data_3SPY
# 
_entry.id   3SPY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SPY         
NDB   NA1203       
RCSB  RCSB066507   
WWPDB D_1000066507 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SPZ 'RB69 DNA Polymerase(L415A/L561A/S565G/Y567A) Ternary Complex with dUpCpp Opposite dA (Ca2+)' unspecified 
PDB 3SQ0 'RB69 DNA Polymerase(L561A/S565G/Y567A) Ternary Complex with dUpNpp Opposite dA (Mn2+)'       unspecified 
PDB 3SQ1 'RB69 DNA Polymerase Ternary Complex with dUpCpp Opposite dA'                                 unspecified 
PDB 3SQ2 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (AT rich sequence)'               unspecified 
PDB 3SQ4 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (GC rich sequence)'               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SPY 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Insights into Complete Metal Ion Coordination from Ternary Complexes of B Family RB69 DNA Polymerase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            50 
_citation.page_first                9114 
_citation.page_last                 9124 
_citation.year                      2011 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21923197 
_citation.pdbx_database_id_DOI      10.1021/bi201260h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Wang, M.'         2 
primary 'Blaha, G.'        3 
primary 'Konigsberg, W.H.' 4 
primary 'Wang, J.'         5 
# 
_cell.entry_id           3SPY 
_cell.length_a           75.336 
_cell.length_b           120.598 
_cell.length_c           130.812 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SPY 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                                            104186.609 1   
2.7.7.7 'L415A, L561A, S565G, Y567A' ? ?        
2 polymer     syn "5'-D(*TP*CP*GP*AP*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3'"                            5541.591   1   ? ? ? 
template 
3 polymer     syn "5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*C)-3'"                                           3967.585   1   ? ? ? 
primer   
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]uridine" 466.169    1   ? ? ? 
?        
5 non-polymer syn 'MAGNESIUM ION'                                                                             24.305     5   ? ? ? 
?        
6 water       nat water                                                                                       18.015     494 ? ? ? 
?        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSAYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSAYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMF
;
A ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DG)(DA)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' TCGAGTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 ALA n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
2 1   DT  n 
2 2   DC  n 
2 3   DG  n 
2 4   DA  n 
2 5   DG  n 
2 6   DT  n 
2 7   DA  n 
2 8   DA  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
2 12  DG  n 
2 13  DT  n 
2 14  DC  n 
2 15  DC  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMF
;
1 ? 
2 PDB 3SPY       3SPY   2 TCGAGTAAGCAGTCCGCG ? ? 
3 PDB 3SPY       3SPY   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SPY A 1 ? 901 ? Q38087 1   ? 901 ? 1   901 
2 2 3SPY T 1 ? 18  ? 3SPY   1   ? 18  ? 1   18  
3 3 3SPY P 1 ? 13  ? 3SPY   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SPY ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 3SPY ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 3SPY ALA A 415 ? UNP Q38087 LEU 415 'ENGINEERED MUTATION' 415 3 
1 3SPY ALA A 561 ? UNP Q38087 LEU 561 'ENGINEERED MUTATION' 561 4 
1 3SPY GLY A 565 ? UNP Q38087 SER 565 'ENGINEERED MUTATION' 565 5 
1 3SPY ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                         ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                             ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'       181.189 
UPC non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]uridine" ? 
'C10 H17 N2 O13 P3' 466.169 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3SPY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'150 mM calcium chloride, 15% w/v PEG350 MME, 100 mM sodium cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2011-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3SPY 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.d_resolution_low             88.67 
_reflns.d_resolution_high            2.14 
_reflns.number_obs                   61948 
_reflns.number_all                   65531 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.14 
_reflns_shell.d_res_low              2.23 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SPY 
_refine.ls_number_reflns_obs                     61948 
_refine.ls_number_reflns_all                     65531 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             88.67 
_refine.ls_d_res_high                            2.14 
_refine.ls_percent_reflns_obs                    98.54 
_refine.ls_R_factor_obs                          0.19357 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19101 
_refine.ls_R_factor_R_free                       0.24205 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3323 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.927 
_refine.B_iso_mean                               35.018 
_refine.aniso_B[1][1]                            0.14 
_refine.aniso_B[2][2]                            1.08 
_refine.aniso_B[3][3]                            -1.22 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
U VALUES      : RESIDUAL ONLY
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.197 
_refine.overall_SU_ML                            0.141 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             12.168 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.232 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7340 
_refine_hist.pdbx_number_atoms_nucleic_acid   631 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             494 
_refine_hist.number_atoms_total               8498 
_refine_hist.d_res_high                       2.14 
_refine_hist.d_res_low                        88.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.022  ? 8295  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.147  2.061  ? 11352 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.224  5.000  ? 910   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.699 24.111 ? 377   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.565 15.000 ? 1351  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       15.545 15.000 ? 48    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.079  0.200  ? 1201  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.005  0.021  ? 6135  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.467  4.000  ? 4510  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.417  6.000  ? 7313  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  2.972  6.000  ? 3785  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.180  9.000  ? 4034  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.142 
_refine_ls_shell.d_res_low                        2.198 
_refine_ls_shell.number_reflns_R_work             4134 
_refine_ls_shell.R_factor_R_work                  0.263 
_refine_ls_shell.percent_reflns_obs               90.34 
_refine_ls_shell.R_factor_R_free                  0.308 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             231 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SPY 
_struct.title                     'RB69 DNA Polymerase(L415A/L561A/S565G/Y567A) Ternary Complex with dUpCpp Opposite dA' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SPY 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'dUpCpp, Quadruple mutant, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? LYS A 169 ? SER A 163 LYS A 169 1 ? 7  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? SER A 310 ? PRO A 308 SER A 310 5 ? 3  
HELX_P HELX_P14 14 LYS A 311 ? GLN A 339 ? LYS A 311 GLN A 339 1 ? 29 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLU A 375 ? SER A 360 GLU A 375 1 ? 16 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? ASN A 505 ? GLY A 469 ASN A 505 1 ? 37 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? GLY A 610 ? ASP A 579 GLY A 610 1 ? 32 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P33 33 ILE A 858 ? MET A 866 ? ILE A 858 MET A 866 1 ? 9  
HELX_P HELX_P34 34 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P35 35 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
HELX_P HELX_P36 36 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E MG  .  MG ? ? A ASP 411 A MG  903  1_555 ? ? ? ? ? ? ?            1.922 ? 
metalc2  metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 623 A MG  904  1_555 ? ? ? ? ? ? ?            1.983 ? 
metalc3  metalc ? ? D UPC .   O2B   ? ? ? 1_555 E MG  .  MG ? ? A UPC 902 A MG  903  1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc4  metalc ? ? D UPC .   O1G   ? ? ? 1_555 E MG  .  MG ? ? A UPC 902 A MG  903  1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc5  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E MG  .  MG ? ? A ASP 623 A MG  903  1_555 ? ? ? ? ? ? ?            2.107 ? 
metalc6  metalc ? ? A LEU 412 O     ? ? ? 1_555 E MG  .  MG ? ? A LEU 412 A MG  903  1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc7  metalc ? ? D UPC .   O2A   ? ? ? 1_555 F MG  .  MG ? ? A UPC 902 A MG  904  1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc8  metalc ? ? D UPC .   O2A   ? ? ? 1_555 E MG  .  MG ? ? A UPC 902 A MG  903  1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc9  metalc ? ? C DC  13  "O3'" ? ? ? 1_555 F MG  .  MG ? ? P DC  115 A MG  904  1_555 ? ? ? ? ? ? ?            2.283 ? 
metalc10 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F MG  .  MG ? ? A ASP 411 A MG  904  1_555 ? ? ? ? ? ? ?            2.302 ? 
metalc11 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 I MG  .  MG ? ? A GLU 116 A MG  907  1_555 ? ? ? ? ? ? ?            2.451 ? 
metalc12 metalc ? ? A LYS 531 O     ? ? ? 1_555 G MG  .  MG ? ? A LYS 531 A MG  905  1_555 ? ? ? ? ? ? ?            2.677 ? 
metalc13 metalc ? ? A ASP 114 OD2   ? ? ? 1_555 I MG  .  MG ? ? A ASP 114 A MG  907  1_555 ? ? ? ? ? ? ?            2.801 ? 
metalc14 metalc ? ? A ASN 505 O     ? ? ? 1_555 G MG  .  MG ? ? A ASN 505 A MG  905  1_555 ? ? ? ? ? ? ?            2.914 ? 
metalc15 metalc ? ? F MG  .   MG    ? ? ? 1_555 L HOH .  O  ? ? A MG  904 P HOH 493  1_555 ? ? ? ? ? ? ?            1.890 ? 
metalc16 metalc ? ? H MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  906 A HOH 1228 1_555 ? ? ? ? ? ? ?            1.902 ? 
metalc17 metalc ? ? H MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  906 A HOH 1014 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc18 metalc ? ? H MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  906 A HOH 973  1_555 ? ? ? ? ? ? ?            2.426 ? 
metalc19 metalc ? ? H MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  906 A HOH 936  1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc20 metalc ? ? I MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  907 A HOH 1222 1_555 ? ? ? ? ? ? ?            2.483 ? 
metalc21 metalc ? ? H MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  906 A HOH 1180 1_555 ? ? ? ? ? ? ?            2.490 ? 
metalc22 metalc ? ? F MG  .   MG    ? ? ? 1_555 J HOH .  O  ? ? A MG  904 A HOH 1267 1_555 ? ? ? ? ? ? ?            2.515 ? 
hydrog1  hydrog ? ? B DG  5   N1    ? ? ? 1_555 C DC  13 N3 ? ? T DG  5   P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  5   N2    ? ? ? 1_555 C DC  13 O2 ? ? T DG  5   P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  5   O6    ? ? ? 1_555 C DC  13 N4 ? ? T DG  5   P DC  115  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6   P DA  114  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7   P DT  113  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8   P DT  112  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  9   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  9   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  9   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9   P DC  111  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10  P DG  110  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11  P DT  109  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  12  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  12  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  12  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12  P DC  108  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  13  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  13  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13  P DA  107  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  14  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  14  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  14  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15  P DG  105  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16  P DC  104  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  17  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  17  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  17  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17  P DG  103  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 6 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 4 ? 
H ? 3 ? 
I ? 3 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? parallel      
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
F 6 7 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 PRO A 56  ? LEU A 61  ? PRO A 56  LEU A 61  
B 3 TYR A 49  ? ASP A 51  ? TYR A 49  ASP A 51  
B 4 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
C 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
C 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
C 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
C 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
C 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
C 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
D 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
D 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
E 1 THR A 248 ? ASN A 255 ? THR A 248 ASN A 255 
E 2 GLY A 258 ? LEU A 265 ? GLY A 258 LEU A 265 
F 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
F 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
F 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
F 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
F 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
F 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
F 7 VAL A 617 ? TYR A 619 ? VAL A 617 TYR A 619 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
H 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
H 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
H 3 SER A 455 ? SER A 457 ? SER A 455 SER A 457 
I 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
I 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
I 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
J 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
J 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 6   ? N LEU A 6   O ARG A 18  ? O ARG A 18  
A 2 3 N ILE A 15  ? N ILE A 15  O VAL A 31  ? O VAL A 31  
B 1 2 N LEU A 37  ? N LEU A 37  O LYS A 60  ? O LYS A 60  
B 2 3 O CYS A 57  ? O CYS A 57  N TYR A 49  ? N TYR A 49  
B 3 4 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
C 1 2 O MET A 189 ? O MET A 189 N VAL A 148 ? N VAL A 148 
C 2 3 O PHE A 149 ? O PHE A 149 N ILE A 136 ? N ILE A 136 
C 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
C 4 5 N ALA A 111 ? N ALA A 111 O ILE A 212 ? O ILE A 212 
C 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
D 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
E 1 2 N ILE A 253 ? N ILE A 253 O ARG A 260 ? O ARG A 260 
F 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
F 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
F 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
F 4 5 O ALA A 689 ? O ALA A 689 N VAL A 407 ? N VAL A 407 
F 5 6 N MET A 408 ? N MET A 408 O VAL A 627 ? O VAL A 627 
F 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N PHE A 701 ? N PHE A 701 O ALA A 709 ? O ALA A 709 
G 3 4 N VAL A 712 ? N VAL A 712 O LYS A 724 ? O LYS A 724 
H 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
H 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
I 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
I 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
J 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE UPC A 902' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 903'  
AC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MG A 904'  
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 905'  
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MG A 906'  
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 907'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 23 ASP A 411 ? ASP A 411  . ? 1_555 ? 
2  AC1 23 LEU A 412 ? LEU A 412  . ? 1_555 ? 
3  AC1 23 THR A 413 ? THR A 413  . ? 1_555 ? 
4  AC1 23 SER A 414 ? SER A 414  . ? 1_555 ? 
5  AC1 23 ALA A 415 ? ALA A 415  . ? 1_555 ? 
6  AC1 23 TYR A 416 ? TYR A 416  . ? 1_555 ? 
7  AC1 23 ARG A 482 ? ARG A 482  . ? 1_555 ? 
8  AC1 23 LYS A 560 ? LYS A 560  . ? 1_555 ? 
9  AC1 23 ASN A 564 ? ASN A 564  . ? 1_555 ? 
10 AC1 23 THR A 622 ? THR A 622  . ? 1_555 ? 
11 AC1 23 ASP A 623 ? ASP A 623  . ? 1_555 ? 
12 AC1 23 MG  E .   ? MG  A 903  . ? 1_555 ? 
13 AC1 23 MG  F .   ? MG  A 904  . ? 1_555 ? 
14 AC1 23 HOH J .   ? HOH A 931  . ? 1_555 ? 
15 AC1 23 HOH J .   ? HOH A 965  . ? 1_555 ? 
16 AC1 23 HOH J .   ? HOH A 1014 . ? 1_555 ? 
17 AC1 23 HOH J .   ? HOH A 1104 . ? 1_555 ? 
18 AC1 23 HOH J .   ? HOH A 1180 . ? 1_555 ? 
19 AC1 23 HOH J .   ? HOH A 1199 . ? 1_555 ? 
20 AC1 23 HOH J .   ? HOH A 1267 . ? 1_555 ? 
21 AC1 23 DC  C 13  ? DC  P 115  . ? 1_555 ? 
22 AC1 23 DA  B 4   ? DA  T 4    . ? 1_555 ? 
23 AC1 23 DG  B 5   ? DG  T 5    . ? 1_555 ? 
24 AC2 5  ASP A 411 ? ASP A 411  . ? 1_555 ? 
25 AC2 5  LEU A 412 ? LEU A 412  . ? 1_555 ? 
26 AC2 5  ASP A 623 ? ASP A 623  . ? 1_555 ? 
27 AC2 5  UPC D .   ? UPC A 902  . ? 1_555 ? 
28 AC2 5  MG  F .   ? MG  A 904  . ? 1_555 ? 
29 AC3 7  ASP A 411 ? ASP A 411  . ? 1_555 ? 
30 AC3 7  ASP A 623 ? ASP A 623  . ? 1_555 ? 
31 AC3 7  UPC D .   ? UPC A 902  . ? 1_555 ? 
32 AC3 7  MG  E .   ? MG  A 903  . ? 1_555 ? 
33 AC3 7  HOH J .   ? HOH A 1267 . ? 1_555 ? 
34 AC3 7  DC  C 13  ? DC  P 115  . ? 1_555 ? 
35 AC3 7  HOH L .   ? HOH P 493  . ? 1_555 ? 
36 AC4 6  ALA A 502 ? ALA A 502  . ? 1_555 ? 
37 AC4 6  ASN A 505 ? ASN A 505  . ? 1_555 ? 
38 AC4 6  PRO A 506 ? PRO A 506  . ? 1_555 ? 
39 AC4 6  ILE A 530 ? ILE A 530  . ? 1_555 ? 
40 AC4 6  LYS A 531 ? LYS A 531  . ? 1_555 ? 
41 AC4 6  LEU A 533 ? LEU A 533  . ? 1_555 ? 
42 AC5 6  LYS A 486 ? LYS A 486  . ? 1_555 ? 
43 AC5 6  HOH J .   ? HOH A 936  . ? 1_555 ? 
44 AC5 6  HOH J .   ? HOH A 973  . ? 1_555 ? 
45 AC5 6  HOH J .   ? HOH A 1014 . ? 1_555 ? 
46 AC5 6  HOH J .   ? HOH A 1180 . ? 1_555 ? 
47 AC5 6  HOH J .   ? HOH A 1228 . ? 1_555 ? 
48 AC6 3  ASP A 114 ? ASP A 114  . ? 1_555 ? 
49 AC6 3  GLU A 116 ? GLU A 116  . ? 1_555 ? 
50 AC6 3  HOH J .   ? HOH A 1222 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SPY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SPY 
_atom_sites.fract_transf_matrix[1][1]   0.013274 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008292 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007645 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -37.803 18.332  29.528  1.00 53.31 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.517 17.779  29.016  1.00 52.72 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.474 16.255  29.135  1.00 50.63 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.271 15.646  29.864  1.00 48.38 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.310 18.432  29.726  1.00 54.69 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.168 18.148  31.238  1.00 59.94 ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -33.902 19.148  32.089  1.00 67.20 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -32.388 18.522  31.360  1.00 64.92 ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.556 15.646  28.393  1.00 47.72 ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.268 14.228  28.543  1.00 47.17 ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.469 14.017  29.827  1.00 43.48 ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.604 14.819  30.166  1.00 40.57 ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.496 13.701  27.330  1.00 49.85 ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.373 13.205  26.176  1.00 55.25 ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -36.083 11.887  26.529  1.00 59.41 ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -36.715 11.217  25.304  1.00 63.43 ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -35.716 10.531  24.425  1.00 62.79 ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.773 12.941  30.539  1.00 41.91 ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -34.140 12.667  31.826  1.00 41.30 ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.684 12.208  31.645  1.00 37.40 ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.318 11.682  30.586  1.00 35.52 ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.965 11.636  32.609  1.00 42.88 ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -36.477 11.920  32.581  1.00 51.65 ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -37.267 11.181  33.659  1.00 58.12 ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -38.217 11.784  34.214  1.00 61.69 ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.949 10.004  33.951  1.00 59.58 ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.850 12.450  32.655  1.00 31.84 ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.495 11.899  32.662  1.00 25.97 ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -29.975 11.567  34.055  1.00 25.40 ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.232 12.294  35.009  1.00 24.88 ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.521 12.807  31.909  1.00 26.00 ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.302 14.158  32.543  1.00 26.41 ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.171 15.212  32.292  1.00 26.25 ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.192 14.387  33.349  1.00 25.27 ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -29.948 16.475  32.855  1.00 29.91 ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -27.963 15.640  33.913  1.00 24.45 ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -28.843 16.686  33.668  1.00 26.19 ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -29.237 10.465  34.161  1.00 23.62 ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.667 10.052  35.440  1.00 24.29 ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.595 11.020  35.938  1.00 23.88 ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -26.960 11.705  35.146  1.00 22.99 ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -28.099 8.629   35.355  1.00 23.21 ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.834 8.482   34.522  1.00 21.86 ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -26.912 8.145   33.178  1.00 16.91 ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.564 8.656   35.084  1.00 22.35 ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.773 7.982   32.404  1.00 22.19 ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.391 8.496   34.297  1.00 23.61 ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.522 8.154   32.960  1.00 21.57 ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.426 7.996   32.145  1.00 28.30 ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -27.427 11.073  37.259  1.00 24.33 ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -26.332 11.786  37.904  1.00 22.03 ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -25.305 10.788  38.416  1.00 23.74 ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -24.115 10.882  38.100  1.00 23.40 ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.879 12.631  39.054  1.00 23.71 ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.793 13.774  38.597  1.00 19.56 ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -28.430 14.445  39.779  1.00 15.82 ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -26.983 14.778  37.774  1.00 19.98 ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.783 9.829   39.205  1.00 23.88 ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.971 8.728   39.708  1.00 24.28 ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -25.806 7.457   39.777  1.00 25.80 ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -27.031 7.505   39.890  1.00 28.20 ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -24.434 8.997   41.125  1.00 26.39 ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -25.531 9.059   42.044  1.00 25.48 ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -23.603 10.309  41.203  1.00 22.53 ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -25.127 6.321   39.722  1.00 24.77 ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -25.751 5.024   39.886  1.00 25.38 ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -24.806 4.158   40.709  1.00 27.13 ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -23.583 4.229   40.538  1.00 27.40 ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -26.064 4.355   38.503  1.00 24.77 ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -24.796 4.171   37.668  1.00 18.28 ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.788 3.026   38.674  1.00 27.03 ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -25.382 3.364   41.613  1.00 28.29 ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -24.636 2.418   42.424  1.00 28.71 ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -25.427 1.110   42.536  1.00 29.39 ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -26.659 1.115   42.487  1.00 30.19 ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -24.393 2.986   43.832  1.00 28.73 ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -23.689 