data_3SPJ
# 
_entry.id   3SPJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SPJ         
RCSB  RCSB066492   
WWPDB D_1000066492 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SPC 'Kir2.2 in complex with dioctanoylglycerol pyrophosphate (DGPP)' unspecified 
PDB 3SPG 'Kir2.2 R186A mutant in complex with PIP2'                       unspecified 
PDB 3SPH 'Kir2.2 I223L mutant in complex with PIP2'                       unspecified 
PDB 3SPI 'Kir2.2 in complex with PIP2'                                    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SPJ 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hansen, S.B.'  1 
'Tao, X.'       2 
'MacKinnon, R.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural basis of PIP(2) activation of the classical inward rectifier K(+) channel Kir2.2.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            477 
_citation.page_first                495 
_citation.page_last                 498 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21874019 
_citation.pdbx_database_id_DOI      10.1038/nature10370 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hansen, S.B.'  1 
primary 'Tao, X.'       2 
primary 'Mackinnon, R.' 3 
# 
_cell.entry_id           3SPJ 
_cell.length_a           83.769 
_cell.length_b           83.769 
_cell.length_c           197.126 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SPJ 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Inward-rectifier K+ channel Kir2.2' 39361.723 1 ? I223L ? ? 
2 non-polymer syn 'POTASSIUM ION'                      39.098    5 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'inward rectifier potassium channel 2.2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   ARG n 
1 5   LYS n 
1 6   CYS n 
1 7   ARG n 
1 8   ASN n 
1 9   ARG n 
1 10  PHE n 
1 11  VAL n 
1 12  LYS n 
1 13  LYS n 
1 14  ASN n 
1 15  GLY n 
1 16  GLN n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  PHE n 
1 22  THR n 
1 23  ASN n 
1 24  MET n 
1 25  ASP n 
1 26  ASP n 
1 27  LYS n 
1 28  PRO n 
1 29  GLN n 
1 30  ARG n 
1 31  TYR n 
1 32  ILE n 
1 33  ALA n 
1 34  ASP n 
1 35  MET n 
1 36  PHE n 
1 37  THR n 
1 38  THR n 
1 39  CYS n 
1 40  VAL n 
1 41  ASP n 
1 42  ILE n 
1 43  ARG n 
1 44  TRP n 
1 45  ARG n 
1 46  TYR n 
1 47  MET n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  PHE n 
1 52  SER n 
1 53  LEU n 
1 54  ALA n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  SER n 
1 59  TRP n 
1 60  LEU n 
1 61  LEU n 
1 62  PHE n 
1 63  GLY n 
1 64  LEU n 
1 65  ILE n 
1 66  PHE n 
1 67  TRP n 
1 68  LEU n 
1 69  ILE n 
1 70  ALA n 
1 71  LEU n 
1 72  ILE n 
1 73  HIS n 
1 74  GLY n 
1 75  ASP n 
1 76  LEU n 
1 77  GLU n 
1 78  ASN n 
1 79  PRO n 
1 80  GLY n 
1 81  GLY n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  LYS n 
1 87  PRO n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  GLN n 
1 92  VAL n 
1 93  ASN n 
1 94  GLY n 
1 95  PHE n 
1 96  VAL n 
1 97  ALA n 
1 98  ALA n 
1 99  PHE n 
1 100 LEU n 
1 101 PHE n 
1 102 SER n 
1 103 ILE n 
1 104 GLU n 
1 105 THR n 
1 106 GLN n 
1 107 THR n 
1 108 THR n 
1 109 ILE n 
1 110 GLY n 
1 111 TYR n 
1 112 GLY n 
1 113 PHE n 
1 114 ARG n 
1 115 CYS n 
1 116 VAL n 
1 117 THR n 
1 118 GLU n 
1 119 GLU n 
1 120 CYS n 
1 121 PRO n 
1 122 LEU n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 MET n 
1 127 VAL n 
1 128 VAL n 
1 129 VAL n 
1 130 GLN n 
1 131 SER n 
1 132 ILE n 
1 133 VAL n 
1 134 GLY n 
1 135 CYS n 
1 136 ILE n 
1 137 ILE n 
1 138 ASP n 
1 139 SER n 
1 140 PHE n 
1 141 MET n 
1 142 ILE n 
1 143 GLY n 
1 144 ALA n 
1 145 ILE n 
1 146 MET n 
1 147 ALA n 
1 148 LYS n 
1 149 MET n 
1 150 ALA n 
1 151 ARG n 
1 152 PRO n 
1 153 LYS n 
1 154 LYS n 
1 155 ARG n 
1 156 ALA n 
1 157 GLN n 
1 158 THR n 
1 159 LEU n 
1 160 LEU n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 ASN n 
1 165 ALA n 
1 166 VAL n 
1 167 VAL n 
1 168 ALA n 
1 169 MET n 
1 170 ARG n 
1 171 ASP n 
1 172 GLY n 
1 173 LYS n 
1 174 LEU n 
1 175 CYS n 
1 176 LEU n 
1 177 MET n 
1 178 TRP n 
1 179 ARG n 
1 180 VAL n 
1 181 GLY n 
1 182 ASN n 
1 183 LEU n 
1 184 ARG n 
1 185 LYS n 
1 186 SER n 
1 187 HIS n 
1 188 LEU n 
1 189 VAL n 
1 190 GLU n 
1 191 ALA n 
1 192 HIS n 
1 193 VAL n 
1 194 ARG n 
1 195 ALA n 
1 196 GLN n 
1 197 LEU n 
1 198 ILE n 
1 199 LYS n 
1 200 PRO n 
1 201 ARG n 
1 202 ILE n 
1 203 THR n 
1 204 GLU n 
1 205 GLU n 
1 206 GLY n 
1 207 GLU n 
1 208 TYR n 
1 209 ILE n 
1 210 PRO n 
1 211 LEU n 
1 212 ASP n 
1 213 GLN n 
1 214 ILE n 
1 215 ASP n 
1 216 ILE n 
1 217 ASP n 
1 218 VAL n 
1 219 GLY n 
1 220 PHE n 
1 221 ASP n 
1 222 LYS n 
1 223 GLY n 
1 224 LEU n 
1 225 ASP n 
1 226 ARG n 
1 227 ILE n 
1 228 PHE n 
1 229 LEU n 
1 230 VAL n 
1 231 SER n 
1 232 PRO n 
1 233 ILE n 
1 234 THR n 
1 235 ILE n 
1 236 LEU n 
1 237 HIS n 
1 238 GLU n 
1 239 ILE n 
1 240 ASN n 
1 241 GLU n 
1 242 ASP n 
1 243 SER n 
1 244 PRO n 
1 245 LEU n 
1 246 PHE n 
1 247 GLY n 
1 248 ILE n 
1 249 SER n 
1 250 ARG n 
1 251 GLN n 
1 252 ASP n 
1 253 LEU n 
1 254 GLU n 
1 255 THR n 
1 256 ASP n 
1 257 ASP n 
1 258 PHE n 
1 259 GLU n 
1 260 ILE n 
1 261 VAL n 
1 262 VAL n 
1 263 ILE n 
1 264 LEU n 
1 265 GLU n 
1 266 GLY n 
1 267 MET n 
1 268 VAL n 
1 269 GLU n 
1 270 ALA n 
1 271 THR n 
1 272 ALA n 
1 273 MET n 
1 274 THR n 
1 275 THR n 
1 276 GLN n 
1 277 ALA n 
1 278 ARG n 
1 279 SER n 
1 280 SER n 
1 281 TYR n 
1 282 LEU n 
1 283 ALA n 
1 284 SER n 
1 285 GLU n 
1 286 ILE n 
1 287 LEU n 
1 288 TRP n 
1 289 GLY n 
1 290 HIS n 
1 291 ARG n 
1 292 PHE n 
1 293 GLU n 
1 294 PRO n 
1 295 VAL n 
1 296 LEU n 
1 297 PHE n 
1 298 GLU n 
1 299 GLU n 
1 300 LYS n 
1 301 ASN n 
1 302 GLN n 
1 303 TYR n 
1 304 LYS n 
1 305 VAL n 
1 306 ASP n 
1 307 TYR n 
1 308 SER n 
1 309 HIS n 
1 310 PHE n 
1 311 HIS n 
1 312 LYS n 
1 313 THR n 
1 314 TYR n 
1 315 GLU n 
1 316 VAL n 
1 317 PRO n 
1 318 SER n 
1 319 THR n 
1 320 PRO n 
1 321 ARG n 
1 322 CYS n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 VAL n 
1 329 GLU n 
1 330 ASN n 
1 331 LYS n 
1 332 PHE n 
1 333 LEU n 
1 334 LEU n 
1 335 SER n 
1 336 ASN n 
1 337 SER n 
1 338 LEU n 
1 339 GLU n 
1 340 VAL n 
1 341 LEU n 
1 342 PHE n 
1 343 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               chicken 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Kir2.2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D2YW45_CHICK 
_struct_ref.pdbx_db_accession          D2YW45 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3SPJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 343 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             D2YW45 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  343 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       36 
_struct_ref_seq.pdbx_auth_seq_align_end       378 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3SPJ 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      188 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   D2YW45 
_struct_ref_seq_dif.db_mon_id                    ILE 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          188 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            223 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3SPJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.39 
_exptl_crystal.density_percent_sol   72.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'10.62% PEG400, 0.5 M sodium chloride, 0.05 M HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2011-06-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rosenbaum-Rock double crystal sagittal focusing monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3SPJ 
_reflns.observed_criterion_sigma_I   3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.3 
_reflns.number_obs                   10028 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99 
_reflns.pdbx_Rmerge_I_obs            0.0118 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.3 
_reflns_shell.d_res_low              3.4 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.0526 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        7.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SPJ 
_refine.ls_number_reflns_obs                     9689 
_refine.ls_number_reflns_all                     10028 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.364 
_refine.ls_d_res_high                            3.307 
_refine.ls_percent_reflns_obs                    95.58 
_refine.ls_R_factor_obs                          0.2365 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2351 
_refine.ls_R_factor_R_free                       0.2668 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_number_reflns_R_free                  465 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -4.5338 
_refine.aniso_B[2][2]                            -4.5338 
_refine.aniso_B[3][3]                            9.0677 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.291 
_refine.solvent_model_param_bsol                 97.946 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.83 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 3SPH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.36 
_refine.pdbx_overall_phase_error                 28.73 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2544 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         5 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2549 
_refine_hist.d_res_high                       3.307 
_refine_hist.d_res_low                        28.364 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.008  ? ? 2636 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.877  ? ? 3521 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 15.717 ? ? 939  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.060  ? ? 401  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.003  ? ? 447  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.3071 3.7847  2951 0.2742 92.00 0.3188 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 3.7847 4.7646  3129 0.1916 98.00 0.2480 . . 176 . . . . 'X-RAY DIFFRACTION' 
. 4.7646 28.3650 3144 0.2476 97.00 0.2661 . . 150 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SPJ 
_struct.title                     'Apo inward rectifier potassium channel Kir2.2 I223L mutant' 
_struct.pdbx_descriptor           'Inward-rectifier K+ channel Kir2.2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SPJ 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'PIP, membrane protein, lipid, receptor, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 35  ? VAL A 40  ? MET A 70  VAL A 75  5 ? 6  
HELX_P HELX_P2 2 ARG A 45  ? HIS A 73  ? ARG A 80  HIS A 108 1 ? 29 
HELX_P HELX_P3 3 GLY A 74  ? ASN A 78  ? GLY A 109 ASN A 113 5 ? 5  
HELX_P HELX_P4 4 GLY A 94  ? THR A 107 ? GLY A 129 THR A 142 1 ? 14 
HELX_P HELX_P5 5 CYS A 120 ? LYS A 148 ? CYS A 155 LYS A 183 1 ? 29 
HELX_P HELX_P6 6 GLY A 219 ? GLY A 223 ? GLY A 254 GLY A 258 5 ? 5  
HELX_P HELX_P7 7 SER A 249 ? GLU A 254 ? SER A 284 GLU A 289 1 ? 6  
HELX_P HELX_P8 8 SER A 323 ? SER A 337 ? SER A 358 SER A 372 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 88  SG  ? ? ? 1_555 A CYS 120 SG ? ? A CYS 123 A CYS 155 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc1 metalc ? ? A ILE 109 O   ? ? ? 1_555 D K   .   K  ? ? A ILE 144 A K   503 1_555 ? ? ? ? ? ? ? 2.665 ? 
metalc2 metalc ? ? A THR 108 OG1 ? ? ? 1_555 E K   .   K  ? ? A THR 143 A K   504 1_555 ? ? ? ? ? ? ? 2.693 ? 
metalc3 metalc ? ? A THR 108 O   ? ? ? 1_555 E K   .   K  ? ? A THR 143 A K   504 1_555 ? ? ? ? ? ? ? 2.698 ? 
metalc4 metalc ? ? A THR 108 O   ? ? ? 1_555 D K   .   K  ? ? A THR 143 A K   503 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc5 metalc ? ? A GLY 110 O   ? ? ? 1_555 C K   .   K  ? ? A GLY 145 A K   502 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc6 metalc ? ? A ILE 109 O   ? ? ? 1_555 C K   .   K  ? ? A ILE 144 A K   502 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc7 metalc ? ? A GLY 110 O   ? ? ? 1_555 B K   .   K  ? ? A GLY 145 A K   501 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc8 metalc ? ? A TYR 111 O   ? ? ? 1_555 B K   .   K  ? ? A TYR 146 A K   501 1_555 ? ? ? ? ? ? ? 2.819 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 19  ? THR A 22  ? VAL A 54  THR A 57  
A 2 GLN A 302 ? ASP A 306 ? GLN A 337 ASP A 341 
A 3 LEU A 296 ? GLU A 299 ? LEU A 331 GLU A 334 
B 1 VAL A 89  ? LEU A 90  ? VAL A 124 LEU A 125 
B 2 CYS A 115 ? VAL A 116 ? CYS A 150 VAL A 151 
C 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
C 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
C 3 ILE A 233 ? GLU A 238 ? ILE A 268 GLU A 273 
D 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
D 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
D 3 ALA A 165 ? ARG A 170 ? ALA A 200 ARG A 205 
D 4 ILE A 286 ? TRP A 288 ? ILE A 321 TRP A 323 
E 1 TYR A 208 ? ILE A 216 ? TYR A 243 ILE A 251 
E 2 LEU A 188 ? ILE A 202 ? LEU A 223 ILE A 237 
E 3 ARG A 226 ? ILE A 227 ? ARG A 261 ILE A 262 
F 1 TYR A 208 ? ILE A 216 ? TYR A 243 ILE A 251 
F 2 LEU A 188 ? ILE A 202 ? LEU A 223 ILE A 237 
F 3 GLU A 259 ? VAL A 268 ? GLU A 294 VAL A 303 
F 4 THR A 274 ? LEU A 282 ? THR A 309 LEU A 317 
G 1 HIS A 290 ? PHE A 292 ? HIS A 325 PHE A 327 
G 2 THR A 313 ? GLU A 315 ? THR A 348 GLU A 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 20  ? N GLU A 55  O TYR A 303 ? O TYR A 338 
A 2 3 O LYS A 304 ? O LYS A 339 N PHE A 297 ? N PHE A 332 
B 1 2 N LEU A 90  ? N LEU A 125 O CYS A 115 ? O CYS A 150 
C 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
C 2 3 N TRP A 178 ? N TRP A 213 O ILE A 235 ? O ILE A 270 
D 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
D 2 3 O MET A 177 ? O MET A 212 N VAL A 166 ? N VAL A 201 
D 3 4 N ALA A 165 ? N ALA A 200 O LEU A 287 ? O LEU A 322 
E 1 2 O ASP A 212 ? O ASP A 247 N LYS A 199 ? N LYS A 234 
E 2 3 N ALA A 191 ? N ALA A 226 O ILE A 227 ? O ILE A 262 
F 1 2 O ASP A 212 ? O ASP A 247 N LYS A 199 ? N LYS A 234 
F 2 3 N ILE A 198 ? N ILE A 233 O GLU A 259 ? O GLU A 294 
F 3 4 N GLY A 266 ? N GLY A 301 O THR A 275 ? O THR A 310 
G 1 2 N ARG A 291 ? N ARG A 326 O TYR A 314 ? O TYR A 349 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE K A 501' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE K A 502' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE K A 503' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE K A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY A 110 ? GLY A 145 . ? 1_555 ? 
2  AC1 12 GLY A 110 ? GLY A 145 . ? 2_555 ? 
3  AC1 12 GLY A 110 ? GLY A 145 . ? 3_555 ? 
4  AC1 12 GLY A 110 ? GLY A 145 . ? 4_555 ? 
5  AC1 12 TYR A 111 ? TYR A 146 . ? 1_555 ? 
6  AC1 12 TYR A 111 ? TYR A 146 . ? 2_555 ? 
7  AC1 12 TYR A 111 ? TYR A 146 . ? 3_555 ? 
8  AC1 12 TYR A 111 ? TYR A 146 . ? 4_555 ? 
9  AC1 12 K   C .   ? K   A 502 . ? 4_555 ? 
10 AC1 12 K   C .   ? K   A 502 . ? 3_555 ? 
11 AC1 12 K   C .   ? K   A 502 . ? 2_555 ? 
12 AC1 12 K   C .   ? K   A 502 . ? 1_555 ? 
13 AC2 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
14 AC2 16 ILE A 109 ? ILE A 144 . ? 2_555 ? 
15 AC2 16 ILE A 109 ? ILE A 144 . ? 3_555 ? 
16 AC2 16 ILE A 109 ? ILE A 144 . ? 4_555 ? 
17 AC2 16 GLY A 110 ? GLY A 145 . ? 2_555 ? 
18 AC2 16 GLY A 110 ? GLY A 145 . ? 3_555 ? 
19 AC2 16 GLY A 110 ? GLY A 145 . ? 1_555 ? 
20 AC2 16 GLY A 110 ? GLY A 145 . ? 4_555 ? 
21 AC2 16 K   B .   ? K   A 501 . ? 4_555 ? 
22 AC2 16 K   B .   ? K   A 501 . ? 3_555 ? 
23 AC2 16 K   B .   ? K   A 501 . ? 2_555 ? 
24 AC2 16 K   B .   ? K   A 501 . ? 1_555 ? 
25 AC2 16 K   D .   ? K   A 503 . ? 4_555 ? 
26 AC2 16 K   D .   ? K   A 503 . ? 3_555 ? 
27 AC2 16 K   D .   ? K   A 503 . ? 2_555 ? 
28 AC2 16 K   D .   ? K   A 503 . ? 1_555 ? 
29 AC3 16 THR A 108 ? THR A 143 . ? 1_555 ? 
30 AC3 16 THR A 108 ? THR A 143 . ? 2_555 ? 
31 AC3 16 THR A 108 ? THR A 143 . ? 3_555 ? 
32 AC3 16 THR A 108 ? THR A 143 . ? 4_555 ? 
33 AC3 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
34 AC3 16 ILE A 109 ? ILE A 144 . ? 4_555 ? 
35 AC3 16 ILE A 109 ? ILE A 144 . ? 3_555 ? 
36 AC3 16 ILE A 109 ? ILE A 144 . ? 2_555 ? 
37 AC3 16 K   C .   ? K   A 502 . ? 4_555 ? 
38 AC3 16 K   C .   ? K   A 502 . ? 3_555 ? 
39 AC3 16 K   C .   ? K   A 502 . ? 2_555 ? 
40 AC3 16 K   C .   ? K   A 502 . ? 1_555 ? 
41 AC3 16 K   E .   ? K   A 504 . ? 4_555 ? 
42 AC3 16 K   E .   ? K   A 504 . ? 3_555 ? 
43 AC3 16 K   E .   ? K   A 504 . ? 2_555 ? 
44 AC3 16 K   E .   ? K   A 504 . ? 1_555 ? 
45 AC4 8  THR A 108 ? THR A 143 . ? 3_555 ? 
46 AC4 8  THR A 108 ? THR A 143 . ? 1_555 ? 
47 AC4 8  THR A 108 ? THR A 143 . ? 4_555 ? 
48 AC4 8  THR A 108 ? THR A 143 . ? 2_555 ? 
49 AC4 8  K   D .   ? K   A 503 . ? 4_555 ? 
50 AC4 8  K   D .   ? K   A 503 . ? 3_555 ? 
51 AC4 8  K   D .   ? K   A 503 . ? 2_555 ? 
52 AC4 8  K   D .   ? K   A 503 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SPJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SPJ 
_atom_sites.fract_transf_matrix[1][1]   0.011938 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011938 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005073 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 8   ? 8.633   -32.858 17.114  1.00 218.46 ? 43  ASN A N   1 
ATOM   2    C CA  . ASN A 1 8   ? 9.580   -32.090 16.312  1.00 219.27 ? 43  ASN A CA  1 
ATOM   3    C C   . ASN A 1 8   ? 9.218   -30.610 16.216  1.00 214.80 ? 43  ASN A C   1 
ATOM   4    O O   . ASN A 1 8   ? 8.475   -30.088 17.046  1.00 210.83 ? 43  ASN A O   1 
ATOM   5    C CB  . ASN A 1 8   ? 9.705   -32.687 14.910  1.00 223.64 ? 43  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 8   ? 8.378   -32.735 14.182  1.00 222.79 ? 43  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 8   ? 8.003   -31.787 13.493  1.00 220.89 ? 43  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 8   ? 7.656   -33.839 14.336  1.00 224.47 ? 43  ASN A ND2 1 
ATOM   9    N N   . ARG A 1 9   ? 9.732   -29.946 15.186  1.00 170.11 ? 44  ARG A N   1 
ATOM   10   C CA  . ARG A 1 9   ? 9.617   -28.493 15.062  1.00 166.58 ? 44  ARG A CA  1 
ATOM   11   C C   . ARG A 1 9   ? 8.236   -28.005 14.633  1.00 163.77 ? 44  ARG A C   1 
ATOM   12   O O   . ARG A 1 9   ? 7.621   -28.561 13.722  1.00 165.82 ? 44  ARG A O   1 
ATOM   13   C CB  . ARG A 1 9   ? 10.672  -27.957 14.090  1.00 169.22 ? 44  ARG A CB  1 
ATOM   14   C CG  . ARG A 1 9   ? 11.594  -26.909 14.687  1.00 167.56 ? 44  ARG A CG  1 
ATOM   15   C CD  . ARG A 1 9   ? 12.732  -26.570 13.736  1.00 171.16 ? 44  ARG A CD  1 
ATOM   16   N NE  . ARG A 1 9   ? 13.615  -25.549 14.291  1.00 169.89 ? 44  ARG A NE  1 
ATOM   17   C CZ  . ARG A 1 9   ? 14.569  -25.796 15.182  1.00 170.90 ? 44  ARG A CZ  1 
ATOM   18   N NH1 . ARG A 1 9   ? 14.760  -27.032 15.620  1.00 173.17 ? 44  ARG A NH1 1 
ATOM   19   N NH2 . ARG A 1 9   ? 15.327  -24.808 15.639  1.00 169.91 ? 44  ARG A NH2 1 
ATOM   20   N N   . PHE A 1 10  ? 7.752   -26.970 15.319  1.00 165.56 ? 45  PHE A N   1 
ATOM   21   C CA  . PHE A 1 10  ? 6.576   -26.225 14.878  1.00 162.87 ? 45  PHE A CA  1 
ATOM   22   C C   . PHE A 1 10  ? 6.979   -25.204 13.824  1.00 163.43 ? 45  PHE A C   1 
ATOM   23   O O   . PHE A 1 10  ? 6.278   -25.004 12.829  1.00 163.99 ? 45  PHE A O   1 
ATOM   24   C CB  . PHE A 1 10  ? 5.901   -25.519 16.044  1.00 158.37 ? 45  PHE A CB  1 
ATOM   25   C CG  . PHE A 1 10  ? 4.500   -25.078 15.745  1.00 156.05 ? 45  PHE A CG  1 
ATOM   26   C CD1 . PHE A 1 10  ? 3.915   -24.039 16.450  1.00 152.16 ? 45  PHE A CD1 1 
ATOM   27   C CD2 . PHE A 1 10  ? 3.761   -25.712 14.765  1.00 158.11 ? 45  PHE A CD2 1 
ATOM   28   C CE1 . PHE A 1 10  ? 2.618   -23.641 16.172  1.00 150.35 ? 45  PHE A CE1 1 
ATOM   29   C CE2 . PHE A 1 10  ? 2.470   -25.319 14.487  1.00 156.31 ? 45  PHE A CE2 1 
ATOM   30   C CZ  . PHE A 1 10  ? 1.898   -24.284 15.190  1.00 152.41 ? 45  PHE A CZ  1 
ATOM   31   N N   . VAL A 1 11  ? 8.113   -24.553 14.055  1.00 148.39 ? 46  VAL A N   1 
ATOM   32   C CA  . VAL A 1 11  ? 8.637   -23.571 13.114  1.00 149.40 ? 46  VAL A CA  1 
ATOM   33   C C   . VAL A 1 11  ? 10.074  -23.896 12.721  1.00 153.50 ? 46  VAL A C   1 
ATOM   34   O O   . VAL A 1 11  ? 10.974  -23.872 13.561  1.00 153.44 ? 46  VAL A O   1 
ATOM   35   C CB  . VAL A 1 11  ? 8.592   -22.145 13.700  1.00 145.63 ? 46  VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 11  ? 9.218   -21.152 12.725  1.00 147.22 ? 46  VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 11  ? 7.163   -21.748 14.034  1.00 141.90 ? 46  VAL A CG2 1 
ATOM   38   N N   . LYS A 1 12  ? 10.292  -24.179 11.441  1.00 159.55 ? 47  LYS A N   1 
ATOM   39   C CA  . LYS A 1 12  ? 11.634  -24.468 10.953  1.00 164.03 ? 47  LYS A CA  1 
ATOM   40   C C   . LYS A 1 12  ? 12.507  -23.234 11.159  1.00 163.14 ? 47  LYS A C   1 
ATOM   41   O O   . LYS A 1 12  ? 11.993  -22.122 11.294  1.00 159.78 ? 47  LYS A O   1 
ATOM   42   C CB  . LYS A 1 12  ? 11.606  -24.877 9.477   1.00 168.58 ? 47  LYS A CB  1 
ATOM   43   C CG  . LYS A 1 12  ? 10.685  -26.059 9.185   1.00 169.85 ? 47  LYS A CG  1 
ATOM   44   C CD  . LYS A 1 12  ? 11.074  -26.789 7.897   1.00 175.85 ? 47  LYS A CD  1 
ATOM   45   C CE  . LYS A 1 12  ? 10.913  -25.914 6.657   1.00 177.39 ? 47  LYS A CE  1 
ATOM   46   N NZ  . LYS A 1 12  ? 11.554  -26.521 5.449   1.00 183.91 ? 47  LYS A NZ  1 
ATOM   47   N N   . LYS A 1 13  ? 13.823  -23.432 11.210  1.00 151.55 ? 48  LYS A N   1 
ATOM   48   C CA  . LYS A 1 13  ? 14.745  -22.341 11.537  1.00 151.07 ? 48  LYS A CA  1 
ATOM   49   C C   . LYS A 1 13  ? 14.683  -21.146 10.573  1.00 151.40 ? 48  LYS A C   1 
ATOM   50   O O   . LYS A 1 13  ? 15.085  -20.034 10.924  1.00 149.86 ? 48  LYS A O   1 
ATOM   51   C CB  . LYS A 1 13  ? 16.181  -22.858 11.701  1.00 155.17 ? 48  LYS A CB  1 
ATOM   52   C CG  . LYS A 1 13  ? 16.453  -23.480 13.069  1.00 153.82 ? 48  LYS A CG  1 
ATOM   53   C CD  . LYS A 1 13  ? 17.917  -23.352 13.460  1.00 156.67 ? 48  LYS A CD  1 
ATOM   54   C CE  . LYS A 1 13  ? 18.139  -23.639 14.941  1.00 154.75 ? 48  LYS A CE  1 
ATOM   55   N NZ  . LYS A 1 13  ? 17.624  -22.561 15.827  1.00 149.79 ? 48  LYS A NZ  1 
ATOM   56   N N   . ASN A 1 14  ? 14.146  -21.368 9.378   1.00 174.48 ? 49  ASN A N   1 
ATOM   57   C CA  . ASN A 1 14  ? 14.010  -20.304 8.388   1.00 175.33 ? 49  ASN A CA  1 
ATOM   58   C C   . ASN A 1 14  ? 12.676  -19.555 8.463   1.00 170.95 ? 49  ASN A C   1 
ATOM   59   O O   . ASN A 1 14  ? 12.414  -18.652 7.669   1.00 171.49 ? 49  ASN A O   1 
ATOM   60   C CB  . ASN A 1 14  ? 14.213  -20.876 6.988   1.00 180.84 ? 49  ASN A CB  1 
ATOM   61   C CG  . ASN A 1 14  ? 13.555  -22.234 6.816   1.00 181.95 ? 49  ASN A CG  1 
ATOM   62   O OD1 . ASN A 1 14  ? 12.380  -22.326 6.464   1.00 180.50 ? 49  ASN A OD1 1 
ATOM   63   N ND2 . ASN A 1 14  ? 14.311  -23.297 7.071   1.00 184.82 ? 49  ASN A ND2 1 
ATOM   64   N N   . GLY A 1 15  ? 11.836  -19.929 9.420   1.00 149.90 ? 50  GLY A N   1 
ATOM   65   C CA  . GLY A 1 15  ? 10.556  -19.271 9.591   1.00 145.87 ? 50  GLY A CA  1 
ATOM   66   C C   . GLY A 1 15  ? 9.411   -20.098 9.049   1.00 146.22 ? 50  GLY A C   1 
ATOM   67   O O   . GLY A 1 15  ? 8.249   -19.876 9.401   1.00 142.82 ? 50  GLY A O   1 
ATOM   68   N N   . GLN A 1 16  ? 9.744   -21.064 8.200   1.00 159.32 ? 51  GLN A N   1 
ATOM   69   C CA  . GLN A 1 16  ? 8.743   -21.935 7.594   1.00 160.56 ? 51  GLN A CA  1 
ATOM   70   C C   . GLN A 1 16  ? 7.930   -22.667 8.659   1.00 157.28 ? 51  GLN A C   1 
ATOM   71   O O   . GLN A 1 16  ? 8.452   -23.042 9.709   1.00 156.02 ? 51  GLN A O   1 
ATOM   72   C CB  . GLN A 1 16  ? 9.420   -22.952 6.676   1.00 166.33 ? 51  GLN A CB  1 
ATOM   73   C CG  . GLN A 1 16  ? 8.570   -23.416 5.502   1.00 169.27 ? 51  GLN A CG  1 
ATOM   74   C CD  . GLN A 1 16  ? 8.466   -22.371 4.408   1.00 170.91 ? 51  GLN A CD  1 
ATOM   75   O OE1 . GLN A 1 16  ? 8.235   -21.193 4.677   1.00 167.66 ? 51  GLN A OE1 1 
ATOM   76   N NE2 . GLN A 1 16  ? 8.649   -22.797 3.165   1.00 176.34 ? 51  GLN A NE2 1 
ATOM   77   N N   . CYS A 1 17  ? 6.651   -22.878 8.382   1.00 173.07 ? 52  CYS A N   1 
ATOM   78   C CA  . CYS A 1 17  ? 5.786   -23.530 9.350   1.00 170.24 ? 52  CYS A CA  1 
ATOM   79   C C   . CYS A 1 17  ? 5.589   -25.007 9.065   1.00 173.50 ? 52  CYS A C   1 
ATOM   80   O O   . CYS A 1 17  ? 5.465   -25.423 7.915   1.00 177.35 ? 52  CYS A O   1 
ATOM   81   C CB  . CYS A 1 17  ? 4.455   -22.802 9.445   1.00 166.78 ? 52  CYS A CB  1 
ATOM   82   S SG  . CYS A 1 17  ? 4.671   -21.198 10.209  1.00 162.48 ? 52  CYS A SG  1 
ATOM   83   N N   . ASN A 1 18  ? 5.554   -25.792 10.133  1.00 175.87 ? 53  ASN A N   1 
ATOM   84   C CA  . ASN A 1 18  ? 5.566   -27.241 10.022  1.00 179.28 ? 53  ASN A CA  1 
ATOM   85   C C   . ASN A 1 18  ? 4.192   -27.898 9.932   1.00 179.06 ? 53  ASN A C   1 
ATOM   86   O O   . ASN A 1 18  ? 4.077   -29.121 9.961   1.00 181.74 ? 53  ASN A O   1 
ATOM   87   C CB  . ASN A 1 18  ? 6.373   -27.838 11.169  1.00 179.02 ? 53  ASN A CB  1 
ATOM   88   C CG  . ASN A 1 18  ? 7.393   -28.825 10.695  1.00 184.13 ? 53  ASN A CG  1 
ATOM   89   O OD1 . ASN A 1 18  ? 8.440   -28.441 10.180  1.00 186.31 ? 53  ASN A OD1 1 
ATOM   90   N ND2 . ASN A 1 18  ? 7.108   -30.109 10.878  1.00 186.39 ? 53  ASN A ND2 1 
ATOM   91   N N   . VAL A 1 19  ? 3.153   -27.080 9.833   1.00 142.81 ? 54  VAL A N   1 
ATOM   92   C CA  . VAL A 1 19  ? 1.792   -27.592 9.804   1.00 142.47 ? 54  VAL A CA  1 
ATOM   93   C C   . VAL A 1 19  ? 1.239   -27.800 8.409   1.00 146.05 ? 54  VAL A C   1 
ATOM   94   O O   . VAL A 1 19  ? 1.548   -27.048 7.478   1.00 147.30 ? 54  VAL A O   1 
ATOM   95   C CB  . VAL A 1 19  ? 0.823   -26.678 10.555  1.00 137.58 ? 54  VAL A CB  1 
ATOM   96   C CG1 . VAL A 1 19  ? 1.086   -26.756 12.041  1.00 134.57 ? 54  VAL A CG1 1 
ATOM   97   C CG2 . VAL A 1 19  ? 0.939   -25.249 10.032  1.00 136.00 ? 54  VAL A CG2 1 
ATOM   98   N N   . GLU A 1 20  ? 0.423   -28.841 8.284   1.00 178.20 ? 55  GLU A N   1 
ATOM   99   C CA  . GLU A 1 20  ? -0.317  -29.104 7.064   1.00 181.63 ? 55  GLU A CA  1 
ATOM   100  C C   . GLU A 1 20  ? -1.808  -29.055 7.371   1.00 179.43 ? 55  GLU A C   1 
ATOM   101  O O   . GLU A 1 20  ? -2.254  -29.523 8.420   1.00 177.35 ? 55  GLU A O   1 
ATOM   102  C CB  . GLU A 1 20  ? 0.064   -30.471 6.510   1.00 187.07 ? 55  GLU A CB  1 
ATOM   103  C CG  . GLU A 1 20  ? -0.163  -30.630 5.021   1.00 191.93 ? 55  GLU A CG  1 
ATOM   104  C CD  . GLU A 1 20  ? 0.385   -31.946 4.500   1.00 197.70 ? 55  GLU A CD  1 
ATOM   105  O OE1 . GLU A 1 20  ? 0.307   -32.953 5.239   1.00 198.05 ? 55  GLU A OE1 1 
ATOM   106  O OE2 . GLU A 1 20  ? 0.907   -31.973 3.364   1.00 202.18 ? 55  GLU A OE2 1 
ATOM   107  N N   . PHE A 1 21  ? -2.574  -28.478 6.453   1.00 168.72 ? 56  PHE A N   1 
ATOM   108  C CA  . PHE A 1 21  ? -4.009  -28.302 6.652   1.00 166.90 ? 56  PHE A CA  1 
ATOM   109  C C   . PHE A 1 21  ? -4.788  -29.387 5.923   1.00 171.36 ? 56  PHE A C   1 
ATOM   110  O O   . PHE A 1 21  ? -4.428  -29.782 4.815   1.00 175.99 ? 56  PHE A O   1 
ATOM   111  C CB  . PHE A 1 21  ? -4.448  -26.921 6.162   1.00 165.01 ? 56  PHE A CB  1 
ATOM   112  C CG  . PHE A 1 21  ? -3.902  -25.779 6.979   1.00 160.41 ? 56  PHE A CG  1 
ATOM   113  C CD1 . PHE A 1 21  ? -2.564  -25.735 7.336   1.00 160.05 ? 56  PHE A CD1 1 
ATOM   114  C CD2 . PHE A 1 21  ? -4.724  -24.739 7.368   1.00 156.82 ? 56  PHE A CD2 1 
ATOM   115  C CE1 . PHE A 1 21  ? -2.064  -24.687 8.077   1.00 156.19 ? 56  PHE A CE1 1 
ATOM   116  C CE2 . PHE A 1 21  ? -4.228  -23.687 8.109   1.00 152.97 ? 56  PHE A CE2 1 
ATOM   117  C CZ  . PHE A 1 21  ? -2.895  -23.662 8.462   1.00 152.67 ? 56  PHE A CZ  1 
ATOM   118  N N   . THR A 1 22  ? -5.858  -29.869 6.543   1.00 192.96 ? 57  THR A N   1 
ATOM   119  C CA  . THR A 1 22  ? -6.643  -30.942 5.952   1.00 197.31 ? 57  THR A CA  1 
ATOM   120  C C   . THR A 1 22  ? -8.140  -30.702 6.098   1.00 196.04 ? 57  THR A C   1 
ATOM   121  O O   . THR A 1 22  ? -8.590  -30.055 7.044   1.00 191.59 ? 57  THR A O   1 
ATOM   122  C CB  . THR A 1 22  ? -6.309  -32.304 6.598   1.00 199.18 ? 57  THR A CB  1 
ATOM   123  O OG1 . THR A 1 22  ? -6.835  -32.345 7.931   1.00 195.40 ? 57  THR A OG1 1 
ATOM   124  C CG2 . THR A 1 22  ? -4.800  -32.532 6.639   1.00 200.19 ? 57  THR A CG2 1 
ATOM   125  N N   . ASN A 1 23  ? -8.903  -31.235 5.151   1.00 181.22 ? 58  ASN A N   1 
ATOM   126  C CA  . ASN A 1 23  ? -10.358 -31.271 5.253   1.00 181.14 ? 58  ASN A CA  1 
ATOM   127  C C   . ASN A 1 23  ? -11.048 -29.908 5.321   1.00 177.50 ? 58  ASN A C   1 
ATOM   128  O O   . ASN A 1 23  ? -11.883 -29.662 6.191   1.00 174.51 ? 58  ASN A O   1 
ATOM   129  C CB  . ASN A 1 23  ? -10.767 -32.149 6.435   1.00 180.07 ? 58  ASN A CB  1 
ATOM   130  C CG  . ASN A 1 23  ? -10.136 -33.526 6.370   1.00 184.09 ? 58  ASN A CG  1 
ATOM   131  O OD1 . ASN A 1 23  ? -9.935  -34.078 5.287   1.00 188.98 ? 58  ASN A OD1 1 
ATOM   132  N ND2 . ASN A 1 23  ? -9.806  -34.082 7.529   1.00 182.39 ? 58  ASN A ND2 1 
ATOM   133  N N   . MET A 1 24  ? -10.691 -29.031 4.389   1.00 207.08 ? 59  MET A N   1 
ATOM   134  C CA  . MET A 1 24  ? -11.348 -27.739 4.242   1.00 204.64 ? 59  MET A CA  1 
ATOM   135  C C   . MET A 1 24  ? -12.326 -27.789 3.069   1.00 208.95 ? 59  MET A C   1 
ATOM   136  O O   . MET A 1 24  ? -11.986 -28.281 1.991   1.00 213.74 ? 59  MET A O   1 
ATOM   137  C CB  . MET A 1 24  ? -10.302 -26.648 4.022   1.00 202.69 ? 59  MET A CB  1 
ATOM   138  C CG  . MET A 1 24  ? -9.319  -26.499 5.177   1.00 198.57 ? 59  MET A CG  1 
ATOM   139  S SD  . MET A 1 24  ? -7.842  -25.579 4.712   1.00 198.14 ? 59  MET A SD  1 
ATOM   140  C CE  . MET A 1 24  ? -8.557  -24.325 3.650   1.00 199.07 ? 59  MET A CE  1 
ATOM   141  N N   . ASP A 1 25  ? -13.539 -27.285 3.283   1.00 191.24 ? 60  ASP A N   1 
ATOM   142  C CA  . ASP A 1 25  ? -14.588 -27.364 2.265   1.00 195.47 ? 60  ASP A CA  1 
ATOM   143  C C   . ASP A 1 25  ? -14.108 -26.861 0.904   1.00 198.98 ? 60  ASP A C   1 
ATOM   144  O O   . ASP A 1 25  ? -14.434 -27.438 -0.132  1.00 204.36 ? 60  ASP A O   1 
ATOM   145  C CB  . ASP A 1 25  ? -15.836 -26.589 2.700   1.00 193.06 ? 60  ASP A CB  1 
ATOM   146  C CG  . ASP A 1 25  ? -15.717 -25.095 2.444   1.00 190.73 ? 60  ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 25  ? -14.642 -24.521 2.722   1.00 187.93 ? 60  ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 25  ? -16.699 -24.498 1.950   1.00 192.01 ? 60  ASP A OD2 1 
ATOM   149  N N   . MET A 1 35  ? -15.996 12.213  -7.898  1.00 211.54 ? 70  MET A N   1 
ATOM   150  C CA  . MET A 1 35  ? -15.947 12.365  -9.349  1.00 205.90 ? 70  MET A CA  1 
ATOM   151  C C   . MET A 1 35  ? -16.015 11.015  -10.061 1.00 202.15 ? 70  MET A C   1 
ATOM   152  O O   . MET A 1 35  ? -16.885 10.188  -9.774  1.00 204.55 ? 70  MET A O   1 
ATOM   153  C CB  . MET A 1 35  ? -14.681 13.121  -9.769  1.00 202.39 ? 70  MET A CB  1 
ATOM   154  N N   . PHE A 1 36  ? -15.078 10.800  -10.980 1.00 178.19 ? 71  PHE A N   1 
ATOM   155  C CA  . PHE A 1 36  ? -15.028 9.582   -11.787 1.00 174.19 ? 71  PHE A CA  1 
ATOM   156  C C   . PHE A 1 36  ? -14.215 8.487   -11.090 1.00 174.26 ? 71  PHE A C   1 
ATOM   157  O O   . PHE A 1 36  ? -13.952 7.430   -11.664 1.00 170.99 ? 71  PHE A O   1 
ATOM   158  C CB  . PHE A 1 36  ? -14.456 9.884   -13.176 1.00 168.47 ? 71  PHE A CB  1 
ATOM   159  N N   . THR A 1 37  ? -13.803 8.759   -9.854  1.00 239.13 ? 72  THR A N   1 
ATOM   160  C CA  . THR A 1 37  ? -13.122 7.762   -9.031  1.00 240.44 ? 72  THR A CA  1 
ATOM   161  C C   . THR A 1 37  ? -13.970 6.496   -8.915  1.00 242.07 ? 72  THR A C   1 
ATOM   162  O O   . THR A 1 37  ? -13.452 5.405   -8.673  1.00 241.68 ? 72  THR A O   1 
ATOM   163  C CB  . THR A 1 37  ? -12.824 8.303   -7.618  1.00 245.87 ? 72  THR A CB  1 
ATOM   164  N N   . THR A 1 38  ? -15.279 6.652   -9.091  1.00 182.42 ? 73  THR A N   1 
ATOM   165  C CA  . THR A 1 38  ? -16.204 5.526   -9.044  1.00 184.35 ? 73  THR A CA  1 
ATOM   166  C C   . THR A 1 38  ? -16.147 4.730   -10.347 1.00 178.76 ? 73  THR A C   1 
ATOM   167  O O   . THR A 1 38  ? -16.739 3.652   -10.462 1.00 179.49 ? 73  THR A O   1 
ATOM   168  C CB  . THR A 1 38  ? -17.646 5.995   -8.777  1.00 188.99 ? 73  THR A CB  1 
ATOM   169  N N   . CYS A 1 39  ? -15.419 5.270   -11.322 1.00 217.98 ? 74  CYS A N   1 
ATOM   170  C CA  . CYS A 1 39  ? -15.283 4.643   -12.636 1.00 212.60 ? 74  CYS A CA  1 
ATOM   171  C C   . CYS A 1 39  ? -14.343 3.442   -12.606 1.00 210.43 ? 74  CYS A C   1 
ATOM   172  O O   . CYS A 1 39  ? -14.406 2.568   -13.471 1.00 207.27 ? 74  CYS A O   1 
ATOM   173  C CB  . CYS A 1 39  ? -14.817 5.660   -13.683 1.00 208.29 ? 74  CYS A CB  1 
ATOM   174  N N   . VAL A 1 40  ? -13.466 3.405   -11.610 1.00 232.94 ? 75  VAL A N   1 
ATOM   175  C CA  . VAL A 1 40  ? -12.590 2.258   -11.418 1.00 231.85 ? 75  VAL A CA  1 
