ATOM   1603 N NE2 . GLN A 1 213 ? 21.045  -0.267  93.153  1.00 65.49  ? 248 GLN A NE2 1 
ATOM   1604 N N   . ILE A 1 214 ? 19.636  2.830   99.397  1.00 66.33  ? 249 ILE A N   1 
ATOM   1605 C CA  . ILE A 1 214 ? 18.854  2.977   100.615 1.00 62.35  ? 249 ILE A CA  1 
ATOM   1606 C C   . ILE A 1 214 ? 17.709  3.964   100.434 1.00 62.00  ? 249 ILE A C   1 
ATOM   1607 O O   . ILE A 1 214 ? 17.917  5.142   100.125 1.00 59.08  ? 249 ILE A O   1 
ATOM   1608 C CB  . ILE A 1 214 ? 19.742  3.425   101.786 1.00 66.39  ? 249 ILE A CB  1 
ATOM   1609 C CG1 . ILE A 1 214 ? 20.803  2.354   102.074 1.00 70.73  ? 249 ILE A CG1 1 
ATOM   1610 C CG2 . ILE A 1 214 ? 18.892  3.718   103.022 1.00 61.83  ? 249 ILE A CG2 1 
ATOM   1611 C CD1 . ILE A 1 214 ? 22.014  2.878   102.817 1.00 73.91  ? 249 ILE A CD1 1 
ATOM   1612 N N   . ASP A 1 215 ? 16.495  3.470   100.641 1.00 63.63  ? 250 ASP A N   1 
ATOM   1613 C CA  . ASP A 1 215 ? 15.303  4.264   100.410 1.00 61.15  ? 250 ASP A CA  1 
ATOM   1614 C C   . ASP A 1 215 ? 15.293  5.556   101.209 1.00 59.84  ? 250 ASP A C   1 
ATOM   1615 O O   . ASP A 1 215 ? 15.643  5.583   102.390 1.00 60.49  ? 250 ASP A O   1 
ATOM   1616 C CB  . ASP A 1 215 ? 14.041  3.464   100.720 1.00 61.45  ? 250 ASP A CB  1 
ATOM   1617 C CG  . ASP A 1 215 ? 12.780  4.282   100.516 1.00 66.40  ? 250 ASP A CG  1 
ATOM   1618 O OD1 . ASP A 1 215 ? 12.382  4.470   99.349  1.00 66.61  ? 250 ASP A OD1 1 
ATOM   1619 O OD2 . ASP A 1 215 ? 12.196  4.753   101.516 1.00 68.65  ? 250 ASP A OD2 1 
ATOM   1620 N N   . ILE A 1 216 ? 14.890  6.627   100.541 1.00 57.05  ? 251 ILE A N   1 
ATOM   1621 C CA  . ILE A 1 216 ? 14.649  7.900   101.195 1.00 59.21  ? 251 ILE A CA  1 
ATOM   1622 C C   . ILE A 1 216 ? 13.144  8.122   101.200 1.00 57.55  ? 251 ILE A C   1 
ATOM   1623 O O   . ILE A 1 216 ? 12.518  8.159   100.144 1.00 60.80  ? 251 ILE A O   1 
ATOM   1624 C CB  . ILE A 1 216 ? 15.374  9.036   100.450 1.00 65.23  ? 251 ILE A CB  1 
ATOM   1625 C CG1 . ILE A 1 216 ? 16.878  8.923   100.694 1.00 66.26  ? 251 ILE A CG1 1 
ATOM   1626 C CG2 . ILE A 1 216 ? 14.850  10.403  100.882 1.00 65.39  ? 251 ILE A CG2 1 
ATOM   1627 C CD1 . ILE A 1 216 ? 17.668  10.055  100.108 1.00 72.82  ? 251 ILE A CD1 1 
ATOM   1628 N N   . ASP A 1 217 ? 12.565  8.276   102.386 1.00 58.83  ? 252 ASP A N   1 
ATOM   1629 C CA  . ASP A 1 217 ? 11.117  8.236   102.519 1.00 53.63  ? 252 ASP A CA  1 
ATOM   1630 C C   . ASP A 1 217 ? 10.520  9.558   102.045 1.00 57.39  ? 252 ASP A C   1 
ATOM   1631 O O   . ASP A 1 217 ? 10.781  10.624  102.611 1.00 50.43  ? 252 ASP A O   1 
ATOM   1632 C CB  . ASP A 1 217 ? 10.757  7.989   103.986 1.00 51.79  ? 252 ASP A CB  1 
ATOM   1633 C CG  . ASP A 1 217 ? 9.264   7.858   104.220 1.00 62.02  ? 252 ASP A CG  1 
ATOM   1634 O OD1 . ASP A 1 217 ? 8.467   8.153   103.304 1.00 65.57  ? 252 ASP A OD1 1 
ATOM   1635 O OD2 . ASP A 1 217 ? 8.888   7.469   105.346 1.00 66.25  ? 252 ASP A OD2 1 
ATOM   1636 N N   . VAL A 1 218 ? 9.766   9.462   100.955 1.00 49.24  ? 253 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 218 ? 9.001   10.568  100.388 1.00 55.16  ? 253 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 218 ? 7.485   10.524  100.623 1.00 56.19  ? 253 VAL A C   1 
ATOM   1639 O O   . VAL A 1 218 ? 6.733   11.226  99.946  1.00 59.70  ? 253 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 218 ? 9.410   10.923  98.936  1.00 56.63  ? 253 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 218 ? 10.785  11.582  98.944  1.00 55.67  ? 253 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 218 ? 9.407   9.696   98.042  1.00 56.56  ? 253 VAL A CG2 1 
ATOM   1643 N N   . GLY A 1 219 ? 7.040   9.641   101.514 1.00 53.06  ? 254 GLY A N   1 
ATOM   1644 C CA  . GLY A 1 219 ? 5.629   9.540   101.855 1.00 51.56  ? 254 GLY A CA  1 
ATOM   1645 C C   . GLY A 1 219 ? 4.863   8.314   101.388 1.00 54.26  ? 254 GLY A C   1 
ATOM   1646 O O   . GLY A 1 219 ? 3.631   8.261   101.507 1.00 52.48  ? 254 GLY A O   1 
ATOM   1647 N N   . PHE A 1 220 ? 5.589   7.318   100.891 1.00 48.62  ? 255 PHE A N   1 
ATOM   1648 C CA  . PHE A 1 220 ? 4.979   6.096   100.366 1.00 49.84  ? 255 PHE A CA  1 
ATOM   1649 C C   . PHE A 1 220 ? 3.911   5.457   101.261 1.00 50.64  ? 255 PHE A C   1 
ATOM   1650 O O   . PHE A 1 220 ? 2.894   4.961   100.764 1.00 49.21  ? 255 PHE A O   1 
ATOM   1651 C CB  . PHE A 1 220 ? 6.054   5.045   100.060 1.00 51.67  ? 255 PHE A CB  1 
ATOM   1652 C CG  . PHE A 1 220 ? 5.490   3.728   99.609  1.00 49.73  ? 255 PHE A CG  1 
ATOM   1653 C CD1 . PHE A 1 220 ? 5.133   3.531   98.287  1.00 48.39  ? 255 PHE A CD1 1 
ATOM   1654 C CD2 . PHE A 1 220 ? 5.286   2.697   100.520 1.00 49.05  ? 255 PHE A CD2 1 
ATOM   1655 C CE1 . PHE A 1 220 ? 4.599   2.324   97.871  1.00 48.74  ? 255 PHE A CE1 1 
ATOM   1656 C CE2 . PHE A 1 220 ? 4.745   1.485   100.111 1.00 49.41  ? 255 PHE A CE2 1 
ATOM   1657 C CZ  . PHE A 1 220 ? 4.405   1.299   98.785  1.00 49.25  ? 255 PHE A CZ  1 
ATOM   1658 N N   . ASP A 1 221 ? 4.146   5.444   102.568 1.00 49.54  ? 256 ASP A N   1 
ATOM   1659 C CA  . ASP A 1 221 ? 3.249   4.751   103.485 1.00 61.71  ? 256 ASP A CA  1 
ATOM   1660 C C   . ASP A 1 221 ? 1.896   5.428   103.640 1.00 57.47  ? 256 ASP A C   1 
ATOM   1661 O O   . ASP A 1 221 ? 0.910   4.787   104.008 1.00 54.67  ? 256 ASP A O   1 
ATOM   1662 C CB  . ASP A 1 221 ? 3.907   4.558   104.854 1.00 71.72  ? 256 ASP A CB  1 
ATOM   1663 C CG  . ASP A 1 221 ? 4.947   3.449   104.844 1.00 84.67  ? 256 ASP A CG  1 
ATOM   1664 O OD1 . ASP A 1 221 ? 4.561   2.280   104.602 1.00 88.28  ? 256 ASP A OD1 1 
ATOM   1665 O OD2 . ASP A 1 221 ? 6.144   3.743   105.074 1.00 88.12  ? 256 ASP A OD2 1 
ATOM   1666 N N   . LYS A 1 222 ? 1.858   6.733   103.417 1.00 59.36  ? 257 LYS A N   1 
ATOM   1667 C CA  . LYS A 1 222 ? 0.593   7.454   103.451 1.00 60.53  ? 257 LYS A CA  1 
ATOM   1668 C C   . LYS A 1 222 ? 0.033   7.735   102.062 1.00 56.34  ? 257 LYS A C   1 
ATOM   1669 O O   . LYS A 1 222 ? -1.016  8.358   101.930 1.00 59.58  ? 257 LYS A O   1 
ATOM   1670 C CB  . LYS A 1 222 ? 0.727   8.733   104.277 1.00 67.10  ? 257 LYS A CB  1 
ATOM   1671 C CG  . LYS A 1 222 ? 1.035   8.463   105.753 1.00 72.89  ? 257 LYS A CG  1 
ATOM   1672 C CD  . LYS A 1 222 ? 1.984   9.514   106.332 1.00 80.41  ? 257 LYS A CD  1 
ATOM   1673 C CE  . LYS A 1 222 ? 3.217   9.740   105.433 1.00 82.18  ? 257 LYS A CE  1 
ATOM   1674 N NZ  . LYS A 1 222 ? 4.015   8.498   105.148 1.00 79.52  ? 257 LYS A NZ  1 
ATOM   1675 N N   . GLY A 1 223 ? 0.740   7.281   101.031 1.00 52.00  ? 258 GLY A N   1 
ATOM   1676 C CA  . GLY A 1 223 ? 0.338   7.529   99.656  1.00 50.02  ? 258 GLY A CA  1 
ATOM   1677 C C   . GLY A 1 223 ? 0.707   8.930   99.194  1.00 53.00  ? 258 GLY A C   1 
ATOM   1678 O O   . GLY A 1 223 ? 0.305   9.359   98.114  1.00 50.08  ? 258 GLY A O   1 
ATOM   1679 N N   . LEU A 1 224 ? 1.490   9.637   100.005 1.00 49.92  ? 259 LEU A N   1 
ATOM   1680 C CA  . LEU A 1 224 ? 1.867   11.018  99.711  1.00 53.68  ? 259 LEU A CA  1 
ATOM   1681 C C   . LEU A 1 224 ? 3.040   11.130  98.738  1.00 53.49  ? 259 LEU A C   1 
ATOM   1682 O O   . LEU A 1 224 ? 3.449   12.231  98.372  1.00 52.19  ? 259 LEU A O   1 
ATOM   1683 C CB  . LEU A 1 224 ? 2.183   11.781  100.999 1.00 53.05  ? 259 LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 224 ? 1.031   11.833  102.002 1.00 56.61  ? 259 LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 224 ? 1.435   12.577  103.270 1.00 52.37  ? 259 LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 224 ? -0.222  12.444  101.362 1.00 53.93  ? 259 LEU A CD2 1 
ATOM   1687 N N   . ASP A 1 225 ? 3.580   9.988   98.328  1.00 54.74  ? 260 ASP A N   1 
ATOM   1688 C CA  . ASP A 1 225 ? 4.564   9.947   97.256  1.00 48.60  ? 260 ASP A CA  1 
ATOM   1689 C C   . ASP A 1 225 ? 3.862   10.118  95.910  1.00 49.17  ? 260 ASP A C   1 
ATOM   1690 O O   . ASP A 1 225 ? 4.512   10.284  94.870  1.00 48.89  ? 260 ASP A O   1 
ATOM   1691 C CB  . ASP A 1 225 ? 5.292   8.607   97.273  1.00 53.19  ? 260 ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 225 ? 4.353   7.437   97.023  1.00 57.79  ? 260 ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 225 ? 4.655   6.610   96.136  1.00 62.51  ? 260 ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 225 ? 3.309   7.350   97.706  1.00 53.62  ? 260 ASP A OD2 1 
ATOM   1695 N N   . ARG A 1 226 ? 2.531   10.041  95.937  1.00 49.21  ? 261 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 226 ? 1.716   10.193  94.738  1.00 52.43  ? 261 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 226 ? 1.423   11.666  94.526  1.00 54.59  ? 261 ARG A C   1 
ATOM   1698 O O   . ARG A 1 226 ? 0.933   12.344  95.428  1.00 55.82  ? 261 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 226 ? 0.403   9.425   94.881  1.00 54.68  ? 261 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 226 ? 0.584   7.935   95.052  1.00 53.11  ? 261 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 226 ? -0.399  7.384   96.051  1.00 54.41  ? 261 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 226 ? -1.707  7.164   95.465  1.00 56.13  ? 261 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 226 ? -2.852  7.607   95.975  1.00 59.13  ? 261 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 226 ? -2.866  8.319   97.092  1.00 51.96  ? 261 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 226 ? -3.991  7.330   95.352  1.00 59.41  ? 261 ARG A NH2 1 
ATOM   1706 N N   . ILE A 1 227 ? 1.718   12.172  93.338  1.00 50.82  ? 262 ILE A N   1 
ATOM   1707 C CA  . ILE A 1 227 ? 1.582   13.604  93.130  1.00 59.05  ? 262 ILE A CA  1 
ATOM   1708 C C   . ILE A 1 227 ? 0.691   13.950  91.943  1.00 55.92  ? 262 ILE A C   1 
ATOM   1709 O O   . ILE A 1 227 ? 0.613   13.210  90.968  1.00 52.78  ? 262 ILE A O   1 
ATOM   1710 C CB  . ILE A 1 227 ? 2.962   14.301  93.000  1.00 60.56  ? 262 ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 227 ? 3.654   13.894  91.701  1.00 59.01  ? 262 ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 227 ? 3.848   13.981  94.217  1.00 50.84  ? 262 ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 227 ? 4.902   14.695  91.409  1.00 62.46  ? 262 ILE A CD1 1 
ATOM   1714 N N   . PHE A 1 228 ? 0.006   15.080  92.055  1.00 56.11  ? 263 PHE A N   1 
ATOM   1715 C CA  . PHE A 1 228 ? -0.768  15.613  90.954  1.00 55.14  ? 263 PHE A CA  1 
ATOM   1716 C C   . PHE A 1 228 ? 0.037   16.799  90.461  1.00 57.17  ? 263 PHE A C   1 
ATOM   1717 O O   . PHE A 1 228 ? 0.043   17.857  91.088  1.00 56.46  ? 263 PHE A O   1 
ATOM   1718 C CB  . PHE A 1 228 ? -2.143  16.038  91.466  1.00 56.20  ? 263 PHE A CB  1 
ATOM   1719 C CG  . PHE A 1 228 ? -2.956  16.825  90.479  1.00 58.38  ? 263 PHE A CG  1 
ATOM   1720 C CD1 . PHE A 1 228 ? -3.097  16.396  89.167  1.00 60.62  ? 263 PHE A CD1 1 
ATOM   1721 C CD2 . PHE A 1 228 ? -3.619  17.977  90.879  1.00 59.36  ? 263 PHE A CD2 1 
ATOM   1722 C CE1 . PHE A 1 228 ? -3.862  17.121  88.264  1.00 60.32  ? 263 PHE A CE1 1 
ATOM   1723 C CE2 . PHE A 1 228 ? -4.384  18.700  89.988  1.00 61.23  ? 263 PHE A CE2 1 
ATOM   1724 C CZ  . PHE A 1 228 ? -4.506  18.271  88.675  1.00 61.71  ? 263 PHE A CZ  1 
ATOM   1725 N N   . LEU A 1 229 ? 0.695   16.623  89.318  1.00 57.58  ? 264 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 229 ? 1.706   17.575  88.870  1.00 60.26  ? 264 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 229 ? 1.190   18.481  87.765  1.00 62.35  ? 264 LEU A C   1 
ATOM   1728 O O   . LEU A 1 229 ? 1.004   18.049  86.630  1.00 64.65  ? 264 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 229 ? 2.960   16.834  88.392  1.00 59.54  ? 264 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 229 ? 4.203   17.666  88.054  1.00 61.29  ? 264 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 229 ? 4.715   18.428  89.279  1.00 56.29  ? 264 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 229 ? 5.303   16.776  87.479  1.00 58.16  ? 264 LEU A CD2 1 
ATOM   1733 N N   . VAL A 1 230 ? 0.975   19.745  88.101  1.00 62.99  ? 265 VAL A N   1 
ATOM   1734 C CA  . VAL A 1 230 ? 0.566   20.730  87.112  1.00 69.00  ? 265 VAL A CA  1 
ATOM   1735 C C   . VAL A 1 230 ? 1.663   21.778  87.026  1.00 70.62  ? 265 VAL A C   1 
ATOM   1736 O O   . VAL A 1 230 ? 2.425   21.820  86.058  1.00 70.71  ? 265 VAL A O   1 
ATOM   1737 C CB  . VAL A 1 230 ? -0.770  21.392  87.487  1.00 70.43  ? 265 VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 230 ? -1.171  22.404  86.425  1.00 71.41  ? 265 VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 230 ? -1.854  20.332  87.661  1.00 66.25  ? 265 VAL A CG2 1 
ATOM   1740 N N   . SER A 1 231 ? 1.745   22.613  88.056  1.00 69.57  ? 266 SER A N   1 
ATOM   1741 C CA  . SER A 1 231 ? 2.877   23.509  88.227  1.00 69.77  ? 266 SER A CA  1 
ATOM   1742 C C   . SER A 1 231 ? 3.962   22.799  89.038  1.00 68.04  ? 266 SER A C   1 
ATOM   1743 O O   . SER A 1 231 ? 3.681   21.839  89.754  1.00 59.90  ? 266 SER A O   1 
ATOM   1744 C CB  . SER A 1 231 ? 2.438   24.799  88.915  1.00 70.43  ? 266 SER A CB  1 
ATOM   1745 O OG  . SER A 1 231 ? 1.690   24.510  90.078  1.00 73.42  ? 266 SER A OG  1 
ATOM   1746 N N   . PRO A 1 232 ? 5.212   23.262  88.917  1.00 68.73  ? 267 PRO A N   1 
ATOM   1747 C CA  . PRO A 1 232 ? 6.308   22.579  89.604  1.00 66.94  ? 267 PRO A CA  1 
ATOM   1748 C C   . PRO A 1 232 ? 5.995   22.347  91.077  1.00 68.35  ? 267 PRO A C   1 
ATOM   1749 O O   . PRO A 1 232 ? 5.361   23.182  91.722  1.00 72.89  ? 267 PRO A O   1 
ATOM   1750 C CB  . PRO A 1 232 ? 7.472   23.558  89.444  1.00 66.81  ? 267 PRO A CB  1 
ATOM   1751 C CG  . PRO A 1 232 ? 7.189   24.237  88.147  1.00 65.95  ? 267 PRO A CG  1 
ATOM   1752 C CD  . PRO A 1 232 ? 5.690   24.382  88.086  1.00 68.35  ? 267 PRO A CD  1 
ATOM   1753 N N   . ILE A 1 233 ? 6.431   21.206  91.596  1.00 64.67  ? 268 ILE A N   1 
ATOM   1754 C CA  . ILE A 1 233 ? 6.174   20.840  92.980  1.00 58.64  ? 268 ILE A CA  1 
ATOM   1755 C C   . ILE A 1 233 ? 7.490   20.581  93.700  1.00 57.95  ? 268 ILE A C   1 
ATOM   1756 O O   . ILE A 1 233 ? 8.443   20.072  93.107  1.00 58.19  ? 268 ILE A O   1 
ATOM   1757 C CB  . ILE A 1 233 ? 5.277   19.586  93.063  1.00 58.89  ? 268 ILE A CB  1 
ATOM   1758 C CG1 . ILE A 1 233 ? 3.822   19.953  92.764  1.00 62.88  ? 268 ILE A CG1 1 
ATOM   1759 C CG2 . ILE A 1 233 ? 5.364   18.944  94.430  1.00 56.94  ? 268 ILE A CG2 1 
ATOM   1760 C CD1 . ILE A 1 233 ? 2.871   18.778  92.874  1.00 64.74  ? 268 ILE A CD1 1 
ATOM   1761 N N   . THR A 1 234 ? 7.544   20.943  94.976  1.00 56.28  ? 269 THR A N   1 
ATOM   1762 C CA  . THR A 1 234 ? 8.729   20.695  95.785  1.00 58.24  ? 269 THR A CA  1 
ATOM   1763 C C   . THR A 1 234 ? 8.561   19.395  96.568  1.00 58.45  ? 269 THR A C   1 
ATOM   1764 O O   . THR A 1 234 ? 7.712   19.306  97.449  1.00 58.47  ? 269 THR A O   1 
ATOM   1765 C CB  . THR A 1 234 ? 8.992   21.865  96.757  1.00 61.86  ? 269 THR A CB  1 
ATOM   1766 O OG1 . THR A 1 234 ? 9.311   23.046  96.009  1.00 66.02  ? 269 THR A OG1 1 
ATOM   1767 C CG2 . THR A 1 234 ? 10.142  21.546  97.720  1.00 58.18  ? 269 THR A CG2 1 
ATOM   1768 N N   . ILE A 1 235 ? 9.367   18.388  96.232  1.00 60.41  ? 270 ILE A N   1 