4.353   43.900  1.00 26.90 ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -22.181 4.286   43.601  1.00 27.70 ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -21.667 3.188   43.307  1.00 24.32 ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -21.503 5.336   43.668  1.00 27.19 ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -24.718 -0.007  42.674  1.00 29.65 ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -25.346 -1.243  43.141  1.00 29.83 ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -25.043 -1.439  44.626  1.00 31.64 ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -23.878 -1.468  45.018  1.00 32.53 ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -24.862 -2.464  42.367  1.00 29.76 ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -25.345 -3.778  42.998  1.00 29.64 ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -24.764 -5.015  42.363  1.00 31.60 ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -24.049 -4.943  41.366  1.00 29.38 ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -25.080 -6.175  42.940  1.00 33.27 ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -26.094 -1.564  45.440  1.00 30.84 ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -25.943 -1.868  46.855  1.00 31.82 ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -26.784 -3.106  47.162  1.00 33.07 ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -28.011 -3.034  47.256  1.00 32.25 ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -26.330 -0.666  47.755  1.00 32.49 ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -25.413 0.534   47.466  1.00 33.48 ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -26.276 -1.062  49.244  1.00 33.75 ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -25.820 1.847   48.174  1.00 37.04 ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -26.113 -4.247  47.285  1.00 33.92 ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -26.803 -5.524  47.414  1.00 35.81 ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -27.674 -5.782  46.199  1.00 36.95 ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -27.185 -5.794  45.061  1.00 36.31 ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -28.970 -5.965  46.441  1.00 36.77 ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -29.922 -6.242  45.369  1.00 35.34 ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -30.654 -4.995  44.875  1.00 34.97 ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -31.644 -5.088  44.145  1.00 34.34 ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -30.917 -7.313  45.805  1.00 35.73 ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -30.291 -8.680  45.883  1.00 35.29 ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -30.673 -9.448  46.783  1.00 41.74 ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -29.424 -8.996  45.040  1.00 34.14 ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -30.153 -3.827  45.253  1.00 32.48 ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -30.791 -2.596  44.817  1.00 33.49 ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -29.856 -1.725  44.003  1.00 31.21 ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -28.657 -1.620  44.293  1.00 29.54 ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -31.360 -1.816  46.002  1.00 33.46 ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -32.606 -2.371  46.418  1.00 34.55 ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -30.420 -1.129  42.960  1.00 30.12 ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -29.770 -0.035  42.267  1.00 30.12 ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -30.185 1.267   42.951  1.00 29.38 ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -31.371 1.542   43.105  1.00 32.71 ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -30.139 -0.015  40.756  1.00 28.34 ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -29.534 -1.227  40.017  1.00 24.02 ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -29.734 1.306   40.090  1.00 28.33 ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -28.011 -1.303  39.982  1.00 29.45 ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -29.204 2.059   43.359  1.00 27.95 ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -29.463 3.412   43.852  1.00 28.20 ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -29.040 4.410   42.776  1.00 28.59 ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -27.877 4.408   42.335  1.00 25.41 ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -28.715 3.673   45.167  1.00 26.00 ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -29.383 3.074   46.374  1.00 29.44 ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -30.247 3.840   47.158  1.00 28.99 ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -29.163 1.741   46.724  1.00 29.36 ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -30.880 3.284   48.279  1.00 34.13 ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -29.788 1.175   47.843  1.00 31.07 ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -30.644 1.946   48.621  1.00 30.68 ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -29.987 5.243   42.343  1.00 26.42 ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -29.729 6.198   41.273  1.00 27.01 ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -30.139 7.613   41.648  1.00 28.36 ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -31.260 7.845   42.114  1.00 31.30 ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -30.468 5.808   39.996  1.00 27.43 ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -30.092 6.694   38.804  1.00 31.77 ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -31.087 6.636   37.658  1.00 31.12 ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.844 7.315   36.645  1.00 30.57 ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -32.104 5.926   37.758  1.00 30.39 ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -29.227 8.553   41.432  1.00 27.24 ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -29.564 9.957   41.495  1.00 27.61 ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -29.738 10.387  40.057  1.00 25.35 ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.974 9.958   39.200  1.00 23.61 ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -28.446 10.745  42.171  1.00 27.98 ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -28.268 10.374  43.641  1.00 30.05 ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -27.030 11.032  44.219  1.00 26.21 ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -27.228 12.465  44.411  1.00 24.43 ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -26.244 13.320  44.669  1.00 26.05 ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -24.981 12.888  44.753  1.00 19.79 ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -26.520 14.604  44.839  1.00 21.03 ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.745 11.213  39.786  1.00 24.27 ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -31.037 11.612  38.414  1.00 25.39 ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.745 12.963  38.335  1.00 28.24 ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -32.232 13.478  39.340  1.00 28.19 ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.851 10.512  37.692  1.00 27.21 ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -33.277 10.330  38.192  1.00 28.12 ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -33.546 9.713   39.420  1.00 28.43 ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -34.359 10.767  37.426  1.00 31.32 ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.868 9.542   39.870  1.00 31.31 ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.676 10.594  37.856  1.00 28.98 ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.927 9.994   39.074  1.00 31.56 ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -37.236 9.853   39.485  1.00 31.73 ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.768 13.539  37.135  1.00 29.64 ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -32.550 14.741  36.848  1.00 29.81 ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.798 14.313  36.068  1.00 29.01 ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.686 13.671  35.024  1.00 29.08 ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.718 15.774  36.030  1.00 28.85 ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -30.525 16.312  36.843  1.00 27.58 ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.597 16.883  35.481  1.00 28.19 ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.874 17.027  38.162  1.00 26.03 ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -34.981 14.645  36.582  1.00 29.48 ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -36.228 14.185  35.962  1.00 28.63 ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.647 15.106  34.816  1.00 30.54 ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -35.963 16.103  34.521  1.00 31.28 ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -37.354 14.017  37.007  1.00 27.74 ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.822 15.352  37.623  1.00 29.24 ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.564 16.443  37.055  1.00 30.33 ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -38.477 15.308  38.688  1.00 32.39 ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.784 14.787  34.195  1.00 31.87 ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -38.274 15.530  33.028  1.00 33.95 ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.551 17.012  33.285  1.00 33.26 ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.605 17.800  32.346  1.00 33.70 ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.492 14.842  32.387  1.00 35.15 ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.434 14.432  33.359  1.00 41.65 ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.688 17.395  34.549  1.00 32.66 ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.902 18.803  34.891  1.00 34.53 ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.618 19.514  35.308  1.00 35.10 ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -37.635 20.698  35.659  1.00 36.62 ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.986 18.933  35.971  1.00 36.59 ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -41.329 18.376  35.515  1.00 37.73 ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.908 18.849  34.538  1.00 40.94 ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -41.820 17.358  36.214  1.00 40.52 ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -36.502 18.788  35.271  1.00 34.43 ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -35.199 19.385  35.567  1.00 33.03 ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.852 19.391  37.043  1.00 32.66 ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.979 20.141  37.481  1.00 31.68 ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -35.532 18.543  37.806  1.00 31.63 ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -35.300 18.441  39.244  1.00 33.60 ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -34.483 17.204  39.616  1.00 33.21 ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -34.606 16.150  38.986  1.00 31.98 ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -36.641 18.413  39.974  1.00 33.43 ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -37.447 19.671  39.760  1.00 33.18 ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -38.911 19.358  39.805  1.00 32.71 ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -39.685 20.546  40.132  1.00 35.17 ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -40.998 20.559  40.313  1.00 31.94 ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -41.704 19.438  40.187  1.00 31.26 ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -41.600 21.694  40.632  1.00 33.18 ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -33.655 17.338  40.644  1.00 33.05 ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -32.886 16.208  41.145  1.00 33.20 ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -33.765 15.315  42.010  1.00 34.67 ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -34.497 15.795  42.880  1.00 34.07 ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -31.658 16.672  41.937  1.00 31.99 ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -30.827 15.519  42.481  1.00 29.87 ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -29.500 15.957  43.105  1.00 34.90 ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -28.996 17.066  42.791  1.00 33.97 ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -28.956 15.171  43.908  1.00 28.71 ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -33.681 14.013  41.748  1.00 32.55 ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -34.407 13.005  42.495  1.00 33.40 ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -33.465 11.841  42.789  1.00 31.08 ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -32.373 11.757  42.230  1.00 30.86 ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -35.611 12.496  41.690  1.00 37.01 ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -36.372 13.555  40.899  1.00 45.03 ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -37.380 14.310  41.757  1.00 52.73 ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -38.495 13.467  42.195  1.00 60.76 ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -39.446 12.973  41.398  1.00 63.31 ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -39.439 13.212  40.088  1.00 60.19 ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -40.411 12.225  41.916  1.00 63.41 ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -33.905 10.951  43.667  1.00 29.74 ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -33.185 9.739   43.993  1.00 30.65 ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -34.211 8.623   44.066  1.00 31.65 ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -35.353 8.849   44.473  1.00 32.08 ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -32.467 9.842   45.358  1.00 31.26 ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -31.797 11.102  45.457  1.00 37.42 ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -31.444 8.740   45.518  1.00 26.56 ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -33.804 7.418   43.675  1.00 31.05 ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -34.680 6.265   43.751  1.00 30.92 ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -33.892 4.985   43.989  1.00 31.89 ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -32.709 4.890   43.664  1.00 28.51 ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -35.507 6.137   42.473  1.00 31.41 ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -34.678 5.894   41.213  1.00 33.93 ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -35.571 5.840   39.991  1.00 37.32 ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.834 6.162   38.778  1.00 35.38 ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -35.391 6.617   37.662  1.00 38.77 ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.702 6.812   37.599  1.00 41.19 ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.633 6.886   36.608  1.00 40.02 ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -34.569 4.004   44.564  1.00 34.03 ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -33.999 2.693   44.768  1.00 35.53 ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -34.810 1.737   43.908  1.00 36.14 ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -36.041 1.696   44.008  1.00 37.18 ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -34.081 2.316   46.247  1.00 36.63 ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -33.472 0.966   46.572  1.00 40.33 ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -33.649 0.560   48.021  1.00 39.54 ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -34.018 1.418   48.846  1.00 36.75 ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -33.409 -0.625  48.332  1.00 44.45 ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -34.122 0.984   43.055  1.00 34.63 ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -34.781 0.083   42.110  1.00 34.91 ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -34.303 -1.354  42.312  1.00 35.42 ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -33.100 -1.620  42.348  1.00 31.99 ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -34.539 0.518   40.643  1.00 33.66 ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -35.286 -0.390  39.669  1.00 38.91 ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -34.968 1.973   40.436  1.00 37.37 ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -35.258 -2.270  42.457  1.00 35.67 ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -34.948 -3.690  42.576  1.00 38.78 ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -34.779 -4.276  41.169  1.00 37.84 ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -35.608 -5.040  40.687  1.00 38.52 ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -36.030 -4.411  43.390  1.00 42.12 ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -36.169 -3.882  44.825  1.00 46.34 ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -37.336 -4.505  45.580  1.00 52.31 ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -37.112 -5.523  46.268  1.00 55.83 ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -38.473 -3.988  45.481  1.00 50.77 ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -33.691 -3.867  40.518  1.00 37.03 ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -33.396 -4.201  39.128  1.00 33.13 ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -33.167 -5.701  38.937  1.00 31.13 ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -32.359 -6.301  39.647  1.00 30.29 ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -32.154 -3.418  38.676  1.00 32.89 ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -31.744 -3.644  37.238  1.00 31.01 ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -32.596 -3.300  36.180  1.00 32.51 ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -30.494 -4.186  36.930  1.00 32.44 ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -32.212 -3.508  34.852  1.00 32.44 ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -30.099 -4.391  35.607  1.00 28.42 ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.962 -4.054  34.581  1.00 29.03 ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.577 -4.263  33.287  1.00 27.73 ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.883 -6.289  37.982  1.00 27.32 ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.724 -7.702  37.657  1.00 29.77 ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.807 -7.773  36.446  1.00 28.15 ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.216 -7.404  35.344  1.00 26.09 ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -35.074 -8.363  37.333  1.00 30.59 ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -36.253 -7.980  38.251  1.00 37.46 ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.475 -8.970  39.369  1.00 42.89 ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.373 -10.135 38.941  1.00 49.48 ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.829 -9.838  39.145  1.00 51.78 ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.550 -8.219  36.641  1.00 27.93 ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.655 -8.260  35.496  1.00 27.37 ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.930 -9.488  34.628  1.00 27.14 ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.593 -10.430 35.073  1.00 26.24 ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.279 -8.363  36.143  1.00 25.77 ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.516 -9.111  37.368  1.00 27.46 ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.890 -8.721  37.858  1.00 29.66 ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.445 -9.448  33.392  1.00 27.42 ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.456 -10.615 32.535  1.00 26.22 ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -29.034 -10.973 32.162  1.00 25.86 ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.189 -10.096 31.994  1.00 25.00 ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.262 -10.348 31.269  1.00 25.28 ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.647 -10.292 31.554  1.00 28.47 ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.777 -12.272 32.046  1.00 27.71 ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.540 -12.773 31.454  1.00 27.23 ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -27.910 -13.869 30.461  1.00 27.46 ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.091 -14.181 30.307  1.00 30.56 ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.576 -13.265 32.535  1.00 26.52 ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -26.074 -12.202 33.506  1.00 29.78 ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.425 -12.850 34.723  1.00 31.76 ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -25.129 -11.232 32.814  1.00 25.80 ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -26.922 -14.443 29.776  1.00 27.26 ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.207 -15.326 28.647  1.00 26.27 ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.350 -16.583 28.631  1.00 28.81 ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.207 -16.584 29.107  1.00 30.58 ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.039 -14.592 27.309  1.00 25.56 ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -27.851 -13.318 27.193  1.00 27.68 ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -27.434 -12.146 27.829  1.00 25.49 ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -29.014 -13.283 26.424  1.00 26.29 ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.180 -10.955 27.721  1.00 29.00 ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -29.768 -12.099 26.309  1.00 29.14 ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -29.347 -10.937 26.960  1.00 31.35 ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -26.926 -17.652 28.080  1.00 29.87 ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.212 -18.888 27.820  1.00 31.01 ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -26.470 -19.322 26.385  1.00 32.01 ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -27.558 -19.093 25.856  1.00 33.17 ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -26.669 -19.965 28.787  1.00 31.57 ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -25.479 -19.957 25.755  1.00 32.60 ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -25.691 -20.556 24.443  1.00 31.93 ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -26.816 -21.586 24.554  1.00 32.59 ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -26.958 -22.233 25.585  1.00 32.04 ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -24.416 -21.218 23.912  1.00 32.35 ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -23.323 -20.251 23.576  1.00 31.70 ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -22.138 -20.197 24.277  1.00 34.63 ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -23.233 -19.299 22.617  1.00 33.48 ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -21.365 -19.254 23.766  1.00 32.89 ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -22.007 -18.688 22.762  1.00 30.91 ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -27.622 -21.708 23.501  1.00 32.90 ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -28.719 -22.672 23.461  1.00 34.82 ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -28.706 -23.448 22.131  1.00 37.58 ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -27.983 -23.070 21.206  1.00 37.91 ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -30.051 -21.950 23.662  1.00 34.61 ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -30.460 -20.766 22.351  1.00 34.62 ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -29.498 -24.540 22.027  1.00 40.97 ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -29.545 -25.268 20.747  1.00 43.45 ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -30.083 -24.404 19.607  1.00 46.12 ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -30.800 -23.426 19.856  1.00 44.49 ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -30.506 -26.433 21.030  1.00 43.43 ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -30.521 -26.581 22.525  1.00 42.90 ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -30.322 -25.192 23.066  1.00 40.99 ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -29.713 -24.755 18.375  1.00 50.97 ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -30.218 -24.082 17.172  1.00 56.24 ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -31.739 -24.124 17.111  1.00 57.41 ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -32.373 -23.161 16.682  1.00 57.78 ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -29.620 -24.701 15.897  1.00 59.39 ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -28.517 -23.858 15.212  1.00 65.68 ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -27.114 -24.023 15.825  1.00 69.36 ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -26.374 -23.010 15.903  1.00 67.54 ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -26.747 -25.159 16.211  1.00 69.36 ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -32.304 -25.241 17.572  1.00 59.67 ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -33.747 -25.489 17.578  1.00 61.18 ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -34.524 -24.540 18.491  1.00 62.04 ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -35.744 -24.413 18.366  1.00 63.77 ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -34.022 -26.932 18.011  1.00 61.66 ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -33.789 -27.098 19.401  1.00 59.32 ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -33.818 -23.895 19.414  1.00 60.73 ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -34.447 -23.027 20.400  1.00 60.49 ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -34.628 -21.612 19.841  1.00 59.41 ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -33.655 -20.873 19.647  1.00 57.78 ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -33.619 -23.014 21.682  1.00 60.84 ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -34.410 -22.746 22.944  1.00 63.84 ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -33.599 -23.034 24.198  1.00 67.77 ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -33.237 -24.181 24.477  1.00 68.48 ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -33.311 -21.989 24.961  1.00 69.10 ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -35.888 -21.258 19.584  1.00 59.31 ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -36.261 -19.961 19.013  1.00 57.63 ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -35.867 -18.798 19.920  1.00 55.01 ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -36.304 -18.714 21.075  1.00 55.24 ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -37.767 -19.923 18.706  1.00 58.51 ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -35.028 -17.910 19.393  1.00 51.77 ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -34.549 -16.761 20.157  1.00 47.94 ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -34.283 -15.553 19.256  1.00 46.86 ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -34.100 -15.700 18.047  1.00 46.33 ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -33.282 -17.123 20.998  1.00 47.84 ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -32.792 -15.960 21.680  1.00 42.05 ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -32.174 -17.700 20.119  1.00 47.80 ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -34.280 -14.362 19.850  1.00 43.83 ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -33.847 -13.164 19.139  1.00 42.10 ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -32.462 -12.696 19.599  1.00 40.29 ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -31.948 -11.682 19.109  1.00 39.99 ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -34.881 -12.036 19.264  1.00 41.53 ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -34.886 -11.307 20.599  1.00 42.84 ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -35.788 -10.077 20.549  1.00 42.87 ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -36.084 -9.573  21.951  1.00 42.40 ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -37.339 -8.775  22.033  1.00 40.19 ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -31.857 -13.433 20.531  1.00 38.24 ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -30.539 -13.054 21.053  1.00 35.05 ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -29.445 -13.940 20.503  1.00 33.85 ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -29.547 -15.164 20.534  1.00 32.00 ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -30.517 -13.091 22.574  1.00 32.68 ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -31.649 -12.334 23.211  1.00 32.32 ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -32.741 -13.016 23.756  1.00 30.74 ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -31.640 -10.943 23.263  1.00 29.40 ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -33.786 -12.339 24.342  1.00 31.62 ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -32.690 -10.250 23.851  1.00 33.40 ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -33.752 -10.960 24.390  1.00 32.91 ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -34.792 -10.292 24.974  1.00 40.42 ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -28.392 -13.300 20.007  1.00 33.57 ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -27.257 -13.995 19.403  1.00 31.87 ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -25.946 -13.425 19.932  1.00 31.04 ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -25.833 -12.217 20.153  1.00 29.82 ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -27.309 -13.877 17.878  1.00 31.91 ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -28.485 -14.581 17.256  1.00 37.06 ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -29.680 -13.897 17.016  1.00 39.02 ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -28.407 -15.935 16.923  1.00 37.23 ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -30.782 -14.557 16.452  1.00 39.22 ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -29.500 -16.601 16.357  1.00 39.31 ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -30.688 -15.907 16.113  1.00 42.04 ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -24.954 -14.287 20.141  1.00 29.84 ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -23.645 -13.800 20.549  1.00 31.34 ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -22.999 -13.098 19.345  1.00 31.99 ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -23.599 -13.073 18.261  1.00 32.84 ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -22.805 -14.920 21.203  1.00 30.59 ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -22.119 -15.848 20.202  1.00 33.38 ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -22.196 -15.636 18.973  1.00 31.92 ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -21.468 -16.801 20.677  1.00 33.08 ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -21.818 -12.507 19.510  1.00 29.92 ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -21.251 -11.698 18.412  1.00 30.22 ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -20.892 -12.496 17.155  1.00 30.22 ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -20.776 -11.924 16.069  1.00 29.13 ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -20.081 -10.760 18.863  1.00 29.27 ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -18.881 -11.543 19.407  1.00 30.15 ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -20.598 -9.753  19.866  1.00 29.99 ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -17.672 -10.655 19.825  1.00 30.96 ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -20.753 -13.811 17.317  1.00 30.91 ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -20.418 -14.729 16.232  1.00 32.52 ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -21.666 -15.347 15.582  1.00 35.59 ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -21.554 -16.202 14.700  1.00 37.92 ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -19.502 -15.841 16.773  1.00 32.42 ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -18.339 -15.302 17.579  1.00 34.97 ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -18.326 -15.380 18.974  1.00 32.99 ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -17.259 -14.683 16.942  1.00 33.62 ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -17.257 -14.865 19.712  1.00 33.69 ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -16.196 -14.166 17.661  1.00 32.29 ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -16.195 -14.259 19.045  1.00 34.93 ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -15.124 -13.744 19.743  1.00 30.85 ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -22.849 -14.924 16.027  1.00 35.30 ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -24.111 -15.436 15.499  1.00 35.39 ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -24.582 -16.773 16.058  1.00 36.44 ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -25.453 -17.419 15.479  1.00 37.38 ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -24.011 -17.205 17.176  1.00 36.22 ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -24.496 -18.411 17.860  1.00 36.61 ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -25.684 -18.011 18.755  1.00 35.15 ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -25.619 -16.984 19.442  1.00 33.95 ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -23.380 -19.054 18.687  1.00 37.46 ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -22.065 -19.272 17.927  1.00 42.15 ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -21.690 -20.747 17.784  1.00 48.13 ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -22.417 -21.430 16.629  1.00 52.02 ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -21.929 -22.831 16.429  1.00 54.74 ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -26.774 -18.808 18.738  1.00 33.66 ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -27.998 -18.464 19.482  1.00 32.55 ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -27.826 -18.520 20.999  1.00 32.10 ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -27.049 -19.345 21.517  1.00 31.81 ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -29.007 -19.526 19.023  1.00 32.71 ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -28.160 -20.703 18.640  1.00 35.53 ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -26.877 -20.128 18.081  1.00 34.13 ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -28.554 -17.648 21.693  1.00 29.57 ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -28.473 -17.536 23.148  1.00 30.97 ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -29.847 -17.489 23.778  1.00 31.29 ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -30.769 -16.876 23.239  1.00 28.52 ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -27.741 -16.254 23.559  1.00 28.86 ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -25.970 -16.265 23.285  1.00 35.71 ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -29.981 -18.110 24.939  1.00 31.94 ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -31.186 -17.909 25.724  1.00 34.67 ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -30.924 -16.862 26.807  1.00 33.13 ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -29.852 -16.833 27.409  1.00 32.98 ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -31.775 -19.239 26.290  1.00 35.56 ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -32.842 -18.942 27.199  1.00 42.28 ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -30.718 -20.074 27.005  1.00 36.02 ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -31.895 -15.977 27.007  1.00 35.42 ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -31.830 -14.976 28.062  1.00 36.03 ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.287 -15.575 29.391  1.00 37.17 ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.352 -16.201 29.475  1.00 36.60 ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -32.693 -13.761 27.707  1.00 36.11 ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -32.604 -12.619 28.704  1.00 36.90 ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -33.051 -11.291 28.098  1.00 39.45 ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -34.496 -11.249 27.883  1.00 40.54 ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.379 -10.841 28.789  1.00 39.41 ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -34.973 -10.422 29.982  1.00 36.43 ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -36.672 -10.848 28.495  1.00 41.64 ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -31.470 -15.373 30.419  1.00 37.14 ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -31.806 -15.777 31.775  1.00 38.84 ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.109 -14.563 32.639  1.00 39.50 ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.215 -13.754 32.934  1.00 39.33 ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -30.677 -16.610 32.374  1.00 39.48 ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.670 -18.048 31.853  1.00 46.93 ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -29.802 -18.956 32.705  1.00 50.04 ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -30.508 -20.282 32.978  1.00 55.89 ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -31.707 -20.119 33.852  1.00 56.92 ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.379 -14.440 33.025  1.00 38.83 ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -33.858 -13.336 33.854  1.00 38.23 ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.784 -13.749 35.320  1.00 37.56 ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.375 -14.755 35.722  1.00 39.65 ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.295 -12.955 33.463  1.00 39.24 ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -35.953 -11.635 33.929  1.00 42.38 ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -37.028 -11.846 35.002  1.00 42.82 ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -34.950 -10.546 34.348  1.00 36.83 ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -33.052 -12.971 36.111  1.00 33.31 ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.815 -13.317 37.505  1.00 32.11 ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.725 -12.578 38.479  1.00 33.96 ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -34.103 -11.428 38.238  1.00 34.35 ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.336 -13.125 37.851  1.00 27.80 ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.446 -14.086 37.144  1.00 26.43 ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -29.757 -13.702 36.000  1.00 27.12 ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -30.336 -15.404 37.587  1.00 29.14 ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -28.942 -14.605 35.326  1.00 28.53 ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.531 -16.321 36.909  1.00 29.10 ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -28.828 -15.919 35.784  1.00 29.17 ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -34.081 -13.250 39.570  1.00 32.19 ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -34.905 -12.646 40.610  1.00 34.20 ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -34.212 -11.433 41.249  1.00 32.74 ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -34.872 -10.515 41.724  1.00 32.21 ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -35.287 -13.692 41.665  1.00 34.40 ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -32.879 -11.427 41.238  1.00 33.74 ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -32.089 -10.313 41.784  1.00 31.90 ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -30.646 -10.365 41.315  1.00 31.10 ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -30.210 -11.358 40.729  1.00 34.84 ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -32.154 -10.298 43.322  1.00 31.24 ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -31.918 -11.676 43.932  1.00 33.24 ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -30.870 -12.294 43.733  1.00 32.81 ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -32.894 -12.156 44.685  1.00 33.65 ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.897 -9.305  41.587  1.00 31.60 ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -28.508 -9.221  41.141  1.00 31.04 ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -27.589 -10.248 41.803  1.00 33.62 ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -26.661 -10.736 41.162  1.00 32.78 ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -27.966 -7.799  41.287  1.00 30.20 ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -28.583 -6.835  40.282  1.00 30.10 ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -28.009 -5.144  40.414  1.00 31.32 ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -29.048 -4.525  41.755  1.00 26.49 ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -27.850 -10.593 43.064  1.00 36.57 ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -27.056 -11.630 43.742  1.00 38.42 ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -27.248 -13.023 43.128  1.00 35.76 ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -26.291 -13.779 43.014  1.00 33.28 ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -27.308 -11.649 45.254  1.00 42.18 ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -26.614 -10.494 45.992  1.00 53.26 ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -27.267 -10.222 47.341  1.00 61.85 ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -26.606 -9.140  48.067  1.00 66.28 ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -26.997 -8.674  49.251  1.00 69.95 ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -28.062 -9.182  49.865  1.00 71.05 ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -26.319 -7.689  49.827  1.00 72.76 ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -28.468 -13.346 42.709  1.00 36.73 ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.714 -14.627 42.031  1.00 37.88 ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.933 -14.695 40.727  1.00 36.10 ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.321 -15.723 40.423  1.00 35.69 ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -30.199 -14.850 41.762  1.00 39.98 ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -30.971 -15.228 43.009  1.00 41.84 ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -30.350 -15.450 44.066  1.00 43.45 ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -32.209 -15.294 42.930  1.00 43.19 ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.936 -13.582 39.990  1.00 32.98 ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -27.191 -13.436 38.743  1.00 31.51 ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.687 -13.678 38.921  1.00 32.04 ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -25.079 -14.423 38.137  1.00 32.81 ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.448 -12.061 38.137  1.00 30.90 ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -25.101 -13.055 39.948  1.00 30.32 ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.683 -13.225 40.281  1.00 32.25 ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -23.362 -14.664 40.678  1.00 32.22 ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -22.371 -15.229 40.232  1.00 33.83 ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -23.268 -12.276 41.406  1.00 33.12 ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -23.202 -10.945 40.933  1.00 39.57 ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -24.207 -15.253 41.511  1.00 32.56 ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? -24.025 -16.641 41.910  1.00 35.60 ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? -24.039 -17.572 40.704  1.00 33.52 ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? -23.227 -18.492 40.621  1.00 34.25 ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? -25.068 -17.060 42.958  1.00 34.82 ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? -24.784 -16.489 44.346  1.00 41.61 ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? -23.323 -16.655 44.762  1.00 46.80 ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? -22.565 -15.682 44.825  1.00 50.57 ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? -22.918 -17.893 45.018  1.00 48.97 ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? -24.948 -17.307 39.767  1.00 33.53 ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? -25.041 -18.076 38.530  1.00 34.70 ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? -23.739 -18.007 37.724  1.00 33.08 ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? -23.265 -19.015 37.214  1.00 34.97 ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? -26.241 -17.612 37.690  1.00 34.34 ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? -26.428 -18.394 36.410  1.00 32.73 ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? -26.993 -19.633 36.279  1.00 34.80 ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? -26.049 -17.986 35.090  1.00 30.84 ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? -26.987 -20.021 34.957  1.00 32.45 ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? -26.412 -19.027 34.208  1.00 30.71 ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? -25.428 -16.841 34.565  1.00 30.41 ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? -26.179 -18.958 32.826  1.00 30.67 ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? -25.195 -16.775 33.193  1.00 30.32 ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? -25.576 -17.823 32.341  1.00 29.12 ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? -23.154 -16.821 37.625  1.00 35.52 ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? -21.871 -16.671 36.939  1.00 35.78 ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? -20.808 -17.597 37.554  1.00 37.40 ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? -20.057 -18.248 36.821  1.00 36.63 ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? -21.395 -15.210 36.918  1.00 34.84 ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? -22.225 -14.389 35.927  1.00 33.08 ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? -19.892 -15.106 36.572  1.00 33.97 ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? -22.078 -12.870 36.119  1.00 37.08 ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? -20.772 -17.674 38.887  1.00 37.87 ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? -19.819 -18.562 39.582  1.00 41.35 ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? -20.027 -20.036 39.245  1.00 40.41 ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? -19.071 -20.753 38.937  1.00 41.97 ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? -19.861 -18.372 41.100  1.00 42.70 ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? -19.210 -17.093 41.582  1.00 49.16 ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? -19.224 -17.011 43.102  1.00 55.58 ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? -19.582 -15.605 43.586  1.00 59.23 ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? -18.730 -14.530 43.002  1.00 60.92 ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? -21.277 -20.483 39.298  1.00 40.40 ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? -21.594 -21.873 38.990  1.00 39.49 ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? -21.289 -22.239 37.535  1.00 37.43 ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? -20.882 -23.365 37.253  1.00 36.90 ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? -23.033 -22.209 39.392  1.00 40.83 ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? -23.203 -22.303 40.919  1.00 45.13 ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? -24.542 -22.890 41.325  1.00 52.80 ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? -25.665 -22.063 40.883  1.00 60.07 ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? -26.343 -21.214 41.656  1.00 61.82 ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? -26.031 -21.063 42.941  1.00 61.97 ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? -27.343 -20.514 41.133  1.00 62.34 ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? -21.456 -21.281 36.624  1.00 36.41 ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? -21.112 -21.496 35.224  1.00 36.73 ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? -19.606 -21.716 35.071  1.00 39.24 ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? -19.168 -22.521 34.240  1.00 38.12 ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? -21.592 -20.333 34.345  1.00 36.01 ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? -23.108 -20.273 34.168  1.00 34.01 ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? -23.814 -21.704 33.289  1.00 37.83 ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? -23.327 -21.334 31.611  1.00 36.13 ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? -18.819 -21.005 35.878  1.00 40.75 ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? -17.382 -21.257 35.958  1.00 43.09 ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? -17.088 -22.652 36.533  1.00 42.24 ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? -16.258 -23.386 35.999  1.00 40.23 ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? -16.672 -20.182 36.784  1.00 45.12 ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? -15.149 -20.299 36.725  1.00 51.85 ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? -14.424 -19.455 37.758  1.00 57.14 ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? -13.243 -19.770 38.044  1.00 59.80 ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? -15.023 -18.488 38.282  1.00 57.09 ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? -17.781 -23.014 37.611  1.00 41.82 ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? -17.625 -24.333 38.223  1.00 41.93 ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? -17.965 -25.460 37.249  1.00 42.38 ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? -17.330 -26.513 37.282  1.00 43.62 ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? -18.497 -24.461 39.478  1.00 44.32 ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? -18.055 -23.532 40.602  1.00 43.70 ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? -16.911 -23.039 40.561  1.00 43.94 ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? -18.853 -23.302 41.532  1.00 44.38 ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? -18.964 -25.237 36.394  1.00 39.08 ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? -19.367 -26.221 35.386  1.00 37.24 ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? -18.408 -26.239 34.182  1.00 38.22 ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? -18.168 -27.296 33.591  1.00 39.38 ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? -20.846 -26.025 34.929  1.00 35.83 ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? -21.797 -26.150 36.134  1.00 36.47 ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? -21.222 -27.050 33.854  1.00 34.36 ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? -23.288 -25.949 35.833  1.00 31.42 ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? -17.850 -25.076 33.840  1.00 37.72 ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? -16.963 -24.933 32.676  1.00 37.46 ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? -17.676 -24.397 31.440  1.00 37.13 ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? -17.401 -24.821 30.319  1.00 37.64 ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? -18.591 -23.453 31.646  1.00 36.95 ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? -19.412 -22.929 30.558  1.00 35.05 ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? -19.475 -21.408 30.575  1.00 35.90 ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? -19.577 -20.798 31.638  1.00 37.04 ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? -20.827 -23.496 30.643  1.00 34.10 ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? -21.075 -24.932 30.188  1.00 34.32 ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? -22.479 -25.349 30.607  1.00 32.50 ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? -20.903 -25.059 28.681  1.00 27.31 ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? -19.441 -20.812 29.385  1.00 34.43 ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? -19.444 -19.368 29.239  1.00 34.35 ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? -20.753 -18.756 29.736  1.00 31.79 ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? -21.841 -19.253 29.438  1.00 31.03 ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? -19.181 -18.977 