ATOM   176  C C   . VAL A 1 40  ? -13.452 1.007   -11.346 1.00 233.86 ? 75  VAL A C   1 
ATOM   177  O O   . VAL A 1 40  ? -13.208 0.011   -12.040 1.00 230.80 ? 75  VAL A O   1 
ATOM   178  C CB  . VAL A 1 40  ? -11.761 2.398   -10.129 1.00 235.36 ? 75  VAL A CB  1 
ATOM   179  N N   . ASP A 1 41  ? -14.482 1.084   -10.511 1.00 231.28 ? 76  ASP A N   1 
ATOM   180  C CA  . ASP A 1 41  ? -15.473 0.020   -10.343 1.00 234.35 ? 76  ASP A CA  1 
ATOM   181  C C   . ASP A 1 41  ? -16.674 0.243   -11.273 1.00 233.26 ? 76  ASP A C   1 
ATOM   182  O O   . ASP A 1 41  ? -17.678 -0.471  -11.184 1.00 236.22 ? 76  ASP A O   1 
ATOM   183  C CB  . ASP A 1 41  ? -15.908 -0.078  -8.875  1.00 241.64 ? 76  ASP A CB  1 
ATOM   184  N N   . ILE A 1 42  ? -16.541 1.204   -12.189 1.00 233.04 ? 77  ILE A N   1 
ATOM   185  C CA  . ILE A 1 42  ? -17.671 1.758   -12.939 1.00 232.82 ? 77  ILE A CA  1 
ATOM   186  C C   . ILE A 1 42  ? -18.640 0.703   -13.477 1.00 233.24 ? 77  ILE A C   1 
ATOM   187  O O   . ILE A 1 42  ? -19.843 0.949   -13.555 1.00 236.01 ? 77  ILE A O   1 
ATOM   188  C CB  . ILE A 1 42  ? -17.184 2.617   -14.126 1.00 227.39 ? 77  ILE A CB  1 
ATOM   189  N N   . ARG A 1 43  ? -18.131 -0.473  -13.827 1.00 209.32 ? 78  ARG A N   1 
ATOM   190  C CA  . ARG A 1 43  ? -18.997 -1.507  -14.381 1.00 209.67 ? 78  ARG A CA  1 
ATOM   191  C C   . ARG A 1 43  ? -18.267 -2.812  -14.621 1.00 207.39 ? 78  ARG A C   1 
ATOM   192  O O   . ARG A 1 43  ? -17.038 -2.882  -14.516 1.00 204.83 ? 78  ARG A O   1 
ATOM   193  C CB  . ARG A 1 43  ? -19.619 -1.046  -15.705 1.00 206.36 ? 78  ARG A CB  1 
ATOM   194  N N   . TRP A 1 44  ? -19.040 -3.846  -14.945 1.00 203.20 ? 79  TRP A N   1 
ATOM   195  C CA  . TRP A 1 44  ? -18.471 -5.152  -15.214 1.00 201.48 ? 79  TRP A CA  1 
ATOM   196  C C   . TRP A 1 44  ? -17.991 -5.174  -16.662 1.00 195.03 ? 79  TRP A C   1 
ATOM   197  O O   . TRP A 1 44  ? -16.796 -5.027  -16.934 1.00 191.16 ? 79  TRP A O   1 
ATOM   198  C CB  . TRP A 1 44  ? -19.548 -6.218  -14.971 1.00 205.90 ? 79  TRP A CB  1 
ATOM   199  C CG  . TRP A 1 44  ? -19.083 -7.644  -15.067 1.00 205.47 ? 79  TRP A CG  1 
ATOM   200  C CD1 . TRP A 1 44  ? -19.427 -8.556  -16.027 1.00 203.52 ? 79  TRP A CD1 1 
ATOM   201  C CD2 . TRP A 1 44  ? -18.193 -8.323  -14.171 1.00 207.34 ? 79  TRP A CD2 1 
ATOM   202  N NE1 . TRP A 1 44  ? -18.808 -9.760  -15.782 1.00 204.05 ? 79  TRP A NE1 1 
ATOM   203  C CE2 . TRP A 1 44  ? -18.043 -9.644  -14.648 1.00 206.42 ? 79  TRP A CE2 1 
ATOM   204  C CE3 . TRP A 1 44  ? -17.505 -7.944  -13.010 1.00 209.97 ? 79  TRP A CE3 1 
ATOM   205  C CZ2 . TRP A 1 44  ? -17.237 -10.585 -14.008 1.00 208.08 ? 79  TRP A CZ2 1 
ATOM   206  C CZ3 . TRP A 1 44  ? -16.703 -8.882  -12.375 1.00 211.64 ? 79  TRP A CZ3 1 
ATOM   207  C CH2 . TRP A 1 44  ? -16.577 -10.187 -12.876 1.00 210.71 ? 79  TRP A CH2 1 
ATOM   208  N N   . ARG A 1 45  ? -18.920 -5.342  -17.594 1.00 251.52 ? 80  ARG A N   1 
ATOM   209  C CA  . ARG A 1 45  ? -18.617 -5.141  -19.006 1.00 245.98 ? 80  ARG A CA  1 
ATOM   210  C C   . ARG A 1 45  ? -19.175 -3.859  -19.637 1.00 244.88 ? 80  ARG A C   1 
ATOM   211  O O   . ARG A 1 45  ? -18.909 -3.579  -20.803 1.00 240.65 ? 80  ARG A O   1 
ATOM   212  C CB  . ARG A 1 45  ? -18.990 -6.384  -19.806 1.00 244.99 ? 80  ARG A CB  1 
ATOM   213  C CG  . ARG A 1 45  ? -18.157 -7.581  -19.397 1.00 245.00 ? 80  ARG A CG  1 
ATOM   214  C CD  . ARG A 1 45  ? -18.676 -8.864  -20.006 1.00 245.26 ? 80  ARG A CD  1 
ATOM   215  N NE  . ARG A 1 45  ? -18.315 -10.017 -19.188 1.00 248.07 ? 80  ARG A NE  1 
ATOM   216  C CZ  . ARG A 1 45  ? -18.542 -11.280 -19.531 1.00 248.75 ? 80  ARG A CZ  1 
ATOM   217  N NH1 . ARG A 1 45  ? -19.124 -11.558 -20.688 1.00 246.67 ? 80  ARG A NH1 1 
ATOM   218  N NH2 . ARG A 1 45  ? -18.180 -12.263 -18.717 1.00 251.78 ? 80  ARG A NH2 1 
ATOM   219  N N   . TYR A 1 46  ? -19.952 -3.085  -18.884 1.00 188.89 ? 81  TYR A N   1 
ATOM   220  C CA  . TYR A 1 46  ? -20.542 -1.871  -19.445 1.00 188.43 ? 81  TYR A CA  1 
ATOM   221  C C   . TYR A 1 46  ? -19.459 -0.886  -19.860 1.00 184.36 ? 81  TYR A C   1 
ATOM   222  O O   . TYR A 1 46  ? -19.681 -0.018  -20.700 1.00 182.55 ? 81  TYR A O   1 
ATOM   223  C CB  . TYR A 1 46  ? -21.523 -1.221  -18.463 1.00 194.04 ? 81  TYR A CB  1 
ATOM   224  C CG  . TYR A 1 46  ? -22.967 -1.565  -18.747 1.00 197.22 ? 81  TYR A CG  1 
ATOM   225  C CD1 . TYR A 1 46  ? -23.410 -2.882  -18.695 1.00 198.97 ? 81  TYR A CD1 1 
ATOM   226  C CD2 . TYR A 1 46  ? -23.890 -0.573  -19.066 1.00 198.80 ? 81  TYR A CD2 1 
ATOM   227  C CE1 . TYR A 1 46  ? -24.733 -3.204  -18.957 1.00 202.18 ? 81  TYR A CE1 1 
ATOM   228  C CE2 . TYR A 1 46  ? -25.215 -0.885  -19.327 1.00 202.01 ? 81  TYR A CE2 1 
ATOM   229  C CZ  . TYR A 1 46  ? -25.630 -2.200  -19.272 1.00 203.67 ? 81  TYR A CZ  1 
ATOM   230  O OH  . TYR A 1 46  ? -26.947 -2.507  -19.532 1.00 207.13 ? 81  TYR A OH  1 
ATOM   231  N N   . MET A 1 47  ? -18.282 -1.038  -19.265 1.00 216.45 ? 82  MET A N   1 
ATOM   232  C CA  . MET A 1 47  ? -17.133 -0.222  -19.621 1.00 212.75 ? 82  MET A CA  1 
ATOM   233  C C   . MET A 1 47  ? -16.611 -0.641  -20.994 1.00 207.71 ? 82  MET A C   1 
ATOM   234  O O   . MET A 1 47  ? -16.176 0.192   -21.791 1.00 204.80 ? 82  MET A O   1 
ATOM   235  C CB  . MET A 1 47  ? -16.046 -0.347  -18.548 1.00 213.54 ? 82  MET A CB  1 
ATOM   236  C CG  . MET A 1 47  ? -14.740 0.363   -18.872 1.00 209.90 ? 82  MET A CG  1 
ATOM   237  S SD  . MET A 1 47  ? -13.664 0.571   -17.436 1.00 212.14 ? 82  MET A SD  1 
ATOM   238  C CE  . MET A 1 47  ? -14.414 2.008   -16.676 1.00 216.23 ? 82  MET A CE  1 
ATOM   239  N N   . LEU A 1 48  ? -16.678 -1.938  -21.274 1.00 170.12 ? 83  LEU A N   1 
ATOM   240  C CA  . LEU A 1 48  ? -16.245 -2.458  -22.567 1.00 165.78 ? 83  LEU A CA  1 
ATOM   241  C C   . LEU A 1 48  ? -17.121 -1.954  -23.707 1.00 164.85 ? 83  LEU A C   1 
ATOM   242  O O   . LEU A 1 48  ? -16.619 -1.609  -24.777 1.00 161.33 ? 83  LEU A O   1 
ATOM   243  C CB  . LEU A 1 48  ? -16.206 -3.990  -22.568 1.00 165.85 ? 83  LEU A CB  1 
ATOM   244  C CG  . LEU A 1 48  ? -14.984 -4.630  -21.901 1.00 165.22 ? 83  LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 48  ? -14.679 -5.983  -22.538 1.00 163.31 ? 83  LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 48  ? -13.764 -3.713  -21.981 1.00 162.42 ? 83  LEU A CD2 1 
ATOM   247  N N   . LEU A 1 49  ? -18.428 -1.918  -23.478 1.00 182.17 ? 84  LEU A N   1 
ATOM   248  C CA  . LEU A 1 49  ? -19.346 -1.344  -24.451 1.00 182.06 ? 84  LEU A CA  1 
ATOM   249  C C   . LEU A 1 49  ? -19.184 0.166   -24.473 1.00 181.95 ? 84  LEU A C   1 
ATOM   250  O O   . LEU A 1 49  ? -19.500 0.826   -25.462 1.00 180.78 ? 84  LEU A O   1 
ATOM   251  C CB  . LEU A 1 49  ? -20.793 -1.718  -24.126 1.00 186.37 ? 84  LEU A CB  1 
ATOM   252  C CG  . LEU A 1 49  ? -21.169 -3.166  -24.449 1.00 186.56 ? 84  LEU A CG  1 
ATOM   253  C CD1 . LEU A 1 49  ? -22.613 -3.459  -24.055 1.00 191.43 ? 84  LEU A CD1 1 
ATOM   254  C CD2 . LEU A 1 49  ? -20.926 -3.473  -25.931 1.00 182.51 ? 84  LEU A CD2 1 
ATOM   255  N N   . LEU A 1 50  ? -18.681 0.708   -23.372 1.00 154.16 ? 85  LEU A N   1 
ATOM   256  C CA  . LEU A 1 50  ? -18.448 2.138   -23.275 1.00 154.39 ? 85  LEU A CA  1 
ATOM   257  C C   . LEU A 1 50  ? -17.315 2.535   -24.212 1.00 149.96 ? 85  LEU A C   1 
ATOM   258  O O   . LEU A 1 50  ? -17.463 3.433   -25.042 1.00 149.10 ? 85  LEU A O   1 
ATOM   259  C CB  . LEU A 1 50  ? -18.086 2.514   -21.840 1.00 157.19 ? 85  LEU A CB  1 
ATOM   260  C CG  . LEU A 1 50  ? -18.243 3.986   -21.465 1.00 159.22 ? 85  LEU A CG  1 
ATOM   261  C CD1 . LEU A 1 50  ? -19.682 4.253   -21.037 1.00 163.85 ? 85  LEU A CD1 1 
ATOM   262  C CD2 . LEU A 1 50  ? -17.264 4.366   -20.361 1.00 160.06 ? 85  LEU A CD2 1 
ATOM   263  N N   . PHE A 1 51  ? -16.183 1.852   -24.073 1.00 176.70 ? 86  PHE A N   1 
ATOM   264  C CA  . PHE A 1 51  ? -15.014 2.117   -24.903 1.00 172.77 ? 86  PHE A CA  1 
ATOM   265  C C   . PHE A 1 51  ? -15.290 1.822   -26.373 1.00 170.29 ? 86  PHE A C   1 
ATOM   266  O O   . PHE A 1 51  ? -14.928 2.607   -27.250 1.00 168.55 ? 86  PHE A O   1 
ATOM   267  C CB  . PHE A 1 51  ? -13.802 1.322   -24.406 1.00 171.14 ? 86  PHE A CB  1 
ATOM   268  C CG  . PHE A 1 51  ? -12.994 2.041   -23.358 1.00 172.32 ? 86  PHE A CG  1 
ATOM   269  C CD1 . PHE A 1 51  ? -13.118 1.715   -22.017 1.00 175.49 ? 86  PHE A CD1 1 
ATOM   270  C CD2 . PHE A 1 51  ? -12.115 3.055   -23.716 1.00 170.63 ? 86  PHE A CD2 1 
ATOM   271  C CE1 . PHE A 1 51  ? -12.374 2.382   -21.054 1.00 176.85 ? 86  PHE A CE1 1 
ATOM   272  C CE2 . PHE A 1 51  ? -11.371 3.726   -22.758 1.00 171.93 ? 86  PHE A CE2 1 
ATOM   273  C CZ  . PHE A 1 51  ? -11.500 3.388   -21.427 1.00 174.99 ? 86  PHE A CZ  1 
ATOM   274  N N   . SER A 1 52  ? -15.931 0.689   -26.639 1.00 160.17 ? 87  SER A N   1 
ATOM   275  C CA  . SER A 1 52  ? -16.319 0.353   -28.002 1.00 158.36 ? 87  SER A CA  1 
ATOM   276  C C   . SER A 1 52  ? -17.138 1.501   -28.577 1.00 159.72 ? 87  SER A C   1 
ATOM   277  O O   . SER A 1 52  ? -17.084 1.782   -29.773 1.00 158.00 ? 87  SER A O   1 
ATOM   278  C CB  . SER A 1 52  ? -17.120 -0.952  -28.044 1.00 159.40 ? 87  SER A CB  1 
ATOM   279  O OG  . SER A 1 52  ? -18.320 -0.843  -27.301 1.00 163.38 ? 87  SER A OG  1 
ATOM   280  N N   . LEU A 1 53  ? -17.888 2.174   -27.712 1.00 144.85 ? 88  LEU A N   1 
ATOM   281  C CA  . LEU A 1 53  ? -18.668 3.320   -28.142 1.00 146.65 ? 88  LEU A CA  1 
ATOM   282  C C   . LEU A 1 53  ? -17.751 4.518   -28.339 1.00 145.36 ? 88  LEU A C   1 
ATOM   283  O O   . LEU A 1 53  ? -17.924 5.298   -29.273 1.00 145.14 ? 88  LEU A O   1 
ATOM   284  C CB  . LEU A 1 53  ? -19.754 3.654   -27.119 1.00 151.09 ? 88  LEU A CB  1 
ATOM   285  C CG  . LEU A 1 53  ? -21.086 4.121   -27.710 1.00 153.64 ? 88  LEU A CG  1 
ATOM   286  C CD1 . LEU A 1 53  ? -21.793 2.953   -28.388 1.00 153.39 ? 88  LEU A CD1 1 
ATOM   287  C CD2 . LEU A 1 53  ? -21.975 4.740   -26.642 1.00 158.23 ? 88  LEU A CD2 1 
ATOM   288  N N   . ALA A 1 54  ? -16.772 4.656   -27.449 1.00 158.37 ? 89  ALA A N   1 
ATOM   289  C CA  . ALA A 1 54  ? -15.815 5.754   -27.522 1.00 157.42 ? 89  ALA A CA  1 
ATOM   290  C C   . ALA A 1 54  ? -15.124 5.766   -28.876 1.00 154.20 ? 89  ALA A C   1 
ATOM   291  O O   . ALA A 1 54  ? -15.009 6.814   -29.512 1.00 154.39 ? 89  ALA A O   1 
ATOM   292  C CB  . ALA A 1 54  ? -14.789 5.640   -26.403 1.00 157.18 ? 89  ALA A CB  1 
ATOM   293  N N   . PHE A 1 55  ? -14.668 4.592   -29.307 1.00 151.49 ? 90  PHE A N   1 
ATOM   294  C CA  . PHE A 1 55  ? -14.029 4.442   -30.608 1.00 148.65 ? 90  PHE A CA  1 
ATOM   295  C C   . PHE A 1 55  ? -14.992 4.835   -31.707 1.00 149.58 ? 90  PHE A C   1 
ATOM   296  O O   . PHE A 1 55  ? -14.719 5.735   -32.496 1.00 149.44 ? 90  PHE A O   1 
ATOM   297  C CB  . PHE A 1 55  ? -13.614 2.991   -30.839 1.00 146.31 ? 90  PHE A CB  1 
ATOM   298  C CG  . PHE A 1 55  ? -12.357 2.599   -30.135 1.00 144.80 ? 90  PHE A CG  1 
ATOM   299  C CD1 . PHE A 1 55  ? -12.160 1.292   -29.721 1.00 144.03 ? 90  PHE A CD1 1 
ATOM   300  C CD2 . PHE A 1 55  ? -11.365 3.531   -29.895 1.00 144.43 ? 90  PHE A CD2 1 
ATOM   301  C CE1 . PHE A 1 55  ? -10.998 0.923   -29.072 1.00 142.95 ? 90  PHE A CE1 1 
ATOM   302  C CE2 . PHE A 1 55  ? -10.199 3.170   -29.246 1.00 143.30 ? 90  PHE A CE2 1 
ATOM   303  C CZ  . PHE A 1 55  ? -10.016 1.864   -28.833 1.00 142.56 ? 90  PHE A CZ  1 
ATOM   304  N N   . LEU A 1 56  ? -16.128 4.149   -31.745 1.00 140.64 ? 91  LEU A N   1 
ATOM   305  C CA  . LEU A 1 56  ? -17.119 4.349   -32.791 1.00 141.76 ? 91  LEU A CA  1 
ATOM   306  C C   . LEU A 1 56  ? -17.434 5.829   -32.985 1.00 143.92 ? 91  LEU A C   1 
ATOM   307  O O   . LEU A 1 56  ? -17.506 6.317   -34.111 1.00 143.88 ? 91  LEU A O   1 
ATOM   308  C CB  . LEU A 1 56  ? -18.397 3.578   -32.455 1.00 143.88 ? 91  LEU A CB  1 
ATOM   309  C CG  . LEU A 1 56  ? -19.475 3.541   -33.537 1.00 145.17 ? 91  LEU A CG  1 
ATOM   310  C CD1 . LEU A 1 56  ? -18.962 2.827   -34.781 1.00 142.39 ? 91  LEU A CD1 1 
ATOM   311  C CD2 . LEU A 1 56  ? -20.740 2.878   -33.006 1.00 147.90 ? 91  LEU A CD2 1 
ATOM   312  N N   . VAL A 1 57  ? -17.626 6.540   -31.881 1.00 123.03 ? 92  VAL A N   1 
ATOM   313  C CA  . VAL A 1 57  ? -17.935 7.960   -31.941 1.00 125.48 ? 92  VAL A CA  1 
ATOM   314  C C   . VAL A 1 57  ? -16.809 8.746   -32.613 1.00 123.88 ? 92  VAL A C   1 
ATOM   315  O O   . VAL A 1 57  ? -17.058 9.605   -33.459 1.00 125.16 ? 92  VAL A O   1 
ATOM   316  C CB  . VAL A 1 57  ? -18.204 8.533   -30.535 1.00 128.18 ? 92  VAL A CB  1 
ATOM   317  C CG1 . VAL A 1 57  ? -18.376 10.046  -30.598 1.00 130.70 ? 92  VAL A CG1 1 
ATOM   318  C CG2 . VAL A 1 57  ? -19.425 7.863   -29.918 1.00 130.58 ? 92  VAL A CG2 1 
ATOM   319  N N   . SER A 1 58  ? -15.570 8.447   -32.237 1.00 136.75 ? 93  SER A N   1 
ATOM   320  C CA  . SER A 1 58  ? -14.422 9.152   -32.796 1.00 135.48 ? 93  SER A CA  1 
ATOM   321  C C   . SER A 1 58  ? -14.213 8.799   -34.267 1.00 133.79 ? 93  SER A C   1 
ATOM   322  O O   . SER A 1 58  ? -13.867 9.661   -35.076 1.00 134.39 ? 93  SER A O   1 
ATOM   323  C CB  . SER A 1 58  ? -13.152 8.867   -31.988 1.00 133.58 ? 93  SER A CB  1 
ATOM   324  O OG  . SER A 1 58  ? -12.836 7.486   -31.984 1.00 131.07 ? 93  SER A OG  1 
ATOM   325  N N   . TRP A 1 59  ? -14.425 7.532   -34.608 1.00 153.67 ? 94  TRP A N   1 
ATOM   326  C CA  . TRP A 1 59  ? -14.269 7.072   -35.986 1.00 152.23 ? 94  TRP A CA  1 
ATOM   327  C C   . TRP A 1 59  ? -15.301 7.719   -36.909 1.00 154.73 ? 94  TRP A C   1 
ATOM   328  O O   . TRP A 1 59  ? -14.967 8.177   -38.000 1.00 154.88 ? 94  TRP A O   1 
ATOM   329  C CB  . TRP A 1 59  ? -14.369 5.543   -36.069 1.00 150.18 ? 94  TRP A CB  1 
ATOM   330  C CG  . TRP A 1 59  ? -13.176 4.804   -35.521 1.00 147.56 ? 94  TRP A CG  1 
ATOM   331  C CD1 . TRP A 1 59  ? -11.972 5.340   -35.160 1.00 146.66 ? 94  TRP A CD1 1 
ATOM   332  C CD2 . TRP A 1 59  ? -13.076 3.393   -35.271 1.00 145.84 ? 94  TRP A CD2 1 
ATOM   333  N NE1 . TRP A 1 59  ? -11.129 4.352   -34.702 1.00 144.48 ? 94  TRP A NE1 1 
ATOM   334  C CE2 . TRP A 1 59  ? -11.782 3.152   -34.760 1.00 143.96 ? 94  TRP A CE2 1 
ATOM   335  C CE3 . TRP A 1 59  ? -13.953 2.315   -35.429 1.00 145.99 ? 94  TRP A CE3 1 
ATOM   336  C CZ2 . TRP A 1 59  ? -11.348 1.871   -34.407 1.00 142.28 ? 94  TRP A CZ2 1 
ATOM   337  C CZ3 . TRP A 1 59  ? -13.517 1.045   -35.077 1.00 144.31 ? 94  TRP A CZ3 1 
ATOM   338  C CH2 . TRP A 1 59  ? -12.227 0.835   -34.573 1.00 142.49 ? 94  TRP A CH2 1 
ATOM   339  N N   . LEU A 1 60  ? -16.554 7.753   -36.467 1.00 146.76 ? 95  LEU A N   1 
ATOM   340  C CA  . LEU A 1 60  ? -17.629 8.355   -37.251 1.00 149.59 ? 95  LEU A CA  1 
ATOM   341  C C   . LEU A 1 60  ? -17.459 9.864   -37.401 1.00 151.88 ? 95  LEU A C   1 
ATOM   342  O O   . LEU A 1 60  ? -17.752 10.431  -38.454 1.00 153.55 ? 95  LEU A O   1 
ATOM   343  C CB  . LEU A 1 60  ? -18.994 8.046   -36.629 1.00 151.88 ? 95  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 60  ? -19.578 6.658   -36.898 1.00 150.92 ? 95  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 60  ? -20.915 6.490   -36.196 1.00 153.83 ? 95  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 60  ? -19.733 6.437   -38.390 1.00 150.68 ? 95  LEU A CD2 1 
ATOM   347  N N   . LEU A 1 61  ? -16.991 10.511  -36.339 1.00 151.92 ? 96  LEU A N   1 
ATOM   348  C CA  . LEU A 1 61  ? -16.824 11.959  -36.342 1.00 154.40 ? 96  LEU A CA  1 
ATOM   349  C C   . LEU A 1 61  ? -15.759 12.404  -37.342 1.00 153.48 ? 96  LEU A C   1 
ATOM   350  O O   . LEU A 1 61  ? -15.996 13.295  -38.158 1.00 155.93 ? 96  LEU A O   1 
ATOM   351  C CB  . LEU A 1 61  ? -16.468 12.463  -34.943 1.00 154.99 ? 96  LEU A CB  1 
ATOM   352  C CG  . LEU A 1 61  ? -16.639 13.972  -34.752 1.00 158.44 ? 96  LEU A CG  1 
ATOM   353  C CD1 . LEU A 1 61  ? -17.936 14.264  -34.006 1.00 161.67 ? 96  LEU A CD1 1 
ATOM   354  C CD2 . LEU A 1 61  ? -15.439 14.588  -34.033 1.00 157.87 ? 96  LEU A CD2 1 
ATOM   355  N N   . PHE A 1 62  ? -14.586 11.782  -37.271 1.00 141.01 ? 97  PHE A N   1 
ATOM   356  C CA  . PHE A 1 62  ? -13.485 12.122  -38.170 1.00 140.24 ? 97  PHE A CA  1 
ATOM   357  C C   . PHE A 1 62  ? -13.778 11.737  -39.623 1.00 140.33 ? 97  PHE A C   1 
ATOM   358  O O   . PHE A 1 62  ? -13.339 12.412  -40.555 1.00 141.68 ? 97  PHE A O   1 
ATOM   359  C CB  . PHE A 1 62  ? -12.175 11.489  -37.692 1.00 137.04 ? 97  PHE A CB  1 
ATOM   360  C CG  . PHE A 1 62  ? -11.455 12.301  -36.650 1.00 137.66 ? 97  PHE A CG  1 
ATOM   361  C CD1 . PHE A 1 62  ? -11.443 11.906  -35.322 1.00 136.86 ? 97  PHE A CD1 1 
ATOM   362  C CD2 . PHE A 1 62  ? -10.790 13.466  -37.002 1.00 139.43 ? 97  PHE A CD2 1 
ATOM   363  C CE1 . PHE A 1 62  ? -10.775 12.657  -34.364 1.00 137.71 ? 97  PHE A CE1 1 
ATOM   364  C CE2 . PHE A 1 62  ? -10.123 14.220  -36.052 1.00 140.24 ? 97  PHE A CE2 1 
ATOM   365  C CZ  . PHE A 1 62  ? -10.115 13.816  -34.732 1.00 139.33 ? 97  PHE A CZ  1 
ATOM   366  N N   . GLY A 1 63  ? -14.524 10.653  -39.809 1.00 128.50 ? 98  GLY A N   1 
ATOM   367  C CA  . GLY A 1 63  ? -14.946 10.244  -41.135 1.00 128.95 ? 98  GLY A CA  1 
ATOM   368  C C   . GLY A 1 63  ? -15.859 11.278  -41.769 1.00 132.93 ? 98  GLY A C   1 
ATOM   369  O O   . GLY A 1 63  ? -15.776 11.544  -42.968 1.00 134.30 ? 98  GLY A O   1 
ATOM   370  N N   . LEU A 1 64  ? -16.733 11.871  -40.959 1.00 133.47 ? 99  LEU A N   1 
ATOM   371  C CA  . LEU A 1 64  ? -17.646 12.898  -41.446 1.00 137.64 ? 99  LEU A CA  1 
ATOM   372  C C   . LEU A 1 64  ? -16.870 14.152  -41.825 1.00 139.54 ? 99  LEU A C   1 
ATOM   373  O O   . LEU A 1 64  ? -17.206 14.826  -42.797 1.00 142.61 ? 99  LEU A O   1 
ATOM   374  C CB  . LEU A 1 64  ? -18.710 13.233  -40.396 1.00 139.74 ? 99  LEU A CB  1 
ATOM   375  C CG  . LEU A 1 64  ? -19.902 14.068  -40.886 1.00 144.26 ? 99  LEU A CG  1 
ATOM   376  C CD1 . LEU A 1 64  ? -20.764 13.260  -41.851 1.00 144.74 ? 99  LEU A CD1 1 
ATOM   377  C CD2 . LEU A 1 64  ? -20.740 14.577  -39.724 1.00 146.59 ? 99  LEU A CD2 1 
ATOM   378  N N   . ILE A 1 65  ? -15.831 14.460  -41.053 1.00 140.59 ? 100 ILE A N   1 
ATOM   379  C CA  . ILE A 1 65  ? -14.971 15.605  -41.342 1.00 142.37 ? 100 ILE A CA  1 
ATOM   380  C C   . ILE A 1 65  ? -14.234 15.399  -42.652 1.00 141.96 ? 100 ILE A C   1 
ATOM   381  O O   . ILE A 1 65  ? -14.216 16.275  -43.515 1.00 145.21 ? 100 ILE A O   1 
ATOM   382  C CB  . ILE A 1 65  ? -13.925 15.837  -40.239 1.00 140.65 ? 100 ILE A CB  1 
ATOM   383  C CG1 . ILE A 1 65  ? -14.601 16.360  -38.978 1.00 142.21 ? 100 ILE A CG1 1 
ATOM   384  C CG2 . ILE A 1 65  ? -12.873 16.831  -40.707 1.00 142.23 ? 100 ILE A CG2 1 
ATOM   385  C CD1 . ILE A 1 65  ? -15.428 17.610  -39.221 1.00 146.88 ? 100 ILE A CD1 1 
ATOM   386  N N   . PHE A 1 66  ? -13.616 14.234  -42.788 1.00 144.50 ? 101 PHE A N   1 
ATOM   387  C CA  . PHE A 1 66  ? -12.919 13.890  -44.015 1.00 144.04 ? 101 PHE A CA  1 
ATOM   388  C C   . PHE A 1 66  ? -13.887 13.881  -45.191 1.00 146.68 ? 101 PHE A C   1 
ATOM   389  O O   . PHE A 1 66  ? -13.530 14.281  -46.296 1.00 148.80 ? 101 PHE A O   1 
ATOM   390  C CB  . PHE A 1 66  ? -12.216 12.540  -43.871 1.00 139.70 ? 101 PHE A CB  1 
ATOM   391  C CG  . PHE A 1 66  ? -10.913 12.614  -43.128 1.00 137.64 ? 101 PHE A CG  1 
ATOM   392  C CD1 . PHE A 1 66  ? -10.675 11.807  -42.030 1.00 134.50 ? 101 PHE A CD1 1 
ATOM   393  C CD2 . PHE A 1 66  ? -9.921  13.487  -43.537 1.00 139.22 ? 101 PHE A CD2 1 
ATOM   394  C CE1 . PHE A 1 66  ? -9.478  11.877  -41.348 1.00 132.91 ? 101 PHE A CE1 1 
ATOM   395  C CE2 . PHE A 1 66  ? -8.721  13.560  -42.860 1.00 137.60 ? 101 PHE A CE2 1 
ATOM   396  C CZ  . PHE A 1 66  ? -8.498  12.755  -41.765 1.00 134.40 ? 101 PHE A CZ  1 
ATOM   397  N N   . TRP A 1 67  ? -15.117 13.438  -44.950 1.00 130.76 ? 102 TRP A N   1 
ATOM   398  C CA  . TRP A 1 67  ? -16.118 13.425  -46.008 1.00 133.57 ? 102 TRP A CA  1 
ATOM   399  C C   . TRP A 1 67  ? -16.570 14.842  -46.360 1.00 138.47 ? 102 TRP A C   1 
ATOM   400  O O   . TRP A 1 67  ? -16.806 15.153  -47.528 1.00 141.47 ? 102 TRP A O   1 
ATOM   401  C CB  . TRP A 1 67  ? -17.319 12.554  -45.633 1.00 132.84 ? 102 TRP A CB  1 
ATOM   402  C CG  . TRP A 1 67  ? -18.402 12.624  -46.658 1.00 136.19 ? 102 TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 67  ? -18.524 11.853  -47.781 1.00 136.13 ? 102 TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 67  ? -19.506 13.535  -46.672 1.00 140.49 ? 102 TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 67  ? -19.645 12.224  -48.488 1.00 140.13 ? 102 TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 67  ? -20.265 13.253  -47.828 1.00 142.87 ? 102 TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 67  ? -19.930 14.558  -45.816 1.00 142.77 ? 102 TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 67  ? -21.424 13.959  -48.151 1.00 147.48 ? 102 TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 67  ? -21.081 15.258  -46.139 1.00 147.30 ? 102 TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 67  ? -21.814 14.955  -47.296 1.00 149.62 ? 102 TRP A CH2 1 
ATOM   411  N N   . LEU A 1 68  ? -16.691 15.695  -45.346 1.00 128.44 ? 103 LEU A N   1 
ATOM   412  C CA  . LEU A 1 68  ? -16.993 17.107  -45.565 1.00 133.19 ? 103 LEU A CA  1 
ATOM   413  C C   . LEU A 1 68  ? -15.922 17.756  -46.421 1.00 134.75 ? 103 LEU A C   1 
ATOM   414  O O   . LEU A 1 68  ? -16.222 18.522  -47.335 1.00 139.04 ? 103 LEU A O   1 
ATOM   415  C CB  . LEU A 1 68  ? -17.092 17.858  -44.238 1.00 133.75 ? 103 LEU A CB  1 
ATOM   416  C CG  . LEU A 1 68  ? -18.482 17.952  -43.614 1.00 135.61 ? 103 LEU A CG  1 
ATOM   417  C CD1 . LEU A 1 68  ? -18.472 18.955  -42.477 1.00 137.27 ? 103 LEU A CD1 1 
ATOM   418  C CD2 . LEU A 1 68  ? -19.503 18.347  -44.668 1.00 139.90 ? 103 LEU A CD2 1 
ATOM   419  N N   . ILE A 1 69  ? -14.668 17.449  -46.109 1.00 130.03 ? 104 ILE A N   1 
ATOM   420  C CA  . ILE A 1 69  ? -13.537 18.019  -46.829 1.00 131.48 ? 104 ILE A CA  1 
ATOM   421  C C   . ILE A 1 69  ? -13.491 17.542  -48.282 1.00 132.56 ? 104 ILE A C   1 
ATOM   422  O O   . ILE A 1 69  ? -13.317 18.344  -49.199 1.00 136.67 ? 104 ILE A O   1 
ATOM   423  C CB  . ILE A 1 69  ? -12.207 17.694  -46.131 1.00 127.82 ? 104 ILE A CB  1 
ATOM   424  C CG1 . ILE A 1 69  ? -12.233 18.197  -44.687 1.00 127.17 ? 104 ILE A CG1 1 
ATOM   425  C CG2 . ILE A 1 69  ? -11.050 18.315  -46.884 1.00 129.81 ? 104 ILE A CG2 1 
ATOM   426  C CD1 . ILE A 1 69  ? -10.957 17.928  -43.926 1.00 123.97 ? 104 ILE A CD1 1 
ATOM   427  N N   . ALA A 1 70  ? -13.654 16.238  -48.483 1.00 148.28 ? 105 ALA A N   1 
ATOM   428  C CA  . ALA A 1 70  ? -13.641 15.661  -49.823 1.00 149.15 ? 105 ALA A CA  1 
ATOM   429  C C   . ALA A 1 70  ? -14.808 16.179  -50.648 1.00 153.84 ? 105 ALA A C   1 
ATOM   430  O O   . ALA A 1 70  ? -14.696 16.358  -51.861 1.00 156.94 ? 105 ALA A O   1 
ATOM   431  C CB  . ALA A 1 70  ? -13.679 14.151  -49.751 1.00 144.73 ? 105 ALA A CB  1 
ATOM   432  N N   . LEU A 1 71  ? -15.935 16.404  -49.982 1.00 140.29 ? 106 LEU A N   1 
ATOM   433  C CA  . LEU A 1 71  ? -17.109 16.958  -50.638 1.00 145.04 ? 106 LEU A CA  1 
ATOM   434  C C   . LEU A 1 71  ? -16.820 18.358  -51.160 1.00 150.17 ? 106 LEU A C   1 
ATOM   435  O O   . LEU A 1 71  ? -17.067 18.659  -52.326 1.00 154.24 ? 106 LEU A O   1 
ATOM   436  C CB  . LEU A 1 71  ? -18.291 16.999  -49.669 1.00 145.05 ? 106 LEU A CB  1 
ATOM   437  C CG  . LEU A 1 71  ? -19.572 17.643  -50.203 1.00 150.27 ? 106 LEU A CG  1 
ATOM   438  C CD1 . LEU A 1 71  ? -20.143 16.832  -51.359 1.00 151.21 ? 106 LEU A CD1 1 
ATOM   439  C CD2 . LEU A 1 71  ? -20.600 17.803  -49.088 1.00 150.45 ? 106 LEU A CD2 1 
ATOM   440  N N   . ILE A 1 72  ? -16.286 19.208  -50.287 1.00 152.05 ? 107 ILE A N   1 
ATOM   441  C CA  . ILE A 1 72  ? -16.044 20.608  -50.623 1.00 157.19 ? 107 ILE A CA  1 
ATOM   442  C C   . ILE A 1 72  ? -14.945 20.767  -51.664 1.00 158.79 ? 107 ILE A C   1 
ATOM   443  O O   . ILE A 1 72  ? -15.058 21.584  -52.581 1.00 164.18 ? 107 ILE A O   1 
ATOM   444  C CB  . ILE A 1 72  ? -15.681 21.439  -49.374 1.00 156.82 ? 107 ILE A CB  1 
ATOM   445  C CG1 . ILE A 1 72  ? -16.948 21.899  -48.650 1.00 158.70 ? 107 ILE A CG1 1 
ATOM   446  C CG2 . ILE A 1 72  ? -14.858 22.654  -49.764 1.00 160.95 ? 107 ILE A CG2 1 
ATOM   447  C CD1 . ILE A 1 72  ? -17.849 20.773  -48.181 1.00 155.30 ? 107 ILE A CD1 1 
ATOM   448  N N   . HIS A 1 73  ? -13.882 19.983  -51.520 1.00 154.16 ? 108 HIS A N   1 
ATOM   449  C CA  . HIS A 1 73  ? -12.749 20.086  -52.427 1.00 155.57 ? 108 HIS A CA  1 
ATOM   450  C C   . HIS A 1 73  ? -13.099 19.511  -53.792 1.00 157.53 ? 108 HIS A C   1 
ATOM   451  O O   . HIS A 1 73  ? -12.388 19.736  -54.771 1.00 160.39 ? 108 HIS A O   1 
ATOM   452  C CB  . HIS A 1 73  ? -11.528 19.380  -51.844 1.00 150.49 ? 108 HIS A CB  1 
ATOM   453  C CG  . HIS A 1 73  ? -10.252 19.695  -52.559 1.00 152.36 ? 108 HIS A CG  1 
ATOM   454  N ND1 . HIS A 1 73  ? -9.585  18.770  -53.330 1.00 150.73 ? 108 HIS A ND1 1 
ATOM   455  C CD2 . HIS A 1 73  ? -9.523  20.834  -52.618 1.00 156.06 ? 108 HIS A CD2 1 
ATOM   456  C CE1 . HIS A 1 73  ? -8.496  19.326  -53.836 1.00 153.40 ? 108 HIS A CE1 1 
ATOM   457  N NE2 . HIS A 1 73  ? -8.436  20.577  -53.420 1.00 156.67 ? 108 HIS A NE2 1 
ATOM   458  N N   . GLY A 1 74  ? -14.202 18.772  -53.847 1.00 150.67 ? 109 GLY A N   1 
ATOM   459  C CA  . GLY A 1 74  ? -14.706 18.235  -55.099 1.00 152.87 ? 109 GLY A CA  1 
ATOM   460  C C   . GLY A 1 74  ? -14.105 16.894  -55.460 1.00 148.72 ? 109 GLY A C   1 
ATOM   461  O O   . GLY A 1 74  ? -14.099 16.497  -56.628 1.00 150.81 ? 109 GLY A O   1 
ATOM   462  N N   . ASP A 1 75  ? -13.604 16.193  -54.450 1.00 156.17 ? 110 ASP A N   1 
ATOM   463  C CA  . ASP A 1 75  ? -12.933 14.918  -54.657 1.00 152.03 ? 110 ASP A CA  1 
ATOM   464  C C   . ASP A 1 75  ? -13.909 13.801  -55.016 1.00 150.67 ? 110 ASP A C   1 
ATOM   465  O O   . ASP A 1 75  ? -13.550 12.856  -55.712 1.00 149.38 ? 110 ASP A O   1 
ATOM   466  C CB  . ASP A 1 75  ? -12.118 14.537  -53.417 1.00 146.85 ? 110 ASP A CB  1 
ATOM   467  C CG  . ASP A 1 75  ? -10.982 15.506  -53.146 1.00 148.08 ? 110 ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 75  ? -10.595 16.237  -54.081 1.00 152.50 ? 110 ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 75  ? -10.472 15.530  -52.004 1.00 144.93 ? 110 ASP A OD2 1 
ATOM   470  N N   . LEU A 1 76  ? -15.146 13.915  -54.547 1.00 149.94 ? 111 LEU A N   1 
ATOM   471  C CA  . LEU A 1 76  ? -16.138 12.873  -54.778 1.00 148.83 ? 111 LEU A CA  1 
ATOM   472  C C   . LEU A 1 76  ? -16.294 12.546  -56.260 1.00 152.02 ? 111 LEU A C   1 
ATOM   473  O O   . LEU A 1 76  ? -16.538 11.394  -56.619 1.00 150.11 ? 111 LEU A O   1 
ATOM   474  C CB  . LEU A 1 76  ? -17.488 13.263  -54.170 1.00 150.36 ? 111 LEU A CB  1 
ATOM   475  C CG  . LEU A 1 76  ? -17.459 13.572  -52.674 1.00 147.67 ? 111 LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 76  ? -18.871 13.625  -52.116 1.00 148.86 ? 111 LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 76  ? -16.620 12.549  -51.917 1.00 141.93 ? 111 LEU A CD2 1 
ATOM   478  N N   . GLU A 1 77  ? -16.153 13.553  -57.117 1.00 173.34 ? 112 GLU A N   1 
ATOM   479  C CA  . GLU A 1 77  ? -16.296 13.346  -58.556 1.00 177.22 ? 112 GLU A CA  1 
ATOM   480  C C   . GLU A 1 77  ? -14.981 13.014  -59.272 1.00 176.83 ? 112 GLU A C   1 
ATOM   481  O O   . GLU A 1 77  ? -14.988 12.637  -60.445 1.00 179.53 ? 112 GLU A O   1 
ATOM   482  C CB  . GLU A 1 77  ? -16.957 14.564  -59.223 1.00 183.99 ? 112 GLU A CB  1 
ATOM   483  C CG  . GLU A 1 77  ? -18.459 14.683  -58.986 1.00 185.76 ? 112 GLU A CG  1 
ATOM   484  C CD  . GLU A 1 77  ? -18.794 15.368  -57.675 1.00 184.40 ? 112 GLU A CD  1 
ATOM   485  O OE1 . GLU A 1 77  ? -17.980 16.195  -57.209 1.00 184.43 ? 112 GLU A OE1 1 
ATOM   486  O OE2 . GLU A 1 77  ? -19.869 15.074  -57.110 1.00 183.56 ? 112 GLU A OE2 1 
ATOM   487  N N   . ASN A 1 78  ? -13.859 13.163  -58.575 1.00 140.66 ? 113 ASN A N   1 
ATOM   488  C CA  . ASN A 1 78  ? -12.563 12.748  -59.115 1.00 139.82 ? 113 ASN A CA  1 
ATOM   489  C C   . ASN A 1 78  ? -11.660 12.160  -58.032 1.00 133.87 ? 113 ASN A C   1 
ATOM   490  O O   . ASN A 1 78  ? -10.586 12.697  -57.757 1.00 133.75 ? 113 ASN A O   1 
ATOM   491  C CB  . ASN A 1 78  ? -11.870 13.923  -59.810 1.00 145.16 ? 113 ASN A CB  1 
ATOM   492  C CG  . ASN A 1 78  ? -10.740 13.480  -60.717 1.00 145.99 ? 113 ASN A CG  1 
ATOM   493  O OD1 . ASN A 1 78  ? -10.553 12.288  -60.954 1.00 142.95 ? 113 ASN A OD1 1 
ATOM   494  N ND2 . ASN A 1 78  ? -9.986  14.440  -61.238 1.00 150.47 ? 113 ASN A ND2 1 
ATOM   495  N N   . PRO A 1 79  ? -12.088 11.036  -57.433 1.00 142.97 ? 114 PRO A N   1 
ATOM   496  C CA  . PRO A 1 79  ? -11.476 10.502  -56.209 1.00 137.48 ? 114 PRO A CA  1 
ATOM   497  C C   . PRO A 1 79  ? -10.032 10.087  -56.417 1.00 135.75 ? 114 PRO A C   1 
ATOM   498  O O   . PRO A 1 79  ? -9.214  10.246  -55.516 1.00 133.14 ? 114 PRO A O   1 
ATOM   499  C CB  . PRO A 1 79  ? -12.332 9.267   -55.891 1.00 134.20 ? 114 PRO A CB  1 
ATOM   500  C CG  . PRO A 1 79  ? -13.594 9.452   -56.663 1.00 138.07 ? 114 PRO A CG  1 
ATOM   501  C CD  . PRO A 1 79  ? -13.194 10.184  -57.903 1.00 143.08 ? 114 PRO A CD  1 
ATOM   502  N N   . GLY A 1 80  ? -9.732  9.556   -57.595 1.00 134.26 ? 115 GLY A N   1 
ATOM   503  C CA  . GLY A 1 80  ? -8.385  9.129   -57.910 1.00 133.20 ? 115 GLY A CA  1 
ATOM   504  C C   . GLY A 1 80  ? -7.519  10.291  -58.349 1.00 137.26 ? 115 GLY A C   1 
ATOM   505  O O   . GLY A 1 80  ? -6.295  10.253  -58.209 1.00 136.24 ? 115 GLY A O   1 
ATOM   506  N N   . GLY A 1 81  ? -8.160  11.328  -58.881 1.00 129.59 ? 116 GLY A N   1 
ATOM   507  C CA  . GLY A 1 81  ? -7.458  12.501  -59.370 1.00 134.38 ? 116 GLY A CA  1 
ATOM   508  C C   . GLY A 1 81  ? -6.840  12.256  -60.733 1.00 138.07 ? 116 GLY A C   1 
ATOM   509  O O   . GLY A 1 81  ? -7.062  11.211  -61.341 1.00 137.10 ? 116 GLY A O   1 
ATOM   510  N N   . ASP A 1 82  ? -6.078  13.233  -61.217 1.00 163.05 ? 117 ASP A N   1 
ATOM   511  C CA  . ASP A 1 82  ? -5.385  13.134  -62.502 1.00 167.40 ? 117 ASP A CA  1 
ATOM   512  C C   . ASP A 1 82  ? -4.254  14.158  -62.570 1.00 171.01 ? 117 ASP A C   1 
ATOM   513  O O   . ASP A 1 82  ? -3.931  14.795  -61.566 1.00 169.31 ? 117 ASP A O   1 
ATOM   514  C CB  . ASP A 1 82  ? -6.354  13.328  -63.665 1.00 172.76 ? 117 ASP A CB  1 
ATOM   515  C CG  . ASP A 1 82  ? -7.189  14.582  -63.526 1.00 176.66 ? 117 ASP A CG  1 
ATOM   516  O OD1 . ASP A 1 82  ? -6.613  15.670  -63.303 1.00 179.44 ? 117 ASP A OD1 1 
ATOM   517  O OD2 . ASP A 1 82  ? -8.428  14.470  -63.636 1.00 177.15 ? 117 ASP A OD2 1 
ATOM   518  N N   . ASP A 1 83  ? -3.663  14.319  -63.752 1.00 173.25 ? 118 ASP A N   1 
ATOM   519  C CA  . ASP A 1 83  ? -2.529  15.226  -63.942 1.00 177.39 ? 118 ASP A CA  1 
ATOM   520  C C   . ASP A 1 83  ? -2.797  16.641  -63.436 1.00 180.38 ? 118 ASP A C   1 
ATOM   521  O O   . ASP A 1 83  ? -1.897  17.294  -62.920 1.00 180.87 ? 118 ASP A O   1 
ATOM   522  C CB  . ASP A 1 83  ? -2.103  15.271  -65.422 1.00 183.99 ? 118 ASP A CB  1 
ATOM   523  C CG  . ASP A 1 83  ? -1.495  13.965  -65.901 1.00 181.59 ? 118 ASP A CG  1 
ATOM   524  O OD1 . ASP A 1 83  ? -1.112  13.136  -65.049 1.00 175.13 ? 118 ASP A OD1 1 
ATOM   525  O OD2 . ASP A 1 83  ? -1.398  13.777  -67.133 1.00 186.50 ? 118 ASP A OD2 1 
ATOM   526  N N   . THR A 1 84  ? -4.022  17.124  -63.624 1.00 173.10 ? 119 THR A N   1 
ATOM   527  C CA  . THR A 1 84  ? -4.380  18.486  -63.223 1.00 176.58 ? 119 THR A CA  1 
ATOM   528  C C   . THR A 1 84  ? -5.034  18.660  -61.835 1.00 171.61 ? 119 THR A C   1 
ATOM   529  O O   . THR A 1 84  ? -5.161  19.786  -61.358 1.00 174.08 ? 119 THR A O   1 
ATOM   530  C CB  . THR A 1 84  ? -5.295  19.142  -64.281 1.00 183.65 ? 119 THR A CB  1 
ATOM   531  O OG1 . THR A 1 84  ? -6.489  18.365  -64.425 1.00 181.34 ? 119 THR A OG1 1 
ATOM   532  C CG2 . THR A 1 84  ? -4.590  19.226  -65.623 1.00 189.94 ? 119 THR A CG2 1 
ATOM   533  N N   . PHE A 1 85  ? -5.451  17.568  -61.195 1.00 166.35 ? 120 PHE A N   1 
ATOM   534  C CA  . PHE A 1 85  ? -6.211  17.668  -59.941 1.00 162.16 ? 120 PHE A CA  1 
ATOM   535  C C   . PHE A 1 85  ? -5.819  16.626  -58.884 1.00 154.62 ? 120 PHE A C   1 
ATOM   536  O O   . PHE A 1 85  ? -5.822  15.425  -59.156 1.00 151.44 ? 120 PHE A O   1 
ATOM   537  C CB  . PHE A 1 85  ? -7.714  17.587  -60.238 1.00 163.40 ? 120 PHE A CB  1 
ATOM   538  C CG  . PHE A 1 85  ? -8.581  17.542  -59.010 1.00 159.23 ? 120 PHE A CG  1 
ATOM   539  C CD1 . PHE A 1 85  ? -8.564  18.578  -58.094 1.00 159.80 ? 120 PHE A CD1 1 
ATOM   540  C CD2 . PHE A 1 85  ? -9.430  16.470  -58.783 1.00 155.16 ? 120 PHE A CD2 1 
ATOM   541  C CE1 . PHE A 1 85  ? -9.365  18.539  -56.965 1.00 156.37 ? 120 PHE A CE1 1 