ATOM   1769 C CA  . ILE A 1 235 ? 9.325   17.101  96.920  1.00 59.00  ? 270 ILE A CA  1 
ATOM   1770 C C   . ILE A 1 235 ? 10.005  17.199  98.287  1.00 60.19  ? 270 ILE A C   1 
ATOM   1771 O O   . ILE A 1 235 ? 11.063  17.821  98.417  1.00 63.79  ? 270 ILE A O   1 
ATOM   1772 C CB  . ILE A 1 235 ? 10.004  15.987  96.091  1.00 56.81  ? 270 ILE A CB  1 
ATOM   1773 C CG1 . ILE A 1 235 ? 9.399   15.901  94.680  1.00 57.66  ? 270 ILE A CG1 1 
ATOM   1774 C CG2 . ILE A 1 235 ? 9.899   14.648  96.814  1.00 54.32  ? 270 ILE A CG2 1 
ATOM   1775 C CD1 . ILE A 1 235 ? 7.903   15.603  94.644  1.00 51.50  ? 270 ILE A CD1 1 
ATOM   1776 N N   . LEU A 1 236 ? 9.396   16.584  99.299  1.00 57.91  ? 271 LEU A N   1 
ATOM   1777 C CA  . LEU A 1 236 ? 9.882   16.691  100.677 1.00 61.80  ? 271 LEU A CA  1 
ATOM   1778 C C   . LEU A 1 236 ? 10.276  15.357  101.301 1.00 59.53  ? 271 LEU A C   1 
ATOM   1779 O O   . LEU A 1 236 ? 9.502   14.394  101.291 1.00 56.64  ? 271 LEU A O   1 
ATOM   1780 C CB  . LEU A 1 236 ? 8.827   17.336  101.576 1.00 69.81  ? 271 LEU A CB  1 
ATOM   1781 C CG  . LEU A 1 236 ? 8.466   18.801  101.356 1.00 78.80  ? 271 LEU A CG  1 
ATOM   1782 C CD1 . LEU A 1 236 ? 7.139   19.126  102.033 1.00 83.52  ? 271 LEU A CD1 1 
ATOM   1783 C CD2 . LEU A 1 236 ? 9.568   19.684  101.891 1.00 81.21  ? 271 LEU A CD2 1 
ATOM   1784 N N   . HIS A 1 237 ? 11.485  15.319  101.849 1.00 61.76  ? 272 HIS A N   1 
ATOM   1785 C CA  . HIS A 1 237 ? 11.918  14.229  102.711 1.00 61.32  ? 272 HIS A CA  1 
ATOM   1786 C C   . HIS A 1 237 ? 12.153  14.754  104.121 1.00 62.04  ? 272 HIS A C   1 
ATOM   1787 O O   . HIS A 1 237 ? 13.113  15.488  104.365 1.00 62.03  ? 272 HIS A O   1 
ATOM   1788 C CB  . HIS A 1 237 ? 13.208  13.610  102.179 1.00 62.05  ? 272 HIS A CB  1 
ATOM   1789 C CG  . HIS A 1 237 ? 13.863  12.670  103.141 1.00 62.69  ? 272 HIS A CG  1 
ATOM   1790 N ND1 . HIS A 1 237 ? 13.242  11.532  103.608 1.00 61.06  ? 272 HIS A ND1 1 
ATOM   1791 C CD2 . HIS A 1 237 ? 15.086  12.700  103.725 1.00 63.19  ? 272 HIS A CD2 1 
ATOM   1792 C CE1 . HIS A 1 237 ? 14.051  10.901  104.439 1.00 63.09  ? 272 HIS A CE1 1 
ATOM   1793 N NE2 . HIS A 1 237 ? 15.178  11.587  104.526 1.00 64.74  ? 272 HIS A NE2 1 
ATOM   1794 N N   . GLU A 1 238 ? 11.280  14.382  105.050 1.00 64.59  ? 273 GLU A N   1 
ATOM   1795 C CA  . GLU A 1 238 ? 11.501  14.707  106.455 1.00 70.81  ? 273 GLU A CA  1 
ATOM   1796 C C   . GLU A 1 238 ? 12.665  13.868  106.972 1.00 66.96  ? 273 GLU A C   1 
ATOM   1797 O O   . GLU A 1 238 ? 12.660  12.641  106.849 1.00 63.48  ? 273 GLU A O   1 
ATOM   1798 C CB  . GLU A 1 238 ? 10.238  14.453  107.291 1.00 78.10  ? 273 GLU A CB  1 
ATOM   1799 C CG  . GLU A 1 238 ? 9.066   15.374  106.945 1.00 89.06  ? 273 GLU A CG  1 
ATOM   1800 C CD  . GLU A 1 238 ? 7.771   15.020  107.679 1.00 96.23  ? 273 GLU A CD  1 
ATOM   1801 O OE1 . GLU A 1 238 ? 7.826   14.280  108.687 1.00 97.25  ? 273 GLU A OE1 1 
ATOM   1802 O OE2 . GLU A 1 238 ? 6.693   15.487  107.242 1.00 96.55  ? 273 GLU A OE2 1 
ATOM   1803 N N   . ILE A 1 239 ? 13.662  14.529  107.547 1.00 64.29  ? 274 ILE A N   1 
ATOM   1804 C CA  . ILE A 1 239 ? 14.815  13.825  108.083 1.00 63.39  ? 274 ILE A CA  1 
ATOM   1805 C C   . ILE A 1 239 ? 14.548  13.487  109.548 1.00 65.70  ? 274 ILE A C   1 
ATOM   1806 O O   . ILE A 1 239 ? 14.495  14.369  110.402 1.00 68.29  ? 274 ILE A O   1 
ATOM   1807 C CB  . ILE A 1 239 ? 16.083  14.689  107.967 1.00 65.09  ? 274 ILE A CB  1 
ATOM   1808 C CG1 . ILE A 1 239 ? 16.236  15.211  106.534 1.00 66.22  ? 274 ILE A CG1 1 
ATOM   1809 C CG2 . ILE A 1 239 ? 17.315  13.908  108.410 1.00 65.29  ? 274 ILE A CG2 1 
ATOM   1810 C CD1 . ILE A 1 239 ? 17.356  16.215  106.349 1.00 59.17  ? 274 ILE A CD1 1 
ATOM   1811 N N   . ASN A 1 240 ? 14.383  12.199  109.833 1.00 65.14  ? 275 ASN A N   1 
ATOM   1812 C CA  . ASN A 1 240 ? 14.033  11.746  111.175 1.00 66.38  ? 275 ASN A CA  1 
ATOM   1813 C C   . ASN A 1 240 ? 14.802  10.483  111.551 1.00 66.17  ? 275 ASN A C   1 
ATOM   1814 O O   . ASN A 1 240 ? 15.704  10.075  110.823 1.00 67.02  ? 275 ASN A O   1 
ATOM   1815 C CB  . ASN A 1 240 ? 12.518  11.532  111.300 1.00 63.99  ? 275 ASN A CB  1 
ATOM   1816 C CG  . ASN A 1 240 ? 11.990  10.487  110.333 1.00 65.37  ? 275 ASN A CG  1 
ATOM   1817 O OD1 . ASN A 1 240 ? 12.723  9.601   109.884 1.00 64.48  ? 275 ASN A OD1 1 
ATOM   1818 N ND2 . ASN A 1 240 ? 10.705  10.586  110.010 1.00 66.00  ? 275 ASN A ND2 1 
ATOM   1819 N N   . GLU A 1 241 ? 14.447  9.867   112.676 1.00 68.28  ? 276 GLU A N   1 
ATOM   1820 C CA  . GLU A 1 241 ? 15.162  8.686   113.162 1.00 75.01  ? 276 GLU A CA  1 
ATOM   1821 C C   . GLU A 1 241 ? 15.417  7.678   112.047 1.00 69.41  ? 276 GLU A C   1 
ATOM   1822 O O   . GLU A 1 241 ? 16.488  7.074   111.980 1.00 69.14  ? 276 GLU A O   1 
ATOM   1823 C CB  . GLU A 1 241 ? 14.357  7.966   114.241 1.00 84.25  ? 276 GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 241 ? 13.685  8.845   115.258 1.00 95.29  ? 276 GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 241 ? 12.862  8.029   116.241 1.00 102.51 ? 276 GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 241 ? 12.015  7.224   115.788 1.00 100.84 ? 276 GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 241 ? 13.075  8.183   117.465 1.00 107.10 ? 276 GLU A OE2 1 
ATOM   1828 N N   . ASP A 1 242 ? 14.422  7.498   111.181 1.00 62.68  ? 277 ASP A N   1 
ATOM   1829 C CA  . ASP A 1 242 ? 14.465  6.454   110.162 1.00 63.00  ? 277 ASP A CA  1 
ATOM   1830 C C   . ASP A 1 242 ? 15.151  6.900   108.875 1.00 63.06  ? 277 ASP A C   1 
ATOM   1831 O O   . ASP A 1 242 ? 15.300  6.114   107.942 1.00 64.45  ? 277 ASP A O   1 
ATOM   1832 C CB  . ASP A 1 242 ? 13.051  5.955   109.860 1.00 62.96  ? 277 ASP A CB  1 
ATOM   1833 C CG  . ASP A 1 242 ? 12.335  5.456   111.103 1.00 74.42  ? 277 ASP A CG  1 
ATOM   1834 O OD1 . ASP A 1 242 ? 12.948  4.701   111.892 1.00 76.78  ? 277 ASP A OD1 1 
ATOM   1835 O OD2 . ASP A 1 242 ? 11.161  5.831   111.300 1.00 79.15  ? 277 ASP A OD2 1 
ATOM   1836 N N   . SER A 1 243 ? 15.571  8.159   108.825 1.00 60.19  ? 278 SER A N   1 
ATOM   1837 C CA  . SER A 1 243 ? 16.246  8.679   107.645 1.00 60.24  ? 278 SER A CA  1 
ATOM   1838 C C   . SER A 1 243 ? 17.739  8.374   107.679 1.00 65.65  ? 278 SER A C   1 
ATOM   1839 O O   . SER A 1 243 ? 18.360  8.401   108.738 1.00 68.49  ? 278 SER A O   1 
ATOM   1840 C CB  . SER A 1 243 ? 16.018  10.187  107.515 1.00 59.27  ? 278 SER A CB  1 
ATOM   1841 O OG  . SER A 1 243 ? 16.848  10.743  106.511 1.00 59.34  ? 278 SER A OG  1 
ATOM   1842 N N   . PRO A 1 244 ? 18.318  8.076   106.510 1.00 67.31  ? 279 PRO A N   1 
ATOM   1843 C CA  . PRO A 1 244 ? 19.761  7.855   106.363 1.00 69.21  ? 279 PRO A CA  1 
ATOM   1844 C C   . PRO A 1 244 ? 20.534  9.150   106.589 1.00 67.71  ? 279 PRO A C   1 
ATOM   1845 O O   . PRO A 1 244 ? 21.742  9.118   106.806 1.00 71.04  ? 279 PRO A O   1 
ATOM   1846 C CB  . PRO A 1 244 ? 19.909  7.429   104.893 1.00 69.61  ? 279 PRO A CB  1 
ATOM   1847 C CG  . PRO A 1 244 ? 18.526  7.100   104.423 1.00 69.01  ? 279 PRO A CG  1 
ATOM   1848 C CD  . PRO A 1 244 ? 17.606  7.952   105.229 1.00 66.93  ? 279 PRO A CD  1 
ATOM   1849 N N   . LEU A 1 245 ? 19.837  10.278  106.514 1.00 64.34  ? 280 LEU A N   1 
ATOM   1850 C CA  . LEU A 1 245 ? 20.461  11.588  106.670 1.00 67.94  ? 280 LEU A CA  1 
ATOM   1851 C C   . LEU A 1 245 ? 20.322  12.111  108.099 1.00 66.63  ? 280 LEU A C   1 
ATOM   1852 O O   . LEU A 1 245 ? 20.743  13.223  108.409 1.00 66.29  ? 280 LEU A O   1 
ATOM   1853 C CB  . LEU A 1 245 ? 19.851  12.582  105.675 1.00 71.69  ? 280 LEU A CB  1 
ATOM   1854 C CG  . LEU A 1 245 ? 19.926  12.168  104.202 1.00 74.32  ? 280 LEU A CG  1 
ATOM   1855 C CD1 . LEU A 1 245 ? 19.159  13.131  103.320 1.00 72.83  ? 280 LEU A CD1 1 
ATOM   1856 C CD2 . LEU A 1 245 ? 21.372  12.074  103.753 1.00 79.71  ? 280 LEU A CD2 1 
ATOM   1857 N N   . PHE A 1 246 ? 19.726  11.294  108.961 1.00 66.87  ? 281 PHE A N   1 
ATOM   1858 C CA  . PHE A 1 246 ? 19.427  11.686  110.333 1.00 67.21  ? 281 PHE A CA  1 
ATOM   1859 C C   . PHE A 1 246 ? 20.629  12.294  111.050 1.00 70.76  ? 281 PHE A C   1 
ATOM   1860 O O   . PHE A 1 246 ? 20.498  13.286  111.774 1.00 71.07  ? 281 PHE A O   1 
ATOM   1861 C CB  . PHE A 1 246 ? 18.904  10.477  111.116 1.00 64.20  ? 281 PHE A CB  1 
ATOM   1862 C CG  . PHE A 1 246 ? 18.350  10.819  112.468 1.00 63.28  ? 281 PHE A CG  1 
ATOM   1863 C CD1 . PHE A 1 246 ? 17.411  11.829  112.613 1.00 62.94  ? 281 PHE A CD1 1 
ATOM   1864 C CD2 . PHE A 1 246 ? 18.755  10.117  113.594 1.00 66.76  ? 281 PHE A CD2 1 
ATOM   1865 C CE1 . PHE A 1 246 ? 16.888  12.137  113.856 1.00 64.22  ? 281 PHE A CE1 1 
ATOM   1866 C CE2 . PHE A 1 246 ? 18.236  10.418  114.845 1.00 66.19  ? 281 PHE A CE2 1 
ATOM   1867 C CZ  . PHE A 1 246 ? 17.301  11.430  114.978 1.00 65.85  ? 281 PHE A CZ  1 
ATOM   1868 N N   . GLY A 1 247 ? 21.799  11.702  110.842 1.00 71.65  ? 282 GLY A N   1 
ATOM   1869 C CA  . GLY A 1 247 ? 22.981  12.108  111.579 1.00 73.23  ? 282 GLY A CA  1 
ATOM   1870 C C   . GLY A 1 247 ? 23.853  13.114  110.858 1.00 75.61  ? 282 GLY A C   1 
ATOM   1871 O O   . GLY A 1 247 ? 24.937  13.442  111.332 1.00 76.96  ? 282 GLY A O   1 
ATOM   1872 N N   . ILE A 1 248 ? 23.379  13.612  109.720 1.00 77.32  ? 283 ILE A N   1 
ATOM   1873 C CA  . ILE A 1 248 ? 24.177  14.498  108.875 1.00 78.75  ? 283 ILE A CA  1 
ATOM   1874 C C   . ILE A 1 248 ? 23.928  15.986  109.134 1.00 75.55  ? 283 ILE A C   1 
ATOM   1875 O O   . ILE A 1 248 ? 22.803  16.473  109.008 1.00 70.57  ? 283 ILE A O   1 
ATOM   1876 C CB  . ILE A 1 248 ? 23.933  14.196  107.387 1.00 79.28  ? 283 ILE A CB  1 
ATOM   1877 C CG1 . ILE A 1 248 ? 24.422  12.788  107.053 1.00 83.36  ? 283 ILE A CG1 1 
ATOM   1878 C CG2 . ILE A 1 248 ? 24.629  15.221  106.508 1.00 77.64  ? 283 ILE A CG2 1 
ATOM   1879 C CD1 . ILE A 1 248 ? 24.188  12.390  105.616 1.00 86.66  ? 283 ILE A CD1 1 
ATOM   1880 N N   . SER A 1 249 ? 24.989  16.704  109.490 1.00 74.87  ? 284 SER A N   1 
ATOM   1881 C CA  . SER A 1 249 ? 24.901  18.142  109.719 1.00 75.56  ? 284 SER A CA  1 
ATOM   1882 C C   . SER A 1 249 ? 25.399  18.896  108.491 1.00 74.88  ? 284 SER A C   1 
ATOM   1883 O O   . SER A 1 249 ? 25.832  18.282  107.517 1.00 72.73  ? 284 SER A O   1 
ATOM   1884 C CB  . SER A 1 249 ? 25.729  18.538  110.936 1.00 74.89  ? 284 SER A CB  1 
ATOM   1885 O OG  . SER A 1 249 ? 27.109  18.368  110.668 1.00 78.68  ? 284 SER A OG  1 
ATOM   1886 N N   . ARG A 1 250 ? 25.347  20.223  108.541 1.00 73.61  ? 285 ARG A N   1 
ATOM   1887 C CA  . ARG A 1 250 ? 25.800  21.029  107.416 1.00 78.68  ? 285 ARG A CA  1 
ATOM   1888 C C   . ARG A 1 250 ? 27.288  20.819  107.137 1.00 82.06  ? 285 ARG A C   1 
ATOM   1889 O O   . ARG A 1 250 ? 27.715  20.797  105.981 1.00 83.44  ? 285 ARG A O   1 
ATOM   1890 C CB  . ARG A 1 250 ? 25.519  22.517  107.642 1.00 75.59  ? 285 ARG A CB  1 
ATOM   1891 C CG  . ARG A 1 250 ? 26.044  23.386  106.506 1.00 76.63  ? 285 ARG A CG  1 
ATOM   1892 C CD  . ARG A 1 250 ? 25.790  24.866  106.718 1.00 85.43  ? 285 ARG A CD  1 
ATOM   1893 N NE  . ARG A 1 250 ? 27.031  25.627  106.602 1.00 94.34  ? 285 ARG A NE  1 
ATOM   1894 C CZ  . ARG A 1 250 ? 27.117  26.869  106.136 1.00 98.34  ? 285 ARG A CZ  1 
ATOM   1895 N NH1 . ARG A 1 250 ? 26.029  27.507  105.724 1.00 99.47  ? 285 ARG A NH1 1 
ATOM   1896 N NH2 . ARG A 1 250 ? 28.298  27.469  106.075 1.00 98.70  ? 285 ARG A NH2 1 
ATOM   1897 N N   . GLN A 1 251 ? 28.073  20.663  108.198 1.00 83.45  ? 286 GLN A N   1 
ATOM   1898 C CA  . GLN A 1 251 ? 29.509  20.473  108.047 1.00 87.17  ? 286 GLN A CA  1 
ATOM   1899 C C   . GLN A 1 251 ? 29.837  19.072  107.533 1.00 88.06  ? 286 GLN A C   1 
ATOM   1900 O O   . GLN A 1 251 ? 30.793  18.889  106.781 1.00 89.21  ? 286 GLN A O   1 
ATOM   1901 C CB  . GLN A 1 251 ? 30.242  20.750  109.361 1.00 90.48  ? 286 GLN A CB  1 
ATOM   1902 C CG  . GLN A 1 251 ? 31.750  20.621  109.246 1.00 96.48  ? 286 GLN A CG  1 
ATOM   1903 C CD  . GLN A 1 251 ? 32.472  21.038  110.509 1.00 104.45 ? 286 GLN A CD  1 
ATOM   1904 O OE1 . GLN A 1 251 ? 31.847  21.441  111.491 1.00 107.04 ? 286 GLN A OE1 1 
ATOM   1905 N NE2 . GLN A 1 251 ? 33.797  20.947  110.489 1.00 109.35 ? 286 GLN A NE2 1 
ATOM   1906 N N   . ASP A 1 252 ? 29.041  18.087  107.940 1.00 86.74  ? 287 ASP A N   1 
ATOM   1907 C CA  . ASP A 1 252 ? 29.210  16.726  107.445 1.00 87.92  ? 287 ASP A CA  1 
ATOM   1908 C C   . ASP A 1 252 ? 29.054  16.713  105.930 1.00 87.09  ? 287 ASP A C   1 
ATOM   1909 O O   . ASP A 1 252 ? 29.657  15.898  105.236 1.00 88.00  ? 287 ASP A O   1 
ATOM   1910 C CB  . ASP A 1 252 ? 28.182  15.781  108.077 1.00 89.63  ? 287 ASP A CB  1 
ATOM   1911 C CG  . ASP A 1 252 ? 28.460  15.502  109.544 1.00 95.23  ? 287 ASP A CG  1 
ATOM   1912 O OD1 . ASP A 1 252 ? 29.637  15.597  109.961 1.00 102.79 ? 287 ASP A OD1 1 
ATOM   1913 O OD2 . ASP A 1 252 ? 27.501  15.179  110.280 1.00 92.33  ? 287 ASP A OD2 1 
ATOM   1914 N N   . LEU A 1 253 ? 28.237  17.631  105.428 1.00 86.74  ? 288 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 253 ? 27.902  17.686  104.010 1.00 85.57  ? 288 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 253 ? 29.111  18.016  103.134 1.00 90.49  ? 288 LEU A C   1 
ATOM   1917 O O   . LEU A 1 253 ? 29.246  17.490  102.030 1.00 90.68  ? 288 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 253 ? 26.791  18.712  103.785 1.00 80.92  ? 288 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 253 ? 25.757  18.440  102.696 1.00 76.96  ? 288 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 253 ? 25.112  17.074  102.886 1.00 75.30  ? 288 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 253 ? 24.703  19.536  102.708 1.00 73.99  ? 288 LEU A CD2 1 
ATOM   1922 N N   . GLU A 1 254 ? 29.990  18.884  103.626 1.00 95.89  ? 289 GLU A N   1 
ATOM   1923 C CA  . GLU A 1 254 ? 31.146  19.313  102.841 1.00 102.94 ? 289 GLU A CA  1 
ATOM   1924 C C   . GLU A 1 254 ? 32.278  18.296  102.938 1.00 103.62 ? 289 GLU A C   1 
ATOM   1925 O O   . GLU A 1 254 ? 33.314  18.430  102.290 1.00 104.06 ? 289 GLU A O   1 
ATOM   1926 C CB  . GLU A 1 254 ? 31.614  20.706  103.279 1.00 109.63 ? 289 GLU A CB  1 
ATOM   1927 C CG  . GLU A 1 254 ? 31.685  20.895  104.787 1.00 115.49 ? 289 GLU A CG  1 
ATOM   1928 C CD  . GLU A 1 254 ? 31.685  22.360  105.206 1.00 119.35 ? 289 GLU A CD  1 
ATOM   1929 O OE1 . GLU A 1 254 ? 30.808  23.117  104.730 1.00 117.84 ? 289 GLU A OE1 1 
ATOM   1930 O OE2 . GLU A 1 254 ? 32.560  22.751  106.012 1.00 121.56 ? 289 GLU A OE2 1 
ATOM   1931 N N   . THR A 1 255 ? 32.045  17.269  103.746 1.00 105.27 ? 290 THR A N   1 
ATOM   1932 C CA  . THR A 1 255 ? 32.983  16.172  103.947 1.00 110.37 ? 290 THR A CA  1 
ATOM   1933 C C   . THR A 1 255 ? 32.464  14.923  103.245 1.00 110.91 ? 290 THR A C   1 
ATOM   1934 O O   . THR A 1 255 ? 33.132  14.357  102.383 1.00 112.14 ? 290 THR A O   1 
ATOM   1935 C CB  . THR A 1 255 ? 33.194  15.866  105.439 1.00 113.15 ? 290 THR A CB  1 
ATOM   1936 O OG1 . THR A 1 255 ? 33.726  17.022  106.097 1.00 114.92 ? 290 THR A OG1 1 
ATOM   1937 C CG2 . THR A 1 255 ? 34.156  14.701  105.610 1.00 115.25 ? 290 THR A CG2 1 