27.781  1.00 35.51 ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? -18.869 -17.495 27.582  1.00 35.80 ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? -18.730 -17.120 26.121  1.00 37.54 ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? -18.667 -18.033 25.278  1.00 36.73 ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? -18.688 -15.913 25.812  1.00 36.92 ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? -20.617 -17.685 30.513  1.00 30.99 ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? -21.737 -16.940 31.054  1.00 27.83 ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? -21.694 -15.546 30.435  1.00 29.13 ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? -20.885 -14.700 30.828  1.00 26.58 ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? -21.640 -16.871 32.572  1.00 30.28 ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? -22.565 -15.333 29.452  1.00 28.57 ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? -22.516 -14.156 28.588  1.00 29.02 ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? -23.395 -13.021 29.106  1.00 29.15 ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? -24.374 -13.265 29.809  1.00 29.44 ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? -22.951 -14.538 27.168  1.00 27.50 ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? -22.063 -15.475 26.341  1.00 26.62 ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? -22.447 -16.946 26.533  1.00 27.17 ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? -22.177 -15.111 24.874  1.00 24.98 ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? -23.037 -11.786 28.746  1.00 28.74 ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? -23.833 -10.610 29.091  1.00 26.17 ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? -23.091 -9.634  29.976  1.00 26.62 ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? -21.996 -9.920  30.452  1.00 23.59 ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? -23.691 -8.471  30.202  1.00 27.01 ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? -23.044 -7.425  30.985  1.00 24.68 ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? -23.106 -7.800  32.455  1.00 26.16 ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? -24.169 -7.754  33.075  1.00 29.63 ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? -23.692 -6.058  30.699  1.00 25.26 ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? -23.184 -4.885  31.540  1.00 23.21 ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? -21.390 -4.717  31.593  1.00 25.31 ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? -21.036 -4.143  29.920  1.00 24.50 ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? -21.950 -8.181  32.993  1.00 27.63 ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? -21.810 -8.645  34.369  1.00 28.84 ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? -21.758 -7.496  35.383  1.00 29.19 ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? -21.935 -7.716  36.579  1.00 28.23 ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? -20.574 -9.552  34.505  1.00 31.07 ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? -19.277 -8.869  34.037  1.00 35.47 ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? -18.322 -8.812  34.832  1.00 39.01 ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? -19.210 -8.378  32.887  1.00 39.91 ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? -21.511 -6.279  34.897  1.00 28.34 ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? -21.603 -5.081  35.721  1.00 26.71 ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? -23.036 -4.553  35.616  1.00 27.95 ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? -23.414 -3.893  34.641  1.00 27.52 ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? -20.578 -4.047  35.258  1.00 28.17 ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? -20.511 -2.814  36.173  1.00 33.29 ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? -21.431 -2.585  36.993  1.00 29.89 ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? -19.518 -2.063  36.049  1.00 32.00 ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? -23.837 -4.856  36.628  1.00 26.91 ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? -25.279 -4.690  36.523  1.00 27.34 ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? -25.738 -3.237  36.415  1.00 28.31 ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? -26.730 -2.942  35.739  1.00 31.54 ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? -25.972 -5.429  37.661  1.00 27.78 ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? -25.631 -6.900  37.716  1.00 28.11 ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? -25.715 -7.689  36.574  1.00 29.57 ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? -25.223 -7.492  38.909  1.00 28.78 ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? -25.401 -9.059  36.612  1.00 27.44 ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? -24.905 -8.862  38.961  1.00 29.84 ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? -24.991 -9.640  37.804  1.00 28.10 ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? -25.003 -2.327  37.037  1.00 25.69 ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? -25.345 -0.910  36.942  1.00 28.67 ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? -25.185 -0.359  35.528  1.00 26.19 ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? -25.881 0.577   35.162  1.00 24.41 ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? -24.628 -0.054  38.002  1.00 27.78 ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? -23.116 -0.064  38.008  1.00 30.76 ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? -22.641 0.255   39.443  1.00 33.25 ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? -21.131 0.220   39.606  1.00 38.47 ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? -20.480 -0.996  39.046  1.00 36.75 ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? -24.312 -0.979  34.728  1.00 26.97 ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? -24.145 -0.589  33.325  1.00 25.84 ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? -25.312 -1.080  32.477  1.00 25.93 ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? -25.746 -0.382  31.561  1.00 23.75 ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? -22.820 -1.103  32.741  1.00 26.45 ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? -21.487 -0.490  33.183  1.00 25.70 ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? -20.388 -1.082  32.336  1.00 23.35 ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? -21.480 1.021   33.065  1.00 28.82 ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? -25.794 -2.291  32.763  1.00 25.48 ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? -27.011 -2.796  32.121  1.00 27.90 ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? -28.236 -1.948  32.521  1.00 26.68 ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? -29.102 -1.664  31.688  1.00 28.19 ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? -27.235 -4.299  32.442  1.00 22.59 ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? -28.286 -1.537  33.789  1.00 27.93 ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? -29.359 -0.663  34.296  1.00 29.53 ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? -29.431 0.661   33.536  1.00 29.34 ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? -30.509 1.098   33.132  1.00 27.61 ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? -29.180 -0.372  35.794  1.00 30.93 ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? -30.159 0.667   36.318  1.00 33.29 ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? -29.797 2.017   36.413  1.00 30.71 ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? -31.450 0.305   36.696  1.00 31.67 ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? -30.694 2.965   36.873  1.00 32.85 ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? -32.358 1.253   37.158  1.00 33.81 ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? -31.974 2.574   37.248  1.00 32.71 ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? -32.871 3.506   37.708  1.00 33.94 ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? -28.279 1.305   33.359  1.00 29.46 ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? -28.231 2.560   32.616  1.00 29.73 ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? -28.693 2.351   31.178  1.00 29.41 ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? -29.402 3.188   30.620  1.00 29.06 ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? -26.825 3.167   32.650  1.00 26.11 ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? -26.379 3.779   33.977  1.00 27.26 ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? -24.951 4.325   33.865  1.00 25.65 ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? -27.341 4.880   34.443  1.00 23.11 ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? -28.307 1.216   30.601  1.00 26.64 ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? -28.654 0.896   29.225  1.00 28.68 ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? -30.168 0.758   29.027  1.00 30.42 ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? -30.725 1.281   28.054  1.00 28.64 ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? -27.960 -0.394  28.802  1.00 29.81 ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? -27.754 -0.402  27.409  1.00 27.90 ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? -30.813 0.044   29.953  1.00 30.65 ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? -32.261 -0.143  29.958  1.00 31.39 ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? -33.017 1.140   30.251  1.00 31.53 ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? -34.059 1.410   29.651  1.00 33.89 ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? -32.643 -1.204  30.999  1.00 31.05 ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? -32.367 -2.615  30.513  1.00 31.25 ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? -32.072 -3.492  31.347  1.00 29.43 ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? -32.437 -2.842  29.289  1.00 31.86 ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? -32.484 1.925   31.181  1.00 32.59 ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? -33.175 3.101   31.694  1.00 30.24 ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? -32.987 4.322   30.796  1.00 29.60 ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? -33.867 5.192   30.724  1.00 29.39 ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? -32.726 3.388   33.138  1.00 31.58 ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? -32.847 2.182   33.910  1.00 30.33 ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? -33.569 4.497   33.789  1.00 29.49 ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? -31.842 4.382   30.120  1.00 28.44 ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? -31.516 5.487   29.204  1.00 29.53 ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? -31.154 4.919   27.848  1.00 31.99 ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? -29.988 4.950   27.428  1.00 32.56 ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? -30.384 6.376   29.762  1.00 24.60 ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? -30.747 6.955   31.100  1.00 25.85 ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? -30.376 6.314   32.272  1.00 27.21 ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? -31.513 8.116   31.193  1.00 29.55 ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? -30.738 6.812   33.500  1.00 27.43 ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? -31.873 8.636   32.425  1.00 26.57 ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? -31.490 7.974   33.571  1.00 27.66 ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? -31.849 8.461   34.800  1.00 26.13 ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? -32.172 4.385   27.178  1.00 34.45 ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? -32.016 3.736   25.879  1.00 37.75 ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? -32.111 4.757   24.741  1.00 38.77 ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? -32.907 4.617   23.824  1.00 41.71 ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? -33.061 2.615   25.716  1.00 36.90 ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? -32.773 1.706   24.523  1.00 40.51 ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? -31.704 1.774   23.913  1.00 36.29 ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? -33.736 0.851   24.188  1.00 39.63 ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? -31.284 5.790   24.820  1.00 40.28 ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? -31.233 6.842   23.810  1.00 41.12 ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? -29.934 7.610   24.002  1.00 40.40 ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? -29.248 7.426   25.012  1.00 37.55 ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? -32.436 7.783   23.950  1.00 42.12 ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? -32.692 8.273   25.371  1.00 46.51 ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? -33.533 7.561   26.235  1.00 47.10 ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? -32.099 9.452   25.848  1.00 46.53 ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? -33.770 8.006   27.538  1.00 47.75 ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? -32.333 9.907   27.150  1.00 43.35 ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? -33.169 9.181   27.982  1.00 48.24 ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? -33.413 9.622   29.260  1.00 50.08 ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? -29.583 8.458   23.043  1.00 38.66 ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? -28.413 9.311   23.217  1.00 41.64 ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? -28.708 10.354  24.296  1.00 39.19 ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? -29.625 11.162  24.152  1.00 41.76 ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? -28.016 9.991   21.903  1.00 43.44 ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? -26.595 10.540  21.934  1.00 51.49 ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? -26.216 11.332  20.690  1.00 58.36 ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? -25.005 11.606  20.526  1.00 59.51 ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? -27.114 11.685  19.887  1.00 59.38 ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? -27.942 10.325  25.381  1.00 37.15 ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? -28.188 11.235  26.500  1.00 37.00 ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? -27.809 12.669  26.158  1.00 37.76 ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? -26.690 12.939  25.717  1.00 39.43 ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? -27.447 10.779  27.776  1.00 35.13 ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? -28.070 9.480   28.288  1.00 36.23 ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? -27.464 11.875  28.853  1.00 29.96 ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? -27.216 8.738   29.269  1.00 32.12 ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? -28.760 13.577  26.348  1.00 39.53 ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? -28.502 15.002  26.260  1.00 42.21 ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? -28.604 15.571  27.670  1.00 41.75 ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? -29.692 15.639  28.241  1.00 44.79 ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? -29.506 15.681  25.322  1.00 45.54 ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? -29.132 17.114  24.928  1.00 50.83 ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? -28.085 17.153  23.802  1.00 57.82 ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? -27.482 18.561  23.661  1.00 62.27 ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? -26.410 18.647  22.620  1.00 62.19 ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? -27.466 15.955  28.241  1.00 38.69 ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? -27.431 16.394  29.630  1.00 36.48 ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? -27.379 17.921  29.732  1.00 36.37 ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? -26.975 18.605  28.785  1.00 37.65 ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? -26.259 15.727  30.373  1.00 34.22 ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? -24.895 16.274  30.010  1.00 32.62 ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? -24.156 15.739  28.944  1.00 34.14 ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? -24.338 17.317  30.735  1.00 28.34 ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? -22.896 16.235  28.619  1.00 30.95 ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? -23.095 17.829  30.411  1.00 31.44 ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? -22.380 17.290  29.357  1.00 30.61 ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? -21.149 17.819  29.066  1.00 27.77 ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? -27.809 18.450  30.871  1.00 34.07 ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? -27.753 19.881  31.116  1.00 33.98 ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? -26.846 20.118  32.315  1.00 32.84 ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? -27.221 19.817  33.442  1.00 33.25 ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? -29.164 20.435  31.365  1.00 34.15 ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? -29.177 21.925  31.699  1.00 35.53 ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? -28.106 22.567  31.781  1.00 33.74 ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? -30.288 22.463  31.886  1.00 40.59 ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? -25.659 20.664  32.065  1.00 32.72 ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? -24.653 20.822  33.117  1.00 34.30 ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? -25.091 21.784  34.225  1.00 32.98 ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? -24.655 21.637  35.371  1.00 32.42 ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? -23.284 21.219  32.543  1.00 32.83 ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? -23.174 22.666  32.187  1.00 36.65 ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? -22.577 23.594  33.016  1.00 36.54 ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? -23.591 23.351  31.094  1.00 39.34 ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? -22.630 24.787  32.448  1.00 39.82 ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? -23.237 24.667  31.279  1.00 37.67 ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? -25.962 22.741  33.896  1.00 30.12 ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? -26.461 23.700  34.900  1.00 29.26 ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? -27.263 23.023  36.012  1.00 29.78 ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? -27.438 23.604  37.077  1.00 29.21 ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? -27.325 24.835  34.285  1.00 31.44 ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? -28.572 24.300  33.814  1.00 29.04 ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? -26.580 25.551  33.132  1.00 30.32 ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? -27.732 21.797  35.763  1.00 27.96 ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? -28.488 21.015  36.763  1.00 28.50 ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? -27.596 20.068  37.563  1.00 28.17 ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? -28.044 19.454  38.540  1.00 28.07 ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? -29.572 20.151  36.100  1.00 28.31 ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? -30.533 20.859  35.158  1.00 32.67 ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? -31.306 21.934  35.857  1.00 33.22 ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? -32.391 22.473  34.941  1.00 41.65 ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? -32.794 23.824  35.402  1.00 41.85 ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? -26.360 19.895  37.117  1.00 24.34 ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? -25.443 18.981  37.800  1.00 25.17 ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? -24.683 19.758  38.884  1.00 23.89 ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? -24.031 20.764  38.584  1.00 22.35 ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? -24.456 18.315  36.814  1.00 20.96 ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? -25.213 17.522  35.742  1.00 21.58 ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? -23.461 17.422  37.571  1.00 23.59 ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? -24.328 16.972  34.624  1.00 19.81 ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? -24.786 19.301  40.131  1.00 24.58 ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? -24.093 19.959  41.240  1.00 23.40 ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? -22.630 19.579  41.285  1.00 21.66 ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? -22.276 18.464  41.691  1.00 22.56 ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? -24.769 19.658  42.584  1.00 25.74 ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? -24.294 20.559  43.728  1.00 25.21 ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? -25.082 20.341  45.027  1.00 22.76 ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? -26.522 20.545  44.865  1.00 26.40 ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? -27.141 21.722  44.952  1.00 27.11 ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? -26.458 22.833  45.214  1.00 29.24 ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? -28.455 21.789  44.792  1.00 29.94 ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? -21.775 20.511  40.872  1.00 22.70 ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? -20.344 20.280  40.876  1.00 23.39 ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? -19.742 20.999  42.074  1.00 26.85 ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? -19.835 22.230  42.186  1.00 29.64 ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? -19.672 20.716  39.546  1.00 26.75 ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? -18.175 20.366  39.553  1.00 23.41 ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? -20.357 20.037  38.350  1.00 24.66 ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? -19.158 20.217  42.982  1.00 23.36 ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? -18.571 20.744  44.206  1.00 24.26 ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? -17.054 20.709  44.146  1.00 22.73 ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? -16.457 19.675  43.845  1.00 20.22 ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? -19.052 19.968  45.407  1.00 24.69 ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? -16.454 21.851  44.455  1.00 22.26 ? 112  ASN A N     1 
ATOM   931  C  CA    . ASN A 1 112 ? -15.009 22.027  44.456  1.00 25.65 ? 112  ASN A CA    1 
ATOM   932  C  C     . ASN A 1 112 ? -14.648 22.393  45.894  1.00 25.12 ? 112  ASN A C     1 
ATOM   933  O  O     . ASN A 1 112 ? -15.141 23.399  46.404  1.00 26.27 ? 112  ASN A O     1 
ATOM   934  C  CB    . ASN A 1 112 ? -14.678 23.183  43.494  1.00 27.56 ? 112  ASN A CB    1 
ATOM   935  C  CG    . ASN A 1 112 ? -13.230 23.194  43.031  1.00 37.15 ? 112  ASN A CG    1 
ATOM   936  O  OD1   . ASN A 1 112 ? -12.301 23.421  43.821  1.00 38.33 ? 112  ASN A OD1   1 
ATOM   937  N  ND2   . ASN A 1 112 ? -13.031 22.996  41.721  1.00 37.80 ? 112  ASN A ND2   1 
ATOM   938  N  N     . PHE A 1 113 ? -13.837 21.583  46.572  1.00 24.41 ? 113  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 113 ? -13.482 21.923  47.960  1.00 25.48 ? 113  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 113 ? -12.018 21.761  48.318  1.00 24.39 ? 113  PHE A C     1 
ATOM   941  O  O     . PHE A 1 113 ? -11.258 21.098  47.603  1.00 23.19 ? 113  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 113 ? -14.417 21.254  49.003  1.00 24.53 ? 113  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 113 ? -14.023 19.851  49.415  1.00 23.95 ? 113  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 113 ? -14.039 18.802  48.511  1.00 30.33 ? 113  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 113 ? -13.694 19.576  50.733  1.00 27.50 ? 113  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 113 ? -13.701 17.496  48.917  1.00 30.05 ? 113  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 113 ? -13.357 18.287  51.150  1.00 21.97 ? 113  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 113 ? -13.371 17.245  50.249  1.00 25.82 ? 113  PHE A CZ    1 
ATOM   949  N  N     . ASP A 1 114 ? -11.637 22.397  49.422  1.00 25.24 ? 114  ASP A N     1 
ATOM   950  C  CA    . ASP A 1 114 ? -10.283 22.293  49.951  1.00 27.39 ? 114  ASP A CA    1 
ATOM   951  C  C     . ASP A 1 114 ? -10.324 22.484  51.466  1.00 26.68 ? 114  ASP A C     1 
ATOM   952  O  O     . ASP A 1 114 ? -11.062 23.330  51.955  1.00 26.88 ? 114  ASP A O     1 
ATOM   953  C  CB    . ASP A 1 114 ? -9.390  23.349  49.294  1.00 27.64 ? 114  ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 114 ? -7.944  23.226  49.697  1.00 35.01 ? 114  ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 114 ? -7.364  22.136  49.509  1.00 31.31 ? 114  ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 114 ? -7.390  24.227  50.213  1.00 44.40 ? 114  ASP A OD2   1 
ATOM   957  N  N     . ILE A 1 115 ? -9.543  21.699  52.208  1.00 25.59 ? 115  ILE A N     1 
ATOM   958  C  CA    . ILE A 1 115 ? -9.497  21.855  53.669  1.00 26.05 ? 115  ILE A CA    1 
ATOM   959  C  C     . ILE A 1 115 ? -8.124  22.301  54.176  1.00 26.64 ? 115  ILE A C     1 
ATOM   960  O  O     . ILE A 1 115 ? -7.122  22.158  53.474  1.00 26.21 ? 115  ILE A O     1 
ATOM   961  C  CB    . ILE A 1 115 ? -9.962  20.581  54.423  1.00 25.76 ? 115  ILE A CB    1 
ATOM   962  C  CG1   . ILE A 1 115 ? -8.918  19.458  54.339  1.00 24.89 ? 115  ILE A CG1   1 
ATOM   963  C  CG2   . ILE A 1 115 ? -11.334 20.136  53.927  1.00 25.02 ? 115  ILE A CG2   1 
ATOM   964  C  CD1   . ILE A 1 115 ? -9.182  18.276  55.297  1.00 23.60 ? 115  ILE A CD1   1 