ATOM   542  C CE2 . PHE A 1 85  ? -10.234 16.426  -57.655 1.00 151.81 ? 120 PHE A CE2 1 
ATOM   543  C CZ  . PHE A 1 85  ? -10.201 17.462  -56.747 1.00 152.45 ? 120 PHE A CZ  1 
ATOM   544  N N   . LYS A 1 86  ? -5.486  17.098  -57.682 1.00 147.48 ? 121 LYS A N   1 
ATOM   545  C CA  . LYS A 1 86  ? -5.081  16.228  -56.573 1.00 140.84 ? 121 LYS A CA  1 
ATOM   546  C C   . LYS A 1 86  ? -6.028  16.309  -55.362 1.00 137.65 ? 121 LYS A C   1 
ATOM   547  O O   . LYS A 1 86  ? -6.163  17.367  -54.749 1.00 139.43 ? 121 LYS A O   1 
ATOM   548  C CB  . LYS A 1 86  ? -3.632  16.535  -56.158 1.00 140.41 ? 121 LYS A CB  1 
ATOM   549  C CG  . LYS A 1 86  ? -3.018  15.545  -55.161 1.00 134.09 ? 121 LYS A CG  1 
ATOM   550  C CD  . LYS A 1 86  ? -1.585  15.149  -55.546 1.00 134.05 ? 121 LYS A CD  1 
ATOM   551  C CE  . LYS A 1 86  ? -0.597  16.307  -55.386 1.00 137.57 ? 121 LYS A CE  1 
ATOM   552  N NZ  . LYS A 1 86  ? 0.790   15.978  -55.857 1.00 138.38 ? 121 LYS A NZ  1 
ATOM   553  N N   . PRO A 1 87  ? -6.691  15.190  -55.020 1.00 147.20 ? 122 PRO A N   1 
ATOM   554  C CA  . PRO A 1 87  ? -7.568  15.126  -53.841 1.00 144.13 ? 122 PRO A CA  1 
ATOM   555  C C   . PRO A 1 87  ? -6.834  15.367  -52.524 1.00 141.13 ? 122 PRO A C   1 
ATOM   556  O O   . PRO A 1 87  ? -5.629  15.150  -52.436 1.00 139.77 ? 122 PRO A O   1 
ATOM   557  C CB  . PRO A 1 87  ? -8.086  13.683  -53.870 1.00 140.10 ? 122 PRO A CB  1 
ATOM   558  C CG  . PRO A 1 87  ? -7.996  13.282  -55.294 1.00 142.70 ? 122 PRO A CG  1 
ATOM   559  C CD  . PRO A 1 87  ? -6.768  13.960  -55.827 1.00 145.70 ? 122 PRO A CD  1 
ATOM   560  N N   . CYS A 1 88  ? -7.569  15.805  -51.509 1.00 154.35 ? 123 CYS A N   1 
ATOM   561  C CA  . CYS A 1 88  ? -7.010  15.982  -50.177 1.00 151.56 ? 123 CYS A CA  1 
ATOM   562  C C   . CYS A 1 88  ? -6.608  14.624  -49.639 1.00 146.17 ? 123 CYS A C   1 
ATOM   563  O O   . CYS A 1 88  ? -5.499  14.439  -49.141 1.00 144.13 ? 123 CYS A O   1 
ATOM   564  C CB  . CYS A 1 88  ? -8.047  16.611  -49.254 1.00 152.09 ? 123 CYS A CB  1 
ATOM   565  S SG  . CYS A 1 88  ? -8.811  18.100  -49.922 1.00 158.72 ? 123 CYS A SG  1 
ATOM   566  N N   . VAL A 1 89  ? -7.542  13.684  -49.735 1.00 137.28 ? 124 VAL A N   1 
ATOM   567  C CA  . VAL A 1 89  ? -7.293  12.285  -49.430 1.00 132.71 ? 124 VAL A CA  1 
ATOM   568  C C   . VAL A 1 89  ? -7.720  11.457  -50.626 1.00 133.19 ? 124 VAL A C   1 
ATOM   569  O O   . VAL A 1 89  ? -8.843  11.578  -51.109 1.00 135.26 ? 124 VAL A O   1 
ATOM   570  C CB  . VAL A 1 89  ? -8.091  11.811  -48.205 1.00 129.74 ? 124 VAL A CB  1 
ATOM   571  C CG1 . VAL A 1 89  ? -7.867  10.322  -47.972 1.00 125.52 ? 124 VAL A CG1 1 
ATOM   572  C CG2 . VAL A 1 89  ? -7.702  12.614  -46.975 1.00 129.47 ? 124 VAL A CG2 1 
ATOM   573  N N   . LEU A 1 90  ? -6.814  10.622  -51.110 1.00 113.48 ? 125 LEU A N   1 
ATOM   574  C CA  . LEU A 1 90  ? -7.085  9.804   -52.280 1.00 114.10 ? 125 LEU A CA  1 
ATOM   575  C C   . LEU A 1 90  ? -8.210  8.808   -52.043 1.00 111.81 ? 125 LEU A C   1 
ATOM   576  O O   . LEU A 1 90  ? -8.385  8.299   -50.937 1.00 108.46 ? 125 LEU A O   1 
ATOM   577  C CB  . LEU A 1 90  ? -5.820  9.061   -52.701 1.00 112.63 ? 125 LEU A CB  1 
ATOM   578  C CG  . LEU A 1 90  ? -4.803  9.913   -53.453 1.00 116.22 ? 125 LEU A CG  1 
ATOM   579  C CD1 . LEU A 1 90  ? -3.433  9.256   -53.473 1.00 114.30 ? 125 LEU A CD1 1 
ATOM   580  C CD2 . LEU A 1 90  ? -5.303  10.177  -54.864 1.00 120.66 ? 125 LEU A CD2 1 
ATOM   581  N N   . GLN A 1 91  ? -8.980  8.551   -53.093 1.00 142.47 ? 126 GLN A N   1 
ATOM   582  C CA  . GLN A 1 91  ? -9.930  7.448   -53.102 1.00 140.65 ? 126 GLN A CA  1 
ATOM   583  C C   . GLN A 1 91  ? -11.090 7.548   -52.123 1.00 139.82 ? 126 GLN A C   1 
ATOM   584  O O   . GLN A 1 91  ? -11.642 6.525   -51.721 1.00 137.34 ? 126 GLN A O   1 
ATOM   585  C CB  . GLN A 1 91  ? -9.186  6.135   -52.864 1.00 136.64 ? 126 GLN A CB  1 
ATOM   586  C CG  . GLN A 1 91  ? -8.225  5.793   -53.975 1.00 137.68 ? 126 GLN A CG  1 
ATOM   587  C CD  . GLN A 1 91  ? -8.903  5.796   -55.334 1.00 141.39 ? 126 GLN A CD  1 
ATOM   588  O OE1 . GLN A 1 91  ? -10.116 5.604   -55.437 1.00 142.13 ? 126 GLN A OE1 1 
ATOM   589  N NE2 . GLN A 1 91  ? -8.123  6.025   -56.385 1.00 144.09 ? 126 GLN A NE2 1 
ATOM   590  N N   . VAL A 1 92  ? -11.475 8.757   -51.736 1.00 122.69 ? 127 VAL A N   1 
ATOM   591  C CA  . VAL A 1 92  ? -12.705 8.883   -50.973 1.00 122.78 ? 127 VAL A CA  1 
ATOM   592  C C   . VAL A 1 92  ? -13.840 9.220   -51.939 1.00 126.82 ? 127 VAL A C   1 
ATOM   593  O O   . VAL A 1 92  ? -13.970 10.357  -52.399 1.00 130.72 ? 127 VAL A O   1 
ATOM   594  C CB  . VAL A 1 92  ? -12.584 9.967   -49.888 1.00 123.16 ? 127 VAL A CB  1 
ATOM   595  C CG1 . VAL A 1 92  ? -13.902 10.143  -49.161 1.00 123.89 ? 127 VAL A CG1 1 
ATOM   596  C CG2 . VAL A 1 92  ? -11.479 9.609   -48.906 1.00 119.40 ? 127 VAL A CG2 1 
ATOM   597  N N   . ASN A 1 93  ? -14.671 8.221   -52.222 1.00 147.31 ? 128 ASN A N   1 
ATOM   598  C CA  . ASN A 1 93  ? -15.784 8.379   -53.152 1.00 151.12 ? 128 ASN A CA  1 
ATOM   599  C C   . ASN A 1 93  ? -17.146 8.558   -52.495 1.00 152.18 ? 128 ASN A C   1 
ATOM   600  O O   . ASN A 1 93  ? -18.145 8.754   -53.183 1.00 155.67 ? 128 ASN A O   1 
ATOM   601  C CB  . ASN A 1 93  ? -15.819 7.224   -54.157 1.00 150.75 ? 128 ASN A CB  1 
ATOM   602  C CG  . ASN A 1 93  ? -15.937 5.867   -53.488 1.00 146.54 ? 128 ASN A CG  1 
ATOM   603  O OD1 . ASN A 1 93  ? -16.200 5.774   -52.287 1.00 144.33 ? 128 ASN A OD1 1 
ATOM   604  N ND2 . ASN A 1 93  ? -15.760 4.804   -54.269 1.00 145.78 ? 128 ASN A ND2 1 
ATOM   605  N N   . GLY A 1 94  ? -17.187 8.485   -51.169 1.00 146.14 ? 129 GLY A N   1 
ATOM   606  C CA  . GLY A 1 94  ? -18.441 8.599   -50.447 1.00 147.18 ? 129 GLY A CA  1 
ATOM   607  C C   . GLY A 1 94  ? -18.212 8.633   -48.952 1.00 144.43 ? 129 GLY A C   1 
ATOM   608  O O   . GLY A 1 94  ? -17.073 8.763   -48.504 1.00 142.13 ? 129 GLY A O   1 
ATOM   609  N N   . PHE A 1 95  ? -19.288 8.517   -48.178 1.00 187.46 ? 130 PHE A N   1 
ATOM   610  C CA  . PHE A 1 95  ? -19.173 8.538   -46.724 1.00 185.41 ? 130 PHE A CA  1 
ATOM   611  C C   . PHE A 1 95  ? -18.627 7.217   -46.192 1.00 181.20 ? 130 PHE A C   1 
ATOM   612  O O   . PHE A 1 95  ? -17.889 7.191   -45.205 1.00 178.82 ? 130 PHE A O   1 
ATOM   613  C CB  . PHE A 1 95  ? -20.515 8.861   -46.064 1.00 187.93 ? 130 PHE A CB  1 
ATOM   614  C CG  . PHE A 1 95  ? -20.435 8.966   -44.568 1.00 186.50 ? 130 PHE A CG  1 
ATOM   615  C CD1 . PHE A 1 95  ? -19.849 10.072  -43.972 1.00 187.05 ? 130 PHE A CD1 1 
ATOM   616  C CD2 . PHE A 1 95  ? -20.927 7.955   -43.756 1.00 184.93 ? 130 PHE A CD2 1 
ATOM   617  C CE1 . PHE A 1 95  ? -19.762 10.173  -42.596 1.00 186.03 ? 130 PHE A CE1 1 
ATOM   618  C CE2 . PHE A 1 95  ? -20.844 8.052   -42.377 1.00 184.06 ? 130 PHE A CE2 1 
ATOM   619  C CZ  . PHE A 1 95  ? -20.260 9.164   -41.797 1.00 184.59 ? 130 PHE A CZ  1 
ATOM   620  N N   . VAL A 1 96  ? -18.997 6.123   -46.851 1.00 124.40 ? 131 VAL A N   1 
ATOM   621  C CA  . VAL A 1 96  ? -18.503 4.800   -46.485 1.00 120.80 ? 131 VAL A CA  1 
ATOM   622  C C   . VAL A 1 96  ? -16.989 4.714   -46.661 1.00 118.17 ? 131 VAL A C   1 
ATOM   623  O O   . VAL A 1 96  ? -16.276 4.233   -45.779 1.00 115.31 ? 131 VAL A O   1 
ATOM   624  C CB  . VAL A 1 96  ? -19.179 3.693   -47.311 1.00 121.14 ? 131 VAL A CB  1 
ATOM   625  C CG1 . VAL A 1 96  ? -18.660 2.327   -46.886 1.00 117.68 ? 131 VAL A CG1 1 
ATOM   626  C CG2 . VAL A 1 96  ? -20.689 3.769   -47.156 1.00 124.09 ? 131 VAL A CG2 1 
ATOM   627  N N   . ALA A 1 97  ? -16.503 5.179   -47.807 1.00 141.12 ? 132 ALA A N   1 
ATOM   628  C CA  . ALA A 1 97  ? -15.070 5.278   -48.025 1.00 139.38 ? 132 ALA A CA  1 
ATOM   629  C C   . ALA A 1 97  ? -14.471 6.206   -46.972 1.00 138.88 ? 132 ALA A C   1 
ATOM   630  O O   . ALA A 1 97  ? -13.433 5.902   -46.383 1.00 136.21 ? 132 ALA A O   1 
ATOM   631  C CB  . ALA A 1 97  ? -14.776 5.795   -49.422 1.00 141.91 ? 132 ALA A CB  1 
ATOM   632  N N   . ALA A 1 98  ? -15.140 7.331   -46.733 1.00 131.87 ? 133 ALA A N   1 
ATOM   633  C CA  . ALA A 1 98  ? -14.702 8.311   -45.745 1.00 132.02 ? 133 ALA A CA  1 
ATOM   634  C C   . ALA A 1 98  ? -14.534 7.668   -44.372 1.00 129.12 ? 133 ALA A C   1 
ATOM   635  O O   . ALA A 1 98  ? -13.523 7.868   -43.687 1.00 127.47 ? 133 ALA A O   1 
ATOM   636  C CB  . ALA A 1 98  ? -15.704 9.448   -45.668 1.00 135.78 ? 133 ALA A CB  1 
ATOM   637  N N   . PHE A 1 99  ? -15.553 6.911   -43.977 1.00 142.61 ? 134 PHE A N   1 
ATOM   638  C CA  . PHE A 1 99  ? -15.547 6.162   -42.729 1.00 140.42 ? 134 PHE A CA  1 
ATOM   639  C C   . PHE A 1 99  ? -14.308 5.278   -42.653 1.00 137.02 ? 134 PHE A C   1 
ATOM   640  O O   . PHE A 1 99  ? -13.600 5.259   -41.652 1.00 135.44 ? 134 PHE A O   1 
ATOM   641  C CB  . PHE A 1 99  ? -16.808 5.297   -42.658 1.00 141.08 ? 134 PHE A CB  1 
ATOM   642  C CG  . PHE A 1 99  ? -16.972 4.566   -41.362 1.00 139.71 ? 134 PHE A CG  1 
ATOM   643  C CD1 . PHE A 1 99  ? -17.074 5.265   -40.173 1.00 140.60 ? 134 PHE A CD1 1 
ATOM   644  C CD2 . PHE A 1 99  ? -17.039 3.183   -41.333 1.00 137.92 ? 134 PHE A CD2 1 
ATOM   645  C CE1 . PHE A 1 99  ? -17.229 4.598   -38.977 1.00 139.84 ? 134 PHE A CE1 1 
ATOM   646  C CE2 . PHE A 1 99  ? -17.197 2.512   -40.141 1.00 137.18 ? 134 PHE A CE2 1 
ATOM   647  C CZ  . PHE A 1 99  ? -17.292 3.221   -38.961 1.00 138.20 ? 134 PHE A CZ  1 
ATOM   648  N N   . LEU A 1 100 ? -14.048 4.552   -43.733 1.00 124.99 ? 135 LEU A N   1 
ATOM   649  C CA  . LEU A 1 100 ? -12.911 3.639   -43.796 1.00 122.06 ? 135 LEU A CA  1 
ATOM   650  C C   . LEU A 1 100 ? -11.570 4.330   -43.565 1.00 121.25 ? 135 LEU A C   1 
ATOM   651  O O   . LEU A 1 100 ? -10.779 3.881   -42.738 1.00 119.09 ? 135 LEU A O   1 
ATOM   652  C CB  . LEU A 1 100 ? -12.888 2.910   -45.137 1.00 122.00 ? 135 LEU A CB  1 
ATOM   653  C CG  . LEU A 1 100 ? -14.035 1.926   -45.377 1.00 122.39 ? 135 LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 100 ? -13.909 1.309   -46.757 1.00 122.64 ? 135 LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 100 ? -14.055 0.859   -44.304 1.00 120.25 ? 135 LEU A CD2 1 
ATOM   656  N N   . PHE A 1 101 ? -11.319 5.425   -44.277 1.00 114.34 ? 136 PHE A N   1 
ATOM   657  C CA  . PHE A 1 101 ? -10.058 6.135   -44.128 1.00 114.08 ? 136 PHE A CA  1 
ATOM   658  C C   . PHE A 1 101 ? -9.848  6.599   -42.695 1.00 113.52 ? 136 PHE A C   1 
ATOM   659  O O   . PHE A 1 101 ? -8.741  6.514   -42.170 1.00 111.93 ? 136 PHE A O   1 
ATOM   660  C CB  . PHE A 1 101 ? -9.978  7.325   -45.074 1.00 117.15 ? 136 PHE A CB  1 
ATOM   661  C CG  . PHE A 1 101 ? -8.753  8.170   -44.867 1.00 117.48 ? 136 PHE A CG  1 
ATOM   662  C CD1 . PHE A 1 101 ? -7.564  7.867   -45.508 1.00 116.67 ? 136 PHE A CD1 1 
ATOM   663  C CD2 . PHE A 1 101 ? -8.789  9.264   -44.021 1.00 118.86 ? 136 PHE A CD2 1 
ATOM   664  C CE1 . PHE A 1 101 ? -6.442  8.639   -45.313 1.00 117.29 ? 136 PHE A CE1 1 
ATOM   665  C CE2 . PHE A 1 101 ? -7.668  10.040  -43.823 1.00 119.42 ? 136 PHE A CE2 1 
ATOM   666  C CZ  . PHE A 1 101 ? -6.496  9.727   -44.469 1.00 118.66 ? 136 PHE A CZ  1 
ATOM   667  N N   . SER A 1 102 ? -10.912 7.091   -42.069 1.00 126.84 ? 137 SER A N   1 
ATOM   668  C CA  . SER A 1 102 ? -10.853 7.525   -40.677 1.00 126.78 ? 137 SER A CA  1 
ATOM   669  C C   . SER A 1 102 ? -10.404 6.380   -39.775 1.00 123.97 ? 137 SER A C   1 
ATOM   670  O O   . SER A 1 102 ? -9.478  6.524   -38.976 1.00 122.99 ? 137 SER A O   1 
ATOM   671  C CB  . SER A 1 102 ? -12.218 8.029   -40.229 1.00 129.15 ? 137 SER A CB  1 
ATOM   672  O OG  . SER A 1 102 ? -12.199 8.411   -38.865 1.00 129.38 ? 137 SER A OG  1 
ATOM   673  N N   . ILE A 1 103 ? -11.067 5.238   -39.918 1.00 121.81 ? 138 ILE A N   1 
ATOM   674  C CA  . ILE A 1 103 ? -10.695 4.035   -39.181 1.00 119.50 ? 138 ILE A CA  1 
ATOM   675  C C   . ILE A 1 103 ? -9.223  3.702   -39.387 1.00 117.43 ? 138 ILE A C   1 
ATOM   676  O O   . ILE A 1 103 ? -8.452  3.623   -38.432 1.00 116.45 ? 138 ILE A O   1 
ATOM   677  C CB  . ILE A 1 103 ? -11.525 2.825   -39.648 1.00 119.00 ? 138 ILE A CB  1 
ATOM   678  C CG1 . ILE A 1 103 ? -12.981 2.962   -39.200 1.00 121.11 ? 138 ILE A CG1 1 
ATOM   679  C CG2 . ILE A 1 103 ? -10.931 1.539   -39.117 1.00 116.71 ? 138 ILE A CG2 1 
ATOM   680  C CD1 . ILE A 1 103 ? -13.878 1.847   -39.692 1.00 121.15 ? 138 ILE A CD1 1 
ATOM   681  N N   . GLU A 1 104 ? -8.836  3.529   -40.642 1.00 122.84 ? 139 GLU A N   1 
ATOM   682  C CA  . GLU A 1 104 ? -7.488  3.104   -40.976 1.00 121.14 ? 139 GLU A CA  1 
ATOM   683  C C   . GLU A 1 104 ? -6.438  4.066   -40.430 1.00 121.46 ? 139 GLU A C   1 
ATOM   684  O O   . GLU A 1 104 ? -5.312  3.664   -40.144 1.00 120.01 ? 139 GLU A O   1 
ATOM   685  C CB  . GLU A 1 104 ? -7.349  2.966   -42.491 1.00 121.58 ? 139 GLU A CB  1 
ATOM   686  C CG  . GLU A 1 104 ? -8.461  2.151   -43.130 1.00 121.80 ? 139 GLU A CG  1 
ATOM   687  C CD  . GLU A 1 104 ? -8.407  2.169   -44.645 1.00 122.90 ? 139 GLU A CD  1 
ATOM   688  O OE1 . GLU A 1 104 ? -7.391  2.635   -45.210 1.00 123.26 ? 139 GLU A OE1 1 
ATOM   689  O OE2 . GLU A 1 104 ? -9.384  1.717   -45.274 1.00 123.72 ? 139 GLU A OE2 1 
ATOM   690  N N   . THR A 1 105 ? -6.804  5.337   -40.294 1.00 118.22 ? 140 THR A N   1 
ATOM   691  C CA  . THR A 1 105 ? -5.896  6.335   -39.736 1.00 118.97 ? 140 THR A CA  1 
ATOM   692  C C   . THR A 1 105 ? -5.737  6.161   -38.234 1.00 118.17 ? 140 THR A C   1 
ATOM   693  O O   . THR A 1 105 ? -4.621  6.105   -37.716 1.00 117.30 ? 140 THR A O   1 
ATOM   694  C CB  . THR A 1 105 ? -6.411  7.757   -39.979 1.00 121.90 ? 140 THR A CB  1 
ATOM   695  O OG1 . THR A 1 105 ? -6.734  7.914   -41.363 1.00 123.19 ? 140 THR A OG1 1 
ATOM   696  C CG2 . THR A 1 105 ? -5.363  8.786   -39.579 1.00 122.94 ? 140 THR A CG2 1 
ATOM   697  N N   . GLN A 1 106 ? -6.865  6.085   -37.537 1.00 135.17 ? 141 GLN A N   1 
ATOM   698  C CA  . GLN A 1 106 ? -6.854  6.031   -36.087 1.00 135.17 ? 141 GLN A CA  1 
ATOM   699  C C   . GLN A 1 106 ? -6.306  4.697   -35.621 1.00 132.95 ? 141 GLN A C   1 
ATOM   700  O O   . GLN A 1 106 ? -5.365  4.647   -34.835 1.00 132.41 ? 141 GLN A O   1 
ATOM   701  C CB  . GLN A 1 106 ? -8.261  6.254   -35.545 1.00 136.90 ? 141 GLN A CB  1 
ATOM   702  C CG  . GLN A 1 106 ? -8.299  6.777   -34.125 1.00 138.20 ? 141 GLN A CG  1 
ATOM   703  C CD  . GLN A 1 106 ? -9.641  7.377   -33.779 1.00 140.70 ? 141 GLN A CD  1 
ATOM   704  O OE1 . GLN A 1 106 ? -10.131 8.265   -34.474 1.00 142.36 ? 141 GLN A OE1 1 
ATOM   705  N NE2 . GLN A 1 106 ? -10.253 6.886   -32.707 1.00 141.34 ? 141 GLN A NE2 1 
ATOM   706  N N   . THR A 1 107 ? -6.893  3.617   -36.122 1.00 106.03 ? 142 THR A N   1 
ATOM   707  C CA  . THR A 1 107 ? -6.408  2.275   -35.839 1.00 104.14 ? 142 THR A CA  1 
ATOM   708  C C   . THR A 1 107 ? -4.953  2.136   -36.261 1.00 102.75 ? 142 THR A C   1 
ATOM   709  O O   . THR A 1 107 ? -4.246  1.250   -35.797 1.00 101.50 ? 142 THR A O   1 
ATOM   710  C CB  . THR A 1 107 ? -7.202  1.236   -36.628 1.00 103.50 ? 142 THR A CB  1 
ATOM   711  O OG1 . THR A 1 107 ? -6.978  1.434   -38.032 1.00 103.25 ? 142 THR A OG1 1 
ATOM   712  C CG2 . THR A 1 107 ? -8.693  1.352   -36.317 1.00 105.19 ? 142 THR A CG2 1 
ATOM   713  N N   . THR A 1 108 ? -4.521  3.027   -37.147 1.00 111.88 ? 143 THR A N   1 
ATOM   714  C CA  . THR A 1 108 ? -3.198  2.972   -37.774 1.00 111.06 ? 143 THR A CA  1 
ATOM   715  C C   . THR A 1 108 ? -3.004  1.683   -38.570 1.00 109.44 ? 143 THR A C   1 
ATOM   716  O O   . THR A 1 108 ? -1.874  1.255   -38.800 1.00 108.52 ? 143 THR A O   1 
ATOM   717  C CB  . THR A 1 108 ? -2.030  3.146   -36.754 1.00 110.83 ? 143 THR A CB  1 
ATOM   718  O OG1 . THR A 1 108 ? -1.621  1.867   -36.252 1.00 109.25 ? 143 THR A OG1 1 
ATOM   719  C CG2 . THR A 1 108 ? -2.434  4.056   -35.609 1.00 112.34 ? 143 THR A CG2 1 
ATOM   720  N N   . ILE A 1 109 ? -4.105  1.075   -39.003 1.00 103.07 ? 144 ILE A N   1 
ATOM   721  C CA  . ILE A 1 109 ? -4.009  -0.052  -39.913 1.00 101.92 ? 144 ILE A CA  1 
ATOM   722  C C   . ILE A 1 109 ? -3.354  0.463   -41.175 1.00 102.52 ? 144 ILE A C   1 
ATOM   723  O O   . ILE A 1 109 ? -2.320  -0.045  -41.598 1.00 101.71 ? 144 ILE A O   1 
ATOM   724  C CB  . ILE A 1 109 ? -5.391  -0.626  -40.274 1.00 102.25 ? 144 ILE A CB  1 
ATOM   725  C CG1 . ILE A 1 109 ? -6.015  -1.314  -39.063 1.00 101.98 ? 144 ILE A CG1 1 
ATOM   726  C CG2 . ILE A 1 109 ? -5.280  -1.605  -41.437 1.00 101.52 ? 144 ILE A CG2 1 
ATOM   727  C CD1 . ILE A 1 109 ? -7.401  -1.844  -39.315 1.00 102.70 ? 144 ILE A CD1 1 
ATOM   728  N N   . GLY A 1 110 ? -3.960  1.490   -41.765 1.00 126.16 ? 145 GLY A N   1 
ATOM   729  C CA  . GLY A 1 110 ? -3.399  2.131   -42.936 1.00 127.47 ? 145 GLY A CA  1 
ATOM   730  C C   . GLY A 1 110 ? -3.173  1.213   -44.120 1.00 127.03 ? 145 GLY A C   1 
ATOM   731  O O   . GLY A 1 110 ? -2.043  1.073   -44.585 1.00 126.90 ? 145 GLY A O   1 
ATOM   732  N N   . TYR A 1 111 ? -4.232  0.565   -44.597 1.00 120.27 ? 146 TYR A N   1 
ATOM   733  C CA  . TYR A 1 111 ? -4.108  -0.271  -45.785 1.00 120.24 ? 146 TYR A CA  1 
ATOM   734  C C   . TYR A 1 111 ? -3.388  0.520   -46.857 1.00 122.16 ? 146 TYR A C   1 
ATOM   735  O O   . TYR A 1 111 ? -2.469  0.021   -47.501 1.00 121.99 ? 146 TYR A O   1 
ATOM   736  C CB  . TYR A 1 111 ? -5.469  -0.714  -46.302 1.00 120.91 ? 146 TYR A CB  1 
ATOM   737  C CG  . TYR A 1 111 ? -6.155  -1.706  -45.405 1.00 119.37 ? 146 TYR A CG  1 
ATOM   738  C CD1 . TYR A 1 111 ? -7.384  -1.422  -44.832 1.00 120.13 ? 146 TYR A CD1 1 
ATOM   739  C CD2 . TYR A 1 111 ? -5.571  -2.931  -45.129 1.00 117.53 ? 146 TYR A CD2 1 
ATOM   740  C CE1 . TYR A 1 111 ? -8.009  -2.334  -44.009 1.00 119.20 ? 146 TYR A CE1 1 
ATOM   741  C CE2 . TYR A 1 111 ? -6.188  -3.846  -44.310 1.00 116.59 ? 146 TYR A CE2 1 
ATOM   742  C CZ  . TYR A 1 111 ? -7.403  -3.546  -43.751 1.00 117.48 ? 146 TYR A CZ  1 
ATOM   743  O OH  . TYR A 1 111 ? -8.009  -4.471  -42.931 1.00 116.98 ? 146 TYR A OH  1 
ATOM   744  N N   . GLY A 1 112 ? -3.803  1.766   -47.040 1.00 122.05 ? 147 GLY A N   1 
ATOM   745  C CA  . GLY A 1 112 ? -3.124  2.643   -47.968 1.00 124.46 ? 147 GLY A CA  1 
ATOM   746  C C   . GLY A 1 112 ? -3.895  2.959   -49.230 1.00 127.13 ? 147 GLY A C   1 
ATOM   747  O O   . GLY A 1 112 ? -3.526  3.885   -49.944 1.00 129.87 ? 147 GLY A O   1 
ATOM   748  N N   . PHE A 1 113 ? -4.961  2.214   -49.515 1.00 109.76 ? 148 PHE A N   1 
ATOM   749  C CA  . PHE A 1 113 ? -5.770  2.526   -50.690 1.00 112.62 ? 148 PHE A CA  1 
ATOM   750  C C   . PHE A 1 113 ? -6.380  3.912   -50.555 1.00 115.18 ? 148 PHE A C   1 
ATOM   751  O O   . PHE A 1 113 ? -6.230  4.754   -51.441 1.00 118.35 ? 148 PHE A O   1 
ATOM   752  C CB  . PHE A 1 113 ? -6.862  1.489   -50.939 1.00 111.93 ? 148 PHE A CB  1 
ATOM   753  C CG  . PHE A 1 113 ? -7.629  1.736   -52.206 1.00 115.12 ? 148 PHE A CG  1 
ATOM   754  C CD1 . PHE A 1 113 ? -6.970  1.792   -53.422 1.00 117.23 ? 148 PHE A CD1 1 
ATOM   755  C CD2 . PHE A 1 113 ? -9.000  1.925   -52.183 1.00 116.40 ? 148 PHE A CD2 1 
ATOM   756  C CE1 . PHE A 1 113 ? -7.660  2.027   -54.592 1.00 120.59 ? 148 PHE A CE1 1 
ATOM   757  C CE2 . PHE A 1 113 ? -9.700  2.163   -53.355 1.00 119.68 ? 148 PHE A CE2 1 
ATOM   758  C CZ  . PHE A 1 113 ? -9.024  2.215   -54.562 1.00 121.80 ? 148 PHE A CZ  1 
ATOM   759  N N   . ARG A 1 114 ? -7.077  4.144   -49.448 1.00 132.45 ? 149 ARG A N   1 
ATOM   760  C CA  . ARG A 1 114 ? -7.426  5.499   -49.056 1.00 134.59 ? 149 ARG A CA  1 
ATOM   761  C C   . ARG A 1 114 ? -6.178  6.087   -48.410 1.00 133.96 ? 149 ARG A C   1 
ATOM   762  O O   . ARG A 1 114 ? -5.678  5.549   -47.422 1.00 131.18 ? 149 ARG A O   1 
ATOM   763  C CB  . ARG A 1 114 ? -8.580  5.494   -48.052 1.00 133.89 ? 149 ARG A CB  1 
ATOM   764  C CG  . ARG A 1 114 ? -9.976  5.418   -48.663 1.00 135.86 ? 149 ARG A CG  1 
ATOM   765  C CD  . ARG A 1 114 ? -10.303 4.022   -49.151 1.00 134.36 ? 149 ARG A CD  1 
ATOM   766  N NE  . ARG A 1 114 ? -10.451 3.065   -48.058 1.00 131.33 ? 149 ARG A NE  1 
ATOM   767  C CZ  . ARG A 1 114 ? -10.649 1.762   -48.237 1.00 129.74 ? 149 ARG A CZ  1 
ATOM   768  N NH1 . ARG A 1 114 ? -10.716 1.262   -49.464 1.00 130.73 ? 149 ARG A NH1 1 
ATOM   769  N NH2 . ARG A 1 114 ? -10.777 0.956   -47.195 1.00 127.47 ? 149 ARG A NH2 1 
ATOM   770  N N   . CYS A 1 115 ? -5.674  7.185   -48.962 1.00 125.58 ? 150 CYS A N   1 
ATOM   771  C CA  . CYS A 1 115 ? -4.384  7.719   -48.542 1.00 125.49 ? 150 CYS A CA  1 
ATOM   772  C C   . CYS A 1 115 ? -4.370  9.241   -48.565 1.00 128.95 ? 150 CYS A C   1 
ATOM   773  O O   . CYS A 1 115 ? -4.947  9.864   -49.454 1.00 132.25 ? 150 CYS A O   1 
ATOM   774  C CB  . CYS A 1 115 ? -3.280  7.175   -49.448 1.00 125.58 ? 150 CYS A CB  1 
ATOM   775  S SG  . CYS A 1 115 ? -1.609  7.770   -49.079 1.00 125.99 ? 150 CYS A SG  1 
ATOM   776  N N   . VAL A 1 116 ? -3.705  9.845   -47.587 1.00 121.42 ? 151 VAL A N   1 
ATOM   777  C CA  . VAL A 1 116 ? -3.625  11.298  -47.537 1.00 124.85 ? 151 VAL A CA  1 
ATOM   778  C C   . VAL A 1 116 ? -2.649  11.798  -48.582 1.00 127.82 ? 151 VAL A C   1 
ATOM   779  O O   . VAL A 1 116 ? -1.703  11.098  -48.947 1.00 126.63 ? 151 VAL A O   1 
ATOM   780  C CB  . VAL A 1 116 ? -3.153  11.805  -46.173 1.00 123.79 ? 151 VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 116 ? -3.575  13.251  -45.983 1.00 127.32 ? 151 VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 116 ? -3.723  10.948  -45.069 1.00 120.26 ? 151 VAL A CG2 1 
ATOM   783  N N   . THR A 1 117 ? -2.884  13.017  -49.055 1.00 122.73 ? 152 THR A N   1 
ATOM   784  C CA  . THR A 1 117 ? -1.975  13.674  -49.986 1.00 126.45 ? 152 THR A CA  1 
ATOM   785  C C   . THR A 1 117 ? -1.594  15.061  -49.462 1.00 129.37 ? 152 THR A C   1 
ATOM   786  O O   . THR A 1 117 ? -2.224  15.584  -48.543 1.00 129.01 ? 152 THR A O   1 
ATOM   787  C CB  . THR A 1 117 ? -2.575  13.764  -51.409 1.00 129.96 ? 152 THR A CB  1 
ATOM   788  O OG1 . THR A 1 117 ? -3.173  15.051  -51.606 1.00 134.32 ? 152 THR A OG1 1 
ATOM   789  C CG2 . THR A 1 117 ? -3.615  12.680  -51.612 1.00 127.44 ? 152 THR A CG2 1 
ATOM   790  N N   . GLU A 1 118 ? -0.573  15.654  -50.069 1.00 146.69 ? 153 GLU A N   1 
ATOM   791  C CA  . GLU A 1 118 ? 0.040   16.875  -49.557 1.00 149.46 ? 153 GLU A CA  1 
ATOM   792  C C   . GLU A 1 118 ? -0.750  18.112  -49.963 1.00 154.29 ? 153 GLU A C   1 
ATOM   793  O O   . GLU A 1 118 ? -0.314  19.244  -49.738 1.00 157.65 ? 153 GLU A O   1 
ATOM   794  C CB  . GLU A 1 118 ? 1.485   17.005  -50.034 1.00 151.41 ? 153 GLU A CB  1 
ATOM   795  C CG  . GLU A 1 118 ? 1.981   15.811  -50.820 1.00 149.69 ? 153 GLU A CG  1 
ATOM   796  C CD  . GLU A 1 118 ? 1.620   15.900  -52.289 1.00 153.57 ? 153 GLU A CD  1 
ATOM   797  O OE1 . GLU A 1 118 ? 1.765   16.999  -52.874 1.00 158.83 ? 153 GLU A OE1 1 
ATOM   798  O OE2 . GLU A 1 118 ? 1.185   14.874  -52.855 1.00 151.66 ? 153 GLU A OE2 1 
ATOM   799  N N   . GLU A 1 119 ? -1.907  17.892  -50.576 1.00 150.98 ? 154 GLU A N   1 
ATOM   800  C CA  . GLU A 1 119 ? -2.699  18.986  -51.124 1.00 156.02 ? 154 GLU A CA  1 
ATOM   801  C C   . GLU A 1 119 ? -3.339  19.843  -50.033 1.00 156.33 ? 154 GLU A C   1 
ATOM   802  O O   . GLU A 1 119 ? -2.962  20.996  -49.849 1.00 159.93 ? 154 GLU A O   1 
ATOM   803  C CB  . GLU A 1 119 ? -3.787  18.432  -52.048 1.00 156.58 ? 154 GLU A CB  1 
ATOM   804  C CG  . GLU A 1 119 ? -4.587  19.497  -52.781 1.00 162.36 ? 154 GLU A CG  1 
ATOM   805  C CD  . GLU A 1 119 ? -3.841  20.073  -53.971 1.00 167.74 ? 154 GLU A CD  1 
ATOM   806  O OE1 . GLU A 1 119 ? -2.658  19.715  -54.163 1.00 167.00 ? 154 GLU A OE1 1 
ATOM   807  O OE2 . GLU A 1 119 ? -4.440  20.877  -54.719 1.00 173.03 ? 154 GLU A OE2 1 
ATOM   808  N N   . CYS A 1 120 ? -4.294  19.283  -49.300 1.00 167.01 ? 155 CYS A N   1 
ATOM   809  C CA  . CYS A 1 120 ? -5.029  20.072  -48.317 1.00 167.71 ? 155 CYS A CA  1 
ATOM   810  C C   . CYS A 1 120 ? -4.350  20.103  -46.952 1.00 164.82 ? 155 CYS A C   1 
ATOM   811  O O   . CYS A 1 120 ? -4.215  19.067  -46.301 1.00 160.13 ? 155 CYS A O   1 
ATOM   812  C CB  . CYS A 1 120 ? -6.458  19.549  -48.175 1.00 166.17 ? 155 CYS A CB  1 
ATOM   813  S SG  . CYS A 1 120 ? -7.396  19.556  -49.713 1.00 169.99 ? 155 CYS A SG  1 
ATOM   814  N N   . PRO A 1 121 ? -3.925  21.298  -46.510 1.00 134.95 ? 156 PRO A N   1 
ATOM   815  C CA  . PRO A 1 121 ? -3.387  21.423  -45.154 1.00 132.74 ? 156 PRO A CA  1 
ATOM   816  C C   . PRO A 1 121 ? -4.443  20.991  -44.143 1.00 129.81 ? 156 PRO A C   1 
ATOM   817  O O   . PRO A 1 121 ? -4.152  20.219  -43.223 1.00 125.77 ? 156 PRO A O   1 
ATOM   818  C CB  . PRO A 1 121 ? -3.119  22.925  -45.023 1.00 137.74 ? 156 PRO A CB  1 
ATOM   819  C CG  . PRO A 1 121 ? -2.960  23.408  -46.423 1.00 142.20 ? 156 PRO A CG  1 
ATOM   820  C CD  . PRO A 1 121 ? -3.902  22.579  -47.236 1.00 140.98 ? 156 PRO A CD  1 
ATOM   821  N N   . LEU A 1 122 ? -5.669  21.470  -44.336 1.00 145.34 ? 157 LEU A N   1 
ATOM   822  C CA  . LEU A 1 122 ? -6.760  21.151  -43.428 1.00 143.39 ? 157 LEU A CA  1 
ATOM   823  C C   . LEU A 1 122 ? -6.799  19.647  -43.184 1.00 138.21 ? 157 LEU A C   1 
ATOM   824  O O   . LEU A 1 122 ? -6.872  19.200  -42.040 1.00 135.39 ? 157 LEU A O   1 
ATOM   825  C CB  . LEU A 1 122 ? -8.094  21.647  -43.988 1.00 146.71 ? 157 LEU A CB  1 
ATOM   826  C CG  . LEU A 1 122 ? -9.299  21.599  -43.039 1.00 146.05 ? 157 LEU A CG  1 
ATOM   827  C CD1 . LEU A 1 122 ? -9.000  22.340  -41.745 1.00 146.56 ? 157 LEU A CD1 1 
ATOM   828  C CD2 . LEU A 1 122 ? -10.534 22.173  -43.712 1.00 150.00 ? 157 LEU A CD2 1 
ATOM   829  N N   . ALA A 1 123 ? -6.720  18.873  -44.263 1.00 140.40 ? 158 ALA A N   1 
ATOM   830  C CA  . ALA A 1 123 ? -6.732  17.419  -44.165 1.00 135.84 ? 158 ALA A CA  1 
ATOM   831  C C   . ALA A 1 123 ? -5.535  16.895  -43.372 1.00 132.60 ? 158 ALA A C   1 
ATOM   832  O O   . ALA A 1 123 ? -5.693  16.061  -42.480 1.00 129.22 ? 158 ALA A O   1 
ATOM   833  C CB  . ALA A 1 123 ? -6.775  16.792  -45.551 1.00 136.10 ? 158 ALA A CB  1 
ATOM   834  N N   . VAL A 1 124 ? -4.341  17.386  -43.694 1.00 123.39 ? 159 VAL A N   1 
ATOM   835  C CA  . VAL A 1 124 ? -3.130  16.959  -43.002 1.00 120.85 ? 159 VAL A CA  1 
ATOM   836  C C   . VAL A 1 124 ? -3.260  17.222  -41.510 1.00 119.84 ? 159 VAL A C   1 
ATOM   837  O O   . VAL A 1 124 ? -3.014  16.341  -40.687 1.00 116.44 ? 159 VAL A O   1 
ATOM   838  C CB  . VAL A 1 124 ? -1.886  17.705  -43.518 1.00 123.57 ? 159 VAL A CB  1 
ATOM   839  C CG1 . VAL A 1 124 ? -0.628  17.108  -42.911 1.00 120.91 ? 159 VAL A CG1 1 
ATOM   840  C CG2 . VAL A 1 124 ? -1.822  17.658  -45.033 1.00 125.76 ? 159 VAL A CG2 1 
ATOM   841  N N   . PHE A 1 125 ? -3.641  18.447  -41.170 1.00 137.51 ? 160 PHE A N   1 
ATOM   842  C CA  . PHE A 1 125 ? -3.843  18.821  -39.782 1.00 137.27 ? 160 PHE A CA  1 
ATOM   843  C C   . PHE A 1 125 ? -4.863  17.893  -39.138 1.00 134.46 ? 160 PHE A C   1 
ATOM   844  O O   . PHE A 1 125 ? -4.753  17.547  -37.962 1.00 132.63 ? 160 PHE A O   1 
ATOM   845  C CB  . PHE A 1 125 ? -4.319  20.269  -39.693 1.00 141.74 ? 160 PHE A CB  1 
ATOM   846  C CG  . PHE A 1 125 ? -4.836  20.658  -38.337 1.00 141.97 ? 160 PHE A CG  1 
ATOM   847  C CD1 . PHE A 1 125 ? -3.961  20.891  -37.288 1.00 141.57 ? 160 PHE A CD1 1 
ATOM   848  C CD2 . PHE A 1 125 ? -6.198  20.796  -38.111 1.00 142.94 ? 160 PHE A CD2 1 
ATOM   849  C CE1 . PHE A 1 125 ? -4.433  21.253  -36.040 1.00 142.15 ? 160 PHE A CE1 1 
ATOM   850  C CE2 . PHE A 1 125 ? -6.674  21.159  -36.866 1.00 143.55 ? 160 PHE A CE2 1 
ATOM   851  C CZ  . PHE A 1 125 ? -5.791  21.388  -35.830 1.00 143.17 ? 160 PHE A CZ  1 
ATOM   852  N N   . MET A 1 126 ? -5.853  17.483  -39.920 1.00 137.28 ? 161 MET A N   1 
ATOM   853  C CA  . MET A 1 126 ? -6.916  16.633  -39.408 1.00 135.20 ? 161 MET A CA  1 
ATOM   854  C C   . MET A 1 126 ? -6.382  15.251  -39.066 1.00 131.00 ? 161 MET A C   1 
ATOM   855  O O   . MET A 1 126 ? -6.750  14.668  -38.050 1.00 129.25 ? 161 MET A O   1 
ATOM   856  C CB  . MET A 1 126 ? -8.047  16.525  -40.427 1.00 136.54 ? 161 MET A CB  1 
ATOM   857  C CG  . MET A 1 126 ? -9.411  16.341  -39.797 1.00 136.73 ? 161 MET A CG  1 
ATOM   858  S SD  . MET A 1 126 ? -9.812  17.666  -38.630 1.00 139.90 ? 161 MET A SD  1 
ATOM   859  C CE  . MET A 1 126 ? -9.731  19.113  -39.689 1.00 144.66 ? 161 MET A CE  1 
ATOM   860  N N   . VAL A 1 127 ? -5.519  14.725  -39.924 1.00 135.03 ? 162 VAL A N   1 
ATOM   861  C CA  . VAL A 1 127 ? -4.859  13.458  -39.650 1.00 131.37 ? 162 VAL A CA  1 
ATOM   862  C C   . VAL A 1 127 ? -4.022  13.605  -38.390 1.00 130.58 ? 162 VAL A C   1 
ATOM   863  O O   . VAL A 1 127 ? -4.121  12.806  -37.463 1.00 128.37 ? 162 VAL A O   1 
ATOM   864  C CB  . VAL A 1 127 ? -3.936  13.047  -40.805 1.00 130.84 ? 162 VAL A CB  1 
ATOM   865  C CG1 . VAL A 1 127 ? -3.091  11.849  -40.400 1.00 127.41 ? 162 VAL A CG1 1 
ATOM   866  C CG2 . VAL A 1 127 ? -4.751  12.750  -42.056 1.00 131.60 ? 162 VAL A CG2 1 
ATOM   867  N N   . VAL A 1 128 ? -3.201  14.645  -38.367 1.00 124.69 ? 163 VAL A N   1 
ATOM   868  C CA  . VAL A 1 128 ? -2.385  14.947  -37.208 1.00 124.60 ? 163 VAL A CA  1 
ATOM   869  C C   . VAL A 1 128 ? -3.236  14.925  -35.944 1.00 124.40 ? 163 VAL A C   1 
ATOM   870  O O   . VAL A 1 128 ? -2.872  14.293  -34.954 1.00 122.61 ? 163 VAL A O   1 
ATOM   871  C CB  . VAL A 1 128 ? -1.718  16.320  -37.354 1.00 128.00 ? 163 VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 128 ? -1.019  16.704  -36.071 1.00 128.31 ? 163 VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 128 ? -0.737  16.306  -38.514 1.00 128.54 ? 163 VAL A CG2 1 
ATOM   874  N N   . VAL A 1 129 ? -4.375  15.609  -35.986 1.00 120.73 ? 164 VAL A N   1 
ATOM   875  C CA  . VAL A 1 129 ? -5.290  15.637  -34.851 1.00 121.12 ? 164 VAL A CA  1 
ATOM   876  C C   . VAL A 1 129 ? -5.820  14.252  -34.514 1.00 118.22 ? 164 VAL A C   1 
ATOM   877  O O   . VAL A 1 129 ? -5.837  13.852  -33.351 1.00 117.49 ? 164 VAL A O   1 
ATOM   878  C CB  . VAL A 1 129 ? -6.499  16.555  -35.102 1.00 124.22 ? 164 VAL A CB  1 
ATOM   879  C CG1 . VAL A 1 129 ? -7.539  16.360  -34.009 1.00 124.51 ? 164 VAL A CG1 1 
ATOM   880  C CG2 . VAL A 1 129 ? -6.060  18.004  -35.182 1.00 127.67 ? 164 VAL A CG2 1 
ATOM   881  N N   . GLN A 1 130 ? -6.263  13.525  -35.534 1.00 132.09 ? 165 GLN A N   1 
ATOM   882  C CA  . GLN A 1 130 ? -6.879  12.224  -35.319 1.00 129.76 ? 165 GLN A CA  1 
ATOM   883  C C   . GLN A 1 130 ? -5.889  11.231  -34.728 1.00 127.05 ? 165 GLN A C   1 
ATOM   884  O O   . GLN A 1 130 ? -6.272  10.328  -33.990 1.00 125.77 ? 165 GLN A O   1 
ATOM   885  C CB  . GLN A 1 130 ? -7.465  11.675  -36.617 1.00 129.18 ? 165 GLN A CB  1 
ATOM   886  C CG  . GLN A 1 130 ? -8.079  10.297  -36.459 1.00 126.96 ? 165 GLN A CG  1 
ATOM   887  C CD  . GLN A 1 130 ? -8.829  9.832   -37.692 1.00 126.92 ? 165 GLN A CD  1 
ATOM   888  O OE1 . GLN A 1 130 ? -8.361  9.991   -38.822 1.00 127.09 ? 165 GLN A OE1 1 
ATOM   889  N NE2 . GLN A 1 130 ? -10.005 9.254   -37.479 1.00 127.03 ? 165 GLN A NE2 1 
ATOM   890  N N   . SER A 1 131 ? -4.615  11.406  -35.056 1.00 132.86 ? 166 SER A N   1 
ATOM   891  C CA  . SER A 1 131 ? -3.573  10.515  -34.566 1.00 130.61 ? 166 SER A CA  1 
ATOM   892  C C   . SER A 1 131 ? -3.395  10.670  -33.066 1.00 131.16 ? 166 SER A C   1 
ATOM   893  O O   . SER A 1 131 ? -3.362  9.688   -32.323 1.00 129.68 ? 166 SER A O   1 
ATOM   894  C CB  . SER A 1 131 ? -2.249  10.796  -35.275 1.00 130.55 ? 166 SER A CB  1 
ATOM   895  O OG  . SER A 1 131 ? -2.358  10.572  -36.669 1.00 130.27 ? 166 SER A OG  1 
ATOM   896  N N   . ILE A 1 132 ? -3.274  11.912  -32.622 1.00 120.08 ? 167 ILE A N   1 
ATOM   897  C CA  . ILE A 1 132 ? -3.121  12.183  -31.204 1.00 121.15 ? 167 ILE A CA  1 
ATOM   898  C C   . ILE A 1 132 ? -4.366  11.743  -30.431 1.00 121.49 ? 167 ILE A C   1 
ATOM   899  O O   . ILE A 1 132 ? -4.262  11.043  -29.420 1.00 120.93 ? 167 ILE A O   1 
ATOM   900  C CB  . ILE A 1 132 ? -2.802  13.660  -30.948 1.00 124.10 ? 167 ILE A CB  1 
ATOM   901  C CG1 . ILE A 1 132 ? -1.405  13.985  -31.486 1.00 124.02 ? 167 ILE A CG1 1 
ATOM   902  C CG2 . ILE A 1 132 ? -2.897  13.971  -29.461 1.00 125.67 ? 167 ILE A CG2 1 
ATOM   903  C CD1 . ILE A 1 132 ? -1.054  15.459  -31.466 1.00 127.22 ? 167 ILE A CD1 1 
ATOM   904  N N   . VAL A 1 133 ? -5.539  12.135  -30.919 1.00 124.12 ? 168 VAL A N   1 
ATOM   905  C CA  . VAL A 1 133 ? -6.796  11.703  -30.316 1.00 124.75 ? 168 VAL A CA  1 
ATOM   906  C C   . VAL A 1 133 ? -6.827  10.191  -30.122 1.00 122.30 ? 168 VAL A C   1 
ATOM   907  O O   . VAL A 1 133 ? -7.087  9.702   -29.021 1.00 122.77 ? 168 VAL A O   1 
ATOM   908  C CB  . VAL A 1 133 ? -8.004  12.098  -31.181 1.00 126.03 ? 168 VAL A CB  1 