ATOM   1938 N N   . ASP A 1 256 ? 31.262  14.508  103.635 1.00 111.23 ? 291 ASP A N   1 
ATOM   1939 C CA  . ASP A 1 256 ? 30.673  13.235  103.224 1.00 111.03 ? 291 ASP A CA  1 
ATOM   1940 C C   . ASP A 1 256 ? 30.726  12.996  101.726 1.00 105.70 ? 291 ASP A C   1 
ATOM   1941 O O   . ASP A 1 256 ? 30.640  13.925  100.922 1.00 104.16 ? 291 ASP A O   1 
ATOM   1942 C CB  . ASP A 1 256 ? 29.206  13.155  103.663 1.00 113.05 ? 291 ASP A CB  1 
ATOM   1943 C CG  . ASP A 1 256 ? 29.020  12.395  104.958 1.00 118.25 ? 291 ASP A CG  1 
ATOM   1944 O OD1 . ASP A 1 256 ? 30.030  11.921  105.523 1.00 123.18 ? 291 ASP A OD1 1 
ATOM   1945 O OD2 . ASP A 1 256 ? 27.858  12.259  105.402 1.00 117.26 ? 291 ASP A OD2 1 
ATOM   1946 N N   . ASP A 1 257 ? 30.911  11.730  101.373 1.00 100.60 ? 292 ASP A N   1 
ATOM   1947 C CA  . ASP A 1 257 ? 30.844  11.295  99.995  1.00 95.46  ? 292 ASP A CA  1 
ATOM   1948 C C   . ASP A 1 257 ? 29.597  10.433  99.858  1.00 88.10  ? 292 ASP A C   1 
ATOM   1949 O O   . ASP A 1 257 ? 29.575  9.288   100.312 1.00 87.43  ? 292 ASP A O   1 
ATOM   1950 C CB  . ASP A 1 257 ? 32.078  10.449  99.680  1.00 100.17 ? 292 ASP A CB  1 
ATOM   1951 C CG  . ASP A 1 257 ? 32.533  10.577  98.242  1.00 103.61 ? 292 ASP A CG  1 
ATOM   1952 O OD1 . ASP A 1 257 ? 33.745  10.397  98.000  1.00 109.72 ? 292 ASP A OD1 1 
ATOM   1953 O OD2 . ASP A 1 257 ? 31.692  10.856  97.361  1.00 100.61 ? 292 ASP A OD2 1 
ATOM   1954 N N   . PHE A 1 258 ? 28.562  10.973  99.225  1.00 81.09  ? 293 PHE A N   1 
ATOM   1955 C CA  . PHE A 1 258 ? 27.381  10.181  98.911  1.00 73.74  ? 293 PHE A CA  1 
ATOM   1956 C C   . PHE A 1 258 ? 26.558  10.832  97.810  1.00 71.54  ? 293 PHE A C   1 
ATOM   1957 O O   . PHE A 1 258 ? 26.837  11.957  97.389  1.00 70.07  ? 293 PHE A O   1 
ATOM   1958 C CB  . PHE A 1 258 ? 26.519  9.935   100.159 1.00 69.45  ? 293 PHE A CB  1 
ATOM   1959 C CG  . PHE A 1 258 ? 25.771  11.151  100.641 1.00 70.31  ? 293 PHE A CG  1 
ATOM   1960 C CD1 . PHE A 1 258 ? 24.554  11.509  100.072 1.00 68.18  ? 293 PHE A CD1 1 
ATOM   1961 C CD2 . PHE A 1 258 ? 26.273  11.927  101.675 1.00 73.61  ? 293 PHE A CD2 1 
ATOM   1962 C CE1 . PHE A 1 258 ? 23.861  12.625  100.516 1.00 68.45  ? 293 PHE A CE1 1 
ATOM   1963 C CE2 . PHE A 1 258 ? 25.582  13.047  102.126 1.00 73.59  ? 293 PHE A CE2 1 
ATOM   1964 C CZ  . PHE A 1 258 ? 24.375  13.394  101.544 1.00 70.87  ? 293 PHE A CZ  1 
ATOM   1965 N N   . GLU A 1 259 ? 25.518  10.129  97.378  1.00 70.29  ? 294 GLU A N   1 
ATOM   1966 C CA  . GLU A 1 259 ? 24.731  10.544  96.229  1.00 67.73  ? 294 GLU A CA  1 
ATOM   1967 C C   . GLU A 1 259 ? 23.264  10.251  96.479  1.00 65.06  ? 294 GLU A C   1 
ATOM   1968 O O   . GLU A 1 259 ? 22.914  9.224   97.059  1.00 64.82  ? 294 GLU A O   1 
ATOM   1969 C CB  . GLU A 1 259 ? 25.213  9.808   94.974  1.00 68.65  ? 294 GLU A CB  1 
ATOM   1970 C CG  . GLU A 1 259 ? 24.370  10.034  93.727  1.00 68.27  ? 294 GLU A CG  1 
ATOM   1971 C CD  . GLU A 1 259 ? 24.948  9.330   92.508  1.00 72.31  ? 294 GLU A CD  1 
ATOM   1972 O OE1 . GLU A 1 259 ? 24.331  9.395   91.424  1.00 72.58  ? 294 GLU A OE1 1 
ATOM   1973 O OE2 . GLU A 1 259 ? 26.028  8.713   92.633  1.00 75.71  ? 294 GLU A OE2 1 
ATOM   1974 N N   . ILE A 1 260 ? 22.402  11.159  96.049  1.00 62.63  ? 295 ILE A N   1 
ATOM   1975 C CA  . ILE A 1 260 ? 20.976  10.921  96.160  1.00 60.85  ? 295 ILE A CA  1 
ATOM   1976 C C   . ILE A 1 260 ? 20.339  10.870  94.779  1.00 61.02  ? 295 ILE A C   1 
ATOM   1977 O O   . ILE A 1 260 ? 20.432  11.822  93.997  1.00 57.81  ? 295 ILE A O   1 
ATOM   1978 C CB  . ILE A 1 260 ? 20.294  11.967  97.057  1.00 61.80  ? 295 ILE A CB  1 
ATOM   1979 C CG1 . ILE A 1 260 ? 20.842  11.847  98.486  1.00 62.06  ? 295 ILE A CG1 1 
ATOM   1980 C CG2 . ILE A 1 260 ? 18.776  11.779  97.032  1.00 59.56  ? 295 ILE A CG2 1 
ATOM   1981 C CD1 . ILE A 1 260 ? 20.310  12.873  99.443  1.00 64.29  ? 295 ILE A CD1 1 
ATOM   1982 N N   . VAL A 1 261 ? 19.719  9.734   94.476  1.00 58.96  ? 296 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 261 ? 19.028  9.558   93.209  1.00 59.12  ? 296 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 261 ? 17.540  9.847   93.388  1.00 58.20  ? 296 VAL A C   1 
ATOM   1985 O O   . VAL A 1 261 ? 16.897  9.321   94.303  1.00 55.02  ? 296 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 261 ? 19.222  8.136   92.644  1.00 59.49  ? 296 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 261 ? 18.440  7.970   91.344  1.00 59.62  ? 296 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 261 ? 20.704  7.849   92.421  1.00 59.97  ? 296 VAL A CG2 1 
ATOM   1989 N N   . VAL A 1 262 ? 16.997  10.696  92.521  1.00 56.68  ? 297 VAL A N   1 
ATOM   1990 C CA  . VAL A 1 262 ? 15.582  11.023  92.588  1.00 56.85  ? 297 VAL A CA  1 
ATOM   1991 C C   . VAL A 1 262 ? 14.855  10.504  91.362  1.00 59.74  ? 297 VAL A C   1 
ATOM   1992 O O   . VAL A 1 262 ? 15.356  10.596  90.242  1.00 61.21  ? 297 VAL A O   1 
ATOM   1993 C CB  . VAL A 1 262 ? 15.344  12.531  92.761  1.00 57.29  ? 297 VAL A CB  1 
ATOM   1994 C CG1 . VAL A 1 262 ? 15.858  12.982  94.123  1.00 53.88  ? 297 VAL A CG1 1 
ATOM   1995 C CG2 . VAL A 1 262 ? 16.010  13.317  91.634  1.00 54.98  ? 297 VAL A CG2 1 
ATOM   1996 N N   . ILE A 1 263 ? 13.672  9.944   91.587  1.00 59.45  ? 298 ILE A N   1 
ATOM   1997 C CA  . ILE A 1 263 ? 12.900  9.346   90.513  1.00 58.86  ? 298 ILE A CA  1 
ATOM   1998 C C   . ILE A 1 263 ? 11.489  9.911   90.476  1.00 56.82  ? 298 ILE A C   1 
ATOM   1999 O O   . ILE A 1 263 ? 10.891  10.198  91.513  1.00 54.11  ? 298 ILE A O   1 
ATOM   2000 C CB  . ILE A 1 263 ? 12.843  7.813   90.663  1.00 58.55  ? 298 ILE A CB  1 
ATOM   2001 C CG1 . ILE A 1 263 ? 14.261  7.237   90.591  1.00 60.18  ? 298 ILE A CG1 1 
ATOM   2002 C CG2 . ILE A 1 263 ? 11.933  7.193   89.594  1.00 51.77  ? 298 ILE A CG2 1 
ATOM   2003 C CD1 . ILE A 1 263 ? 14.405  5.839   91.148  1.00 59.58  ? 298 ILE A CD1 1 
ATOM   2004 N N   . LEU A 1 264 ? 10.974  10.092  89.266  1.00 53.77  ? 299 LEU A N   1 
ATOM   2005 C CA  . LEU A 1 264 ? 9.565   10.386  89.073  1.00 55.23  ? 299 LEU A CA  1 
ATOM   2006 C C   . LEU A 1 264 ? 9.022   9.423   88.031  1.00 58.20  ? 299 LEU A C   1 
ATOM   2007 O O   . LEU A 1 264 ? 9.515   9.373   86.902  1.00 61.92  ? 299 LEU A O   1 
ATOM   2008 C CB  . LEU A 1 264 ? 9.370   11.837  88.638  1.00 59.24  ? 299 LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 264 ? 7.959   12.288  88.263  1.00 64.59  ? 299 LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 264 ? 6.943   11.837  89.283  1.00 67.50  ? 299 LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 264 ? 7.926   13.798  88.122  1.00 68.73  ? 299 LEU A CD2 1 
ATOM   2012 N N   . GLU A 1 265 ? 8.027   8.633   88.418  1.00 51.41  ? 300 GLU A N   1 
ATOM   2013 C CA  . GLU A 1 265 ? 7.399   7.701   87.487  1.00 51.90  ? 300 GLU A CA  1 
ATOM   2014 C C   . GLU A 1 265 ? 5.937   8.051   87.235  1.00 52.06  ? 300 GLU A C   1 
ATOM   2015 O O   . GLU A 1 265 ? 5.250   8.583   88.110  1.00 51.48  ? 300 GLU A O   1 
ATOM   2016 C CB  . GLU A 1 265 ? 7.534   6.262   87.984  1.00 51.46  ? 300 GLU A CB  1 
ATOM   2017 C CG  . GLU A 1 265 ? 8.964   5.737   87.923  1.00 72.83  ? 300 GLU A CG  1 
ATOM   2018 C CD  . GLU A 1 265 ? 9.178   4.459   88.721  1.00 72.08  ? 300 GLU A CD  1 
ATOM   2019 O OE1 . GLU A 1 265 ? 8.509   4.270   89.761  1.00 70.89  ? 300 GLU A OE1 1 
ATOM   2020 O OE2 . GLU A 1 265 ? 10.026  3.641   88.307  1.00 72.57  ? 300 GLU A OE2 1 
ATOM   2021 N N   . GLY A 1 266 ? 5.467   7.756   86.029  1.00 53.07  ? 301 GLY A N   1 
ATOM   2022 C CA  . GLY A 1 266 ? 4.075   7.970   85.695  1.00 54.91  ? 301 GLY A CA  1 
ATOM   2023 C C   . GLY A 1 266 ? 3.770   7.691   84.240  1.00 59.02  ? 301 GLY A C   1 
ATOM   2024 O O   . GLY A 1 266 ? 4.667   7.436   83.437  1.00 62.54  ? 301 GLY A O   1 
ATOM   2025 N N   . MET A 1 267 ? 2.488   7.741   83.906  1.00 56.62  ? 302 MET A N   1 
ATOM   2026 C CA  . MET A 1 267 ? 2.041   7.493   82.552  1.00 60.27  ? 302 MET A CA  1 
ATOM   2027 C C   . MET A 1 267 ? 1.898   8.842   81.859  1.00 63.81  ? 302 MET A C   1 
ATOM   2028 O O   . MET A 1 267 ? 1.023   9.634   82.207  1.00 61.57  ? 302 MET A O   1 
ATOM   2029 C CB  . MET A 1 267 ? 0.701   6.756   82.581  1.00 63.72  ? 302 MET A CB  1 
ATOM   2030 C CG  . MET A 1 267 ? 0.474   5.828   81.399  1.00 71.64  ? 302 MET A CG  1 
ATOM   2031 S SD  . MET A 1 267 ? 0.654   6.646   79.804  1.00 102.39 ? 302 MET A SD  1 
ATOM   2032 C CE  . MET A 1 267 ? -0.633  7.897   79.895  1.00 73.01  ? 302 MET A CE  1 
ATOM   2033 N N   . VAL A 1 268 ? 2.760   9.116   80.887  1.00 69.34  ? 303 VAL A N   1 
ATOM   2034 C CA  . VAL A 1 268 ? 2.726   10.414  80.224  1.00 77.65  ? 303 VAL A CA  1 
ATOM   2035 C C   . VAL A 1 268 ? 1.629   10.433  79.176  1.00 80.97  ? 303 VAL A C   1 
ATOM   2036 O O   . VAL A 1 268 ? 1.642   9.621   78.257  1.00 78.05  ? 303 VAL A O   1 
ATOM   2037 C CB  . VAL A 1 268 ? 4.080   10.762  79.582  1.00 85.07  ? 303 VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 268 ? 3.964   12.028  78.747  1.00 90.23  ? 303 VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 268 ? 5.149   10.925  80.659  1.00 83.51  ? 303 VAL A CG2 1 
ATOM   2040 N N   . GLU A 1 269 ? 0.680   11.355  79.324  1.00 91.37  ? 304 GLU A N   1 
ATOM   2041 C CA  . GLU A 1 269 ? -0.480  11.417  78.435  1.00 102.22 ? 304 GLU A CA  1 
ATOM   2042 C C   . GLU A 1 269 ? -0.101  11.773  76.998  1.00 108.11 ? 304 GLU A C   1 
ATOM   2043 O O   . GLU A 1 269 ? -0.865  11.524  76.064  1.00 109.71 ? 304 GLU A O   1 
ATOM   2044 C CB  . GLU A 1 269 ? -1.535  12.389  78.971  1.00 105.78 ? 304 GLU A CB  1 
ATOM   2045 C CG  . GLU A 1 269 ? -2.602  11.724  79.833  1.00 108.41 ? 304 GLU A CG  1 
ATOM   2046 C CD  . GLU A 1 269 ? -3.803  12.623  80.083  1.00 113.41 ? 304 GLU A CD  1 
ATOM   2047 O OE1 . GLU A 1 269 ? -3.691  13.846  79.852  1.00 115.61 ? 304 GLU A OE1 1 
ATOM   2048 O OE2 . GLU A 1 269 ? -4.861  12.104  80.505  1.00 114.16 ? 304 GLU A OE2 1 
ATOM   2049 N N   . ALA A 1 270 ? 1.087   12.345  76.830  1.00 111.97 ? 305 ALA A N   1 
ATOM   2050 C CA  . ALA A 1 270 ? 1.604   12.671  75.506  1.00 119.55 ? 305 ALA A CA  1 
ATOM   2051 C C   . ALA A 1 270 ? 2.108   11.420  74.784  1.00 121.49 ? 305 ALA A C   1 
ATOM   2052 O O   . ALA A 1 270 ? 1.575   11.031  73.741  1.00 122.69 ? 305 ALA A O   1 
ATOM   2053 C CB  . ALA A 1 270 ? 2.713   13.712  75.612  1.00 120.02 ? 305 ALA A CB  1 
ATOM   2054 N N   . THR A 1 271 ? 3.140   10.798  75.349  1.00 118.90 ? 306 THR A N   1 
ATOM   2055 C CA  . THR A 1 271 ? 3.785   9.636   74.744  1.00 115.62 ? 306 THR A CA  1 
ATOM   2056 C C   . THR A 1 271 ? 2.991   8.340   74.930  1.00 108.67 ? 306 THR A C   1 
ATOM   2057 O O   . THR A 1 271 ? 3.305   7.320   74.315  1.00 107.17 ? 306 THR A O   1 
ATOM   2058 C CB  . THR A 1 271 ? 5.208   9.434   75.312  1.00 116.65 ? 306 THR A CB  1 
ATOM   2059 O OG1 . THR A 1 271 ? 5.128   9.123   76.709  1.00 115.83 ? 306 THR A OG1 1 
ATOM   2060 C CG2 . THR A 1 271 ? 6.047   10.693  75.126  1.00 116.32 ? 306 THR A CG2 1 
ATOM   2061 N N   . ALA A 1 272 ? 1.976   8.385   75.789  1.00 104.36 ? 307 ALA A N   1 
ATOM   2062 C CA  . ALA A 1 272 ? 1.122   7.225   76.054  1.00 101.17 ? 307 ALA A CA  1 
ATOM   2063 C C   . ALA A 1 272 ? 1.825   6.083   76.803  1.00 98.18  ? 307 ALA A C   1 
ATOM   2064 O O   . ALA A 1 272 ? 1.199   5.068   77.119  1.00 97.13  ? 307 ALA A O   1 
ATOM   2065 C CB  . ALA A 1 272 ? 0.497   6.714   74.765  1.00 101.46 ? 307 ALA A CB  1 
ATOM   2066 N N   . MET A 1 273 ? 3.118   6.244   77.077  1.00 94.51  ? 308 MET A N   1 
ATOM   2067 C CA  . MET A 1 273 ? 3.905   5.185   77.710  1.00 90.85  ? 308 MET A CA  1 
ATOM   2068 C C   . MET A 1 273 ? 4.346   5.529   79.132  1.00 84.56  ? 308 MET A C   1 
ATOM   2069 O O   . MET A 1 273 ? 4.564   6.694   79.467  1.00 86.04  ? 308 MET A O   1 
ATOM   2070 C CB  . MET A 1 273 ? 5.125   4.846   76.851  1.00 94.33  ? 308 MET A CB  1 
ATOM   2071 C CG  . MET A 1 273 ? 4.777   4.363   75.442  1.00 96.62  ? 308 MET A CG  1 
ATOM   2072 S SD  . MET A 1 273 ? 6.231   4.120   74.405  1.00 183.09 ? 308 MET A SD  1 
ATOM   2073 C CE  . MET A 1 273 ? 6.859   5.794   74.298  1.00 146.32 ? 308 MET A CE  1 
ATOM   2074 N N   . THR A 1 274 ? 4.472   4.506   79.969  1.00 79.98  ? 309 THR A N   1 
ATOM   2075 C CA  . THR A 1 274 ? 4.922   4.709   81.342  1.00 77.15  ? 309 THR A CA  1 
ATOM   2076 C C   . THR A 1 274 ? 6.375   5.171   81.335  1.00 70.95  ? 309 THR A C   1 
ATOM   2077 O O   . THR A 1 274 ? 7.210   4.601   80.636  1.00 71.89  ? 309 THR A O   1 
ATOM   2078 C CB  . THR A 1 274 ? 4.760   3.436   82.203  1.00 79.50  ? 309 THR A CB  1 
ATOM   2079 O OG1 . THR A 1 274 ? 3.376   3.060   82.248  1.00 81.96  ? 309 THR A OG1 1 
ATOM   2080 C CG2 . THR A 1 274 ? 5.244   3.687   83.615  1.00 76.83  ? 309 THR A CG2 1 
ATOM   2081 N N   . THR A 1 275 ? 6.663   6.210   82.114  1.00 66.06  ? 310 THR A N   1 
ATOM   2082 C CA  . THR A 1 275 ? 7.954   6.888   82.056  1.00 61.46  ? 310 THR A CA  1 
ATOM   2083 C C   . THR A 1 275 ? 8.669   6.906   83.397  1.00 56.77  ? 310 THR A C   1 
ATOM   2084 O O   . THR A 1 275 ? 8.039   7.015   84.441  1.00 59.49  ? 310 THR A O   1 
ATOM   2085 C CB  . THR A 1 275 ? 7.777   8.343   81.589  1.00 64.07  ? 310 THR A CB  1 
ATOM   2086 O OG1 . THR A 1 275 ? 7.197   8.346   80.282  1.00 71.49  ? 310 THR A OG1 1 
ATOM   2087 C CG2 . THR A 1 275 ? 9.106   9.066   81.543  1.00 58.78  ? 310 THR A CG2 1 
ATOM   2088 N N   . GLN A 1 276 ? 9.993   6.792   83.356  1.00 58.76  ? 311 GLN A N   1 
ATOM   2089 C CA  . GLN A 1 276 ? 10.823  7.007   84.534  1.00 56.97  ? 311 GLN A CA  1 
ATOM   2090 C C   . GLN A 1 276 ? 11.803  8.154   84.283  1.00 58.25  ? 311 GLN A C   1 
ATOM   2091 O O   . GLN A 1 276 ? 12.760  8.015   83.527  1.00 62.28  ? 311 GLN A O   1 
ATOM   2092 C CB  . GLN A 1 276 ? 11.598  5.734   84.867  1.00 55.63  ? 311 GLN A CB  1 
ATOM   2093 C CG  . GLN A 1 276 ? 12.463  5.833   86.110  1.00 60.64  ? 311 GLN A CG  1 
ATOM   2094 C CD  . GLN A 1 276 ? 13.237  4.552   86.376  1.00 65.73  ? 311 GLN A CD  1 
ATOM   2095 O OE1 . GLN A 1 276 ? 14.351  4.374   85.878  1.00 67.14  ? 311 GLN A OE1 1 
ATOM   2096 N NE2 . GLN A 1 276 ? 12.645  3.646   87.154  1.00 54.34  ? 311 GLN A NE2 1 
ATOM   2097 N N   . ALA A 1 277 ? 11.574  9.284   84.938  1.00 57.27  ? 312 ALA A N   1 
ATOM   2098 C CA  . ALA A 1 277 ? 12.506  10.398  84.863  1.00 58.25  ? 312 ALA A CA  1 
ATOM   2099 C C   . ALA A 1 277 ? 13.457  10.334  86.056  1.00 61.36  ? 312 ALA A C   1 
ATOM   2100 O O   . ALA A 1 277 ? 13.034  10.100  87.196  1.00 61.28  ? 312 ALA A O   1 
ATOM   2101 C CB  . ALA A 1 277 ? 11.759  11.718  84.838  1.00 56.77  ? 312 ALA A CB  1 
ATOM   2102 N N   . ARG A 1 278 ? 14.739  10.548  85.787  1.00 60.57  ? 313 ARG A N   1 
ATOM   2103 C CA  . ARG A 1 278 ? 15.771  10.402  86.799  1.00 57.10  ? 313 ARG A CA  1 
ATOM   2104 C C   . ARG A 1 278 ? 16.670  11.622  86.909  1.00 59.21  ? 313 ARG A C   1 
ATOM   2105 O O   . ARG A 1 278 ? 16.917  12.326  85.924  1.00 61.44  ? 313 ARG A O   1 
ATOM   2106 C CB  . ARG A 1 278 ? 16.650  9.201   86.464  1.00 64.37  ? 313 ARG A CB  1 