ATOM   965  N  N     . GLU A 1 116 ? -8.100  22.883  55.376  1.00 25.34 ? 116  GLU A N     1 
ATOM   966  C  CA    . GLU A 1 116 ? -6.851  23.184  56.073  1.00 26.65 ? 116  GLU A CA    1 
ATOM   967  C  C     . GLU A 1 116 ? -6.805  22.448  57.408  1.00 26.05 ? 116  GLU A C     1 
ATOM   968  O  O     . GLU A 1 116 ? -7.828  22.311  58.070  1.00 26.56 ? 116  GLU A O     1 
ATOM   969  C  CB    . GLU A 1 116 ? -6.686  24.691  56.295  1.00 25.92 ? 116  GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 116 ? -6.679  25.548  55.010  1.00 32.68 ? 116  GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 116 ? -5.550  25.214  54.029  1.00 37.13 ? 116  GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 116 ? -4.505  24.660  54.442  1.00 40.98 ? 116  GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 116 ? -5.704  25.532  52.829  1.00 41.92 ? 116  GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 117 ? -5.617  21.970  57.776  1.00 25.36 ? 117  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 117 ? -5.387  21.216  59.001  1.00 27.46 ? 117  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 117 ? -4.024  21.644  59.551  1.00 28.89 ? 117  VAL A C     1 
ATOM   977  O  O     . VAL A 1 117 ? -2.995  21.380  58.931  1.00 30.11 ? 117  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 117 ? -5.343  19.681  58.733  1.00 28.96 ? 117  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 117 ? -4.986  18.915  60.006  1.00 27.13 ? 117  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 117 ? -6.655  19.162  58.143  1.00 26.46 ? 117  VAL A CG2   1 
ATOM   981  N  N     . THR A 1 118 ? -4.013  22.310  60.699  1.00 30.35 ? 118  THR A N     1 
ATOM   982  C  CA    . THR A 1 118 ? -2.763  22.679  61.365  1.00 31.53 ? 118  THR A CA    1 
ATOM   983  C  C     . THR A 1 118 ? -2.149  21.441  62.018  1.00 34.54 ? 118  THR A C     1 
ATOM   984  O  O     . THR A 1 118 ? -2.851  20.651  62.658  1.00 34.81 ? 118  THR A O     1 
ATOM   985  C  CB    . THR A 1 118 ? -2.987  23.817  62.390  1.00 31.70 ? 118  THR A CB    1 
ATOM   986  O  OG1   . THR A 1 118 ? -3.509  24.964  61.705  1.00 28.60 ? 118  THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 118 ? -1.688  24.208  63.093  1.00 33.31 ? 118  THR A CG2   1 
ATOM   988  N  N     . SER A 1 119 ? -0.843  21.264  61.813  1.00 40.41 ? 119  SER A N     1 
ATOM   989  C  CA    . SER A 1 119 ? -0.109  20.105  62.336  1.00 45.03 ? 119  SER A CA    1 
ATOM   990  C  C     . SER A 1 119 ? 1.338   20.450  62.707  1.00 46.93 ? 119  SER A C     1 
ATOM   991  O  O     . SER A 1 119 ? 2.157   20.704  61.822  1.00 46.56 ? 119  SER A O     1 
ATOM   992  C  CB    . SER A 1 119 ? -0.129  18.950  61.331  1.00 43.99 ? 119  SER A CB    1 
ATOM   993  O  OG    . SER A 1 119 ? 0.734   17.906  61.752  1.00 47.63 ? 119  SER A OG    1 
ATOM   994  N  N     . PRO A 1 120 ? 1.652   20.452  64.019  1.00 49.98 ? 120  PRO A N     1 
ATOM   995  C  CA    . PRO A 1 120 ? 3.013   20.690  64.515  1.00 52.22 ? 120  PRO A CA    1 
ATOM   996  C  C     . PRO A 1 120 ? 3.965   19.490  64.388  1.00 53.30 ? 120  PRO A C     1 
ATOM   997  O  O     . PRO A 1 120 ? 5.180   19.671  64.510  1.00 55.13 ? 120  PRO A O     1 
ATOM   998  C  CB    . PRO A 1 120 ? 2.790   21.007  65.996  1.00 52.54 ? 120  PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 120 ? 1.567   20.237  66.353  1.00 52.18 ? 120  PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 120 ? 0.689   20.301  65.129  1.00 50.63 ? 120  PRO A CD    1 
ATOM   1001 N  N     . ASP A 1 121 ? 3.435   18.290  64.143  1.00 51.12 ? 121  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 121 ? 4.284   17.089  64.087  1.00 51.14 ? 121  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 121 ? 4.308   16.390  62.724  1.00 50.75 ? 121  ASP A C     1 
ATOM   1004 O  O     . ASP A 1 121 ? 4.170   15.167  62.639  1.00 51.50 ? 121  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 121 ? 3.907   16.100  65.196  1.00 51.91 ? 121  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 121 ? 2.412   15.841  65.270  1.00 51.15 ? 121  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 121 ? 1.916   15.559  66.384  1.00 51.72 ? 121  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 121 ? 1.730   15.925  64.222  1.00 49.65 ? 121  ASP A OD2   1 
ATOM   1009 N  N     . GLY A 1 122 ? 4.497   17.171  61.666  1.00 49.77 ? 122  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 122 ? 4.642   16.625  60.320  1.00 48.96 ? 122  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 122 ? 3.358   16.580  59.519  1.00 47.42 ? 122  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 122 ? 2.329   17.123  59.937  1.00 45.92 ? 122  GLY A O     1 
ATOM   1013 N  N     . PHE A 1 123 ? 3.430   15.934  58.356  1.00 46.17 ? 123  PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 123 ? 2.280   15.780  57.470  1.00 44.69 ? 123  PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 123 ? 1.132   15.093  58.215  1.00 41.26 ? 123  PHE A C     1 
ATOM   1016 O  O     . PHE A 1 123 ? 1.324   14.032  58.810  1.00 41.60 ? 123  PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 123 ? 2.669   14.993  56.210  1.00 45.80 ? 123  PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 123 ? 1.513   14.702  55.279  1.00 48.53 ? 123  PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 123 ? 1.050   15.674  54.392  1.00 50.14 ? 123  PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 123 ? 0.906   13.443  55.273  1.00 49.79 ? 123  PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 123 ? -0.012  15.402  53.524  1.00 51.48 ? 123  PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 123 ? -0.153  13.162  54.413  1.00 50.52 ? 123  PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 123 ? -0.615  14.144  53.535  1.00 50.64 ? 123  PHE A CZ    1 
ATOM   1024 N  N     . PRO A 1 124 ? -0.059  15.712  58.192  1.00 36.82 ? 124  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 124 ? -1.232  15.142  58.837  1.00 35.13 ? 124  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 124 ? -1.794  13.993  58.009  1.00 35.86 ? 124  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 124 ? -2.403  14.218  56.966  1.00 36.85 ? 124  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 124 ? -2.210  16.313  58.894  1.00 34.08 ? 124  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 124 ? -1.816  17.212  57.781  1.00 33.37 ? 124  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 124 ? -0.342  17.006  57.543  1.00 36.28 ? 124  PRO A CD    1 
ATOM   1031 N  N     . GLU A 1 125 ? -1.571  12.770  58.477  1.00 36.48 ? 125  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 125 ? -2.012  11.563  57.784  1.00 35.77 ? 125  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 125 ? -3.529  11.431  57.765  1.00 33.83 ? 125  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 125 ? -4.163  11.375  58.816  1.00 35.20 ? 125  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 125 ? -1.378  10.328  58.426  1.00 37.82 ? 125  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 125 ? 0.121   10.201  58.165  1.00 44.38 ? 125  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 125 ? 0.452   9.896   56.707  1.00 49.62 ? 125  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 125 ? -0.472  9.565   55.930  1.00 47.66 ? 125  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 125 ? 1.644   9.990   56.336  1.00 55.10 ? 125  GLU A OE2   1 
ATOM   1040 N  N     . PRO A 1 126 ? -4.120  11.389  56.562  1.00 34.68 ? 126  PRO A N     1 
ATOM   1041 C  CA    . PRO A 1 126 ? -5.580  11.261  56.430  1.00 34.70 ? 126  PRO A CA    1 
ATOM   1042 C  C     . PRO A 1 126 ? -6.168  9.996   57.073  1.00 35.74 ? 126  PRO A C     1 
ATOM   1043 O  O     . PRO A 1 126 ? -7.335  10.013  57.483  1.00 37.15 ? 126  PRO A O     1 
ATOM   1044 C  CB    . PRO A 1 126 ? -5.805  11.261  54.912  1.00 33.75 ? 126  PRO A CB    1 
ATOM   1045 C  CG    . PRO A 1 126 ? -4.448  11.018  54.300  1.00 32.10 ? 126  PRO A CG    1 
ATOM   1046 C  CD    . PRO A 1 126 ? -3.462  11.580  55.257  1.00 33.66 ? 126  PRO A CD    1 
ATOM   1047 N  N     . SER A 1 127 ? -5.382  8.925   57.186  1.00 34.72 ? 127  SER A N     1 
ATOM   1048 C  CA    . SER A 1 127 ? -5.897  7.678   57.773  1.00 37.28 ? 127  SER A CA    1 
ATOM   1049 C  C     . SER A 1 127 ? -5.945  7.730   59.299  1.00 39.84 ? 127  SER A C     1 
ATOM   1050 O  O     . SER A 1 127 ? -6.627  6.919   59.938  1.00 42.21 ? 127  SER A O     1 
ATOM   1051 C  CB    . SER A 1 127 ? -5.090  6.464   57.313  1.00 38.26 ? 127  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 127 ? -3.762  6.534   57.795  1.00 38.80 ? 127  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 128 ? -5.207  8.673   59.878  1.00 39.92 ? 128  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 128 ? -5.204  8.879   61.320  1.00 39.65 ? 128  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 128 ? -6.157  9.999   61.705  1.00 37.06 ? 128  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 128 ? -6.920  9.868   62.660  1.00 35.37 ? 128  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 128 ? -3.792  9.201   61.816  1.00 43.05 ? 128  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 128 ? -2.791  8.066   61.621  1.00 47.37 ? 128  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 128 ? -3.117  6.849   62.465  1.00 53.26 ? 128  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 128 ? -3.397  5.768   61.936  1.00 56.05 ? 128  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 128 ? -3.090  7.018   63.785  1.00 55.88 ? 128  GLN A NE2   1 
ATOM   1062 N  N     . ALA A 1 129 ? -6.092  11.097  60.951  1.00 35.35 ? 129  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 129 ? -6.891  12.303  61.190  1.00 33.21 ? 129  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 129 ? -6.870  12.741  62.653  1.00 33.22 ? 129  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 129 ? -7.918  12.924  63.280  1.00 33.54 ? 129  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 129 ? -8.318  12.113  60.681  1.00 30.88 ? 129  ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 130 ? -5.666  12.916  63.189  1.00 34.29 ? 130  LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 130 ? -5.511  13.202  64.613  1.00 36.17 ? 130  LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 130 ? -5.532  14.688  64.950  1.00 34.84 ? 130  LYS A C     1 
ATOM   1070 O  O     . LYS A 1 130 ? -5.545  15.057  66.117  1.00 35.20 ? 130  LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 130 ? -4.260  12.512  65.185  1.00 38.99 ? 130  LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 130 ? -2.914  12.994  64.642  1.00 43.76 ? 130  LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 130 ? -1.761  12.187  65.254  1.00 47.82 ? 130  LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 130 ? -0.417  12.875  65.041  1.00 50.88 ? 130  LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 130 ? 0.732   12.006  65.420  1.00 52.26 ? 130  LYS A NZ    1 
ATOM   1076 N  N     . HIS A 1 131 ? -5.551  15.534  63.926  1.00 32.77 ? 131  HIS A N     1 
ATOM   1077 C  CA    . HIS A 1 131 ? -5.541  16.976  64.124  1.00 31.44 ? 131  HIS A CA    1 
ATOM   1078 C  C     . HIS A 1 131 ? -6.848  17.617  63.666  1.00 30.95 ? 131  HIS A C     1 
ATOM   1079 O  O     . HIS A 1 131 ? -7.500  17.113  62.750  1.00 31.11 ? 131  HIS A O     1 
ATOM   1080 C  CB    . HIS A 1 131 ? -4.358  17.598  63.389  1.00 32.06 ? 131  HIS A CB    1 
ATOM   1081 C  CG    . HIS A 1 131 ? -3.030  17.080  63.845  1.00 34.25 ? 131  HIS A CG    1 
ATOM   1082 N  ND1   . HIS A 1 131 ? -2.280  16.196  63.100  1.00 36.85 ? 131  HIS A ND1   1 
ATOM   1083 C  CD2   . HIS A 1 131 ? -2.326  17.308  64.979  1.00 33.21 ? 131  HIS A CD2   1 
ATOM   1084 C  CE1   . HIS A 1 131 ? -1.163  15.916  63.747  1.00 35.79 ? 131  HIS A CE1   1 
ATOM   1085 N  NE2   . HIS A 1 131 ? -1.169  16.573  64.894  1.00 33.72 ? 131  HIS A NE2   1 
ATOM   1086 N  N     . PRO A 1 132 ? -7.247  18.724  64.318  1.00 29.78 ? 132  PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 132 ? -8.478  19.406  63.938  1.00 28.92 ? 132  PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 132 ? -8.485  19.929  62.499  1.00 28.66 ? 132  PRO A C     1 
ATOM   1089 O  O     . PRO A 1 132 ? -7.459  20.393  61.995  1.00 27.62 ? 132  PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 132 ? -8.539  20.578  64.926  1.00 32.16 ? 132  PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 132 ? -7.827  20.043  66.155  1.00 30.64 ? 132  PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 132 ? -6.690  19.258  65.578  1.00 30.65 ? 132  PRO A CD    1 
ATOM   1093 N  N     . ILE A 1 133 ? -9.640  19.821  61.847  1.00 25.78 ? 133  ILE A N     1 
ATOM   1094 C  CA    . ILE A 1 133 ? -9.898  20.517  60.600  1.00 26.22 ? 133  ILE A CA    1 
ATOM   1095 C  C     . ILE A 1 133 ? -10.255 21.959  60.984  1.00 27.14 ? 133  ILE A C     1 
ATOM   1096 O  O     . ILE A 1 133 ? -11.215 22.186  61.725  1.00 28.24 ? 133  ILE A O     1 
ATOM   1097 C  CB    . ILE A 1 133 ? -11.046 19.833  59.825  1.00 24.43 ? 133  ILE A CB    1 
ATOM   1098 C  CG1   . ILE A 1 133 ? -10.624 18.420  59.419  1.00 24.35 ? 133  ILE A CG1   1 
ATOM   1099 C  CG2   . ILE A 1 133 ? -11.455 20.648  58.593  1.00 25.71 ? 133  ILE A CG2   1 
ATOM   1100 C  CD1   . ILE A 1 133 ? -11.738 17.564  58.912  1.00 22.15 ? 133  ILE A CD1   1 
ATOM   1101 N  N     . ASP A 1 134 ? -9.464  22.925  60.523  1.00 27.15 ? 134  ASP A N     1 
ATOM   1102 C  CA    . ASP A 1 134 ? -9.658  24.310  60.960  1.00 25.73 ? 134  ASP A CA    1 
ATOM   1103 C  C     . ASP A 1 134 ? -10.165 25.272  59.890  1.00 26.40 ? 134  ASP A C     1 
ATOM   1104 O  O     . ASP A 1 134 ? -10.457 26.429  60.184  1.00 28.19 ? 134  ASP A O     1 
ATOM   1105 C  CB    . ASP A 1 134 ? -8.437  24.876  61.710  1.00 25.91 ? 134  ASP A CB    1 
ATOM   1106 C  CG    . ASP A 1 134 ? -7.123  24.672  60.977  1.00 25.62 ? 134  ASP A CG    1 
ATOM   1107 O  OD1   . ASP A 1 134 ? -7.075  24.722  59.735  1.00 31.62 ? 134  ASP A OD1   1 
ATOM   1108 O  OD2   . ASP A 1 134 ? -6.109  24.480  61.670  1.00 29.75 ? 134  ASP A OD2   1 
ATOM   1109 N  N     . ALA A 1 135 ? -10.278 24.779  58.660  1.00 25.45 ? 135  ALA A N     1 
ATOM   1110 C  CA    . ALA A 1 135 ? -10.908 25.520  57.574  1.00 24.62 ? 135  ALA A CA    1 
ATOM   1111 C  C     . ALA A 1 135 ? -11.399 24.580  56.488  1.00 24.35 ? 135  ALA A C     1 
ATOM   1112 O  O     . ALA A 1 135 ? -10.735 23.596  56.154  1.00 24.24 ? 135  ALA A O     1 
ATOM   1113 C  CB    . ALA A 1 135 ? -9.953  26.555  56.989  1.00 21.23 ? 135  ALA A CB    1 
ATOM   1114 N  N     . ILE A 1 136 ? -12.591 24.871  55.974  1.00 24.98 ? 136  ILE A N     1 
ATOM   1115 C  CA    . ILE A 1 136 ? -13.093 24.254  54.751  1.00 23.79 ? 136  ILE A CA    1 
ATOM   1116 C  C     . ILE A 1 136 ? -13.634 25.364  53.859  1.00 25.49 ? 136  ILE A C     1 
ATOM   1117 O  O     . ILE A 1 136 ? -14.427 26.209  54.315  1.00 24.28 ? 136  ILE A O     1 
ATOM   1118 C  CB    . ILE A 1 136 ? -14.213 23.199  55.019  1.00 22.04 ? 136  ILE A CB    1 
ATOM   1119 C  CG1   . ILE A 1 136 ? -13.793 22.207  56.113  1.00 20.06 ? 136  ILE A CG1   1 
ATOM   1120 C  CG2   . ILE A 1 136 ? -14.548 22.445  53.744  1.00 21.34 ? 136  ILE A CG2   1 
ATOM   1121 C  CD1   . ILE A 1 136 ? -14.817 21.109  56.426  1.00 19.42 ? 136  ILE A CD1   1 
ATOM   1122 N  N     . THR A 1 137 ? -13.174 25.400  52.607  1.00 23.42 ? 137  THR A N     1 
ATOM   1123 C  CA    . THR A 1 137 ? -13.871 26.186  51.591  1.00 22.45 ? 137  THR A CA    1 
ATOM   1124 C  C     . THR A 1 137 ? -14.476 25.248  50.567  1.00 23.24 ? 137  THR A C     1 
ATOM   1125 O  O     . THR A 1 137 ? -13.794 24.383  50.000  1.00 23.46 ? 137  THR A O     1 
ATOM   1126 C  CB    . THR A 1 137 ? -12.986 27.251  50.935  1.00 21.71 ? 137  THR A CB    1 
ATOM   1127 O  OG1   . THR A 1 137 ? -12.540 28.152  51.951  1.00 21.94 ? 137  THR A OG1   1 
ATOM   1128 C  CG2   . THR A 1 137 ? -13.766 28.040  49.875  1.00 21.37 ? 137  THR A CG2   1 
ATOM   1129 N  N     . HIS A 1 138 ? -15.774 25.422  50.359  1.00 22.29 ? 138  HIS A N     1 
ATOM   1130 C  CA    . HIS A 1 138 ? -16.561 24.543  49.510  1.00 23.66 ? 138  HIS A CA    1 
ATOM   1131 C  C     . HIS A 1 138 ? -17.341 25.406  48.520  1.00 26.54 ? 138  HIS A C     1 
ATOM   1132 O  O     . HIS A 1 138 ? -18.290 26.101  48.899  1.00 26.63 ? 138  HIS A O     1 
ATOM   1133 C  CB    . HIS A 1 138 ? -17.495 23.718  50.396  1.00 21.76 ? 138  HIS A CB    1 
ATOM   1134 C  CG    . HIS A 1 138 ? -18.345 22.724  49.663  1.00 24.35 ? 138  HIS A CG    1 
ATOM   1135 N  ND1   . HIS A 1 138 ? -18.235 21.366  49.866  1.00 23.05 ? 138  HIS A ND1   1 
ATOM   1136 C  CD2   . HIS A 1 138 ? -19.356 22.891  48.775  1.00 22.34 ? 138  HIS A CD2   1 
ATOM   1137 C  CE1   . HIS A 1 138 ? -19.129 20.737  49.121  1.00 23.28 ? 138  HIS A CE1   1 
ATOM   1138 N  NE2   . HIS A 1 138 ? -19.824 21.642  48.453  1.00 23.91 ? 138  HIS A NE2   1 
ATOM   1139 N  N     . TYR A 1 139 ? -16.913 25.370  47.255  1.00 26.50 ? 139  TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 139 ? -17.621 26.050  46.178  1.00 24.67 ? 139  TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 139 ? -18.665 25.097  45.609  1.00 23.84 ? 139  TYR A C     1 
ATOM   1142 O  O     . TYR A 1 139 ? -18.385 23.928  45.341  1.00 23.00 ? 139  TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 139 ? -16.667 26.526  45.062  1.00 21.00 ? 139  TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 139 ? -17.385 27.101  43.849  1.00 21.14 ? 139  TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 139 ? -17.654 26.313  42.727  1.00 20.21 ? 139  TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 139 ? -17.798 28.429  43.829  1.00 21.21 ? 139  TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 139 ? -18.299 26.835  41.611  1.00 15.30 ? 139  TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 139 ? -18.451 28.963  42.723  1.00 24.64 ? 139  TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 139 ? -18.714 28.159  41.628  1.00 24.69 ? 139  TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 139 ? -19.370 28.703  40.545  1.00 27.46 ? 139  TYR A OH    1 
ATOM   1151 N  N     . ASP A 1 140 ? -19.861 25.632  45.427  1.00 23.59 ? 140  ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 140 ? -20.972 24.933  44.839  1.00 23.97 ? 140  ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 140 ? -21.304 25.601  43.502  1.00 24.88 ? 140  ASP A C     1 
ATOM   1154 O  O     . ASP A 1 140 ? -21.560 26.813  43.463  1.00 23.42 ? 140  ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 140 ? -22.163 25.037  45.788  1.00 23.08 ? 140  ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 140 ? -23.365 24.299  45.287  1.00 22.64 ? 140  ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 140 ? -24.053 24.816  44.375  1.00 24.38 ? 140  ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 140 ? -23.627 23.201  45.825  1.00 22.07 ? 140  ASP A OD2   1 
ATOM   1159 N  N     . SER A 1 141 ? -21.295 24.809  42.423  1.00 24.12 ? 141  SER A N     1 
ATOM   1160 C  CA    . SER A 1 141 ? -21.500 25.308  41.054  1.00 25.37 ? 141  SER A CA    1 
ATOM   1161 C  C     . SER A 1 141 ? -22.923 25.802  40.770  1.00 27.40 ? 141  SER A C     1 
ATOM   1162 O  O     . SER A 1 141 ? -23.113 26.713  39.967  1.00 27.84 ? 141  SER A O     1 
ATOM   1163 C  CB    . SER A 1 141 ? -21.148 24.229  40.030  1.00 25.13 ? 141  SER A CB    1 
ATOM   1164 O  OG    . SER A 1 141 ? -22.119 23.189  40.050  1.00 24.75 ? 141  SER A OG    1 
ATOM   1165 N  N     . ILE A 1 142 ? -23.909 25.173  41.405  1.00 27.17 ? 142  ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 142 ? -25.310 25.573  41.277  1.00 29.20 ? 142  ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 142 ? -25.604 26.926  41.972  1.00 29.99 ? 142  ILE A C     1 
ATOM   1168 O  O     . ILE A 1 142 ? -26.225 27.812  41.380  1.00 30.86 ? 142  ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 142 ? -26.266 24.450  41.785  1.00 30.05 ? 142  ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 142 ? -26.135 23.214  40.885  1.00 27.79 ? 142  ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 142 ? -27.708 24.956  41.866  1.00 29.11 ? 142  ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 142 ? -27.218 22.156  41.056  1.00 32.99 ? 142  ILE A CD1   1 
ATOM   1173 N  N     . ASP A 1 143 ? -25.149 27.088  43.211  1.00 28.36 ? 143  ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 143 ? -25.302 28.361  43.914  1.00 30.63 ? 143  ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 143 ? -24.342 29.435  43.402  1.00 30.49 ? 143  ASP A C     1 
ATOM   1176 O  O     . ASP A 1 143 ? -24.607 30.624  43.558  1.00 29.95 ? 143  ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 143 ? -25.068 28.176  45.416  1.00 32.17 ? 143  ASP A CB    1 
ATOM   1178 C  CG    . ASP A 1 143 ? -26.137 27.322  46.081  1.00 32.82 ? 143  ASP A CG    1 
ATOM   1179 O  OD1   . ASP A 1 143 ? -27.184 27.041  45.457  1.00 30.66 ? 143  ASP A OD1   1 
ATOM   1180 O  OD2   . ASP A 1 143 ? -25.925 26.936  47.247  1.00 35.26 ? 143  ASP A OD2   1 
ATOM   1181 N  N     . ASP A 1 144 ? -23.219 29.009  42.818  1.00 29.05 ? 144  ASP A N     1 
ATOM   1182 C  CA    . ASP A 1 144 ? -22.130 29.922  42.443  1.00 28.78 ? 144  ASP A CA    1 
ATOM   1183 C  C     . ASP A 1 144 ? -21.615 30.664  43.684  1.00 28.26 ? 144  ASP A C     1 
ATOM   1184 O  O     . ASP A 1 144 ? -21.390 31.883  43.654  1.00 30.39 ? 144  ASP A O     1 
ATOM   1185 C  CB    . ASP A 1 144 ? -22.567 30.906  41.324  1.00 29.01 ? 144  ASP A CB    1 
ATOM   1186 C  CG    . ASP A 1 144 ? -21.381 31.619  40.661  1.00 31.10 ? 144  ASP A CG    1 
ATOM   1187 O  OD1   . ASP A 1 144 ? -20.242 31.106  40.721  1.00 28.63 ? 144  ASP A OD1   1 
ATOM   1188 O  OD2   . ASP A 1 144 ? -21.594 32.697  40.073  1.00 32.53 ? 144  ASP A OD2   1 
ATOM   1189 N  N     . ARG A 1 145 ? -21.436 29.927  44.778  1.00 25.54 ? 145  ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 145 ? -20.951 30.525  46.029  1.00 27.08 ? 145  ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 145 ? -19.814 29.722  46.646  1.00 27.06 ? 145  ARG A C     1 
ATOM   1192 O  O     . ARG A 1 145 ? -19.802 28.489  46.551  1.00 27.57 ? 145  ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 145 ? -22.093 30.669  47.047  1.00 27.89 ? 145  ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 145 ? -23.248 31.589  46.619  1.00 28.17 ? 145  ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 145 ? -22.833 33.051  46.612  1.00 28.52 ? 145  ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 145 ? -23.936 33.941  46.250  1.00 31.97 ? 145  ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 145 ? -24.222 34.335  45.011  1.00 31.91 ? 145  ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 145 ? -23.496 33.925  43.982  1.00 32.31 ? 145  ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 145 ? -25.243 35.151  44.800  1.00 34.31 ? 145  ARG A NH2   1 
ATOM   1200 N  N     . PHE A 1 146 ? -18.861 30.425  47.263  1.00 27.08 ? 146  PHE A N     1 
ATOM   1201 C  CA    . PHE A 1 146 ? -17.814 29.790  48.078  1.00 25.53 ? 146  PHE A CA    1 
ATOM   1202 C  C     . PHE A 1 146 ? -18.281 29.777  49.522  1.00 25.76 ? 146  PHE A C     1 
ATOM   1203 O  O     . PHE A 1 146 ? -18.470 30.826  50.138  1.00 24.73 ? 146  PHE A O     1 
ATOM   1204 C  CB    . PHE A 1 146 ? -16.493 30.566  48.004  1.00 25.61 ? 146  PHE A CB    1 
ATOM   1205 C  CG    . PHE A 1 146 ? -15.909 30.653  46.628  1.00 24.71 ? 146  PHE A CG    1 
ATOM   1206 C  CD1   . PHE A 1 146 ? -16.384 31.591  45.718  1.00 22.69 ? 146  PHE A CD1   1 
ATOM   1207 C  CD2   . PHE A 1 146 ? -14.875 29.806  46.247  1.00 25.65 ? 146  PHE A CD2   1 
ATOM   1208 C  CE1   . PHE A 1 146 ? -15.850 31.674  44.431  1.00 26.29 ? 146  PHE A CE1   1 
ATOM   1209 C  CE2   . PHE A 1 146 ? -14.331 29.878  44.969  1.00 24.37 ? 146  PHE A CE2   1 
ATOM   1210 C  CZ    . PHE A 1 146 ? -14.820 30.819  44.057  1.00 23.07 ? 146  PHE A CZ    1 
ATOM   1211 N  N     . TYR A 1 147 ? -18.480 28.587  50.062  1.00 25.95 ? 147  TYR A N     1 
ATOM   1212 C  CA    . TYR A 1 147 ? -18.907 28.466  51.440  1.00 25.58 ? 147  TYR A CA    1 
ATOM   1213 C  C     . TYR A 1 147 ? -17.684 28.232  52.301  1.00 25.52 ? 147  TYR A C     1 
ATOM   1214 O  O     . TYR A 1 147 ? -16.936 27.262  52.097  1.00 25.05 ? 147  TYR A O     1 
ATOM   1215 C  CB    . TYR A 1 147 ? -19.914 27.328  51.589  1.00 25.96 ? 147  TYR A CB    1 
ATOM   1216 C  CG    . TYR A 1 147 ? -21.247 27.622  50.942  1.00 29.45 ? 147  TYR A CG    1 
ATOM   1217 C  CD1   . TYR A 1 147 ? -21.521 27.205  49.637  1.00 27.80 ? 147  TYR A CD1   1 
ATOM   1218 C  CD2   . TYR A 1 147 ? -22.237 28.313  51.637  1.00 26.12 ? 147  TYR A CD2   1 
ATOM   1219 C  CE1   . TYR A 1 147 ? -22.750 27.474  49.040  1.00 29.41 ? 147  TYR A CE1   1 
ATOM   1220 C  CE2   . TYR A 1 147 ? -23.467 28.586  51.051  1.00 29.88 ? 147  TYR A CE2   1 
ATOM   1221 C  CZ    . TYR A 1 147 ? -23.718 28.164  49.758  1.00 30.36 ? 147  TYR A CZ    1 
ATOM   1222 O  OH    . TYR A 1 147 ? -24.937 28.431  49.195  1.00 30.49 ? 147  TYR A OH    1 
ATOM   1223 N  N     . VAL A 1 148 ? -17.489 29.119  53.266  1.00 24.61 ? 148  VAL A N     1 
ATOM   1224 C  CA    . VAL A 1 148 ? -16.285 29.107  54.092  1.00 25.91 ? 148  VAL A CA    1 
ATOM   1225 C  C     . VAL A 1 148 ? -16.602 28.781  55.544  1.00 27.09 ? 148  VAL A C     1 
ATOM   1226 O  O     . VAL A 1 148 ? -17.325 29.517  56.218  1.00 30.69 ? 148  VAL A O     1 
ATOM   1227 C  CB    . VAL A 1 148 ? -15.527 30.457  54.015  1.00 24.45 ? 148  VAL A CB    1 
ATOM   1228 C  CG1   . VAL A 1 148 ? -14.264 30.427  54.878  1.00 25.34 ? 148  VAL A CG1   1 
ATOM   1229 C  CG2   . VAL A 1 148 ? -15.191 30.789  52.577  1.00 22.92 ? 148  VAL A CG2   1 
ATOM   1230 N  N     . PHE A 1 149 ? -16.033 27.675  56.008  1.00 26.91 ? 149  PHE A N     1 
ATOM   1231 C  CA    . PHE A 1 149 ? -16.206 27.200  57.365  1.00 27.47 ? 149  PHE A CA    1 
ATOM   1232 C  C     . PHE A 1 149 ? -14.892 27.421  58.083  1.00 26.48 ? 149  PHE A C     1 
ATOM   1233 O  O     . PHE A 1 149 ? -13.887 26.789  57.765  1.00 29.06 ? 149  PHE A O     1 
ATOM   1234 C  CB    . PHE A 1 149 ? -16.589 25.712  57.361  1.00 25.75 ? 149  PHE A CB    1 