ATOM   909  C CG1 . VAL A 1 133 ? -9.208  11.239  -30.833 1.00 125.97 ? 168 VAL A CG1 1 
ATOM   910  C CG2 . VAL A 1 133 ? -8.318  13.570  -31.006 1.00 129.33 ? 168 VAL A CG2 1 
ATOM   911  N N   . GLY A 1 134 ? -6.558  9.460   -31.200 1.00 129.68 ? 169 GLY A N   1 
ATOM   912  C CA  . GLY A 1 134 ? -6.580  8.010   -31.171 1.00 127.47 ? 169 GLY A CA  1 
ATOM   913  C C   . GLY A 1 134 ? -5.666  7.438   -30.108 1.00 126.76 ? 169 GLY A C   1 
ATOM   914  O O   . GLY A 1 134 ? -6.042  6.510   -29.393 1.00 126.56 ? 169 GLY A O   1 
ATOM   915  N N   . CYS A 1 135 ? -4.466  8.000   -30.002 1.00 151.69 ? 170 CYS A N   1 
ATOM   916  C CA  . CYS A 1 135 ? -3.491  7.536   -29.026 1.00 151.33 ? 170 CYS A CA  1 
ATOM   917  C C   . CYS A 1 135 ? -3.995  7.751   -27.605 1.00 153.54 ? 170 CYS A C   1 
ATOM   918  O O   . CYS A 1 135 ? -4.041  6.825   -26.798 1.00 153.45 ? 170 CYS A O   1 
ATOM   919  C CB  . CYS A 1 135 ? -2.149  8.242   -29.217 1.00 151.41 ? 170 CYS A CB  1 
ATOM   920  S SG  . CYS A 1 135 ? -0.881  7.681   -28.047 1.00 151.28 ? 170 CYS A SG  1 
ATOM   921  N N   . ILE A 1 136 ? -4.372  8.983   -27.305 1.00 134.00 ? 171 ILE A N   1 
ATOM   922  C CA  . ILE A 1 136 ? -4.937  9.308   -26.008 1.00 136.60 ? 171 ILE A CA  1 
ATOM   923  C C   . ILE A 1 136 ? -6.050  8.343   -25.639 1.00 136.79 ? 171 ILE A C   1 
ATOM   924  O O   . ILE A 1 136 ? -6.101  7.835   -24.520 1.00 137.99 ? 171 ILE A O   1 
ATOM   925  C CB  . ILE A 1 136 ? -5.508  10.731  -26.008 1.00 139.19 ? 171 ILE A CB  1 
ATOM   926  C CG1 . ILE A 1 136 ? -4.384  11.743  -26.242 1.00 139.64 ? 171 ILE A CG1 1 
ATOM   927  C CG2 . ILE A 1 136 ? -6.258  11.004  -24.711 1.00 142.16 ? 171 ILE A CG2 1 
ATOM   928  C CD1 . ILE A 1 136 ? -4.863  13.165  -26.403 1.00 142.29 ? 171 ILE A CD1 1 
ATOM   929  N N   . ILE A 1 137 ? -6.940  8.087   -26.588 1.00 149.05 ? 172 ILE A N   1 
ATOM   930  C CA  . ILE A 1 137 ? -8.116  7.270   -26.318 1.00 149.69 ? 172 ILE A CA  1 
ATOM   931  C C   . ILE A 1 137 ? -7.760  5.890   -25.767 1.00 148.61 ? 172 ILE A C   1 
ATOM   932  O O   . ILE A 1 137 ? -8.187  5.523   -24.671 1.00 150.62 ? 172 ILE A O   1 
ATOM   933  C CB  . ILE A 1 137 ? -9.008  7.135   -27.566 1.00 148.80 ? 172 ILE A CB  1 
ATOM   934  C CG1 . ILE A 1 137 ? -9.648  8.485   -27.902 1.00 150.90 ? 172 ILE A CG1 1 
ATOM   935  C CG2 . ILE A 1 137 ? -10.080 6.077   -27.347 1.00 149.24 ? 172 ILE A CG2 1 
ATOM   936  C CD1 . ILE A 1 137 ? -10.555 8.452   -29.117 1.00 150.59 ? 172 ILE A CD1 1 
ATOM   937  N N   . ASP A 1 138 ? -6.966  5.130   -26.512 1.00 157.80 ? 173 ASP A N   1 
ATOM   938  C CA  . ASP A 1 138 ? -6.619  3.784   -26.070 1.00 156.90 ? 173 ASP A CA  1 
ATOM   939  C C   . ASP A 1 138 ? -5.615  3.810   -24.927 1.00 157.89 ? 173 ASP A C   1 
ATOM   940  O O   . ASP A 1 138 ? -5.496  2.843   -24.179 1.00 158.45 ? 173 ASP A O   1 
ATOM   941  C CB  . ASP A 1 138 ? -6.114  2.923   -27.232 1.00 153.85 ? 173 ASP A CB  1 
ATOM   942  C CG  . ASP A 1 138 ? -4.855  3.473   -27.863 1.00 152.30 ? 173 ASP A CG  1 
ATOM   943  O OD1 . ASP A 1 138 ? -4.460  4.604   -27.511 1.00 153.55 ? 173 ASP A OD1 1 
ATOM   944  O OD2 . ASP A 1 138 ? -4.264  2.777   -28.719 1.00 150.08 ? 173 ASP A OD2 1 
ATOM   945  N N   . SER A 1 139 ? -4.891  4.915   -24.795 1.00 147.56 ? 174 SER A N   1 
ATOM   946  C CA  . SER A 1 139 ? -4.042  5.103   -23.628 1.00 149.15 ? 174 SER A CA  1 
ATOM   947  C C   . SER A 1 139 ? -4.931  5.025   -22.401 1.00 152.27 ? 174 SER A C   1 
ATOM   948  O O   . SER A 1 139 ? -4.616  4.342   -21.431 1.00 153.53 ? 174 SER A O   1 
ATOM   949  C CB  . SER A 1 139 ? -3.328  6.454   -23.668 1.00 149.86 ? 174 SER A CB  1 
ATOM   950  O OG  . SER A 1 139 ? -2.382  6.514   -24.722 1.00 147.48 ? 174 SER A OG  1 
ATOM   951  N N   . PHE A 1 140 ? -6.057  5.725   -22.462 1.00 147.19 ? 175 PHE A N   1 
ATOM   952  C CA  . PHE A 1 140 ? -7.025  5.710   -21.378 1.00 150.54 ? 175 PHE A CA  1 
ATOM   953  C C   . PHE A 1 140 ? -7.651  4.338   -21.220 1.00 150.58 ? 175 PHE A C   1 
ATOM   954  O O   . PHE A 1 140 ? -7.954  3.904   -20.111 1.00 153.34 ? 175 PHE A O   1 
ATOM   955  C CB  . PHE A 1 140 ? -8.107  6.758   -21.622 1.00 152.23 ? 175 PHE A CB  1 
ATOM   956  C CG  . PHE A 1 140 ? -7.754  8.112   -21.092 1.00 154.33 ? 175 PHE A CG  1 
ATOM   957  C CD1 . PHE A 1 140 ? -6.676  8.812   -21.607 1.00 152.80 ? 175 PHE A CD1 1 
ATOM   958  C CD2 . PHE A 1 140 ? -8.492  8.682   -20.068 1.00 158.16 ? 175 PHE A CD2 1 
ATOM   959  C CE1 . PHE A 1 140 ? -6.342  10.059  -21.112 1.00 155.01 ? 175 PHE A CE1 1 
ATOM   960  C CE2 . PHE A 1 140 ? -8.166  9.930   -19.570 1.00 160.33 ? 175 PHE A CE2 1 
ATOM   961  C CZ  . PHE A 1 140 ? -7.089  10.620  -20.093 1.00 158.72 ? 175 PHE A CZ  1 
ATOM   962  N N   . MET A 1 141 ? -7.842  3.654   -22.337 1.00 168.99 ? 176 MET A N   1 
ATOM   963  C CA  . MET A 1 141 ? -8.407  2.319   -22.304 1.00 168.97 ? 176 MET A CA  1 
ATOM   964  C C   . MET A 1 141 ? -7.550  1.395   -21.452 1.00 169.45 ? 176 MET A C   1 
ATOM   965  O O   . MET A 1 141 ? -8.061  0.510   -20.774 1.00 171.47 ? 176 MET A O   1 
ATOM   966  C CB  . MET A 1 141 ? -8.535  1.778   -23.720 1.00 165.77 ? 176 MET A CB  1 
ATOM   967  C CG  . MET A 1 141 ? -9.109  0.389   -23.805 1.00 165.71 ? 176 MET A CG  1 
ATOM   968  S SD  . MET A 1 141 ? -9.673  0.052   -25.480 1.00 162.93 ? 176 MET A SD  1 
ATOM   969  C CE  . MET A 1 141 ? -9.714  -1.740  -25.467 1.00 162.44 ? 176 MET A CE  1 
ATOM   970  N N   . ILE A 1 142 ? -6.243  1.614   -21.483 1.00 162.36 ? 177 ILE A N   1 
ATOM   971  C CA  . ILE A 1 142 ? -5.325  0.803   -20.697 1.00 162.98 ? 177 ILE A CA  1 
ATOM   972  C C   . ILE A 1 142 ? -5.391  1.183   -19.220 1.00 166.99 ? 177 ILE A C   1 
ATOM   973  O O   . ILE A 1 142 ? -5.150  0.354   -18.342 1.00 168.95 ? 177 ILE A O   1 
ATOM   974  C CB  . ILE A 1 142 ? -3.884  0.919   -21.228 1.00 160.36 ? 177 ILE A CB  1 
ATOM   975  C CG1 . ILE A 1 142 ? -3.810  0.350   -22.646 1.00 156.82 ? 177 ILE A CG1 1 
ATOM   976  C CG2 . ILE A 1 142 ? -2.916  0.177   -20.323 1.00 161.53 ? 177 ILE A CG2 1 
ATOM   977  C CD1 . ILE A 1 142 ? -2.461  0.506   -23.309 1.00 154.43 ? 177 ILE A CD1 1 
ATOM   978  N N   . GLY A 1 143 ? -5.736  2.436   -18.949 1.00 169.28 ? 178 GLY A N   1 
ATOM   979  C CA  . GLY A 1 143 ? -5.878  2.899   -17.582 1.00 173.41 ? 178 GLY A CA  1 
ATOM   980  C C   . GLY A 1 143 ? -7.142  2.370   -16.927 1.00 176.63 ? 178 GLY A C   1 
ATOM   981  O O   . GLY A 1 143 ? -7.133  1.973   -15.761 1.00 180.09 ? 178 GLY A O   1 
ATOM   982  N N   . ALA A 1 144 ? -8.237  2.366   -17.682 1.00 182.24 ? 179 ALA A N   1 
ATOM   983  C CA  . ALA A 1 144 ? -9.503  1.847   -17.181 1.00 185.37 ? 179 ALA A CA  1 
ATOM   984  C C   . ALA A 1 144 ? -9.416  0.339   -16.961 1.00 185.65 ? 179 ALA A C   1 
ATOM   985  O O   . ALA A 1 144 ? -9.985  -0.195  -16.007 1.00 189.54 ? 179 ALA A O   1 
ATOM   986  C CB  . ALA A 1 144 ? -10.635 2.186   -18.134 1.00 184.42 ? 179 ALA A CB  1 
ATOM   987  N N   . ILE A 1 145 ? -8.690  -0.342  -17.840 1.00 159.23 ? 180 ILE A N   1 
ATOM   988  C CA  . ILE A 1 145 ? -8.497  -1.779  -17.706 1.00 159.36 ? 180 ILE A CA  1 
ATOM   989  C C   . ILE A 1 145 ? -7.347  -2.017  -16.736 1.00 160.84 ? 180 ILE A C   1 
ATOM   990  O O   . ILE A 1 145 ? -6.929  -3.149  -16.502 1.00 161.26 ? 180 ILE A O   1 
ATOM   991  C CB  . ILE A 1 145 ? -8.221  -2.454  -19.062 1.00 154.98 ? 180 ILE A CB  1 
ATOM   992  C CG1 . ILE A 1 145 ? -9.307  -2.083  -20.074 1.00 153.63 ? 180 ILE A CG1 1 
ATOM   993  C CG2 . ILE A 1 145 ? -8.172  -3.961  -18.910 1.00 155.61 ? 180 ILE A CG2 1 
ATOM   994  C CD1 . ILE A 1 145 ? -9.160  -2.776  -21.420 1.00 149.82 ? 180 ILE A CD1 1 
ATOM   995  N N   . MET A 1 146 ? -6.822  -0.924  -16.196 1.00 196.03 ? 181 MET A N   1 
ATOM   996  C CA  . MET A 1 146 ? -5.882  -0.987  -15.088 1.00 198.51 ? 181 MET A CA  1 
ATOM   997  C C   . MET A 1 146 ? -6.665  -0.893  -13.782 1.00 203.99 ? 181 MET A C   1 
ATOM   998  O O   . MET A 1 146 ? -6.632  -1.808  -12.958 1.00 207.11 ? 181 MET A O   1 
ATOM   999  C CB  . MET A 1 146 ? -4.842  0.129   -15.184 1.00 196.99 ? 181 MET A CB  1 
ATOM   1000 C CG  . MET A 1 146 ? -3.483  -0.241  -14.602 1.00 197.52 ? 181 MET A CG  1 
ATOM   1001 S SD  . MET A 1 146 ? -2.810  -1.763  -15.315 1.00 194.61 ? 181 MET A SD  1 
ATOM   1002 C CE  . MET A 1 146 ? -3.391  -2.997  -14.150 1.00 199.38 ? 181 MET A CE  1 
ATOM   1003 N N   . ALA A 1 147 ? -7.359  0.227   -13.599 1.00 172.08 ? 182 ALA A N   1 
ATOM   1004 C CA  . ALA A 1 147 ? -8.221  0.423   -12.437 1.00 177.51 ? 182 ALA A CA  1 
ATOM   1005 C C   . ALA A 1 147 ? -9.107  -0.796  -12.209 1.00 179.89 ? 182 ALA A C   1 
ATOM   1006 O O   . ALA A 1 147 ? -8.977  -1.492  -11.202 1.00 183.78 ? 182 ALA A O   1 
ATOM   1007 C CB  . ALA A 1 147 ? -9.075  1.675   -12.609 1.00 178.17 ? 182 ALA A CB  1 
ATOM   1008 N N   . LYS A 1 148 ? -9.997  -1.058  -13.158 1.00 183.02 ? 183 LYS A N   1 
ATOM   1009 C CA  . LYS A 1 148 ? -10.920 -2.172  -13.034 1.00 185.36 ? 183 LYS A CA  1 
ATOM   1010 C C   . LYS A 1 148 ? -10.175 -3.502  -12.901 1.00 185.10 ? 183 LYS A C   1 
ATOM   1011 O O   . LYS A 1 148 ? -10.761 -4.502  -12.494 1.00 188.23 ? 183 LYS A O   1 
ATOM   1012 C CB  . LYS A 1 148 ? -11.896 -2.201  -14.218 1.00 182.73 ? 183 LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 148 ? -12.923 -3.329  -14.184 1.00 185.21 ? 183 LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 148 ? -12.500 -4.485  -15.079 1.00 181.64 ? 183 LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 148 ? -13.594 -5.531  -15.188 1.00 183.97 ? 183 LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 148 ? -13.234 -6.588  -16.168 1.00 180.38 ? 183 LYS A NZ  1 
ATOM   1017 N N   . MET A 1 149 ? -8.883  -3.513  -13.224 1.00 204.13 ? 184 MET A N   1 
ATOM   1018 C CA  . MET A 1 149 ? -8.112  -4.752  -13.144 1.00 203.87 ? 184 MET A CA  1 
ATOM   1019 C C   . MET A 1 149 ? -7.690  -5.081  -11.722 1.00 209.01 ? 184 MET A C   1 
ATOM   1020 O O   . MET A 1 149 ? -8.164  -6.076  -11.156 1.00 212.75 ? 184 MET A O   1 
ATOM   1021 C CB  . MET A 1 149 ? -6.900  -4.743  -14.061 1.00 198.69 ? 184 MET A CB  1 
ATOM   1022 C CG  . MET A 1 149 ? -6.265  -6.112  -14.192 1.00 198.15 ? 184 MET A CG  1 
ATOM   1023 S SD  . MET A 1 149 ? -5.574  -6.442  -15.822 1.00 191.64 ? 184 MET A SD  1 
ATOM   1024 C CE  . MET A 1 149 ? -7.044  -6.554  -16.845 1.00 190.09 ? 184 MET A CE  1 
ATOM   1025 N N   . ALA A 1 150 ? -6.788  -4.298  -11.133 1.00 213.98 ? 185 ALA A N   1 
ATOM   1026 C CA  . ALA A 1 150 ? -6.618  -4.460  -9.695  1.00 219.82 ? 185 ALA A CA  1 
ATOM   1027 C C   . ALA A 1 150 ? -7.160  -3.240  -8.941  1.00 223.09 ? 185 ALA A C   1 
ATOM   1028 O O   . ALA A 1 150 ? -6.489  -2.219  -8.763  1.00 222.37 ? 185 ALA A O   1 
ATOM   1029 C CB  . ALA A 1 150 ? -5.133  -4.666  -9.352  1.00 219.43 ? 185 ALA A CB  1 
ATOM   1030 N N   . ARG A 1 151 ? -8.408  -3.365  -8.518  1.00 267.14 ? 186 ARG A N   1 
ATOM   1031 C CA  . ARG A 1 151 ? -9.017  -2.586  -7.461  1.00 272.41 ? 186 ARG A CA  1 
ATOM   1032 C C   . ARG A 1 151 ? -10.175 -3.445  -6.956  1.00 277.31 ? 186 ARG A C   1 
ATOM   1033 O O   . ARG A 1 151 ? -11.334 -3.095  -7.168  1.00 278.25 ? 186 ARG A O   1 
ATOM   1034 C CB  . ARG A 1 151 ? -9.501  -1.236  -7.992  1.00 270.17 ? 186 ARG A CB  1 
ATOM   1035 C CG  . ARG A 1 151 ? -9.942  -0.248  -6.914  1.00 275.38 ? 186 ARG A CG  1 
ATOM   1036 C CD  . ARG A 1 151 ? -8.870  0.797   -6.568  1.00 274.79 ? 186 ARG A CD  1 
ATOM   1037 N NE  . ARG A 1 151 ? -7.799  0.269   -5.724  1.00 277.10 ? 186 ARG A NE  1 
ATOM   1038 C CZ  . ARG A 1 151 ? -7.991  -0.288  -4.531  1.00 283.29 ? 186 ARG A CZ  1 
ATOM   1039 N NH1 . ARG A 1 151 ? -9.220  -0.397  -4.042  1.00 287.79 ? 186 ARG A NH1 1 
ATOM   1040 N NH2 . ARG A 1 151 ? -6.957  -0.740  -3.831  1.00 285.31 ? 186 ARG A NH2 1 
ATOM   1041 N N   . PRO A 1 152 ? -9.884  -4.580  -6.311  1.00 292.02 ? 187 PRO A N   1 
ATOM   1042 C CA  . PRO A 1 152 ? -10.976 -5.557  -6.197  1.00 295.48 ? 187 PRO A CA  1 
ATOM   1043 C C   . PRO A 1 152 ? -12.137 -5.187  -5.262  1.00 302.07 ? 187 PRO A C   1 
ATOM   1044 O O   . PRO A 1 152 ? -12.114 -4.165  -4.567  1.00 304.58 ? 187 PRO A O   1 
ATOM   1045 C CB  . PRO A 1 152 ? -10.259 -6.812  -5.680  1.00 297.94 ? 187 PRO A CB  1 
ATOM   1046 C CG  . PRO A 1 152 ? -9.097  -6.270  -4.879  1.00 299.26 ? 187 PRO A CG  1 
ATOM   1047 C CD  . PRO A 1 152 ? -8.658  -5.008  -5.612  1.00 293.62 ? 187 PRO A CD  1 
ATOM   1048 N N   . LYS A 1 153 ? -13.145 -6.058  -5.270  1.00 301.19 ? 188 LYS A N   1 
ATOM   1049 C CA  . LYS A 1 153 ? -14.261 -6.050  -4.332  1.00 308.50 ? 188 LYS A CA  1 
ATOM   1050 C C   . LYS A 1 153 ? -14.528 -7.530  -4.120  1.00 311.99 ? 188 LYS A C   1 
ATOM   1051 O O   . LYS A 1 153 ? -14.276 -8.331  -5.021  1.00 307.70 ? 188 LYS A O   1 
ATOM   1052 C CB  . LYS A 1 153 ? -15.518 -5.405  -4.937  1.00 307.64 ? 188 LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 153 ? -15.343 -3.976  -5.443  1.00 303.31 ? 188 LYS A CG  1 
ATOM   1054 C CD  . LYS A 1 153 ? -14.876 -3.023  -4.330  1.00 307.04 ? 188 LYS A CD  1 
ATOM   1055 C CE  . LYS A 1 153 ? -15.833 -3.024  -3.127  1.00 315.59 ? 188 LYS A CE  1 
ATOM   1056 N NZ  . LYS A 1 153 ? -17.197 -2.498  -3.446  1.00 316.90 ? 188 LYS A NZ  1 
ATOM   1057 N N   . LYS A 1 154 ? -15.037 -7.905  -2.952  1.00 237.01 ? 189 LYS A N   1 
ATOM   1058 C CA  . LYS A 1 154 ? -15.256 -9.318  -2.642  1.00 236.07 ? 189 LYS A CA  1 
ATOM   1059 C C   . LYS A 1 154 ? -13.962 -10.137 -2.651  1.00 235.67 ? 189 LYS A C   1 
ATOM   1060 O O   . LYS A 1 154 ? -13.762 -11.005 -3.514  1.00 239.63 ? 189 LYS A O   1 
ATOM   1061 C CB  . LYS A 1 154 ? -16.247 -9.938  -3.633  1.00 241.13 ? 189 LYS A CB  1 
ATOM   1062 C CG  . LYS A 1 154 ? -17.627 -10.229 -3.068  1.00 239.85 ? 189 LYS A CG  1 
ATOM   1063 C CD  . LYS A 1 154 ? -18.645 -9.199  -3.523  1.00 242.40 ? 189 LYS A CD  1 
ATOM   1064 C CE  . LYS A 1 154 ? -20.031 -9.548  -3.001  1.00 241.69 ? 189 LYS A CE  1 
ATOM   1065 N NZ  . LYS A 1 154 ? -21.048 -8.562  -3.452  1.00 244.55 ? 189 LYS A NZ  1 
ATOM   1066 N N   . ARG A 1 155 ? -13.091 -9.856  -1.687  1.00 249.37 ? 190 ARG A N   1 
ATOM   1067 C CA  . ARG A 1 155 ? -11.904 -10.662 -1.467  1.00 248.38 ? 190 ARG A CA  1 
ATOM   1068 C C   . ARG A 1 155 ? -12.297 -11.840 -0.588  1.00 245.52 ? 190 ARG A C   1 
ATOM   1069 O O   . ARG A 1 155 ? -12.898 -11.660 0.475   1.00 241.53 ? 190 ARG A O   1 
ATOM   1070 C CB  . ARG A 1 155 ? -10.809 -9.834  -0.792  1.00 245.16 ? 190 ARG A CB  1 
ATOM   1071 C CG  . ARG A 1 155 ? -9.548  -10.615 -0.449  1.00 243.98 ? 190 ARG A CG  1 
ATOM   1072 C CD  . ARG A 1 155 ? -8.794  -11.051 -1.696  1.00 249.23 ? 190 ARG A CD  1 
ATOM   1073 N NE  . ARG A 1 155 ? -7.491  -11.623 -1.363  1.00 248.32 ? 190 ARG A NE  1 
ATOM   1074 C CZ  . ARG A 1 155 ? -7.279  -12.908 -1.095  1.00 248.01 ? 190 ARG A CZ  1 
ATOM   1075 N NH1 . ARG A 1 155 ? -8.285  -13.772 -1.123  1.00 248.54 ? 190 ARG A NH1 1 
ATOM   1076 N NH2 . ARG A 1 155 ? -6.056  -13.330 -0.800  1.00 247.46 ? 190 ARG A NH2 1 
ATOM   1077 N N   . ALA A 1 156 ? -11.953 -13.041 -1.040  1.00 189.17 ? 191 ALA A N   1 
ATOM   1078 C CA  . ALA A 1 156 ? -12.293 -14.271 -0.332  1.00 187.36 ? 191 ALA A CA  1 
ATOM   1079 C C   . ALA A 1 156 ? -11.866 -14.193 1.130   1.00 181.63 ? 191 ALA A C   1 
ATOM   1080 O O   . ALA A 1 156 ? -10.769 -13.725 1.441   1.00 179.89 ? 191 ALA A O   1 
ATOM   1081 C CB  . ALA A 1 156 ? -11.634 -15.457 -1.010  1.00 190.89 ? 191 ALA A CB  1 
ATOM   1082 N N   . GLN A 1 157 ? -12.738 -14.650 2.025   1.00 203.26 ? 192 GLN A N   1 
ATOM   1083 C CA  . GLN A 1 157 ? -12.461 -14.593 3.455   1.00 198.19 ? 192 GLN A CA  1 
ATOM   1084 C C   . GLN A 1 157 ? -11.520 -15.719 3.864   1.00 197.55 ? 192 GLN A C   1 
ATOM   1085 O O   . GLN A 1 157 ? -11.859 -16.899 3.770   1.00 199.16 ? 192 GLN A O   1 
ATOM   1086 C CB  . GLN A 1 157 ? -13.772 -14.698 4.247   1.00 196.27 ? 192 GLN A CB  1 
ATOM   1087 C CG  . GLN A 1 157 ? -14.297 -13.373 4.766   1.00 193.89 ? 192 GLN A CG  1 
ATOM   1088 C CD  . GLN A 1 157 ? -13.648 -12.965 6.078   1.00 189.29 ? 192 GLN A CD  1 
ATOM   1089 O OE1 . GLN A 1 157 ? -12.553 -12.397 6.095   1.00 188.39 ? 192 GLN A OE1 1 
ATOM   1090 N NE2 . GLN A 1 157 ? -14.320 -13.264 7.187   1.00 186.72 ? 192 GLN A NE2 1 
ATOM   1091 N N   . THR A 1 158 ? -10.341 -15.345 4.340   1.00 186.70 ? 193 THR A N   1 
ATOM   1092 C CA  . THR A 1 158 ? -9.325  -16.329 4.667   1.00 186.51 ? 193 THR A CA  1 
ATOM   1093 C C   . THR A 1 158 ? -9.421  -16.741 6.131   1.00 182.44 ? 193 THR A C   1 
ATOM   1094 O O   . THR A 1 158 ? -8.790  -17.705 6.560   1.00 182.24 ? 193 THR A O   1 
ATOM   1095 C CB  . THR A 1 158 ? -7.912  -15.793 4.359   1.00 187.01 ? 193 THR A CB  1 
ATOM   1096 O OG1 . THR A 1 158 ? -6.927  -16.705 4.861   1.00 186.48 ? 193 THR A OG1 1 
ATOM   1097 C CG2 . THR A 1 158 ? -7.708  -14.421 4.992   1.00 183.80 ? 193 THR A CG2 1 
ATOM   1098 N N   . LEU A 1 159 ? -10.238 -16.023 6.892   1.00 157.27 ? 194 LEU A N   1 
ATOM   1099 C CA  . LEU A 1 159 ? -10.280 -16.212 8.337   1.00 153.51 ? 194 LEU A CA  1 
ATOM   1100 C C   . LEU A 1 159 ? -11.617 -16.735 8.824   1.00 153.14 ? 194 LEU A C   1 
ATOM   1101 O O   . LEU A 1 159 ? -12.660 -16.478 8.225   1.00 154.82 ? 194 LEU A O   1 
ATOM   1102 C CB  . LEU A 1 159 ? -9.927  -14.913 9.058   1.00 150.38 ? 194 LEU A CB  1 
ATOM   1103 C CG  . LEU A 1 159 ? -8.575  -14.335 8.646   1.00 150.84 ? 194 LEU A CG  1 
ATOM   1104 C CD1 . LEU A 1 159 ? -8.252  -13.090 9.457   1.00 147.88 ? 194 LEU A CD1 1 
ATOM   1105 C CD2 . LEU A 1 159 ? -7.491  -15.389 8.800   1.00 151.40 ? 194 LEU A CD2 1 
ATOM   1106 N N   . LEU A 1 160 ? -11.575 -17.459 9.934   1.00 135.39 ? 195 LEU A N   1 
ATOM   1107 C CA  . LEU A 1 160 ? -12.720 -18.236 10.370  1.00 135.76 ? 195 LEU A CA  1 
ATOM   1108 C C   . LEU A 1 160 ? -12.899 -18.223 11.884  1.00 132.52 ? 195 LEU A C   1 
ATOM   1109 O O   . LEU A 1 160 ? -11.937 -18.356 12.640  1.00 130.72 ? 195 LEU A O   1 
ATOM   1110 C CB  . LEU A 1 160 ? -12.555 -19.673 9.876   1.00 138.73 ? 195 LEU A CB  1 
ATOM   1111 C CG  . LEU A 1 160 ? -13.635 -20.691 10.231  1.00 139.93 ? 195 LEU A CG  1 
ATOM   1112 C CD1 . LEU A 1 160 ? -14.912 -20.370 9.478   1.00 142.03 ? 195 LEU A CD1 1 
ATOM   1113 C CD2 . LEU A 1 160 ? -13.153 -22.088 9.901   1.00 142.66 ? 195 LEU A CD2 1 
ATOM   1114 N N   . PHE A 1 161 ? -14.143 -18.059 12.317  1.00 133.42 ? 196 PHE A N   1 
ATOM   1115 C CA  . PHE A 1 161 ? -14.485 -18.191 13.726  1.00 131.15 ? 196 PHE A CA  1 
ATOM   1116 C C   . PHE A 1 161 ? -15.308 -19.454 13.950  1.00 133.01 ? 196 PHE A C   1 
ATOM   1117 O O   . PHE A 1 161 ? -16.132 -19.823 13.110  1.00 135.71 ? 196 PHE A O   1 
ATOM   1118 C CB  . PHE A 1 161 ? -15.294 -16.985 14.195  1.00 129.53 ? 196 PHE A CB  1 
ATOM   1119 C CG  . PHE A 1 161 ? -14.517 -15.703 14.231  1.00 127.58 ? 196 PHE A CG  1 
ATOM   1120 C CD1 . PHE A 1 161 ? -14.333 -14.954 13.081  1.00 128.83 ? 196 PHE A CD1 1 
ATOM   1121 C CD2 . PHE A 1 161 ? -13.988 -15.235 15.421  1.00 124.86 ? 196 PHE A CD2 1 
ATOM   1122 C CE1 . PHE A 1 161 ? -13.626 -13.767 13.115  1.00 127.37 ? 196 PHE A CE1 1 
ATOM   1123 C CE2 . PHE A 1 161 ? -13.280 -14.052 15.463  1.00 123.38 ? 196 PHE A CE2 1 
ATOM   1124 C CZ  . PHE A 1 161 ? -13.099 -13.316 14.308  1.00 124.61 ? 196 PHE A CZ  1 
ATOM   1125 N N   . SER A 1 162 ? -15.092 -20.113 15.082  1.00 131.43 ? 197 SER A N   1 
ATOM   1126 C CA  . SER A 1 162 ? -15.920 -21.251 15.443  1.00 133.27 ? 197 SER A CA  1 
ATOM   1127 C C   . SER A 1 162 ? -17.368 -20.793 15.409  1.00 133.98 ? 197 SER A C   1 
ATOM   1128 O O   . SER A 1 162 ? -17.675 -19.671 15.820  1.00 132.05 ? 197 SER A O   1 
ATOM   1129 C CB  . SER A 1 162 ? -15.564 -21.746 16.839  1.00 131.79 ? 197 SER A CB  1 
ATOM   1130 O OG  . SER A 1 162 ? -15.667 -20.693 17.778  1.00 129.07 ? 197 SER A OG  1 
ATOM   1131 N N   . HIS A 1 163 ? -18.253 -21.648 14.901  1.00 143.74 ? 198 HIS A N   1 
ATOM   1132 C CA  . HIS A 1 163 ? -19.661 -21.288 14.783  1.00 145.01 ? 198 HIS A CA  1 
ATOM   1133 C C   . HIS A 1 163 ? -20.216 -20.848 16.126  1.00 143.07 ? 198 HIS A C   1 
ATOM   1134 O O   . HIS A 1 163 ? -21.068 -19.963 16.200  1.00 142.83 ? 198 HIS A O   1 
ATOM   1135 C CB  . HIS A 1 163 ? -20.500 -22.442 14.243  1.00 148.87 ? 198 HIS A CB  1 
ATOM   1136 C CG  . HIS A 1 163 ? -21.959 -22.120 14.148  1.00 150.55 ? 198 HIS A CG  1 
ATOM   1137 N ND1 . HIS A 1 163 ? -22.848 -22.371 15.174  1.00 150.75 ? 198 HIS A ND1 1 
ATOM   1138 C CD2 . HIS A 1 163 ? -22.685 -21.548 13.159  1.00 152.41 ? 198 HIS A CD2 1 
ATOM   1139 C CE1 . HIS A 1 163 ? -24.054 -21.976 14.818  1.00 152.62 ? 198 HIS A CE1 1 
ATOM   1140 N NE2 . HIS A 1 163 ? -23.985 -21.472 13.597  1.00 153.65 ? 198 HIS A NE2 1 
ATOM   1141 N N   . ASN A 1 164 ? -19.726 -21.470 17.190  1.00 168.47 ? 199 ASN A N   1 
ATOM   1142 C CA  . ASN A 1 164 ? -20.180 -21.141 18.528  1.00 167.07 ? 199 ASN A CA  1 
ATOM   1143 C C   . ASN A 1 164 ? -19.028 -20.747 19.435  1.00 164.11 ? 199 ASN A C   1 
ATOM   1144 O O   . ASN A 1 164 ? -17.863 -20.977 19.118  1.00 163.39 ? 199 ASN A O   1 
ATOM   1145 C CB  . ASN A 1 164 ? -20.947 -22.317 19.135  1.00 169.47 ? 199 ASN A CB  1 
ATOM   1146 C CG  . ASN A 1 164 ? -22.132 -22.738 18.292  1.00 172.78 ? 199 ASN A CG  1 
ATOM   1147 O OD1 . ASN A 1 164 ? -23.188 -22.106 18.327  1.00 173.38 ? 199 ASN A OD1 1 
ATOM   1148 N ND2 . ASN A 1 164 ? -21.967 -23.818 17.536  1.00 175.29 ? 199 ASN A ND2 1 
ATOM   1149 N N   . ALA A 1 165 ? -19.368 -20.126 20.554  1.00 122.42 ? 200 ALA A N   1 
ATOM   1150 C CA  . ALA A 1 165 ? -18.399 -19.820 21.593  1.00 120.12 ? 200 ALA A CA  1 
ATOM   1151 C C   . ALA A 1 165 ? -18.736 -20.666 22.812  1.00 121.19 ? 200 ALA A C   1 
ATOM   1152 O O   . ALA A 1 165 ? -19.897 -20.997 23.035  1.00 123.13 ? 200 ALA A O   1 
ATOM   1153 C CB  . ALA A 1 165 ? -18.433 -18.348 21.936  1.00 118.02 ? 200 ALA A CB  1 
ATOM   1154 N N   . VAL A 1 166 ? -17.725 -21.024 23.596  1.00 149.01 ? 201 VAL A N   1 
ATOM   1155 C CA  . VAL A 1 166 ? -17.928 -21.931 24.719  1.00 150.48 ? 201 VAL A CA  1 
ATOM   1156 C C   . VAL A 1 166 ? -17.613 -21.284 26.065  1.00 149.06 ? 201 VAL A C   1 
ATOM   1157 O O   . VAL A 1 166 ? -16.710 -20.457 26.174  1.00 146.81 ? 201 VAL A O   1 
ATOM   1158 C CB  . VAL A 1 166 ? -17.060 -23.192 24.568  1.00 151.68 ? 201 VAL A CB  1 
ATOM   1159 C CG1 . VAL A 1 166 ? -17.281 -24.130 25.733  1.00 153.59 ? 201 VAL A CG1 1 
ATOM   1160 C CG2 . VAL A 1 166 ? -17.370 -23.888 23.255  1.00 153.60 ? 201 VAL A CG2 1 
ATOM   1161 N N   . VAL A 1 167 ? -18.366 -21.661 27.091  1.00 117.11 ? 202 VAL A N   1 
ATOM   1162 C CA  . VAL A 1 167 ? -18.013 -21.300 28.458  1.00 116.58 ? 202 VAL A CA  1 
ATOM   1163 C C   . VAL A 1 167 ? -17.618 -22.546 29.234  1.00 118.54 ? 202 VAL A C   1 
ATOM   1164 O O   . VAL A 1 167 ? -18.416 -23.467 29.385  1.00 121.24 ? 202 VAL A O   1 
ATOM   1165 C CB  . VAL A 1 167 ? -19.169 -20.607 29.192  1.00 117.39 ? 202 VAL A CB  1 
ATOM   1166 C CG1 . VAL A 1 167 ? -18.886 -20.558 30.692  1.00 117.96 ? 202 VAL A CG1 1 
ATOM   1167 C CG2 . VAL A 1 167 ? -19.397 -19.214 28.633  1.00 115.42 ? 202 VAL A CG2 1 
ATOM   1168 N N   . ALA A 1 168 ? -16.385 -22.574 29.722  1.00 137.34 ? 203 ALA A N   1 
ATOM   1169 C CA  . ALA A 1 168 ? -15.902 -23.715 30.484  1.00 139.38 ? 203 ALA A CA  1 
ATOM   1170 C C   . ALA A 1 168 ? -14.869 -23.263 31.505  1.00 138.38 ? 203 ALA A C   1 
ATOM   1171 O O   . ALA A 1 168 ? -14.612 -22.069 31.660  1.00 136.23 ? 203 ALA A O   1 
ATOM   1172 C CB  . ALA A 1 168 ? -15.308 -24.756 29.554  1.00 140.16 ? 203 ALA A CB  1 
ATOM   1173 N N   . MET A 1 169 ? -14.270 -24.218 32.201  1.00 144.39 ? 204 MET A N   1 
ATOM   1174 C CA  . MET A 1 169 ? -13.255 -23.893 33.186  1.00 143.97 ? 204 MET A CA  1 
ATOM   1175 C C   . MET A 1 169 ? -11.874 -24.242 32.667  1.00 143.12 ? 204 MET A C   1 
ATOM   1176 O O   . MET A 1 169 ? -11.637 -25.359 32.202  1.00 144.70 ? 204 MET A O   1 
ATOM   1177 C CB  . MET A 1 169 ? -13.530 -24.636 34.488  1.00 147.17 ? 204 MET A CB  1 
ATOM   1178 C CG  . MET A 1 169 ? -14.666 -24.045 35.294  1.00 148.15 ? 204 MET A CG  1 
ATOM   1179 S SD  . MET A 1 169 ? -14.112 -22.700 36.353  1.00 146.83 ? 204 MET A SD  1 
ATOM   1180 C CE  . MET A 1 169 ? -13.057 -23.588 37.499  1.00 149.43 ? 204 MET A CE  1 
ATOM   1181 N N   . ARG A 1 170 ? -10.966 -23.274 32.735  1.00 135.71 ? 205 ARG A N   1 
ATOM   1182 C CA  . ARG A 1 170 ? -9.571  -23.520 32.396  1.00 135.20 ? 205 ARG A CA  1 
ATOM   1183 C C   . ARG A 1 170 ? -8.644  -22.968 33.462  1.00 135.01 ? 205 ARG A C   1 
ATOM   1184 O O   . ARG A 1 170 ? -8.767  -21.815 33.866  1.00 133.57 ? 205 ARG A O   1 
ATOM   1185 C CB  . ARG A 1 170 ? -9.207  -22.903 31.053  1.00 132.84 ? 205 ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 170 ? -7.729  -23.012 30.749  1.00 132.47 ? 205 ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 170 ? -7.413  -22.583 29.330  1.00 130.86 ? 205 ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 170 ? -8.054  -23.440 28.335  1.00 132.05 ? 205 ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 170 ? -7.786  -23.399 27.034  1.00 131.64 ? 205 ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 170 ? -6.882  -22.546 26.570  1.00 130.04 ? 205 ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 170 ? -8.419  -24.214 26.199  1.00 133.17 ? 205 ARG A NH2 1 
ATOM   1192 N N   . ASP A 1 171 ? -7.715  -23.801 33.912  1.00 135.50 ? 206 ASP A N   1 
ATOM   1193 C CA  . ASP A 1 171 ? -6.729  -23.389 34.901  1.00 135.83 ? 206 ASP A CA  1 
ATOM   1194 C C   . ASP A 1 171 ? -7.364  -22.637 36.064  1.00 136.21 ? 206 ASP A C   1 
ATOM   1195 O O   . ASP A 1 171 ? -6.831  -21.629 36.522  1.00 135.16 ? 206 ASP A O   1 
ATOM   1196 C CB  . ASP A 1 171 ? -5.642  -22.528 34.248  1.00 133.49 ? 206 ASP A CB  1 
ATOM   1197 C CG  . ASP A 1 171 ? -4.860  -23.282 33.190  1.00 133.69 ? 206 ASP A CG  1 
ATOM   1198 O OD1 . ASP A 1 171 ? -4.525  -22.669 32.155  1.00 131.69 ? 206 ASP A OD1 1 
ATOM   1199 O OD2 . ASP A 1 171 ? -4.588  -24.487 33.400  1.00 136.17 ? 206 ASP A OD2 1 
ATOM   1200 N N   . GLY A 1 172 ? -8.511  -23.117 36.527  1.00 125.71 ? 207 GLY A N   1 
ATOM   1201 C CA  . GLY A 1 172 ? -9.129  -22.572 37.720  1.00 126.95 ? 207 GLY A CA  1 
ATOM   1202 C C   . GLY A 1 172 ? -10.065 -21.401 37.492  1.00 125.03 ? 207 GLY A C   1 
ATOM   1203 O O   . GLY A 1 172 ? -10.836 -21.032 38.376  1.00 126.44 ? 207 GLY A O   1 
ATOM   1204 N N   . LYS A 1 173 ? -10.002 -20.804 36.310  1.00 149.85 ? 208 LYS A N   1 
ATOM   1205 C CA  . LYS A 1 173 ? -10.856 -19.664 36.020  1.00 148.18 ? 208 LYS A CA  1 
ATOM   1206 C C   . LYS A 1 173 ? -11.988 -20.054 35.083  1.00 148.05 ? 208 LYS A C   1 
ATOM   1207 O O   . LYS A 1 173 ? -11.841 -20.955 34.257  1.00 148.19 ? 208 LYS A O   1 
ATOM   1208 C CB  . LYS A 1 173 ? -10.041 -18.504 35.449  1.00 145.42 ? 208 LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 173 ? -9.878  -17.341 36.423  1.00 145.43 ? 208 LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 173 ? -9.040  -16.220 35.825  1.00 143.01 ? 208 LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 173 ? -9.202  -14.925 36.609  1.00 143.08 ? 208 LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 173 ? -9.048  -13.732 35.725  1.00 140.75 ? 208 LYS A NZ  1 
ATOM   1213 N N   . LEU A 1 174 ? -13.130 -19.393 35.242  1.00 117.63 ? 209 LEU A N   1 
ATOM   1214 C CA  . LEU A 1 174 ? -14.278 -19.640 34.378  1.00 117.74 ? 209 LEU A CA  1 
ATOM   1215 C C   . LEU A 1 174 ? -14.196 -18.715 33.179  1.00 114.99 ? 209 LEU A C   1 
ATOM   1216 O O   . LEU A 1 174 ? -14.120 -17.500 33.338  1.00 113.64 ? 209 LEU A O   1 
ATOM   1217 C CB  . LEU A 1 174 ? -15.582 -19.400 35.137  1.00 119.71 ? 209 LEU A CB  1 
ATOM   1218 C CG  . LEU A 1 174 ? -16.867 -19.795 34.406  1.00 120.65 ? 209 LEU A CG  1 
ATOM   1219 C CD1 . LEU A 1 174 ? -16.955 -21.307 34.252  1.00 122.79 ? 209 LEU A CD1 1 
ATOM   1220 C CD2 . LEU A 1 174 ? -18.075 -19.261 35.150  1.00 122.45 ? 209 LEU A CD2 1 
ATOM   1221 N N   . CYS A 1 175 ? -14.220 -19.281 31.979  1.00 136.89 ? 210 CYS A N   1 
ATOM   1222 C CA  . CYS A 1 175 ? -13.871 -18.503 30.799  1.00 134.58 ? 210 CYS A CA  1 
ATOM   1223 C C   . CYS A 1 175 ? -14.763 -18.719 29.587  1.00 134.79 ? 210 CYS A C   1 
ATOM   1224 O O   . CYS A 1 175 ? -15.120 -19.845 29.250  1.00 136.43 ? 210 CYS A O   1 
ATOM   1225 C CB  . CYS A 1 175 ? -12.422 -18.790 30.414  1.00 133.61 ? 210 CYS A CB  1 
ATOM   1226 S SG  . CYS A 1 175 ? -11.323 -18.963 31.837  1.00 134.31 ? 210 CYS A SG  1 
ATOM   1227 N N   . LEU A 1 176 ? -15.104 -17.619 28.930  1.00 113.01 ? 211 LEU A N   1 
ATOM   1228 C CA  . LEU A 1 176 ? -15.777 -17.667 27.644  1.00 113.19 ? 211 LEU A CA  1 
ATOM   1229 C C   . LEU A 1 176 ? -14.728 -17.788 26.546  1.00 112.12 ? 211 LEU A C   1 
ATOM   1230 O O   . LEU A 1 176 ? -13.804 -16.983 26.482  1.00 110.46 ? 211 LEU A O   1 
ATOM   1231 C CB  . LEU A 1 176 ? -16.592 -16.391 27.435  1.00 112.56 ? 211 LEU A CB  1 
ATOM   1232 C CG  . LEU A 1 176 ? -17.236 -16.230 26.056  1.00 112.83 ? 211 LEU A CG  1 
ATOM   1233 C CD1 . LEU A 1 176 ? -18.732 -16.486 26.118  1.00 114.88 ? 211 LEU A CD1 1 
ATOM   1234 C CD2 . LEU A 1 176 ? -16.958 -14.847 25.508  1.00 111.22 ? 211 LEU A CD2 1 
ATOM   1235 N N   . MET A 1 177 ? -14.870 -18.784 25.679  1.00 133.98 ? 212 MET A N   1 
ATOM   1236 C CA  . MET A 1 177 ? -13.865 -19.042 24.652  1.00 133.59 ? 212 MET A CA  1 
ATOM   1237 C C   . MET A 1 177 ? -14.476 -19.184 23.262  1.00 134.61 ? 212 MET A C   1 
ATOM   1238 O O   . MET A 1 177 ? -15.646 -19.532 23.125  1.00 136.12 ? 212 MET A O   1 
ATOM   1239 C CB  . MET A 1 177 ? -13.091 -20.313 24.996  1.00 134.77 ? 212 MET A CB  1 
ATOM   1240 C CG  . MET A 1 177 ? -12.714 -20.414 26.463  1.00 134.66 ? 212 MET A CG  1 
ATOM   1241 S SD  . MET A 1 177 ? -11.921 -21.977 26.902  1.00 136.68 ? 212 MET A SD  1 
ATOM   1242 C CE  . MET A 1 177 ? -13.286 -23.133 26.768  1.00 139.49 ? 212 MET A CE  1 
ATOM   1243 N N   . TRP A 1 178 ? -13.679 -18.908 22.234  1.00 119.15 ? 213 TRP A N   1 
ATOM   1244 C CA  . TRP A 1 178 ? -14.090 -19.146 20.853  1.00 120.61 ? 213 TRP A CA  1 
ATOM   1245 C C   . TRP A 1 178 ? -12.856 -19.326 19.989  1.00 120.73 ? 213 TRP A C   1 
ATOM   1246 O O   . TRP A 1 178 ? -11.772 -18.878 20.349  1.00 119.26 ? 213 TRP A O   1 
ATOM   1247 C CB  . TRP A 1 178 ? -14.926 -17.991 20.320  1.00 120.19 ? 213 TRP A CB  1 
ATOM   1248 C CG  . TRP A 1 178 ? -14.169 -16.721 20.277  1.00 118.21 ? 213 TRP A CG  1 
ATOM   1249 C CD1 . TRP A 1 178 ? -13.498 -16.199 19.211  1.00 118.16 ? 213 TRP A CD1 1 
ATOM   1250 C CD2 . TRP A 1 178 ? -13.982 -15.808 21.359  1.00 116.37 ? 213 TRP A CD2 1 
ATOM   1251 N NE1 . TRP A 1 178 ? -12.911 -15.006 19.560  1.00 116.35 ? 213 TRP A NE1 1 
ATOM   1252 C CE2 . TRP A 1 178 ? -13.193 -14.746 20.874  1.00 115.21 ? 213 TRP A CE2 1 
ATOM   1253 C CE3 . TRP A 1 178 ? -14.410 -15.782 22.688  1.00 115.94 ? 213 TRP A CE3 1 
ATOM   1254 C CZ2 . TRP A 1 178 ? -12.825 -13.669 21.677  1.00 113.62 ? 213 TRP A CZ2 1 
ATOM   1255 C CZ3 . TRP A 1 178 ? -14.044 -14.717 23.481  1.00 114.40 ? 213 TRP A CZ3 1 
ATOM   1256 C CH2 . TRP A 1 178 ? -13.257 -13.674 22.976  1.00 113.23 ? 213 TRP A CH2 1 
ATOM   1257 N N   . ARG A 1 179 ? -13.025 -19.968 18.840  1.00 124.56 ? 214 ARG A N   1 
ATOM   1258 C CA  . ARG A 1 179 ? -11.888 -20.343 18.017  1.00 125.41 ? 214 ARG A CA  1 
ATOM   1259 C C   . ARG A 1 179 ? -11.747 -19.484 16.776  1.00 125.70 ? 214 ARG A C   1 
ATOM   1260 O O   . ARG A 1 179 ? -12.741 -19.048 16.195  1.00 126.40 ? 214 ARG A O   1 
ATOM   1261 C CB  . ARG A 1 179 ? -12.007 -21.802 17.585  1.00 128.25 ? 214 ARG A CB  1 
ATOM   1262 C CG  . ARG A 1 179 ? -11.088 -22.750 18.317  1.00 128.58 ? 214 ARG A CG  1 
ATOM   1263 C CD  . ARG A 1 179 ? -10.425 -23.713 17.347  1.00 131.26 ? 214 ARG A CD  1 
ATOM   1264 N NE  . ARG A 1 179 ? -10.071 -24.966 18.007  1.00 132.73 ? 214 ARG A NE  1 
ATOM   1265 C CZ  . ARG A 1 179 ? -10.829 -26.060 17.989  1.00 135.22 ? 214 ARG A CZ  1 
ATOM   1266 N NH1 . ARG A 1 179 ? -11.981 -26.063 17.333  1.00 136.51 ? 214 ARG A NH1 1 
ATOM   1267 N NH2 . ARG A 1 179 ? -10.434 -27.156 18.621  1.00 136.74 ? 214 ARG A NH2 1 
ATOM   1268 N N   . VAL A 1 180 ? -10.500 -19.266 16.369  1.00 124.61 ? 215 VAL A N   1 
ATOM   1269 C CA  . VAL A 1 180 ? -10.194 -18.594 15.114  1.00 125.56 ? 215 VAL A CA  1 
ATOM   1270 C C   . VAL A 1 180 ? -9.105  -19.362 14.383  1.00 127.59 ? 215 VAL A C   1 
ATOM   1271 O O   . VAL A 1 180 ? -8.244  -19.982 15.011  1.00 127.31 ? 215 VAL A O   1 
ATOM   1272 C CB  . VAL A 1 180 ? -9.708  -17.154 15.337  1.00 123.37 ? 215 VAL A CB  1 
ATOM   1273 C CG1 . VAL A 1 180 ? -10.815 -16.302 15.938  1.00 121.83 ? 215 VAL A CG1 1 
ATOM   1274 C CG2 . VAL A 1 180 ? -8.464  -17.148 16.215  1.00 121.85 ? 215 VAL A CG2 1 