ATOM   2107 C CG  . ARG A 1 278 ? 16.098  7.867   86.881  1.00 64.12  ? 313 ARG A CG  1 
ATOM   2108 C CD  . ARG A 1 278 ? 16.868  6.743   86.205  1.00 70.33  ? 313 ARG A CD  1 
ATOM   2109 N NE  . ARG A 1 278 ? 16.128  6.234   85.058  1.00 75.75  ? 313 ARG A NE  1 
ATOM   2110 C CZ  . ARG A 1 278 ? 16.410  6.517   83.795  1.00 79.80  ? 313 ARG A CZ  1 
ATOM   2111 N NH1 . ARG A 1 278 ? 17.440  7.295   83.501  1.00 81.62  ? 313 ARG A NH1 1 
ATOM   2112 N NH2 . ARG A 1 278 ? 15.661  6.009   82.825  1.00 85.02  ? 313 ARG A NH2 1 
ATOM   2113 N N   . SER A 1 279 ? 17.173  11.858  88.114  1.00 58.69  ? 314 SER A N   1 
ATOM   2114 C CA  . SER A 1 279 ? 18.297  12.768  88.299  1.00 61.84  ? 314 SER A CA  1 
ATOM   2115 C C   . SER A 1 279 ? 19.097  12.391  89.542  1.00 62.42  ? 314 SER A C   1 
ATOM   2116 O O   . SER A 1 279 ? 18.827  11.371  90.185  1.00 61.37  ? 314 SER A O   1 
ATOM   2117 C CB  . SER A 1 279 ? 17.846  14.230  88.359  1.00 62.34  ? 314 SER A CB  1 
ATOM   2118 O OG  . SER A 1 279 ? 18.943  15.102  88.125  1.00 61.94  ? 314 SER A OG  1 
ATOM   2119 N N   . SER A 1 280 ? 20.085  13.215  89.872  1.00 62.55  ? 315 SER A N   1 
ATOM   2120 C CA  . SER A 1 280 ? 21.006  12.895  90.952  1.00 63.09  ? 315 SER A CA  1 
ATOM   2121 C C   . SER A 1 280 ? 21.532  14.148  91.642  1.00 64.04  ? 315 SER A C   1 
ATOM   2122 O O   . SER A 1 280 ? 21.736  15.185  91.007  1.00 64.28  ? 315 SER A O   1 
ATOM   2123 C CB  . SER A 1 280 ? 22.170  12.059  90.416  1.00 61.92  ? 315 SER A CB  1 
ATOM   2124 O OG  . SER A 1 280 ? 23.161  11.863  91.402  1.00 77.39  ? 315 SER A OG  1 
ATOM   2125 N N   . TYR A 1 281 ? 21.744  14.043  92.950  1.00 60.86  ? 316 TYR A N   1 
ATOM   2126 C CA  . TYR A 1 281 ? 22.391  15.100  93.711  1.00 63.01  ? 316 TYR A CA  1 
ATOM   2127 C C   . TYR A 1 281 ? 23.552  14.511  94.500  1.00 64.53  ? 316 TYR A C   1 
ATOM   2128 O O   . TYR A 1 281 ? 23.353  13.647  95.359  1.00 62.66  ? 316 TYR A O   1 
ATOM   2129 C CB  . TYR A 1 281 ? 21.397  15.784  94.659  1.00 63.43  ? 316 TYR A CB  1 
ATOM   2130 C CG  . TYR A 1 281 ? 20.176  16.330  93.956  1.00 63.61  ? 316 TYR A CG  1 
ATOM   2131 C CD1 . TYR A 1 281 ? 20.244  17.499  93.201  1.00 61.19  ? 316 TYR A CD1 1 
ATOM   2132 C CD2 . TYR A 1 281 ? 18.955  15.671  94.037  1.00 59.18  ? 316 TYR A CD2 1 
ATOM   2133 C CE1 . TYR A 1 281 ? 19.129  17.996  92.549  1.00 62.92  ? 316 TYR A CE1 1 
ATOM   2134 C CE2 . TYR A 1 281 ? 17.836  16.160  93.390  1.00 60.45  ? 316 TYR A CE2 1 
ATOM   2135 C CZ  . TYR A 1 281 ? 17.924  17.320  92.646  1.00 62.74  ? 316 TYR A CZ  1 
ATOM   2136 O OH  . TYR A 1 281 ? 16.802  17.798  91.999  1.00 63.44  ? 316 TYR A OH  1 
ATOM   2137 N N   . LEU A 1 282 ? 24.764  14.962  94.196  1.00 65.23  ? 317 LEU A N   1 
ATOM   2138 C CA  . LEU A 1 282 ? 25.910  14.636  95.029  1.00 66.63  ? 317 LEU A CA  1 
ATOM   2139 C C   . LEU A 1 282 ? 25.791  15.394  96.344  1.00 66.56  ? 317 LEU A C   1 
ATOM   2140 O O   . LEU A 1 282 ? 25.077  16.394  96.433  1.00 66.32  ? 317 LEU A O   1 
ATOM   2141 C CB  . LEU A 1 282 ? 27.217  15.010  94.330  1.00 76.46  ? 317 LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 282 ? 27.451  14.361  92.963  1.00 79.52  ? 317 LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 282 ? 28.787  14.791  92.378  1.00 80.21  ? 317 LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 282 ? 27.366  12.846  93.065  1.00 80.30  ? 317 LEU A CD2 1 
ATOM   2145 N N   . ALA A 1 283 ? 26.478  14.910  97.371  1.00 72.05  ? 318 ALA A N   1 
ATOM   2146 C CA  . ALA A 1 283 ? 26.511  15.604  98.651  1.00 73.04  ? 318 ALA A CA  1 
ATOM   2147 C C   . ALA A 1 283 ? 26.893  17.071  98.441  1.00 73.36  ? 318 ALA A C   1 
ATOM   2148 O O   . ALA A 1 283 ? 26.367  17.963  99.107  1.00 72.37  ? 318 ALA A O   1 
ATOM   2149 C CB  . ALA A 1 283 ? 27.485  14.919  99.602  1.00 72.86  ? 318 ALA A CB  1 
ATOM   2150 N N   . SER A 1 284 ? 27.800  17.312  97.498  1.00 74.07  ? 319 SER A N   1 
ATOM   2151 C CA  . SER A 1 284 ? 28.267  18.665  97.204  1.00 77.59  ? 319 SER A CA  1 
ATOM   2152 C C   . SER A 1 284 ? 27.242  19.516  96.452  1.00 76.16  ? 319 SER A C   1 
ATOM   2153 O O   . SER A 1 284 ? 27.388  20.734  96.361  1.00 79.97  ? 319 SER A O   1 
ATOM   2154 C CB  . SER A 1 284 ? 29.580  18.621  96.414  1.00 80.30  ? 319 SER A CB  1 
ATOM   2155 O OG  . SER A 1 284 ? 29.388  18.082  95.119  1.00 79.41  ? 319 SER A OG  1 
ATOM   2156 N N   . GLU A 1 285 ? 26.222  18.873  95.898  1.00 72.36  ? 320 GLU A N   1 
ATOM   2157 C CA  . GLU A 1 285 ? 25.195  19.583  95.141  1.00 73.49  ? 320 GLU A CA  1 
ATOM   2158 C C   . GLU A 1 285 ? 23.959  19.900  95.989  1.00 72.52  ? 320 GLU A C   1 
ATOM   2159 O O   . GLU A 1 285 ? 22.970  20.435  95.487  1.00 70.04  ? 320 GLU A O   1 
ATOM   2160 C CB  . GLU A 1 285 ? 24.808  18.790  93.890  1.00 74.72  ? 320 GLU A CB  1 
ATOM   2161 C CG  . GLU A 1 285 ? 25.965  18.556  92.926  1.00 76.86  ? 320 GLU A CG  1 
ATOM   2162 C CD  . GLU A 1 285 ? 25.643  17.521  91.857  1.00 78.03  ? 320 GLU A CD  1 
ATOM   2163 O OE1 . GLU A 1 285 ? 24.595  16.847  91.974  1.00 77.54  ? 320 GLU A OE1 1 
ATOM   2164 O OE2 . GLU A 1 285 ? 26.437  17.382  90.901  1.00 77.28  ? 320 GLU A OE2 1 
ATOM   2165 N N   . ILE A 1 286 ? 24.012  19.551  97.270  1.00 72.25  ? 321 ILE A N   1 
ATOM   2166 C CA  . ILE A 1 286 ? 22.917  19.852  98.185  1.00 71.13  ? 321 ILE A CA  1 
ATOM   2167 C C   . ILE A 1 286 ? 23.207  21.160  98.911  1.00 74.49  ? 321 ILE A C   1 
ATOM   2168 O O   . ILE A 1 286 ? 24.287  21.339  99.478  1.00 75.93  ? 321 ILE A O   1 
ATOM   2169 C CB  . ILE A 1 286 ? 22.706  18.721  99.207  1.00 68.34  ? 321 ILE A CB  1 
ATOM   2170 C CG1 . ILE A 1 286 ? 22.448  17.397  98.483  1.00 67.34  ? 321 ILE A CG1 1 
ATOM   2171 C CG2 . ILE A 1 286 ? 21.558  19.060  100.153 1.00 63.80  ? 321 ILE A CG2 1 
ATOM   2172 C CD1 . ILE A 1 286 ? 22.411  16.204  99.403  1.00 67.73  ? 321 ILE A CD1 1 
ATOM   2173 N N   . LEU A 1 287 ? 22.250  22.081  98.881  1.00 73.10  ? 322 LEU A N   1 
ATOM   2174 C CA  . LEU A 1 287 ? 22.465  23.399  99.465  1.00 73.77  ? 322 LEU A CA  1 
ATOM   2175 C C   . LEU A 1 287 ? 21.781  23.531  100.824 1.00 74.45  ? 322 LEU A C   1 
ATOM   2176 O O   . LEU A 1 287 ? 20.556  23.635  100.914 1.00 73.99  ? 322 LEU A O   1 
ATOM   2177 C CB  . LEU A 1 287 ? 21.976  24.487  98.509  1.00 74.92  ? 322 LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 287 ? 22.573  24.442  97.099  1.00 77.52  ? 322 LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 287 ? 21.978  25.535  96.226  1.00 78.13  ? 322 LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 287 ? 24.090  24.559  97.145  1.00 80.14  ? 322 LEU A CD2 1 
ATOM   2181 N N   . TRP A 1 288 ? 22.588  23.551  101.878 1.00 69.71  ? 323 TRP A N   1 
ATOM   2182 C CA  . TRP A 1 288 ? 22.076  23.591  103.240 1.00 75.95  ? 323 TRP A CA  1 
ATOM   2183 C C   . TRP A 1 288 ? 21.638  25.003  103.618 1.00 76.95  ? 323 TRP A C   1 
ATOM   2184 O O   . TRP A 1 288 ? 22.354  25.977  103.363 1.00 77.54  ? 323 TRP A O   1 
ATOM   2185 C CB  . TRP A 1 288 ? 23.145  23.093  104.216 1.00 70.77  ? 323 TRP A CB  1 
ATOM   2186 C CG  . TRP A 1 288 ? 22.635  22.856  105.601 1.00 74.78  ? 323 TRP A CG  1 
ATOM   2187 C CD1 . TRP A 1 288 ? 22.308  23.803  106.522 1.00 71.90  ? 323 TRP A CD1 1 
ATOM   2188 C CD2 . TRP A 1 288 ? 22.398  21.588  106.227 1.00 72.69  ? 323 TRP A CD2 1 
ATOM   2189 N NE1 . TRP A 1 288 ? 21.879  23.209  107.682 1.00 76.84  ? 323 TRP A NE1 1 
ATOM   2190 C CE2 . TRP A 1 288 ? 21.926  21.848  107.529 1.00 73.52  ? 323 TRP A CE2 1 
ATOM   2191 C CE3 . TRP A 1 288 ? 22.540  20.257  105.813 1.00 71.42  ? 323 TRP A CE3 1 
ATOM   2192 C CZ2 . TRP A 1 288 ? 21.593  20.829  108.424 1.00 72.59  ? 323 TRP A CZ2 1 
ATOM   2193 C CZ3 . TRP A 1 288 ? 22.205  19.245  106.701 1.00 68.13  ? 323 TRP A CZ3 1 
ATOM   2194 C CH2 . TRP A 1 288 ? 21.739  19.538  107.993 1.00 71.13  ? 323 TRP A CH2 1 
ATOM   2195 N N   . GLY A 1 289 ? 20.462  25.112  104.230 1.00 73.90  ? 324 GLY A N   1 
ATOM   2196 C CA  . GLY A 1 289 ? 19.940  26.405  104.634 1.00 73.32  ? 324 GLY A CA  1 
ATOM   2197 C C   . GLY A 1 289 ? 19.509  27.237  103.442 1.00 72.67  ? 324 GLY A C   1 
ATOM   2198 O O   . GLY A 1 289 ? 19.747  28.441  103.397 1.00 74.59  ? 324 GLY A O   1 
ATOM   2199 N N   . HIS A 1 290 ? 18.882  26.579  102.471 1.00 72.39  ? 325 HIS A N   1 
ATOM   2200 C CA  . HIS A 1 290 ? 18.366  27.239  101.276 1.00 74.43  ? 325 HIS A CA  1 
ATOM   2201 C C   . HIS A 1 290 ? 16.915  26.841  101.034 1.00 75.34  ? 325 HIS A C   1 
ATOM   2202 O O   . HIS A 1 290 ? 16.443  25.818  101.539 1.00 74.05  ? 325 HIS A O   1 
ATOM   2203 C CB  . HIS A 1 290 ? 19.194  26.857  100.047 1.00 74.05  ? 325 HIS A CB  1 
ATOM   2204 C CG  . HIS A 1 290 ? 20.487  27.597  99.930  1.00 80.22  ? 325 HIS A CG  1 
ATOM   2205 N ND1 . HIS A 1 290 ? 20.766  28.440  98.871  1.00 82.08  ? 325 HIS A ND1 1 
ATOM   2206 C CD2 . HIS A 1 290 ? 21.582  27.622  100.725 1.00 82.73  ? 325 HIS A CD2 1 
ATOM   2207 C CE1 . HIS A 1 290 ? 21.975  28.952  99.027  1.00 85.23  ? 325 HIS A CE1 1 
ATOM   2208 N NE2 . HIS A 1 290 ? 22.489  28.472  100.145 1.00 87.19  ? 325 HIS A NE2 1 
ATOM   2209 N N   . ARG A 1 291 ? 16.221  27.654  100.243 1.00 74.96  ? 326 ARG A N   1 
ATOM   2210 C CA  . ARG A 1 291 ? 14.848  27.380  99.837  1.00 70.32  ? 326 ARG A CA  1 
ATOM   2211 C C   . ARG A 1 291 ? 14.671  27.803  98.380  1.00 70.79  ? 326 ARG A C   1 
ATOM   2212 O O   . ARG A 1 291 ? 15.330  28.740  97.920  1.00 72.52  ? 326 ARG A O   1 
ATOM   2213 C CB  . ARG A 1 291 ? 13.865  28.124  100.747 1.00 71.83  ? 326 ARG A CB  1 
ATOM   2214 C CG  . ARG A 1 291 ? 13.309  27.265  101.876 1.00 74.91  ? 326 ARG A CG  1 
ATOM   2215 C CD  . ARG A 1 291 ? 13.049  28.043  103.160 1.00 77.50  ? 326 ARG A CD  1 
ATOM   2216 N NE  . ARG A 1 291 ? 12.336  29.297  102.940 1.00 81.94  ? 326 ARG A NE  1 
ATOM   2217 C CZ  . ARG A 1 291 ? 11.895  30.081  103.921 1.00 87.07  ? 326 ARG A CZ  1 
ATOM   2218 N NH1 . ARG A 1 291 ? 12.078  29.727  105.189 1.00 83.87  ? 326 ARG A NH1 1 
ATOM   2219 N NH2 . ARG A 1 291 ? 11.264  31.216  103.638 1.00 89.13  ? 326 ARG A NH2 1 
ATOM   2220 N N   . PHE A 1 292 ? 13.802  27.108  97.650  1.00 67.82  ? 327 PHE A N   1 
ATOM   2221 C CA  . PHE A 1 292 ? 13.565  27.442  96.244  1.00 71.08  ? 327 PHE A CA  1 
ATOM   2222 C C   . PHE A 1 292 ? 12.764  28.737  96.093  1.00 75.52  ? 327 PHE A C   1 
ATOM   2223 O O   . PHE A 1 292 ? 11.870  29.026  96.891  1.00 73.38  ? 327 PHE A O   1 
ATOM   2224 C CB  . PHE A 1 292 ? 12.857  26.296  95.504  1.00 65.88  ? 327 PHE A CB  1 
ATOM   2225 C CG  . PHE A 1 292 ? 13.664  25.030  95.429  1.00 65.80  ? 327 PHE A CG  1 
ATOM   2226 C CD1 . PHE A 1 292 ? 14.725  24.920  94.543  1.00 66.85  ? 327 PHE A CD1 1 
ATOM   2227 C CD2 . PHE A 1 292 ? 13.360  23.944  96.245  1.00 64.37  ? 327 PHE A CD2 1 
ATOM   2228 C CE1 . PHE A 1 292 ? 15.474  23.754  94.477  1.00 62.82  ? 327 PHE A CE1 1 
ATOM   2229 C CE2 . PHE A 1 292 ? 14.103  22.776  96.184  1.00 60.31  ? 327 PHE A CE2 1 
ATOM   2230 C CZ  . PHE A 1 292 ? 15.160  22.680  95.301  1.00 61.04  ? 327 PHE A CZ  1 
ATOM   2231 N N   . GLU A 1 293 ? 13.105  29.517  95.071  1.00 80.02  ? 328 GLU A N   1 
ATOM   2232 C CA  . GLU A 1 293 ? 12.320  30.686  94.701  1.00 87.28  ? 328 GLU A CA  1 
ATOM   2233 C C   . GLU A 1 293 ? 10.982  30.209  94.152  1.00 86.34  ? 328 GLU A C   1 
ATOM   2234 O O   . GLU A 1 293 ? 10.936  29.233  93.405  1.00 83.91  ? 328 GLU A O   1 
ATOM   2235 C CB  . GLU A 1 293 ? 13.048  31.500  93.627  1.00 94.97  ? 328 GLU A CB  1 
ATOM   2236 C CG  . GLU A 1 293 ? 14.387  32.089  94.057  1.00 102.83 ? 328 GLU A CG  1 
ATOM   2237 C CD  . GLU A 1 293 ? 14.248  33.436  94.749  1.00 111.07 ? 328 GLU A CD  1 
ATOM   2238 O OE1 . GLU A 1 293 ? 13.111  33.808  95.115  1.00 112.77 ? 328 GLU A OE1 1 
ATOM   2239 O OE2 . GLU A 1 293 ? 15.279  34.127  94.918  1.00 114.31 ? 328 GLU A OE2 1 
ATOM   2240 N N   . PRO A 1 294 ? 9.885   30.889  94.518  1.00 88.92  ? 329 PRO A N   1 
ATOM   2241 C CA  . PRO A 1 294 ? 8.569   30.471  94.021  1.00 86.77  ? 329 PRO A CA  1 
ATOM   2242 C C   . PRO A 1 294 ? 8.462   30.700  92.517  1.00 84.06  ? 329 PRO A C   1 
ATOM   2243 O O   . PRO A 1 294 ? 8.806   31.778  92.038  1.00 87.26  ? 329 PRO A O   1 
ATOM   2244 C CB  . PRO A 1 294 ? 7.597   31.400  94.762  1.00 90.81  ? 329 PRO A CB  1 
ATOM   2245 C CG  . PRO A 1 294 ? 8.411   32.075  95.839  1.00 93.23  ? 329 PRO A CG  1 
ATOM   2246 C CD  . PRO A 1 294 ? 9.808   32.119  95.320  1.00 92.03  ? 329 PRO A CD  1 
ATOM   2247 N N   . VAL A 1 295 ? 8.022   29.688  91.778  1.00 80.70  ? 330 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 295 ? 7.822   29.834  90.341  1.00 79.19  ? 330 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 295 ? 6.378   30.166  89.961  1.00 77.66  ? 330 VAL A C   1 
ATOM   2250 O O   . VAL A 1 295 ? 6.105   30.567  88.827  1.00 77.58  ? 330 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 295 ? 8.244   28.555  89.598  1.00 76.80  ? 330 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 295 ? 9.733   28.306  89.783  1.00 76.00  ? 330 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 295 ? 7.432   27.366  90.098  1.00 73.76  ? 330 VAL A CG2 1 
ATOM   2254 N N   . LEU A 1 296 ? 5.464   30.027  90.917  1.00 74.84  ? 331 LEU A N   1 
ATOM   2255 C CA  . LEU A 1 296 ? 4.037   30.149  90.631  1.00 77.01  ? 331 LEU A CA  1 
ATOM   2256 C C   . LEU A 1 296 ? 3.470   31.505  91.044  1.00 82.09  ? 331 LEU A C   1 
ATOM   2257 O O   . LEU A 1 296 ? 3.698   31.972  92.161  1.00 84.71  ? 331 LEU A O   1 
ATOM   2258 C CB  . LEU A 1 296 ? 3.257   29.016  91.304  1.00 73.51  ? 331 LEU A CB  1 
ATOM   2259 C CG  . LEU A 1 296 ? 1.743   28.986  91.080  1.00 74.67  ? 331 LEU A CG  1 
ATOM   2260 C CD1 . LEU A 1 296 ? 1.419   28.894  89.597  1.00 71.38  ? 331 LEU A CD1 1 
ATOM   2261 C CD2 . LEU A 1 296 ? 1.110   27.829  91.846  1.00 70.53  ? 331 LEU A CD2 1 
ATOM   2262 N N   . PHE A 1 297 ? 2.729   32.133  90.138  1.00 85.68  ? 332 PHE A N   1 
ATOM   2263 C CA  . PHE A 1 297 ? 2.158   33.449  90.406  1.00 93.21  ? 332 PHE A CA  1 
ATOM   2264 C C   . PHE A 1 297 ? 0.755   33.571  89.835  1.00 94.23  ? 332 PHE A C   1 
ATOM   2265 O O   . PHE A 1 297 ? 0.472   33.094  88.735  1.00 91.86  ? 332 PHE A O   1 
ATOM   2266 C CB  . PHE A 1 297 ? 3.055   34.552  89.839  1.00 100.93 ? 332 PHE A CB  1 
ATOM   2267 C CG  . PHE A 1 297 ? 4.488   34.441  90.274  1.00 108.15 ? 332 PHE A CG  1 
ATOM   2268 C CD1 . PHE A 1 297 ? 4.900   34.959  91.493  1.00 111.05 ? 332 PHE A CD1 1 
ATOM   2269 C CD2 . PHE A 1 297 ? 5.423   33.807  89.469  1.00 110.63 ? 332 PHE A CD2 1 
ATOM   2270 C CE1 . PHE A 1 297 ? 6.221   34.851  91.900  1.00 111.72 ? 332 PHE A CE1 1 
ATOM   2271 C CE2 . PHE A 1 297 ? 6.747   33.696  89.871  1.00 111.08 ? 332 PHE A CE2 1 
ATOM   2272 C CZ  . PHE A 1 297 ? 7.146   34.219  91.087  1.00 110.92 ? 332 PHE A CZ  1 
ATOM   2273 N N   . GLU A 1 298 ? -0.124  34.211  90.593  1.00 98.40  ? 333 GLU A N   1 
ATOM   2274 C CA  . GLU A 1 298 ? -1.495  34.412  90.159  1.00 105.14 ? 333 GLU A CA  1 
ATOM   2275 C C   . GLU A 1 298 ? -1.670  35.808  89.584  1.00 113.60 ? 333 GLU A C   1 
ATOM   2276 O O   . GLU A 1 298 ? -1.424  36.799  90.268  1.00 116.50 ? 333 GLU A O   1 