ATOM   1235 C  CG    . PHE A 1 149 ? -17.815 25.406  56.547  1.00 28.16 ? 149  PHE A CG    1 
ATOM   1236 C  CD1   . PHE A 1 149 ? -17.754 25.380  55.152  1.00 28.45 ? 149  PHE A CD1   1 
ATOM   1237 C  CD2   . PHE A 1 149 ? -19.035 25.151  57.172  1.00 29.55 ? 149  PHE A CD2   1 
ATOM   1238 C  CE1   . PHE A 1 149 ? -18.887 25.102  54.386  1.00 28.21 ? 149  PHE A CE1   1 
ATOM   1239 C  CE2   . PHE A 1 149 ? -20.180 24.873  56.417  1.00 31.87 ? 149  PHE A CE2   1 
ATOM   1240 C  CZ    . PHE A 1 149 ? -20.098 24.848  55.010  1.00 27.81 ? 149  PHE A CZ    1 
ATOM   1241 N  N     . ASP A 1 150 ? -14.917 28.310  59.065  1.00 27.25 ? 150  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1 150 ? -13.715 28.814  59.700  1.00 30.50 ? 150  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1 150 ? -13.697 28.455  61.185  1.00 30.04 ? 150  ASP A C     1 
ATOM   1244 O  O     . ASP A 1 150 ? -14.606 28.826  61.928  1.00 32.32 ? 150  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1 150 ? -13.656 30.336  59.496  1.00 31.35 ? 150  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1 150 ? -12.379 30.963  60.025  1.00 32.30 ? 150  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1 150 ? -11.459 30.217  60.420  1.00 29.14 ? 150  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1 150 ? -12.306 32.220  60.036  1.00 31.65 ? 150  ASP A OD2   1 
ATOM   1249 N  N     . LEU A 1 151 ? -12.675 27.719  61.616  1.00 28.51 ? 151  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 151 ? -12.586 27.328  63.024  1.00 28.48 ? 151  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 151 ? -11.828 28.374  63.828  1.00 29.30 ? 151  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 151 ? -10.630 28.578  63.608  1.00 29.05 ? 151  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 151 ? -11.927 25.950  63.187  1.00 28.10 ? 151  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 151 ? -11.778 25.444  64.622  1.00 27.25 ? 151  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 151 ? -13.143 25.416  65.300  1.00 25.70 ? 151  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 151 ? -11.112 24.062  64.687  1.00 27.16 ? 151  LEU A CD2   1 
ATOM   1257 N  N     . LEU A 1 152 ? -12.532 29.020  64.755  1.00 29.35 ? 152  LEU A N     1 
ATOM   1258 C  CA    . LEU A 1 152 ? -11.947 30.088  65.583  1.00 35.24 ? 152  LEU A CA    1 
ATOM   1259 C  C     . LEU A 1 152 ? -11.201 29.590  66.817  1.00 33.21 ? 152  LEU A C     1 
ATOM   1260 O  O     . LEU A 1 152 ? -10.261 30.236  67.279  1.00 34.34 ? 152  LEU A O     1 
ATOM   1261 C  CB    . LEU A 1 152 ? -13.006 31.120  66.020  1.00 35.35 ? 152  LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1 152 ? -13.790 31.884  64.948  1.00 35.08 ? 152  LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1 152 ? -14.483 33.073  65.594  1.00 36.75 ? 152  LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1 152 ? -12.907 32.327  63.776  1.00 35.11 ? 152  LEU A CD2   1 
ATOM   1265 N  N     . ASN A 1 153 ? -11.629 28.456  67.353  1.00 33.11 ? 153  ASN A N     1 
ATOM   1266 C  CA    . ASN A 1 153 ? -11.016 27.924  68.559  1.00 34.75 ? 153  ASN A CA    1 
ATOM   1267 C  C     . ASN A 1 153 ? -10.503 26.514  68.348  1.00 35.94 ? 153  ASN A C     1 
ATOM   1268 O  O     . ASN A 1 153 ? -11.232 25.619  67.891  1.00 35.24 ? 153  ASN A O     1 
ATOM   1269 C  CB    . ASN A 1 153 ? -11.977 27.999  69.751  1.00 35.53 ? 153  ASN A CB    1 
ATOM   1270 C  CG    . ASN A 1 153 ? -12.461 29.416  70.021  1.00 39.52 ? 153  ASN A CG    1 
ATOM   1271 O  OD1   . ASN A 1 153 ? -11.683 30.372  69.993  1.00 41.60 ? 153  ASN A OD1   1 
ATOM   1272 N  ND2   . ASN A 1 153 ? -13.751 29.557  70.279  1.00 42.78 ? 153  ASN A ND2   1 
ATOM   1273 N  N     . SER A 1 154 ? -9.236  26.330  68.689  1.00 35.89 ? 154  SER A N     1 
ATOM   1274 C  CA    . SER A 1 154 ? -8.549  25.071  68.471  1.00 36.81 ? 154  SER A CA    1 
ATOM   1275 C  C     . SER A 1 154 ? -7.514  24.877  69.565  1.00 37.42 ? 154  SER A C     1 
ATOM   1276 O  O     . SER A 1 154 ? -7.060  25.861  70.154  1.00 37.51 ? 154  SER A O     1 
ATOM   1277 C  CB    . SER A 1 154 ? -7.869  25.093  67.099  1.00 34.42 ? 154  SER A CB    1 
ATOM   1278 O  OG    . SER A 1 154 ? -6.777  24.195  67.034  1.00 36.29 ? 154  SER A OG    1 
ATOM   1279 N  N     . PRO A 1 155 ? -7.134  23.611  69.840  1.00 39.24 ? 155  PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 155 ? -5.973  23.367  70.702  1.00 39.30 ? 155  PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 155 ? -4.671  24.004  70.191  1.00 39.38 ? 155  PRO A C     1 
ATOM   1282 O  O     . PRO A 1 155 ? -3.772  24.240  70.997  1.00 40.70 ? 155  PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 155 ? -5.849  21.835  70.720  1.00 39.35 ? 155  PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 155 ? -6.763  21.331  69.655  1.00 38.87 ? 155  PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 155 ? -7.837  22.355  69.508  1.00 38.69 ? 155  PRO A CD    1 
ATOM   1286 N  N     . TYR A 1 156 ? -4.574  24.294  68.887  1.00 37.51 ? 156  TYR A N     1 
ATOM   1287 C  CA    . TYR A 1 156 ? -3.369  24.936  68.323  1.00 38.75 ? 156  TYR A CA    1 
ATOM   1288 C  C     . TYR A 1 156 ? -3.465  26.457  68.194  1.00 40.25 ? 156  TYR A C     1 
ATOM   1289 O  O     . TYR A 1 156 ? -2.579  27.104  67.612  1.00 42.63 ? 156  TYR A O     1 
ATOM   1290 C  CB    . TYR A 1 156 ? -2.969  24.312  66.981  1.00 38.11 ? 156  TYR A CB    1 
ATOM   1291 C  CG    . TYR A 1 156 ? -2.753  22.824  67.074  1.00 43.34 ? 156  TYR A CG    1 
ATOM   1292 C  CD1   . TYR A 1 156 ? -1.788  22.290  67.930  1.00 45.59 ? 156  TYR A CD1   1 
ATOM   1293 C  CD2   . TYR A 1 156 ? -3.526  21.946  66.320  1.00 41.99 ? 156  TYR A CD2   1 
ATOM   1294 C  CE1   . TYR A 1 156 ? -1.599  20.918  68.027  1.00 48.85 ? 156  TYR A CE1   1 
ATOM   1295 C  CE2   . TYR A 1 156 ? -3.342  20.577  66.410  1.00 46.45 ? 156  TYR A CE2   1 
ATOM   1296 C  CZ    . TYR A 1 156 ? -2.380  20.071  67.260  1.00 46.54 ? 156  TYR A CZ    1 
ATOM   1297 O  OH    . TYR A 1 156 ? -2.206  18.715  67.342  1.00 51.14 ? 156  TYR A OH    1 
ATOM   1298 N  N     . GLY A 1 157 ? -4.538  27.024  68.731  1.00 39.67 ? 157  GLY A N     1 
ATOM   1299 C  CA    . GLY A 1 157 ? -4.664  28.472  68.802  1.00 41.90 ? 157  GLY A CA    1 
ATOM   1300 C  C     . GLY A 1 157 ? -6.088  28.955  68.654  1.00 42.62 ? 157  GLY A C     1 
ATOM   1301 O  O     . GLY A 1 157 ? -6.868  28.411  67.861  1.00 43.21 ? 157  GLY A O     1 
ATOM   1302 N  N     . ASN A 1 158 ? -6.424  29.970  69.439  1.00 41.59 ? 158  ASN A N     1 
ATOM   1303 C  CA    . ASN A 1 158 ? -7.665  30.698  69.270  1.00 39.52 ? 158  ASN A CA    1 
ATOM   1304 C  C     . ASN A 1 158 ? -7.384  31.942  68.432  1.00 41.04 ? 158  ASN A C     1 
ATOM   1305 O  O     . ASN A 1 158 ? -6.381  32.636  68.652  1.00 41.73 ? 158  ASN A O     1 
ATOM   1306 C  CB    . ASN A 1 158 ? -8.267  31.046  70.633  1.00 40.48 ? 158  ASN A CB    1 
ATOM   1307 C  CG    . ASN A 1 158 ? -8.644  29.802  71.441  1.00 40.19 ? 158  ASN A CG    1 
ATOM   1308 O  OD1   . ASN A 1 158 ? -8.688  28.682  70.920  1.00 40.99 ? 158  ASN A OD1   1 
ATOM   1309 N  ND2   . ASN A 1 158 ? -8.918  29.999  72.711  1.00 39.90 ? 158  ASN A ND2   1 
ATOM   1310 N  N     . VAL A 1 159 ? -8.252  32.200  67.455  1.00 39.54 ? 159  VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 159 ? -8.043  33.289  66.494  1.00 38.61 ? 159  VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 159 ? -9.275  34.179  66.352  1.00 38.17 ? 159  VAL A C     1 
ATOM   1313 O  O     . VAL A 1 159 ? -10.361 33.824  66.812  1.00 36.55 ? 159  VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 159 ? -7.640  32.749  65.094  1.00 38.32 ? 159  VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 159 ? -6.286  32.036  65.157  1.00 37.32 ? 159  VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 159 ? -8.721  31.824  64.525  1.00 36.91 ? 159  VAL A CG2   1 
ATOM   1317 N  N     . GLU A 1 160 ? -9.092  35.327  65.702  1.00 37.85 ? 160  GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 160 ? -10.188 36.254  65.405  1.00 38.40 ? 160  GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 160 ? -10.856 35.926  64.059  1.00 36.23 ? 160  GLU A C     1 
ATOM   1320 O  O     . GLU A 1 160 ? -10.280 35.225  63.232  1.00 33.26 ? 160  GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 160 ? -9.661  37.700  65.397  1.00 40.38 ? 160  GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 160 ? -9.059  38.166  66.722  1.00 45.70 ? 160  GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 160 ? -10.095 38.265  67.837  1.00 53.67 ? 160  GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 160 ? -11.185 38.831  67.597  1.00 54.60 ? 160  GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 160 ? -9.821  37.773  68.955  1.00 57.99 ? 160  GLU A OE2   1 
ATOM   1326 N  N     . GLU A 1 161 ? -12.059 36.449  63.833  1.00 36.38 ? 161  GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 161 ? -12.763 36.226  62.562  1.00 35.89 ? 161  GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 161 ? -11.967 36.743  61.369  1.00 34.19 ? 161  GLU A C     1 
ATOM   1329 O  O     . GLU A 1 161 ? -11.176 37.671  61.485  1.00 34.63 ? 161  GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 161 ? -14.159 36.853  62.577  1.00 36.27 ? 161  GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 161 ? -15.215 35.983  63.266  1.00 40.24 ? 161  GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 161 ? -16.618 36.584  63.225  1.00 43.07 ? 161  GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 161 ? -16.945 37.303  62.257  1.00 42.93 ? 161  GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 161 ? -17.402 36.323  64.164  1.00 46.41 ? 161  GLU A OE2   1 
ATOM   1335 N  N     . TRP A 1 162 ? -12.169 36.115  60.226  1.00 33.42 ? 162  TRP A N     1 
ATOM   1336 C  CA    . TRP A 1 162 ? -11.523 36.545  59.000  1.00 33.82 ? 162  TRP A CA    1 
ATOM   1337 C  C     . TRP A 1 162 ? -12.274 37.763  58.485  1.00 35.00 ? 162  TRP A C     1 
ATOM   1338 O  O     . TRP A 1 162 ? -13.500 37.842  58.618  1.00 36.00 ? 162  TRP A O     1 
ATOM   1339 C  CB    . TRP A 1 162 ? -11.538 35.391  58.002  1.00 31.89 ? 162  TRP A CB    1 
ATOM   1340 C  CG    . TRP A 1 162 ? -11.282 35.733  56.560  1.00 30.68 ? 162  TRP A CG    1 
ATOM   1341 C  CD1   . TRP A 1 162 ? -10.072 35.827  55.939  1.00 28.04 ? 162  TRP A CD1   1 
ATOM   1342 C  CD2   . TRP A 1 162 ? -12.273 35.963  55.554  1.00 29.64 ? 162  TRP A CD2   1 
ATOM   1343 N  NE1   . TRP A 1 162 ? -10.249 36.113  54.603  1.00 31.34 ? 162  TRP A NE1   1 
ATOM   1344 C  CE2   . TRP A 1 162 ? -11.591 36.205  54.343  1.00 27.74 ? 162  TRP A CE2   1 
ATOM   1345 C  CE3   . TRP A 1 162 ? -13.676 35.994  55.560  1.00 28.57 ? 162  TRP A CE3   1 
ATOM   1346 C  CZ2   . TRP A 1 162 ? -12.263 36.482  53.148  1.00 30.53 ? 162  TRP A CZ2   1 
ATOM   1347 C  CZ3   . TRP A 1 162 ? -14.345 36.269  54.367  1.00 30.89 ? 162  TRP A CZ3   1 
ATOM   1348 C  CH2   . TRP A 1 162 ? -13.636 36.501  53.176  1.00 29.66 ? 162  TRP A CH2   1 
ATOM   1349 N  N     . SER A 1 163 ? -11.530 38.715  57.927  1.00 33.60 ? 163  SER A N     1 
ATOM   1350 C  CA    . SER A 1 163 ? -12.104 39.953  57.413  1.00 37.04 ? 163  SER A CA    1 
ATOM   1351 C  C     . SER A 1 163 ? -12.121 39.998  55.884  1.00 38.37 ? 163  SER A C     1 
ATOM   1352 O  O     . SER A 1 163 ? -11.068 40.000  55.235  1.00 40.38 ? 163  SER A O     1 
ATOM   1353 C  CB    . SER A 1 163 ? -11.335 41.161  57.940  1.00 36.69 ? 163  SER A CB    1 
ATOM   1354 O  OG    . SER A 1 163 ? -11.680 42.315  57.196  1.00 37.37 ? 163  SER A OG    1 
ATOM   1355 N  N     . ILE A 1 164 ? -13.319 40.062  55.318  1.00 37.68 ? 164  ILE A N     1 
ATOM   1356 C  CA    . ILE A 1 164 ? -13.473 40.135  53.872  1.00 38.17 ? 164  ILE A CA    1 
ATOM   1357 C  C     . ILE A 1 164 ? -12.924 41.448  53.304  1.00 38.89 ? 164  ILE A C     1 
ATOM   1358 O  O     . ILE A 1 164 ? -12.421 41.473  52.173  1.00 38.60 ? 164  ILE A O     1 
ATOM   1359 C  CB    . ILE A 1 164 ? -14.940 39.869  53.431  1.00 37.92 ? 164  ILE A CB    1 
ATOM   1360 C  CG1   . ILE A 1 164 ? -15.000 39.552  51.930  1.00 36.82 ? 164  ILE A CG1   1 
ATOM   1361 C  CG2   . ILE A 1 164 ? -15.874 41.027  53.855  1.00 38.59 ? 164  ILE A CG2   1 
ATOM   1362 C  CD1   . ILE A 1 164 ? -16.197 38.709  51.508  1.00 36.93 ? 164  ILE A CD1   1 
ATOM   1363 N  N     . GLU A 1 165 ? -12.991 42.519  54.098  1.00 38.05 ? 165  GLU A N     1 
ATOM   1364 C  CA    . GLU A 1 165 ? -12.496 43.828  53.671  1.00 39.12 ? 165  GLU A CA    1 
ATOM   1365 C  C     . GLU A 1 165 ? -10.981 43.809  53.511  1.00 37.22 ? 165  GLU A C     1 
ATOM   1366 O  O     . GLU A 1 165 ? -10.449 44.362  52.550  1.00 36.56 ? 165  GLU A O     1 
ATOM   1367 C  CB    . GLU A 1 165 ? -12.916 44.951  54.642  1.00 41.65 ? 165  GLU A CB    1 
ATOM   1368 C  CG    . GLU A 1 165 ? -14.426 45.128  54.817  1.00 46.44 ? 165  GLU A CG    1 
ATOM   1369 C  CD    . GLU A 1 165 ? -15.027 44.186  55.859  1.00 53.78 ? 165  GLU A CD    1 
ATOM   1370 O  OE1   . GLU A 1 165 ? -14.308 43.308  56.396  1.00 55.84 ? 165  GLU A OE1   1 
ATOM   1371 O  OE2   . GLU A 1 165 ? -16.233 44.321  56.144  1.00 58.51 ? 165  GLU A OE2   1 
ATOM   1372 N  N     . ILE A 1 166 ? -10.287 43.182  54.457  1.00 34.30 ? 166  ILE A N     1 
ATOM   1373 C  CA    . ILE A 1 166 ? -8.835  43.046  54.346  1.00 34.45 ? 166  ILE A CA    1 
ATOM   1374 C  C     . ILE A 1 166 ? -8.484  42.049  53.239  1.00 32.65 ? 166  ILE A C     1 
ATOM   1375 O  O     . ILE A 1 166 ? -7.511  42.246  52.519  1.00 29.98 ? 166  ILE A O     1 
ATOM   1376 C  CB    . ILE A 1 166 ? -8.161  42.655  55.701  1.00 35.15 ? 166  ILE A CB    1 
ATOM   1377 C  CG1   . ILE A 1 166 ? -8.348  43.789  56.719  1.00 35.17 ? 166  ILE A CG1   1 
ATOM   1378 C  CG2   . ILE A 1 166 ? -6.653  42.345  55.513  1.00 32.07 ? 166  ILE A CG2   1 
ATOM   1379 C  CD1   . ILE A 1 166 ? -7.975  43.430  58.152  1.00 32.86 ? 166  ILE A CD1   1 
ATOM   1380 N  N     . ALA A 1 167 ? -9.295  41.001  53.099  1.00 31.05 ? 167  ALA A N     1 
ATOM   1381 C  CA    . ALA A 1 167 ? -9.085  39.992  52.065  1.00 31.36 ? 167  ALA A CA    1 
ATOM   1382 C  C     . ALA A 1 167 ? -9.069  40.607  50.665  1.00 33.16 ? 167  ALA A C     1 
ATOM   1383 O  O     . ALA A 1 167 ? -8.245  40.228  49.830  1.00 33.25 ? 167  ALA A O     1 
ATOM   1384 C  CB    . ALA A 1 167 ? -10.151 38.929  52.147  1.00 29.57 ? 167  ALA A CB    1 
ATOM   1385 N  N     . ALA A 1 168 ? -9.976  41.557  50.424  1.00 35.01 ? 168  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 168 ? -10.122 42.202  49.114  1.00 35.13 ? 168  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 168 ? -9.010  43.195  48.819  1.00 37.17 ? 168  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 168 ? -8.703  43.450  47.659  1.00 38.33 ? 168  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 168 ? -11.466 42.892  49.011  1.00 34.67 ? 168  ALA A CB    1 
ATOM   1390 N  N     . LYS A 1 169 ? -8.412  43.762  49.864  1.00 38.97 ? 169  LYS A N     1 
ATOM   1391 C  CA    . LYS A 1 169 ? -7.376  44.789  49.703  1.00 39.65 ? 169  LYS A CA    1 
ATOM   1392 C  C     . LYS A 1 169 ? -6.112  44.268  49.006  1.00 39.59 ? 169  LYS A C     1 
ATOM   1393 O  O     . LYS A 1 169 ? -5.832  43.065  49.021  1.00 37.50 ? 169  LYS A O     1 
ATOM   1394 C  CB    . LYS A 1 169 ? -7.038  45.422  51.055  1.00 41.94 ? 169  LYS A CB    1 
ATOM   1395 C  CG    . LYS A 1 169 ? -8.071  46.432  51.520  1.00 45.17 ? 169  LYS A CG    1 
ATOM   1396 C  CD    . LYS A 1 169 ? -7.801  46.925  52.927  1.00 52.52 ? 169  LYS A CD    1 
ATOM   1397 C  CE    . LYS A 1 169 ? -8.822  47.987  53.327  1.00 58.02 ? 169  LYS A CE    1 
ATOM   1398 N  NZ    . LYS A 1 169 ? -8.870  48.185  54.803  1.00 63.07 ? 169  LYS A NZ    1 
ATOM   1399 N  N     . LEU A 1 170 ? -5.367  45.184  48.388  1.00 39.05 ? 170  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 170 ? -4.095  44.858  47.741  1.00 38.13 ? 170  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 170 ? -3.066  44.374  48.758  1.00 38.01 ? 170  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 170 ? -3.102  44.787  49.917  1.00 37.06 ? 170  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 170 ? -3.546  46.086  47.013  1.00 39.42 ? 170  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 170 ? -4.428  46.742  45.949  1.00 41.89 ? 170  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 170 ? -3.945  48.168  45.686  1.00 45.99 ? 170  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 170 ? -4.464  45.923  44.664  1.00 40.33 ? 170  LEU A CD2   1 
ATOM   1407 N  N     . GLN A 1 171 ? -2.141  43.517  48.328  1.00 37.33 ? 171  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 171 ? -1.074  43.051  49.218  1.00 40.98 ? 171  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 171 ? -0.221  44.219  49.686  1.00 41.92 ? 171  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 171 ? 0.347   44.188  50.774  1.00 42.69 ? 171  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 171 ? -0.209  41.970  48.564  1.00 43.71 ? 171  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 171 ? -1.006  40.738  48.111  1.00 51.15 ? 171  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 171 ? -0.501  39.426  48.706  1.00 57.64 ? 171  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 171 ? 0.685   39.277  49.026  1.00 60.89 ? 171  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 171 ? -1.409  38.465  48.858  1.00 56.65 ? 171  GLN A NE2   1 
ATOM   1416 N  N     . GLU A 1 172 ? -0.182  45.270  48.871  1.00 42.27 ? 172  GLU A N     1 
ATOM   1417 C  CA    . GLU A 1 172 ? 0.531   46.496  49.195  1.00 43.61 ? 172  GLU A CA    1 
ATOM   1418 C  C     . GLU A 1 172 ? -0.246  47.366  50.185  1.00 43.98 ? 172  GLU A C     1 
ATOM   1419 O  O     . GLU A 1 172 ? 0.226   48.420  50.599  1.00 45.83 ? 172  GLU A O     1 
ATOM   1420 C  CB    . GLU A 1 172 ? 0.856   47.269  47.907  1.00 46.00 ? 172  GLU A CB    1 
ATOM   1421 C  CG    . GLU A 1 172 ? 1.704   46.482  46.886  1.00 47.55 ? 172  GLU A CG    1 
ATOM   1422 C  CD    . GLU A 1 172 ? 0.888   45.551  45.987  1.00 50.69 ? 172  GLU A CD    1 
ATOM   1423 O  OE1   . GLU A 1 172 ? 1.493   44.847  45.151  1.00 53.45 ? 172  GLU A OE1   1 
ATOM   1424 O  OE2   . GLU A 1 172 ? -0.356  45.521  46.105  1.00 51.83 ? 172  GLU A OE2   1 
ATOM   1425 N  N     . GLN A 1 173 ? -1.444  46.926  50.554  1.00 44.33 ? 173  GLN A N     1 
ATOM   1426 C  CA    . GLN A 1 173 ? -2.240  47.584  51.592  1.00 45.85 ? 173  GLN A CA    1 
ATOM   1427 C  C     . GLN A 1 173 ? -2.341  46.701  52.821  1.00 43.98 ? 173  GLN A C     1 
ATOM   1428 O  O     . GLN A 1 173 ? -3.123  46.985  53.729  1.00 45.98 ? 173  GLN A O     1 
ATOM   1429 C  CB    . GLN A 1 173 ? -3.657  47.845  51.093  1.00 47.23 ? 173  GLN A CB    1 
ATOM   1430 C  CG    . GLN A 1 173 ? -3.856  49.128  50.328  1.00 50.91 ? 173  GLN A CG    1 
ATOM   1431 C  CD    . GLN A 1 173 ? -5.238  49.192  49.719  1.00 51.04 ? 173  GLN A CD    1 
ATOM   1432 O  OE1   . GLN A 1 173 ? -5.608  48.342  48.902  1.00 51.07 ? 173  GLN A OE1   1 
ATOM   1433 N  NE2   . GLN A 1 173 ? -6.016  50.192  50.118  1.00 53.46 ? 173  GLN A NE2   1 
ATOM   1434 N  N     . GLY A 1 174 ? -1.565  45.620  52.836  1.00 42.74 ? 174  GLY A N     1 
ATOM   1435 C  CA    . GLY A 1 174 ? -1.640  44.634  53.908  1.00 40.27 ? 174  GLY A CA    1 
ATOM   1436 C  C     . GLY A 1 174 ? -2.789  43.654  53.721  1.00 40.59 ? 174  GLY A C     1 
ATOM   1437 O  O     . GLY A 1 174 ? -3.161  42.936  54.653  1.00 37.98 ? 174  GLY A O     1 
ATOM   1438 N  N     . GLY A 1 175 ? -3.348  43.616  52.512  1.00 38.01 ? 175  GLY A N     1 
ATOM   1439 C  CA    . GLY A 1 175 ? -4.483  42.741  52.220  1.00 34.92 ? 175  GLY A CA    1 
ATOM   1440 C  C     . GLY A 1 175 ? -4.067  41.429  51.588  1.00 34.46 ? 175  GLY A C     1 
ATOM   1441 O  O     . GLY A 1 175 ? -2.881  41.171  51.392  1.00 34.99 ? 175  GLY A O     1 
ATOM   1442 N  N     . ASP A 1 176 ? -5.042  40.602  51.240  1.00 35.09 ? 176  ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 176 ? -4.737  39.294  50.661  1.00 35.09 ? 176  ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 176 ? -4.976  39.223  49.158  1.00 36.08 ? 176  ASP A C     1 
ATOM   1445 O  O     . ASP A 1 176 ? -4.632  38.219  48.527  1.00 35.20 ? 176  ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 176 ? -5.539  38.197  51.369  1.00 35.03 ? 176  ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 176 ? -5.368  38.228  52.883  1.00 33.39 ? 176  ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 176 ? -4.216  38.384  53.353  1.00 32.36 ? 176  ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 176 ? -6.389  38.088  53.596  1.00 30.10 ? 176  ASP A OD2   1 
ATOM   1450 N  N     . GLU A 1 177 ? -5.569  40.277  48.593  1.00 36.15 ? 177  GLU A N     1 
ATOM   1451 C  CA    . GLU A 1 177 ? -5.934  40.303  47.173  1.00 39.68 ? 177  GLU A CA    1 
ATOM   1452 C  C     . GLU A 1 177 ? -6.701  39.063  46.749  1.00 36.88 ? 177  GLU A C     1 
ATOM   1453 O  O     . GLU A 1 177 ? -6.353  38.429  45.760  1.00 37.03 ? 177  GLU A O     1 
ATOM   1454 C  CB    . GLU A 1 177 ? -4.695  40.464  46.271  1.00 42.46 ? 177  GLU A CB    1 
ATOM   1455 C  CG    . GLU A 1 177 ? -4.444  41.873  45.773  1.00 49.49 ? 177  GLU A CG    1 
ATOM   1456 C  CD    . GLU A 1 177 ? -3.034  42.052  45.226  1.00 56.01 ? 177  GLU A CD    1 
ATOM   1457 O  OE1   . GLU A 1 177 ? -2.663  41.339  44.267  1.00 56.29 ? 177  GLU A OE1   1 
ATOM   1458 O  OE2   . GLU A 1 177 ? -2.294  42.908  45.757  1.00 58.97 ? 177  GLU A OE2   1 
ATOM   1459 N  N     . VAL A 1 178 ? -7.722  38.693  47.513  1.00 35.90 ? 178  VAL A N     1 
ATOM   1460 C  CA    . VAL A 1 178 ? -8.706  37.750  47.010  1.00 32.56 ? 178  VAL A CA    1 
ATOM   1461 C  C     . VAL A 1 178 ? -9.352  38.466  45.818  1.00 32.97 ? 178  VAL A C     1 
ATOM   1462 O  O     . VAL A 1 178 ? -9.782  39.616  45.965  1.00 32.60 ? 178  VAL A O     1 
ATOM   1463 C  CB    . VAL A 1 178 ? -9.740  37.355  48.094  1.00 32.18 ? 178  VAL A CB    1 
ATOM   1464 C  CG1   . VAL A 1 178 ? -10.884 36.549  47.489  1.00 26.43 ? 178  VAL A CG1   1 
ATOM   1465 C  CG2   . VAL A 1 178 ? -9.062  36.551  49.206  1.00 28.10 ? 178  VAL A CG2   1 
ATOM   1466 N  N     . PRO A 1 179 ? -9.373  37.814  44.628  1.00 32.53 ? 179  PRO A N     1 
ATOM   1467 C  CA    . PRO A 1 179 ? -9.881  38.450  43.409  1.00 32.23 ? 179  PRO A CA    1 
ATOM   1468 C  C     . PRO A 1 179 ? -11.266 39.034  43.615  1.00 33.64 ? 179  PRO A C     1 
ATOM   1469 O  O     . PRO A 1 179 ? -12.144 38.361  44.163  1.00 34.70 ? 179  PRO A O     1 
ATOM   1470 C  CB    . PRO A 1 179 ? -9.944  37.295  42.406  1.00 31.26 ? 179  PRO A CB    1 
ATOM   1471 C  CG    . PRO A 1 179 ? -8.911  36.343  42.854  1.00 32.59 ? 179  PRO A CG    1 
ATOM   1472 C  CD    . PRO A 1 179 ? -8.878  36.447  44.363  1.00 30.98 ? 179  PRO A CD    1 
ATOM   1473 N  N     . SER A 1 180 ? -11.449 40.279  43.184  1.00 33.90 ? 180  SER A N     1 
ATOM   1474 C  CA    . SER A 1 180 ? -12.700 41.018  43.398  1.00 35.14 ? 180  SER A CA    1 
ATOM   1475 C  C     . SER A 1 180 ? -13.931 40.377  42.756  1.00 35.40 ? 180  SER A C     1 
ATOM   1476 O  O     . SER A 1 180 ? -15.057 40.602  43.215  1.00 37.26 ? 180  SER A O     1 
ATOM   1477 C  CB    . SER A 1 180 ? -12.560 42.457  42.901  1.00 36.86 ? 180  SER A CB    1 
ATOM   1478 O  OG    . SER A 1 180 ? -12.049 42.466  41.586  1.00 38.92 ? 180  SER A OG    1 
ATOM   1479 N  N     . GLU A 1 181 ? -13.729 39.579  41.709  1.00 32.20 ? 181  GLU A N     1 
ATOM   1480 C  CA    . GLU A 1 181 ? -14.861 38.932  41.041  1.00 33.00 ? 181  GLU A CA    1 
ATOM   1481 C  C     . GLU A 1 181 ? -15.505 37.787  41.855  1.00 33.30 ? 181  GLU A C     1 
ATOM   1482 O  O     . GLU A 1 181 ? -16.576 37.292  41.486  1.00 36.74 ? 181  GLU A O     1 
ATOM   1483 C  CB    . GLU A 1 181 ? -14.481 38.458  39.628  1.00 33.34 ? 181  GLU A CB    1 
ATOM   1484 C  CG    . GLU A 1 181 ? -13.539 37.249  39.584  1.00 30.98 ? 181  GLU A CG    1 
ATOM   1485 C  CD    . GLU A 1 181 ? -12.062 37.628  39.493  1.00 34.88 ? 181  GLU A CD    1 
ATOM   1486 O  OE1   . GLU A 1 181 ? -11.698 38.789  39.804  1.00 32.25 ? 181  GLU A OE1   1 
ATOM   1487 O  OE2   . GLU A 1 181 ? -11.257 36.746  39.102  1.00 38.29 ? 181  GLU A OE2   1 
ATOM   1488 N  N     . ILE A 1 182 ? -14.858 37.362  42.941  1.00 30.65 ? 182  ILE A N     1 
ATOM   1489 C  CA    . ILE A 1 182 ? -15.436 36.342  43.822  1.00 30.13 ? 182  ILE A CA    1 
ATOM   1490 C  C     . ILE A 1 182 ? -15.799 36.853  45.222  1.00 29.38 ? 182  ILE A C     1 
ATOM   1491 O  O     . ILE A 1 182 ? -16.380 36.114  46.017  1.00 29.70 ? 182  ILE A O     1 
ATOM   1492 C  CB    . ILE A 1 182 ? -14.539 35.049  43.952  1.00 29.55 ? 182  ILE A CB    1 
ATOM   1493 C  CG1   . ILE A 1 182 ? -13.257 35.338  44.734  1.00 29.46 ? 182  ILE A CG1   1 
ATOM   1494 C  CG2   . ILE A 1 182 ? -14.236 34.431  42.587  1.00 28.74 ? 182  ILE A CG2   1 
ATOM   1495 C  CD1   . ILE A 1 182 ? -12.536 34.079  45.213  1.00 29.11 ? 182  ILE A CD1   1 
ATOM   1496 N  N     . ILE A 1 183 ? -15.452 38.104  45.524  1.00 30.35 ? 183  ILE A N     1 
ATOM   1497 C  CA    . ILE A 1 183 ? -15.715 38.686  46.842  1.00 30.45 ? 183  ILE A CA    1 
ATOM   1498 C  C     . ILE A 1 183 ? -17.193 38.619  47.240  1.00 30.91 ? 183  ILE A C     1 
ATOM   1499 O  O     . ILE A 1 183 ? -17.519 38.229  48.360  1.00 33.05 ? 183  ILE A O     1 
ATOM   1500 C  CB    . ILE A 1 183 ? -15.206 40.154  46.932  1.00 34.67 ? 183  ILE A CB    1 
ATOM   1501 C  CG1   . ILE A 1 183 ? -13.672 40.191  46.986  1.00 33.75 ? 183  ILE A CG1   1 
ATOM   1502 C  CG2   . ILE A 1 183 ? -15.854 40.904  48.132  1.00 33.26 ? 183  ILE A CG2   1 
ATOM   1503 C  CD1   . ILE A 1 183 ? -13.055 39.423  48.161  1.00 34.56 ? 183  ILE A CD1   1 
ATOM   1504 N  N     . ASP A 1 184 ? -18.078 38.989  46.321  1.00 31.54 ? 184  ASP A N     1 
ATOM   1505 C  CA    . ASP A 1 184 ? -19.524 38.972  46.575  1.00 32.34 ? 184  ASP A CA    1 
ATOM   1506 C  C     . ASP A 1 184 ? -20.080 37.544  46.600  1.00 30.96 ? 184  ASP A C     1 
ATOM   1507 O  O     . ASP A 1 184 ? -21.258 37.330  46.885  1.00 31.06 ? 184  ASP A O     1 
ATOM   1508 C  CB    . ASP A 1 184 ? -20.268 39.800  45.519  1.00 36.49 ? 184  ASP A CB    1 