ATOM   1275 N N   . GLY A 1 181 ? -9.147  -19.325 13.056  1.00 123.49 ? 216 GLY A N   1 
ATOM   1276 C CA  . GLY A 1 181 ? -8.154  -20.016 12.258  1.00 125.99 ? 216 GLY A CA  1 
ATOM   1277 C C   . GLY A 1 181 ? -7.996  -19.472 10.851  1.00 128.28 ? 216 GLY A C   1 
ATOM   1278 O O   . GLY A 1 181 ? -8.919  -18.885 10.280  1.00 128.84 ? 216 GLY A O   1 
ATOM   1279 N N   . ASN A 1 182 ? -6.812  -19.684 10.286  1.00 159.82 ? 217 ASN A N   1 
ATOM   1280 C CA  . ASN A 1 182 ? -6.526  -19.252 8.929   1.00 162.65 ? 217 ASN A CA  1 
ATOM   1281 C C   . ASN A 1 182 ? -6.850  -20.391 7.983   1.00 166.70 ? 217 ASN A C   1 
ATOM   1282 O O   . ASN A 1 182 ? -6.463  -21.531 8.228   1.00 167.87 ? 217 ASN A O   1 
ATOM   1283 C CB  . ASN A 1 182 ? -5.053  -18.854 8.784   1.00 162.92 ? 217 ASN A CB  1 
ATOM   1284 C CG  . ASN A 1 182 ? -4.849  -17.703 7.808   1.00 164.21 ? 217 ASN A CG  1 
ATOM   1285 O OD1 . ASN A 1 182 ? -5.653  -17.494 6.902   1.00 166.24 ? 217 ASN A OD1 1 
ATOM   1286 N ND2 . ASN A 1 182 ? -3.771  -16.948 7.997   1.00 163.32 ? 217 ASN A ND2 1 
ATOM   1287 N N   . LEU A 1 183 ? -7.577  -20.092 6.914   1.00 164.76 ? 218 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 183 ? -7.881  -21.103 5.910   1.00 169.20 ? 218 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 183 ? -6.701  -21.253 4.966   1.00 172.55 ? 218 LEU A C   1 
ATOM   1290 O O   . LEU A 1 183 ? -6.574  -22.251 4.263   1.00 176.47 ? 218 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 183 ? -9.143  -20.728 5.137   1.00 170.96 ? 218 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 183 ? -10.419 -20.777 5.980   1.00 168.60 ? 218 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 183 ? -11.611 -20.215 5.217   1.00 170.36 ? 218 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 183 ? -10.680 -22.205 6.440   1.00 169.58 ? 218 LEU A CD2 1 
ATOM   1295 N N   . ARG A 1 184 ? -5.827  -20.255 4.973   1.00 190.35 ? 219 ARG A N   1 
ATOM   1296 C CA  . ARG A 1 184 ? -4.649  -20.257 4.122   1.00 193.58 ? 219 ARG A CA  1 
ATOM   1297 C C   . ARG A 1 184 ? -3.391  -20.458 4.956   1.00 191.81 ? 219 ARG A C   1 
ATOM   1298 O O   . ARG A 1 184 ? -3.323  -20.024 6.106   1.00 187.62 ? 219 ARG A O   1 
ATOM   1299 C CB  . ARG A 1 184 ? -4.565  -18.942 3.350   1.00 194.40 ? 219 ARG A CB  1 
ATOM   1300 C CG  . ARG A 1 184 ? -5.859  -18.587 2.638   1.00 195.89 ? 219 ARG A CG  1 
ATOM   1301 C CD  . ARG A 1 184 ? -6.314  -19.739 1.754   1.00 200.46 ? 219 ARG A CD  1 
ATOM   1302 N NE  . ARG A 1 184 ? -7.641  -19.527 1.179   1.00 201.98 ? 219 ARG A NE  1 
ATOM   1303 C CZ  . ARG A 1 184 ? -7.877  -18.823 0.076   1.00 205.20 ? 219 ARG A CZ  1 
ATOM   1304 N NH1 . ARG A 1 184 ? -6.873  -18.248 -0.571  1.00 207.23 ? 219 ARG A NH1 1 
ATOM   1305 N NH2 . ARG A 1 184 ? -9.117  -18.687 -0.375  1.00 206.67 ? 219 ARG A NH2 1 
ATOM   1306 N N   . LYS A 1 185 ? -2.399  -21.127 4.380   1.00 192.10 ? 220 LYS A N   1 
ATOM   1307 C CA  . LYS A 1 185 ? -1.123  -21.310 5.059   1.00 191.14 ? 220 LYS A CA  1 
ATOM   1308 C C   . LYS A 1 185 ? -0.397  -19.973 5.207   1.00 189.29 ? 220 LYS A C   1 
ATOM   1309 O O   . LYS A 1 185 ? 0.582   -19.864 5.949   1.00 187.72 ? 220 LYS A O   1 
ATOM   1310 C CB  . LYS A 1 185 ? -0.247  -22.320 4.306   1.00 196.02 ? 220 LYS A CB  1 
ATOM   1311 C CG  . LYS A 1 185 ? -0.854  -23.715 4.220   1.00 198.23 ? 220 LYS A CG  1 
ATOM   1312 C CD  . LYS A 1 185 ? 0.040   -24.672 3.444   1.00 203.51 ? 220 LYS A CD  1 
ATOM   1313 C CE  . LYS A 1 185 ? -0.613  -26.041 3.300   1.00 206.18 ? 220 LYS A CE  1 
ATOM   1314 N NZ  . LYS A 1 185 ? 0.184   -26.965 2.439   1.00 211.98 ? 220 LYS A NZ  1 
ATOM   1315 N N   . SER A 1 186 ? -0.894  -18.959 4.501   1.00 165.24 ? 221 SER A N   1 
ATOM   1316 C CA  . SER A 1 186 ? -0.333  -17.610 4.554   1.00 163.89 ? 221 SER A CA  1 
ATOM   1317 C C   . SER A 1 186 ? -0.486  -16.974 5.934   1.00 158.63 ? 221 SER A C   1 
ATOM   1318 O O   . SER A 1 186 ? -1.550  -17.041 6.542   1.00 155.98 ? 221 SER A O   1 
ATOM   1319 C CB  . SER A 1 186 ? -0.993  -16.718 3.496   1.00 165.89 ? 221 SER A CB  1 
ATOM   1320 O OG  . SER A 1 186 ? -0.579  -15.366 3.627   1.00 164.47 ? 221 SER A OG  1 
ATOM   1321 N N   . HIS A 1 187 ? 0.583   -16.348 6.417   1.00 183.18 ? 222 HIS A N   1 
ATOM   1322 C CA  . HIS A 1 187 ? 0.599   -15.750 7.753   1.00 178.69 ? 222 HIS A CA  1 
ATOM   1323 C C   . HIS A 1 187 ? -0.146  -14.416 7.853   1.00 176.54 ? 222 HIS A C   1 
ATOM   1324 O O   . HIS A 1 187 ? -0.361  -13.731 6.850   1.00 178.71 ? 222 HIS A O   1 
ATOM   1325 C CB  . HIS A 1 187 ? 2.037   -15.579 8.249   1.00 178.66 ? 222 HIS A CB  1 
ATOM   1326 C CG  . HIS A 1 187 ? 2.773   -16.875 8.412   1.00 180.36 ? 222 HIS A CG  1 
ATOM   1327 N ND1 . HIS A 1 187 ? 3.289   -17.573 7.346   1.00 184.80 ? 222 HIS A ND1 1 
ATOM   1328 C CD2 . HIS A 1 187 ? 3.054   -17.599 9.518   1.00 178.55 ? 222 HIS A CD2 1 
ATOM   1329 C CE1 . HIS A 1 187 ? 3.872   -18.678 7.790   1.00 185.62 ? 222 HIS A CE1 1 
ATOM   1330 N NE2 . HIS A 1 187 ? 3.744   -18.716 9.099   1.00 181.88 ? 222 HIS A NE2 1 
ATOM   1331 N N   . LEU A 1 188 ? -0.546  -14.064 9.072   1.00 152.82 ? 223 LEU A N   1 
ATOM   1332 C CA  . LEU A 1 188 ? -1.119  -12.750 9.349   1.00 150.73 ? 223 LEU A CA  1 
ATOM   1333 C C   . LEU A 1 188 ? -0.158  -11.911 10.171  1.00 148.98 ? 223 LEU A C   1 
ATOM   1334 O O   . LEU A 1 188 ? 0.040   -12.171 11.359  1.00 146.48 ? 223 LEU A O   1 
ATOM   1335 C CB  . LEU A 1 188 ? -2.427  -12.880 10.128  1.00 147.93 ? 223 LEU A CB  1 
ATOM   1336 C CG  . LEU A 1 188 ? -3.651  -13.441 9.417   1.00 149.36 ? 223 LEU A CG  1 
ATOM   1337 C CD1 . LEU A 1 188 ? -4.848  -13.307 10.332  1.00 146.49 ? 223 LEU A CD1 1 
ATOM   1338 C CD2 . LEU A 1 188 ? -3.892  -12.710 8.112   1.00 152.20 ? 223 LEU A CD2 1 
ATOM   1339 N N   . VAL A 1 189 ? 0.420   -10.886 9.556   1.00 131.62 ? 224 VAL A N   1 
ATOM   1340 C CA  . VAL A 1 189 ? 1.353   -10.028 10.273  1.00 130.45 ? 224 VAL A CA  1 
ATOM   1341 C C   . VAL A 1 189 ? 0.625   -9.090  11.236  1.00 127.19 ? 224 VAL A C   1 
ATOM   1342 O O   . VAL A 1 189 ? -0.399  -8.500  10.885  1.00 126.98 ? 224 VAL A O   1 
ATOM   1343 C CB  . VAL A 1 189 ? 2.231   -9.217  9.308   1.00 133.64 ? 224 VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 189 ? 3.228   -8.392  10.089  1.00 132.69 ? 224 VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 189 ? 2.949   -10.155 8.359   1.00 137.29 ? 224 VAL A CG2 1 
ATOM   1346 N N   . GLU A 1 190 ? 1.163   -8.964  12.446  1.00 128.06 ? 225 GLU A N   1 
ATOM   1347 C CA  . GLU A 1 190 ? 0.576   -8.115  13.477  1.00 125.27 ? 225 GLU A CA  1 
ATOM   1348 C C   . GLU A 1 190 ? -0.923  -8.345  13.623  1.00 123.74 ? 225 GLU A C   1 
ATOM   1349 O O   . GLU A 1 190 ? -1.727  -7.453  13.351  1.00 123.63 ? 225 GLU A O   1 
ATOM   1350 C CB  . GLU A 1 190 ? 0.859   -6.636  13.193  1.00 126.08 ? 225 GLU A CB  1 
ATOM   1351 C CG  . GLU A 1 190 ? 2.305   -6.212  13.435  1.00 127.14 ? 225 GLU A CG  1 
ATOM   1352 C CD  . GLU A 1 190 ? 2.551   -4.756  13.066  1.00 128.46 ? 225 GLU A CD  1 
ATOM   1353 O OE1 . GLU A 1 190 ? 1.582   -4.064  12.676  1.00 128.43 ? 225 GLU A OE1 1 
ATOM   1354 O OE2 . GLU A 1 190 ? 3.714   -4.306  13.161  1.00 129.80 ? 225 GLU A OE2 1 
ATOM   1355 N N   . ALA A 1 191 ? -1.288  -9.546  14.061  1.00 128.11 ? 226 ALA A N   1 
ATOM   1356 C CA  . ALA A 1 191 ? -2.687  -9.915  14.249  1.00 126.97 ? 226 ALA A CA  1 
ATOM   1357 C C   . ALA A 1 191 ? -3.108  -9.717  15.693  1.00 124.22 ? 226 ALA A C   1 
ATOM   1358 O O   . ALA A 1 191 ? -2.335  -9.988  16.608  1.00 123.31 ? 226 ALA A O   1 
ATOM   1359 C CB  . ALA A 1 191 ? -2.908  -11.353 13.845  1.00 128.14 ? 226 ALA A CB  1 
ATOM   1360 N N   . HIS A 1 192 ? -4.333  -9.248  15.895  1.00 119.98 ? 227 HIS A N   1 
ATOM   1361 C CA  . HIS A 1 192 ? -4.845  -9.035  17.240  1.00 117.81 ? 227 HIS A CA  1 
ATOM   1362 C C   . HIS A 1 192 ? -6.356  -9.185  17.297  1.00 117.42 ? 227 HIS A C   1 
ATOM   1363 O O   . HIS A 1 192 ? -7.062  -8.920  16.323  1.00 118.65 ? 227 HIS A O   1 
ATOM   1364 C CB  . HIS A 1 192 ? -4.430  -7.660  17.766  1.00 117.08 ? 227 HIS A CB  1 
ATOM   1365 C CG  . HIS A 1 192 ? -4.904  -6.521  16.923  1.00 118.08 ? 227 HIS A CG  1 
ATOM   1366 N ND1 . HIS A 1 192 ? -6.076  -5.844  17.178  1.00 117.53 ? 227 HIS A ND1 1 
ATOM   1367 C CD2 . HIS A 1 192 ? -4.366  -5.939  15.822  1.00 119.96 ? 227 HIS A CD2 1 
ATOM   1368 C CE1 . HIS A 1 192 ? -6.240  -4.892  16.276  1.00 118.97 ? 227 HIS A CE1 1 
ATOM   1369 N NE2 . HIS A 1 192 ? -5.214  -4.929  15.442  1.00 120.49 ? 227 HIS A NE2 1 
ATOM   1370 N N   . VAL A 1 193 ? -6.845  -9.595  18.460  1.00 113.46 ? 228 VAL A N   1 
ATOM   1371 C CA  . VAL A 1 193 ? -8.259  -9.881  18.635  1.00 113.33 ? 228 VAL A CA  1 
ATOM   1372 C C   . VAL A 1 193 ? -8.944  -8.873  19.548  1.00 112.23 ? 228 VAL A C   1 
ATOM   1373 O O   . VAL A 1 193 ? -8.315  -8.250  20.402  1.00 111.28 ? 228 VAL A O   1 
ATOM   1374 C CB  . VAL A 1 193 ? -8.467  -11.290 19.204  1.00 113.27 ? 228 VAL A CB  1 
ATOM   1375 C CG1 . VAL A 1 193 ? -8.008  -12.336 18.200  1.00 114.87 ? 228 VAL A CG1 1 
ATOM   1376 C CG2 . VAL A 1 193 ? -7.720  -11.437 20.518  1.00 112.07 ? 228 VAL A CG2 1 
ATOM   1377 N N   . ARG A 1 194 ? -10.241 -8.699  19.333  1.00 133.23 ? 229 ARG A N   1 
ATOM   1378 C CA  . ARG A 1 194 ? -11.051 -7.860  20.196  1.00 132.62 ? 229 ARG A CA  1 
ATOM   1379 C C   . ARG A 1 194 ? -12.416 -8.514  20.357  1.00 133.19 ? 229 ARG A C   1 
ATOM   1380 O O   . ARG A 1 194 ? -12.804 -9.368  19.561  1.00 134.25 ? 229 ARG A O   1 
ATOM   1381 C CB  . ARG A 1 194 ? -11.223 -6.474  19.583  1.00 133.25 ? 229 ARG A CB  1 
ATOM   1382 C CG  . ARG A 1 194 ? -10.003 -5.934  18.863  1.00 133.62 ? 229 ARG A CG  1 
ATOM   1383 C CD  . ARG A 1 194 ? -10.350 -4.602  18.249  1.00 134.69 ? 229 ARG A CD  1 
ATOM   1384 N NE  . ARG A 1 194 ? -11.272 -3.890  19.127  1.00 134.30 ? 229 ARG A NE  1 
ATOM   1385 C CZ  . ARG A 1 194 ? -11.868 -2.745  18.819  1.00 135.37 ? 229 ARG A CZ  1 
ATOM   1386 N NH1 . ARG A 1 194 ? -11.640 -2.172  17.645  1.00 136.90 ? 229 ARG A NH1 1 
ATOM   1387 N NH2 . ARG A 1 194 ? -12.693 -2.175  19.688  1.00 135.24 ? 229 ARG A NH2 1 
ATOM   1388 N N   . ALA A 1 195 ? -13.144 -8.112  21.389  1.00 141.54 ? 230 ALA A N   1 
ATOM   1389 C CA  . ALA A 1 195 ? -14.494 -8.607  21.588  1.00 142.42 ? 230 ALA A CA  1 
ATOM   1390 C C   . ALA A 1 195 ? -15.325 -7.569  22.324  1.00 142.60 ? 230 ALA A C   1 
ATOM   1391 O O   . ALA A 1 195 ? -14.805 -6.812  23.144  1.00 141.82 ? 230 ALA A O   1 
ATOM   1392 C CB  . ALA A 1 195 ? -14.472 -9.920  22.351  1.00 142.28 ? 230 ALA A CB  1 
ATOM   1393 N N   . GLN A 1 196 ? -16.619 -7.539  22.030  1.00 124.10 ? 231 GLN A N   1 
ATOM   1394 C CA  . GLN A 1 196 ? -17.533 -6.637  22.712  1.00 124.76 ? 231 GLN A CA  1 
ATOM   1395 C C   . GLN A 1 196 ? -18.876 -7.292  22.974  1.00 126.22 ? 231 GLN A C   1 
ATOM   1396 O O   . GLN A 1 196 ? -19.414 -7.996  22.121  1.00 127.29 ? 231 GLN A O   1 
ATOM   1397 C CB  . GLN A 1 196 ? -17.764 -5.389  21.883  1.00 125.56 ? 231 GLN A CB  1 
ATOM   1398 C CG  . GLN A 1 196 ? -16.554 -4.528  21.705  1.00 124.60 ? 231 GLN A CG  1 
ATOM   1399 C CD  . GLN A 1 196 ? -16.843 -3.379  20.782  1.00 125.89 ? 231 GLN A CD  1 
ATOM   1400 O OE1 . GLN A 1 196 ? -16.294 -2.284  20.937  1.00 125.78 ? 231 GLN A OE1 1 
ATOM   1401 N NE2 . GLN A 1 196 ? -17.719 -3.615  19.810  1.00 127.44 ? 231 GLN A NE2 1 
ATOM   1402 N N   . LEU A 1 197 ? -19.421 -7.054  24.159  1.00 127.77 ? 232 LEU A N   1 
ATOM   1403 C CA  . LEU A 1 197 ? -20.804 -7.402  24.413  1.00 129.66 ? 232 LEU A CA  1 
ATOM   1404 C C   . LEU A 1 197 ? -21.656 -6.257  23.885  1.00 131.07 ? 232 LEU A C   1 
ATOM   1405 O O   . LEU A 1 197 ? -21.409 -5.087  24.190  1.00 130.84 ? 232 LEU A O   1 
ATOM   1406 C CB  . LEU A 1 197 ? -21.057 -7.625  25.905  1.00 130.05 ? 232 LEU A CB  1 
ATOM   1407 C CG  . LEU A 1 197 ? -22.394 -8.278  26.293  1.00 132.28 ? 232 LEU A CG  1 
ATOM   1408 C CD1 . LEU A 1 197 ? -22.432 -8.613  27.778  1.00 132.83 ? 232 LEU A CD1 1 
ATOM   1409 C CD2 . LEU A 1 197 ? -23.586 -7.403  25.920  1.00 134.21 ? 232 LEU A CD2 1 
ATOM   1410 N N   . ILE A 1 198 ? -22.654 -6.604  23.081  1.00 130.15 ? 233 ILE A N   1 
ATOM   1411 C CA  . ILE A 1 198 ? -23.540 -5.619  22.486  1.00 131.97 ? 233 ILE A CA  1 
ATOM   1412 C C   . ILE A 1 198 ? -24.967 -5.841  22.958  1.00 134.37 ? 233 ILE A C   1 
ATOM   1413 O O   . ILE A 1 198 ? -25.464 -6.962  22.945  1.00 135.24 ? 233 ILE A O   1 
ATOM   1414 C CB  . ILE A 1 198 ? -23.466 -5.673  20.958  1.00 132.57 ? 233 ILE A CB  1 
ATOM   1415 C CG1 . ILE A 1 198 ? -22.167 -5.011  20.489  1.00 130.87 ? 233 ILE A CG1 1 
ATOM   1416 C CG2 . ILE A 1 198 ? -24.668 -4.992  20.345  1.00 135.24 ? 233 ILE A CG2 1 
ATOM   1417 C CD1 . ILE A 1 198 ? -21.948 -5.058  19.000  1.00 131.70 ? 233 ILE A CD1 1 
ATOM   1418 N N   . LYS A 1 199 ? -25.614 -4.764  23.389  1.00 139.96 ? 234 LYS A N   1 
ATOM   1419 C CA  . LYS A 1 199 ? -26.950 -4.841  23.964  1.00 142.57 ? 234 LYS A CA  1 
ATOM   1420 C C   . LYS A 1 199 ? -27.413 -3.437  24.338  1.00 144.01 ? 234 LYS A C   1 
ATOM   1421 O O   . LYS A 1 199 ? -26.585 -2.559  24.601  1.00 142.65 ? 234 LYS A O   1 
ATOM   1422 C CB  . LYS A 1 199 ? -26.938 -5.712  25.221  1.00 142.34 ? 234 LYS A CB  1 
ATOM   1423 C CG  . LYS A 1 199 ? -26.829 -4.902  26.498  1.00 142.50 ? 234 LYS A CG  1 
ATOM   1424 C CD  . LYS A 1 199 ? -26.711 -5.778  27.727  1.00 142.50 ? 234 LYS A CD  1 
ATOM   1425 C CE  . LYS A 1 199 ? -26.506 -4.921  28.972  1.00 142.91 ? 234 LYS A CE  1 
ATOM   1426 N NZ  . LYS A 1 199 ? -26.168 -5.723  30.183  1.00 142.90 ? 234 LYS A NZ  1 
ATOM   1427 N N   . PRO A 1 200 ? -28.740 -3.226  24.375  1.00 120.12 ? 235 PRO A N   1 
ATOM   1428 C CA  . PRO A 1 200 ? -29.344 -1.954  24.787  1.00 122.18 ? 235 PRO A CA  1 
ATOM   1429 C C   . PRO A 1 200 ? -29.247 -1.779  26.293  1.00 122.28 ? 235 PRO A C   1 
ATOM   1430 O O   . PRO A 1 200 ? -29.288 -2.778  27.008  1.00 122.06 ? 235 PRO A O   1 
ATOM   1431 C CB  . PRO A 1 200 ? -30.809 -2.134  24.394  1.00 125.67 ? 235 PRO A CB  1 
ATOM   1432 C CG  . PRO A 1 200 ? -31.036 -3.604  24.506  1.00 125.55 ? 235 PRO A CG  1 
ATOM   1433 C CD  . PRO A 1 200 ? -29.762 -4.233  24.030  1.00 122.16 ? 235 PRO A CD  1 
ATOM   1434 N N   . ARG A 1 201 ? -29.111 -0.544  26.766  1.00 134.17 ? 236 ARG A N   1 
ATOM   1435 C CA  . ARG A 1 201 ? -29.132 -0.282  28.205  1.00 135.05 ? 236 ARG A CA  1 
ATOM   1436 C C   . ARG A 1 201 ? -29.506 1.163   28.549  1.00 137.37 ? 236 ARG A C   1 
ATOM   1437 O O   . ARG A 1 201 ? -29.406 2.057   27.707  1.00 137.55 ? 236 ARG A O   1 
ATOM   1438 C CB  . ARG A 1 201 ? -27.794 -0.651  28.848  1.00 132.04 ? 236 ARG A CB  1 
ATOM   1439 C CG  . ARG A 1 201 ? -26.747 0.438   28.751  1.00 130.54 ? 236 ARG A CG  1 
ATOM   1440 C CD  . ARG A 1 201 ? -25.485 0.051   29.494  1.00 128.08 ? 236 ARG A CD  1 
ATOM   1441 N NE  . ARG A 1 201 ? -24.495 1.124   29.460  1.00 127.05 ? 236 ARG A NE  1 
ATOM   1442 C CZ  . ARG A 1 201 ? -24.455 2.123   30.335  1.00 128.62 ? 236 ARG A CZ  1 
ATOM   1443 N NH1 . ARG A 1 201 ? -25.350 2.185   31.314  1.00 131.32 ? 236 ARG A NH1 1 
ATOM   1444 N NH2 . ARG A 1 201 ? -23.524 3.059   30.231  1.00 127.82 ? 236 ARG A NH2 1 
ATOM   1445 N N   . ILE A 1 202 ? -29.932 1.374   29.794  1.00 128.40 ? 237 ILE A N   1 
ATOM   1446 C CA  . ILE A 1 202 ? -30.358 2.689   30.267  1.00 131.22 ? 237 ILE A CA  1 
ATOM   1447 C C   . ILE A 1 202 ? -29.467 3.196   31.393  1.00 130.64 ? 237 ILE A C   1 
ATOM   1448 O O   . ILE A 1 202 ? -29.355 2.559   32.438  1.00 130.80 ? 237 ILE A O   1 
ATOM   1449 C CB  . ILE A 1 202 ? -31.795 2.660   30.799  1.00 135.44 ? 237 ILE A CB  1 
ATOM   1450 C CG1 . ILE A 1 202 ? -32.775 2.257   29.693  1.00 136.72 ? 237 ILE A CG1 1 
ATOM   1451 C CG2 . ILE A 1 202 ? -32.154 4.014   31.391  1.00 138.60 ? 237 ILE A CG2 1 
ATOM   1452 C CD1 . ILE A 1 202 ? -34.221 2.154   30.155  1.00 141.16 ? 237 ILE A CD1 1 
ATOM   1453 N N   . THR A 1 203 ? -28.863 4.361   31.191  1.00 130.55 ? 238 THR A N   1 
ATOM   1454 C CA  . THR A 1 203 ? -27.886 4.878   32.140  1.00 129.95 ? 238 THR A CA  1 
ATOM   1455 C C   . THR A 1 203 ? -28.509 5.244   33.482  1.00 133.56 ? 238 THR A C   1 
ATOM   1456 O O   . THR A 1 203 ? -29.727 5.384   33.610  1.00 136.89 ? 238 THR A O   1 
ATOM   1457 C CB  . THR A 1 203 ? -27.100 6.082   31.579  1.00 129.28 ? 238 THR A CB  1 
ATOM   1458 O OG1 . THR A 1 203 ? -27.878 7.279   31.705  1.00 133.01 ? 238 THR A OG1 1 
ATOM   1459 C CG2 . THR A 1 203 ? -26.742 5.849   30.121  1.00 126.81 ? 238 THR A CG2 1 
ATOM   1460 N N   . GLU A 1 204 ? -27.647 5.363   34.484  1.00 161.60 ? 239 GLU A N   1 
ATOM   1461 C CA  . GLU A 1 204 ? -28.034 5.739   35.833  1.00 165.16 ? 239 GLU A CA  1 
ATOM   1462 C C   . GLU A 1 204 ? -28.944 6.968   35.834  1.00 169.20 ? 239 GLU A C   1 
ATOM   1463 O O   . GLU A 1 204 ? -29.907 7.040   36.598  1.00 173.06 ? 239 GLU A O   1 
ATOM   1464 C CB  . GLU A 1 204 ? -26.770 6.019   36.643  1.00 164.08 ? 239 GLU A CB  1 
ATOM   1465 C CG  . GLU A 1 204 ? -26.969 6.097   38.138  1.00 167.48 ? 239 GLU A CG  1 
ATOM   1466 C CD  . GLU A 1 204 ? -25.693 6.487   38.858  1.00 166.76 ? 239 GLU A CD  1 
ATOM   1467 O OE1 . GLU A 1 204 ? -25.673 7.568   39.485  1.00 169.79 ? 239 GLU A OE1 1 
ATOM   1468 O OE2 . GLU A 1 204 ? -24.709 5.717   38.793  1.00 163.43 ? 239 GLU A OE2 1 
ATOM   1469 N N   . GLU A 1 205 ? -28.641 7.923   34.963  1.00 125.41 ? 240 GLU A N   1 
ATOM   1470 C CA  . GLU A 1 205 ? -29.396 9.166   34.882  1.00 129.32 ? 240 GLU A CA  1 
ATOM   1471 C C   . GLU A 1 205 ? -30.618 9.005   34.000  1.00 130.81 ? 240 GLU A C   1 
ATOM   1472 O O   . GLU A 1 205 ? -31.332 9.968   33.741  1.00 134.12 ? 240 GLU A O   1 
ATOM   1473 C CB  . GLU A 1 205 ? -28.519 10.303  34.346  1.00 128.53 ? 240 GLU A CB  1 
ATOM   1474 C CG  . GLU A 1 205 ? -27.284 10.604  35.188  1.00 127.54 ? 240 GLU A CG  1 
ATOM   1475 C CD  . GLU A 1 205 ? -26.151 9.636   34.930  1.00 122.77 ? 240 GLU A CD  1 
ATOM   1476 O OE1 . GLU A 1 205 ? -26.254 8.840   33.969  1.00 120.13 ? 240 GLU A OE1 1 
ATOM   1477 O OE2 . GLU A 1 205 ? -25.159 9.677   35.686  1.00 121.97 ? 240 GLU A OE2 1 
ATOM   1478 N N   . GLY A 1 206 ? -30.846 7.787   33.528  1.00 148.99 ? 241 GLY A N   1 
ATOM   1479 C CA  . GLY A 1 206 ? -31.984 7.510   32.676  1.00 150.47 ? 241 GLY A CA  1 
ATOM   1480 C C   . GLY A 1 206 ? -31.798 7.980   31.248  1.00 149.11 ? 241 GLY A C   1 
ATOM   1481 O O   . GLY A 1 206 ? -32.669 8.645   30.686  1.00 152.09 ? 241 GLY A O   1 
ATOM   1482 N N   . GLU A 1 207 ? -30.650 7.649   30.665  1.00 158.32 ? 242 GLU A N   1 
ATOM   1483 C CA  . GLU A 1 207 ? -30.399 7.915   29.253  1.00 156.95 ? 242 GLU A CA  1 
ATOM   1484 C C   . GLU A 1 207 ? -30.392 6.586   28.522  1.00 154.30 ? 242 GLU A C   1 
ATOM   1485 O O   . GLU A 1 207 ? -29.884 5.596   29.045  1.00 151.91 ? 242 GLU A O   1 
ATOM   1486 C CB  . GLU A 1 207 ? -29.059 8.616   29.074  1.00 154.74 ? 242 GLU A CB  1 
ATOM   1487 C CG  . GLU A 1 207 ? -28.674 8.901   27.639  1.00 153.52 ? 242 GLU A CG  1 
ATOM   1488 C CD  . GLU A 1 207 ? -27.266 9.445   27.542  1.00 151.29 ? 242 GLU A CD  1 
ATOM   1489 O OE1 . GLU A 1 207 ? -26.819 9.754   26.419  1.00 150.52 ? 242 GLU A OE1 1 
ATOM   1490 O OE2 . GLU A 1 207 ? -26.603 9.561   28.597  1.00 150.63 ? 242 GLU A OE2 1 
ATOM   1491 N N   . TYR A 1 208 ? -30.952 6.559   27.316  1.00 156.12 ? 243 TYR A N   1 
ATOM   1492 C CA  . TYR A 1 208 ? -31.075 5.310   26.566  1.00 154.32 ? 243 TYR A CA  1 
ATOM   1493 C C   . TYR A 1 208 ? -30.016 5.131   25.480  1.00 151.15 ? 243 TYR A C   1 
ATOM   1494 O O   . TYR A 1 208 ? -29.952 5.904   24.521  1.00 152.01 ? 243 TYR A O   1 
ATOM   1495 C CB  . TYR A 1 208 ? -32.466 5.181   25.942  1.00 157.65 ? 243 TYR A CB  1 
ATOM   1496 C CG  . TYR A 1 208 ? -32.709 3.833   25.297  1.00 156.43 ? 243 TYR A CG  1 
ATOM   1497 C CD1 . TYR A 1 208 ? -32.741 2.676   26.063  1.00 155.34 ? 243 TYR A CD1 1 
ATOM   1498 C CD2 . TYR A 1 208 ? -32.911 3.716   23.927  1.00 156.77 ? 243 TYR A CD2 1 
ATOM   1499 C CE1 . TYR A 1 208 ? -32.965 1.438   25.486  1.00 154.55 ? 243 TYR A CE1 1 
ATOM   1500 C CE2 . TYR A 1 208 ? -33.136 2.481   23.339  1.00 156.03 ? 243 TYR A CE2 1 
ATOM   1501 C CZ  . TYR A 1 208 ? -33.162 1.344   24.124  1.00 154.90 ? 243 TYR A CZ  1 
ATOM   1502 O OH  . TYR A 1 208 ? -33.383 0.110   23.548  1.00 154.47 ? 243 TYR A OH  1 
ATOM   1503 N N   . ILE A 1 209 ? -29.194 4.098   25.636  1.00 135.59 ? 244 ILE A N   1 
ATOM   1504 C CA  . ILE A 1 209 ? -28.260 3.703   24.594  1.00 132.86 ? 244 ILE A CA  1 
ATOM   1505 C C   . ILE A 1 209 ? -28.833 2.470   23.904  1.00 132.79 ? 244 ILE A C   1 
ATOM   1506 O O   . ILE A 1 209 ? -28.832 1.378   24.476  1.00 131.65 ? 244 ILE A O   1 
ATOM   1507 C CB  . ILE A 1 209 ? -26.867 3.408   25.179  1.00 129.48 ? 244 ILE A CB  1 
ATOM   1508 C CG1 . ILE A 1 209 ? -26.278 4.687   25.783  1.00 129.92 ? 244 ILE A CG1 1 
ATOM   1509 C CG2 . ILE A 1 209 ? -25.945 2.837   24.108  1.00 126.94 ? 244 ILE A CG2 1 
ATOM   1510 C CD1 . ILE A 1 209 ? -25.413 4.461   27.006  1.00 128.18 ? 244 ILE A CD1 1 
ATOM   1511 N N   . PRO A 1 210 ? -29.325 2.648   22.666  1.00 147.23 ? 245 PRO A N   1 
ATOM   1512 C CA  . PRO A 1 210 ? -30.088 1.621   21.945  1.00 148.23 ? 245 PRO A CA  1 
ATOM   1513 C C   . PRO A 1 210 ? -29.302 0.329   21.811  1.00 145.24 ? 245 PRO A C   1 
ATOM   1514 O O   . PRO A 1 210 ? -29.822 -0.758  22.070  1.00 145.53 ? 245 PRO A O   1 
ATOM   1515 C CB  . PRO A 1 210 ? -30.280 2.239   20.557  1.00 149.98 ? 245 PRO A CB  1 
ATOM   1516 C CG  . PRO A 1 210 ? -30.139 3.698   20.764  1.00 151.17 ? 245 PRO A CG  1 
ATOM   1517 C CD  . PRO A 1 210 ? -29.132 3.862   21.858  1.00 148.46 ? 245 PRO A CD  1 
ATOM   1518 N N   . LEU A 1 211 ? -28.053 0.454   21.387  1.00 146.12 ? 246 LEU A N   1 
ATOM   1519 C CA  . LEU A 1 211 ? -27.159 -0.681  21.368  1.00 143.31 ? 246 LEU A CA  1 
ATOM   1520 C C   . LEU A 1 211 ? -25.820 -0.241  21.932  1.00 140.65 ? 246 LEU A C   1 
ATOM   1521 O O   . LEU A 1 211 ? -25.123 0.571   21.329  1.00 140.26 ? 246 LEU A O   1 
ATOM   1522 C CB  . LEU A 1 211 ? -27.002 -1.195  19.940  1.00 143.49 ? 246 LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 211 ? -26.942 -2.716  19.803  1.00 142.59 ? 246 LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 211 ? -28.015 -3.381  20.661  1.00 144.00 ? 246 LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 211 ? -27.057 -3.135  18.340  1.00 143.86 ? 246 LEU A CD2 1 
ATOM   1526 N N   . ASP A 1 212 ? -25.450 -0.787  23.081  1.00 135.04 ? 247 ASP A N   1 
ATOM   1527 C CA  . ASP A 1 212 ? -24.206 -0.380  23.702  1.00 132.86 ? 247 ASP A CA  1 
ATOM   1528 C C   . ASP A 1 212 ? -23.120 -1.400  23.445  1.00 130.28 ? 247 ASP A C   1 
ATOM   1529 O O   . ASP A 1 212 ? -23.343 -2.607  23.518  1.00 129.95 ? 247 ASP A O   1 
ATOM   1530 C CB  . ASP A 1 212 ? -24.375 -0.145  25.201  1.00 133.26 ? 247 ASP A CB  1 
ATOM   1531 C CG  . ASP A 1 212 ? -23.215 0.632   25.798  1.00 131.87 ? 247 ASP A CG  1 
ATOM   1532 O OD1 . ASP A 1 212 ? -22.558 1.379   25.041  1.00 131.39 ? 247 ASP A OD1 1 
ATOM   1533 O OD2 . ASP A 1 212 ? -22.957 0.499   27.016  1.00 131.57 ? 247 ASP A OD2 1 
ATOM   1534 N N   . GLN A 1 213 ? -21.937 -0.893  23.133  1.00 129.82 ? 248 GLN A N   1 
ATOM   1535 C CA  . GLN A 1 213 ? -20.795 -1.738  22.860  1.00 127.62 ? 248 GLN A CA  1 
ATOM   1536 C C   . GLN A 1 213 ? -19.865 -1.681  24.052  1.00 126.05 ? 248 GLN A C   1 
ATOM   1537 O O   . GLN A 1 213 ? -19.280 -0.641  24.354  1.00 125.93 ? 248 GLN A O   1 
ATOM   1538 C CB  . GLN A 1 213 ? -20.097 -1.274  21.589  1.00 127.50 ? 248 GLN A CB  1 
ATOM   1539 C CG  . GLN A 1 213 ? -21.086 -0.937  20.482  1.00 129.79 ? 248 GLN A CG  1 
ATOM   1540 C CD  . GLN A 1 213 ? -20.429 -0.748  19.136  1.00 130.07 ? 248 GLN A CD  1 
ATOM   1541 O OE1 . GLN A 1 213 ? -19.422 -1.383  18.834  1.00 128.60 ? 248 GLN A OE1 1 
ATOM   1542 N NE2 . GLN A 1 213 ? -21.000 0.126   18.314  1.00 132.33 ? 248 GLN A NE2 1 
ATOM   1543 N N   . ILE A 1 214 ? -19.767 -2.808  24.744  1.00 129.09 ? 249 ILE A N   1 
ATOM   1544 C CA  . ILE A 1 214 ? -18.953 -2.914  25.940  1.00 127.98 ? 249 ILE A CA  1 
ATOM   1545 C C   . ILE A 1 214 ? -17.781 -3.825  25.647  1.00 126.14 ? 249 ILE A C   1 
ATOM   1546 O O   . ILE A 1 214 ? -17.953 -4.921  25.120  1.00 125.99 ? 249 ILE A O   1 
ATOM   1547 C CB  . ILE A 1 214 ? -19.768 -3.480  27.110  1.00 129.04 ? 249 ILE A CB  1 
ATOM   1548 C CG1 . ILE A 1 214 ? -20.847 -2.477  27.520  1.00 131.20 ? 249 ILE A CG1 1 
ATOM   1549 C CG2 . ILE A 1 214 ? -18.864 -3.801  28.284  1.00 128.13 ? 249 ILE A CG2 1 
ATOM   1550 C CD1 . ILE A 1 214 ? -22.248 -3.067  27.603  1.00 133.15 ? 249 ILE A CD1 1 
ATOM   1551 N N   . ASP A 1 215 ? -16.581 -3.367  25.973  1.00 129.71 ? 250 ASP A N   1 
ATOM   1552 C CA  . ASP A 1 215 ? -15.408 -4.165  25.685  1.00 128.25 ? 250 ASP A CA  1 
ATOM   1553 C C   . ASP A 1 215 ? -15.409 -5.436  26.506  1.00 127.97 ? 250 ASP A C   1 
ATOM   1554 O O   . ASP A 1 215 ? -15.790 -5.440  27.673  1.00 128.61 ? 250 ASP A O   1 
ATOM   1555 C CB  . ASP A 1 215 ? -14.123 -3.384  25.933  1.00 127.49 ? 250 ASP A CB  1 
ATOM   1556 C CG  . ASP A 1 215 ? -12.888 -4.185  25.573  1.00 126.30 ? 250 ASP A CG  1 
ATOM   1557 O OD1 . ASP A 1 215 ? -12.742 -4.534  24.377  1.00 126.23 ? 250 ASP A OD1 1 
ATOM   1558 O OD2 . ASP A 1 215 ? -12.072 -4.464  26.484  1.00 125.77 ? 250 ASP A OD2 1 
ATOM   1559 N N   . ILE A 1 216 ? -14.996 -6.520  25.867  1.00 122.21 ? 251 ILE A N   1 
ATOM   1560 C CA  . ILE A 1 216 ? -14.770 -7.780  26.545  1.00 122.07 ? 251 ILE A CA  1 
ATOM   1561 C C   . ILE A 1 216 ? -13.273 -8.022  26.499  1.00 120.93 ? 251 ILE A C   1 
ATOM   1562 O O   . ILE A 1 216 ? -12.659 -7.892  25.441  1.00 120.48 ? 251 ILE A O   1 
ATOM   1563 C CB  . ILE A 1 216 ? -15.525 -8.917  25.851  1.00 122.81 ? 251 ILE A CB  1 
ATOM   1564 C CG1 . ILE A 1 216 ? -17.027 -8.653  25.930  1.00 124.28 ? 251 ILE A CG1 1 
ATOM   1565 C CG2 . ILE A 1 216 ? -15.183 -10.255 26.481  1.00 122.91 ? 251 ILE A CG2 1 
ATOM   1566 C CD1 . ILE A 1 216 ? -17.853 -9.692  25.234  1.00 125.41 ? 251 ILE A CD1 1 
ATOM   1567 N N   . ASP A 1 217 ? -12.681 -8.370  27.638  1.00 118.39 ? 252 ASP A N   1 
ATOM   1568 C CA  . ASP A 1 217 ? -11.229 -8.340  27.743  1.00 117.60 ? 252 ASP A CA  1 
ATOM   1569 C C   . ASP A 1 217 ? -10.537 -9.649  27.368  1.00 117.45 ? 252 ASP A C   1 
ATOM   1570 O O   . ASP A 1 217 ? -10.639 -10.661 28.064  1.00 118.01 ? 252 ASP A O   1 
ATOM   1571 C CB  . ASP A 1 217 ? -10.788 -7.903  29.135  1.00 117.89 ? 252 ASP A CB  1 
ATOM   1572 C CG  . ASP A 1 217 ? -9.330  -7.517  29.171  1.00 117.35 ? 252 ASP A CG  1 
ATOM   1573 O OD1 . ASP A 1 217 ? -8.757  -7.311  28.075  1.00 116.77 ? 252 ASP A OD1 1 
ATOM   1574 O OD2 . ASP A 1 217 ? -8.764  -7.410  30.281  1.00 117.82 ? 252 ASP A OD2 1 
ATOM   1575 N N   . VAL A 1 218 ? -9.826  -9.594  26.248  1.00 128.51 ? 253 VAL A N   1 
ATOM   1576 C CA  . VAL A 1 218 ? -9.024  -10.704 25.753  1.00 128.65 ? 253 VAL A CA  1 
ATOM   1577 C C   . VAL A 1 218 ? -7.544  -10.601 26.126  1.00 128.38 ? 253 VAL A C   1 
ATOM   1578 O O   . VAL A 1 218 ? -6.723  -11.368 25.627  1.00 128.69 ? 253 VAL A O   1 
ATOM   1579 C CB  . VAL A 1 218 ? -9.213  -10.936 24.242  1.00 129.01 ? 253 VAL A CB  1 
ATOM   1580 C CG1 . VAL A 1 218 ? -10.596 -11.517 23.974  1.00 129.76 ? 253 VAL A CG1 1 
ATOM   1581 C CG2 . VAL A 1 218 ? -9.007  -9.645  23.476  1.00 128.77 ? 253 VAL A CG2 1 
ATOM   1582 N N   . GLY A 1 219 ? -7.204  -9.644  26.985  1.00 121.44 ? 254 GLY A N   1 
ATOM   1583 C CA  . GLY A 1 219 ? -5.831  -9.503  27.435  1.00 121.51 ? 254 GLY A CA  1 
ATOM   1584 C C   . GLY A 1 219 ? -5.037  -8.343  26.865  1.00 121.34 ? 254 GLY A C   1 
ATOM   1585 O O   . GLY A 1 219 ? -3.808  -8.344  26.928  1.00 121.65 ? 254 GLY A O   1 
ATOM   1586 N N   . PHE A 1 220 ? -5.739  -7.363  26.302  1.00 105.67 ? 255 PHE A N   1 
ATOM   1587 C CA  . PHE A 1 220 ? -5.111  -6.188  25.703  1.00 105.86 ? 255 PHE A CA  1 
ATOM   1588 C C   . PHE A 1 220 ? -4.009  -5.568  26.554  1.00 106.21 ? 255 PHE A C   1 
ATOM   1589 O O   . PHE A 1 220 ? -2.919  -5.316  26.053  1.00 106.67 ? 255 PHE A O   1 
ATOM   1590 C CB  . PHE A 1 220 ? -6.166  -5.117  25.428  1.00 105.94 ? 255 PHE A CB  1 
ATOM   1591 C CG  . PHE A 1 220 ? -5.592  -3.778  25.032  1.00 106.50 ? 255 PHE A CG  1 
ATOM   1592 C CD1 . PHE A 1 220 ? -5.316  -3.494  23.707  1.00 107.03 ? 255 PHE A CD1 1 
ATOM   1593 C CD2 . PHE A 1 220 ? -5.350  -2.800  25.981  1.00 106.87 ? 255 PHE A CD2 1 
ATOM   1594 C CE1 . PHE A 1 220 ? -4.802  -2.270  23.337  1.00 107.90 ? 255 PHE A CE1 1 
ATOM   1595 C CE2 . PHE A 1 220 ? -4.835  -1.571  25.615  1.00 107.70 ? 255 PHE A CE2 1 
ATOM   1596 C CZ  . PHE A 1 220 ? -4.561  -1.308  24.290  1.00 108.20 ? 255 PHE A CZ  1 
ATOM   1597 N N   . ASP A 1 221 ? -4.287  -5.318  27.829  1.00 132.02 ? 256 ASP A N   1 
ATOM   1598 C CA  . ASP A 1 221 ? -3.357  -4.563  28.662  1.00 132.74 ? 256 ASP A CA  1 
ATOM   1599 C C   . ASP A 1 221 ? -1.977  -5.185  28.797  1.00 133.20 ? 256 ASP A C   1 
ATOM   1600 O O   . ASP A 1 221 ? -0.990  -4.475  28.975  1.00 134.00 ? 256 ASP A O   1 
ATOM   1601 C CB  . ASP A 1 221 ? -3.956  -4.282  30.038  1.00 133.26 ? 256 ASP A CB  1 
ATOM   1602 C CG  . ASP A 1 221 ? -4.846  -3.053  30.040  1.00 133.57 ? 256 ASP A CG  1 
ATOM   1603 O OD1 . ASP A 1 221 ? -4.321  -1.942  30.286  1.00 134.42 ? 256 ASP A OD1 1 
ATOM   1604 O OD2 . ASP A 1 221 ? -6.064  -3.198  29.788  1.00 133.23 ? 256 ASP A OD2 1 
ATOM   1605 N N   . LYS A 1 222 ? -1.903  -6.507  28.720  1.00 107.98 ? 257 LYS A N   1 
ATOM   1606 C CA  . LYS A 1 222 ? -0.606  -7.176  28.715  1.00 108.68 ? 257 LYS A CA  1 
ATOM   1607 C C   . LYS A 1 222 ? -0.151  -7.472  27.288  1.00 108.68 ? 257 LYS A C   1 
ATOM   1608 O O   . LYS A 1 222 ? 0.952   -7.962  27.069  1.00 109.52 ? 257 LYS A O   1 
ATOM   1609 C CB  . LYS A 1 222 ? -0.659  -8.465  29.530  1.00 109.02 ? 257 LYS A CB  1 
ATOM   1610 C CG  . LYS A 1 222 ? -0.938  -8.262  31.014  1.00 109.65 ? 257 LYS A CG  1 
ATOM   1611 C CD  . LYS A 1 222 ? -1.643  -9.485  31.626  1.00 109.91 ? 257 LYS A CD  1 
ATOM   1612 C CE  . LYS A 1 222 ? -3.182  -9.359  31.615  1.00 109.24 ? 257 LYS A CE  1 
ATOM   1613 N NZ  . LYS A 1 222 ? -3.816  -9.420  30.257  1.00 108.13 ? 257 LYS A NZ  1 
ATOM   1614 N N   . GLY A 1 223 ? -1.005  -7.163  26.320  1.00 116.06 ? 258 GLY A N   1 
ATOM   1615 C CA  . GLY A 1 223 ? -0.681  -7.394  24.927  1.00 116.46 ? 258 GLY A CA  1 
ATOM   1616 C C   . GLY A 1 223 ? -0.776  -8.864  24.576  1.00 116.62 ? 258 GLY A C   1 
ATOM   1617 O O   . GLY A 1 223 ? -0.137  -9.333  23.631  1.00 117.51 ? 258 GLY A O   1 
ATOM   1618 N N   . LEU A 1 224 ? -1.568  -9.598  25.351  1.00 109.24 ? 259 LEU A N   1 
ATOM   1619 C CA  . LEU A 1 224 ? -1.806  -11.008 25.073  1.00 109.63 ? 259 LEU A CA  1 
ATOM   1620 C C   . LEU A 1 224 ? -2.846  -11.154 23.973  1.00 109.49 ? 259 LEU A C   1 
ATOM   1621 O O   . LEU A 1 224 ? -3.017  -12.235 23.406  1.00 110.18 ? 259 LEU A O   1 
ATOM   1622 C CB  . LEU A 1 224 ? -2.239  -11.748 26.338  1.00 109.59 ? 259 LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 224 ? -1.154  -11.761 27.413  1.00 110.24 ? 259 LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 224 ? -1.654  -12.378 28.703  1.00 110.58 ? 259 LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 224 ? 0.066   -12.496 26.901  1.00 111.39 ? 259 LEU A CD2 1 
ATOM   1626 N N   . ASP A 1 225 ? -3.529  -10.054 23.665  1.00 128.68 ? 260 ASP A N   1 
ATOM   1627 C CA  . ASP A 1 225 ? -4.454  -10.020 22.539  1.00 128.91 ? 260 ASP A CA  1 
ATOM   1628 C C   . ASP A 1 225 ? -3.687  -10.048 21.221  1.00 130.06 ? 260 ASP A C   1 
ATOM   1629 O O   . ASP A 1 225 ? -4.280  -10.172 20.151  1.00 130.79 ? 260 ASP A O   1 
ATOM   1630 C CB  . ASP A 1 225 ? -5.358  -8.787  22.605  1.00 128.36 ? 260 ASP A CB  1 
ATOM   1631 C CG  . ASP A 1 225 ? -4.622  -7.491  22.279  1.00 128.60 ? 260 ASP A CG  1 
ATOM   1632 O OD1 . ASP A 1 225 ? -3.614  -7.177  22.951  1.00 128.56 ? 260 ASP A OD1 1 
ATOM   1633 O OD2 . ASP A 1 225 ? -5.059  -6.776  21.348  1.00 129.12 ? 260 ASP A OD2 1 
ATOM   1634 N N   . ARG A 1 226 ? -2.365  -9.909  21.309  1.00 108.50 ? 261 ARG A N   1 
ATOM   1635 C CA  . ARG A 1 226 ? -1.481  -10.105 20.161  1.00 110.06 ? 261 ARG A CA  1 
ATOM   1636 C C   . ARG A 1 226 ? -1.284  -11.596 19.982  1.00 110.95 ? 261 ARG A C   1 
ATOM   1637 O O   . ARG A 1 226 ? -0.887  -12.286 20.914  1.00 110.72 ? 261 ARG A O   1 
ATOM   1638 C CB  . ARG A 1 226 ? -0.123  -9.441  20.404  1.00 110.61 ? 261 ARG A CB  1 
ATOM   1639 C CG  . ARG A 1 226 ? -0.129  -7.940  20.254  1.00 110.51 ? 261 ARG A CG  1 
ATOM   1640 C CD  . ARG A 1 226 ? 0.758   -7.272  21.290  1.00 110.31 ? 261 ARG A CD  1 