ATOM   2277 C CB  . GLU A 1 298 ? -2.452  34.225  91.333  1.00 106.71 ? 333 GLU A CB  1 
ATOM   2278 C CG  . GLU A 1 298 ? -3.876  34.645  91.024  1.00 111.47 ? 333 GLU A CG  1 
ATOM   2279 C CD  . GLU A 1 298 ? -4.736  34.742  92.265  1.00 112.36 ? 333 GLU A CD  1 
ATOM   2280 O OE1 . GLU A 1 298 ? -4.197  34.578  93.382  1.00 110.69 ? 333 GLU A OE1 1 
ATOM   2281 O OE2 . GLU A 1 298 ? -5.953  34.982  92.120  1.00 114.31 ? 333 GLU A OE2 1 
ATOM   2282 N N   . GLU A 1 299 ? -2.079  35.888  88.323  1.00 119.86 ? 334 GLU A N   1 
ATOM   2283 C CA  . GLU A 1 299 ? -2.423  37.173  87.737  1.00 131.02 ? 334 GLU A CA  1 
ATOM   2284 C C   . GLU A 1 299 ? -3.911  37.213  87.405  1.00 136.56 ? 334 GLU A C   1 
ATOM   2285 O O   . GLU A 1 299 ? -4.347  36.645  86.404  1.00 136.44 ? 334 GLU A O   1 
ATOM   2286 C CB  . GLU A 1 299 ? -1.606  37.381  86.464  1.00 134.84 ? 334 GLU A CB  1 
ATOM   2287 C CG  . GLU A 1 299 ? -1.664  36.187  85.524  1.00 136.63 ? 334 GLU A CG  1 
ATOM   2288 C CD  . GLU A 1 299 ? -0.644  36.255  84.409  1.00 140.37 ? 334 GLU A CD  1 
ATOM   2289 O OE1 . GLU A 1 299 ? -0.021  37.325  84.228  1.00 143.47 ? 334 GLU A OE1 1 
ATOM   2290 O OE2 . GLU A 1 299 ? -0.467  35.231  83.714  1.00 139.50 ? 334 GLU A OE2 1 
ATOM   2291 N N   . LYS A 1 300 ? -4.687  37.913  88.229  1.00 140.55 ? 335 LYS A N   1 
ATOM   2292 C CA  . LYS A 1 300 ? -6.111  38.092  87.957  1.00 142.84 ? 335 LYS A CA  1 
ATOM   2293 C C   . LYS A 1 300 ? -6.792  36.771  87.583  1.00 138.00 ? 335 LYS A C   1 
ATOM   2294 O O   . LYS A 1 300 ? -6.842  35.838  88.386  1.00 138.89 ? 335 LYS A O   1 
ATOM   2295 C CB  . LYS A 1 300 ? -6.339  39.184  86.907  1.00 150.00 ? 335 LYS A CB  1 
ATOM   2296 C CG  . LYS A 1 300 ? -6.373  40.596  87.499  1.00 155.49 ? 335 LYS A CG  1 
ATOM   2297 C CD  . LYS A 1 300 ? -5.199  40.841  88.446  1.00 155.68 ? 335 LYS A CD  1 
ATOM   2298 C CE  . LYS A 1 300 ? -5.310  42.187  89.151  1.00 159.33 ? 335 LYS A CE  1 
ATOM   2299 N NZ  . LYS A 1 300 ? -4.177  42.418  90.096  1.00 158.22 ? 335 LYS A NZ  1 
ATOM   2300 N N   . ASN A 1 301 ? -7.299  36.699  86.357  1.00 132.63 ? 336 ASN A N   1 
ATOM   2301 C CA  . ASN A 1 301 ? -8.065  35.549  85.881  1.00 127.80 ? 336 ASN A CA  1 
ATOM   2302 C C   . ASN A 1 301 ? -7.322  34.207  85.781  1.00 120.27 ? 336 ASN A C   1 
ATOM   2303 O O   . ASN A 1 301 ? -7.943  33.182  85.497  1.00 118.29 ? 336 ASN A O   1 
ATOM   2304 C CB  . ASN A 1 301 ? -8.683  35.860  84.515  1.00 131.06 ? 336 ASN A CB  1 
ATOM   2305 C CG  . ASN A 1 301 ? -9.697  36.985  84.569  1.00 137.53 ? 336 ASN A CG  1 
ATOM   2306 O OD1 . ASN A 1 301 ? -10.852 36.773  84.936  1.00 139.98 ? 336 ASN A OD1 1 
ATOM   2307 N ND2 . ASN A 1 301 ? -9.273  38.187  84.189  1.00 139.94 ? 336 ASN A ND2 1 
ATOM   2308 N N   . GLN A 1 302 ? -6.007  34.197  85.991  1.00 114.68 ? 337 GLN A N   1 
ATOM   2309 C CA  . GLN A 1 302 ? -5.222  33.011  85.643  1.00 108.61 ? 337 GLN A CA  1 
ATOM   2310 C C   . GLN A 1 302 ? -3.917  32.829  86.434  1.00 101.82 ? 337 GLN A C   1 
ATOM   2311 O O   . GLN A 1 302 ? -3.364  33.790  86.963  1.00 104.61 ? 337 GLN A O   1 
ATOM   2312 C CB  . GLN A 1 302 ? -4.935  33.059  84.142  1.00 111.87 ? 337 GLN A CB  1 
ATOM   2313 C CG  . GLN A 1 302 ? -3.951  32.046  83.621  1.00 112.42 ? 337 GLN A CG  1 
ATOM   2314 C CD  . GLN A 1 302 ? -3.466  32.414  82.234  1.00 116.82 ? 337 GLN A CD  1 
ATOM   2315 O OE1 . GLN A 1 302 ? -3.961  31.896  81.233  1.00 118.71 ? 337 GLN A OE1 1 
ATOM   2316 N NE2 . GLN A 1 302 ? -2.503  33.329  82.168  1.00 117.58 ? 337 GLN A NE2 1 
ATOM   2317 N N   . TYR A 1 303 ? -3.430  31.590  86.504  1.00 91.69  ? 338 TYR A N   1 
ATOM   2318 C CA  . TYR A 1 303 ? -2.153  31.294  87.154  1.00 85.95  ? 338 TYR A CA  1 
ATOM   2319 C C   . TYR A 1 303 ? -1.044  31.122  86.126  1.00 82.65  ? 338 TYR A C   1 
ATOM   2320 O O   . TYR A 1 303 ? -1.272  30.595  85.039  1.00 81.92  ? 338 TYR A O   1 
ATOM   2321 C CB  . TYR A 1 303 ? -2.241  30.026  88.013  1.00 83.82  ? 338 TYR A CB  1 
ATOM   2322 C CG  . TYR A 1 303 ? -3.069  30.173  89.269  1.00 83.20  ? 338 TYR A CG  1 
ATOM   2323 C CD1 . TYR A 1 303 ? -2.525  30.724  90.425  1.00 81.45  ? 338 TYR A CD1 1 
ATOM   2324 C CD2 . TYR A 1 303 ? -4.394  29.754  89.302  1.00 83.32  ? 338 TYR A CD2 1 
ATOM   2325 C CE1 . TYR A 1 303 ? -3.284  30.859  91.577  1.00 81.88  ? 338 TYR A CE1 1 
ATOM   2326 C CE2 . TYR A 1 303 ? -5.158  29.884  90.445  1.00 83.96  ? 338 TYR A CE2 1 
ATOM   2327 C CZ  . TYR A 1 303 ? -4.601  30.436  91.579  1.00 84.09  ? 338 TYR A CZ  1 
ATOM   2328 O OH  . TYR A 1 303 ? -5.370  30.564  92.713  1.00 85.21  ? 338 TYR A OH  1 
ATOM   2329 N N   . LYS A 1 304 ? 0.158   31.563  86.480  1.00 81.95  ? 339 LYS A N   1 
ATOM   2330 C CA  . LYS A 1 304 ? 1.301   31.475  85.582  1.00 82.20  ? 339 LYS A CA  1 
ATOM   2331 C C   . LYS A 1 304 ? 2.507   30.889  86.302  1.00 78.64  ? 339 LYS A C   1 
ATOM   2332 O O   . LYS A 1 304 ? 2.672   31.065  87.509  1.00 76.34  ? 339 LYS A O   1 
ATOM   2333 C CB  . LYS A 1 304 ? 1.653   32.861  85.038  1.00 89.99  ? 339 LYS A CB  1 
ATOM   2334 C CG  . LYS A 1 304 ? 1.924   32.907  83.539  1.00 96.23  ? 339 LYS A CG  1 
ATOM   2335 C CD  . LYS A 1 304 ? 2.295   34.321  83.094  1.00 101.22 ? 339 LYS A CD  1 
ATOM   2336 C CE  . LYS A 1 304 ? 1.891   34.588  81.644  1.00 105.27 ? 339 LYS A CE  1 
ATOM   2337 N NZ  . LYS A 1 304 ? 2.203   35.990  81.211  1.00 108.41 ? 339 LYS A NZ  1 
ATOM   2338 N N   . VAL A 1 305 ? 3.350   30.190  85.554  1.00 77.73  ? 340 VAL A N   1 
ATOM   2339 C CA  . VAL A 1 305 ? 4.597   29.677  86.090  1.00 76.26  ? 340 VAL A CA  1 
ATOM   2340 C C   . VAL A 1 305 ? 5.758   30.327  85.363  1.00 80.89  ? 340 VAL A C   1 
ATOM   2341 O O   . VAL A 1 305 ? 5.812   30.320  84.134  1.00 84.31  ? 340 VAL A O   1 
ATOM   2342 C CB  . VAL A 1 305 ? 4.708   28.149  85.931  1.00 74.34  ? 340 VAL A CB  1 
ATOM   2343 C CG1 . VAL A 1 305 ? 6.080   27.671  86.387  1.00 73.99  ? 340 VAL A CG1 1 
ATOM   2344 C CG2 . VAL A 1 305 ? 3.613   27.452  86.716  1.00 72.02  ? 340 VAL A CG2 1 
ATOM   2345 N N   . ASP A 1 306 ? 6.681   30.899  86.126  1.00 83.48  ? 341 ASP A N   1 
ATOM   2346 C CA  . ASP A 1 306 ? 7.875   31.493  85.548  1.00 85.27  ? 341 ASP A CA  1 
ATOM   2347 C C   . ASP A 1 306 ? 9.034   30.526  85.740  1.00 80.68  ? 341 ASP A C   1 
ATOM   2348 O O   . ASP A 1 306 ? 9.562   30.386  86.839  1.00 77.02  ? 341 ASP A O   1 
ATOM   2349 C CB  . ASP A 1 306 ? 8.171   32.829  86.227  1.00 89.33  ? 341 ASP A CB  1 
ATOM   2350 C CG  . ASP A 1 306 ? 9.456   33.461  85.738  1.00 94.28  ? 341 ASP A CG  1 
ATOM   2351 O OD1 . ASP A 1 306 ? 10.044  32.942  84.766  1.00 94.52  ? 341 ASP A OD1 1 
ATOM   2352 O OD2 . ASP A 1 306 ? 9.871   34.483  86.322  1.00 98.05  ? 341 ASP A OD2 1 
ATOM   2353 N N   . TYR A 1 307 ? 9.449   29.889  84.651  1.00 83.02  ? 342 TYR A N   1 
ATOM   2354 C CA  . TYR A 1 307 ? 10.406  28.791  84.725  1.00 83.88  ? 342 TYR A CA  1 
ATOM   2355 C C   . TYR A 1 307 ? 11.855  29.242  84.869  1.00 84.85  ? 342 TYR A C   1 
ATOM   2356 O O   . TYR A 1 307 ? 12.750  28.421  85.089  1.00 82.41  ? 342 TYR A O   1 
ATOM   2357 C CB  . TYR A 1 307 ? 10.250  27.863  83.519  1.00 85.31  ? 342 TYR A CB  1 
ATOM   2358 C CG  . TYR A 1 307 ? 9.336   26.684  83.780  1.00 84.48  ? 342 TYR A CG  1 
ATOM   2359 C CD1 . TYR A 1 307 ? 9.840   25.489  84.279  1.00 82.91  ? 342 TYR A CD1 1 
ATOM   2360 C CD2 . TYR A 1 307 ? 7.971   26.767  83.533  1.00 84.35  ? 342 TYR A CD2 1 
ATOM   2361 C CE1 . TYR A 1 307 ? 9.012   24.407  84.519  1.00 83.00  ? 342 TYR A CE1 1 
ATOM   2362 C CE2 . TYR A 1 307 ? 7.133   25.690  83.770  1.00 84.03  ? 342 TYR A CE2 1 
ATOM   2363 C CZ  . TYR A 1 307 ? 7.659   24.512  84.263  1.00 84.19  ? 342 TYR A CZ  1 
ATOM   2364 O OH  . TYR A 1 307 ? 6.834   23.436  84.501  1.00 82.93  ? 342 TYR A OH  1 
ATOM   2365 N N   . SER A 1 308 ? 12.082  30.545  84.747  1.00 87.07  ? 343 SER A N   1 
ATOM   2366 C CA  . SER A 1 308 ? 13.418  31.094  84.940  1.00 89.18  ? 343 SER A CA  1 
ATOM   2367 C C   . SER A 1 308 ? 13.776  31.127  86.424  1.00 88.27  ? 343 SER A C   1 
ATOM   2368 O O   . SER A 1 308 ? 14.928  31.345  86.790  1.00 92.34  ? 343 SER A O   1 
ATOM   2369 C CB  . SER A 1 308 ? 13.526  32.493  84.329  1.00 92.30  ? 343 SER A CB  1 
ATOM   2370 O OG  . SER A 1 308 ? 12.628  33.393  84.953  1.00 94.13  ? 343 SER A OG  1 
ATOM   2371 N N   . HIS A 1 309 ? 12.783  30.919  87.279  1.00 83.81  ? 344 HIS A N   1 
ATOM   2372 C CA  . HIS A 1 309 ? 13.034  30.825  88.711  1.00 85.09  ? 344 HIS A CA  1 
ATOM   2373 C C   . HIS A 1 309 ? 13.158  29.374  89.173  1.00 78.56  ? 344 HIS A C   1 
ATOM   2374 O O   . HIS A 1 309 ? 13.415  29.114  90.346  1.00 75.69  ? 344 HIS A O   1 
ATOM   2375 C CB  . HIS A 1 309 ? 11.934  31.537  89.502  1.00 90.46  ? 344 HIS A CB  1 
ATOM   2376 C CG  . HIS A 1 309 ? 11.925  33.024  89.317  1.00 99.96  ? 344 HIS A CG  1 
ATOM   2377 N ND1 . HIS A 1 309 ? 13.063  33.743  89.026  1.00 104.86 ? 344 HIS A ND1 1 
ATOM   2378 C CD2 . HIS A 1 309 ? 10.913  33.923  89.377  1.00 102.86 ? 344 HIS A CD2 1 
ATOM   2379 C CE1 . HIS A 1 309 ? 12.754  35.025  88.915  1.00 107.47 ? 344 HIS A CE1 1 
ATOM   2380 N NE2 . HIS A 1 309 ? 11.458  35.160  89.124  1.00 106.77 ? 344 HIS A NE2 1 
ATOM   2381 N N   . PHE A 1 310 ? 12.989  28.439  88.240  1.00 75.78  ? 345 PHE A N   1 
ATOM   2382 C CA  . PHE A 1 310 ? 12.899  27.017  88.573  1.00 71.71  ? 345 PHE A CA  1 
ATOM   2383 C C   . PHE A 1 310 ? 14.070  26.508  89.401  1.00 68.34  ? 345 PHE A C   1 
ATOM   2384 O O   . PHE A 1 310 ? 13.878  25.808  90.390  1.00 67.82  ? 345 PHE A O   1 
ATOM   2385 C CB  . PHE A 1 310 ? 12.761  26.168  87.304  1.00 72.52  ? 345 PHE A CB  1 
ATOM   2386 C CG  . PHE A 1 310 ? 12.532  24.705  87.576  1.00 73.57  ? 345 PHE A CG  1 
ATOM   2387 C CD1 . PHE A 1 310 ? 11.249  24.213  87.763  1.00 74.87  ? 345 PHE A CD1 1 
ATOM   2388 C CD2 . PHE A 1 310 ? 13.599  23.822  87.650  1.00 72.68  ? 345 PHE A CD2 1 
ATOM   2389 C CE1 . PHE A 1 310 ? 11.034  22.863  88.018  1.00 71.61  ? 345 PHE A CE1 1 
ATOM   2390 C CE2 . PHE A 1 310 ? 13.392  22.474  87.904  1.00 68.57  ? 345 PHE A CE2 1 
ATOM   2391 C CZ  . PHE A 1 310 ? 12.109  21.995  88.089  1.00 68.07  ? 345 PHE A CZ  1 
ATOM   2392 N N   . HIS A 1 311 ? 15.284  26.851  88.988  1.00 77.87  ? 346 HIS A N   1 
ATOM   2393 C CA  . HIS A 1 311 ? 16.481  26.326  89.638  1.00 75.48  ? 346 HIS A CA  1 
ATOM   2394 C C   . HIS A 1 311 ? 16.987  27.204  90.775  1.00 76.44  ? 346 HIS A C   1 
ATOM   2395 O O   . HIS A 1 311 ? 17.892  26.812  91.510  1.00 78.96  ? 346 HIS A O   1 
ATOM   2396 C CB  . HIS A 1 311 ? 17.596  26.112  88.610  1.00 73.49  ? 346 HIS A CB  1 
ATOM   2397 C CG  . HIS A 1 311 ? 17.232  25.149  87.524  1.00 74.43  ? 346 HIS A CG  1 
ATOM   2398 N ND1 . HIS A 1 311 ? 17.139  23.787  87.736  1.00 73.58  ? 346 HIS A ND1 1 
ATOM   2399 C CD2 . HIS A 1 311 ? 16.927  25.348  86.221  1.00 72.54  ? 346 HIS A CD2 1 
ATOM   2400 C CE1 . HIS A 1 311 ? 16.800  23.192  86.606  1.00 71.55  ? 346 HIS A CE1 1 
ATOM   2401 N NE2 . HIS A 1 311 ? 16.666  24.116  85.671  1.00 73.23  ? 346 HIS A NE2 1 
ATOM   2402 N N   . LYS A 1 312 ? 16.392  28.381  90.928  1.00 76.02  ? 347 LYS A N   1 
ATOM   2403 C CA  . LYS A 1 312 ? 16.926  29.386  91.843  1.00 79.48  ? 347 LYS A CA  1 
ATOM   2404 C C   . LYS A 1 312 ? 16.562  29.183  93.318  1.00 76.80  ? 347 LYS A C   1 
ATOM   2405 O O   . LYS A 1 312 ? 15.481  28.685  93.651  1.00 73.89  ? 347 LYS A O   1 
ATOM   2406 C CB  . LYS A 1 312 ? 16.555  30.791  91.358  1.00 85.05  ? 347 LYS A CB  1 
ATOM   2407 C CG  . LYS A 1 312 ? 17.189  31.130  90.014  1.00 92.15  ? 347 LYS A CG  1 
ATOM   2408 C CD  . LYS A 1 312 ? 16.716  32.469  89.475  1.00 100.95 ? 347 LYS A CD  1 
ATOM   2409 C CE  . LYS A 1 312 ? 17.398  32.806  88.154  1.00 106.58 ? 347 LYS A CE  1 
ATOM   2410 N NZ  . LYS A 1 312 ? 16.792  34.004  87.497  1.00 111.08 ? 347 LYS A NZ  1 
ATOM   2411 N N   . THR A 1 313 ? 17.488  29.572  94.193  1.00 78.09  ? 348 THR A N   1 
ATOM   2412 C CA  . THR A 1 313 ? 17.323  29.404  95.634  1.00 79.74  ? 348 THR A CA  1 
ATOM   2413 C C   . THR A 1 313 ? 17.808  30.627  96.395  1.00 83.04  ? 348 THR A C   1 
ATOM   2414 O O   . THR A 1 313 ? 18.580  31.434  95.874  1.00 85.27  ? 348 THR A O   1 
ATOM   2415 C CB  . THR A 1 313 ? 18.123  28.194  96.156  1.00 79.26  ? 348 THR A CB  1 
ATOM   2416 O OG1 . THR A 1 313 ? 19.526  28.437  95.981  1.00 79.38  ? 348 THR A OG1 1 
ATOM   2417 C CG2 . THR A 1 313 ? 17.726  26.917  95.412  1.00 75.10  ? 348 THR A CG2 1 
ATOM   2418 N N   . TYR A 1 314 ? 17.361  30.755  97.639  1.00 82.30  ? 349 TYR A N   1 
ATOM   2419 C CA  . TYR A 1 314 ? 17.815  31.840  98.501  1.00 84.89  ? 349 TYR A CA  1 
ATOM   2420 C C   . TYR A 1 314 ? 18.145  31.314  99.893  1.00 84.85  ? 349 TYR A C   1 
ATOM   2421 O O   . TYR A 1 314 ? 17.598  30.302  100.331 1.00 85.53  ? 349 TYR A O   1 
ATOM   2422 C CB  . TYR A 1 314 ? 16.770  32.954  98.573  1.00 78.47  ? 349 TYR A CB  1 
ATOM   2423 C CG  . TYR A 1 314 ? 15.420  32.504  99.078  1.00 79.18  ? 349 TYR A CG  1 
ATOM   2424 C CD1 . TYR A 1 314 ? 15.072  32.648  100.416 1.00 79.91  ? 349 TYR A CD1 1 
ATOM   2425 C CD2 . TYR A 1 314 ? 14.489  31.931  98.217  1.00 74.91  ? 349 TYR A CD2 1 
ATOM   2426 C CE1 . TYR A 1 314 ? 13.833  32.238  100.881 1.00 79.20  ? 349 TYR A CE1 1 
ATOM   2427 C CE2 . TYR A 1 314 ? 13.251  31.518  98.672  1.00 74.75  ? 349 TYR A CE2 1 
ATOM   2428 C CZ  . TYR A 1 314 ? 12.927  31.675  100.003 1.00 76.92  ? 349 TYR A CZ  1 
ATOM   2429 O OH  . TYR A 1 314 ? 11.696  31.265  100.461 1.00 78.01  ? 349 TYR A OH  1 
ATOM   2430 N N   . GLU A 1 315 ? 19.044  32.005  100.582 1.00 86.36  ? 350 GLU A N   1 
ATOM   2431 C CA  . GLU A 1 315 ? 19.515  31.562  101.889 1.00 86.09  ? 350 GLU A CA  1 
ATOM   2432 C C   . GLU A 1 315 ? 18.519  31.842  103.008 1.00 82.76  ? 350 GLU A C   1 
ATOM   2433 O O   . GLU A 1 315 ? 17.860  32.883  103.032 1.00 82.91  ? 350 GLU A O   1 
ATOM   2434 C CB  . GLU A 1 315 ? 20.867  32.204  102.222 1.00 90.64  ? 350 GLU A CB  1 
ATOM   2435 C CG  . GLU A 1 315 ? 22.017  31.714  101.358 1.00 96.97  ? 350 GLU A CG  1 
ATOM   2436 C CD  . GLU A 1 315 ? 23.356  32.325  101.748 1.00 107.26 ? 350 GLU A CD  1 
ATOM   2437 O OE1 . GLU A 1 315 ? 23.372  33.322  102.504 1.00 109.84 ? 350 GLU A OE1 1 
ATOM   2438 O OE2 . GLU A 1 315 ? 24.399  31.801  101.298 1.00 111.48 ? 350 GLU A OE2 1 
ATOM   2439 N N   . VAL A 1 316 ? 18.419  30.896  103.934 1.00 80.04  ? 351 VAL A N   1 
ATOM   2440 C CA  . VAL A 1 316 ? 17.618  31.071  105.135 1.00 81.17  ? 351 VAL A CA  1 
ATOM   2441 C C   . VAL A 1 316 ? 18.521  30.891  106.346 1.00 83.26  ? 351 VAL A C   1 
ATOM   2442 O O   . VAL A 1 316 ? 18.583  29.809  106.933 1.00 82.27  ? 351 VAL A O   1 
ATOM   2443 C CB  . VAL A 1 316 ? 16.463  30.064  105.192 1.00 78.61  ? 351 VAL A CB  1 
ATOM   2444 C CG1 . VAL A 1 316 ? 15.604  30.320  106.427 1.00 77.65  ? 351 VAL A CG1 1 
ATOM   2445 C CG2 . VAL A 1 316 ? 15.633  30.149  103.918 1.00 73.73  ? 351 VAL A CG2 1 
ATOM   2446 N N   . PRO A 1 317 ? 19.233  31.963  106.721 1.00 87.43  ? 352 PRO A N   1 