ATOM   1509 C  CG    . ASP A 1 184 ? -19.825 41.266  45.489  1.00 42.93 ? 184  ASP A CG    1 
ATOM   1510 O  OD1   . ASP A 1 184 ? -19.512 41.828  46.556  1.00 47.62 ? 184  ASP A OD1   1 
ATOM   1511 O  OD2   . ASP A 1 184 ? -19.798 41.859  44.389  1.00 48.48 ? 184  ASP A OD2   1 
ATOM   1512 N  N     . LYS A 1 185 ? -19.226 36.567  46.321  1.00 28.06 ? 185  LYS A N     1 
ATOM   1513 C  CA    . LYS A 1 185 ? -19.673 35.190  46.186  1.00 27.75 ? 185  LYS A CA    1 
ATOM   1514 C  C     . LYS A 1 185 ? -19.258 34.355  47.396  1.00 28.23 ? 185  LYS A C     1 
ATOM   1515 O  O     . LYS A 1 185 ? -19.472 33.146  47.432  1.00 29.34 ? 185  LYS A O     1 
ATOM   1516 C  CB    . LYS A 1 185 ? -19.139 34.590  44.879  1.00 27.07 ? 185  LYS A CB    1 
ATOM   1517 C  CG    . LYS A 1 185 ? -19.674 35.250  43.602  1.00 26.33 ? 185  LYS A CG    1 
ATOM   1518 C  CD    . LYS A 1 185 ? -19.251 34.449  42.357  1.00 27.19 ? 185  LYS A CD    1 
ATOM   1519 C  CE    . LYS A 1 185 ? -19.689 35.129  41.052  1.00 29.38 ? 185  LYS A CE    1 
ATOM   1520 N  NZ    . LYS A 1 185 ? -19.332 34.295  39.846  1.00 27.83 ? 185  LYS A NZ    1 
ATOM   1521 N  N     . ILE A 1 186 ? -18.672 35.014  48.392  1.00 30.05 ? 186  ILE A N     1 
ATOM   1522 C  CA    . ILE A 1 186 ? -18.230 34.340  49.608  1.00 29.45 ? 186  ILE A CA    1 
ATOM   1523 C  C     . ILE A 1 186 ? -19.300 34.400  50.697  1.00 30.74 ? 186  ILE A C     1 
ATOM   1524 O  O     . ILE A 1 186 ? -19.801 35.474  51.056  1.00 28.05 ? 186  ILE A O     1 
ATOM   1525 C  CB    . ILE A 1 186 ? -16.877 34.910  50.130  1.00 31.23 ? 186  ILE A CB    1 
ATOM   1526 C  CG1   . ILE A 1 186 ? -15.765 34.646  49.109  1.00 28.74 ? 186  ILE A CG1   1 
ATOM   1527 C  CG2   . ILE A 1 186 ? -16.503 34.279  51.470  1.00 29.77 ? 186  ILE A CG2   1 
ATOM   1528 C  CD1   . ILE A 1 186 ? -14.542 35.520  49.292  1.00 28.54 ? 186  ILE A CD1   1 
ATOM   1529 N  N     . ILE A 1 187 ? -19.661 33.228  51.207  1.00 30.78 ? 187  ILE A N     1 
ATOM   1530 C  CA    . ILE A 1 187 ? -20.567 33.141  52.342  1.00 30.25 ? 187  ILE A CA    1 
ATOM   1531 C  C     . ILE A 1 187 ? -19.744 32.580  53.486  1.00 30.45 ? 187  ILE A C     1 
ATOM   1532 O  O     . ILE A 1 187 ? -19.331 31.412  53.456  1.00 28.50 ? 187  ILE A O     1 
ATOM   1533 C  CB    . ILE A 1 187 ? -21.808 32.291  52.015  1.00 31.05 ? 187  ILE A CB    1 
ATOM   1534 C  CG1   . ILE A 1 187 ? -22.678 33.032  50.986  1.00 30.84 ? 187  ILE A CG1   1 
ATOM   1535 C  CG2   . ILE A 1 187 ? -22.600 31.977  53.293  1.00 28.04 ? 187  ILE A CG2   1 
ATOM   1536 C  CD1   . ILE A 1 187 ? -23.832 32.210  50.411  1.00 34.88 ? 187  ILE A CD1   1 
ATOM   1537 N  N     . TYR A 1 188 ? -19.473 33.443  54.464  1.00 28.20 ? 188  TYR A N     1 
ATOM   1538 C  CA    . TYR A 1 188 ? -18.497 33.170  55.518  1.00 28.35 ? 188  TYR A CA    1 
ATOM   1539 C  C     . TYR A 1 188 ? -19.160 32.711  56.818  1.00 29.80 ? 188  TYR A C     1 
ATOM   1540 O  O     . TYR A 1 188 ? -20.043 33.393  57.332  1.00 30.53 ? 188  TYR A O     1 
ATOM   1541 C  CB    . TYR A 1 188 ? -17.627 34.420  55.763  1.00 30.05 ? 188  TYR A CB    1 
ATOM   1542 C  CG    . TYR A 1 188 ? -16.703 34.316  56.964  1.00 29.01 ? 188  TYR A CG    1 
ATOM   1543 C  CD1   . TYR A 1 188 ? -15.637 33.407  56.977  1.00 25.42 ? 188  TYR A CD1   1 
ATOM   1544 C  CD2   . TYR A 1 188 ? -16.897 35.122  58.092  1.00 29.85 ? 188  TYR A CD2   1 
ATOM   1545 C  CE1   . TYR A 1 188 ? -14.795 33.302  58.076  1.00 23.61 ? 188  TYR A CE1   1 
ATOM   1546 C  CE2   . TYR A 1 188 ? -16.048 35.025  59.207  1.00 27.63 ? 188  TYR A CE2   1 
ATOM   1547 C  CZ    . TYR A 1 188 ? -15.005 34.109  59.192  1.00 26.52 ? 188  TYR A CZ    1 
ATOM   1548 O  OH    . TYR A 1 188 ? -14.160 34.011  60.282  1.00 26.64 ? 188  TYR A OH    1 
ATOM   1549 N  N     . MET A 1 189 ? -18.722 31.566  57.345  1.00 28.93 ? 189  MET A N     1 
ATOM   1550 C  CA    . MET A 1 189 ? -19.270 31.004  58.587  1.00 30.78 ? 189  MET A CA    1 
ATOM   1551 C  C     . MET A 1 189 ? -18.174 30.646  59.606  1.00 31.57 ? 189  MET A C     1 
ATOM   1552 O  O     . MET A 1 189 ? -17.502 29.611  59.464  1.00 30.26 ? 189  MET A O     1 
ATOM   1553 C  CB    . MET A 1 189 ? -20.126 29.770  58.285  1.00 31.92 ? 189  MET A CB    1 
ATOM   1554 C  CG    . MET A 1 189 ? -21.291 30.045  57.344  1.00 36.25 ? 189  MET A CG    1 
ATOM   1555 S  SD    . MET A 1 189 ? -21.887 28.576  56.499  1.00 40.25 ? 189  MET A SD    1 
ATOM   1556 C  CE    . MET A 1 189 ? -20.631 28.357  55.227  1.00 34.98 ? 189  MET A CE    1 
ATOM   1557 N  N     . PRO A 1 190 ? -17.979 31.506  60.628  1.00 31.08 ? 190  PRO A N     1 
ATOM   1558 C  CA    . PRO A 1 190 ? -17.043 31.184  61.703  1.00 32.25 ? 190  PRO A CA    1 
ATOM   1559 C  C     . PRO A 1 190 ? -17.682 30.261  62.744  1.00 33.11 ? 190  PRO A C     1 
ATOM   1560 O  O     . PRO A 1 190 ? -18.887 30.327  62.963  1.00 33.37 ? 190  PRO A O     1 
ATOM   1561 C  CB    . PRO A 1 190 ? -16.706 32.555  62.307  1.00 31.41 ? 190  PRO A CB    1 
ATOM   1562 C  CG    . PRO A 1 190 ? -17.852 33.439  61.957  1.00 33.44 ? 190  PRO A CG    1 
ATOM   1563 C  CD    . PRO A 1 190 ? -18.606 32.833  60.807  1.00 33.18 ? 190  PRO A CD    1 
ATOM   1564 N  N     . PHE A 1 191 ? -16.880 29.387  63.348  1.00 32.49 ? 191  PHE A N     1 
ATOM   1565 C  CA    . PHE A 1 191 ? -17.369 28.445  64.345  1.00 33.23 ? 191  PHE A CA    1 
ATOM   1566 C  C     . PHE A 1 191 ? -16.493 28.498  65.582  1.00 35.53 ? 191  PHE A C     1 
ATOM   1567 O  O     . PHE A 1 191 ? -15.271 28.669  65.489  1.00 34.35 ? 191  PHE A O     1 
ATOM   1568 C  CB    . PHE A 1 191 ? -17.422 27.010  63.794  1.00 32.95 ? 191  PHE A CB    1 
ATOM   1569 C  CG    . PHE A 1 191 ? -18.467 26.811  62.736  1.00 30.78 ? 191  PHE A CG    1 
ATOM   1570 C  CD1   . PHE A 1 191 ? -18.158 27.012  61.389  1.00 27.23 ? 191  PHE A CD1   1 
ATOM   1571 C  CD2   . PHE A 1 191 ? -19.770 26.458  63.087  1.00 30.21 ? 191  PHE A CD2   1 
ATOM   1572 C  CE1   . PHE A 1 191 ? -19.126 26.854  60.394  1.00 27.88 ? 191  PHE A CE1   1 
ATOM   1573 C  CE2   . PHE A 1 191 ? -20.759 26.296  62.101  1.00 32.68 ? 191  PHE A CE2   1 
ATOM   1574 C  CZ    . PHE A 1 191 ? -20.432 26.491  60.746  1.00 30.52 ? 191  PHE A CZ    1 
ATOM   1575 N  N     . ASP A 1 192 ? -17.121 28.348  66.742  1.00 37.23 ? 192  ASP A N     1 
ATOM   1576 C  CA    . ASP A 1 192 ? -16.390 28.441  67.991  1.00 39.78 ? 192  ASP A CA    1 
ATOM   1577 C  C     . ASP A 1 192 ? -15.724 27.130  68.399  1.00 37.37 ? 192  ASP A C     1 
ATOM   1578 O  O     . ASP A 1 192 ? -14.804 27.125  69.214  1.00 38.07 ? 192  ASP A O     1 
ATOM   1579 C  CB    . ASP A 1 192 ? -17.270 29.053  69.084  1.00 43.93 ? 192  ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1 192 ? -17.417 30.568  68.919  1.00 51.80 ? 192  ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1 192 ? -17.250 31.067  67.779  1.00 55.97 ? 192  ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1 192 ? -17.681 31.267  69.920  1.00 56.29 ? 192  ASP A OD2   1 
ATOM   1583 N  N     . ASN A 1 193 ? -16.169 26.026  67.804  1.00 34.44 ? 193  ASN A N     1 
ATOM   1584 C  CA    . ASN A 1 193 ? -15.524 24.723  68.010  1.00 33.94 ? 193  ASN A CA    1 
ATOM   1585 C  C     . ASN A 1 193 ? -15.645 23.800  66.792  1.00 30.99 ? 193  ASN A C     1 
ATOM   1586 O  O     . ASN A 1 193 ? -16.492 24.014  65.933  1.00 30.29 ? 193  ASN A O     1 
ATOM   1587 C  CB    . ASN A 1 193 ? -16.022 24.049  69.303  1.00 35.92 ? 193  ASN A CB    1 
ATOM   1588 C  CG    . ASN A 1 193 ? -17.523 23.745  69.281  1.00 38.07 ? 193  ASN A CG    1 
ATOM   1589 O  OD1   . ASN A 1 193 ? -17.977 22.807  68.620  1.00 37.03 ? 193  ASN A OD1   1 
ATOM   1590 N  ND2   . ASN A 1 193 ? -18.289 24.526  70.025  1.00 38.00 ? 193  ASN A ND2   1 
ATOM   1591 N  N     . GLU A 1 194 ? -14.783 22.787  66.717  1.00 30.22 ? 194  GLU A N     1 
ATOM   1592 C  CA    . GLU A 1 194 ? -14.726 21.890  65.564  1.00 31.96 ? 194  GLU A CA    1 
ATOM   1593 C  C     . GLU A 1 194 ? -15.986 21.031  65.381  1.00 31.31 ? 194  GLU A C     1 
ATOM   1594 O  O     . GLU A 1 194 ? -16.398 20.757  64.259  1.00 30.60 ? 194  GLU A O     1 
ATOM   1595 C  CB    . GLU A 1 194 ? -13.467 21.004  65.632  1.00 30.87 ? 194  GLU A CB    1 
ATOM   1596 C  CG    . GLU A 1 194 ? -13.235 20.156  64.394  1.00 31.27 ? 194  GLU A CG    1 
ATOM   1597 C  CD    . GLU A 1 194 ? -12.188 19.070  64.598  1.00 37.45 ? 194  GLU A CD    1 
ATOM   1598 O  OE1   . GLU A 1 194 ? -11.708 18.506  63.589  1.00 33.10 ? 194  GLU A OE1   1 
ATOM   1599 O  OE2   . GLU A 1 194 ? -11.840 18.782  65.765  1.00 39.08 ? 194  GLU A OE2   1 
ATOM   1600 N  N     . LYS A 1 195 ? -16.596 20.600  66.479  1.00 33.51 ? 195  LYS A N     1 
ATOM   1601 C  CA    . LYS A 1 195 ? -17.785 19.760  66.378  1.00 33.79 ? 195  LYS A CA    1 
ATOM   1602 C  C     . LYS A 1 195 ? -18.932 20.489  65.685  1.00 33.72 ? 195  LYS A C     1 
ATOM   1603 O  O     . LYS A 1 195 ? -19.575 19.929  64.801  1.00 34.60 ? 195  LYS A O     1 
ATOM   1604 C  CB    . LYS A 1 195 ? -18.206 19.233  67.746  1.00 34.58 ? 195  LYS A CB    1 
ATOM   1605 C  CG    . LYS A 1 195 ? -17.323 18.121  68.267  1.00 36.61 ? 195  LYS A CG    1 
ATOM   1606 C  CD    . LYS A 1 195 ? -17.672 17.790  69.712  1.00 43.30 ? 195  LYS A CD    1 
ATOM   1607 C  CE    . LYS A 1 195 ? -16.815 16.657  70.246  1.00 46.24 ? 195  LYS A CE    1 
ATOM   1608 N  NZ    . LYS A 1 195 ? -16.943 16.531  71.717  1.00 50.99 ? 195  LYS A NZ    1 
ATOM   1609 N  N     . GLU A 1 196 ? -19.175 21.739  66.075  1.00 33.96 ? 196  GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 196 ? -20.188 22.546  65.407  1.00 35.87 ? 196  GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 196 ? -19.866 22.743  63.929  1.00 32.34 ? 196  GLU A C     1 
ATOM   1612 O  O     . GLU A 1 196 ? -20.746 22.579  63.083  1.00 31.97 ? 196  GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 196 ? -20.406 23.883  66.117  1.00 39.64 ? 196  GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 196 ? -21.600 23.840  67.066  1.00 47.65 ? 196  GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 196 ? -21.409 24.701  68.301  1.00 54.43 ? 196  GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 196 ? -21.168 25.923  68.161  1.00 57.52 ? 196  GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 196 ? -21.514 24.147  69.417  1.00 57.53 ? 196  GLU A OE2   1 
ATOM   1618 N  N     . LEU A 1 197 ? -18.613 23.081  63.624  1.00 28.59 ? 197  LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 197 ? -18.171 23.222  62.234  1.00 27.49 ? 197  LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 197 ? -18.508 21.960  61.409  1.00 26.14 ? 197  LEU A C     1 
ATOM   1621 O  O     . LEU A 1 197 ? -19.127 22.051  60.352  1.00 24.42 ? 197  LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 197 ? -16.671 23.546  62.171  1.00 26.26 ? 197  LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 197 ? -16.027 23.884  60.818  1.00 24.13 ? 197  LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 197 ? -14.728 24.665  61.011  1.00 24.61 ? 197  LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 197 ? -15.758 22.637  59.993  1.00 23.18 ? 197  LEU A CD2   1 
ATOM   1626 N  N     . LEU A 1 198 ? -18.124 20.792  61.912  1.00 27.44 ? 198  LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 198 ? -18.340 19.546  61.184  1.00 28.60 ? 198  LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 198 ? -19.810 19.129  61.072  1.00 30.42 ? 198  LEU A C     1 
ATOM   1629 O  O     . LEU A 1 198 ? -20.218 18.621  60.029  1.00 30.21 ? 198  LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 198 ? -17.492 18.419  61.770  1.00 29.35 ? 198  LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 198 ? -15.982 18.641  61.620  1.00 30.71 ? 198  LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 198 ? -15.222 17.617  62.413  1.00 25.28 ? 198  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 198 ? -15.572 18.597  60.165  1.00 28.52 ? 198  LEU A CD2   1 
ATOM   1634 N  N     . MET A 1 199 ? -20.594 19.333  62.132  1.00 30.44 ? 199  MET A N     1 
ATOM   1635 C  CA    . MET A 1 199 ? -22.035 19.013  62.095  1.00 32.24 ? 199  MET A CA    1 
ATOM   1636 C  C     . MET A 1 199 ? -22.777 19.919  61.111  1.00 31.91 ? 199  MET A C     1 
ATOM   1637 O  O     . MET A 1 199 ? -23.647 19.466  60.364  1.00 31.28 ? 199  MET A O     1 
ATOM   1638 C  CB    . MET A 1 199 ? -22.678 19.107  63.490  1.00 35.12 ? 199  MET A CB    1 
ATOM   1639 C  CG    . MET A 1 199 ? -22.330 17.954  64.441  1.00 34.85 ? 199  MET A CG    1 
ATOM   1640 S  SD    . MET A 1 199 ? -23.187 18.046  66.037  1.00 39.38 ? 199  MET A SD    1 
ATOM   1641 C  CE    . MET A 1 199 ? -22.573 19.581  66.726  1.00 35.37 ? 199  MET A CE    1 
ATOM   1642 N  N     . GLU A 1 200 ? -22.412 21.197  61.102  1.00 31.86 ? 200  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 200 ? -22.990 22.146  60.160  1.00 33.34 ? 200  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 200 ? -22.536 21.858  58.713  1.00 32.07 ? 200  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 200 ? -23.334 21.986  57.773  1.00 31.74 ? 200  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 200 ? -22.681 23.584  60.592  1.00 35.91 ? 200  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 200 ? -23.279 24.683  59.704  1.00 44.58 ? 200  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 200 ? -24.795 24.591  59.545  1.00 51.71 ? 200  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 200 ? -25.501 24.362  60.554  1.00 49.95 ? 200  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 200 ? -25.277 24.757  58.396  1.00 55.22 ? 200  GLU A OE2   1 
ATOM   1651 N  N     . TYR A 1 201 ? -21.279 21.453  58.535  1.00 28.07 ? 201  TYR A N     1 
ATOM   1652 C  CA    . TYR A 1 201 ? -20.800 21.039  57.207  1.00 27.15 ? 201  TYR A CA    1 
ATOM   1653 C  C     . TYR A 1 201 ? -21.594 19.852  56.657  1.00 26.66 ? 201  TYR A C     1 
ATOM   1654 O  O     . TYR A 1 201 ? -21.953 19.835  55.478  1.00 27.86 ? 201  TYR A O     1 
ATOM   1655 C  CB    . TYR A 1 201 ? -19.304 20.715  57.222  1.00 26.36 ? 201  TYR A CB    1 
ATOM   1656 C  CG    . TYR A 1 201 ? -18.717 20.450  55.842  1.00 28.02 ? 201  TYR A CG    1 
ATOM   1657 C  CD1   . TYR A 1 201 ? -18.661 21.458  54.882  1.00 27.43 ? 201  TYR A CD1   1 
ATOM   1658 C  CD2   . TYR A 1 201 ? -18.205 19.184  55.501  1.00 30.89 ? 201  TYR A CD2   1 
ATOM   1659 C  CE1   . TYR A 1 201 ? -18.119 21.224  53.610  1.00 27.81 ? 201  TYR A CE1   1 
ATOM   1660 C  CE2   . TYR A 1 201 ? -17.647 18.937  54.222  1.00 24.58 ? 201  TYR A CE2   1 
ATOM   1661 C  CZ    . TYR A 1 201 ? -17.611 19.965  53.287  1.00 27.70 ? 201  TYR A CZ    1 
ATOM   1662 O  OH    . TYR A 1 201 ? -17.077 19.754  52.030  1.00 25.27 ? 201  TYR A OH    1 
ATOM   1663 N  N     . LEU A 1 202 ? -21.871 18.869  57.511  1.00 24.75 ? 202  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1 202 ? -22.658 17.711  57.103  1.00 25.78 ? 202  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1 202 ? -24.128 18.058  56.819  1.00 26.61 ? 202  LEU A C     1 
ATOM   1666 O  O     . LEU A 1 202 ? -24.732 17.484  55.914  1.00 27.50 ? 202  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1 202 ? -22.566 16.596  58.146  1.00 26.03 ? 202  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1 202 ? -21.239 15.846  58.305  1.00 30.52 ? 202  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1 202 ? -21.293 14.999  59.548  1.00 28.51 ? 202  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1 202 ? -20.908 14.977  57.101  1.00 29.40 ? 202  LEU A CD2   1 
ATOM   1671 N  N     . ASN A 1 203 ? -24.706 18.985  57.587  1.00 26.19 ? 203  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 203 ? -26.068 19.447  57.292  1.00 27.60 ? 203  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 203 ? -26.130 20.175  55.951  1.00 27.13 ? 203  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 203 ? -27.063 19.984  55.166  1.00 26.75 ? 203  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 203 ? -26.623 20.316  58.421  1.00 27.31 ? 203  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 203 ? -26.989 19.499  59.651  1.00 27.88 ? 203  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 203 ? -26.920 19.987  60.768  1.00 32.87 ? 203  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 203 ? -27.366 18.252  59.445  1.00 28.54 ? 203  ASN A ND2   1 
ATOM   1679 N  N     . PHE A 1 204 ? -25.108 20.985  55.702  1.00 27.61 ? 204  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 204 ? -24.922 21.689  54.441  1.00 28.14 ? 204  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 204 ? -24.780 20.671  53.295  1.00 27.62 ? 204  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 204 ? -25.454 20.776  52.273  1.00 30.75 ? 204  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 204 ? -23.691 22.604  54.587  1.00 25.94 ? 204  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 204 ? -23.037 23.000  53.295  1.00 26.70 ? 204  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 204 ? -23.427 24.159  52.632  1.00 26.93 ? 204  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 204 ? -21.987 22.245  52.767  1.00 26.32 ? 204  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 204 ? -22.804 24.544  51.447  1.00 28.75 ? 204  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 204 ? -21.358 22.625  51.579  1.00 25.38 ? 204  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 204 ? -21.769 23.777  50.920  1.00 24.91 ? 204  PHE A CZ    1 
ATOM   1690 N  N     . TRP A 1 205 ? -23.931 19.670  53.494  1.00 27.22 ? 205  TRP A N     1 
ATOM   1691 C  CA    . TRP A 1 205 ? -23.668 18.628  52.492  1.00 26.29 ? 205  TRP A CA    1 
ATOM   1692 C  C     . TRP A 1 205 ? -24.949 17.879  52.119  1.00 28.44 ? 205  TRP A C     1 
ATOM   1693 O  O     . TRP A 1 205 ? -25.140 17.495  50.957  1.00 25.43 ? 205  TRP A O     1 
ATOM   1694 C  CB    . TRP A 1 205 ? -22.613 17.673  53.047  1.00 25.41 ? 205  TRP A CB    1 
ATOM   1695 C  CG    . TRP A 1 205 ? -22.057 16.594  52.139  1.00 25.77 ? 205  TRP A CG    1 
ATOM   1696 C  CD1   . TRP A 1 205 ? -22.640 15.398  51.832  1.00 26.04 ? 205  TRP A CD1   1 
ATOM   1697 C  CD2   . TRP A 1 205 ? -20.767 16.580  51.507  1.00 24.29 ? 205  TRP A CD2   1 
ATOM   1698 N  NE1   . TRP A 1 205 ? -21.805 14.649  51.031  1.00 23.42 ? 205  TRP A NE1   1 
ATOM   1699 C  CE2   . TRP A 1 205 ? -20.650 15.354  50.816  1.00 23.82 ? 205  TRP A CE2   1 
ATOM   1700 C  CE3   . TRP A 1 205 ? -19.699 17.485  51.457  1.00 25.18 ? 205  TRP A CE3   1 
ATOM   1701 C  CZ2   . TRP A 1 205 ? -19.508 15.011  50.080  1.00 24.34 ? 205  TRP A CZ2   1 
ATOM   1702 C  CZ3   . TRP A 1 205 ? -18.568 17.147  50.720  1.00 23.78 ? 205  TRP A CZ3   1 
ATOM   1703 C  CH2   . TRP A 1 205 ? -18.483 15.919  50.044  1.00 27.17 ? 205  TRP A CH2   1 
ATOM   1704 N  N     . GLN A 1 206 ? -25.821 17.685  53.112  1.00 30.60 ? 206  GLN A N     1 
ATOM   1705 C  CA    . GLN A 1 206 ? -27.131 17.068  52.905  1.00 33.76 ? 206  GLN A CA    1 
ATOM   1706 C  C     . GLN A 1 206 ? -28.045 17.940  52.036  1.00 33.09 ? 206  GLN A C     1 
ATOM   1707 O  O     . GLN A 1 206 ? -28.753 17.423  51.184  1.00 33.16 ? 206  GLN A O     1 
ATOM   1708 C  CB    . GLN A 1 206 ? -27.802 16.741  54.246  1.00 37.11 ? 206  GLN A CB    1 
ATOM   1709 C  CG    . GLN A 1 206 ? -29.026 15.829  54.125  1.00 46.90 ? 206  GLN A CG    1 
ATOM   1710 C  CD    . GLN A 1 206 ? -29.203 14.901  55.321  1.00 55.74 ? 206  GLN A CD    1 
ATOM   1711 O  OE1   . GLN A 1 206 ? -28.244 14.599  56.044  1.00 60.63 ? 206  GLN A OE1   1 
ATOM   1712 N  NE2   . GLN A 1 206 ? -30.431 14.429  55.525  1.00 57.30 ? 206  GLN A NE2   1 
ATOM   1713 N  N     . GLN A 1 207 ? -28.017 19.253  52.245  1.00 32.53 ? 207  GLN A N     1 
ATOM   1714 C  CA    . GLN A 1 207 ? -28.836 20.161  51.448  1.00 34.51 ? 207  GLN A CA    1 
ATOM   1715 C  C     . GLN A 1 207 ? -28.258 20.368  50.051  1.00 33.54 ? 207  GLN A C     1 
ATOM   1716 O  O     . GLN A 1 207 ? -29.001 20.610  49.107  1.00 35.75 ? 207  GLN A O     1 
ATOM   1717 C  CB    . GLN A 1 207 ? -29.005 21.512  52.145  1.00 36.44 ? 207  GLN A CB    1 
ATOM   1718 C  CG    . GLN A 1 207 ? -29.883 21.475  53.388  1.00 45.41 ? 207  GLN A CG    1 
ATOM   1719 C  CD    . GLN A 1 207 ? -31.316 21.002  53.110  1.00 53.37 ? 207  GLN A CD    1 
ATOM   1720 O  OE1   . GLN A 1 207 ? -32.066 21.643  52.362  1.00 54.40 ? 207  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN A 1 207 ? -31.702 19.882  53.730  1.00 53.24 ? 207  GLN A NE2   1 
ATOM   1722 N  N     . LYS A 1 208 ? -26.935 20.278  49.927  1.00 31.33 ? 208  LYS A N     1 
ATOM   1723 C  CA    . LYS A 1 208 ? -26.253 20.516  48.653  1.00 28.93 ? 208  LYS A CA    1 
ATOM   1724 C  C     . LYS A 1 208 ? -25.286 19.375  48.350  1.00 26.45 ? 208  LYS A C     1 
ATOM   1725 O  O     . LYS A 1 208 ? -24.081 19.583  48.285  1.00 30.54 ? 208  LYS A O     1 
ATOM   1726 C  CB    . LYS A 1 208 ? -25.513 21.857  48.698  1.00 26.50 ? 208  LYS A CB    1 
ATOM   1727 C  CG    . LYS A 1 208 ? -26.414 23.034  49.033  1.00 26.24 ? 208  LYS A CG    1 
ATOM   1728 C  CD    . LYS A 1 208 ? -25.650 24.343  49.151  1.00 28.85 ? 208  LYS A CD    1 
ATOM   1729 C  CE    . LYS A 1 208 ? -26.504 25.397  49.862  1.00 32.35 ? 208  LYS A CE    1 
ATOM   1730 N  NZ    . LYS A 1 208 ? -27.705 25.759  49.058  1.00 36.31 ? 208  LYS A NZ    1 
ATOM   1731 N  N     . THR A 1 209 ? -25.820 18.173  48.169  1.00 26.40 ? 209  THR A N     1 
ATOM   1732 C  CA    . THR A 1 209 ? -24.999 16.976  48.001  1.00 27.13 ? 209  THR A CA    1 
ATOM   1733 C  C     . THR A 1 209 ? -24.293 16.997  46.657  1.00 26.03 ? 209  THR A C     1 
ATOM   1734 O  O     . THR A 1 209 ? -24.938 17.044  45.616  1.00 25.51 ? 209  THR A O     1 
ATOM   1735 C  CB    . THR A 1 209 ? -25.829 15.675  48.139  1.00 29.45 ? 209  THR A CB    1 
ATOM   1736 O  OG1   . THR A 1 209 ? -26.633 15.745  49.319  1.00 30.37 ? 209  THR A OG1   1 
ATOM   1737 C  CG2   . THR A 1 209 ? -24.913 14.443  48.237  1.00 25.80 ? 209  THR A CG2   1 
ATOM   1738 N  N     . PRO A 1 210 ? -22.956 16.970  46.673  1.00 27.21 ? 210  PRO A N     1 
ATOM   1739 C  CA    . PRO A 1 210 ? -22.235 16.957  45.403  1.00 25.71 ? 210  PRO A CA    1 
ATOM   1740 C  C     . PRO A 1 210 ? -22.655 15.785  44.530  1.00 24.26 ? 210  PRO A C     1 
ATOM   1741 O  O     . PRO A 1 210 ? -23.021 14.732  45.038  1.00 26.05 ? 210  PRO A O     1 
ATOM   1742 C  CB    . PRO A 1 210 ? -20.777 16.806  45.836  1.00 22.49 ? 210  PRO A CB    1 
ATOM   1743 C  CG    . PRO A 1 210 ? -20.753 17.469  47.186  1.00 27.55 ? 210  PRO A CG    1 
ATOM   1744 C  CD    . PRO A 1 210 ? -22.038 17.057  47.825  1.00 26.32 ? 210  PRO A CD    1 
ATOM   1745 N  N     . VAL A 1 211 ? -22.630 15.989  43.221  1.00 23.84 ? 211  VAL A N     1 
ATOM   1746 C  CA    . VAL A 1 211 ? -22.791 14.895  42.280  1.00 21.98 ? 211  VAL A CA    1 
ATOM   1747 C  C     . VAL A 1 211 ? -21.386 14.593  41.811  1.00 22.48 ? 211  VAL A C     1 
ATOM   1748 O  O     . VAL A 1 211 ? -20.894 13.465  41.944  1.00 19.92 ? 211  VAL A O     1 
ATOM   1749 C  CB    . VAL A 1 211 ? -23.700 15.283  41.101  1.00 22.12 ? 211  VAL A CB    1 
ATOM   1750 C  CG1   . VAL A 1 211 ? -23.598 14.239  39.981  1.00 19.51 ? 211  VAL A CG1   1 
ATOM   1751 C  CG2   . VAL A 1 211 ? -25.140 15.418  41.583  1.00 13.72 ? 211  VAL A CG2   1 
ATOM   1752 N  N     . ILE A 1 212 ? -20.749 15.634  41.283  1.00 21.96 ? 212  ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 212 ? -19.348 15.616  40.924  1.00 20.88 ? 212  ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 212 ? -18.587 16.313  42.045  1.00 23.25 ? 212  ILE A C     1 
ATOM   1755 O  O     . ILE A 1 212 ? -18.913 17.449  42.427  1.00 24.25 ? 212  ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 212 ? -19.108 16.361  39.608  1.00 20.14 ? 212  ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 212 ? -19.979 15.779  38.489  1.00 20.90 ? 212  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 212 ? -17.612 16.376  39.243  1.00 19.69 ? 212  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 212 ? -19.605 14.344  38.040  1.00 18.57 ? 212  ILE A CD1   1 
ATOM   1760 N  N     . LEU A 1 213 ? -17.585 15.625  42.577  1.00 19.70 ? 213  LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 213 ? -16.782 16.167  43.664  1.00 21.74 ? 213  LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 213 ? -15.343 16.266  43.192  1.00 20.12 ? 213  LEU A C     1 
ATOM   1763 O  O     . LEU A 1 213 ? -14.777 15.289  42.734  1.00 21.38 ? 213  LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 213 ? -16.911 15.290  44.918  1.00 21.04 ? 213  LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 213 ? -16.242 15.771  46.222  1.00 27.23 ? 213  LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 213 ? -16.727 17.160  46.597  1.00 20.58 ? 213  LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 213 ? -16.449 14.773  47.400  1.00 19.23 ? 213  LEU A CD2   1 
ATOM   1768 N  N     . THR A 1 214 ? -14.772 17.462  43.259  1.00 21.28 ? 214  THR A N     1 
ATOM   1769 C  CA    . THR A 1 214 ? -13.422 17.679  42.761  1.00 20.71 ? 214  THR A CA    1 
ATOM   1770 C  C     . THR A 1 214 ? -12.666 18.608  43.702  1.00 20.73 ? 214  THR A C     1 
ATOM   1771 O  O     . THR A 1 214 ? -13.142 18.888  44.790  1.00 21.63 ? 214  THR A O     1 
ATOM   1772 C  CB    . THR A 1 214 ? -13.417 18.193  41.285  1.00 23.58 ? 214  THR A CB    1 
ATOM   1773 O  OG1   . THR A 1 214 ? -12.076 18.184  40.773  1.00 19.87 ? 214  THR A OG1   1 
ATOM   1774 C  CG2   . THR A 1 214 ? -14.000 19.606  41.169  1.00 18.79 ? 214  THR A CG2   1 
ATOM   1775 N  N     . GLY A 1 215 ? -11.492 19.068  43.276  1.00 22.26 ? 215  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 215 ? -10.570 19.849  44.103  1.00 24.06 ? 215  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 215 ? -9.160  19.351  43.814  1.00 25.90 ? 215  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 215 ? -8.947  18.642  42.830  1.00 25.64 ? 215  GLY A O     1 
ATOM   1779 N  N     . TRP A 1 216 ? -8.189  19.704  44.654  1.00 24.90 ? 216  TRP A N     1 
ATOM   1780 C  CA    . TRP A 1 216 ? -6.805  19.325  44.370  1.00 25.47 ? 216  TRP A CA    1 
ATOM   1781 C  C     . TRP A 1 216 ? -6.292  18.321  45.397  1.00 24.37 ? 216  TRP A C     1 
ATOM   1782 O  O     . TRP A 1 216 ? -6.202  18.630  46.582  1.00 25.93 ? 216  TRP A O     1 