ATOM   1641 N NE  . ARG A 1 226 ? 2.174   -7.282  20.948  1.00 111.93 ? 261 ARG A NE  1 
ATOM   1642 C CZ  . ARG A 1 226 ? 3.087   -7.998  21.592  1.00 112.39 ? 261 ARG A CZ  1 
ATOM   1643 N NH1 . ARG A 1 226 ? 2.727   -8.768  22.609  1.00 111.37 ? 261 ARG A NH1 1 
ATOM   1644 N NH2 . ARG A 1 226 ? 4.361   -7.944  21.224  1.00 114.19 ? 261 ARG A NH2 1 
ATOM   1645 N N   . ILE A 1 227 ? -1.563  -12.104 18.793  1.00 106.94 ? 262 ILE A N   1 
ATOM   1646 C CA  . ILE A 1 227 ? -1.528  -13.542 18.595  1.00 108.09 ? 262 ILE A CA  1 
ATOM   1647 C C   . ILE A 1 227 ? -0.673  -13.956 17.406  1.00 110.50 ? 262 ILE A C   1 
ATOM   1648 O O   . ILE A 1 227 ? -0.552  -13.222 16.421  1.00 111.50 ? 262 ILE A O   1 
ATOM   1649 C CB  . ILE A 1 227 ? -2.950  -14.129 18.439  1.00 107.89 ? 262 ILE A CB  1 
ATOM   1650 C CG1 . ILE A 1 227 ? -3.562  -13.715 17.100  1.00 109.03 ? 262 ILE A CG1 1 
ATOM   1651 C CG2 . ILE A 1 227 ? -3.839  -13.694 19.599  1.00 105.90 ? 262 ILE A CG2 1 
ATOM   1652 C CD1 . ILE A 1 227 ? -4.948  -14.243 16.890  1.00 109.21 ? 262 ILE A CD1 1 
ATOM   1653 N N   . PHE A 1 228 ? -0.092  -15.147 17.507  1.00 131.72 ? 263 PHE A N   1 
ATOM   1654 C CA  . PHE A 1 228 ? 0.643   -15.731 16.406  1.00 134.48 ? 263 PHE A CA  1 
ATOM   1655 C C   . PHE A 1 228 ? -0.209  -16.893 15.936  1.00 135.66 ? 263 PHE A C   1 
ATOM   1656 O O   . PHE A 1 228 ? -0.314  -17.907 16.622  1.00 135.66 ? 263 PHE A O   1 
ATOM   1657 C CB  . PHE A 1 228 ? 2.013   -16.205 16.898  1.00 135.52 ? 263 PHE A CB  1 
ATOM   1658 C CG  . PHE A 1 228 ? 2.838   -16.893 15.851  1.00 138.76 ? 263 PHE A CG  1 
ATOM   1659 C CD1 . PHE A 1 228 ? 3.180   -16.244 14.679  1.00 140.52 ? 263 PHE A CD1 1 
ATOM   1660 C CD2 . PHE A 1 228 ? 3.290   -18.186 16.051  1.00 140.43 ? 263 PHE A CD2 1 
ATOM   1661 C CE1 . PHE A 1 228 ? 3.944   -16.881 13.718  1.00 143.94 ? 263 PHE A CE1 1 
ATOM   1662 C CE2 . PHE A 1 228 ? 4.055   -18.824 15.096  1.00 143.78 ? 263 PHE A CE2 1 
ATOM   1663 C CZ  . PHE A 1 228 ? 4.382   -18.172 13.929  1.00 145.57 ? 263 PHE A CZ  1 
ATOM   1664 N N   . LEU A 1 229 ? -0.833  -16.735 14.771  1.00 120.55 ? 264 LEU A N   1 
ATOM   1665 C CA  . LEU A 1 229 ? -1.823  -17.700 14.305  1.00 121.76 ? 264 LEU A CA  1 
ATOM   1666 C C   . LEU A 1 229 ? -1.301  -18.557 13.164  1.00 125.34 ? 264 LEU A C   1 
ATOM   1667 O O   . LEU A 1 229 ? -1.182  -18.099 12.027  1.00 127.24 ? 264 LEU A O   1 
ATOM   1668 C CB  . LEU A 1 229 ? -3.105  -16.981 13.876  1.00 120.99 ? 264 LEU A CB  1 
ATOM   1669 C CG  . LEU A 1 229 ? -4.262  -17.806 13.304  1.00 122.49 ? 264 LEU A CG  1 
ATOM   1670 C CD1 . LEU A 1 229 ? -4.800  -18.797 14.333  1.00 121.59 ? 264 LEU A CD1 1 
ATOM   1671 C CD2 . LEU A 1 229 ? -5.375  -16.893 12.806  1.00 122.06 ? 264 LEU A CD2 1 
ATOM   1672 N N   . VAL A 1 230 ? -1.016  -19.816 13.473  1.00 139.49 ? 265 VAL A N   1 
ATOM   1673 C CA  . VAL A 1 230 ? -0.634  -20.778 12.452  1.00 143.27 ? 265 VAL A CA  1 
ATOM   1674 C C   . VAL A 1 230 ? -1.743  -21.815 12.389  1.00 144.21 ? 265 VAL A C   1 
ATOM   1675 O O   . VAL A 1 230 ? -2.556  -21.826 11.462  1.00 145.73 ? 265 VAL A O   1 
ATOM   1676 C CB  . VAL A 1 230 ? 0.707   -21.454 12.789  1.00 144.77 ? 265 VAL A CB  1 
ATOM   1677 C CG1 . VAL A 1 230 ? 1.193   -22.272 11.612  1.00 149.13 ? 265 VAL A CG1 1 
ATOM   1678 C CG2 . VAL A 1 230 ? 1.743   -20.410 13.160  1.00 143.44 ? 265 VAL A CG2 1 
ATOM   1679 N N   . SER A 1 231 ? -1.786  -22.671 13.400  1.00 150.91 ? 266 SER A N   1 
ATOM   1680 C CA  . SER A 1 231 ? -2.927  -23.540 13.594  1.00 151.39 ? 266 SER A CA  1 
ATOM   1681 C C   . SER A 1 231 ? -4.008  -22.710 14.280  1.00 148.12 ? 266 SER A C   1 
ATOM   1682 O O   . SER A 1 231 ? -3.715  -21.655 14.847  1.00 145.48 ? 266 SER A O   1 
ATOM   1683 C CB  . SER A 1 231 ? -2.544  -24.742 14.459  1.00 152.26 ? 266 SER A CB  1 
ATOM   1684 O OG  . SER A 1 231 ? -2.310  -24.347 15.799  1.00 149.35 ? 266 SER A OG  1 
ATOM   1685 N N   . PRO A 1 232 ? -5.265  -23.170 14.209  1.00 125.97 ? 267 PRO A N   1 
ATOM   1686 C CA  . PRO A 1 232 ? -6.387  -22.519 14.895  1.00 123.38 ? 267 PRO A CA  1 
ATOM   1687 C C   . PRO A 1 232 ? -6.144  -22.351 16.395  1.00 120.76 ? 267 PRO A C   1 
ATOM   1688 O O   . PRO A 1 232 ? -5.626  -23.265 17.039  1.00 121.53 ? 267 PRO A O   1 
ATOM   1689 C CB  . PRO A 1 232 ? -7.554  -23.490 14.654  1.00 125.39 ? 267 PRO A CB  1 
ATOM   1690 C CG  . PRO A 1 232 ? -6.924  -24.765 14.152  1.00 128.73 ? 267 PRO A CG  1 
ATOM   1691 C CD  . PRO A 1 232 ? -5.708  -24.329 13.418  1.00 129.46 ? 267 PRO A CD  1 
ATOM   1692 N N   . ILE A 1 233 ? -6.517  -21.194 16.936  1.00 132.35 ? 268 ILE A N   1 
ATOM   1693 C CA  . ILE A 1 233 ? -6.345  -20.918 18.359  1.00 130.12 ? 268 ILE A CA  1 
ATOM   1694 C C   . ILE A 1 233 ? -7.678  -20.726 19.067  1.00 128.97 ? 268 ILE A C   1 
ATOM   1695 O O   . ILE A 1 233 ? -8.639  -20.216 18.488  1.00 128.92 ? 268 ILE A O   1 
ATOM   1696 C CB  . ILE A 1 233 ? -5.530  -19.634 18.600  1.00 128.11 ? 268 ILE A CB  1 
ATOM   1697 C CG1 . ILE A 1 233 ? -4.174  -19.700 17.905  1.00 129.43 ? 268 ILE A CG1 1 
ATOM   1698 C CG2 . ILE A 1 233 ? -5.328  -19.397 20.087  1.00 126.29 ? 268 ILE A CG2 1 
ATOM   1699 C CD1 . ILE A 1 233 ? -3.355  -18.438 18.098  1.00 127.86 ? 268 ILE A CD1 1 
ATOM   1700 N N   . THR A 1 234 ? -7.724  -21.132 20.329  1.00 122.37 ? 269 THR A N   1 
ATOM   1701 C CA  . THR A 1 234 ? -8.848  -20.805 21.190  1.00 121.30 ? 269 THR A CA  1 
ATOM   1702 C C   . THR A 1 234 ? -8.574  -19.503 21.923  1.00 118.89 ? 269 THR A C   1 
ATOM   1703 O O   . THR A 1 234 ? -7.585  -19.383 22.648  1.00 118.21 ? 269 THR A O   1 
ATOM   1704 C CB  . THR A 1 234 ? -9.111  -21.900 22.224  1.00 122.40 ? 269 THR A CB  1 
ATOM   1705 O OG1 . THR A 1 234 ? -9.773  -23.002 21.589  1.00 124.82 ? 269 THR A OG1 1 
ATOM   1706 C CG2 . THR A 1 234 ? -9.993  -21.366 23.339  1.00 121.24 ? 269 THR A CG2 1 
ATOM   1707 N N   . ILE A 1 235 ? -9.453  -18.528 21.731  1.00 123.23 ? 270 ILE A N   1 
ATOM   1708 C CA  . ILE A 1 235 ? -9.332  -17.244 22.406  1.00 121.28 ? 270 ILE A CA  1 
ATOM   1709 C C   . ILE A 1 235 ? -10.048 -17.247 23.749  1.00 120.90 ? 270 ILE A C   1 
ATOM   1710 O O   . ILE A 1 235 ? -11.209 -17.638 23.840  1.00 121.76 ? 270 ILE A O   1 
ATOM   1711 C CB  . ILE A 1 235 ? -9.897  -16.123 21.548  1.00 120.76 ? 270 ILE A CB  1 
ATOM   1712 C CG1 . ILE A 1 235 ? -8.990  -15.900 20.341  1.00 121.24 ? 270 ILE A CG1 1 
ATOM   1713 C CG2 . ILE A 1 235 ? -10.026 -14.860 22.364  1.00 119.14 ? 270 ILE A CG2 1 
ATOM   1714 C CD1 . ILE A 1 235 ? -9.704  -16.037 19.038  1.00 122.75 ? 270 ILE A CD1 1 
ATOM   1715 N N   . LEU A 1 236 ? -9.347  -16.799 24.785  1.00 128.17 ? 271 LEU A N   1 
ATOM   1716 C CA  . LEU A 1 236 ? -9.849  -16.856 26.155  1.00 128.27 ? 271 LEU A CA  1 
ATOM   1717 C C   . LEU A 1 236 ? -10.291 -15.501 26.686  1.00 127.12 ? 271 LEU A C   1 
ATOM   1718 O O   . LEU A 1 236 ? -9.548  -14.524 26.616  1.00 126.02 ? 271 LEU A O   1 
ATOM   1719 C CB  . LEU A 1 236 ? -8.766  -17.395 27.091  1.00 128.65 ? 271 LEU A CB  1 
ATOM   1720 C CG  . LEU A 1 236 ? -8.549  -18.899 27.202  1.00 130.45 ? 271 LEU A CG  1 
ATOM   1721 C CD1 . LEU A 1 236 ? -7.269  -19.201 27.980  1.00 130.84 ? 271 LEU A CD1 1 
ATOM   1722 C CD2 . LEU A 1 236 ? -9.749  -19.526 27.873  1.00 131.76 ? 271 LEU A CD2 1 
ATOM   1723 N N   . HIS A 1 237 ? -11.496 -15.451 27.235  1.00 115.43 ? 272 HIS A N   1 
ATOM   1724 C CA  . HIS A 1 237 ? -11.908 -14.306 28.023  1.00 114.89 ? 272 HIS A CA  1 
ATOM   1725 C C   . HIS A 1 237 ? -12.202 -14.776 29.433  1.00 116.06 ? 272 HIS A C   1 
ATOM   1726 O O   . HIS A 1 237 ? -13.204 -15.448 29.672  1.00 117.45 ? 272 HIS A O   1 
ATOM   1727 C CB  . HIS A 1 237 ? -13.161 -13.655 27.442  1.00 115.02 ? 272 HIS A CB  1 
ATOM   1728 C CG  . HIS A 1 237 ? -13.891 -12.790 28.424  1.00 115.31 ? 272 HIS A CG  1 
ATOM   1729 N ND1 . HIS A 1 237 ? -13.399 -11.577 28.857  1.00 114.46 ? 272 HIS A ND1 1 
ATOM   1730 C CD2 . HIS A 1 237 ? -15.059 -12.977 29.078  1.00 116.72 ? 272 HIS A CD2 1 
ATOM   1731 C CE1 . HIS A 1 237 ? -14.243 -11.047 29.725  1.00 115.35 ? 272 HIS A CE1 1 
ATOM   1732 N NE2 . HIS A 1 237 ? -15.259 -11.875 29.877  1.00 116.73 ? 272 HIS A NE2 1 
ATOM   1733 N N   . GLU A 1 238 ? -11.340 -14.402 30.370  1.00 153.19 ? 273 GLU A N   1 
ATOM   1734 C CA  . GLU A 1 238 ? -11.566 -14.720 31.769  1.00 154.66 ? 273 GLU A CA  1 
ATOM   1735 C C   . GLU A 1 238 ? -12.746 -13.905 32.256  1.00 155.22 ? 273 GLU A C   1 
ATOM   1736 O O   . GLU A 1 238 ? -12.774 -12.683 32.113  1.00 154.29 ? 273 GLU A O   1 
ATOM   1737 C CB  . GLU A 1 238 ? -10.329 -14.401 32.606  1.00 154.57 ? 273 GLU A CB  1 
ATOM   1738 C CG  . GLU A 1 238 ? -9.158  -15.334 32.360  1.00 154.67 ? 273 GLU A CG  1 
ATOM   1739 C CD  . GLU A 1 238 ? -7.813  -14.634 32.496  1.00 153.87 ? 273 GLU A CD  1 
ATOM   1740 O OE1 . GLU A 1 238 ? -7.480  -13.805 31.617  1.00 152.40 ? 273 GLU A OE1 1 
ATOM   1741 O OE2 . GLU A 1 238 ? -7.093  -14.913 33.479  1.00 155.01 ? 273 GLU A OE2 1 
ATOM   1742 N N   . ILE A 1 239 ? -13.731 -14.588 32.820  1.00 116.80 ? 274 ILE A N   1 
ATOM   1743 C CA  . ILE A 1 239 ? -14.892 -13.906 33.348  1.00 117.87 ? 274 ILE A CA  1 
ATOM   1744 C C   . ILE A 1 239 ? -14.613 -13.605 34.806  1.00 119.23 ? 274 ILE A C   1 
ATOM   1745 O O   . ILE A 1 239 ? -14.512 -14.511 35.634  1.00 121.01 ? 274 ILE A O   1 
ATOM   1746 C CB  . ILE A 1 239 ? -16.149 -14.771 33.222  1.00 119.67 ? 274 ILE A CB  1 
ATOM   1747 C CG1 . ILE A 1 239 ? -16.437 -15.067 31.746  1.00 118.69 ? 274 ILE A CG1 1 
ATOM   1748 C CG2 . ILE A 1 239 ? -17.333 -14.079 33.867  1.00 121.24 ? 274 ILE A CG2 1 
ATOM   1749 C CD1 . ILE A 1 239 ? -17.579 -16.028 31.522  1.00 120.68 ? 274 ILE A CD1 1 
ATOM   1750 N N   . ASN A 1 240 ? -14.470 -12.323 35.111  1.00 134.93 ? 275 ASN A N   1 
ATOM   1751 C CA  . ASN A 1 240 ? -14.115 -11.901 36.457  1.00 136.42 ? 275 ASN A CA  1 
ATOM   1752 C C   . ASN A 1 240 ? -14.862 -10.648 36.877  1.00 137.25 ? 275 ASN A C   1 
ATOM   1753 O O   . ASN A 1 240 ? -15.780 -10.203 36.190  1.00 136.90 ? 275 ASN A O   1 
ATOM   1754 C CB  . ASN A 1 240 ? -12.601 -11.714 36.599  1.00 135.34 ? 275 ASN A CB  1 
ATOM   1755 C CG  . ASN A 1 240 ? -12.022 -10.763 35.565  1.00 132.93 ? 275 ASN A CG  1 
ATOM   1756 O OD1 . ASN A 1 240 ? -12.711 -9.881  35.056  1.00 132.38 ? 275 ASN A OD1 1 
ATOM   1757 N ND2 . ASN A 1 240 ? -10.746 -10.944 35.249  1.00 131.81 ? 275 ASN A ND2 1 
ATOM   1758 N N   . GLU A 1 241 ? -14.463 -10.088 38.010  1.00 160.48 ? 276 GLU A N   1 
ATOM   1759 C CA  . GLU A 1 241 ? -15.163 -8.956  38.605  1.00 162.02 ? 276 GLU A CA  1 
ATOM   1760 C C   . GLU A 1 241 ? -15.407 -7.848  37.583  1.00 160.22 ? 276 GLU A C   1 
ATOM   1761 O O   . GLU A 1 241 ? -16.441 -7.184  37.608  1.00 161.37 ? 276 GLU A O   1 
ATOM   1762 C CB  . GLU A 1 241 ? -14.378 -8.420  39.803  1.00 163.60 ? 276 GLU A CB  1 
ATOM   1763 C CG  . GLU A 1 241 ? -13.977 -9.493  40.821  1.00 165.66 ? 276 GLU A CG  1 
ATOM   1764 C CD  . GLU A 1 241 ? -12.911 -10.458 40.288  1.00 163.85 ? 276 GLU A CD  1 
ATOM   1765 O OE1 . GLU A 1 241 ? -11.730 -10.051 40.198  1.00 162.65 ? 276 GLU A OE1 1 
ATOM   1766 O OE2 . GLU A 1 241 ? -13.253 -11.618 39.955  1.00 163.89 ? 276 GLU A OE2 1 
ATOM   1767 N N   . ASP A 1 242 ? -14.464 -7.680  36.663  1.00 139.65 ? 277 ASP A N   1 
ATOM   1768 C CA  . ASP A 1 242 ? -14.512 -6.585  35.700  1.00 138.20 ? 277 ASP A CA  1 
ATOM   1769 C C   . ASP A 1 242 ? -15.188 -6.979  34.393  1.00 136.97 ? 277 ASP A C   1 
ATOM   1770 O O   . ASP A 1 242 ? -15.247 -6.185  33.450  1.00 135.91 ? 277 ASP A O   1 
ATOM   1771 C CB  . ASP A 1 242 ? -13.103 -6.081  35.416  1.00 136.65 ? 277 ASP A CB  1 
ATOM   1772 C CG  . ASP A 1 242 ? -12.468 -5.426  36.624  1.00 138.16 ? 277 ASP A CG  1 
ATOM   1773 O OD1 . ASP A 1 242 ? -13.128 -4.570  37.257  1.00 139.94 ? 277 ASP A OD1 1 
ATOM   1774 O OD2 . ASP A 1 242 ? -11.310 -5.773  36.941  1.00 137.87 ? 277 ASP A OD2 1 
ATOM   1775 N N   . SER A 1 243 ? -15.686 -8.211  34.340  1.00 131.40 ? 278 SER A N   1 
ATOM   1776 C CA  . SER A 1 243 ? -16.371 -8.710  33.156  1.00 130.73 ? 278 SER A CA  1 
ATOM   1777 C C   . SER A 1 243 ? -17.859 -8.394  33.209  1.00 132.49 ? 278 SER A C   1 
ATOM   1778 O O   . SER A 1 243 ? -18.476 -8.463  34.269  1.00 134.62 ? 278 SER A O   1 
ATOM   1779 C CB  . SER A 1 243 ? -16.168 -10.219 33.010  1.00 130.71 ? 278 SER A CB  1 
ATOM   1780 O OG  . SER A 1 243 ? -16.703 -10.684 31.785  1.00 130.20 ? 278 SER A OG  1 
ATOM   1781 N N   . PRO A 1 244 ? -18.436 -8.032  32.057  1.00 112.81 ? 279 PRO A N   1 
ATOM   1782 C CA  . PRO A 1 244 ? -19.887 -7.869  31.905  1.00 114.64 ? 279 PRO A CA  1 
ATOM   1783 C C   . PRO A 1 244 ? -20.616 -9.208  32.044  1.00 116.06 ? 279 PRO A C   1 
ATOM   1784 O O   . PRO A 1 244 ? -21.836 -9.246  32.190  1.00 118.17 ? 279 PRO A O   1 
ATOM   1785 C CB  . PRO A 1 244 ? -20.034 -7.300  30.484  1.00 113.56 ? 279 PRO A CB  1 
ATOM   1786 C CG  . PRO A 1 244 ? -18.774 -7.675  29.783  1.00 111.32 ? 279 PRO A CG  1 
ATOM   1787 C CD  . PRO A 1 244 ? -17.706 -7.678  30.828  1.00 110.76 ? 279 PRO A CD  1 
ATOM   1788 N N   . LEU A 1 245 ? -19.863 -10.301 31.975  1.00 123.62 ? 280 LEU A N   1 
ATOM   1789 C CA  . LEU A 1 245 ? -20.430 -11.636 32.129  1.00 125.17 ? 280 LEU A CA  1 
ATOM   1790 C C   . LEU A 1 245 ? -20.305 -12.156 33.561  1.00 126.89 ? 280 LEU A C   1 
ATOM   1791 O O   . LEU A 1 245 ? -20.703 -13.284 33.856  1.00 128.56 ? 280 LEU A O   1 
ATOM   1792 C CB  . LEU A 1 245 ? -19.759 -12.611 31.160  1.00 123.79 ? 280 LEU A CB  1 
ATOM   1793 C CG  . LEU A 1 245 ? -19.837 -12.248 29.675  1.00 122.54 ? 280 LEU A CG  1 
ATOM   1794 C CD1 . LEU A 1 245 ? -19.209 -13.328 28.802  1.00 121.82 ? 280 LEU A CD1 1 
ATOM   1795 C CD2 . LEU A 1 245 ? -21.279 -12.017 29.276  1.00 124.32 ? 280 LEU A CD2 1 
ATOM   1796 N N   . PHE A 1 246 ? -19.753 -11.329 34.444  1.00 110.35 ? 281 PHE A N   1 
ATOM   1797 C CA  . PHE A 1 246 ? -19.505 -11.718 35.832  1.00 112.22 ? 281 PHE A CA  1 
ATOM   1798 C C   . PHE A 1 246 ? -20.745 -12.244 36.559  1.00 115.58 ? 281 PHE A C   1 
ATOM   1799 O O   . PHE A 1 246 ? -20.654 -13.178 37.354  1.00 117.40 ? 281 PHE A O   1 
ATOM   1800 C CB  . PHE A 1 246 ? -18.909 -10.539 36.604  1.00 112.12 ? 281 PHE A CB  1 
ATOM   1801 C CG  . PHE A 1 246 ? -18.408 -10.893 37.980  1.00 114.03 ? 281 PHE A CG  1 
ATOM   1802 C CD1 . PHE A 1 246 ? -17.496 -11.918 38.160  1.00 113.64 ? 281 PHE A CD1 1 
ATOM   1803 C CD2 . PHE A 1 246 ? -18.827 -10.181 39.091  1.00 116.54 ? 281 PHE A CD2 1 
ATOM   1804 C CE1 . PHE A 1 246 ? -17.024 -12.239 39.424  1.00 115.75 ? 281 PHE A CE1 1 
ATOM   1805 C CE2 . PHE A 1 246 ? -18.358 -10.497 40.355  1.00 118.71 ? 281 PHE A CE2 1 
ATOM   1806 C CZ  . PHE A 1 246 ? -17.456 -11.526 40.520  1.00 118.31 ? 281 PHE A CZ  1 
ATOM   1807 N N   . GLY A 1 247 ? -21.901 -11.646 36.295  1.00 157.05 ? 282 GLY A N   1 
ATOM   1808 C CA  . GLY A 1 247 ? -23.107 -12.022 37.008  1.00 160.62 ? 282 GLY A CA  1 
ATOM   1809 C C   . GLY A 1 247 ? -24.000 -12.999 36.272  1.00 161.61 ? 282 GLY A C   1 
ATOM   1810 O O   . GLY A 1 247 ? -25.189 -13.097 36.573  1.00 164.57 ? 282 GLY A O   1 
ATOM   1811 N N   . ILE A 1 248 ? -23.436 -13.728 35.313  1.00 149.11 ? 283 ILE A N   1 
ATOM   1812 C CA  . ILE A 1 248 ? -24.237 -14.611 34.466  1.00 150.06 ? 283 ILE A CA  1 
ATOM   1813 C C   . ILE A 1 248 ? -23.992 -16.102 34.679  1.00 151.25 ? 283 ILE A C   1 
ATOM   1814 O O   . ILE A 1 248 ? -22.856 -16.574 34.621  1.00 149.53 ? 283 ILE A O   1 
ATOM   1815 C CB  . ILE A 1 248 ? -24.047 -14.295 32.979  1.00 147.49 ? 283 ILE A CB  1 
ATOM   1816 C CG1 . ILE A 1 248 ? -24.669 -12.940 32.650  1.00 147.35 ? 283 ILE A CG1 1 
ATOM   1817 C CG2 . ILE A 1 248 ? -24.676 -15.381 32.125  1.00 148.67 ? 283 ILE A CG2 1 
ATOM   1818 C CD1 . ILE A 1 248 ? -24.880 -12.717 31.178  1.00 146.08 ? 283 ILE A CD1 1 
ATOM   1819 N N   . SER A 1 249 ? -25.082 -16.833 34.909  1.00 134.30 ? 284 SER A N   1 
ATOM   1820 C CA  . SER A 1 249 ? -25.050 -18.281 35.091  1.00 136.18 ? 284 SER A CA  1 
ATOM   1821 C C   . SER A 1 249 ? -25.555 -18.989 33.838  1.00 136.34 ? 284 SER A C   1 
ATOM   1822 O O   . SER A 1 249 ? -25.912 -18.341 32.854  1.00 135.01 ? 284 SER A O   1 
ATOM   1823 C CB  . SER A 1 249 ? -25.918 -18.670 36.280  1.00 140.41 ? 284 SER A CB  1 
ATOM   1824 O OG  . SER A 1 249 ? -27.240 -18.193 36.104  1.00 142.44 ? 284 SER A OG  1 
ATOM   1825 N N   . ARG A 1 250 ? -25.596 -20.318 33.876  1.00 143.81 ? 285 ARG A N   1 
ATOM   1826 C CA  . ARG A 1 250 ? -26.016 -21.077 32.706  1.00 144.36 ? 285 ARG A CA  1 
ATOM   1827 C C   . ARG A 1 250 ? -27.497 -20.873 32.411  1.00 146.96 ? 285 ARG A C   1 
ATOM   1828 O O   . ARG A 1 250 ? -27.924 -20.940 31.257  1.00 146.82 ? 285 ARG A O   1 
ATOM   1829 C CB  . ARG A 1 250 ? -25.714 -22.568 32.865  1.00 146.35 ? 285 ARG A CB  1 
ATOM   1830 C CG  . ARG A 1 250 ? -25.750 -23.317 31.538  1.00 146.29 ? 285 ARG A CG  1 
ATOM   1831 C CD  . ARG A 1 250 ? -25.706 -24.824 31.709  1.00 149.21 ? 285 ARG A CD  1 
ATOM   1832 N NE  . ARG A 1 250 ? -27.047 -25.399 31.703  1.00 153.24 ? 285 ARG A NE  1 
ATOM   1833 C CZ  . ARG A 1 250 ? -27.347 -26.586 31.185  1.00 155.89 ? 285 ARG A CZ  1 
ATOM   1834 N NH1 . ARG A 1 250 ? -26.395 -27.325 30.628  1.00 154.93 ? 285 ARG A NH1 1 
ATOM   1835 N NH2 . ARG A 1 250 ? -28.598 -27.031 31.222  1.00 159.81 ? 285 ARG A NH2 1 
ATOM   1836 N N   . GLN A 1 251 ? -28.281 -20.625 33.456  1.00 143.75 ? 286 GLN A N   1 
ATOM   1837 C CA  . GLN A 1 251 ? -29.709 -20.387 33.281  1.00 146.66 ? 286 GLN A CA  1 
ATOM   1838 C C   . GLN A 1 251 ? -29.961 -19.015 32.654  1.00 144.59 ? 286 GLN A C   1 
ATOM   1839 O O   . GLN A 1 251 ? -30.784 -18.882 31.752  1.00 145.51 ? 286 GLN A O   1 
ATOM   1840 C CB  . GLN A 1 251 ? -30.462 -20.527 34.604  1.00 150.66 ? 286 GLN A CB  1 
ATOM   1841 C CG  . GLN A 1 251 ? -31.977 -20.633 34.447  1.00 154.67 ? 286 GLN A CG  1 
ATOM   1842 C CD  . GLN A 1 251 ? -32.680 -21.019 35.745  1.00 159.31 ? 286 GLN A CD  1 
ATOM   1843 O OE1 . GLN A 1 251 ? -32.037 -21.423 36.715  1.00 159.83 ? 286 GLN A OE1 1 
ATOM   1844 N NE2 . GLN A 1 251 ? -34.005 -20.890 35.767  1.00 163.04 ? 286 GLN A NE2 1 
ATOM   1845 N N   . ASP A 1 252 ? -29.240 -17.999 33.126  1.00 153.10 ? 287 ASP A N   1 
ATOM   1846 C CA  . ASP A 1 252 ? -29.351 -16.653 32.569  1.00 151.17 ? 287 ASP A CA  1 
ATOM   1847 C C   . ASP A 1 252 ? -29.113 -16.705 31.074  1.00 149.03 ? 287 ASP A C   1 
ATOM   1848 O O   . ASP A 1 252 ? -29.624 -15.884 30.317  1.00 148.75 ? 287 ASP A O   1 
ATOM   1849 C CB  . ASP A 1 252 ? -28.315 -15.724 33.187  1.00 148.49 ? 287 ASP A CB  1 
ATOM   1850 C CG  . ASP A 1 252 ? -28.437 -15.624 34.690  1.00 150.77 ? 287 ASP A CG  1 
ATOM   1851 O OD1 . ASP A 1 252 ? -29.575 -15.655 35.202  1.00 154.38 ? 287 ASP A OD1 1 
ATOM   1852 O OD2 . ASP A 1 252 ? -27.385 -15.504 35.357  1.00 149.22 ? 287 ASP A OD2 1 
ATOM   1853 N N   . LEU A 1 253 ? -28.315 -17.682 30.664  1.00 152.45 ? 288 LEU A N   1 
ATOM   1854 C CA  . LEU A 1 253 ? -27.852 -17.783 29.289  1.00 150.42 ? 288 LEU A CA  1 
ATOM   1855 C C   . LEU A 1 253 ? -28.990 -18.134 28.335  1.00 152.91 ? 288 LEU A C   1 
ATOM   1856 O O   . LEU A 1 253 ? -28.995 -17.713 27.174  1.00 151.87 ? 288 LEU A O   1 
ATOM   1857 C CB  . LEU A 1 253 ? -26.734 -18.820 29.200  1.00 149.16 ? 288 LEU A CB  1 
ATOM   1858 C CG  . LEU A 1 253 ? -25.632 -18.535 28.186  1.00 145.90 ? 288 LEU A CG  1 
ATOM   1859 C CD1 . LEU A 1 253 ? -25.160 -17.098 28.309  1.00 143.31 ? 288 LEU A CD1 1 
ATOM   1860 C CD2 . LEU A 1 253 ? -24.480 -19.509 28.384  1.00 145.02 ? 288 LEU A CD2 1 
ATOM   1861 N N   . GLU A 1 254 ? -29.964 -18.891 28.832  1.00 162.48 ? 289 GLU A N   1 
ATOM   1862 C CA  . GLU A 1 254 ? -31.120 -19.285 28.028  1.00 165.49 ? 289 GLU A CA  1 
ATOM   1863 C C   . GLU A 1 254 ? -32.226 -18.229 28.123  1.00 167.13 ? 289 GLU A C   1 
ATOM   1864 O O   . GLU A 1 254 ? -33.348 -18.434 27.658  1.00 170.28 ? 289 GLU A O   1 
ATOM   1865 C CB  . GLU A 1 254 ? -31.621 -20.685 28.418  1.00 169.05 ? 289 GLU A CB  1 
ATOM   1866 C CG  . GLU A 1 254 ? -31.780 -20.932 29.911  1.00 170.90 ? 289 GLU A CG  1 
ATOM   1867 C CD  . GLU A 1 254 ? -31.738 -22.415 30.282  1.00 173.51 ? 289 GLU A CD  1 
ATOM   1868 O OE1 . GLU A 1 254 ? -30.728 -23.087 29.975  1.00 171.74 ? 289 GLU A OE1 1 
ATOM   1869 O OE2 . GLU A 1 254 ? -32.716 -22.907 30.885  1.00 177.62 ? 289 GLU A OE2 1 
ATOM   1870 N N   . THR A 1 255 ? -31.889 -17.108 28.756  1.00 172.20 ? 290 THR A N   1 
ATOM   1871 C CA  . THR A 1 255 ? -32.793 -15.977 28.942  1.00 173.62 ? 290 THR A CA  1 
ATOM   1872 C C   . THR A 1 255 ? -32.338 -14.733 28.170  1.00 170.73 ? 290 THR A C   1 
ATOM   1873 O O   . THR A 1 255 ? -33.056 -14.228 27.310  1.00 171.88 ? 290 THR A O   1 
ATOM   1874 C CB  . THR A 1 255 ? -32.914 -15.597 30.432  1.00 174.78 ? 290 THR A CB  1 
ATOM   1875 O OG1 . THR A 1 255 ? -33.371 -16.728 31.184  1.00 177.96 ? 290 THR A OG1 1 
ATOM   1876 C CG2 . THR A 1 255 ? -33.888 -14.443 30.607  1.00 176.74 ? 290 THR A CG2 1 
ATOM   1877 N N   . ASP A 1 256 ? -31.132 -14.262 28.491  1.00 192.48 ? 291 ASP A N   1 
ATOM   1878 C CA  . ASP A 1 256 ? -30.641 -12.918 28.147  1.00 190.04 ? 291 ASP A CA  1 
ATOM   1879 C C   . ASP A 1 256 ? -30.643 -12.507 26.667  1.00 189.15 ? 291 ASP A C   1 
ATOM   1880 O O   . ASP A 1 256 ? -30.503 -13.328 25.763  1.00 189.09 ? 291 ASP A O   1 
ATOM   1881 C CB  . ASP A 1 256 ? -29.233 -12.717 28.715  1.00 186.74 ? 291 ASP A CB  1 
ATOM   1882 C CG  . ASP A 1 256 ? -29.208 -12.712 30.233  1.00 187.79 ? 291 ASP A CG  1 
ATOM   1883 O OD1 . ASP A 1 256 ? -28.186 -12.279 30.812  1.00 185.61 ? 291 ASP A OD1 1 
ATOM   1884 O OD2 . ASP A 1 256 ? -30.211 -13.132 30.851  1.00 191.10 ? 291 ASP A OD2 1 
ATOM   1885 N N   . ASP A 1 257 ? -30.801 -11.202 26.454  1.00 213.41 ? 292 ASP A N   1 
ATOM   1886 C CA  . ASP A 1 257 ? -30.943 -10.602 25.127  1.00 213.26 ? 292 ASP A CA  1 
ATOM   1887 C C   . ASP A 1 257 ? -29.630 -10.126 24.516  1.00 209.79 ? 292 ASP A C   1 
ATOM   1888 O O   . ASP A 1 257 ? -29.630 -9.504  23.452  1.00 209.70 ? 292 ASP A O   1 
ATOM   1889 C CB  . ASP A 1 257 ? -31.905 -9.413  25.179  1.00 215.39 ? 292 ASP A CB  1 
ATOM   1890 C CG  . ASP A 1 257 ? -33.349 -9.836  25.384  1.00 219.50 ? 292 ASP A CG  1 
ATOM   1891 O OD1 . ASP A 1 257 ? -33.723 -10.944 24.932  1.00 220.90 ? 292 ASP A OD1 1 
ATOM   1892 O OD2 . ASP A 1 257 ? -34.113 -9.056  25.994  1.00 221.61 ? 292 ASP A OD2 1 
ATOM   1893 N N   . PHE A 1 258 ? -28.517 -10.387 25.192  1.00 156.05 ? 293 PHE A N   1 
ATOM   1894 C CA  . PHE A 1 258 ? -27.233 -9.877  24.722  1.00 153.00 ? 293 PHE A CA  1 
ATOM   1895 C C   . PHE A 1 258 ? -26.638 -10.669 23.560  1.00 152.12 ? 293 PHE A C   1 
ATOM   1896 O O   . PHE A 1 258 ? -26.955 -11.844 23.349  1.00 153.36 ? 293 PHE A O   1 
ATOM   1897 C CB  . PHE A 1 258 ? -26.227 -9.768  25.861  1.00 150.93 ? 293 PHE A CB  1 
ATOM   1898 C CG  . PHE A 1 258 ? -25.663 -11.089 26.295  1.00 150.35 ? 293 PHE A CG  1 
ATOM   1899 C CD1 . PHE A 1 258 ? -24.606 -11.667 25.609  1.00 148.45 ? 293 PHE A CD1 1 
ATOM   1900 C CD2 . PHE A 1 258 ? -26.183 -11.749 27.393  1.00 152.05 ? 293 PHE A CD2 1 
ATOM   1901 C CE1 . PHE A 1 258 ? -24.085 -12.881 26.009  1.00 148.22 ? 293 PHE A CE1 1 
ATOM   1902 C CE2 . PHE A 1 258 ? -25.668 -12.959 27.800  1.00 151.87 ? 293 PHE A CE2 1 
ATOM   1903 C CZ  . PHE A 1 258 ? -24.616 -13.528 27.108  1.00 149.92 ? 293 PHE A CZ  1 
ATOM   1904 N N   . GLU A 1 259 ? -25.769 -9.993  22.816  1.00 157.49 ? 294 GLU A N   1 
ATOM   1905 C CA  . GLU A 1 259 ? -25.042 -10.582 21.702  1.00 156.71 ? 294 GLU A CA  1 
ATOM   1906 C C   . GLU A 1 259 ? -23.581 -10.196 21.822  1.00 153.86 ? 294 GLU A C   1 
ATOM   1907 O O   . GLU A 1 259 ? -23.256 -9.096  22.266  1.00 152.80 ? 294 GLU A O   1 
ATOM   1908 C CB  . GLU A 1 259 ? -25.584 -10.052 20.378  1.00 158.32 ? 294 GLU A CB  1 
ATOM   1909 C CG  . GLU A 1 259 ? -24.645 -10.256 19.204  1.00 157.51 ? 294 GLU A CG  1 
ATOM   1910 C CD  . GLU A 1 259 ? -25.064 -9.472  17.971  1.00 159.20 ? 294 GLU A CD  1 
ATOM   1911 O OE1 . GLU A 1 259 ? -24.459 -9.683  16.897  1.00 159.36 ? 294 GLU A OE1 1 
ATOM   1912 O OE2 . GLU A 1 259 ? -25.994 -8.643  18.076  1.00 160.69 ? 294 GLU A OE2 1 
ATOM   1913 N N   . ILE A 1 260 ? -22.693 -11.100 21.430  1.00 133.61 ? 295 ILE A N   1 
ATOM   1914 C CA  . ILE A 1 260 ? -21.266 -10.806 21.474  1.00 131.22 ? 295 ILE A CA  1 
ATOM   1915 C C   . ILE A 1 260 ? -20.652 -10.716 20.084  1.00 131.21 ? 295 ILE A C   1 
ATOM   1916 O O   . ILE A 1 260 ? -20.817 -11.613 19.256  1.00 132.52 ? 295 ILE A O   1 
ATOM   1917 C CB  . ILE A 1 260 ? -20.486 -11.843 22.301  1.00 130.16 ? 295 ILE A CB  1 
ATOM   1918 C CG1 . ILE A 1 260 ? -20.927 -11.796 23.762  1.00 130.31 ? 295 ILE A CG1 1 
ATOM   1919 C CG2 . ILE A 1 260 ? -18.995 -11.584 22.207  1.00 128.08 ? 295 ILE A CG2 1 
ATOM   1920 C CD1 . ILE A 1 260 ? -20.092 -12.662 24.672  1.00 129.46 ? 295 ILE A CD1 1 
ATOM   1921 N N   . VAL A 1 261 ? -19.943 -9.621  19.837  1.00 120.30 ? 296 VAL A N   1 
ATOM   1922 C CA  . VAL A 1 261 ? -19.190 -9.469  18.603  1.00 120.40 ? 296 VAL A CA  1 
ATOM   1923 C C   . VAL A 1 261 ? -17.731 -9.852  18.814  1.00 118.61 ? 296 VAL A C   1 
ATOM   1924 O O   . VAL A 1 261 ? -17.152 -9.578  19.865  1.00 116.97 ? 296 VAL A O   1 
ATOM   1925 C CB  . VAL A 1 261 ? -19.268 -8.033  18.073  1.00 120.80 ? 296 VAL A CB  1 
ATOM   1926 C CG1 . VAL A 1 261 ? -18.195 -7.794  17.024  1.00 120.73 ? 296 VAL A CG1 1 
ATOM   1927 C CG2 . VAL A 1 261 ? -20.640 -7.771  17.503  1.00 123.20 ? 296 VAL A CG2 1 
ATOM   1928 N N   . VAL A 1 262 ? -17.144 -10.502 17.816  1.00 124.00 ? 297 VAL A N   1 
ATOM   1929 C CA  . VAL A 1 262 ? -15.729 -10.833 17.857  1.00 122.76 ? 297 VAL A CA  1 
ATOM   1930 C C   . VAL A 1 262 ? -15.010 -10.298 16.623  1.00 123.50 ? 297 VAL A C   1 
ATOM   1931 O O   . VAL A 1 262 ? -15.538 -10.346 15.512  1.00 125.51 ? 297 VAL A O   1 
ATOM   1932 C CB  . VAL A 1 262 ? -15.492 -12.352 17.988  1.00 123.15 ? 297 VAL A CB  1 
ATOM   1933 C CG1 . VAL A 1 262 ? -15.958 -12.852 19.350  1.00 122.46 ? 297 VAL A CG1 1 
ATOM   1934 C CG2 . VAL A 1 262 ? -16.192 -13.097 16.868  1.00 125.58 ? 297 VAL A CG2 1 
ATOM   1935 N N   . ILE A 1 263 ? -13.799 -9.788  16.827  1.00 110.84 ? 298 ILE A N   1 
ATOM   1936 C CA  . ILE A 1 263 ? -13.002 -9.261  15.731  1.00 111.77 ? 298 ILE A CA  1 
ATOM   1937 C C   . ILE A 1 263 ? -11.604 -9.850  15.732  1.00 111.26 ? 298 ILE A C   1 
ATOM   1938 O O   . ILE A 1 263 ? -11.048 -10.162 16.784  1.00 109.65 ? 298 ILE A O   1 
ATOM   1939 C CB  . ILE A 1 263 ? -12.872 -7.739  15.820  1.00 111.35 ? 298 ILE A CB  1 
ATOM   1940 C CG1 . ILE A 1 263 ? -14.242 -7.102  16.051  1.00 111.83 ? 298 ILE A CG1 1 
ATOM   1941 C CG2 . ILE A 1 263 ? -12.210 -7.193  14.563  1.00 112.99 ? 298 ILE A CG2 1 
ATOM   1942 C CD1 . ILE A 1 263 ? -14.201 -5.850  16.910  1.00 110.73 ? 298 ILE A CD1 1 
ATOM   1943 N N   . LEU A 1 264 ? -11.056 -10.022 14.536  1.00 120.19 ? 299 LEU A N   1 
ATOM   1944 C CA  . LEU A 1 264 ? -9.647  -10.331 14.365  1.00 120.23 ? 299 LEU A CA  1 
ATOM   1945 C C   . LEU A 1 264 ? -9.087  -9.438  13.263  1.00 121.89 ? 299 LEU A C   1 
ATOM   1946 O O   . LEU A 1 264 ? -9.481  -9.554  12.106  1.00 124.26 ? 299 LEU A O   1 
ATOM   1947 C CB  . LEU A 1 264 ? -9.470  -11.803 13.995  1.00 121.49 ? 299 LEU A CB  1 
ATOM   1948 C CG  . LEU A 1 264 ? -8.048  -12.286 13.712  1.00 122.15 ? 299 LEU A CG  1 
ATOM   1949 C CD1 . LEU A 1 264 ? -7.152  -12.034 14.902  1.00 119.95 ? 299 LEU A CD1 1 
ATOM   1950 C CD2 . LEU A 1 264 ? -8.051  -13.760 13.362  1.00 123.76 ? 299 LEU A CD2 1 
ATOM   1951 N N   . GLU A 1 265 ? -8.177  -8.541  13.620  1.00 124.44 ? 300 GLU A N   1 
ATOM   1952 C CA  . GLU A 1 265 ? -7.543  -7.697  12.622  1.00 126.30 ? 300 GLU A CA  1 
ATOM   1953 C C   . GLU A 1 265 ? -6.122  -8.180  12.396  1.00 127.01 ? 300 GLU A C   1 
ATOM   1954 O O   . GLU A 1 265 ? -5.661  -9.090  13.078  1.00 125.89 ? 300 GLU A O   1 
ATOM   1955 C CB  . GLU A 1 265 ? -7.583  -6.228  13.052  1.00 125.49 ? 300 GLU A CB  1 
ATOM   1956 C CG  . GLU A 1 265 ? -8.932  -5.543  12.796  1.00 126.11 ? 300 GLU A CG  1 
ATOM   1957 C CD  . GLU A 1 265 ? -9.427  -4.703  13.978  1.00 124.14 ? 300 GLU A CD  1 
ATOM   1958 O OE1 . GLU A 1 265 ? -9.194  -5.101  15.145  1.00 122.02 ? 300 GLU A OE1 1 
ATOM   1959 O OE2 . GLU A 1 265 ? -10.058 -3.647  13.739  1.00 125.04 ? 300 GLU A OE2 1 
ATOM   1960 N N   . GLY A 1 266 ? -5.428  -7.557  11.451  1.00 116.62 ? 301 GLY A N   1 
ATOM   1961 C CA  . GLY A 1 266 ? -4.091  -7.976  11.063  1.00 118.03 ? 301 GLY A CA  1 
ATOM   1962 C C   . GLY A 1 266 ? -3.895  -7.688  9.589   1.00 121.62 ? 301 GLY A C   1 
ATOM   1963 O O   . GLY A 1 266 ? -4.755  -7.072  8.969   1.00 122.81 ? 301 GLY A O   1 
ATOM   1964 N N   . MET A 1 267 ? -2.787  -8.135  9.011   1.00 176.16 ? 302 MET A N   1 
ATOM   1965 C CA  . MET A 1 267 ? -2.534  -7.847  7.607   1.00 180.10 ? 302 MET A CA  1 
ATOM   1966 C C   . MET A 1 267 ? -2.093  -9.087  6.849   1.00 182.75 ? 302 MET A C   1 
ATOM   1967 O O   . MET A 1 267 ? -1.200  -9.807  7.294   1.00 182.31 ? 302 MET A O   1 
ATOM   1968 C CB  . MET A 1 267 ? -1.479  -6.755  7.472   1.00 181.22 ? 302 MET A CB  1 
ATOM   1969 C CG  . MET A 1 267 ? -1.707  -5.589  8.403   1.00 178.61 ? 302 MET A CG  1 
ATOM   1970 S SD  . MET A 1 267 ? -0.446  -4.314  8.252   1.00 180.36 ? 302 MET A SD  1 
ATOM   1971 C CE  . MET A 1 267 ? -0.929  -3.531  6.716   1.00 184.61 ? 302 MET A CE  1 
ATOM   1972 N N   . VAL A 1 268 ? -2.726  -9.336  5.708   1.00 163.72 ? 303 VAL A N   1 
ATOM   1973 C CA  . VAL A 1 268 ? -2.375  -10.483 4.890   1.00 166.89 ? 303 VAL A CA  1 
ATOM   1974 C C   . VAL A 1 268 ? -0.905  -10.417 4.502   1.00 169.28 ? 303 VAL A C   1 
ATOM   1975 O O   . VAL A 1 268 ? -0.431  -9.398  3.998   1.00 171.07 ? 303 VAL A O   1 
ATOM   1976 C CB  . VAL A 1 268 ? -3.244  -10.562 3.632   1.00 170.51 ? 303 VAL A CB  1 
ATOM   1977 C CG1 . VAL A 1 268 ? -2.776  -11.708 2.744   1.00 174.40 ? 303 VAL A CG1 1 
ATOM   1978 C CG2 . VAL A 1 268 ? -4.708  -10.729 4.021   1.00 168.48 ? 303 VAL A CG2 1 
ATOM   1979 N N   . GLU A 1 269 ? -0.191  -11.511 4.745   1.00 193.60 ? 304 GLU A N   1 
ATOM   1980 C CA  . GLU A 1 269 ? 1.254   -11.554 4.543   1.00 195.75 ? 304 GLU A CA  1 
ATOM   1981 C C   . GLU A 1 269 ? 1.658   -10.995 3.180   1.00 200.60 ? 304 GLU A C   1 
ATOM   1982 O O   . GLU A 1 269 ? 2.616   -10.227 3.081   1.00 201.81 ? 304 GLU A O   1 
ATOM   1983 C CB  . GLU A 1 269 ? 1.764   -12.987 4.710   1.00 196.57 ? 304 GLU A CB  1 
ATOM   1984 C CG  . GLU A 1 269 ? 3.275   -13.117 4.877   1.00 197.95 ? 304 GLU A CG  1 
ATOM   1985 C CD  . GLU A 1 269 ? 3.720   -14.563 5.042   1.00 199.06 ? 304 GLU A CD  1 
ATOM   1986 O OE1 . GLU A 1 269 ? 3.015   -15.469 4.542   1.00 200.57 ? 304 GLU A OE1 1 
ATOM   1987 O OE2 . GLU A 1 269 ? 4.771   -14.792 5.680   1.00 198.66 ? 304 GLU A OE2 1 
ATOM   1988 N N   . ALA A 1 270 ? 0.926   -11.376 2.136   1.00 198.73 ? 305 ALA A N   1 
ATOM   1989 C CA  . ALA A 1 270 ? 1.235   -10.926 0.777   1.00 204.00 ? 305 ALA A CA  1 
ATOM   1990 C C   . ALA A 1 270 ? 0.869   -9.460  0.514   1.00 204.13 ? 305 ALA A C   1 
ATOM   1991 O O   . ALA A 1 270 ? 1.698   -8.681  0.039   1.00 206.79 ? 305 ALA A O   1 
ATOM   1992 C CB  . ALA A 1 270 ? 0.564   -11.835 -0.249  1.00 207.74 ? 305 ALA A CB  1 
ATOM   1993 N N   . THR A 1 271 ? -0.370  -9.093  0.838   1.00 185.08 ? 306 THR A N   1 
ATOM   1994 C CA  . THR A 1 271 ? -0.918  -7.787  0.471   1.00 185.81 ? 306 THR A CA  1 
ATOM   1995 C C   . THR A 1 271 ? -0.495  -6.619  1.368   1.00 182.76 ? 306 THR A C   1 
ATOM   1996 O O   . THR A 1 271 ? -0.260  -5.507  0.888   1.00 184.95 ? 306 THR A O   1 
ATOM   1997 C CB  . THR A 1 271 ? -2.464  -7.821  0.410   1.00 184.77 ? 306 THR A CB  1 
ATOM   1998 O OG1 . THR A 1 271 ? -2.994  -8.061  1.720   1.00 179.46 ? 306 THR A OG1 1 
ATOM   1999 C CG2 . THR A 1 271 ? -2.942  -8.910  -0.540  1.00 188.34 ? 306 THR A CG2 1 
ATOM   2000 N N   . ALA A 1 272 ? -0.404  -6.873  2.669   1.00 260.57 ? 307 ALA A N   1 
ATOM   2001 C CA  . ALA A 1 272 ? -0.235  -5.803  3.652   1.00 257.39 ? 307 ALA A CA  1 
ATOM   2002 C C   . ALA A 1 272 ? -1.455  -4.885  3.614   1.00 256.64 ? 307 ALA A C   1 
ATOM   2003 O O   . ALA A 1 272 ? -1.374  -3.694  3.918   1.00 256.06 ? 307 ALA A O   1 
ATOM   2004 C CB  . ALA A 1 272 ? 1.054   -5.023  3.411   1.00 259.69 ? 307 ALA A CB  1 
ATOM   2005 N N   . MET A 1 273 ? -2.581  -5.458  3.206   1.00 181.84 ? 308 MET A N   1 
ATOM   2006 C CA  . MET A 1 273 ? -3.863  -4.798  3.345   1.00 180.71 ? 308 MET A CA  1 
ATOM   2007 C C   . MET A 1 273 ? -4.488  -5.263  4.652   1.00 175.92 ? 308 MET A C   1 
ATOM   2008 O O   . MET A 1 273 ? -4.863  -6.423  4.797   1.00 175.10 ? 308 MET A O   1 
ATOM   2009 C CB  . MET A 1 273 ? -4.778  -5.160  2.180   1.00 184.24 ? 308 MET A CB  1 