ATOM   2447 C CA  . PRO A 1 317 ? 20.257  31.940  107.773 1.00 88.96  ? 352 PRO A CA  1 
ATOM   2448 C C   . PRO A 1 317 ? 19.763  31.389  109.114 1.00 88.42  ? 352 PRO A C   1 
ATOM   2449 O O   . PRO A 1 317 ? 20.578  30.909  109.900 1.00 90.51  ? 352 PRO A O   1 
ATOM   2450 C CB  . PRO A 1 317 ? 20.659  33.416  107.907 1.00 91.06  ? 352 PRO A CB  1 
ATOM   2451 C CG  . PRO A 1 317 ? 19.557  34.194  107.242 1.00 90.51  ? 352 PRO A CG  1 
ATOM   2452 C CD  . PRO A 1 317 ? 19.062  33.311  106.150 1.00 89.19  ? 352 PRO A CD  1 
ATOM   2453 N N   . SER A 1 318 ? 18.459  31.455  109.367 1.00 85.49  ? 353 SER A N   1 
ATOM   2454 C CA  . SER A 1 318 ? 17.894  30.950  110.617 1.00 84.37  ? 353 SER A CA  1 
ATOM   2455 C C   . SER A 1 318 ? 17.863  29.416  110.658 1.00 83.31  ? 353 SER A C   1 
ATOM   2456 O O   . SER A 1 318 ? 17.592  28.816  111.701 1.00 81.91  ? 353 SER A O   1 
ATOM   2457 C CB  . SER A 1 318 ? 16.489  31.517  110.846 1.00 85.50  ? 353 SER A CB  1 
ATOM   2458 O OG  . SER A 1 318 ? 15.547  30.919  109.969 1.00 85.37  ? 353 SER A OG  1 
ATOM   2459 N N   . THR A 1 319 ? 18.135  28.785  109.520 1.00 77.24  ? 354 THR A N   1 
ATOM   2460 C CA  . THR A 1 319 ? 18.229  27.333  109.461 1.00 77.82  ? 354 THR A CA  1 
ATOM   2461 C C   . THR A 1 319 ? 19.308  26.820  110.412 1.00 80.28  ? 354 THR A C   1 
ATOM   2462 O O   . THR A 1 319 ? 20.436  27.313  110.396 1.00 83.19  ? 354 THR A O   1 
ATOM   2463 C CB  . THR A 1 319 ? 18.587  26.857  108.041 1.00 75.24  ? 354 THR A CB  1 
ATOM   2464 O OG1 . THR A 1 319 ? 17.626  27.357  107.105 1.00 74.74  ? 354 THR A OG1 1 
ATOM   2465 C CG2 . THR A 1 319 ? 18.619  25.334  107.978 1.00 72.92  ? 354 THR A CG2 1 
ATOM   2466 N N   . PRO A 1 320 ? 18.967  25.822  111.240 1.00 80.02  ? 355 PRO A N   1 
ATOM   2467 C CA  . PRO A 1 320 ? 19.942  25.195  112.142 1.00 80.19  ? 355 PRO A CA  1 
ATOM   2468 C C   . PRO A 1 320 ? 21.031  24.475  111.346 1.00 79.02  ? 355 PRO A C   1 
ATOM   2469 O O   . PRO A 1 320 ? 20.737  23.883  110.303 1.00 75.34  ? 355 PRO A O   1 
ATOM   2470 C CB  . PRO A 1 320 ? 19.101  24.177  112.927 1.00 80.86  ? 355 PRO A CB  1 
ATOM   2471 C CG  . PRO A 1 320 ? 17.675  24.591  112.718 1.00 81.76  ? 355 PRO A CG  1 
ATOM   2472 C CD  . PRO A 1 320 ? 17.631  25.216  111.360 1.00 79.81  ? 355 PRO A CD  1 
ATOM   2473 N N   . ARG A 1 321 ? 22.274  24.551  111.813 1.00 80.71  ? 356 ARG A N   1 
ATOM   2474 C CA  . ARG A 1 321 ? 23.392  23.912  111.120 1.00 80.35  ? 356 ARG A CA  1 
ATOM   2475 C C   . ARG A 1 321 ? 23.717  22.511  111.636 1.00 80.18  ? 356 ARG A C   1 
ATOM   2476 O O   . ARG A 1 321 ? 24.486  21.776  111.019 1.00 79.89  ? 356 ARG A O   1 
ATOM   2477 C CB  . ARG A 1 321 ? 24.633  24.796  111.205 1.00 80.30  ? 356 ARG A CB  1 
ATOM   2478 C CG  . ARG A 1 321 ? 24.431  26.194  110.656 1.00 81.38  ? 356 ARG A CG  1 
ATOM   2479 C CD  . ARG A 1 321 ? 25.744  26.947  110.641 1.00 84.37  ? 356 ARG A CD  1 
ATOM   2480 N NE  . ARG A 1 321 ? 25.632  28.247  109.991 1.00 90.77  ? 356 ARG A NE  1 
ATOM   2481 C CZ  . ARG A 1 321 ? 26.657  29.071  109.805 1.00 94.30  ? 356 ARG A CZ  1 
ATOM   2482 N NH1 . ARG A 1 321 ? 27.869  28.729  110.224 1.00 96.41  ? 356 ARG A NH1 1 
ATOM   2483 N NH2 . ARG A 1 321 ? 26.471  30.239  109.205 1.00 96.84  ? 356 ARG A NH2 1 
ATOM   2484 N N   . CYS A 1 322 ? 23.140  22.150  112.775 1.00 80.65  ? 357 CYS A N   1 
ATOM   2485 C CA  . CYS A 1 322 ? 23.293  20.801  113.315 1.00 79.60  ? 357 CYS A CA  1 
ATOM   2486 C C   . CYS A 1 322 ? 22.397  19.785  112.599 1.00 74.77  ? 357 CYS A C   1 
ATOM   2487 O O   . CYS A 1 322 ? 21.452  20.158  111.906 1.00 71.65  ? 357 CYS A O   1 
ATOM   2488 C CB  . CYS A 1 322 ? 23.055  20.779  114.826 1.00 77.86  ? 357 CYS A CB  1 
ATOM   2489 S SG  . CYS A 1 322 ? 21.384  21.222  115.323 1.00 83.69  ? 357 CYS A SG  1 
ATOM   2490 N N   . SER A 1 323 ? 22.721  18.505  112.752 1.00 73.95  ? 358 SER A N   1 
ATOM   2491 C CA  . SER A 1 323 ? 21.912  17.417  112.205 1.00 71.37  ? 358 SER A CA  1 
ATOM   2492 C C   . SER A 1 323 ? 20.551  17.296  112.897 1.00 70.28  ? 358 SER A C   1 
ATOM   2493 O O   . SER A 1 323 ? 20.337  17.831  113.991 1.00 71.86  ? 358 SER A O   1 
ATOM   2494 C CB  . SER A 1 323 ? 22.654  16.081  112.318 1.00 70.48  ? 358 SER A CB  1 
ATOM   2495 O OG  . SER A 1 323 ? 22.725  15.646  113.668 1.00 72.45  ? 358 SER A OG  1 
ATOM   2496 N N   . ALA A 1 324 ? 19.630  16.601  112.239 1.00 69.75  ? 359 ALA A N   1 
ATOM   2497 C CA  . ALA A 1 324 ? 18.306  16.349  112.793 1.00 73.27  ? 359 ALA A CA  1 
ATOM   2498 C C   . ALA A 1 324 ? 18.399  15.607  114.123 1.00 72.45  ? 359 ALA A C   1 
ATOM   2499 O O   . ALA A 1 324 ? 17.621  15.860  115.041 1.00 70.30  ? 359 ALA A O   1 
ATOM   2500 C CB  . ALA A 1 324 ? 17.455  15.562  111.794 1.00 72.60  ? 359 ALA A CB  1 
ATOM   2501 N N   . LYS A 1 325 ? 19.352  14.687  114.214 1.00 74.24  ? 360 LYS A N   1 
ATOM   2502 C CA  . LYS A 1 325 ? 19.573  13.932  115.439 1.00 77.34  ? 360 LYS A CA  1 
ATOM   2503 C C   . LYS A 1 325 ? 19.984  14.851  116.591 1.00 82.45  ? 360 LYS A C   1 
ATOM   2504 O O   . LYS A 1 325 ? 19.522  14.691  117.720 1.00 83.50  ? 360 LYS A O   1 
ATOM   2505 C CB  . LYS A 1 325 ? 20.631  12.851  115.215 1.00 81.20  ? 360 LYS A CB  1 
ATOM   2506 C CG  . LYS A 1 325 ? 20.953  12.039  116.456 1.00 87.92  ? 360 LYS A CG  1 
ATOM   2507 C CD  . LYS A 1 325 ? 22.031  11.002  116.185 1.00 94.02  ? 360 LYS A CD  1 
ATOM   2508 C CE  . LYS A 1 325 ? 22.410  10.273  117.468 1.00 102.88 ? 360 LYS A CE  1 
ATOM   2509 N NZ  . LYS A 1 325 ? 23.494  9.273   117.257 1.00 107.75 ? 360 LYS A NZ  1 
ATOM   2510 N N   . ASP A 1 326 ? 20.859  15.809  116.304 1.00 84.52  ? 361 ASP A N   1 
ATOM   2511 C CA  . ASP A 1 326 ? 21.232  16.803  117.301 1.00 88.19  ? 361 ASP A CA  1 
ATOM   2512 C C   . ASP A 1 326 ? 20.011  17.633  117.670 1.00 84.40  ? 361 ASP A C   1 
ATOM   2513 O O   . ASP A 1 326 ? 19.768  17.918  118.844 1.00 82.35  ? 361 ASP A O   1 
ATOM   2514 C CB  . ASP A 1 326 ? 22.348  17.715  116.779 1.00 92.79  ? 361 ASP A CB  1 
ATOM   2515 C CG  . ASP A 1 326 ? 23.678  16.989  116.625 1.00 96.00  ? 361 ASP A CG  1 
ATOM   2516 O OD1 . ASP A 1 326 ? 23.944  16.046  117.406 1.00 92.45  ? 361 ASP A OD1 1 
ATOM   2517 O OD2 . ASP A 1 326 ? 24.458  17.366  115.721 1.00 100.30 ? 361 ASP A OD2 1 
ATOM   2518 N N   . LEU A 1 327 ? 19.241  18.012  116.655 1.00 84.21  ? 362 LEU A N   1 
ATOM   2519 C CA  . LEU A 1 327 ? 18.036  18.800  116.863 1.00 88.18  ? 362 LEU A CA  1 
ATOM   2520 C C   . LEU A 1 327 ? 17.096  18.118  117.850 1.00 90.60  ? 362 LEU A C   1 
ATOM   2521 O O   . LEU A 1 327 ? 16.606  18.745  118.791 1.00 96.17  ? 362 LEU A O   1 
ATOM   2522 C CB  . LEU A 1 327 ? 17.319  19.040  115.536 1.00 88.54  ? 362 LEU A CB  1 
ATOM   2523 C CG  . LEU A 1 327 ? 17.312  20.481  115.028 1.00 91.17  ? 362 LEU A CG  1 
ATOM   2524 C CD1 . LEU A 1 327 ? 16.516  20.567  113.733 1.00 88.59  ? 362 LEU A CD1 1 
ATOM   2525 C CD2 . LEU A 1 327 ? 16.734  21.414  116.084 1.00 93.22  ? 362 LEU A CD2 1 
ATOM   2526 N N   . VAL A 1 328 ? 16.847  16.832  117.633 1.00 85.59  ? 363 VAL A N   1 
ATOM   2527 C CA  . VAL A 1 328 ? 15.988  16.073  118.529 1.00 86.20  ? 363 VAL A CA  1 
ATOM   2528 C C   . VAL A 1 328 ? 16.612  15.968  119.909 1.00 90.11  ? 363 VAL A C   1 
ATOM   2529 O O   . VAL A 1 328 ? 16.000  16.349  120.905 1.00 92.20  ? 363 VAL A O   1 
ATOM   2530 C CB  . VAL A 1 328 ? 15.739  14.645  118.005 1.00 82.99  ? 363 VAL A CB  1 
ATOM   2531 C CG1 . VAL A 1 328 ? 15.053  13.796  119.071 1.00 79.65  ? 363 VAL A CG1 1 
ATOM   2532 C CG2 . VAL A 1 328 ? 14.920  14.684  116.725 1.00 79.30  ? 363 VAL A CG2 1 
ATOM   2533 N N   . GLU A 1 329 ? 17.836  15.451  119.957 1.00 92.78  ? 364 GLU A N   1 
ATOM   2534 C CA  . GLU A 1 329 ? 18.525  15.224  121.222 1.00 97.52  ? 364 GLU A CA  1 
ATOM   2535 C C   . GLU A 1 329 ? 18.607  16.476  122.086 1.00 102.27 ? 364 GLU A C   1 
ATOM   2536 O O   . GLU A 1 329 ? 18.590  16.394  123.319 1.00 107.64 ? 364 GLU A O   1 
ATOM   2537 C CB  . GLU A 1 329 ? 19.932  14.682  120.978 1.00 101.52 ? 364 GLU A CB  1 
ATOM   2538 C CG  . GLU A 1 329 ? 19.974  13.247  120.497 1.00 104.47 ? 364 GLU A CG  1 
ATOM   2539 C CD  . GLU A 1 329 ? 21.384  12.691  120.462 1.00 110.35 ? 364 GLU A CD  1 
ATOM   2540 O OE1 . GLU A 1 329 ? 22.330  13.445  120.787 1.00 113.44 ? 364 GLU A OE1 1 
ATOM   2541 O OE2 . GLU A 1 329 ? 21.546  11.501  120.113 1.00 111.17 ? 364 GLU A OE2 1 
ATOM   2542 N N   . ASN A 1 330 ? 18.710  17.634  121.443 1.00 99.66  ? 365 ASN A N   1 
ATOM   2543 C CA  . ASN A 1 330 ? 18.826  18.884  122.184 1.00 102.12 ? 365 ASN A CA  1 
ATOM   2544 C C   . ASN A 1 330 ? 17.519  19.269  122.866 1.00 106.14 ? 365 ASN A C   1 
ATOM   2545 O O   . ASN A 1 330 ? 17.526  19.835  123.956 1.00 108.59 ? 365 ASN A O   1 
ATOM   2546 C CB  . ASN A 1 330 ? 19.333  20.019  121.290 1.00 97.67  ? 365 ASN A CB  1 
ATOM   2547 C CG  . ASN A 1 330 ? 20.789  19.840  120.890 1.00 93.43  ? 365 ASN A CG  1 
ATOM   2548 O OD1 . ASN A 1 330 ? 21.531  19.084  121.519 1.00 92.86  ? 365 ASN A OD1 1 
ATOM   2549 N ND2 . ASN A 1 330 ? 21.205  20.539  119.842 1.00 91.73  ? 365 ASN A ND2 1 
ATOM   2550 N N   . LYS A 1 331 ? 16.398  18.959  122.224 1.00 108.33 ? 366 LYS A N   1 
ATOM   2551 C CA  . LYS A 1 331 ? 15.097  19.185  122.837 1.00 114.43 ? 366 LYS A CA  1 
ATOM   2552 C C   . LYS A 1 331 ? 14.990  18.388  124.132 1.00 119.12 ? 366 LYS A C   1 
ATOM   2553 O O   . LYS A 1 331 ? 14.578  18.919  125.163 1.00 122.54 ? 366 LYS A O   1 
ATOM   2554 C CB  . LYS A 1 331 ? 13.969  18.787  121.885 1.00 115.40 ? 366 LYS A CB  1 
ATOM   2555 C CG  . LYS A 1 331 ? 13.869  19.644  120.636 1.00 116.10 ? 366 LYS A CG  1 
ATOM   2556 C CD  . LYS A 1 331 ? 12.696  19.212  119.774 1.00 116.53 ? 366 LYS A CD  1 
ATOM   2557 C CE  . LYS A 1 331 ? 12.624  20.025  118.494 1.00 117.26 ? 366 LYS A CE  1 
ATOM   2558 N NZ  . LYS A 1 331 ? 11.504  19.578  117.620 1.00 116.22 ? 366 LYS A NZ  1 
ATOM   2559 N N   . PHE A 1 332 ? 15.364  17.114  124.075 1.00 119.83 ? 367 PHE A N   1 
ATOM   2560 C CA  . PHE A 1 332 ? 15.323  16.257  125.254 1.00 124.73 ? 367 PHE A CA  1 
ATOM   2561 C C   . PHE A 1 332 ? 16.352  16.688  126.294 1.00 128.46 ? 367 PHE A C   1 
ATOM   2562 O O   . PHE A 1 332 ? 16.203  16.393  127.480 1.00 131.60 ? 367 PHE A O   1 
ATOM   2563 C CB  . PHE A 1 332 ? 15.532  14.788  124.871 1.00 125.82 ? 367 PHE A CB  1 
ATOM   2564 C CG  . PHE A 1 332 ? 14.448  14.228  123.994 1.00 128.15 ? 367 PHE A CG  1 
ATOM   2565 C CD1 . PHE A 1 332 ? 13.155  14.722  124.067 1.00 129.82 ? 367 PHE A CD1 1 
ATOM   2566 C CD2 . PHE A 1 332 ? 14.723  13.214  123.088 1.00 126.56 ? 367 PHE A CD2 1 
ATOM   2567 C CE1 . PHE A 1 332 ? 12.154  14.212  123.254 1.00 127.30 ? 367 PHE A CE1 1 
ATOM   2568 C CE2 . PHE A 1 332 ? 13.726  12.700  122.274 1.00 123.02 ? 367 PHE A CE2 1 
ATOM   2569 C CZ  . PHE A 1 332 ? 12.442  13.200  122.357 1.00 123.30 ? 367 PHE A CZ  1 
ATOM   2570 N N   . LEU A 1 333 ? 17.397  17.382  125.851 1.00 128.45 ? 368 LEU A N   1 
ATOM   2571 C CA  . LEU A 1 333 ? 18.398  17.888  126.784 1.00 129.92 ? 368 LEU A CA  1 
ATOM   2572 C C   . LEU A 1 333 ? 17.895  19.139  127.486 1.00 130.64 ? 368 LEU A C   1 
ATOM   2573 O O   . LEU A 1 333 ? 18.049  19.269  128.700 1.00 132.29 ? 368 LEU A O   1 
ATOM   2574 C CB  . LEU A 1 333 ? 19.740  18.152  126.103 1.00 129.97 ? 368 LEU A CB  1 
ATOM   2575 C CG  . LEU A 1 333 ? 20.909  18.295  127.088 1.00 134.14 ? 368 LEU A CG  1 
ATOM   2576 C CD1 . LEU A 1 333 ? 22.236  18.039  126.397 1.00 132.95 ? 368 LEU A CD1 1 
ATOM   2577 C CD2 . LEU A 1 333 ? 20.905  19.655  127.775 1.00 138.71 ? 368 LEU A CD2 1 
ATOM   2578 N N   . LEU A 1 334 ? 17.274  20.056  126.747 1.00 131.75 ? 369 LEU A N   1 
ATOM   2579 C CA  . LEU A 1 334 ? 16.548  21.085  127.458 1.00 137.56 ? 369 LEU A CA  1 
ATOM   2580 C C   . LEU A 1 334 ? 15.097  20.658  127.405 1.00 141.07 ? 369 LEU A C   1 
ATOM   2581 O O   . LEU A 1 334 ? 14.320  21.068  126.537 1.00 139.22 ? 369 LEU A O   1 
ATOM   2582 C CB  . LEU A 1 334 ? 16.726  22.418  126.727 1.00 135.05 ? 369 LEU A CB  1 
ATOM   2583 C CG  . LEU A 1 334 ? 15.779  23.585  127.017 1.00 133.80 ? 369 LEU A CG  1 
ATOM   2584 C CD1 . LEU A 1 334 ? 16.481  24.652  127.840 1.00 135.42 ? 369 LEU A CD1 1 
ATOM   2585 C CD2 . LEU A 1 334 ? 15.251  24.166  125.707 1.00 129.00 ? 369 LEU A CD2 1 
ATOM   2586 N N   . SER A 1 335 ? 14.760  19.814  128.370 1.00 145.40 ? 370 SER A N   1 
ATOM   2587 C CA  . SER A 1 335 ? 13.429  19.575  128.880 1.00 147.64 ? 370 SER A CA  1 
ATOM   2588 C C   . SER A 1 335 ? 13.726  19.305  130.342 1.00 150.67 ? 370 SER A C   1 
ATOM   2589 O O   . SER A 1 335 ? 13.324  20.034  131.250 1.00 154.03 ? 370 SER A O   1 
ATOM   2590 C CB  . SER A 1 335 ? 12.799  18.355  128.215 1.00 146.79 ? 370 SER A CB  1 
ATOM   2591 O OG  . SER A 1 335 ? 11.442  18.216  128.584 1.00 148.76 ? 370 SER A OG  1 
ATOM   2592 N N   . ASN A 1 336 ? 14.469  18.213  130.519 1.00 150.06 ? 371 ASN A N   1 
ATOM   2593 C CA  . ASN A 1 336 ? 14.849  17.652  131.808 1.00 153.94 ? 371 ASN A CA  1 
ATOM   2594 C C   . ASN A 1 336 ? 15.577  18.620  132.734 1.00 159.93 ? 371 ASN A C   1 
ATOM   2595 O O   . ASN A 1 336 ? 15.654  18.391  133.942 1.00 164.10 ? 371 ASN A O   1 
ATOM   2596 C CB  . ASN A 1 336 ? 15.729  16.414  131.591 1.00 151.13 ? 371 ASN A CB  1 
ATOM   2597 C CG  . ASN A 1 336 ? 15.254  15.543  130.440 1.00 146.83 ? 371 ASN A CG  1 
ATOM   2598 O OD1 . ASN A 1 336 ? 14.077  15.550  130.076 1.00 145.26 ? 371 ASN A OD1 1 
ATOM   2599 N ND2 . ASN A 1 336 ? 16.177  14.783  129.860 1.00 145.12 ? 371 ASN A ND2 1 
ATOM   2600 N N   . SER A 1 337 ? 16.135  19.683  132.166 1.00 160.38 ? 372 SER A N   1 
ATOM   2601 C CA  . SER A 1 337 ? 16.829  20.689  132.963 1.00 164.67 ? 372 SER A CA  1 
ATOM   2602 C C   . SER A 1 337 ? 16.298  22.084  132.651 1.00 164.14 ? 372 SER A C   1 
ATOM   2603 O O   . SER A 1 337 ? 15.086  22.277  132.508 1.00 162.35 ? 372 SER A O   1 
ATOM   2604 C CB  . SER A 1 337 ? 18.342  20.624  132.732 1.00 165.41 ? 372 SER A CB  1 
ATOM   2605 O OG  . SER A 1 337 ? 18.661  20.786  131.358 1.00 162.42 ? 372 SER A OG  1 
HETATM 2606 K K   . K   B 2 .   ? 0.000   -0.000  31.562  0.25 52.16  ? 501 K   A K   1 
HETATM 2607 K K   . K   C 2 .   ? 0.000   -0.000  34.579  0.25 67.45  ? 502 K   A K   1 
HETATM 2608 K K   . K   D 2 .   ? 0.000   -0.000  37.519  0.25 49.47  ? 503 K   A K   1 
HETATM 2609 K K   . K   E 2 .   ? 0.000   -0.000  40.642  0.25 42.43  ? 504 K   A K   1 
HETATM 2610 K K   . K   F 2 .   ? 0.000   -0.000  84.728  0.25 160.39 ? 508 K   A K   1 
HETATM 2611 K K   . K   G 2 .   ? 0.000   -0.000  104.268 0.25 105.98 ? 510 K   A K   1 
HETATM 2612 O O1  . P8P H 3 .   ? 18.491  8.897   62.701  1.00 146.00 ? 379 P8P A O1  1 
HETATM 2613 P P1  . P8P H 3 .   ? 19.309  9.077   61.321  1.00 125.45 ? 379 P8P A P1  1 
HETATM 2614 P P2  . P8P H 3 .   ? 18.905  7.801   63.809  1.00 150.17 ? 379 P8P A P2  1 
HETATM 2615 O O11 . P8P H 3 .   ? 20.384  10.121  61.522  1.00 125.53 ? 379 P8P A O11 1 
HETATM 2616 O O12 . P8P H 3 .   ? 19.684  7.706   60.806  1.00 124.69 ? 379 P8P A O12 1 
HETATM 2617 O O13 . P8P H 3 .   ? 18.156  9.701   60.380  1.00 144.79 ? 379 P8P A O13 1 