ATOM   2010 C CG  . MET A 1 273 ? -4.936  -4.066  1.143   1.00 188.30 ? 308 MET A CG  1 
ATOM   2011 S SD  . MET A 1 273 ? -6.638  -3.998  0.557   1.00 189.89 ? 308 MET A SD  1 
ATOM   2012 C CE  . MET A 1 273 ? -6.897  -5.716  0.119   1.00 191.06 ? 308 MET A CE  1 
ATOM   2013 N N   . THR A 1 274 ? -4.598  -4.355  5.609   1.00 141.85 ? 309 THR A N   1 
ATOM   2014 C CA  . THR A 1 274 ? -5.158  -4.717  6.897   1.00 137.65 ? 309 THR A CA  1 
ATOM   2015 C C   . THR A 1 274 ? -6.534  -5.337  6.700   1.00 137.64 ? 309 THR A C   1 
ATOM   2016 O O   . THR A 1 274 ? -7.352  -4.827  5.938   1.00 139.85 ? 309 THR A O   1 
ATOM   2017 C CB  . THR A 1 274 ? -5.260  -3.514  7.839   1.00 135.37 ? 309 THR A CB  1 
ATOM   2018 O OG1 . THR A 1 274 ? -4.132  -2.653  7.644   1.00 136.79 ? 309 THR A OG1 1 
ATOM   2019 C CG2 . THR A 1 274 ? -5.291  -3.983  9.278   1.00 131.38 ? 309 THR A CG2 1 
ATOM   2020 N N   . THR A 1 275 ? -6.776  -6.446  7.387   1.00 141.79 ? 310 THR A N   1 
ATOM   2021 C CA  . THR A 1 275 ? -8.030  -7.165  7.273   1.00 141.90 ? 310 THR A CA  1 
ATOM   2022 C C   . THR A 1 275 ? -8.747  -7.108  8.604   1.00 138.28 ? 310 THR A C   1 
ATOM   2023 O O   . THR A 1 275 ? -8.110  -7.157  9.656   1.00 135.64 ? 310 THR A O   1 
ATOM   2024 C CB  . THR A 1 275 ? -7.791  -8.641  6.965   1.00 142.91 ? 310 THR A CB  1 
ATOM   2025 O OG1 . THR A 1 275 ? -6.882  -8.771  5.865   1.00 146.31 ? 310 THR A OG1 1 
ATOM   2026 C CG2 . THR A 1 275 ? -9.111  -9.336  6.645   1.00 143.93 ? 310 THR A CG2 1 
ATOM   2027 N N   . GLN A 1 276 ? -10.070 -7.007  8.566   1.00 135.55 ? 311 GLN A N   1 
ATOM   2028 C CA  . GLN A 1 276 ? -10.853 -7.136  9.785   1.00 132.67 ? 311 GLN A CA  1 
ATOM   2029 C C   . GLN A 1 276 ? -11.921 -8.205  9.638   1.00 133.41 ? 311 GLN A C   1 
ATOM   2030 O O   . GLN A 1 276 ? -12.885 -8.041  8.887   1.00 135.64 ? 311 GLN A O   1 
ATOM   2031 C CB  . GLN A 1 276 ? -11.501 -5.809  10.168  1.00 132.05 ? 311 GLN A CB  1 
ATOM   2032 C CG  . GLN A 1 276 ? -12.354 -5.897  11.414  1.00 129.57 ? 311 GLN A CG  1 
ATOM   2033 C CD  . GLN A 1 276 ? -13.160 -4.644  11.653  1.00 129.72 ? 311 GLN A CD  1 
ATOM   2034 O OE1 . GLN A 1 276 ? -14.378 -4.641  11.499  1.00 130.75 ? 311 GLN A OE1 1 
ATOM   2035 N NE2 . GLN A 1 276 ? -12.484 -3.567  12.030  1.00 128.98 ? 311 GLN A NE2 1 
ATOM   2036 N N   . ALA A 1 277 ? -11.752 -9.289  10.386  1.00 134.38 ? 312 ALA A N   1 
ATOM   2037 C CA  . ALA A 1 277 ? -12.669 -10.416 10.332  1.00 135.21 ? 312 ALA A CA  1 
ATOM   2038 C C   . ALA A 1 277 ? -13.668 -10.343 11.478  1.00 133.17 ? 312 ALA A C   1 
ATOM   2039 O O   . ALA A 1 277 ? -13.298 -10.120 12.629  1.00 130.54 ? 312 ALA A O   1 
ATOM   2040 C CB  . ALA A 1 277 ? -11.901 -11.728 10.365  1.00 135.39 ? 312 ALA A CB  1 
ATOM   2041 N N   . ARG A 1 278 ? -14.939 -10.529 11.154  1.00 140.05 ? 313 ARG A N   1 
ATOM   2042 C CA  . ARG A 1 278 ? -15.994 -10.381 12.142  1.00 138.75 ? 313 ARG A CA  1 
ATOM   2043 C C   . ARG A 1 278 ? -16.849 -11.636 12.262  1.00 139.81 ? 313 ARG A C   1 
ATOM   2044 O O   . ARG A 1 278 ? -16.839 -12.499 11.379  1.00 142.07 ? 313 ARG A O   1 
ATOM   2045 C CB  . ARG A 1 278 ? -16.867 -9.173  11.794  1.00 139.86 ? 313 ARG A CB  1 
ATOM   2046 C CG  . ARG A 1 278 ? -16.277 -7.851  12.238  1.00 138.25 ? 313 ARG A CG  1 
ATOM   2047 C CD  . ARG A 1 278 ? -16.709 -6.709  11.342  1.00 140.44 ? 313 ARG A CD  1 
ATOM   2048 N NE  . ARG A 1 278 ? -15.986 -6.713  10.074  1.00 142.62 ? 313 ARG A NE  1 
ATOM   2049 C CZ  . ARG A 1 278 ? -16.568 -6.616  8.884   1.00 145.95 ? 313 ARG A CZ  1 
ATOM   2050 N NH1 . ARG A 1 278 ? -17.886 -6.506  8.800   1.00 147.38 ? 313 ARG A NH1 1 
ATOM   2051 N NH2 . ARG A 1 278 ? -15.835 -6.628  7.776   1.00 148.20 ? 313 ARG A NH2 1 
ATOM   2052 N N   . SER A 1 279 ? -17.588 -11.724 13.363  1.00 152.97 ? 314 SER A N   1 
ATOM   2053 C CA  . SER A 1 279 ? -18.530 -12.815 13.608  1.00 154.17 ? 314 SER A CA  1 
ATOM   2054 C C   . SER A 1 279 ? -19.243 -12.537 14.926  1.00 152.65 ? 314 SER A C   1 
ATOM   2055 O O   . SER A 1 279 ? -18.839 -11.649 15.674  1.00 150.56 ? 314 SER A O   1 
ATOM   2056 C CB  . SER A 1 279 ? -17.819 -14.172 13.654  1.00 154.28 ? 314 SER A CB  1 
ATOM   2057 O OG  . SER A 1 279 ? -18.754 -15.238 13.670  1.00 156.17 ? 314 SER A OG  1 
ATOM   2058 N N   . SER A 1 280 ? -20.307 -13.279 15.209  1.00 151.88 ? 315 SER A N   1 
ATOM   2059 C CA  . SER A 1 280 ? -21.139 -12.971 16.364  1.00 151.19 ? 315 SER A CA  1 
ATOM   2060 C C   . SER A 1 280 ? -21.666 -14.207 17.076  1.00 151.95 ? 315 SER A C   1 
ATOM   2061 O O   . SER A 1 280 ? -21.893 -15.245 16.459  1.00 153.94 ? 315 SER A O   1 
ATOM   2062 C CB  . SER A 1 280 ? -22.315 -12.088 15.947  1.00 152.96 ? 315 SER A CB  1 
ATOM   2063 O OG  . SER A 1 280 ? -23.316 -12.072 16.948  1.00 153.27 ? 315 SER A OG  1 
ATOM   2064 N N   . TYR A 1 281 ? -21.863 -14.080 18.384  1.00 149.37 ? 316 TYR A N   1 
ATOM   2065 C CA  . TYR A 1 281 ? -22.502 -15.127 19.165  1.00 150.50 ? 316 TYR A CA  1 
ATOM   2066 C C   . TYR A 1 281 ? -23.623 -14.527 19.999  1.00 151.17 ? 316 TYR A C   1 
ATOM   2067 O O   . TYR A 1 281 ? -23.380 -13.684 20.858  1.00 149.51 ? 316 TYR A O   1 
ATOM   2068 C CB  . TYR A 1 281 ? -21.492 -15.816 20.081  1.00 148.82 ? 316 TYR A CB  1 
ATOM   2069 C CG  . TYR A 1 281 ? -20.253 -16.313 19.372  1.00 148.12 ? 316 TYR A CG  1 
ATOM   2070 C CD1 . TYR A 1 281 ? -20.302 -17.429 18.545  1.00 150.17 ? 316 TYR A CD1 1 
ATOM   2071 C CD2 . TYR A 1 281 ? -19.032 -15.673 19.536  1.00 145.76 ? 316 TYR A CD2 1 
ATOM   2072 C CE1 . TYR A 1 281 ? -19.168 -17.888 17.896  1.00 149.92 ? 316 TYR A CE1 1 
ATOM   2073 C CE2 . TYR A 1 281 ? -17.894 -16.125 18.895  1.00 145.46 ? 316 TYR A CE2 1 
ATOM   2074 C CZ  . TYR A 1 281 ? -17.966 -17.231 18.077  1.00 147.55 ? 316 TYR A CZ  1 
ATOM   2075 O OH  . TYR A 1 281 ? -16.832 -17.679 17.439  1.00 147.62 ? 316 TYR A OH  1 
ATOM   2076 N N   . LEU A 1 282 ? -24.853 -14.949 19.734  1.00 137.68 ? 317 LEU A N   1 
ATOM   2077 C CA  . LEU A 1 282 ? -25.963 -14.591 20.598  1.00 138.90 ? 317 LEU A CA  1 
ATOM   2078 C C   . LEU A 1 282 ? -25.832 -15.382 21.888  1.00 138.64 ? 317 LEU A C   1 
ATOM   2079 O O   . LEU A 1 282 ? -25.181 -16.424 21.915  1.00 138.38 ? 317 LEU A O   1 
ATOM   2080 C CB  . LEU A 1 282 ? -27.293 -14.914 19.924  1.00 142.36 ? 317 LEU A CB  1 
ATOM   2081 C CG  . LEU A 1 282 ? -27.719 -13.983 18.793  1.00 143.41 ? 317 LEU A CG  1 
ATOM   2082 C CD1 . LEU A 1 282 ? -29.024 -14.464 18.183  1.00 147.25 ? 317 LEU A CD1 1 
ATOM   2083 C CD2 . LEU A 1 282 ? -27.863 -12.563 19.314  1.00 142.31 ? 317 LEU A CD2 1 
ATOM   2084 N N   . ALA A 1 283 ? -26.439 -14.888 22.961  1.00 126.21 ? 318 ALA A N   1 
ATOM   2085 C CA  . ALA A 1 283 ? -26.439 -15.622 24.217  1.00 126.64 ? 318 ALA A CA  1 
ATOM   2086 C C   . ALA A 1 283 ? -26.879 -17.056 23.930  1.00 129.07 ? 318 ALA A C   1 
ATOM   2087 O O   . ALA A 1 283 ? -26.345 -18.019 24.486  1.00 129.02 ? 318 ALA A O   1 
ATOM   2088 C CB  . ALA A 1 283 ? -27.371 -14.962 25.211  1.00 128.02 ? 318 ALA A CB  1 
ATOM   2089 N N   . SER A 1 284 ? -27.852 -17.183 23.036  1.00 140.66 ? 319 SER A N   1 
ATOM   2090 C CA  . SER A 1 284 ? -28.384 -18.480 22.642  1.00 143.51 ? 319 SER A CA  1 
ATOM   2091 C C   . SER A 1 284 ? -27.385 -19.332 21.856  1.00 142.72 ? 319 SER A C   1 
ATOM   2092 O O   . SER A 1 284 ? -27.557 -20.546 21.747  1.00 144.87 ? 319 SER A O   1 
ATOM   2093 C CB  . SER A 1 284 ? -29.658 -18.290 21.821  1.00 146.54 ? 319 SER A CB  1 
ATOM   2094 O OG  . SER A 1 284 ? -29.457 -17.349 20.780  1.00 145.44 ? 319 SER A OG  1 
ATOM   2095 N N   . GLU A 1 285 ? -26.360 -18.700 21.290  1.00 147.48 ? 320 GLU A N   1 
ATOM   2096 C CA  . GLU A 1 285 ? -25.367 -19.425 20.500  1.00 146.94 ? 320 GLU A CA  1 
ATOM   2097 C C   . GLU A 1 285 ? -24.146 -19.801 21.318  1.00 144.70 ? 320 GLU A C   1 
ATOM   2098 O O   . GLU A 1 285 ? -23.211 -20.412 20.806  1.00 144.25 ? 320 GLU A O   1 
ATOM   2099 C CB  . GLU A 1 285 ? -24.951 -18.622 19.272  1.00 146.01 ? 320 GLU A CB  1 
ATOM   2100 C CG  . GLU A 1 285 ? -25.724 -18.997 18.030  1.00 149.13 ? 320 GLU A CG  1 
ATOM   2101 C CD  . GLU A 1 285 ? -26.171 -17.787 17.241  1.00 149.32 ? 320 GLU A CD  1 
ATOM   2102 O OE1 . GLU A 1 285 ? -26.719 -17.967 16.130  1.00 151.98 ? 320 GLU A OE1 1 
ATOM   2103 O OE2 . GLU A 1 285 ? -25.978 -16.657 17.740  1.00 147.12 ? 320 GLU A OE2 1 
ATOM   2104 N N   . ILE A 1 286 ? -24.159 -19.432 22.591  1.00 140.98 ? 321 ILE A N   1 
ATOM   2105 C CA  . ILE A 1 286 ? -23.064 -19.776 23.486  1.00 139.27 ? 321 ILE A CA  1 
ATOM   2106 C C   . ILE A 1 286 ? -23.364 -21.076 24.216  1.00 141.58 ? 321 ILE A C   1 
ATOM   2107 O O   . ILE A 1 286 ? -24.372 -21.187 24.919  1.00 143.53 ? 321 ILE A O   1 
ATOM   2108 C CB  . ILE A 1 286 ? -22.790 -18.655 24.510  1.00 137.13 ? 321 ILE A CB  1 
ATOM   2109 C CG1 . ILE A 1 286 ? -22.432 -17.359 23.783  1.00 135.07 ? 321 ILE A CG1 1 
ATOM   2110 C CG2 . ILE A 1 286 ? -21.677 -19.064 25.473  1.00 135.82 ? 321 ILE A CG2 1 
ATOM   2111 C CD1 . ILE A 1 286 ? -22.321 -16.164 24.698  1.00 133.49 ? 321 ILE A CD1 1 
ATOM   2112 N N   . LEU A 1 287 ? -22.487 -22.059 24.044  1.00 132.68 ? 322 LEU A N   1 
ATOM   2113 C CA  . LEU A 1 287 ? -22.680 -23.363 24.665  1.00 135.20 ? 322 LEU A CA  1 
ATOM   2114 C C   . LEU A 1 287 ? -21.934 -23.459 25.985  1.00 134.18 ? 322 LEU A C   1 
ATOM   2115 O O   . LEU A 1 287 ? -20.706 -23.514 26.021  1.00 132.37 ? 322 LEU A O   1 
ATOM   2116 C CB  . LEU A 1 287 ? -22.235 -24.476 23.718  1.00 136.67 ? 322 LEU A CB  1 
ATOM   2117 C CG  . LEU A 1 287 ? -23.014 -24.537 22.403  1.00 138.49 ? 322 LEU A CG  1 
ATOM   2118 C CD1 . LEU A 1 287 ? -22.391 -25.538 21.441  1.00 139.91 ? 322 LEU A CD1 1 
ATOM   2119 C CD2 . LEU A 1 287 ? -24.484 -24.864 22.667  1.00 141.64 ? 322 LEU A CD2 1 
ATOM   2120 N N   . TRP A 1 288 ? -22.693 -23.502 27.071  1.00 130.59 ? 323 TRP A N   1 
ATOM   2121 C CA  . TRP A 1 288 ? -22.120 -23.500 28.406  1.00 130.15 ? 323 TRP A CA  1 
ATOM   2122 C C   . TRP A 1 288 ? -21.641 -24.898 28.766  1.00 132.20 ? 323 TRP A C   1 
ATOM   2123 O O   . TRP A 1 288 ? -22.241 -25.893 28.356  1.00 135.00 ? 323 TRP A O   1 
ATOM   2124 C CB  . TRP A 1 288 ? -23.167 -23.008 29.407  1.00 131.64 ? 323 TRP A CB  1 
ATOM   2125 C CG  . TRP A 1 288 ? -22.683 -22.844 30.818  1.00 131.56 ? 323 TRP A CG  1 
ATOM   2126 C CD1 . TRP A 1 288 ? -22.396 -23.837 31.706  1.00 133.66 ? 323 TRP A CD1 1 
ATOM   2127 C CD2 . TRP A 1 288 ? -22.482 -21.608 31.521  1.00 129.77 ? 323 TRP A CD2 1 
ATOM   2128 N NE1 . TRP A 1 288 ? -22.008 -23.300 32.910  1.00 133.31 ? 323 TRP A NE1 1 
ATOM   2129 C CE2 . TRP A 1 288 ? -22.051 -21.936 32.822  1.00 130.93 ? 323 TRP A CE2 1 
ATOM   2130 C CE3 . TRP A 1 288 ? -22.610 -20.261 31.170  1.00 127.60 ? 323 TRP A CE3 1 
ATOM   2131 C CZ2 . TRP A 1 288 ? -21.750 -20.956 33.777  1.00 130.04 ? 323 TRP A CZ2 1 
ATOM   2132 C CZ3 . TRP A 1 288 ? -22.310 -19.292 32.120  1.00 126.65 ? 323 TRP A CZ3 1 
ATOM   2133 C CH2 . TRP A 1 288 ? -21.885 -19.646 33.405  1.00 127.88 ? 323 TRP A CH2 1 
ATOM   2134 N N   . GLY A 1 289 ? -20.547 -24.964 29.518  1.00 128.86 ? 324 GLY A N   1 
ATOM   2135 C CA  . GLY A 1 289 ? -20.000 -26.229 29.973  1.00 130.95 ? 324 GLY A CA  1 
ATOM   2136 C C   . GLY A 1 289 ? -19.568 -27.171 28.865  1.00 131.70 ? 324 GLY A C   1 
ATOM   2137 O O   . GLY A 1 289 ? -19.792 -28.374 28.954  1.00 134.83 ? 324 GLY A O   1 
ATOM   2138 N N   . HIS A 1 290 ? -18.942 -26.627 27.827  1.00 136.53 ? 325 HIS A N   1 
ATOM   2139 C CA  . HIS A 1 290 ? -18.424 -27.441 26.735  1.00 137.35 ? 325 HIS A CA  1 
ATOM   2140 C C   . HIS A 1 290 ? -16.930 -27.179 26.543  1.00 134.98 ? 325 HIS A C   1 
ATOM   2141 O O   . HIS A 1 290 ? -16.316 -26.444 27.317  1.00 132.88 ? 325 HIS A O   1 
ATOM   2142 C CB  . HIS A 1 290 ? -19.176 -27.161 25.429  1.00 137.56 ? 325 HIS A CB  1 
ATOM   2143 C CG  . HIS A 1 290 ? -20.565 -27.724 25.387  1.00 140.77 ? 325 HIS A CG  1 
ATOM   2144 N ND1 . HIS A 1 290 ? -21.236 -27.972 24.206  1.00 142.43 ? 325 HIS A ND1 1 
ATOM   2145 C CD2 . HIS A 1 290 ? -21.413 -28.086 26.380  1.00 142.99 ? 325 HIS A CD2 1 
ATOM   2146 C CE1 . HIS A 1 290 ? -22.433 -28.459 24.474  1.00 145.45 ? 325 HIS A CE1 1 
ATOM   2147 N NE2 . HIS A 1 290 ? -22.566 -28.540 25.786  1.00 145.86 ? 325 HIS A NE2 1 
ATOM   2148 N N   . ARG A 1 291 ? -16.352 -27.791 25.514  1.00 128.09 ? 326 ARG A N   1 
ATOM   2149 C CA  . ARG A 1 291 ? -14.968 -27.537 25.135  1.00 126.21 ? 326 ARG A CA  1 
ATOM   2150 C C   . ARG A 1 291 ? -14.800 -27.849 23.652  1.00 127.06 ? 326 ARG A C   1 
ATOM   2151 O O   . ARG A 1 291 ? -15.611 -28.567 23.076  1.00 129.65 ? 326 ARG A O   1 
ATOM   2152 C CB  . ARG A 1 291 ? -14.011 -28.377 25.981  1.00 127.35 ? 326 ARG A CB  1 
ATOM   2153 C CG  . ARG A 1 291 ? -13.125 -27.553 26.901  1.00 124.89 ? 326 ARG A CG  1 
ATOM   2154 C CD  . ARG A 1 291 ? -13.045 -28.138 28.304  1.00 126.56 ? 326 ARG A CD  1 
ATOM   2155 N NE  . ARG A 1 291 ? -12.520 -29.500 28.320  1.00 129.49 ? 326 ARG A NE  1 
ATOM   2156 C CZ  . ARG A 1 291 ? -12.076 -30.110 29.414  1.00 131.24 ? 326 ARG A CZ  1 
ATOM   2157 N NH1 . ARG A 1 291 ? -12.083 -29.474 30.578  1.00 130.36 ? 326 ARG A NH1 1 
ATOM   2158 N NH2 . ARG A 1 291 ? -11.617 -31.351 29.343  1.00 134.18 ? 326 ARG A NH2 1 
ATOM   2159 N N   . PHE A 1 292 ? -13.766 -27.299 23.026  1.00 148.97 ? 327 PHE A N   1 
ATOM   2160 C CA  . PHE A 1 292 ? -13.552 -27.528 21.600  1.00 150.07 ? 327 PHE A CA  1 
ATOM   2161 C C   . PHE A 1 292 ? -12.831 -28.853 21.332  1.00 152.88 ? 327 PHE A C   1 
ATOM   2162 O O   . PHE A 1 292 ? -12.015 -29.302 22.137  1.00 153.02 ? 327 PHE A O   1 
ATOM   2163 C CB  . PHE A 1 292 ? -12.795 -26.356 20.969  1.00 147.43 ? 327 PHE A CB  1 
ATOM   2164 C CG  . PHE A 1 292 ? -13.649 -25.135 20.737  1.00 145.62 ? 327 PHE A CG  1 
ATOM   2165 C CD1 . PHE A 1 292 ? -14.492 -25.064 19.635  1.00 146.99 ? 327 PHE A CD1 1 
ATOM   2166 C CD2 . PHE A 1 292 ? -13.607 -24.059 21.614  1.00 142.90 ? 327 PHE A CD2 1 
ATOM   2167 C CE1 . PHE A 1 292 ? -15.281 -23.948 19.413  1.00 145.67 ? 327 PHE A CE1 1 
ATOM   2168 C CE2 . PHE A 1 292 ? -14.395 -22.936 21.400  1.00 141.57 ? 327 PHE A CE2 1 
ATOM   2169 C CZ  . PHE A 1 292 ? -15.233 -22.882 20.296  1.00 142.94 ? 327 PHE A CZ  1 
ATOM   2170 N N   . GLU A 1 293 ? -13.157 -29.483 20.208  1.00 183.44 ? 328 GLU A N   1 
ATOM   2171 C CA  . GLU A 1 293 ? -12.472 -30.698 19.782  1.00 186.52 ? 328 GLU A CA  1 
ATOM   2172 C C   . GLU A 1 293 ? -11.138 -30.322 19.157  1.00 185.50 ? 328 GLU A C   1 
ATOM   2173 O O   . GLU A 1 293 ? -11.111 -29.569 18.186  1.00 184.64 ? 328 GLU A O   1 
ATOM   2174 C CB  . GLU A 1 293 ? -13.316 -31.451 18.750  1.00 190.03 ? 328 GLU A CB  1 
ATOM   2175 C CG  . GLU A 1 293 ? -14.655 -31.954 19.269  1.00 191.83 ? 328 GLU A CG  1 
ATOM   2176 C CD  . GLU A 1 293 ? -14.645 -33.439 19.624  1.00 195.72 ? 328 GLU A CD  1 
ATOM   2177 O OE1 . GLU A 1 293 ? -13.598 -33.948 20.086  1.00 196.06 ? 328 GLU A OE1 1 
ATOM   2178 O OE2 . GLU A 1 293 ? -15.692 -34.098 19.433  1.00 198.73 ? 328 GLU A OE2 1 
ATOM   2179 N N   . PRO A 1 294 ? -10.027 -30.856 19.698  1.00 171.13 ? 329 PRO A N   1 
ATOM   2180 C CA  . PRO A 1 294 ? -8.687  -30.488 19.224  1.00 170.34 ? 329 PRO A CA  1 
ATOM   2181 C C   . PRO A 1 294 ? -8.539  -30.653 17.713  1.00 172.48 ? 329 PRO A C   1 
ATOM   2182 O O   . PRO A 1 294 ? -8.899  -31.693 17.157  1.00 176.03 ? 329 PRO A O   1 
ATOM   2183 C CB  . PRO A 1 294 ? -7.778  -31.478 19.952  1.00 172.17 ? 329 PRO A CB  1 
ATOM   2184 C CG  . PRO A 1 294 ? -8.516  -31.826 21.185  1.00 172.16 ? 329 PRO A CG  1 
ATOM   2185 C CD  . PRO A 1 294 ? -9.969  -31.857 20.776  1.00 172.87 ? 329 PRO A CD  1 
ATOM   2186 N N   . VAL A 1 295 ? -8.041  -29.609 17.057  1.00 163.67 ? 330 VAL A N   1 
ATOM   2187 C CA  . VAL A 1 295 ? -7.882  -29.607 15.608  1.00 165.79 ? 330 VAL A CA  1 
ATOM   2188 C C   . VAL A 1 295 ? -6.472  -29.989 15.137  1.00 167.60 ? 330 VAL A C   1 
ATOM   2189 O O   . VAL A 1 295 ? -6.241  -30.212 13.951  1.00 170.29 ? 330 VAL A O   1 
ATOM   2190 C CB  . VAL A 1 295 ? -8.286  -28.233 15.032  1.00 163.41 ? 330 VAL A CB  1 
ATOM   2191 C CG1 . VAL A 1 295 ? -8.284  -28.262 13.522  1.00 166.15 ? 330 VAL A CG1 1 
ATOM   2192 C CG2 . VAL A 1 295 ? -9.657  -27.816 15.539  1.00 161.79 ? 330 VAL A CG2 1 
ATOM   2193 N N   . LEU A 1 296 ? -5.539  -30.073 16.079  1.00 143.73 ? 331 LEU A N   1 
ATOM   2194 C CA  . LEU A 1 296 ? -4.124  -30.239 15.751  1.00 145.10 ? 331 LEU A CA  1 
ATOM   2195 C C   . LEU A 1 296 ? -3.573  -31.571 16.240  1.00 148.08 ? 331 LEU A C   1 
ATOM   2196 O O   . LEU A 1 296 ? -3.725  -31.919 17.411  1.00 147.28 ? 331 LEU A O   1 
ATOM   2197 C CB  . LEU A 1 296 ? -3.308  -29.100 16.372  1.00 141.63 ? 331 LEU A CB  1 
ATOM   2198 C CG  . LEU A 1 296 ? -1.791  -29.130 16.168  1.00 142.84 ? 331 LEU A CG  1 
ATOM   2199 C CD1 . LEU A 1 296 ? -1.442  -28.645 14.773  1.00 144.22 ? 331 LEU A CD1 1 
ATOM   2200 C CD2 . LEU A 1 296 ? -1.097  -28.280 17.217  1.00 139.71 ? 331 LEU A CD2 1 
ATOM   2201 N N   . PHE A 1 297 ? -2.923  -32.308 15.347  1.00 192.28 ? 332 PHE A N   1 
ATOM   2202 C CA  . PHE A 1 297 ? -2.347  -33.594 15.712  1.00 195.68 ? 332 PHE A CA  1 
ATOM   2203 C C   . PHE A 1 297 ? -0.913  -33.705 15.214  1.00 197.77 ? 332 PHE A C   1 
ATOM   2204 O O   . PHE A 1 297 ? -0.570  -33.166 14.162  1.00 198.34 ? 332 PHE A O   1 
ATOM   2205 C CB  . PHE A 1 297 ? -3.198  -34.732 15.150  1.00 199.58 ? 332 PHE A CB  1 
ATOM   2206 C CG  . PHE A 1 297 ? -4.656  -34.622 15.501  1.00 198.07 ? 332 PHE A CG  1 
ATOM   2207 C CD1 . PHE A 1 297 ? -5.134  -35.130 16.699  1.00 197.66 ? 332 PHE A CD1 1 
ATOM   2208 C CD2 . PHE A 1 297 ? -5.547  -33.999 14.641  1.00 197.39 ? 332 PHE A CD2 1 
ATOM   2209 C CE1 . PHE A 1 297 ? -6.476  -35.023 17.031  1.00 196.60 ? 332 PHE A CE1 1 
ATOM   2210 C CE2 . PHE A 1 297 ? -6.891  -33.891 14.968  1.00 196.28 ? 332 PHE A CE2 1 
ATOM   2211 C CZ  . PHE A 1 297 ? -7.354  -34.404 16.164  1.00 195.89 ? 332 PHE A CZ  1 
ATOM   2212 N N   . GLU A 1 298 ? -0.072  -34.388 15.985  1.00 179.84 ? 333 GLU A N   1 
ATOM   2213 C CA  . GLU A 1 298 ? 1.293   -34.656 15.554  1.00 182.57 ? 333 GLU A CA  1 
ATOM   2214 C C   . GLU A 1 298 ? 1.429   -36.060 14.973  1.00 188.11 ? 333 GLU A C   1 
ATOM   2215 O O   . GLU A 1 298 ? 1.156   -37.056 15.651  1.00 189.94 ? 333 GLU A O   1 
ATOM   2216 C CB  . GLU A 1 298 ? 2.294   -34.470 16.702  1.00 181.17 ? 333 GLU A CB  1 
ATOM   2217 C CG  . GLU A 1 298 ? 3.736   -34.773 16.281  1.00 184.38 ? 333 GLU A CG  1 
ATOM   2218 C CD  . GLU A 1 298 ? 4.718   -34.780 17.442  1.00 183.87 ? 333 GLU A CD  1 
ATOM   2219 O OE1 . GLU A 1 298 ? 4.285   -35.021 18.591  1.00 182.51 ? 333 GLU A OE1 1 
ATOM   2220 O OE2 . GLU A 1 298 ? 5.925   -34.545 17.205  1.00 185.16 ? 333 GLU A OE2 1 
ATOM   2221 N N   . GLU A 1 299 ? 1.828   -36.134 13.709  1.00 221.16 ? 334 GLU A N   1 
ATOM   2222 C CA  . GLU A 1 299 ? 2.155   -37.414 13.110  1.00 226.93 ? 334 GLU A CA  1 
ATOM   2223 C C   . GLU A 1 299 ? 3.638   -37.442 12.764  1.00 229.46 ? 334 GLU A C   1 
ATOM   2224 O O   . GLU A 1 299 ? 4.061   -36.839 11.780  1.00 230.15 ? 334 GLU A O   1 
ATOM   2225 C CB  . GLU A 1 299 ? 1.332   -37.619 11.842  1.00 229.50 ? 334 GLU A CB  1 
ATOM   2226 C CG  . GLU A 1 299 ? 1.105   -36.333 11.033  1.00 226.86 ? 334 GLU A CG  1 
ATOM   2227 C CD  . GLU A 1 299 ? 0.551   -36.578 9.633   1.00 230.57 ? 334 GLU A CD  1 
ATOM   2228 O OE1 . GLU A 1 299 ? 0.935   -37.586 9.004   1.00 235.95 ? 334 GLU A OE1 1 
ATOM   2229 O OE2 . GLU A 1 299 ? -0.271  -35.760 9.160   1.00 228.42 ? 334 GLU A OE2 1 
ATOM   2230 N N   . LYS A 1 300 ? 4.426   -38.164 13.555  1.00 222.86 ? 335 LYS A N   1 
ATOM   2231 C CA  . LYS A 1 300 ? 5.840   -38.348 13.237  1.00 226.11 ? 335 LYS A CA  1 
ATOM   2232 C C   . LYS A 1 300 ? 6.564   -37.030 12.938  1.00 223.36 ? 335 LYS A C   1 
ATOM   2233 O O   . LYS A 1 300 ? 6.744   -36.193 13.820  1.00 219.07 ? 335 LYS A O   1 
ATOM   2234 C CB  . LYS A 1 300 ? 6.019   -39.380 12.127  1.00 232.42 ? 335 LYS A CB  1 
ATOM   2235 C CG  . LYS A 1 300 ? 5.498   -40.750 12.549  1.00 235.73 ? 335 LYS A CG  1 
ATOM   2236 C CD  . LYS A 1 300 ? 5.840   -41.868 11.575  1.00 242.68 ? 335 LYS A CD  1 
ATOM   2237 C CE  . LYS A 1 300 ? 5.380   -43.220 12.127  1.00 246.07 ? 335 LYS A CE  1 
ATOM   2238 N NZ  . LYS A 1 300 ? 5.662   -44.343 11.186  1.00 253.23 ? 335 LYS A NZ  1 
ATOM   2239 N N   . ASN A 1 301 ? 6.975   -36.852 11.689  1.00 203.12 ? 336 ASN A N   1 
ATOM   2240 C CA  . ASN A 1 301 ? 7.889   -35.775 11.313  1.00 202.03 ? 336 ASN A CA  1 
ATOM   2241 C C   . ASN A 1 301 ? 7.268   -34.386 11.089  1.00 197.22 ? 336 ASN A C   1 
ATOM   2242 O O   . ASN A 1 301 ? 7.955   -33.467 10.633  1.00 196.76 ? 336 ASN A O   1 
ATOM   2243 C CB  . ASN A 1 301 ? 8.711   -36.176 10.091  1.00 207.79 ? 336 ASN A CB  1 
ATOM   2244 C CG  . ASN A 1 301 ? 9.656   -37.319 10.377  1.00 212.57 ? 336 ASN A CG  1 
ATOM   2245 O OD1 . ASN A 1 301 ? 10.763  -37.114 10.872  1.00 212.81 ? 336 ASN A OD1 1 
ATOM   2246 N ND2 . ASN A 1 301 ? 9.228   -38.534 10.060  1.00 216.73 ? 336 ASN A ND2 1 
ATOM   2247 N N   . GLN A 1 302 ? 5.985   -34.224 11.403  1.00 175.27 ? 337 GLN A N   1 
ATOM   2248 C CA  . GLN A 1 302 ? 5.281   -32.994 11.057  1.00 171.44 ? 337 GLN A CA  1 
ATOM   2249 C C   . GLN A 1 302 ? 3.870   -32.944 11.650  1.00 168.00 ? 337 GLN A C   1 
ATOM   2250 O O   . GLN A 1 302 ? 3.329   -33.965 12.082  1.00 169.33 ? 337 GLN A O   1 
ATOM   2251 C CB  . GLN A 1 302 ? 5.211   -32.879 9.535   1.00 174.83 ? 337 GLN A CB  1 
ATOM   2252 C CG  . GLN A 1 302 ? 3.966   -32.203 8.999   1.00 172.63 ? 337 GLN A CG  1 
ATOM   2253 C CD  . GLN A 1 302 ? 3.617   -32.662 7.595   1.00 177.39 ? 337 GLN A CD  1 
ATOM   2254 O OE1 . GLN A 1 302 ? 4.224   -33.596 7.064   1.00 182.46 ? 337 GLN A OE1 1 
ATOM   2255 N NE2 . GLN A 1 302 ? 2.638   -32.003 6.984   1.00 176.13 ? 337 GLN A NE2 1 
ATOM   2256 N N   . TYR A 1 303 ? 3.286   -31.746 11.669  1.00 162.53 ? 338 TYR A N   1 
ATOM   2257 C CA  . TYR A 1 303 ? 1.982   -31.514 12.288  1.00 159.03 ? 338 TYR A CA  1 
ATOM   2258 C C   . TYR A 1 303 ? 0.851   -31.394 11.280  1.00 159.83 ? 338 TYR A C   1 
ATOM   2259 O O   . TYR A 1 303 ? 0.994   -30.761 10.235  1.00 160.78 ? 338 TYR A O   1 
ATOM   2260 C CB  . TYR A 1 303 ? 2.005   -30.244 13.144  1.00 153.90 ? 338 TYR A CB  1 
ATOM   2261 C CG  . TYR A 1 303 ? 2.834   -30.353 14.400  1.00 152.63 ? 338 TYR A CG  1 
ATOM   2262 C CD1 . TYR A 1 303 ? 4.128   -29.846 14.448  1.00 152.81 ? 338 TYR A CD1 1 
ATOM   2263 C CD2 . TYR A 1 303 ? 2.323   -30.959 15.541  1.00 151.61 ? 338 TYR A CD2 1 
ATOM   2264 C CE1 . TYR A 1 303 ? 4.893   -29.942 15.599  1.00 151.99 ? 338 TYR A CE1 1 
ATOM   2265 C CE2 . TYR A 1 303 ? 3.078   -31.061 16.696  1.00 150.85 ? 338 TYR A CE2 1 
ATOM   2266 C CZ  . TYR A 1 303 ? 4.364   -30.551 16.719  1.00 151.04 ? 338 TYR A CZ  1 
ATOM   2267 O OH  . TYR A 1 303 ? 5.125   -30.649 17.862  1.00 150.62 ? 338 TYR A OH  1 
ATOM   2268 N N   . LYS A 1 304 ? -0.283  -31.997 11.615  1.00 164.10 ? 339 LYS A N   1 
ATOM   2269 C CA  . LYS A 1 304 ? -1.470  -31.903 10.785  1.00 164.84 ? 339 LYS A CA  1 
ATOM   2270 C C   . LYS A 1 304 ? -2.558  -31.128 11.510  1.00 160.35 ? 339 LYS A C   1 
ATOM   2271 O O   . LYS A 1 304 ? -2.609  -31.100 12.742  1.00 157.59 ? 339 LYS A O   1 
ATOM   2272 C CB  . LYS A 1 304 ? -1.987  -33.293 10.408  1.00 169.32 ? 339 LYS A CB  1 
ATOM   2273 C CG  . LYS A 1 304 ? -2.665  -34.040 11.551  1.00 168.44 ? 339 LYS A CG  1 
ATOM   2274 C CD  . LYS A 1 304 ? -3.531  -35.167 11.021  1.00 172.63 ? 339 LYS A CD  1 
ATOM   2275 C CE  . LYS A 1 304 ? -4.074  -36.024 12.149  1.00 172.59 ? 339 LYS A CE  1 
ATOM   2276 N NZ  . LYS A 1 304 ? -2.981  -36.708 12.901  1.00 173.76 ? 339 LYS A NZ  1 
ATOM   2277 N N   . VAL A 1 305 ? -3.423  -30.491 10.733  1.00 153.47 ? 340 VAL A N   1 
ATOM   2278 C CA  . VAL A 1 305 ? -4.585  -29.813 11.282  1.00 149.95 ? 340 VAL A CA  1 
ATOM   2279 C C   . VAL A 1 305 ? -5.852  -30.361 10.634  1.00 152.44 ? 340 VAL A C   1 
ATOM   2280 O O   . VAL A 1 305 ? -6.065  -30.198 9.433   1.00 154.89 ? 340 VAL A O   1 
ATOM   2281 C CB  . VAL A 1 305 ? -4.516  -28.299 11.045  1.00 146.83 ? 340 VAL A CB  1 
ATOM   2282 C CG1 . VAL A 1 305 ? -5.742  -27.626 11.613  1.00 143.60 ? 340 VAL A CG1 1 
ATOM   2283 C CG2 . VAL A 1 305 ? -3.258  -27.722 11.670  1.00 144.65 ? 340 VAL A CG2 1 
ATOM   2284 N N   . ASP A 1 306 ? -6.694  -31.008 11.434  1.00 151.11 ? 341 ASP A N   1 
ATOM   2285 C CA  . ASP A 1 306 ? -7.936  -31.573 10.929  1.00 153.65 ? 341 ASP A CA  1 
ATOM   2286 C C   . ASP A 1 306 ? -9.051  -30.558 11.113  1.00 150.57 ? 341 ASP A C   1 
ATOM   2287 O O   . ASP A 1 306 ? -9.536  -30.341 12.226  1.00 147.67 ? 341 ASP A O   1 
ATOM   2288 C CB  . ASP A 1 306 ? -8.266  -32.853 11.693  1.00 155.53 ? 341 ASP A CB  1 
ATOM   2289 C CG  . ASP A 1 306 ? -9.547  -33.503 11.217  1.00 158.57 ? 341 ASP A CG  1 
ATOM   2290 O OD1 . ASP A 1 306 ? -9.673  -33.745 9.997   1.00 162.12 ? 341 ASP A OD1 1 
ATOM   2291 O OD2 . ASP A 1 306 ? -10.427 -33.772 12.063  1.00 157.72 ? 341 ASP A OD2 1 
ATOM   2292 N N   . TYR A 1 307 ? -9.493  -29.976 10.005  1.00 177.61 ? 342 TYR A N   1 
ATOM   2293 C CA  . TYR A 1 307 ? -10.371 -28.814 10.063  1.00 174.74 ? 342 TYR A CA  1 
ATOM   2294 C C   . TYR A 1 307 ? -11.844 -29.181 10.192  1.00 175.78 ? 342 TYR A C   1 
ATOM   2295 O O   . TYR A 1 307 ? -12.714 -28.310 10.223  1.00 173.98 ? 342 TYR A O   1 
ATOM   2296 C CB  . TYR A 1 307 ? -10.130 -27.899 8.860   1.00 175.50 ? 342 TYR A CB  1 
ATOM   2297 C CG  . TYR A 1 307 ? -9.254  -26.710 9.189   1.00 171.87 ? 342 TYR A CG  1 
ATOM   2298 C CD1 . TYR A 1 307 ? -7.872  -26.780 9.070   1.00 172.30 ? 342 TYR A CD1 1 
ATOM   2299 C CD2 . TYR A 1 307 ? -9.813  -25.519 9.629   1.00 168.33 ? 342 TYR A CD2 1 
ATOM   2300 C CE1 . TYR A 1 307 ? -7.071  -25.689 9.372   1.00 169.29 ? 342 TYR A CE1 1 
ATOM   2301 C CE2 . TYR A 1 307 ? -9.025  -24.423 9.933   1.00 165.32 ? 342 TYR A CE2 1 
ATOM   2302 C CZ  . TYR A 1 307 ? -7.654  -24.511 9.803   1.00 165.81 ? 342 TYR A CZ  1 
ATOM   2303 O OH  . TYR A 1 307 ? -6.868  -23.420 10.108  1.00 163.12 ? 342 TYR A OH  1 
ATOM   2304 N N   . SER A 1 308 ? -12.114 -30.477 10.272  1.00 180.81 ? 343 SER A N   1 
ATOM   2305 C CA  . SER A 1 308 ? -13.473 -30.959 10.450  1.00 182.33 ? 343 SER A CA  1 
ATOM   2306 C C   . SER A 1 308 ? -13.901 -30.880 11.913  1.00 179.19 ? 343 SER A C   1 
ATOM   2307 O O   . SER A 1 308 ? -15.090 -30.936 12.231  1.00 179.50 ? 343 SER A O   1 
ATOM   2308 C CB  . SER A 1 308 ? -13.590 -32.398 9.948   1.00 187.50 ? 343 SER A CB  1 
ATOM   2309 O OG  . SER A 1 308 ? -12.681 -33.241 10.627  1.00 187.87 ? 343 SER A OG  1 
ATOM   2310 N N   . HIS A 1 309 ? -12.924 -30.746 12.802  1.00 185.02 ? 344 HIS A N   1 
ATOM   2311 C CA  . HIS A 1 309 ? -13.201 -30.663 14.232  1.00 182.33 ? 344 HIS A CA  1 
ATOM   2312 C C   . HIS A 1 309 ? -13.283 -29.219 14.717  1.00 177.89 ? 344 HIS A C   1 
ATOM   2313 O O   . HIS A 1 309 ? -13.517 -28.966 15.899  1.00 175.56 ? 344 HIS A O   1 
ATOM   2314 C CB  . HIS A 1 309 ? -12.144 -31.430 15.032  1.00 182.49 ? 344 HIS A CB  1 
ATOM   2315 C CG  . HIS A 1 309 ? -12.281 -32.920 14.940  1.00 186.86 ? 344 HIS A CG  1 
ATOM   2316 N ND1 . HIS A 1 309 ? -11.488 -33.784 15.667  1.00 187.89 ? 344 HIS A ND1 1 
ATOM   2317 C CD2 . HIS A 1 309 ? -13.113 -33.699 14.211  1.00 190.80 ? 344 HIS A CD2 1 
ATOM   2318 C CE1 . HIS A 1 309 ? -11.828 -35.029 15.389  1.00 192.25 ? 344 HIS A CE1 1 
ATOM   2319 N NE2 . HIS A 1 309 ? -12.813 -35.007 14.508  1.00 194.09 ? 344 HIS A NE2 1 
ATOM   2320 N N   . PHE A 1 310 ? -13.103 -28.281 13.793  1.00 165.49 ? 345 PHE A N   1 
ATOM   2321 C CA  . PHE A 1 310 ? -13.084 -26.860 14.122  1.00 161.66 ? 345 PHE A CA  1 
ATOM   2322 C C   . PHE A 1 310 ? -14.273 -26.452 14.988  1.00 160.07 ? 345 PHE A C   1 
ATOM   2323 O O   . PHE A 1 310 ? -14.096 -26.014 16.124  1.00 157.29 ? 345 PHE A O   1 
ATOM   2324 C CB  . PHE A 1 310 ? -13.040 -26.010 12.850  1.00 162.15 ? 345 PHE A CB  1 
ATOM   2325 C CG  . PHE A 1 310 ? -12.715 -24.558 13.096  1.00 158.57 ? 345 PHE A CG  1 
ATOM   2326 C CD1 . PHE A 1 310 ? -11.399 -24.141 13.218  1.00 156.97 ? 345 PHE A CD1 1 
ATOM   2327 C CD2 . PHE A 1 310 ? -13.722 -23.610 13.201  1.00 157.14 ? 345 PHE A CD2 1 
ATOM   2328 C CE1 . PHE A 1 310 ? -11.095 -22.811 13.443  1.00 154.03 ? 345 PHE A CE1 1 
ATOM   2329 C CE2 . PHE A 1 310 ? -13.422 -22.279 13.423  1.00 154.21 ? 345 PHE A CE2 1 
ATOM   2330 C CZ  . PHE A 1 310 ? -12.106 -21.881 13.544  1.00 152.65 ? 345 PHE A CZ  1 
ATOM   2331 N N   . HIS A 1 311 ? -15.482 -26.588 14.453  1.00 163.43 ? 346 HIS A N   1 
ATOM   2332 C CA  . HIS A 1 311 ? -16.676 -26.144 15.165  1.00 162.38 ? 346 HIS A CA  1 
ATOM   2333 C C   . HIS A 1 311 ? -17.150 -27.151 16.210  1.00 163.51 ? 346 HIS A C   1 
ATOM   2334 O O   . HIS A 1 311 ? -18.046 -26.855 17.000  1.00 162.75 ? 346 HIS A O   1 
ATOM   2335 C CB  . HIS A 1 311 ? -17.803 -25.859 14.177  1.00 164.51 ? 346 HIS A CB  1 
ATOM   2336 C CG  . HIS A 1 311 ? -17.420 -24.919 13.077  1.00 164.14 ? 346 HIS A CG  1 
ATOM   2337 N ND1 . HIS A 1 311 ? -18.135 -23.777 12.794  1.00 163.22 ? 346 HIS A ND1 1 
ATOM   2338 C CD2 . HIS A 1 311 ? -16.399 -24.956 12.189  1.00 164.96 ? 346 HIS A CD2 1 
ATOM   2339 C CE1 . HIS A 1 311 ? -17.570 -23.147 11.778  1.00 163.48 ? 346 HIS A CE1 1 
ATOM   2340 N NE2 . HIS A 1 311 ? -16.515 -23.840 11.394  1.00 164.55 ? 346 HIS A NE2 1 
ATOM   2341 N N   . LYS A 1 312 ? -16.545 -28.335 16.219  1.00 164.17 ? 347 LYS A N   1 
ATOM   2342 C CA  . LYS A 1 312 ? -17.018 -29.421 17.073  1.00 166.13 ? 347 LYS A CA  1 
ATOM   2343 C C   . LYS A 1 312 ? -16.661 -29.224 18.540  1.00 163.60 ? 347 LYS A C   1 
ATOM   2344 O O   . LYS A 1 312 ? -15.564 -28.783 18.873  1.00 161.16 ? 347 LYS A O   1 
ATOM   2345 C CB  . LYS A 1 312 ? -16.522 -30.774 16.561  1.00 169.78 ? 347 LYS A CB  1 
ATOM   2346 C CG  . LYS A 1 312 ? -17.235 -31.220 15.302  1.00 173.47 ? 347 LYS A CG  1 
ATOM   2347 C CD  . LYS A 1 312 ? -16.613 -32.461 14.697  1.00 177.24 ? 347 LYS A CD  1 
ATOM   2348 C CE  . LYS A 1 312 ? -17.388 -32.885 13.459  1.00 181.32 ? 347 LYS A CE  1 
ATOM   2349 N NZ  . LYS A 1 312 ? -16.772 -34.047 12.758  1.00 185.44 ? 347 LYS A NZ  1 
ATOM   2350 N N   . THR A 1 313 ? -17.609 -29.564 19.407  1.00 168.45 ? 348 THR A N   1 
ATOM   2351 C CA  . THR A 1 313 ? -17.496 -29.327 20.838  1.00 166.58 ? 348 THR A CA  1 
ATOM   2352 C C   . THR A 1 313 ? -18.045 -30.517 21.619  1.00 169.73 ? 348 THR A C   1 
ATOM   2353 O O   . THR A 1 313 ? -18.736 -31.370 21.058  1.00 173.17 ? 348 THR A O   1 
ATOM   2354 C CB  . THR A 1 313 ? -18.295 -28.075 21.237  1.00 164.22 ? 348 THR A CB  1 
ATOM   2355 O OG1 . THR A 1 313 ? -19.667 -28.240 20.849  1.00 166.58 ? 348 THR A OG1 1 
ATOM   2356 C CG2 . THR A 1 313 ? -17.726 -26.839 20.550  1.00 161.24 ? 348 THR A CG2 1 
ATOM   2357 N N   . TYR A 1 314 ? -17.757 -30.560 22.918  1.00 152.00 ? 349 TYR A N   1 
ATOM   2358 C CA  . TYR A 1 314 ? -18.218 -31.653 23.768  1.00 155.19 ? 349 TYR A CA  1 
ATOM   2359 C C   . TYR A 1 314 ? -18.488 -31.197 25.202  1.00 154.09 ? 349 TYR A C   1 
ATOM   2360 O O   . TYR A 1 314 ? -17.830 -30.290 25.710  1.00 150.90 ? 349 TYR A O   1 
ATOM   2361 C CB  . TYR A 1 314 ? -17.199 -32.795 23.758  1.00 157.21 ? 349 TYR A CB  1 
ATOM   2362 C CG  . TYR A 1 314 ? -15.871 -32.410 24.348  1.00 154.62 ? 349 TYR A CG  1 
ATOM   2363 C CD1 . TYR A 1 314 ? -15.636 -32.549 25.708  1.00 154.67 ? 349 TYR A CD1 1 
ATOM   2364 C CD2 . TYR A 1 314 ? -14.857 -31.895 23.551  1.00 152.47 ? 349 TYR A CD2 1 
ATOM   2365 C CE1 . TYR A 1 314 ? -14.422 -32.191 26.261  1.00 152.61 ? 349 TYR A CE1 1 
ATOM   2366 C CE2 . TYR A 1 314 ? -13.638 -31.534 24.093  1.00 150.38 ? 349 TYR A CE2 1 
ATOM   2367 C CZ  . TYR A 1 314 ? -13.424 -31.685 25.452  1.00 150.43 ? 349 TYR A CZ  1 
ATOM   2368 O OH  . TYR A 1 314 ? -12.216 -31.329 26.011  1.00 148.67 ? 349 TYR A OH  1 
ATOM   2369 N N   . GLU A 1 315 ? -19.459 -31.837 25.849  1.00 171.89 ? 350 GLU A N   1 
ATOM   2370 C CA  . GLU A 1 315 ? -19.866 -31.460 27.201  1.00 171.66 ? 350 GLU A CA  1 
ATOM   2371 C C   . GLU A 1 315 ? -18.795 -31.774 28.248  1.00 171.42 ? 350 GLU A C   1 
ATOM   2372 O O   . GLU A 1 315 ? -18.066 -32.760 28.143  1.00 173.21 ? 350 GLU A O   1 
ATOM   2373 C CB  . GLU A 1 315 ? -21.196 -32.126 27.581  1.00 175.59 ? 350 GLU A CB  1 
ATOM   2374 C CG  . GLU A 1 315 ? -22.377 -31.726 26.702  1.00 176.15 ? 350 GLU A CG  1 
ATOM   2375 C CD  . GLU A 1 315 ? -23.711 -32.220 27.240  1.00 180.01 ? 350 GLU A CD  1 
ATOM   2376 O OE1 . GLU A 1 315 ? -23.963 -33.445 27.201  1.00 183.97 ? 350 GLU A OE1 1 
ATOM   2377 O OE2 . GLU A 1 315 ? -24.507 -31.378 27.711  1.00 179.35 ? 350 GLU A OE2 1 
ATOM   2378 N N   . VAL A 1 316 ? -18.708 -30.914 29.256  1.00 151.06 ? 351 VAL A N   1 
ATOM   2379 C CA  . VAL A 1 316 ? -17.812 -31.119 30.382  1.00 151.20 ? 351 VAL A CA  1 
ATOM   2380 C C   . VAL A 1 316 ? -18.635 -30.975 31.651  1.00 152.93 ? 351 VAL A C   1 
ATOM   2381 O O   . VAL A 1 316 ? -18.586 -29.940 32.310  1.00 150.82 ? 351 VAL A O   1 
ATOM   2382 C CB  . VAL A 1 316 ? -16.692 -30.071 30.402  1.00 147.17 ? 351 VAL A CB  1 
ATOM   2383 C CG1 . VAL A 1 316 ? -15.584 -30.503 31.350  1.00 147.86 ? 351 VAL A CG1 1 
ATOM   2384 C CG2 . VAL A 1 316 ? -16.151 -29.852 29.001  1.00 145.16 ? 351 VAL A CG2 1 
ATOM   2385 N N   . PRO A 1 317 ? -19.402 -32.018 31.995  1.00 159.36 ? 352 PRO A N   1 
ATOM   2386 C CA  . PRO A 1 317 ? -20.374 -31.988 33.096  1.00 161.90 ? 352 PRO A CA  1 
ATOM   2387 C C   . PRO A 1 317 ? -19.807 -31.407 34.389  1.00 161.08 ? 352 PRO A C   1 
ATOM   2388 O O   . PRO A 1 317 ? -20.551 -30.814 35.169  1.00 161.74 ? 352 PRO A O   1 
ATOM   2389 C CB  . PRO A 1 317 ? -20.748 -33.467 33.281  1.00 166.91 ? 352 PRO A CB  1 
ATOM   2390 C CG  . PRO A 1 317 ? -19.751 -34.254 32.450  1.00 166.80 ? 352 PRO A CG  1 
ATOM   2391 C CD  . PRO A 1 317 ? -19.340 -33.338 31.349  1.00 162.42 ? 352 PRO A CD  1 
ATOM   2392 N N   . SER A 1 318 ? -18.508 -31.577 34.611  1.00 151.37 ? 353 SER A N   1 
ATOM   2393 C CA  . SER A 1 318 ? -17.857 -31.046 35.806  1.00 150.82 ? 353 SER A CA  1 
ATOM   2394 C C   . SER A 1 318 ? -17.854 -29.509 35.831  1.00 146.91 ? 353 SER A C   1 
ATOM   2395 O O   . SER A 1 318 ? -17.486 -28.887 36.833  1.00 146.54 ? 353 SER A O   1 
ATOM   2396 C CB  . SER A 1 318 ? -16.439 -31.609 35.935  1.00 150.81 ? 353 SER A CB  1 
ATOM   2397 O OG  . SER A 1 318 ? -15.720 -31.479 34.720  1.00 147.90 ? 353 SER A OG  1 
ATOM   2398 N N   . THR A 1 319 ? -18.266 -28.904 34.722  1.00 152.95 ? 354 THR A N   1 
ATOM   2399 C CA  . THR A 1 319 ? -18.368 -27.452 34.630  1.00 149.56 ? 354 THR A CA  1 
ATOM   2400 C C   . THR A 1 319 ? -19.490 -26.922 35.515  1.00 151.23 ? 354 THR A C   1 
ATOM   2401 O O   . THR A 1 319 ? -20.641 -27.347 35.384  1.00 153.73 ? 354 THR A O   1 
ATOM   2402 C CB  . THR A 1 319 ? -18.660 -26.992 33.190  1.00 147.10 ? 354 THR A CB  1 
ATOM   2403 O OG1 . THR A 1 319 ? -17.595 -27.399 32.322  1.00 145.69 ? 354 THR A OG1 1 
ATOM   2404 C CG2 . THR A 1 319 ? -18.806 -25.480 33.140  1.00 144.03 ? 354 THR A CG2 1 
ATOM   2405 N N   . PRO A 1 320 ? -19.153 -25.994 36.423  1.00 143.94 ? 355 PRO A N   1 
ATOM   2406 C CA  . PRO A 1 320 ? -20.114 -25.274 37.269  1.00 145.35 ? 355 PRO A CA  1 
ATOM   2407 C C   . PRO A 1 320 ? -21.207 -24.559 36.466  1.00 144.29 ? 355 PRO A C   1 
ATOM   2408 O O   . PRO A 1 320 ? -20.909 -23.914 35.461  1.00 140.97 ? 355 PRO A O   1 
ATOM   2409 C CB  . PRO A 1 320 ? -19.233 -24.249 37.983  1.00 143.34 ? 355 PRO A CB  1 
ATOM   2410 C CG  . PRO A 1 320 ? -17.915 -24.923 38.090  1.00 143.02 ? 355 PRO A CG  1 
ATOM   2411 C CD  . PRO A 1 320 ? -17.761 -25.726 36.825  1.00 142.16 ? 355 PRO A CD  1 
ATOM   2412 N N   . ARG A 1 321 ? -22.452 -24.672 36.925  1.00 162.04 ? 356 ARG A N   1 
ATOM   2413 C CA  . ARG A 1 321 ? -23.603 -24.092 36.234  1.00 161.86 ? 356 ARG A CA  1 
ATOM   2414 C C   . ARG A 1 321 ? -23.921 -22.660 36.662  1.00 160.63 ? 356 ARG A C   1 
ATOM   2415 O O   . ARG A 1 321 ? -24.742 -21.987 36.038  1.00 160.06 ? 356 ARG A O   1 
ATOM   2416 C CB  . ARG A 1 321 ? -24.841 -24.963 36.451  1.00 166.36 ? 356 ARG A CB  1 
ATOM   2417 C CG  . ARG A 1 321 ? -24.871 -26.267 35.677  1.00 167.81 ? 356 ARG A CG  1 
ATOM   2418 C CD  . ARG A 1 321 ? -26.177 -27.002 35.957  1.00 172.62 ? 356 ARG A CD  1 
ATOM   2419 N NE  . ARG A 1 321 ? -26.453 -28.068 34.996  1.00 174.11 ? 356 ARG A NE  1 
ATOM   2420 C CZ  . ARG A 1 321 ? -26.272 -29.362 35.239  1.00 177.20 ? 356 ARG A CZ  1 
ATOM   2421 N NH1 . ARG A 1 321 ? -25.809 -29.759 36.416  1.00 179.11 ? 356 ARG A NH1 1 
ATOM   2422 N NH2 . ARG A 1 321 ? -26.555 -30.259 34.305  1.00 178.70 ? 356 ARG A NH2 1 
ATOM   2423 N N   . CYS A 1 322 ? -23.272 -22.197 37.723  1.00 148.47 ? 357 CYS A N   1 
ATOM   2424 C CA  . CYS A 1 322 ? -23.565 -20.880 38.284  1.00 148.01 ? 357 CYS A CA  1 
ATOM   2425 C C   . CYS A 1 322 ? -22.765 -19.755 37.622  1.00 143.60 ? 357 CYS A C   1 
ATOM   2426 O O   . CYS A 1 322 ? -21.955 -20.000 36.731  1.00 140.90 ? 357 CYS A O   1 
ATOM   2427 C CB  . CYS A 1 322 ? -23.312 -20.885 39.796  1.00 150.70 ? 357 CYS A CB  1 
ATOM   2428 S SG  . CYS A 1 322 ? -21.579 -21.156 40.280  1.00 149.05 ? 357 CYS A SG  1 
ATOM   2429 N N   . SER A 1 323 ? -23.003 -18.521 38.063  1.00 148.89 ? 358 SER A N   1 
ATOM   2430 C CA  . SER A 1 323 ? -22.270 -17.367 37.551  1.00 145.21 ? 358 SER A CA  1 
ATOM   2431 C C   . SER A 1 323 ? -20.917 -17.241 38.243  1.00 144.08 ? 358 SER A C   1 
ATOM   2432 O O   . SER A 1 323 ? -20.777 -17.593 39.415  1.00 146.64 ? 358 SER A O   1 
ATOM   2433 C CB  . SER A 1 323 ? -23.076 -16.075 37.733  1.00 145.65 ? 358 SER A CB  1 
ATOM   2434 O OG  . SER A 1 323 ? -23.030 -15.620 39.074  1.00 147.80 ? 358 SER A OG  1 
ATOM   2435 N N   . ALA A 1 324 ? -19.927 -16.735 37.512  1.00 147.57 ? 359 ALA A N   1 
ATOM   2436 C CA  . ALA A 1 324 ? -18.583 -16.548 38.052  1.00 146.43 ? 359 ALA A CA  1 
ATOM   2437 C C   . ALA A 1 324 ? -18.616 -15.677 39.307  1.00 148.12 ? 359 ALA A C   1 
ATOM   2438 O O   . ALA A 1 324 ? -17.741 -15.771 40.170  1.00 148.87 ? 359 ALA A O   1 
ATOM   2439 C CB  . ALA A 1 324 ? -17.676 -15.928 37.000  1.00 142.70 ? 359 ALA A CB  1 
ATOM   2440 N N   . LYS A 1 325 ? -19.640 -14.834 39.397  1.00 141.22 ? 360 LYS A N   1 
ATOM   2441 C CA  . LYS A 1 325 ? -19.809 -13.918 40.517  1.00 143.21 ? 360 LYS A CA  1 
ATOM   2442 C C   . LYS A 1 325 ? -20.148 -14.664 41.801  1.00 147.37 ? 360 LYS A C   1 
ATOM   2443 O O   . LYS A 1 325 ? -19.621 -14.357 42.871  1.00 149.03 ? 360 LYS A O   1 
ATOM   2444 C CB  . LYS A 1 325 ? -20.901 -12.899 40.190  1.00 143.51 ? 360 LYS A CB  1 
ATOM   2445 C CG  . LYS A 1 325 ? -21.906 -12.659 41.303  1.00 147.68 ? 360 LYS A CG  1 
ATOM   2446 C CD  . LYS A 1 325 ? -21.417 -11.636 42.308  1.00 148.77 ? 360 LYS A CD  1 
ATOM   2447 C CE  . LYS A 1 325 ? -22.597 -10.993 43.013  1.00 152.45 ? 360 LYS A CE  1 
ATOM   2448 N NZ  . LYS A 1 325 ? -22.168 -9.924  43.956  1.00 153.88 ? 360 LYS A NZ  1 
ATOM   2449 N N   . ASP A 1 326 ? -21.043 -15.640 41.684  1.00 174.21 ? 361 ASP A N   1 
ATOM   2450 C CA  . ASP A 1 326 ? -21.445 -16.458 42.818  1.00 178.60 ? 361 ASP A CA  1 
ATOM   2451 C C   . ASP A 1 326 ? -20.394 -17.521 43.080  1.00 178.67 ? 361 ASP A C   1 
ATOM   2452 O O   . ASP A 1 326 ? -20.231 -17.985 44.204  1.00 182.04 ? 361 ASP A O   1 
ATOM   2453 C CB  . ASP A 1 326 ? -22.804 -17.103 42.546  1.00 181.02 ? 361 ASP A CB  1 
ATOM   2454 C CG  . ASP A 1 326 ? -23.869 -16.079 42.191  1.00 181.10 ? 361 ASP A CG  1 
ATOM   2455 O OD1 . ASP A 1 326 ? -23.955 -15.043 42.890  1.00 182.15 ? 361 ASP A OD1 1 
ATOM   2456 O OD2 . ASP A 1 326 ? -24.615 -16.307 41.213  1.00 180.39 ? 361 ASP A OD2 1 
ATOM   2457 N N   . LEU A 1 327 ? -19.680 -17.898 42.027  1.00 150.68 ? 362 LEU A N   1 
ATOM   2458 C CA  . LEU A 1 327 ? -18.578 -18.837 42.147  1.00 150.50 ? 362 LEU A CA  1 
ATOM   2459 C C   . LEU A 1 327 ? -17.556 -18.278 43.132  1.00 150.93 ? 362 LEU A C   1 
ATOM   2460 O O   . LEU A 1 327 ? -17.074 -18.984 44.019  1.00 153.59 ? 362 LEU A O   1 
ATOM   2461 C CB  . LEU A 1 327 ? -17.931 -19.058 40.777  1.00 146.60 ? 362 LEU A CB  1 
ATOM   2462 C CG  . LEU A 1 327 ? -17.357 -20.441 40.465  1.00 147.06 ? 362 LEU A CG  1 
ATOM   2463 C CD1 . LEU A 1 327 ? -16.675 -20.439 39.102  1.00 143.31 ? 362 LEU A CD1 1 
ATOM   2464 C CD2 . LEU A 1 327 ? -16.388 -20.881 41.550  1.00 149.04 ? 362 LEU A CD2 1 
ATOM   2465 N N   . VAL A 1 328 ? -17.237 -16.999 42.973  1.00 162.92 ? 363 VAL A N   1 
ATOM   2466 C CA  . VAL A 1 328 ? -16.256 -16.337 43.822  1.00 163.29 ? 363 VAL A CA  1 
ATOM   2467 C C   . VAL A 1 328 ? -16.819 -16.038 45.204  1.00 167.61 ? 363 VAL A C   1 
ATOM   2468 O O   . VAL A 1 328 ? -16.121 -16.174 46.209  1.00 169.91 ? 363 VAL A O   1 
ATOM   2469 C CB  . VAL A 1 328 ? -15.781 -15.012 43.201  1.00 159.83 ? 363 VAL A CB  1 
ATOM   2470 C CG1 . VAL A 1 328 ? -14.848 -14.284 44.157  1.00 160.80 ? 363 VAL A CG1 1 
ATOM   2471 C CG2 . VAL A 1 328 ? -15.106 -15.267 41.868  1.00 155.94 ? 363 VAL A CG2 1 
ATOM   2472 N N   . GLU A 1 329 ? -18.081 -15.622 45.253  1.00 168.29 ? 364 GLU A N   1 
ATOM   2473 C CA  . GLU A 1 329 ? -18.738 -15.359 46.526  1.00 172.90 ? 364 GLU A CA  1 
ATOM   2474 C C   . GLU A 1 329 ? -18.725 -16.600 47.408  1.00 176.93 ? 364 GLU A C   1 
ATOM   2475 O O   . GLU A 1 329 ? -18.398 -16.525 48.590  1.00 180.36 ? 364 GLU A O   1 
ATOM   2476 C CB  . GLU A 1 329 ? -20.174 -14.878 46.309  1.00 174.04 ? 364 GLU A CB  1 
ATOM   2477 C CG  . GLU A 1 329 ? -20.292 -13.516 45.646  1.00 171.13 ? 364 GLU A CG  1 
ATOM   2478 C CD  . GLU A 1 329 ? -21.714 -12.970 45.664  1.00 173.27 ? 364 GLU A CD  1 
ATOM   2479 O OE1 . GLU A 1 329 ? -22.673 -13.774 45.593  1.00 175.37 ? 364 GLU A OE1 1 
ATOM   2480 O OE2 . GLU A 1 329 ? -21.871 -11.733 45.757  1.00 173.14 ? 364 GLU A OE2 1 
ATOM   2481 N N   . ASN A 1 330 ? -19.071 -17.742 46.823  1.00 175.58 ? 365 ASN A N   1 
ATOM   2482 C CA  . ASN A 1 330 ? -19.126 -18.997 47.565  1.00 179.64 ? 365 ASN A CA  1 
ATOM   2483 C C   . ASN A 1 330 ? -17.779 -19.356 48.168  1.00 180.15 ? 365 ASN A C   1 
ATOM   2484 O O   . ASN A 1 330 ? -17.702 -19.862 49.283  1.00 184.62 ? 365 ASN A O   1 
ATOM   2485 C CB  . ASN A 1 330 ? -19.614 -20.140 46.673  1.00 179.06 ? 365 ASN A CB  1 
ATOM   2486 C CG  . ASN A 1 330 ? -21.081 -20.032 46.345  1.00 180.30 ? 365 ASN A CG  1 
ATOM   2487 O OD1 . ASN A 1 330 ? -21.729 -19.039 46.675  1.00 181.15 ? 365 ASN A OD1 1 
ATOM   2488 N ND2 . ASN A 1 330 ? -21.617 -21.055 45.689  1.00 180.72 ? 365 ASN A ND2 1 
ATOM   2489 N N   . LYS A 1 331 ? -16.715 -19.086 47.424  1.00 167.37 ? 366 LYS A N   1 
ATOM   2490 C CA  . LYS A 1 331 ? -15.372 -19.370 47.901  1.00 167.69 ? 366 LYS A CA  1 
ATOM   2491 C C   . LYS A 1 331 ? -15.151 -18.829 49.316  1.00 171.60 ? 366 LYS A C   1 
ATOM   2492 O O   . LYS A 1 331 ? -14.573 -19.510 50.158  1.00 174.88 ? 366 LYS A O   1 
ATOM   2493 C CB  . LYS A 1 331 ? -14.335 -18.793 46.945  1.00 162.70 ? 366 LYS A CB  1 
ATOM   2494 C CG  . LYS A 1 331 ? -14.388 -19.391 45.551  1.00 159.25 ? 366 LYS A CG  1 
ATOM   2495 C CD  . LYS A 1 331 ? -13.475 -18.644 44.585  1.00 154.61 ? 366 LYS A CD  1 
ATOM   2496 C CE  . LYS A 1 331 ? -13.637 -19.164 43.156  1.00 151.55 ? 366 LYS A CE  1 
ATOM   2497 N NZ  . LYS A 1 331 ? -12.903 -18.310 42.173  1.00 147.34 ? 366 LYS A NZ  1 
ATOM   2498 N N   . PHE A 1 332 ? -15.619 -17.619 49.598  1.00 183.54 ? 367 PHE A N   1 
ATOM   2499 C CA  . PHE A 1 332 ? -15.318 -17.013 50.893  1.00 187.28 ? 367 PHE A CA  1 
ATOM   2500 C C   . PHE A 1 332 ? -16.179 -17.514 52.050  1.00 193.36 ? 367 PHE A C   1 
ATOM   2501 O O   . PHE A 1 332 ? -15.799 -17.378 53.208  1.00 197.42 ? 367 PHE A O   1 
ATOM   2502 C CB  . PHE A 1 332 ? -15.377 -15.487 50.810  1.00 185.53 ? 367 PHE A CB  1 
ATOM   2503 C CG  . PHE A 1 332 ? -14.164 -14.883 50.200  1.00 181.39 ? 367 PHE A CG  1 
ATOM   2504 C CD1 . PHE A 1 332 ? -13.097 -14.501 50.994  1.00 182.98 ? 367 PHE A CD1 1 
ATOM   2505 C CD2 . PHE A 1 332 ? -14.065 -14.736 48.829  1.00 176.28 ? 367 PHE A CD2 1 
ATOM   2506 C CE1 . PHE A 1 332 ? -11.957 -13.950 50.431  1.00 179.48 ? 367 PHE A CE1 1 
ATOM   2507 C CE2 . PHE A 1 332 ? -12.929 -14.186 48.255  1.00 172.81 ? 367 PHE A CE2 1 
ATOM   2508 C CZ  . PHE A 1 332 ? -11.874 -13.793 49.060  1.00 174.40 ? 367 PHE A CZ  1 
ATOM   2509 N N   . LEU A 1 333 ? -17.330 -18.095 51.740  1.00 158.34 ? 368 LEU A N   1 
ATOM   2510 C CA  . LEU A 1 333 ? -18.164 -18.701 52.766  1.00 164.40 ? 368 LEU A CA  1 
ATOM   2511 C C   . LEU A 1 333 ? -17.582 -20.040 53.175  1.00 167.02 ? 368 LEU A C   1 
ATOM   2512 O O   . LEU A 1 333 ? -17.715 -20.476 54.327  1.00 172.72 ? 368 LEU A O   1 
ATOM   2513 C CB  . LEU A 1 333 ? -19.591 -18.848 52.261  1.00 164.78 ? 368 LEU A CB  1 
ATOM   2514 C CG  . LEU A 1 333 ? -20.554 -19.513 53.245  1.00 171.33 ? 368 LEU A CG  1 
ATOM   2515 C CD1 . LEU A 1 333 ? -20.435 -18.885 54.617  1.00 176.17 ? 368 LEU A CD1 1 
ATOM   2516 C CD2 . LEU A 1 333 ? -21.969 -19.404 52.698  1.00 171.49 ? 368 LEU A CD2 1 
ATOM   2517 N N   . LEU A 1 334 ? -16.906 -20.670 52.223  1.00 239.73 ? 369 LEU A N   1 
ATOM   2518 C CA  . LEU A 1 334 ? -16.123 -21.861 52.494  1.00 241.63 ? 369 LEU A CA  1 
ATOM   2519 C C   . LEU A 1 334 ? -14.764 -21.428 53.031  1.00 241.48 ? 369 LEU A C   1 
ATOM   2520 O O   . LEU A 1 334 ? -13.922 -22.259 53.348  1.00 243.20 ? 369 LEU A O   1 
ATOM   2521 C CB  . LEU A 1 334 ? -15.969 -22.698 51.214  1.00 237.80 ? 369 LEU A CB  1 
ATOM   2522 C CG  . LEU A 1 334 ? -15.255 -24.037 51.366  1.00 239.91 ? 369 LEU A CG  1 
ATOM   2523 C CD1 . LEU A 1 334 ? -15.750 -24.755 52.626  1.00 246.84 ? 369 LEU A CD1 1 
ATOM   2524 C CD2 . LEU A 1 334 ? -15.433 -24.908 50.118  1.00 237.10 ? 369 LEU A CD2 1 
ATOM   2525 N N   . SER A 1 335 ? -14.551 -20.119 53.133  1.00 223.93 ? 370 SER A N   1 
ATOM   2526 C CA  . SER A 1 335 ? -13.358 -19.601 53.804  1.00 224.73 ? 370 SER A CA  1 
ATOM   2527 C C   . SER A 1 335 ? -13.693 -19.179 55.233  1.00 230.66 ? 370 SER A C   1 
ATOM   2528 O O   . SER A 1 335 ? -13.158 -19.727 56.198  1.00 235.17 ? 370 SER A O   1 
ATOM   2529 C CB  . SER A 1 335 ? -12.721 -18.427 53.028  1.00 219.40 ? 370 SER A CB  1 
ATOM   2530 O OG  . SER A 1 335 ? -11.488 -18.047 53.613  1.00 220.29 ? 370 SER A OG  1 
ATOM   2531 N N   . ASN A 1 336 ? -14.569 -18.182 55.344  1.00 209.11 ? 371 ASN A N   1 
ATOM   2532 C CA  . ASN A 1 336 ? -15.039 -17.650 56.625  1.00 214.84 ? 371 ASN A CA  1 
ATOM   2533 C C   . ASN A 1 336 ? -15.518 -18.705 57.612  1.00 221.35 ? 371 ASN A C   1 
ATOM   2534 O O   . ASN A 1 336 ? -15.142 -18.685 58.787  1.00 226.57 ? 371 ASN A O   1 
ATOM   2535 C CB  . ASN A 1 336 ? -16.173 -16.642 56.401  1.00 214.14 ? 371 ASN A CB  1 
ATOM   2536 C CG  . ASN A 1 336 ? -15.803 -15.570 55.414  1.00 208.14 ? 371 ASN A CG  1 
ATOM   2537 O OD1 . ASN A 1 336 ? -14.630 -15.222 55.278  1.00 205.82 ? 371 ASN A OD1 1 
ATOM   2538 N ND2 . ASN A 1 336 ? -16.797 -15.038 54.714  1.00 205.89 ? 371 ASN A ND2 1 
ATOM   2539 N N   . SER A 1 337 ? -16.370 -19.610 57.145  1.00 255.83 ? 372 SER A N   1 
ATOM   2540 C CA  . SER A 1 337 ? -16.828 -20.703 57.998  1.00 262.10 ? 372 SER A CA  1 
ATOM   2541 C C   . SER A 1 337 ? -16.205 -22.040 57.596  1.00 261.40 ? 372 SER A C   1 
ATOM   2542 O O   . SER A 1 337 ? -14.990 -22.229 57.728  1.00 260.79 ? 372 SER A O   1 
ATOM   2543 C CB  . SER A 1 337 ? -18.355 -20.793 58.006  1.00 264.55 ? 372 SER A CB  1 
ATOM   2544 O OG  . SER A 1 337 ? -18.869 -21.161 56.739  1.00 259.87 ? 372 SER A OG  1 
HETATM 2545 K K   . K   B 2 .   ? -0.000  0.000   -46.141 0.25 123.27 ? 501 K   A K   1 
HETATM 2546 K K   . K   C 2 .   ? -0.000  0.000   -43.111 0.25 124.66 ? 502 K   A K   1 
HETATM 2547 K K   . K   D 2 .   ? -0.000  0.000   -40.288 0.25 104.66 ? 503 K   A K   1 
HETATM 2548 K K   . K   E 2 .   ? -0.000  0.000   -37.319 0.25 152.65 ? 504 K   A K   1 
HETATM 2549 K K   . K   F 2 .   ? 0.000   -0.000  29.746  0.25 194.53 ? 505 K   A K   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   36  ?   ?   ?   A . n 
A 1 2   ALA 2   37  ?   ?   ?   A . n 
A 1 3   ARG 3   38  ?   ?   ?   A . n 
A 1 4   ARG 4   39  ?   ?   ?   A . n 
A 1 5   LYS 5   40  ?   ?   ?   A . n 
A 1 6   CYS 6   41  ?   ?   ?   A . n 
A 1 7   ARG 7   42  ?   ?   ?   A . n 
A 1 8   ASN 8   43  43  ASN ASN A . n 
A 1 9   ARG 9   44  44  ARG ARG A . n 
A 1 10  PHE 10  45  45  PHE PHE A . n 
A 1 11  VAL 11  46  46  VAL VAL A . n 
A 1 12  LYS 12  47  47  LYS LYS A . n 
A 1 13  LYS 13  48  48  LYS LYS A . n 
A 1 14  ASN 14  49  49  ASN ASN A . n 
A 1 15  GLY 15  50  50  GLY GLY A . n 
A 1 16  GLN 16  51  51  GLN GLN A . n 
A 1 17  CYS 17  52  52  CYS CYS A . n 
A 1 18  ASN 18  53  53  ASN ASN A . n 
A 1 19  VAL 19  54  54  VAL VAL A . n 
A 1 20  GLU 20  55  55  GLU GLU A . n 
A 1 21  PHE 21  56  56  PHE PHE A . n 
A 1 22  THR 22  57  57  THR THR A . n 
A 1 23  ASN 23  58  58  ASN ASN A . n 
A 1 24  MET 24  59  59  MET MET A . n 
A 1 25  ASP 25  60  60  ASP ASP A . n 
A 1 26  ASP 26  61  ?   ?   ?   A . n 
A 1 27  LYS 27  62  ?   ?   ?   A . n 
A 1 28  PRO 28  63  ?   ?   ?   A . n 
A 1 29  GLN 29  64  ?   ?   ?   A . n 
A 1 30  ARG 30  65  ?   ?   ?   A . n 
A 1 31  TYR 31  66  ?   ?   ?   A . n 
A 1 32  ILE 32  67  ?   ?   ?   A . n 
A 1 33  ALA 33  68  ?   ?   ?   A . n 
A 1 34  ASP 34  69  ?   ?   ?   A . n 
A 1 35  MET 35  70  70  MET MET A . n 
A 1 36  PHE 36  71  71  PHE PHE A . n 
A 1 37  THR 37  72  72  THR THR A . n 
A 1 38  THR 38  73  73  THR THR A . n 
A 1 39  CYS 39  74  74  CYS CYS A . n 
A 1 40  VAL 40  75  75  VAL VAL A . n 
A 1 41  ASP 41  76  76  ASP ASP A . n 
A 1 42  ILE 42  77  77  ILE ILE A . n 
A 1 43  ARG 43  78  78  ARG ARG A . n 
A 1 44  TRP 44  79  79  TRP TRP A . n 
A 1 45  ARG 45  80  80  ARG ARG A . n 
A 1 46  TYR 46  81  81  TYR TYR A . n 
A 1 47  MET 47  82  82  MET MET A . n 
A 1 48  LEU 48  83  83  LEU LEU A . n 
A 1 49  LEU 49  84  84  LEU LEU A . n 
A 1 50  LEU 50  85  85  LEU LEU A . n 
A 1 51  PHE 51  86  86  PHE PHE A . n 
A 1 52  SER 52  87  87  SER SER A . n 
A 1 53  LEU 53  88  88  LEU LEU A . n 
A 1 54  ALA 54  89  89  ALA ALA A . n 
A 1 55  PHE 55  90  90  PHE PHE A . n 
A 1 56  LEU 56  91  91  LEU LEU A . n 
A 1 57  VAL 57  92  92  VAL VAL A . n 
A 1 58  SER 58  93  93  SER SER A . n 
A 1 59  TRP 59  94  94  TRP TRP A . n 
A 1 60  LEU 60  95  95  LEU LEU A . n 
A 1 61  LEU 61  96  96  LEU LEU A . n 
A 1 62  PHE 62  97  97  PHE PHE A . n 
A 1 63  GLY 63  98  98  GLY GLY A . n 
A 1 64  LEU 64  99  99  LEU LEU A . n 
A 1 65  ILE 65  100 100 ILE ILE A . n 
A 1 66  PHE 66  101 101 PHE PHE A . n 
A 1 67  TRP 67  102 102 TRP TRP A . n 
A 1 68  LEU 68  103 103 LEU LEU A . n 
A 1 69  ILE 69  104 104 ILE ILE A . n 
A 1 70  ALA 70  105 105 ALA ALA A . n 
A 1 71  LEU 71  106 106 LEU LEU A . n 
A 1 72  ILE 72  107 107 ILE ILE A . n 
A 1 73  HIS 73  108 108 HIS HIS A . n 
A 1 74  GLY 74  109 109 GLY GLY A . n 
A 1 75  ASP 75  110 110 ASP ASP A . n 
A 1 76  LEU 76  111 111 LEU LEU A . n 
A 1 77  GLU 77  112 112 GLU GLU A . n 
A 1 78  ASN 78  113 113 ASN ASN A . n 
A 1 79  PRO 79  114 114 PRO PRO A . n 
A 1 80  GLY 80  115 115 GLY GLY A . n 
A 1 81  GLY 81  116 116 GLY GLY A . n 
A 1 82  ASP 82  117 117 ASP ASP A . n 
A 1 83  ASP 83  118 118 ASP ASP A . n 
A 1 84  THR 84  119 119 THR THR A . n 
A 1 85  PHE 85  120 120 PHE PHE A . n 
A 1 86  LYS 86  121 121 LYS LYS A . n 
A 1 87  PRO 87  122 122 PRO PRO A . n 
A 1 88  CYS 88  123 123 CYS CYS A . n 
A 1 89  VAL 89  124 124 VAL VAL A . n 
A 1 90  LEU 90  125 125 LEU LEU A . n 
A 1 91  GLN 91  126 126 GLN GLN A . n 
A 1 92  VAL 92  127 127 VAL VAL A . n 
A 1 93  ASN 93  128 128 ASN ASN A . n 
A 1 94  GLY 94  129 129 GLY GLY A . n 
A 1 95  PHE 95  130 130 PHE PHE A . n 
A 1 96  VAL 96  131 131 VAL VAL A . n 
A 1 97  ALA 97  132 132 ALA ALA A . n 
A 1 98  ALA 98  133 133 ALA ALA A . n 
A 1 99  PHE 99  134 134 PHE PHE A . n 
A 1 100 LEU 100 135 135 LEU LEU A . n 
A 1 101 PHE 101 136 136 PHE PHE A . n 
A 1 102 SER 102 137 137 SER SER A . n 
A 1 103 ILE 103 138 138 ILE ILE A . n 
A 1 104 GLU 104 139 139 GLU GLU A . n 
A 1 105 THR 105 140 140 THR THR A . n 
A 1 106 GLN 106 141 141 GLN GLN A . n 
A 1 107 THR 107 142 142 THR THR A . n 
A 1 108 THR 108 143 143 THR THR A . n 
A 1 109 ILE 109 144 144 ILE ILE A . n 
A 1 110 GLY 110 145 145 GLY GLY A . n 
A 1 111 TYR 111 146 146 TYR TYR A . n 
A 1 112 GLY 112 147 147 GLY GLY A . n 
A 1 113 PHE 113 148 148 PHE PHE A . n 
A 1 114 ARG 114 149 149 ARG ARG A . n 
A 1 115 CYS 115 150 150 CYS CYS A . n 
A 1 116 VAL 116 151 151 VAL VAL A . n 
A 1 117 THR 117 152 152 THR THR A . n 
A 1 118 GLU 118 153 153 GLU GLU A . n 
A 1 119 GLU 119 154 154 GLU GLU A . n 
A 1 120 CYS 120 155 155 CYS CYS A . n 
A 1 121 PRO 121 156 156 PRO PRO A . n 
A 1 122 LEU 122 157 157 LEU LEU A . n 
A 1 123 ALA 123 158 158 ALA ALA A . n 
A 1 124 VAL 124 159 159 VAL VAL A . n 
A 1 125 PHE 125 160 160 PHE PHE A . n 
A 1 126 MET 126 161 161 MET MET A . n 
A 1 127 VAL 127 162 162 VAL VAL A . n 
A 1 128 VAL 128 163 163 VAL VAL A . n 
A 1 129 VAL 129 164 164 VAL VAL A . n 
A 1 130 GLN 130 165 165 GLN GLN A . n 
A 1 131 SER 131 166 166 SER SER A . n 
A 1 132 ILE 132 167 167 ILE ILE A . n 
A 1 133 VAL 133 168 168 VAL VAL A . n 
A 1 134 GLY 134 169 169 GLY GLY A . n 
A 1 135 CYS 135 170 170 CYS CYS A . n 
A 1 136 ILE 136 171 171 ILE ILE A . n 
A 1 137 ILE 137 172 172 ILE ILE A . n 
A 1 138 ASP 138 173 173 ASP ASP A . n 
A 1 139 SER 139 174 174 SER SER A . n 
A 1 140 PHE 140 175 175 PHE PHE A . n 
A 1 141 MET 141 176 176 MET MET A . n 
A 1 142 ILE 142 177 177 ILE ILE A . n 
A 1 143 GLY 143 178 178 GLY GLY A . n 
A 1 144 ALA 144 179 179 ALA ALA A . n 
A 1 145 ILE 145 180 180 ILE ILE A . n 
A 1 146 MET 146 181 181 MET MET A . n 
A 1 147 ALA 147 182 182 ALA ALA A . n 
A 1 148 LYS 148 183 183 LYS LYS A . n 
A 1 149 MET 149 184 184 MET MET A . n 
A 1 150 ALA 150 185 185 ALA ALA A . n 
A 1 151 ARG 151 186 186 ARG ARG A . n 
A 1 152 PRO 152 187 187 PRO PRO A . n 
A 1 153 LYS 153 188 188 LYS LYS A . n 
A 1 154 LYS 154 189 189 LYS LYS A . n 
A 1 155 ARG 155 190 190 ARG ARG A . n 
A 1 156 ALA 156 191 191 ALA ALA A . n 
A 1 157 GLN 157 192 192 GLN GLN A . n 
A 1 158 THR 158 193 193 THR THR A . n 
A 1 159 LEU 159 194 194 LEU LEU A . n 
A 1 160 LEU 160 195 195 LEU LEU A . n 
A 1 161 PHE 161 196 196 PHE PHE A . n 
A 1 162 SER 162 197 197 SER SER A . n 
A 1 163 HIS 163 198 198 HIS HIS A . n 
A 1 164 ASN 164 199 199 ASN ASN A . n 
A 1 165 ALA 165 200 200 ALA ALA A . n 
A 1 166 VAL 166 201 201 VAL VAL A . n 
A 1 167 VAL 167 202 202 VAL VAL A . n 
A 1 168 ALA 168 203 203 ALA ALA A . n 
A 1 169 MET 169 204 204 MET MET A . n 
A 1 170 ARG 170 205 205 ARG ARG A . n 
A 1 171 ASP 171 206 206 ASP ASP A . n 
A 1 172 GLY 172 207 207 GLY GLY A . n 
A 1 173 LYS 173 208 208 LYS LYS A . n 
A 1 174 LEU 174 209 209 LEU LEU A . n 
A 1 175 CYS 175 210 210 CYS CYS A . n 
A 1 176 LEU 176 211 211 LEU LEU A . n 
A 1 177 MET 177 212 212 MET MET A . n 
A 1 178 TRP 178 213 213 TRP TRP A . n 
A 1 179 ARG 179 214 214 ARG ARG A . n 
A 1 180 VAL 180 215 215 VAL VAL A . n 
A 1 181 GLY 181 216 216 GLY GLY A . n 
A 1 182 ASN 182 217 217 ASN ASN A . n 
A 1 183 LEU 183 218 218 LEU LEU A . n 
A 1 184 ARG 184 219 219 ARG ARG A . n 
A 1 185 LYS 185 220 220 LYS LYS A . n 
A 1 186 SER 186 221 221 SER SER A . n 
A 1 187 HIS 187 222 222 HIS HIS A . n 
A 1 188 LEU 188 223 223 LEU LEU A . n 
A 1 189 VAL 189 224 224 VAL VAL A . n 
A 1 190 GLU 190 225 225 GLU GLU A . n 
A 1 191 ALA 191 226 226 ALA ALA A . n 
A 1 192 HIS 192 227 227 HIS HIS A . n 
A 1 193 VAL 193 228 228 VAL VAL A . n 
A 1 194 ARG 194 229 229 ARG ARG A . n 
A 1 195 ALA 195 230 230 ALA ALA A . n 
A 1 196 GLN 196 231 231 GLN GLN A . n 
A 1 197 LEU 197 232 232 LEU LEU A . n 
A 1 198 ILE 198 233 233 ILE ILE A . n 
A 1 199 LYS 199 234 234 LYS LYS A . n 
A 1 200 PRO 200 235 235 PRO PRO A . n 
A 1 201 ARG 201 236 236 ARG ARG A . n 
A 1 202 ILE 202 237 237 ILE ILE A . n 
A 1 203 THR 203 238 238 THR THR A . n 
A 1 204 GLU 204 239 239 GLU GLU A . n 
A 1 205 GLU 205 240 240 GLU GLU A . n 
A 1 206 GLY 206 241 241 GLY GLY A . n 
A 1 207 GLU 207 242 242 GLU GLU A . n 
A 1 208 TYR 208 243 243 TYR TYR A . n 
A 1 209 ILE 209 244 244 ILE ILE A . n 
A 1 210 PRO 210 245 245 PRO PRO A . n 
A 1 211 LEU 211 246 246 LEU LEU A . n 
A 1 212 ASP 212 247 247 ASP ASP A . n 
A 1 213 GLN 213 248 248 GLN GLN A . n 
A 1 214 ILE 214 249 249 ILE ILE A . n 
A 1 215 ASP 215 250 250 ASP ASP A . n 
A 1 216 ILE 216 251 251 ILE ILE A . n 
A 1 217 ASP 217 252 252 ASP ASP A . n 
A 1 218 VAL 218 253 253 VAL VAL A . n 
A 1 219 GLY 219 254 254 GLY GLY A . n 
A 1 220 PHE 220 255 255 PHE PHE A . n 
A 1 221 ASP 221 256 256 ASP ASP A . n 
A 1 222 LYS 222 257 257 LYS LYS A . n 
A 1 223 GLY 223 258 258 GLY GLY A . n 
A 1 224 LEU 224 259 259 LEU LEU A . n 
A 1 225 ASP 225 260 260 ASP ASP A . n 
A 1 226 ARG 226 261 261 ARG ARG A . n 
A 1 227 ILE 227 262 262 ILE ILE A . n 
A 1 228 PHE 228 263 263 PHE PHE A . n 
A 1 229 LEU 229 264 264 LEU LEU A . n 
A 1 230 VAL 230 265 265 VAL VAL A . n 
A 1 231 SER 231 266 266 SER SER A . n 
A 1 232 PRO 232 267 267 PRO PRO A . n 
A 1 233 ILE 233 268 268 ILE ILE A . n 
A 1 234 THR 234 269 269 THR THR A . n 
A 1 235 ILE 235 270 270 ILE ILE A . n 
A 1 236 LEU 236 271 271 LEU LEU A . n 
A 1 237 HIS 237 272 272 HIS HIS A . n 
A 1 238 GLU 238 273 273 GLU GLU A . n 
A 1 239 ILE 239 274 274 ILE ILE A . n 
A 1 240 ASN 240 275 275 ASN ASN A . n 
A 1 241 GLU 241 276 276 GLU GLU A . n 
A 1 242 ASP 242 277 277 ASP ASP A . n 
A 1 243 SER 243 278 278 SER SER A . n 
A 1 244 PRO 244 279 279 PRO PRO A . n 
A 1 245 LEU 245 280 280 LEU LEU A . n 
A 1 246 PHE 246 281 281 PHE PHE A . n 
A 1 247 GLY 247 282 282 GLY GLY A . n 
A 1 248 ILE 248 283 283 ILE ILE A . n 
A 1 249 SER 249 284 284 SER SER A . n 
A 1 250 ARG 250 285 285 ARG ARG A . n 
A 1 251 GLN 251 286 286 GLN GLN A . n 
A 1 252 ASP 252 287 287 ASP ASP A . n 
A 1 253 LEU 253 288 288 LEU LEU A . n 
A 1 254 GLU 254 289 289 GLU GLU A . n 
A 1 255 THR 255 290 290 THR THR A . n 
A 1 256 ASP 256 291 291 ASP ASP A . n 
A 1 257 ASP 257 292 292 ASP ASP A . n 
A 1 258 PHE 258 293 293 PHE PHE A . n 
A 1 259 GLU 259 294 294 GLU GLU A . n 
A 1 260 ILE 260 295 295 ILE ILE A . n 
A 1 261 VAL 261 296 296 VAL VAL A . n 
A 1 262 VAL 262 297 297 VAL VAL A . n 
A 1 263 ILE 263 298 298 ILE ILE A . n 
A 1 264 LEU 264 299 299 LEU LEU A . n 
A 1 265 GLU 265 300 300 GLU GLU A . n 
A 1 266 GLY 266 301 301 GLY GLY A . n 
A 1 267 MET 267 302 302 MET MET A . n 
A 1 268 VAL 268 303 303 VAL VAL A . n 
A 1 269 GLU 269 304 304 GLU GLU A . n 
A 1 270 ALA 270 305 305 ALA ALA A . n 
A 1 271 THR 271 306 306 THR THR A . n 
A 1 272 ALA 272 307 307 ALA ALA A . n 
A 1 273 MET 273 308 308 MET MET A . n 
A 1 274 THR 274 309 309 THR THR A . n 
A 1 275 THR 275 310 310 THR THR A . n 
A 1 276 GLN 276 311 311 GLN GLN A . n 
A 1 277 ALA 277 312 312 ALA ALA A . n 
A 1 278 ARG 278 313 313 ARG ARG A . n 
A 1 279 SER 279 314 314 SER SER A . n 
A 1 280 SER 280 315 315 SER SER A . n 
A 1 281 TYR 281 316 316 TYR TYR A . n 
A 1 282 LEU 282 317 317 LEU LEU A . n 
A 1 283 ALA 283 318 318 ALA ALA A . n 
A 1 284 SER 284 319 319 SER SER A . n 
A 1 285 GLU 285 320 320 GLU GLU A . n 
A 1 286 ILE 286 321 321 ILE ILE A . n 
A 1 287 LEU 287 322 322 LEU LEU A . n 
A 1 288 TRP 288 323 323 TRP TRP A . n 
A 1 289 GLY 289 324 324 GLY GLY A . n 
A 1 290 HIS 290 325 325 HIS HIS A . n 
A 1 291 ARG 291 326 326 ARG ARG A . n 
A 1 292 PHE 292 327 327 PHE PHE A . n 
A 1 293 GLU 293 328 328 GLU GLU A . n 
A 1 294 PRO 294 329 329 PRO PRO A . n 
A 1 295 VAL 295 330 330 VAL VAL A . n 
A 1 296 LEU 296 331 331 LEU LEU A . n 
A 1 297 PHE 297 332 332 PHE PHE A . n 
A 1 298 GLU 298 333 333 GLU GLU A . n 
A 1 299 GLU 299 334 334 GLU GLU A . n 
A 1 300 LYS 300 335 335 LYS LYS A . n 
A 1 301 ASN 301 336 336 ASN ASN A . n 
A 1 302 GLN 302 337 337 GLN GLN A . n 
A 1 303 TYR 303 338 338 TYR TYR A . n 
A 1 304 LYS 304 339 339 LYS LYS A . n 
A 1 305 VAL 305 340 340 VAL VAL A . n 
A 1 306 ASP 306 341 341 ASP ASP A . n 
A 1 307 TYR 307 342 342 TYR TYR A . n 
A 1 308 SER 308 343 343 SER SER A . n 
A 1 309 HIS 309 344 344 HIS HIS A . n 
A 1 310 PHE 310 345 345 PHE PHE A . n 
A 1 311 HIS 311 346 346 HIS HIS A . n 
A 1 312 LYS 312 347 347 LYS LYS A . n 
A 1 313 THR 313 348 348 THR THR A . n 
A 1 314 TYR 314 349 349 TYR TYR A . n 
A 1 315 GLU 315 350 350 GLU GLU A . n 
A 1 316 VAL 316 351 351 VAL VAL A . n 
A 1 317 PRO 317 352 352 PRO PRO A . n 
A 1 318 SER 318 353 353 SER SER A . n 
A 1 319 THR 319 354 354 THR THR A . n 
A 1 320 PRO 320 355 355 PRO PRO A . n 
A 1 321 ARG 321 356 356 ARG ARG A . n 
A 1 322 CYS 322 357 357 CYS CYS A . n 
A 1 323 SER 323 358 358 SER SER A . n 
A 1 324 ALA 324 359 359 ALA ALA A . n 
A 1 325 LYS 325 360 360 LYS LYS A . n 
A 1 326 ASP 326 361 361 ASP ASP A . n 
A 1 327 LEU 327 362 362 LEU LEU A . n 
A 1 328 VAL 328 363 363 VAL VAL A . n 
A 1 329 GLU 329 364 364 GLU GLU A . n 
A 1 330 ASN 330 365 365 ASN ASN A . n 
A 1 331 LYS 331 366 366 LYS LYS A . n 
A 1 332 PHE 332 367 367 PHE PHE A . n 
A 1 333 LEU 333 368 368 LEU LEU A . n 
A 1 334 LEU 334 369 369 LEU LEU A . n 
A 1 335 SER 335 370 370 SER SER A . n 
A 1 336 ASN 336 371 371 ASN ASN A . n 
A 1 337 SER 337 372 372 SER SER A . n 
A 1 338 LEU 338 373 ?   ?   ?   A . n 
A 1 339 GLU 339 374 ?   ?   ?   A . n 
A 1 340 VAL 340 375 ?   ?   ?   A . n 
A 1 341 LEU 341 376 ?   ?   ?   A . n 
A 1 342 PHE 342 377 ?   ?   ?   A . n 
A 1 343 GLN 343 378 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 K 1 501 501 K K A . 
C 2 K 1 502 502 K K A . 
D 2 K 1 503 503 K K A . 
E 2 K 1 504 504 K K A . 
F 2 K 1 505 505 K K A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 22460 ? 
1 MORE         -112  ? 
1 'SSA (A^2)'  57800 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K 501 ? B K . 
2 1 A K 502 ? C K . 
3 1 A K 503 ? D K . 
4 1 A K 504 ? E K . 
5 1 A K 505 ? F K . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? D K . ? A K 503 ? 1_555 O ? A THR 108 ? A THR 143 ? 1_555 71.0 ? 
2 OG1 ? A THR 108 ? A THR 143 ? 1_555 K ? E K . ? A K 504 ? 1_555 O ? A THR 108 ? A THR 143 ? 1_555 58.5 ? 
3 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? C K . ? A K 502 ? 1_555 O ? A ILE 109 ? A ILE 144 ? 1_555 71.1 ? 
4 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? B K . ? A K 501 ? 1_555 O ? A TYR 111 ? A TYR 146 ? 1_555 67.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-08-24 
2 'Structure model' 1 1 2011-09-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -10.6839 7.8013   -36.7186 1.0177 1.1536 1.3160 0.1628  0.2088  -0.0254 4.3560 4.3391 1.9814 
-0.6029 1.1602 2.5192  0.4504 0.2265 0.6370  0.3073  0.0342  0.4046 -1.1527 -0.9040 0.0003 
'X-RAY DIFFRACTION' 2 ? refined -12.5380 -17.0483 21.6646  1.2986 1.2016 0.9896 -0.1690 -0.0505 -0.1196 4.8185 4.4971 2.1520 
-0.0499 0.6552 -0.0406 0.0930 0.2234 -0.5478 -0.4461 -0.0786 0.3308 0.6454  -0.2855 0.0000 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 70:188))
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and ((resseq 43:60) or (resseq 189:372))
;
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CBASS  'data collection' .                          ? 1 
PHENIX refinement        '(phenix.refine: 1.7_650)' ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TRP A 79  ? ? -82.79  -78.41  
2 1 MET A 181 ? ? -91.97  -61.42  
3 1 ARG A 186 ? ? -156.84 68.11   
4 1 LYS A 189 ? ? 61.31   67.43   
5 1 VAL A 265 ? ? -113.85 -73.72  
6 1 LYS A 335 ? ? 50.43   -112.37 
7 1 SER A 370 ? ? -99.28  -63.16  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 70 ? CG  ? A MET 35 CG  
2  1 Y 1 A MET 70 ? SD  ? A MET 35 SD  
3  1 Y 1 A MET 70 ? CE  ? A MET 35 CE  
4  1 Y 1 A PHE 71 ? CG  ? A PHE 36 CG  
5  1 Y 1 A PHE 71 ? CD1 ? A PHE 36 CD1 
6  1 Y 1 A PHE 71 ? CD2 ? A PHE 36 CD2 
7  1 Y 1 A PHE 71 ? CE1 ? A PHE 36 CE1 
8  1 Y 1 A PHE 71 ? CE2 ? A PHE 36 CE2 
9  1 Y 1 A PHE 71 ? CZ  ? A PHE 36 CZ  
10 1 Y 1 A THR 72 ? OG1 ? A THR 37 OG1 
11 1 Y 1 A THR 72 ? CG2 ? A THR 37 CG2 
12 1 Y 1 A THR 73 ? OG1 ? A THR 38 OG1 
13 1 Y 1 A THR 73 ? CG2 ? A THR 38 CG2 
14 1 Y 1 A CYS 74 ? SG  ? A CYS 39 SG  
15 1 Y 1 A VAL 75 ? CG1 ? A VAL 40 CG1 
16 1 Y 1 A VAL 75 ? CG2 ? A VAL 40 CG2 
17 1 Y 1 A ASP 76 ? CG  ? A ASP 41 CG  
18 1 Y 1 A ASP 76 ? OD1 ? A ASP 41 OD1 
19 1 Y 1 A ASP 76 ? OD2 ? A ASP 41 OD2 
20 1 Y 1 A ILE 77 ? CG1 ? A ILE 42 CG1 
21 1 Y 1 A ILE 77 ? CG2 ? A ILE 42 CG2 
22 1 Y 1 A ILE 77 ? CD1 ? A ILE 42 CD1 
23 1 Y 1 A ARG 78 ? CG  ? A ARG 43 CG  
24 1 Y 1 A ARG 78 ? CD  ? A ARG 43 CD  
25 1 Y 1 A ARG 78 ? NE  ? A ARG 43 NE  
26 1 Y 1 A ARG 78 ? CZ  ? A ARG 43 CZ  
27 1 Y 1 A ARG 78 ? NH1 ? A ARG 43 NH1 
28 1 Y 1 A ARG 78 ? NH2 ? A ARG 43 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 36  ? A MET 1   
2  1 Y 1 A ALA 37  ? A ALA 2   
3  1 Y 1 A ARG 38  ? A ARG 3   
4  1 Y 1 A ARG 39  ? A ARG 4   
5  1 Y 1 A LYS 40  ? A LYS 5   
6  1 Y 1 A CYS 41  ? A CYS 6   
7  1 Y 1 A ARG 42  ? A ARG 7   
8  1 Y 1 A ASP 61  ? A ASP 26  
9  1 Y 1 A LYS 62  ? A LYS 27  
10 1 Y 1 A PRO 63  ? A PRO 28  
11 1 Y 1 A GLN 64  ? A GLN 29  
12 1 Y 1 A ARG 65  ? A ARG 30  
13 1 Y 1 A TYR 66  ? A TYR 31  
14 1 Y 1 A ILE 67  ? A ILE 32  
15 1 Y 1 A ALA 68  ? A ALA 33  
16 1 Y 1 A ASP 69  ? A ASP 34  
17 1 Y 1 A LEU 373 ? A LEU 338 
18 1 Y 1 A GLU 374 ? A GLU 339 
19 1 Y 1 A VAL 375 ? A VAL 340 
20 1 Y 1 A LEU 376 ? A LEU 341 
21 1 Y 1 A PHE 377 ? A PHE 342 
22 1 Y 1 A GLN 378 ? A GLN 343 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'POTASSIUM ION' 
_pdbx_entity_nonpoly.comp_id     K 
#