HETATM 2618 C C1A . P8P H 3 .   ? 14.691  10.299  58.777  1.00 133.70 ? 379 P8P A C1A 1 
HETATM 2619 O O1A . P8P H 3 .   ? 14.105  11.035  59.554  1.00 133.01 ? 379 P8P A O1A 1 
HETATM 2620 C C1B . P8P H 3 .   ? 18.998  9.088   55.370  1.00 149.99 ? 379 P8P A C1B 1 
HETATM 2621 O O1B . P8P H 3 .   ? 18.817  7.887   55.493  1.00 151.51 ? 379 P8P A O1B 1 
HETATM 2622 C C1C . P8P H 3 .   ? 18.409  10.205  59.069  1.00 143.64 ? 379 P8P A C1C 1 
HETATM 2623 O O21 . P8P H 3 .   ? 17.860  7.962   64.890  1.00 148.14 ? 379 P8P A O21 1 
HETATM 2624 O O22 . P8P H 3 .   ? 20.302  8.205   64.219  1.00 151.94 ? 379 P8P A O22 1 
HETATM 2625 O O23 . P8P H 3 .   ? 18.840  6.487   63.069  1.00 150.64 ? 379 P8P A O23 1 
HETATM 2626 C C2A . P8P H 3 .   ? 14.010  9.862   57.500  1.00 130.34 ? 379 P8P A C2A 1 
HETATM 2627 C C2B . P8P H 3 .   ? 19.935  9.616   54.308  1.00 149.24 ? 379 P8P A C2B 1 
HETATM 2628 C C2C . P8P H 3 .   ? 17.086  10.333  58.316  1.00 142.35 ? 379 P8P A C2C 1 
HETATM 2629 O O2C . P8P H 3 .   ? 16.026  9.831   59.136  1.00 138.16 ? 379 P8P A O2C 1 
HETATM 2630 C C3A . P8P H 3 .   ? 12.602  10.447  57.452  1.00 126.91 ? 379 P8P A C3A 1 
HETATM 2631 C C3B . P8P H 3 .   ? 21.359  9.647   54.852  1.00 148.75 ? 379 P8P A C3B 1 
HETATM 2632 C C3C . P8P H 3 .   ? 17.201  9.519   57.035  1.00 145.31 ? 379 P8P A C3C 1 
HETATM 2633 O O3C . P8P H 3 .   ? 18.308  9.998   56.272  1.00 147.96 ? 379 P8P A O3C 1 
HETATM 2634 C C4A . P8P H 3 .   ? 11.928  10.148  56.118  1.00 124.11 ? 379 P8P A C4A 1 
HETATM 2635 C C4B . P8P H 3 .   ? 22.354  9.981   53.747  1.00 148.28 ? 379 P8P A C4B 1 
HETATM 2636 C C5A . P8P H 3 .   ? 10.619  10.917  55.977  1.00 122.73 ? 379 P8P A C5A 1 
HETATM 2637 C C6A . P8P H 3 .   ? 10.052  10.761  54.571  1.00 121.98 ? 379 P8P A C6A 1 
HETATM 2638 C C7A . P8P H 3 .   ? 8.726   11.499  54.410  1.00 121.13 ? 379 P8P A C7A 1 
HETATM 2639 C C8A . P8P H 3 .   ? 8.902   12.996  54.547  1.00 120.58 ? 379 P8P A C8A 1 
HETATM 2640 O O   . HOH I 4 .   ? -6.293  6.781   94.661  1.00 37.95  ? 1   HOH A O   1 
HETATM 2641 O O   . HOH I 4 .   ? 7.167   -2.002  29.997  1.00 46.64  ? 2   HOH A O   1 
HETATM 2642 O O   . HOH I 4 .   ? 1.928   5.193   98.044  1.00 52.03  ? 3   HOH A O   1 
HETATM 2643 O O   . HOH I 4 .   ? 11.800  12.123  93.440  1.00 49.14  ? 4   HOH A O   1 
HETATM 2644 O O   . HOH I 4 .   ? 5.399   21.768  86.233  1.00 62.14  ? 5   HOH A O   1 
HETATM 2645 O O   . HOH I 4 .   ? 5.625   -3.458  32.334  1.00 49.08  ? 6   HOH A O   1 
HETATM 2646 O O   . HOH I 4 .   ? -0.857  11.804  89.018  1.00 46.16  ? 7   HOH A O   1 
HETATM 2647 O O   . HOH I 4 .   ? 11.430  6.568   98.097  1.00 51.51  ? 8   HOH A O   1 
HETATM 2648 O O   . HOH I 4 .   ? 1.301   20.952  90.429  1.00 63.11  ? 9   HOH A O   1 
HETATM 2649 O O   . HOH I 4 .   ? -2.853  4.876   93.982  1.00 46.55  ? 10  HOH A O   1 
HETATM 2650 O O   . HOH I 4 .   ? 15.119  26.674  107.572 1.00 67.52  ? 11  HOH A O   1 
HETATM 2651 O O   . HOH I 4 .   ? -5.215  2.318   87.435  1.00 60.82  ? 12  HOH A O   1 
HETATM 2652 O O   . HOH I 4 .   ? -5.444  20.278  81.222  1.00 64.77  ? 13  HOH A O   1 
HETATM 2653 O O   . HOH I 4 .   ? 5.452   22.871  96.132  1.00 58.82  ? 14  HOH A O   1 
HETATM 2654 O O   . HOH I 4 .   ? 12.090  -3.816  26.458  1.00 54.17  ? 15  HOH A O   1 
HETATM 2655 O O   . HOH I 4 .   ? 3.092   4.904   94.639  1.00 50.72  ? 16  HOH A O   1 
HETATM 2656 O O   . HOH I 4 .   ? 8.607   6.367   97.528  1.00 52.96  ? 17  HOH A O   1 
HETATM 2657 O O   . HOH I 4 .   ? -2.565  9.728   99.816  1.00 59.73  ? 18  HOH A O   1 
HETATM 2658 O O   . HOH I 4 .   ? 6.849   15.402  99.234  1.00 61.62  ? 19  HOH A O   1 
HETATM 2659 O O   . HOH I 4 .   ? 1.921   3.141   90.630  1.00 67.15  ? 20  HOH A O   1 
HETATM 2660 O O   . HOH I 4 .   ? 10.333  -13.563 27.438  1.00 64.43  ? 21  HOH A O   1 
HETATM 2661 O O   . HOH I 4 .   ? 5.975   -22.194 24.262  1.00 75.65  ? 22  HOH A O   1 
HETATM 2662 O O   . HOH I 4 .   ? 1.320   5.365   92.216  1.00 56.86  ? 23  HOH A O   1 
HETATM 2663 O O   . HOH I 4 .   ? 4.793   21.150  102.802 1.00 66.68  ? 24  HOH A O   1 
HETATM 2664 O O   . HOH I 4 .   ? 1.409   2.601   101.408 1.00 57.66  ? 25  HOH A O   1 
HETATM 2665 O O   . HOH I 4 .   ? 8.833   25.590  97.546  1.00 77.45  ? 26  HOH A O   1 
HETATM 2666 O O   . HOH I 4 .   ? 8.554   3.518   103.761 1.00 68.83  ? 27  HOH A O   1 
HETATM 2667 O O   . HOH I 4 .   ? 10.835  -13.960 30.277  1.00 60.59  ? 28  HOH A O   1 
HETATM 2668 O O   . HOH I 4 .   ? 1.468   3.163   96.369  1.00 50.11  ? 29  HOH A O   1 
HETATM 2669 O O   . HOH I 4 .   ? 21.872  -2.853  96.982  1.00 83.79  ? 30  HOH A O   1 
HETATM 2670 O O   . HOH I 4 .   ? 6.099   13.232  97.924  1.00 59.75  ? 31  HOH A O   1 
HETATM 2671 O O   . HOH I 4 .   ? 8.851   -3.925  44.620  1.00 58.75  ? 32  HOH A O   1 
HETATM 2672 O O   . HOH I 4 .   ? 8.039   -4.990  46.939  1.00 70.71  ? 33  HOH A O   1 
HETATM 2673 O O   . HOH I 4 .   ? 8.440   7.040   100.182 1.00 45.58  ? 34  HOH A O   1 
HETATM 2674 O O   . HOH I 4 .   ? 4.117   -16.663 29.272  1.00 51.63  ? 35  HOH A O   1 
HETATM 2675 O O   . HOH I 4 .   ? 12.883  27.241  106.204 1.00 59.96  ? 380 HOH A O   1 
HETATM 2676 O O   . HOH I 4 .   ? 6.805   13.568  102.279 1.00 68.03  ? 381 HOH A O   1 
HETATM 2677 O O   . HOH I 4 .   ? 20.369  15.614  109.600 1.00 65.52  ? 382 HOH A O   1 
HETATM 2678 O O   . HOH I 4 .   ? 9.667   5.120   101.351 1.00 47.69  ? 383 HOH A O   1 
HETATM 2679 O O   . HOH I 4 .   ? 14.752  28.081  109.811 1.00 70.36  ? 384 HOH A O   1 
HETATM 2680 O O   . HOH I 4 .   ? 10.194  -9.509  17.474  1.00 71.99  ? 385 HOH A O   1 
HETATM 2681 O O   . HOH I 4 .   ? 0.052   8.156   91.717  1.00 61.14  ? 386 HOH A O   1 
HETATM 2682 O O   . HOH I 4 .   ? 16.472  32.992  108.051 1.00 77.09  ? 387 HOH A O   1 
HETATM 2683 O O   . HOH I 4 .   ? -0.907  3.078   94.499  1.00 74.88  ? 388 HOH A O   1 
HETATM 2684 O O   . HOH I 4 .   ? 15.574  10.804  83.015  1.00 66.38  ? 389 HOH A O   1 
HETATM 2685 O O   . HOH I 4 .   ? 7.769   24.230  93.895  1.00 63.31  ? 390 HOH A O   1 
HETATM 2686 O O   . HOH I 4 .   ? 7.771   -1.874  45.702  1.00 94.44  ? 391 HOH A O   1 
HETATM 2687 O O   . HOH I 4 .   ? 16.362  0.603   101.631 1.00 60.72  ? 392 HOH A O   1 
HETATM 2688 O O   . HOH I 4 .   ? 5.363   17.194  98.249  1.00 75.24  ? 393 HOH A O   1 
HETATM 2689 O O   . HOH I 4 .   ? 0.565   16.781  94.333  1.00 64.76  ? 394 HOH A O   1 
HETATM 2690 O O   . HOH I 4 .   ? 9.112   12.100  104.358 1.00 61.51  ? 395 HOH A O   1 
HETATM 2691 O O   . HOH I 4 .   ? 1.923   -0.398  27.230  1.00 60.45  ? 396 HOH A O   1 
HETATM 2692 O O   . HOH I 4 .   ? 25.731  -13.586 81.924  1.00 82.92  ? 397 HOH A O   1 
HETATM 2693 O O   . HOH I 4 .   ? 12.082  0.095   24.316  1.00 80.06  ? 398 HOH A O   1 
HETATM 2694 O O   . HOH I 4 .   ? 21.480  -14.610 18.921  1.00 84.80  ? 399 HOH A O   1 
HETATM 2695 O O   . HOH I 4 .   ? 15.281  1.237   104.016 1.00 70.13  ? 400 HOH A O   1 
HETATM 2696 O O   . HOH I 4 .   ? -0.316  14.546  87.543  1.00 63.20  ? 401 HOH A O   1 
HETATM 2697 O O   . HOH I 4 .   ? -2.262  15.549  78.594  1.00 86.87  ? 402 HOH A O   1 
HETATM 2698 O O   . HOH I 4 .   ? 10.462  0.491   26.689  1.00 65.62  ? 403 HOH A O   1 
HETATM 2699 O O   . HOH I 4 .   ? 2.661   0.718   102.917 1.00 65.88  ? 404 HOH A O   1 
HETATM 2700 O O   . HOH I 4 .   ? -1.600  4.515   91.170  1.00 92.69  ? 405 HOH A O   1 
HETATM 2701 O O   . HOH I 4 .   ? 15.811  3.918   104.522 1.00 68.53  ? 406 HOH A O   1 
HETATM 2702 O O   . HOH I 4 .   ? 14.953  1.211   97.959  1.00 78.25  ? 407 HOH A O   1 
HETATM 2703 O O   . HOH I 4 .   ? 2.085   14.898  98.237  1.00 79.58  ? 408 HOH A O   1 
HETATM 2704 O O   . HOH I 4 .   ? 21.015  -11.022 26.896  1.00 68.65  ? 409 HOH A O   1 
HETATM 2705 O O   . HOH I 4 .   ? 21.971  -8.547  27.502  1.00 63.51  ? 410 HOH A O   1 
HETATM 2706 O O   . HOH I 4 .   ? -2.705  9.316   76.892  1.00 78.90  ? 411 HOH A O   1 
HETATM 2707 O O   . HOH I 4 .   ? 12.077  3.277   104.222 1.00 74.10  ? 412 HOH A O   1 
HETATM 2708 O O   . HOH I 4 .   ? 6.152   6.787   104.142 1.00 66.28  ? 413 HOH A O   1 
HETATM 2709 O O   . HOH I 4 .   ? 11.582  12.772  81.074  1.00 69.46  ? 414 HOH A O   1 
HETATM 2710 O O   . HOH I 4 .   ? 14.719  13.586  82.701  1.00 99.09  ? 415 HOH A O   1 
HETATM 2711 O O   . HOH I 4 .   ? 16.624  13.919  80.712  1.00 85.66  ? 416 HOH A O   1 
HETATM 2712 O O   . HOH I 4 .   ? 28.329  7.414   96.515  1.00 69.26  ? 417 HOH A O   1 
HETATM 2713 O O   . HOH I 4 .   ? 28.154  8.364   94.278  1.00 68.50  ? 418 HOH A O   1 
HETATM 2714 O O   . HOH I 4 .   ? 26.293  14.885  85.242  1.00 56.01  ? 419 HOH A O   1 
HETATM 2715 O O   . HOH I 4 .   ? 24.128  15.152  83.028  1.00 77.31  ? 420 HOH A O   1 
HETATM 2716 O O   . HOH I 4 .   ? 29.984  14.710  88.349  1.00 77.60  ? 421 HOH A O   1 
HETATM 2717 O O   . HOH I 4 .   ? 31.499  12.454  89.303  1.00 85.00  ? 422 HOH A O   1 
HETATM 2718 O O   . HOH I 4 .   ? 21.643  2.218   81.822  1.00 96.36  ? 423 HOH A O   1 
HETATM 2719 O O   . HOH I 4 .   ? 3.908   25.711  91.995  1.00 89.38  ? 424 HOH A O   1 
HETATM 2720 O O   . HOH I 4 .   ? 1.856   23.496  93.528  1.00 85.77  ? 425 HOH A O   1 
HETATM 2721 O O   . HOH I 4 .   ? 5.880   28.138  93.439  1.00 54.18  ? 426 HOH A O   1 
HETATM 2722 O O   . HOH I 4 .   ? 9.318   13.342  110.449 1.00 75.20  ? 427 HOH A O   1 
HETATM 2723 O O   . HOH I 4 .   ? 5.350   20.144  105.647 1.00 84.35  ? 428 HOH A O   1 
HETATM 2724 O O   . HOH I 4 .   ? 20.757  28.242  93.392  1.00 85.26  ? 429 HOH A O   1 
HETATM 2725 O O   . HOH I 4 .   ? 3.866   -4.985  24.510  1.00 62.51  ? 430 HOH A O   1 
HETATM 2726 O O   . HOH I 4 .   ? 13.489  -17.327 18.273  1.00 72.23  ? 431 HOH A O   1 
HETATM 2727 O O   . HOH I 4 .   ? 16.138  -18.924 19.312  1.00 79.69  ? 432 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   36  ?   ?   ?   A . n 
A 1 2   ALA 2   37  ?   ?   ?   A . n 
A 1 3   ARG 3   38  ?   ?   ?   A . n 
A 1 4   ARG 4   39  ?   ?   ?   A . n 
A 1 5   LYS 5   40  ?   ?   ?   A . n 
A 1 6   CYS 6   41  41  CYS ALA A . n 
A 1 7   ARG 7   42  42  ARG ARG A . n 
A 1 8   ASN 8   43  43  ASN ASN A . n 
A 1 9   ARG 9   44  44  ARG ARG A . n 
A 1 10  PHE 10  45  45  PHE PHE A . n 
A 1 11  VAL 11  46  46  VAL VAL A . n 
A 1 12  LYS 12  47  47  LYS LYS A . n 
A 1 13  LYS 13  48  48  LYS LYS A . n 
A 1 14  ASN 14  49  49  ASN ASN A . n 
A 1 15  GLY 15  50  50  GLY GLY A . n 
A 1 16  GLN 16  51  51  GLN GLN A . n 
A 1 17  CYS 17  52  52  CYS CYS A . n 
A 1 18  ASN 18  53  53  ASN ASN A . n 
A 1 19  VAL 19  54  54  VAL VAL A . n 
A 1 20  GLU 20  55  55  GLU GLU A . n 
A 1 21  PHE 21  56  56  PHE PHE A . n 
A 1 22  THR 22  57  57  THR THR A . n 
A 1 23  ASN 23  58  58  ASN ASN A . n 
A 1 24  MET 24  59  59  MET MET A . n 
A 1 25  ASP 25  60  60  ASP ASP A . n 
A 1 26  ASP 26  61  61  ASP ALA A . n 
A 1 27  LYS 27  62  62  LYS ALA A . n 
A 1 28  PRO 28  63  63  PRO ALA A . n 
A 1 29  GLN 29  64  ?   ?   ?   A . n 
A 1 30  ARG 30  65  ?   ?   ?   A . n 
A 1 31  TYR 31  66  ?   ?   ?   A . n 
A 1 32  ILE 32  67  ?   ?   ?   A . n 
A 1 33  ALA 33  68  ?   ?   ?   A . n 
A 1 34  ASP 34  69  69  ASP ALA A . n 
A 1 35  MET 35  70  70  MET ALA A . n 
A 1 36  PHE 36  71  71  PHE PHE A . n 
A 1 37  THR 37  72  72  THR THR A . n 
A 1 38  THR 38  73  73  THR THR A . n 
A 1 39  CYS 39  74  74  CYS CYS A . n 
A 1 40  VAL 40  75  75  VAL VAL A . n 
A 1 41  ASP 41  76  76  ASP ASP A . n 
A 1 42  ILE 42  77  77  ILE ILE A . n 
A 1 43  ARG 43  78  78  ARG ARG A . n 
A 1 44  TRP 44  79  79  TRP TRP A . n 
A 1 45  ARG 45  80  80  ARG ARG A . n 
A 1 46  TYR 46  81  81  TYR TYR A . n 
A 1 47  MET 47  82  82  MET MET A . n 
A 1 48  LEU 48  83  83  LEU LEU A . n 
A 1 49  LEU 49  84  84  LEU LEU A . n 
A 1 50  LEU 50  85  85  LEU LEU A . n 
A 1 51  PHE 51  86  86  PHE PHE A . n 
A 1 52  SER 52  87  87  SER SER A . n 
A 1 53  LEU 53  88  88  LEU LEU A . n 
A 1 54  ALA 54  89  89  ALA ALA A . n 
A 1 55  PHE 55  90  90  PHE PHE A . n 
A 1 56  LEU 56  91  91  LEU LEU A . n 
A 1 57  VAL 57  92  92  VAL VAL A . n 
A 1 58  SER 58  93  93  SER SER A . n 
A 1 59  TRP 59  94  94  TRP TRP A . n 
A 1 60  LEU 60  95  95  LEU LEU A . n 
A 1 61  LEU 61  96  96  LEU LEU A . n 
A 1 62  PHE 62  97  97  PHE PHE A . n 
A 1 63  GLY 63  98  98  GLY GLY A . n 
A 1 64  LEU 64  99  99  LEU LEU A . n 
A 1 65  ILE 65  100 100 ILE ILE A . n 
A 1 66  PHE 66  101 101 PHE PHE A . n 
A 1 67  TRP 67  102 102 TRP TRP A . n 
A 1 68  LEU 68  103 103 LEU LEU A . n 
A 1 69  ILE 69  104 104 ILE ILE A . n 
A 1 70  ALA 70  105 105 ALA ALA A . n 
A 1 71  LEU 71  106 106 LEU LEU A . n 
A 1 72  ILE 72  107 107 ILE ILE A . n 
A 1 73  HIS 73  108 108 HIS HIS A . n 
A 1 74  GLY 74  109 109 GLY GLY A . n 
A 1 75  ASP 75  110 110 ASP ASP A . n 
A 1 76  LEU 76  111 111 LEU LEU A . n 
A 1 77  GLU 77  112 112 GLU GLU A . n 
A 1 78  ASN 78  113 113 ASN ASN A . n 
A 1 79  PRO 79  114 114 PRO PRO A . n 
A 1 80  GLY 80  115 115 GLY GLY A . n 
A 1 81  GLY 81  116 116 GLY GLY A . n 
A 1 82  ASP 82  117 117 ASP ASP A . n 
A 1 83  ASP 83  118 118 ASP ASP A . n 
A 1 84  THR 84  119 119 THR THR A . n 
A 1 85  PHE 85  120 120 PHE PHE A . n 
A 1 86  LYS 86  121 121 LYS LYS A . n 
A 1 87  PRO 87  122 122 PRO PRO A . n 
A 1 88  CYS 88  123 123 CYS CYS A . n 
A 1 89  VAL 89  124 124 VAL VAL A . n 
A 1 90  LEU 90  125 125 LEU LEU A . n 
A 1 91  GLN 91  126 126 GLN GLN A . n 
A 1 92  VAL 92  127 127 VAL VAL A . n 
A 1 93  ASN 93  128 128 ASN ASN A . n 
A 1 94  GLY 94  129 129 GLY GLY A . n 
A 1 95  PHE 95  130 130 PHE PHE A . n 
A 1 96  VAL 96  131 131 VAL VAL A . n 
A 1 97  ALA 97  132 132 ALA ALA A . n 
A 1 98  ALA 98  133 133 ALA ALA A . n 
A 1 99  PHE 99  134 134 PHE PHE A . n 
A 1 100 LEU 100 135 135 LEU LEU A . n 
A 1 101 PHE 101 136 136 PHE PHE A . n 
A 1 102 SER 102 137 137 SER SER A . n 
A 1 103 ILE 103 138 138 ILE ILE A . n 
A 1 104 GLU 104 139 139 GLU GLU A . n 
A 1 105 THR 105 140 140 THR THR A . n 
A 1 106 GLN 106 141 141 GLN GLN A . n 
A 1 107 THR 107 142 142 THR THR A . n 
A 1 108 THR 108 143 143 THR THR A . n 
A 1 109 ILE 109 144 144 ILE ILE A . n 
A 1 110 GLY 110 145 145 GLY GLY A . n 
A 1 111 TYR 111 146 146 TYR TYR A . n 
A 1 112 GLY 112 147 147 GLY GLY A . n 
A 1 113 PHE 113 148 148 PHE PHE A . n 
A 1 114 ARG 114 149 149 ARG ARG A . n 
A 1 115 CYS 115 150 150 CYS CYS A . n 
A 1 116 VAL 116 151 151 VAL VAL A . n 
A 1 117 THR 117 152 152 THR THR A . n 
A 1 118 GLU 118 153 153 GLU GLU A . n 
A 1 119 GLU 119 154 154 GLU GLU A . n 
A 1 120 CYS 120 155 155 CYS CYS A . n 
A 1 121 PRO 121 156 156 PRO PRO A . n 
A 1 122 LEU 122 157 157 LEU LEU A . n 
A 1 123 ALA 123 158 158 ALA ALA A . n 
A 1 124 VAL 124 159 159 VAL VAL A . n 
A 1 125 PHE 125 160 160 PHE PHE A . n 
A 1 126 MET 126 161 161 MET MET A . n 
A 1 127 VAL 127 162 162 VAL VAL A . n 
A 1 128 VAL 128 163 163 VAL VAL A . n 
A 1 129 VAL 129 164 164 VAL VAL A . n 
A 1 130 GLN 130 165 165 GLN GLN A . n 
A 1 131 SER 131 166 166 SER SER A . n 
A 1 132 ILE 132 167 167 ILE ILE A . n 
A 1 133 VAL 133 168 168 VAL VAL A . n 
A 1 134 GLY 134 169 169 GLY GLY A . n 
A 1 135 CYS 135 170 170 CYS CYS A . n 
A 1 136 ILE 136 171 171 ILE ILE A . n 
A 1 137 ILE 137 172 172 ILE ILE A . n 
A 1 138 ASP 138 173 173 ASP ASP A . n 
A 1 139 SER 139 174 174 SER SER A . n 
A 1 140 PHE 140 175 175 PHE PHE A . n 
A 1 141 MET 141 176 176 MET MET A . n 
A 1 142 ILE 142 177 177 ILE ILE A . n 
A 1 143 GLY 143 178 178 GLY GLY A . n 
A 1 144 ALA 144 179 179 ALA ALA A . n 
A 1 145 ILE 145 180 180 ILE ILE A . n 
A 1 146 MET 146 181 181 MET MET A . n 
A 1 147 ALA 147 182 182 ALA ALA A . n 
A 1 148 LYS 148 183 183 LYS LYS A . n 
A 1 149 MET 149 184 184 MET MET A . n 
A 1 150 ALA 150 185 185 ALA ALA A . n 
A 1 151 ARG 151 186 186 ARG ARG A . n 
A 1 152 PRO 152 187 187 PRO PRO A . n 
A 1 153 LYS 153 188 188 LYS LYS A . n 
A 1 154 LYS 154 189 189 LYS LYS A . n 
A 1 155 ARG 155 190 190 ARG ARG A . n 
A 1 156 ALA 156 191 191 ALA ALA A . n 
A 1 157 GLN 157 192 192 GLN GLN A . n 
A 1 158 THR 158 193 193 THR THR A . n 
A 1 159 LEU 159 194 194 LEU LEU A . n 
A 1 160 LEU 160 195 195 LEU LEU A . n 
A 1 161 PHE 161 196 196 PHE PHE A . n 
A 1 162 SER 162 197 197 SER SER A . n 
A 1 163 HIS 163 198 198 HIS HIS A . n 
A 1 164 ASN 164 199 199 ASN ASN A . n 
A 1 165 ALA 165 200 200 ALA ALA A . n 
A 1 166 VAL 166 201 201 VAL VAL A . n 
A 1 167 VAL 167 202 202 VAL VAL A . n 
A 1 168 ALA 168 203 203 ALA ALA A . n 
A 1 169 MET 169 204 204 MET MET A . n 
A 1 170 ARG 170 205 205 ARG ARG A . n 
A 1 171 ASP 171 206 206 ASP ASP A . n 
A 1 172 GLY 172 207 207 GLY GLY A . n 
A 1 173 LYS 173 208 208 LYS LYS A . n 
A 1 174 LEU 174 209 209 LEU LEU A . n 
A 1 175 CYS 175 210 210 CYS CYS A . n 
A 1 176 LEU 176 211 211 LEU LEU A . n 
A 1 177 MET 177 212 212 MET MET A . n 
A 1 178 TRP 178 213 213 TRP TRP A . n 
A 1 179 ARG 179 214 214 ARG ARG A . n 
A 1 180 VAL 180 215 215 VAL VAL A . n 
A 1 181 GLY 181 216 216 GLY GLY A . n 
A 1 182 ASN 182 217 217 ASN ASN A . n 
A 1 183 LEU 183 218 218 LEU LEU A . n 
A 1 184 ARG 184 219 219 ARG ARG A . n 
A 1 185 LYS 185 220 220 LYS LYS A . n 
A 1 186 SER 186 221 221 SER SER A . n 
A 1 187 HIS 187 222 222 HIS HIS A . n 
A 1 188 ILE 188 223 223 ILE ILE A . n 
A 1 189 VAL 189 224 224 VAL VAL A . n 
A 1 190 GLU 190 225 225 GLU GLU A . n 
A 1 191 ALA 191 226 226 ALA ALA A . n 
A 1 192 HIS 192 227 227 HIS HIS A . n 
A 1 193 VAL 193 228 228 VAL VAL A . n 
A 1 194 ARG 194 229 229 ARG ARG A . n 
A 1 195 ALA 195 230 230 ALA ALA A . n 
A 1 196 GLN 196 231 231 GLN GLN A . n 
A 1 197 LEU 197 232 232 LEU LEU A . n 
A 1 198 ILE 198 233 233 ILE ILE A . n 
A 1 199 LYS 199 234 234 LYS LYS A . n 
A 1 200 PRO 200 235 235 PRO PRO A . n 
A 1 201 ARG 201 236 236 ARG ARG A . n 
A 1 202 ILE 202 237 237 ILE ILE A . n 
A 1 203 THR 203 238 238 THR THR A . n 
A 1 204 GLU 204 239 239 GLU GLU A . n 
A 1 205 GLU 205 240 240 GLU GLU A . n 
A 1 206 GLY 206 241 241 GLY GLY A . n 
A 1 207 GLU 207 242 242 GLU GLU A . n 
A 1 208 TYR 208 243 243 TYR TYR A . n 
A 1 209 ILE 209 244 244 ILE ILE A . n 
A 1 210 PRO 210 245 245 PRO PRO A . n 
A 1 211 LEU 211 246 246 LEU LEU A . n 
A 1 212 ASP 212 247 247 ASP ASP A . n 
A 1 213 GLN 213 248 248 GLN GLN A . n 
A 1 214 ILE 214 249 249 ILE ILE A . n 
A 1 215 ASP 215 250 250 ASP ASP A . n 
A 1 216 ILE 216 251 251 ILE ILE A . n 
A 1 217 ASP 217 252 252 ASP ASP A . n 
A 1 218 VAL 218 253 253 VAL VAL A . n 
A 1 219 GLY 219 254 254 GLY GLY A . n 
A 1 220 PHE 220 255 255 PHE PHE A . n 
A 1 221 ASP 221 256 256 ASP ASP A . n 
A 1 222 LYS 222 257 257 LYS LYS A . n 
A 1 223 GLY 223 258 258 GLY GLY A . n 
A 1 224 LEU 224 259 259 LEU LEU A . n 
A 1 225 ASP 225 260 260 ASP ASP A . n 
A 1 226 ARG 226 261 261 ARG ARG A . n 
A 1 227 ILE 227 262 262 ILE ILE A . n 
A 1 228 PHE 228 263 263 PHE PHE A . n 
A 1 229 LEU 229 264 264 LEU LEU A . n 
A 1 230 VAL 230 265 265 VAL VAL A . n 
A 1 231 SER 231 266 266 SER SER A . n 
A 1 232 PRO 232 267 267 PRO PRO A . n 
A 1 233 ILE 233 268 268 ILE ILE A . n 
A 1 234 THR 234 269 269 THR THR A . n 
A 1 235 ILE 235 270 270 ILE ILE A . n 
A 1 236 LEU 236 271 271 LEU LEU A . n 
A 1 237 HIS 237 272 272 HIS HIS A . n 
A 1 238 GLU 238 273 273 GLU GLU A . n 
A 1 239 ILE 239 274 274 ILE ILE A . n 
A 1 240 ASN 240 275 275 ASN ASN A . n 
A 1 241 GLU 241 276 276 GLU GLU A . n 
A 1 242 ASP 242 277 277 ASP ASP A . n 
A 1 243 SER 243 278 278 SER SER A . n 
A 1 244 PRO 244 279 279 PRO PRO A . n 
A 1 245 LEU 245 280 280 LEU LEU A . n 
A 1 246 PHE 246 281 281 PHE PHE A . n 
A 1 247 GLY 247 282 282 GLY GLY A . n 
A 1 248 ILE 248 283 283 ILE ILE A . n 
A 1 249 SER 249 284 284 SER SER A . n 
A 1 250 ARG 250 285 285 ARG ARG A . n 
A 1 251 GLN 251 286 286 GLN GLN A . n 
A 1 252 ASP 252 287 287 ASP ASP A . n 
A 1 253 LEU 253 288 288 LEU LEU A . n 
A 1 254 GLU 254 289 289 GLU GLU A . n 
A 1 255 THR 255 290 290 THR THR A . n 
A 1 256 ASP 256 291 291 ASP ASP A . n 
A 1 257 ASP 257 292 292 ASP ASP A . n 
A 1 258 PHE 258 293 293 PHE PHE A . n 
A 1 259 GLU 259 294 294 GLU GLU A . n 
A 1 260 ILE 260 295 295 ILE ILE A . n 
A 1 261 VAL 261 296 296 VAL VAL A . n 
A 1 262 VAL 262 297 297 VAL VAL A . n 
A 1 263 ILE 263 298 298 ILE ILE A . n 
A 1 264 LEU 264 299 299 LEU LEU A . n 
A 1 265 GLU 265 300 300 GLU GLU A . n 
A 1 266 GLY 266 301 301 GLY GLY A . n 
A 1 267 MET 267 302 302 MET MET A . n 
A 1 268 VAL 268 303 303 VAL VAL A . n 
A 1 269 GLU 269 304 304 GLU GLU A . n 
A 1 270 ALA 270 305 305 ALA ALA A . n 
A 1 271 THR 271 306 306 THR THR A . n 
A 1 272 ALA 272 307 307 ALA ALA A . n 
A 1 273 MET 273 308 308 MET MET A . n 
A 1 274 THR 274 309 309 THR THR A . n 
A 1 275 THR 275 310 310 THR THR A . n 
A 1 276 GLN 276 311 311 GLN GLN A . n 
A 1 277 ALA 277 312 312 ALA ALA A . n 
A 1 278 ARG 278 313 313 ARG ARG A . n 
A 1 279 SER 279 314 314 SER SER A . n 
A 1 280 SER 280 315 315 SER SER A . n 
A 1 281 TYR 281 316 316 TYR TYR A . n 
A 1 282 LEU 282 317 317 LEU LEU A . n 
A 1 283 ALA 283 318 318 ALA ALA A . n 
A 1 284 SER 284 319 319 SER SER A . n 
A 1 285 GLU 285 320 320 GLU GLU A . n 
A 1 286 ILE 286 321 321 ILE ILE A . n 
A 1 287 LEU 287 322 322 LEU LEU A . n 
A 1 288 TRP 288 323 323 TRP TRP A . n 
A 1 289 GLY 289 324 324 GLY GLY A . n 
A 1 290 HIS 290 325 325 HIS HIS A . n 
A 1 291 ARG 291 326 326 ARG ARG A . n 
A 1 292 PHE 292 327 327 PHE PHE A . n 
A 1 293 GLU 293 328 328 GLU GLU A . n 
A 1 294 PRO 294 329 329 PRO PRO A . n 
A 1 295 VAL 295 330 330 VAL VAL A . n 
A 1 296 LEU 296 331 331 LEU LEU A . n 
A 1 297 PHE 297 332 332 PHE PHE A . n 
A 1 298 GLU 298 333 333 GLU GLU A . n 
A 1 299 GLU 299 334 334 GLU GLU A . n 
A 1 300 LYS 300 335 335 LYS LYS A . n 
A 1 301 ASN 301 336 336 ASN ASN A . n 
A 1 302 GLN 302 337 337 GLN GLN A . n 
A 1 303 TYR 303 338 338 TYR TYR A . n 
A 1 304 LYS 304 339 339 LYS LYS A . n 
A 1 305 VAL 305 340 340 VAL VAL A . n 
A 1 306 ASP 306 341 341 ASP ASP A . n 
A 1 307 TYR 307 342 342 TYR TYR A . n 
A 1 308 SER 308 343 343 SER SER A . n 
A 1 309 HIS 309 344 344 HIS HIS A . n 
A 1 310 PHE 310 345 345 PHE PHE A . n 
A 1 311 HIS 311 346 346 HIS HIS A . n 
A 1 312 LYS 312 347 347 LYS LYS A . n 
A 1 313 THR 313 348 348 THR THR A . n 
A 1 314 TYR 314 349 349 TYR TYR A . n 
A 1 315 GLU 315 350 350 GLU GLU A . n 
A 1 316 VAL 316 351 351 VAL VAL A . n 
A 1 317 PRO 317 352 352 PRO PRO A . n 
A 1 318 SER 318 353 353 SER SER A . n 
A 1 319 THR 319 354 354 THR THR A . n 
A 1 320 PRO 320 355 355 PRO PRO A . n 
A 1 321 ARG 321 356 356 ARG ARG A . n 
A 1 322 CYS 322 357 357 CYS CYS A . n 
A 1 323 SER 323 358 358 SER SER A . n 
A 1 324 ALA 324 359 359 ALA ALA A . n 
A 1 325 LYS 325 360 360 LYS LYS A . n 
A 1 326 ASP 326 361 361 ASP ASP A . n 
A 1 327 LEU 327 362 362 LEU LEU A . n 
A 1 328 VAL 328 363 363 VAL VAL A . n 
A 1 329 GLU 329 364 364 GLU GLU A . n 
A 1 330 ASN 330 365 365 ASN ASN A . n 
A 1 331 LYS 331 366 366 LYS LYS A . n 
A 1 332 PHE 332 367 367 PHE PHE A . n 
A 1 333 LEU 333 368 368 LEU LEU A . n 
A 1 334 LEU 334 369 369 LEU LEU A . n 
A 1 335 SER 335 370 370 SER SER A . n 
A 1 336 ASN 336 371 371 ASN ASN A . n 
A 1 337 SER 337 372 372 SER SER A . n 
A 1 338 LEU 338 373 ?   ?   ?   A . n 
A 1 339 GLU 339 374 ?   ?   ?   A . n 
A 1 340 VAL 340 375 ?   ?   ?   A . n 
A 1 341 LEU 341 376 ?   ?   ?   A . n 
A 1 342 PHE 342 377 ?   ?   ?   A . n 
A 1 343 GLN 343 378 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 K   1  501 501 K   K   A . 
C 2 K   1  502 502 K   K   A . 
D 2 K   1  503 503 K   K   A . 
E 2 K   1  504 504 K   K   A . 
F 2 K   1  508 508 K   K   A . 
G 2 K   1  510 510 K   K   A . 
H 3 P8P 1  379 4   P8P P8P A . 
I 4 HOH 1  1   1   HOH HOH A . 
I 4 HOH 2  2   2   HOH HOH A . 
I 4 HOH 3  3   3   HOH HOH A . 
I 4 HOH 4  4   4   HOH HOH A . 
I 4 HOH 5  5   5   HOH HOH A . 
I 4 HOH 6  6   6   HOH HOH A . 
I 4 HOH 7  7   7   HOH HOH A . 
I 4 HOH 8  8   8   HOH HOH A . 
I 4 HOH 9  9   9   HOH HOH A . 
I 4 HOH 10 10  10  HOH HOH A . 
I 4 HOH 11 11  11  HOH HOH A . 
I 4 HOH 12 12  12  HOH HOH A . 
I 4 HOH 13 13  13  HOH HOH A . 
I 4 HOH 14 14  14  HOH HOH A . 
I 4 HOH 15 15  15  HOH HOH A . 
I 4 HOH 16 16  16  HOH HOH A . 
I 4 HOH 17 17  17  HOH HOH A . 
I 4 HOH 18 18  18  HOH HOH A . 
I 4 HOH 19 19  19  HOH HOH A . 
I 4 HOH 20 20  20  HOH HOH A . 
I 4 HOH 21 21  21  HOH HOH A . 
I 4 HOH 22 22  22  HOH HOH A . 
I 4 HOH 23 23  23  HOH HOH A . 
I 4 HOH 24 24  24  HOH HOH A . 
I 4 HOH 25 25  25  HOH HOH A . 
I 4 HOH 26 26  26  HOH HOH A . 
I 4 HOH 27 27  27  HOH HOH A . 
I 4 HOH 28 28  28  HOH HOH A . 
I 4 HOH 29 29  29  HOH HOH A . 
I 4 HOH 30 30  30  HOH HOH A . 
I 4 HOH 31 31  31  HOH HOH A . 
I 4 HOH 32 32  32  HOH HOH A . 
I 4 HOH 33 33  33  HOH HOH A . 
I 4 HOH 34 34  34  HOH HOH A . 
I 4 HOH 35 35  35  HOH HOH A . 
I 4 HOH 36 380 36  HOH HOH A . 
I 4 HOH 37 381 37  HOH HOH A . 
I 4 HOH 38 382 38  HOH HOH A . 
I 4 HOH 39 383 39  HOH HOH A . 
I 4 HOH 40 384 40  HOH HOH A . 
I 4 HOH 41 385 41  HOH HOH A . 
I 4 HOH 42 386 42  HOH HOH A . 
I 4 HOH 43 387 43  HOH HOH A . 
I 4 HOH 44 388 44  HOH HOH A . 
I 4 HOH 45 389 45  HOH HOH A . 
I 4 HOH 46 390 46  HOH HOH A . 
I 4 HOH 47 391 47  HOH HOH A . 
I 4 HOH 48 392 48  HOH HOH A . 
I 4 HOH 49 393 49  HOH HOH A . 
I 4 HOH 50 394 50  HOH HOH A . 
I 4 HOH 51 395 51  HOH HOH A . 
I 4 HOH 52 396 52  HOH HOH A . 
I 4 HOH 53 397 53  HOH HOH A . 
I 4 HOH 54 398 54  HOH HOH A . 
I 4 HOH 55 399 55  HOH HOH A . 
I 4 HOH 56 400 57  HOH HOH A . 
I 4 HOH 57 401 58  HOH HOH A . 
I 4 HOH 58 402 59  HOH HOH A . 
I 4 HOH 59 403 60  HOH HOH A . 
I 4 HOH 60 404 61  HOH HOH A . 
I 4 HOH 61 405 62  HOH HOH A . 
I 4 HOH 62 406 63  HOH HOH A . 
I 4 HOH 63 407 64  HOH HOH A . 
I 4 HOH 64 408 65  HOH HOH A . 
I 4 HOH 65 409 66  HOH HOH A . 
I 4 HOH 66 410 67  HOH HOH A . 
I 4 HOH 67 411 68  HOH HOH A . 
I 4 HOH 68 412 69  HOH HOH A . 
I 4 HOH 69 413 70  HOH HOH A . 
I 4 HOH 70 414 71  HOH HOH A . 
I 4 HOH 71 415 72  HOH HOH A . 
I 4 HOH 72 416 73  HOH HOH A . 
I 4 HOH 73 417 74  HOH HOH A . 
I 4 HOH 74 418 75  HOH HOH A . 
I 4 HOH 75 419 76  HOH HOH A . 
I 4 HOH 76 420 77  HOH HOH A . 
I 4 HOH 77 421 78  HOH HOH A . 
I 4 HOH 78 422 79  HOH HOH A . 
I 4 HOH 79 423 80  HOH HOH A . 
I 4 HOH 80 424 81  HOH HOH A . 
I 4 HOH 81 425 82  HOH HOH A . 
I 4 HOH 82 426 83  HOH HOH A . 
I 4 HOH 83 427 84  HOH HOH A . 
I 4 HOH 84 428 85  HOH HOH A . 
I 4 HOH 85 429 86  HOH HOH A . 
I 4 HOH 86 430 87  HOH HOH A . 
I 4 HOH 87 431 88  HOH HOH A . 
I 4 HOH 88 432 89  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 27640 ? 
1 MORE         -173  ? 
1 'SSA (A^2)'  57030 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K 501 ? B K . 
2 1 A K 502 ? C K . 
3 1 A K 503 ? D K . 
4 1 A K 504 ? E K . 
5 1 A K 508 ? F K . 
6 1 A K 510 ? G K . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? A THR 108 ? A THR 143 ? 1_555 K ? D K . ? A K 503 ? 1_555 O ? A ILE 109 ? A ILE 144 ? 1_555 72.1 ? 
2 OG1 ? A THR 108 ? A THR 143 ? 1_555 K ? E K . ? A K 504 ? 1_555 O ? A THR 108 ? A THR 143 ? 1_555 63.4 ? 
3 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? C K . ? A K 502 ? 1_555 O ? A ILE 109 ? A ILE 144 ? 1_555 73.0 ? 
4 O   ? A TYR 111 ? A TYR 146 ? 1_555 K ? B K . ? A K 501 ? 1_555 O ? A GLY 110 ? A GLY 145 ? 1_555 68.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-08-24 
2 'Structure model' 1 1 2011-09-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 10.6730 -7.7003 41.4676 0.6367 0.6430 0.6036 0.0857  -0.0814 0.0130 3.6881 3.4751 1.2424 -1.1765 
-1.3254 -0.7963 -0.0213 -0.3494 -0.1722 0.4105  0.0303  -0.3033 0.3943  0.6783 0.0003  
'X-RAY DIFFRACTION' 2 ? refined 15.4110 14.7389 96.6326 0.6795 0.6723 0.6905 -0.1234 -0.0237 0.0297 2.2999 2.8993 2.5217 0.2658  
0.3601  0.0886  0.0311  0.0161  0.2993  -0.0917 -0.1190 -0.4487 -0.3589 0.3577 -0.0001 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 69:187))
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 42:62) or (resseq 193:372))
;
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS  'data collection' .                          ? 1 
PHENIX refinement        '(phenix.refine: 1.7_650)' ? 2 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_1              63 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              63 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              63 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.79 
_pdbx_validate_rmsd_angle.angle_target_value         103.30 
_pdbx_validate_rmsd_angle.angle_deviation            7.49 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.20 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 42  ? ? -56.59  -75.52  
2 1 ASN A 43  ? ? 171.72  167.84  
3 1 ASP A 60  ? ? -80.41  -79.21  
4 1 ASP A 61  ? ? 171.20  162.12  
5 1 VAL A 265 ? ? -116.95 -73.06  
6 1 ALA A 307 ? ? 68.78   -2.56   
7 1 LYS A 335 ? ? 47.30   -116.58 
8 1 SER A 370 ? ? -145.90 -63.57  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A CYS 41  ? SG  ? A CYS 6  SG  
2  1 Y 1 A ASP 61  ? CG  ? A ASP 26 CG  
3  1 Y 1 A ASP 61  ? OD1 ? A ASP 26 OD1 
4  1 Y 1 A ASP 61  ? OD2 ? A ASP 26 OD2 
5  1 Y 1 A LYS 62  ? CG  ? A LYS 27 CG  
6  1 Y 1 A LYS 62  ? CD  ? A LYS 27 CD  
7  1 Y 1 A LYS 62  ? CE  ? A LYS 27 CE  
8  1 Y 1 A LYS 62  ? NZ  ? A LYS 27 NZ  
9  1 Y 1 A PRO 63  ? CG  ? A PRO 28 CG  
10 1 Y 1 A PRO 63  ? CD  ? A PRO 28 CD  
11 1 Y 1 A ASP 69  ? CG  ? A ASP 34 CG  
12 1 Y 1 A ASP 69  ? OD1 ? A ASP 34 OD1 
13 1 Y 1 A ASP 69  ? OD2 ? A ASP 34 OD2 
14 1 Y 1 A MET 70  ? CG  ? A MET 35 CG  
15 1 Y 1 A MET 70  ? SD  ? A MET 35 SD  
16 1 Y 1 A MET 70  ? CE  ? A MET 35 CE  
17 1 N 1 A P8P 379 ? C16 ? H P8P 1  C16 
18 1 N 1 A P8P 379 ? C17 ? H P8P 1  C17 
19 1 N 1 A P8P 379 ? C18 ? H P8P 1  C18 
20 1 N 1 A P8P 379 ? C19 ? H P8P 1  C19 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 36  ? A MET 1   
2  1 Y 1 A ALA 37  ? A ALA 2   
3  1 Y 1 A ARG 38  ? A ARG 3   
4  1 Y 1 A ARG 39  ? A ARG 4   
5  1 Y 1 A LYS 40  ? A LYS 5   
6  1 Y 1 A GLN 64  ? A GLN 29  
7  1 Y 1 A ARG 65  ? A ARG 30  
8  1 Y 1 A TYR 66  ? A TYR 31  
9  1 Y 1 A ILE 67  ? A ILE 32  
10 1 Y 1 A ALA 68  ? A ALA 33  
11 1 Y 1 A LEU 373 ? A LEU 338 
12 1 Y 1 A GLU 374 ? A GLU 339 
13 1 Y 1 A VAL 375 ? A VAL 340 
14 1 Y 1 A LEU 376 ? A LEU 341 
15 1 Y 1 A PHE 377 ? A PHE 342 
16 1 Y 1 A GLN 378 ? A GLN 343 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION'                                                                 K   
3 '(2R)-3-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}propane-1,2-diyl dioctanoate' P8P 
4 water                                                                           HOH 
#