ATOM   1783 C  CB    . TRP A 1 216 ? -5.908  20.564  44.293  1.00 24.80 ? 216  TRP A CB    1 
ATOM   1784 C  CG    . TRP A 1 216 ? -4.631  20.310  43.533  1.00 25.06 ? 216  TRP A CG    1 
ATOM   1785 C  CD1   . TRP A 1 216 ? -3.396  20.034  44.066  1.00 25.27 ? 216  TRP A CD1   1 
ATOM   1786 C  CD2   . TRP A 1 216 ? -4.460  20.306  42.105  1.00 24.73 ? 216  TRP A CD2   1 
ATOM   1787 N  NE1   . TRP A 1 216 ? -2.471  19.862  43.055  1.00 26.93 ? 216  TRP A NE1   1 
ATOM   1788 C  CE2   . TRP A 1 216 ? -3.095  20.021  41.847  1.00 25.20 ? 216  TRP A CE2   1 
ATOM   1789 C  CE3   . TRP A 1 216 ? -5.326  20.519  41.017  1.00 21.37 ? 216  TRP A CE3   1 
ATOM   1790 C  CZ2   . TRP A 1 216 ? -2.578  19.929  40.548  1.00 26.21 ? 216  TRP A CZ2   1 
ATOM   1791 C  CZ3   . TRP A 1 216 ? -4.810  20.438  39.726  1.00 22.67 ? 216  TRP A CZ3   1 
ATOM   1792 C  CH2   . TRP A 1 216 ? -3.444  20.142  39.504  1.00 25.05 ? 216  TRP A CH2   1 
ATOM   1793 N  N     . ASN A 1 217 ? -5.979  17.108  44.943  1.00 23.33 ? 217  ASN A N     1 
ATOM   1794 C  CA    . ASN A 1 217 ? -5.719  15.971  45.853  1.00 24.57 ? 217  ASN A CA    1 
ATOM   1795 C  C     . ASN A 1 217 ? -6.859  15.656  46.827  1.00 24.36 ? 217  ASN A C     1 
ATOM   1796 O  O     . ASN A 1 217 ? -6.607  15.214  47.950  1.00 26.42 ? 217  ASN A O     1 
ATOM   1797 C  CB    . ASN A 1 217 ? -4.421  16.170  46.650  1.00 24.39 ? 217  ASN A CB    1 
ATOM   1798 C  CG    . ASN A 1 217 ? -3.204  15.865  45.838  1.00 29.70 ? 217  ASN A CG    1 
ATOM   1799 O  OD1   . ASN A 1 217 ? -3.109  14.802  45.223  1.00 35.40 ? 217  ASN A OD1   1 
ATOM   1800 N  ND2   . ASN A 1 217 ? -2.258  16.791  45.820  1.00 28.47 ? 217  ASN A ND2   1 
ATOM   1801 N  N     . VAL A 1 218 ? -8.104  15.880  46.414  1.00 22.98 ? 218  VAL A N     1 
ATOM   1802 C  CA    . VAL A 1 218 ? -9.237  15.602  47.296  1.00 23.84 ? 218  VAL A CA    1 
ATOM   1803 C  C     . VAL A 1 218 ? -9.418  14.112  47.559  1.00 23.81 ? 218  VAL A C     1 
ATOM   1804 O  O     . VAL A 1 218 ? -9.846  13.729  48.640  1.00 25.27 ? 218  VAL A O     1 
ATOM   1805 C  CB    . VAL A 1 218 ? -10.571 16.241  46.810  1.00 22.78 ? 218  VAL A CB    1 
ATOM   1806 C  CG1   . VAL A 1 218 ? -10.492 17.751  46.916  1.00 27.10 ? 218  VAL A CG1   1 
ATOM   1807 C  CG2   . VAL A 1 218 ? -10.931 15.808  45.389  1.00 24.13 ? 218  VAL A CG2   1 
ATOM   1808 N  N     . GLU A 1 219 ? -9.066  13.274  46.589  1.00 24.91 ? 219  GLU A N     1 
ATOM   1809 C  CA    . GLU A 1 219 ? -9.265  11.830  46.730  1.00 27.19 ? 219  GLU A CA    1 
ATOM   1810 C  C     . GLU A 1 219 ? -8.214  11.199  47.644  1.00 28.94 ? 219  GLU A C     1 
ATOM   1811 O  O     . GLU A 1 219 ? -8.523  10.281  48.403  1.00 29.86 ? 219  GLU A O     1 
ATOM   1812 C  CB    . GLU A 1 219 ? -9.296  11.123  45.367  1.00 25.84 ? 219  GLU A CB    1 
ATOM   1813 C  CG    . GLU A 1 219 ? -9.575  9.617   45.479  1.00 27.60 ? 219  GLU A CG    1 
ATOM   1814 C  CD    . GLU A 1 219 ? -9.700  8.919   44.148  1.00 29.03 ? 219  GLU A CD    1 
ATOM   1815 O  OE1   . GLU A 1 219 ? -10.846 8.610   43.756  1.00 33.40 ? 219  GLU A OE1   1 
ATOM   1816 O  OE2   . GLU A 1 219 ? -8.659  8.670   43.495  1.00 31.35 ? 219  GLU A OE2   1 
ATOM   1817 N  N     . SER A 1 220 ? -6.982  11.694  47.572  1.00 27.84 ? 220  SER A N     1 
ATOM   1818 C  CA    . SER A 1 220 ? -5.894  11.126  48.368  1.00 30.40 ? 220  SER A CA    1 
ATOM   1819 C  C     . SER A 1 220 ? -5.740  11.790  49.739  1.00 29.09 ? 220  SER A C     1 
ATOM   1820 O  O     . SER A 1 220 ? -5.167  11.187  50.649  1.00 33.81 ? 220  SER A O     1 
ATOM   1821 C  CB    . SER A 1 220 ? -4.571  11.202  47.600  1.00 29.18 ? 220  SER A CB    1 
ATOM   1822 O  OG    . SER A 1 220 ? -4.226  12.553  47.350  1.00 34.95 ? 220  SER A OG    1 
ATOM   1823 N  N     . PHE A 1 221 ? -6.232  13.021  49.880  1.00 25.53 ? 221  PHE A N     1 
ATOM   1824 C  CA    . PHE A 1 221 ? -6.111  13.763  51.145  1.00 25.70 ? 221  PHE A CA    1 
ATOM   1825 C  C     . PHE A 1 221 ? -7.422  14.280  51.757  1.00 26.77 ? 221  PHE A C     1 
ATOM   1826 O  O     . PHE A 1 221 ? -7.832  13.793  52.812  1.00 29.65 ? 221  PHE A O     1 
ATOM   1827 C  CB    . PHE A 1 221 ? -5.090  14.907  51.050  1.00 24.70 ? 221  PHE A CB    1 
ATOM   1828 C  CG    . PHE A 1 221 ? -4.952  15.683  52.329  1.00 26.93 ? 221  PHE A CG    1 
ATOM   1829 C  CD1   . PHE A 1 221 ? -5.557  16.938  52.474  1.00 23.74 ? 221  PHE A CD1   1 
ATOM   1830 C  CD2   . PHE A 1 221 ? -4.233  15.154  53.406  1.00 25.54 ? 221  PHE A CD2   1 
ATOM   1831 C  CE1   . PHE A 1 221 ? -5.455  17.647  53.675  1.00 26.06 ? 221  PHE A CE1   1 
ATOM   1832 C  CE2   . PHE A 1 221 ? -4.114  15.863  54.606  1.00 26.77 ? 221  PHE A CE2   1 
ATOM   1833 C  CZ    . PHE A 1 221 ? -4.733  17.114  54.739  1.00 26.78 ? 221  PHE A CZ    1 
ATOM   1834 N  N     . ALA A 1 222 ? -8.074  15.257  51.122  1.00 23.08 ? 222  ALA A N     1 
ATOM   1835 C  CA    . ALA A 1 222 ? -9.237  15.923  51.735  1.00 21.66 ? 222  ALA A CA    1 
ATOM   1836 C  C     . ALA A 1 222 ? -10.400 14.996  52.097  1.00 23.55 ? 222  ALA A C     1 
ATOM   1837 O  O     . ALA A 1 222 ? -10.923 15.060  53.207  1.00 23.11 ? 222  ALA A O     1 
ATOM   1838 C  CB    . ALA A 1 222 ? -9.735  17.082  50.876  1.00 20.04 ? 222  ALA A CB    1 
ATOM   1839 N  N     . ILE A 1 223 ? -10.815 14.145  51.172  1.00 23.50 ? 223  ILE A N     1 
ATOM   1840 C  CA    . ILE A 1 223 ? -11.958 13.265  51.440  1.00 24.83 ? 223  ILE A CA    1 
ATOM   1841 C  C     . ILE A 1 223 ? -11.670 12.246  52.566  1.00 24.78 ? 223  ILE A C     1 
ATOM   1842 O  O     . ILE A 1 223 ? -12.449 12.155  53.514  1.00 24.39 ? 223  ILE A O     1 
ATOM   1843 C  CB    . ILE A 1 223 ? -12.498 12.587  50.157  1.00 26.83 ? 223  ILE A CB    1 
ATOM   1844 C  CG1   . ILE A 1 223 ? -12.982 13.651  49.164  1.00 26.62 ? 223  ILE A CG1   1 
ATOM   1845 C  CG2   . ILE A 1 223 ? -13.613 11.572  50.496  1.00 24.32 ? 223  ILE A CG2   1 
ATOM   1846 C  CD1   . ILE A 1 223 ? -13.111 13.150  47.725  1.00 23.27 ? 223  ILE A CD1   1 
ATOM   1847 N  N     . PRO A 1 224 ? -10.542 11.507  52.484  1.00 26.04 ? 224  PRO A N     1 
ATOM   1848 C  CA    . PRO A 1 224 ? -10.223 10.616  53.617  1.00 26.39 ? 224  PRO A CA    1 
ATOM   1849 C  C     . PRO A 1 224 ? -9.959  11.345  54.938  1.00 26.02 ? 224  PRO A C     1 
ATOM   1850 O  O     . PRO A 1 224 ? -10.306 10.813  56.001  1.00 26.34 ? 224  PRO A O     1 
ATOM   1851 C  CB    . PRO A 1 224 ? -8.968  9.845   53.154  1.00 26.47 ? 224  PRO A CB    1 
ATOM   1852 C  CG    . PRO A 1 224 ? -8.460  10.561  51.933  1.00 27.43 ? 224  PRO A CG    1 
ATOM   1853 C  CD    . PRO A 1 224 ? -9.627  11.313  51.340  1.00 23.79 ? 224  PRO A CD    1 
ATOM   1854 N  N     . TYR A 1 225 ? -9.376  12.545  54.886  1.00 22.76 ? 225  TYR A N     1 
ATOM   1855 C  CA    . TYR A 1 225 ? -9.202  13.328  56.118  1.00 24.43 ? 225  TYR A CA    1 
ATOM   1856 C  C     . TYR A 1 225 ? -10.539 13.679  56.767  1.00 24.10 ? 225  TYR A C     1 
ATOM   1857 O  O     . TYR A 1 225 ? -10.734 13.419  57.956  1.00 25.29 ? 225  TYR A O     1 
ATOM   1858 C  CB    . TYR A 1 225 ? -8.359  14.610  55.944  1.00 22.00 ? 225  TYR A CB    1 
ATOM   1859 C  CG    . TYR A 1 225 ? -7.734  14.990  57.261  1.00 24.07 ? 225  TYR A CG    1 
ATOM   1860 C  CD1   . TYR A 1 225 ? -8.455  15.706  58.230  1.00 20.55 ? 225  TYR A CD1   1 
ATOM   1861 C  CD2   . TYR A 1 225 ? -6.450  14.548  57.585  1.00 21.50 ? 225  TYR A CD2   1 
ATOM   1862 C  CE1   . TYR A 1 225 ? -7.879  15.999  59.470  1.00 22.53 ? 225  TYR A CE1   1 
ATOM   1863 C  CE2   . TYR A 1 225 ? -5.885  14.823  58.805  1.00 24.20 ? 225  TYR A CE2   1 
ATOM   1864 C  CZ    . TYR A 1 225 ? -6.592  15.550  59.745  1.00 27.06 ? 225  TYR A CZ    1 
ATOM   1865 O  OH    . TYR A 1 225 ? -5.996  15.819  60.959  1.00 27.43 ? 225  TYR A OH    1 
ATOM   1866 N  N     . VAL A 1 226 ? -11.446 14.274  55.991  1.00 26.13 ? 226  VAL A N     1 
ATOM   1867 C  CA    . VAL A 1 226 ? -12.756 14.678  56.516  1.00 25.24 ? 226  VAL A CA    1 
ATOM   1868 C  C     . VAL A 1 226 ? -13.522 13.470  57.058  1.00 24.56 ? 226  VAL A C     1 
ATOM   1869 O  O     . VAL A 1 226 ? -14.052 13.515  58.162  1.00 24.86 ? 226  VAL A O     1 
ATOM   1870 C  CB    . VAL A 1 226 ? -13.599 15.441  55.463  1.00 27.00 ? 226  VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1 226 ? -15.026 15.679  55.974  1.00 25.28 ? 226  VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1 226 ? -12.941 16.785  55.121  1.00 23.73 ? 226  VAL A CG2   1 
ATOM   1873 N  N     . TYR A 1 227 ? -13.551 12.388  56.285  1.00 24.25 ? 227  TYR A N     1 
ATOM   1874 C  CA    . TYR A 1 227 ? -14.275 11.188  56.669  1.00 25.39 ? 227  TYR A CA    1 
ATOM   1875 C  C     . TYR A 1 227 ? -13.758 10.602  57.977  1.00 27.21 ? 227  TYR A C     1 
ATOM   1876 O  O     . TYR A 1 227 ? -14.543 10.311  58.884  1.00 27.10 ? 227  TYR A O     1 
ATOM   1877 C  CB    . TYR A 1 227 ? -14.189 10.132  55.570  1.00 23.58 ? 227  TYR A CB    1 
ATOM   1878 C  CG    . TYR A 1 227 ? -14.916 8.856   55.903  1.00 24.20 ? 227  TYR A CG    1 
ATOM   1879 C  CD1   . TYR A 1 227 ? -16.269 8.710   55.628  1.00 21.00 ? 227  TYR A CD1   1 
ATOM   1880 C  CD2   . TYR A 1 227 ? -14.237 7.782   56.475  1.00 25.96 ? 227  TYR A CD2   1 
ATOM   1881 C  CE1   . TYR A 1 227 ? -16.939 7.528   55.934  1.00 26.19 ? 227  TYR A CE1   1 
ATOM   1882 C  CE2   . TYR A 1 227 ? -14.886 6.602   56.787  1.00 28.35 ? 227  TYR A CE2   1 
ATOM   1883 C  CZ    . TYR A 1 227 ? -16.231 6.475   56.514  1.00 29.83 ? 227  TYR A CZ    1 
ATOM   1884 O  OH    . TYR A 1 227 ? -16.848 5.291   56.827  1.00 33.12 ? 227  TYR A OH    1 
ATOM   1885 N  N     . ASN A 1 228 ? -12.443 10.422  58.064  1.00 27.63 ? 228  ASN A N     1 
ATOM   1886 C  CA    . ASN A 1 228 ? -11.829 9.839   59.253  1.00 28.07 ? 228  ASN A CA    1 
ATOM   1887 C  C     . ASN A 1 228 ? -11.848 10.735  60.472  1.00 28.64 ? 228  ASN A C     1 
ATOM   1888 O  O     . ASN A 1 228 ? -11.949 10.237  61.593  1.00 29.77 ? 228  ASN A O     1 
ATOM   1889 C  CB    . ASN A 1 228 ? -10.413 9.357   58.967  1.00 26.87 ? 228  ASN A CB    1 
ATOM   1890 C  CG    . ASN A 1 228 ? -10.392 8.119   58.107  1.00 30.60 ? 228  ASN A CG    1 
ATOM   1891 O  OD1   . ASN A 1 228 ? -11.278 7.271   58.205  1.00 31.86 ? 228  ASN A OD1   1 
ATOM   1892 N  ND2   . ASN A 1 228 ? -9.381  8.007   57.246  1.00 31.37 ? 228  ASN A ND2   1 
ATOM   1893 N  N     . ARG A 1 229 ? -11.756 12.050  60.262  1.00 27.71 ? 229  ARG A N     1 
ATOM   1894 C  CA    . ARG A 1 229 ? -11.881 12.998  61.367  1.00 26.63 ? 229  ARG A CA    1 
ATOM   1895 C  C     . ARG A 1 229 ? -13.278 12.920  61.967  1.00 27.93 ? 229  ARG A C     1 
ATOM   1896 O  O     . ARG A 1 229 ? -13.419 12.860  63.189  1.00 27.60 ? 229  ARG A O     1 
ATOM   1897 C  CB    . ARG A 1 229 ? -11.609 14.433  60.921  1.00 27.43 ? 229  ARG A CB    1 
ATOM   1898 C  CG    . ARG A 1 229 ? -11.600 15.444  62.074  1.00 30.79 ? 229  ARG A CG    1 
ATOM   1899 C  CD    . ARG A 1 229 ? -10.363 15.268  62.955  1.00 29.40 ? 229  ARG A CD    1 
ATOM   1900 N  NE    . ARG A 1 229 ? -10.388 16.133  64.132  1.00 31.34 ? 229  ARG A NE    1 
ATOM   1901 C  CZ    . ARG A 1 229 ? -9.654  15.933  65.230  1.00 32.18 ? 229  ARG A CZ    1 
ATOM   1902 N  NH1   . ARG A 1 229 ? -8.825  14.891  65.321  1.00 27.40 ? 229  ARG A NH1   1 
ATOM   1903 N  NH2   . ARG A 1 229 ? -9.758  16.770  66.249  1.00 29.36 ? 229  ARG A NH2   1 
ATOM   1904 N  N     . ILE A 1 230 ? -14.299 12.947  61.107  1.00 26.38 ? 230  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 230 ? -15.693 12.835  61.556  1.00 28.39 ? 230  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 230 ? -15.925 11.476  62.232  1.00 27.50 ? 230  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 230 ? -16.481 11.414  63.328  1.00 28.98 ? 230  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 230 ? -16.703 13.085  60.409  1.00 25.44 ? 230  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 230 ? -16.702 14.570  60.030  1.00 26.88 ? 230  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 230 ? -18.112 12.634  60.810  1.00 26.50 ? 230  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 230 ? -17.360 14.870  58.701  1.00 22.47 ? 230  ILE A CD1   1 
ATOM   1912 N  N     . LYS A 1 231 ? -15.456 10.405  61.596  1.00 28.11 ? 231  LYS A N     1 
ATOM   1913 C  CA    . LYS A 1 231 ? -15.509 9.071   62.196  1.00 27.43 ? 231  LYS A CA    1 
ATOM   1914 C  C     . LYS A 1 231 ? -14.879 9.045   63.603  1.00 28.94 ? 231  LYS A C     1 
ATOM   1915 O  O     . LYS A 1 231 ? -15.479 8.518   64.544  1.00 27.26 ? 231  LYS A O     1 
ATOM   1916 C  CB    . LYS A 1 231 ? -14.879 8.021   61.270  1.00 27.47 ? 231  LYS A CB    1 
ATOM   1917 C  CG    . LYS A 1 231 ? -14.814 6.609   61.884  1.00 30.14 ? 231  LYS A CG    1 
ATOM   1918 C  CD    . LYS A 1 231 ? -14.472 5.535   60.868  1.00 37.29 ? 231  LYS A CD    1 
ATOM   1919 C  CE    . LYS A 1 231 ? -13.040 5.622   60.362  1.00 40.85 ? 231  LYS A CE    1 
ATOM   1920 N  NZ    . LYS A 1 231 ? -12.022 5.255   61.387  1.00 45.91 ? 231  LYS A NZ    1 
ATOM   1921 N  N     . ASN A 1 232 ? -13.694 9.634   63.748  1.00 29.64 ? 232  ASN A N     1 
ATOM   1922 C  CA    . ASN A 1 232 ? -13.034 9.727   65.053  1.00 31.28 ? 232  ASN A CA    1 
ATOM   1923 C  C     . ASN A 1 232 ? -13.853 10.490  66.092  1.00 33.17 ? 232  ASN A C     1 
ATOM   1924 O  O     . ASN A 1 232 ? -13.939 10.074  67.238  1.00 33.30 ? 232  ASN A O     1 
ATOM   1925 C  CB    . ASN A 1 232 ? -11.661 10.397  64.927  1.00 34.13 ? 232  ASN A CB    1 
ATOM   1926 C  CG    . ASN A 1 232 ? -10.653 9.534   64.200  1.00 33.84 ? 232  ASN A CG    1 
ATOM   1927 O  OD1   . ASN A 1 232 ? -10.885 8.350   63.968  1.00 33.91 ? 232  ASN A OD1   1 
ATOM   1928 N  ND2   . ASN A 1 232 ? -9.523  10.129  63.830  1.00 34.19 ? 232  ASN A ND2   1 
ATOM   1929 N  N     . ILE A 1 233 ? -14.452 11.607  65.689  1.00 32.52 ? 233  ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 233 ? -15.176 12.464  66.630  1.00 31.83 ? 233  ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 233 ? -16.595 11.959  66.943  1.00 31.53 ? 233  ILE A C     1 
ATOM   1932 O  O     . ILE A 1 233 ? -17.016 12.000  68.096  1.00 32.29 ? 233  ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 233 ? -15.194 13.950  66.158  1.00 29.62 ? 233  ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 233 ? -13.770 14.512  66.143  1.00 30.62 ? 233  ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 233 ? -16.070 14.807  67.062  1.00 30.57 ? 233  ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 233 ? -13.631 15.865  65.484  1.00 29.77 ? 233  ILE A CD1   1 
ATOM   1937 N  N     . PHE A 1 234 ? -17.311 11.472  65.929  1.00 27.83 ? 234  PHE A N     1 
ATOM   1938 C  CA    . PHE A 1 234 ? -18.721 11.115  66.090  1.00 28.09 ? 234  PHE A CA    1 
ATOM   1939 C  C     . PHE A 1 234 ? -19.025 9.626   65.888  1.00 28.01 ? 234  PHE A C     1 
ATOM   1940 O  O     . PHE A 1 234 ? -20.112 9.170   66.226  1.00 26.18 ? 234  PHE A O     1 
ATOM   1941 C  CB    . PHE A 1 234 ? -19.588 11.912  65.104  1.00 27.72 ? 234  PHE A CB    1 
ATOM   1942 C  CG    . PHE A 1 234 ? -19.428 13.404  65.201  1.00 24.22 ? 234  PHE A CG    1 
ATOM   1943 C  CD1   . PHE A 1 234 ? -18.638 14.086  64.286  1.00 24.82 ? 234  PHE A CD1   1 
ATOM   1944 C  CD2   . PHE A 1 234 ? -20.084 14.133  66.199  1.00 30.02 ? 234  PHE A CD2   1 
ATOM   1945 C  CE1   . PHE A 1 234 ? -18.494 15.495  64.358  1.00 26.70 ? 234  PHE A CE1   1 
ATOM   1946 C  CE2   . PHE A 1 234 ? -19.952 15.545  66.281  1.00 26.39 ? 234  PHE A CE2   1 
ATOM   1947 C  CZ    . PHE A 1 234 ? -19.152 16.216  65.360  1.00 26.19 ? 234  PHE A CZ    1 
ATOM   1948 N  N     . GLY A 1 235 ? -18.086 8.879   65.316  1.00 29.45 ? 235  GLY A N     1 
ATOM   1949 C  CA    . GLY A 1 235 ? -18.362 7.498   64.894  1.00 32.73 ? 235  GLY A CA    1 
ATOM   1950 C  C     . GLY A 1 235 ? -18.650 7.353   63.401  1.00 34.34 ? 235  GLY A C     1 
ATOM   1951 O  O     . GLY A 1 235 ? -18.762 8.348   62.672  1.00 34.22 ? 235  GLY A O     1 
ATOM   1952 N  N     . GLU A 1 236 ? -18.789 6.101   62.967  1.00 35.71 ? 236  GLU A N     1 
ATOM   1953 C  CA    . GLU A 1 236 ? -18.968 5.724   61.563  1.00 38.48 ? 236  GLU A CA    1 
ATOM   1954 C  C     . GLU A 1 236 ? -20.245 6.255   60.907  1.00 38.62 ? 236  GLU A C     1 
ATOM   1955 O  O     . GLU A 1 236 ? -20.198 6.768   59.785  1.00 38.48 ? 236  GLU A O     1 
ATOM   1956 C  CB    . GLU A 1 236 ? -18.983 4.198   61.436  1.00 42.03 ? 236  GLU A CB    1 
ATOM   1957 C  CG    . GLU A 1 236 ? -17.628 3.553   61.264  1.00 48.83 ? 236  GLU A CG    1 
ATOM   1958 C  CD    . GLU A 1 236 ? -17.721 2.183   60.603  1.00 54.17 ? 236  GLU A CD    1 
ATOM   1959 O  OE1   . GLU A 1 236 ? -18.759 1.492   60.758  1.00 54.20 ? 236  GLU A OE1   1 
ATOM   1960 O  OE2   . GLU A 1 236 ? -16.747 1.800   59.922  1.00 55.96 ? 236  GLU A OE2   1 
ATOM   1961 N  N     . SER A 1 237 ? -21.380 6.103   61.593  1.00 36.80 ? 237  SER A N     1 
ATOM   1962 C  CA    . SER A 1 237 ? -22.681 6.396   60.997  1.00 34.63 ? 237  SER A CA    1 
ATOM   1963 C  C     . SER A 1 237 ? -22.796 7.870   60.608  1.00 32.96 ? 237  SER A C     1 
ATOM   1964 O  O     . SER A 1 237 ? -23.496 8.232   59.653  1.00 30.24 ? 237  SER A O     1 
ATOM   1965 C  CB    . SER A 1 237 ? -23.830 5.957   61.925  1.00 36.39 ? 237  SER A CB    1 
ATOM   1966 O  OG    . SER A 1 237 ? -23.990 6.814   63.051  1.00 37.95 ? 237  SER A OG    1 
ATOM   1967 N  N     . THR A 1 238 ? -22.093 8.717   61.347  1.00 31.72 ? 238  THR A N     1 
ATOM   1968 C  CA    . THR A 1 238 ? -22.107 10.137  61.058  1.00 29.77 ? 238  THR A CA    1 
ATOM   1969 C  C     . THR A 1 238 ? -21.167 10.415  59.884  1.00 29.15 ? 238  THR A C     1 
ATOM   1970 O  O     . THR A 1 238 ? -21.504 11.198  58.999  1.00 30.77 ? 238  THR A O     1 
ATOM   1971 C  CB    . THR A 1 238 ? -21.756 10.973  62.310  1.00 29.94 ? 238  THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 238 ? -22.701 10.686  63.349  1.00 29.31 ? 238  THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 238 ? -21.795 12.474  62.007  1.00 27.59 ? 238  THR A CG2   1 
ATOM   1974 N  N     . ALA A 1 239 ? -20.014 9.753   59.861  1.00 28.02 ? 239  ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 239 ? -19.056 9.928   58.767  1.00 29.42 ? 239  ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 239 ? -19.655 9.476   57.440  1.00 28.25 ? 239  ALA A C     1 
ATOM   1977 O  O     . ALA A 1 239 ? -19.409 10.098  56.405  1.00 27.09 ? 239  ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 239 ? -17.747 9.175   59.047  1.00 28.06 ? 239  ALA A CB    1 
ATOM   1979 N  N     . LYS A 1 240 ? -20.449 8.405   57.486  1.00 26.93 ? 240  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 240 ? -21.110 7.875   56.294  1.00 29.44 ? 240  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 240 ? -22.208 8.799   55.724  1.00 28.34 ? 240  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 240 ? -22.753 8.525   54.656  1.00 27.52 ? 240  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 240 ? -21.651 6.465   56.550  1.00 31.52 ? 240  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 240 ? -20.571 5.399   56.789  1.00 32.72 ? 240  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 240 ? -21.202 4.119   57.322  1.00 41.24 ? 240  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 240 ? -20.185 3.013   57.570  1.00 43.66 ? 240  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 240 ? -19.756 2.350   56.314  1.00 47.39 ? 240  LYS A NZ    1 
ATOM   1988 N  N     . ARG A 1 241 ? -22.505 9.901   56.413  1.00 27.64 ? 241  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 241 ? -23.425 10.917  55.880  1.00 26.79 ? 241  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 241 ? -22.854 11.684  54.677  1.00 28.69 ? 241  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 241 ? -23.570 12.436  53.994  1.00 29.98 ? 241  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 241 ? -23.888 11.868  56.990  1.00 27.80 ? 241  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 241 ? -24.813 11.180  58.034  1.00 25.35 ? 241  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 241 ? -25.165 12.116  59.181  1.00 26.16 ? 241  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 241 ? -25.824 13.340  58.719  1.00 27.61 ? 241  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 241 ? -25.766 14.517  59.339  1.00 31.79 ? 241  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 241 ? -25.075 14.650  60.464  1.00 32.74 ? 241  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 241 ? -26.391 15.571  58.827  1.00 29.85 ? 241  ARG A NH2   1 
ATOM   1999 N  N     . LEU A 1 242 ? -21.568 11.482  54.408  1.00 29.04 ? 242  LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 242 ? -20.936 12.048  53.216  1.00 28.07 ? 242  LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 242 ? -21.419 11.336  51.955  1.00 27.75 ? 242  LEU A C     1 
ATOM   2002 O  O     . LEU A 1 242 ? -21.334 11.882  50.859  1.00 26.49 ? 242  LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 242 ? -19.412 11.987  53.325  1.00 27.58 ? 242  LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 242 ? -18.749 12.846  54.407  1.00 24.87 ? 242  LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 242 ? -17.321 12.379  54.599  1.00 27.55 ? 242  LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 242 ? -18.805 14.344  54.051  1.00 23.70 ? 242  LEU A CD2   1 
ATOM   2007 N  N     . SER A 1 243 ? -21.926 10.119  52.126  1.00 25.81 ? 243  SER A N     1 
ATOM   2008 C  CA    . SER A 1 243 ? -22.582 9.397   51.050  1.00 27.17 ? 243  SER A CA    1 
ATOM   2009 C  C     . SER A 1 243 ? -24.093 9.563   51.136  1.00 27.69 ? 243  SER A C     1 
ATOM   2010 O  O     . SER A 1 243 ? -24.666 9.367   52.209  1.00 30.55 ? 243  SER A O     1 
ATOM   2011 C  CB    . SER A 1 243 ? -22.245 7.912   51.133  1.00 26.61 ? 243  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 243 ? -23.228 7.146   50.456  1.00 25.28 ? 243  SER A OG    1 
ATOM   2013 N  N     . PRO A 1 244 ? -24.751 9.898   50.009  1.00 27.70 ? 244  PRO A N     1 
ATOM   2014 C  CA    . PRO A 1 244 ? -26.208 10.062  50.045  1.00 29.60 ? 244  PRO A CA    1 
ATOM   2015 C  C     . PRO A 1 244 ? -26.963 8.757   50.292  1.00 29.55 ? 244  PRO A C     1 
ATOM   2016 O  O     . PRO A 1 244 ? -28.129 8.797   50.659  1.00 31.26 ? 244  PRO A O     1 
ATOM   2017 C  CB    . PRO A 1 244 ? -26.543 10.619  48.658  1.00 29.03 ? 244  PRO A CB    1 
ATOM   2018 C  CG    . PRO A 1 244 ? -25.392 10.203  47.794  1.00 31.89 ? 244  PRO A CG    1 
ATOM   2019 C  CD    . PRO A 1 244 ? -24.196 10.274  48.697  1.00 29.28 ? 244  PRO A CD    1 
ATOM   2020 N  N     . HIS A 1 245 ? -26.306 7.618   50.103  1.00 28.79 ? 245  HIS A N     1 
ATOM   2021 C  CA    . HIS A 1 245 ? -26.938 6.327   50.407  1.00 30.13 ? 245  HIS A CA    1 
ATOM   2022 C  C     . HIS A 1 245 ? -26.383 5.744   51.698  1.00 29.68 ? 245  HIS A C     1 
ATOM   2023 O  O     . HIS A 1 245 ? -26.644 4.579   52.041  1.00 29.58 ? 245  HIS A O     1 
ATOM   2024 C  CB    . HIS A 1 245 ? -26.763 5.355   49.236  1.00 28.19 ? 245  HIS A CB    1 
ATOM   2025 C  CG    . HIS A 1 245 ? -26.920 6.005   47.898  1.00 27.79 ? 245  HIS A CG    1 
ATOM   2026 N  ND1   . HIS A 1 245 ? -28.091 6.616   47.502  1.00 29.51 ? 245  HIS A ND1   1 
ATOM   2027 C  CD2   . HIS A 1 245 ? -26.042 6.179   46.882  1.00 25.55 ? 245  HIS A CD2   1 
ATOM   2028 C  CE1   . HIS A 1 245 ? -27.932 7.121   46.291  1.00 31.42 ? 245  HIS A CE1   1 
ATOM   2029 N  NE2   . HIS A 1 245 ? -26.700 6.862   45.888  1.00 28.73 ? 245  HIS A NE2   1 
ATOM   2030 N  N     . ARG A 1 246 ? -25.607 6.569   52.402  1.00 27.93 ? 246  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 246 ? -25.001 6.200   53.684  1.00 32.33 ? 246  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 246 ? -24.079 4.975   53.568  1.00 31.27 ? 246  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 246 ? -23.847 4.262   54.546  1.00 30.23 ? 246  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 246 ? -26.083 5.975   54.765  1.00 34.95 ? 246  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 246 ? -27.097 7.131   54.957  1.00 39.16 ? 246  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 246 ? -26.426 8.457   55.371  1.00 41.20 ? 246  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 246 ? -27.413 9.506   55.631  1.00 42.20 ? 246  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 246 ? -27.640 10.556  54.846  1.00 44.44 ? 246  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 246 ? -26.937 10.742  53.732  1.00 40.44 ? 246  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 246 ? -28.570 11.437  55.189  1.00 46.50 ? 246  ARG A NH2   1 
ATOM   2041 N  N     . LYS A 1 247 ? -23.561 4.725   52.371  1.00 31.88 ? 247  LYS A N     1 
ATOM   2042 C  CA    . LYS A 1 247 ? -22.617 3.627   52.186  1.00 34.17 ? 247  LYS A CA    1 
ATOM   2043 C  C     . LYS A 1 247 ? -21.259 4.145   51.738  1.00 34.44 ? 247  LYS A C     1 
ATOM   2044 O  O     . LYS A 1 247 ? -21.165 4.996   50.848  1.00 31.28 ? 247  LYS A O     1 
ATOM   2045 C  CB    . LYS A 1 247 ? -23.148 2.575   51.208  1.00 38.59 ? 247  LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1 247 ? -22.421 1.225   51.330  1.00 46.89 ? 247  LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1 247 ? -22.773 0.242   50.212  1.00 49.51 ? 247  LYS A CD    1 
ATOM   2048 C  CE    . LYS A 1 247 ? -21.857 -0.986  50.240  1.00 49.74 ? 247  LYS A CE    1 
ATOM   2049 N  NZ    . LYS A 1 247 ? -22.039 -1.799  51.479  1.00 52.54 ? 247  LYS A NZ    1 
ATOM   2050 N  N     . THR A 1 248 ? -20.214 3.639   52.386  1.00 35.40 ? 248  THR A N     1 
ATOM   2051 C  CA    . THR A 1 248 ? -18.836 3.953   52.033  1.00 35.41 ? 248  THR A CA    1 
ATOM   2052 C  C     . THR A 1 248 ? -18.000 2.680   52.138  1.00 39.07 ? 248  THR A C     1 
ATOM   2053 O  O     . THR A 1 248 ? -18.361 1.740   52.853  1.00 40.06 ? 248  THR A O     1 
ATOM   2054 C  CB    . THR A 1 248 ? -18.208 5.071   52.925  1.00 33.87 ? 248  THR A CB    1 
ATOM   2055 O  OG1   . THR A 1 248 ? -17.966 4.581   54.247  1.00 34.14 ? 248  THR A OG1   1 
ATOM   2056 C  CG2   . THR A 1 248 ? -19.098 6.306   53.007  1.00 32.43 ? 248  THR A CG2   1 
ATOM   2057 N  N     . ARG A 1 249 ? -16.890 2.650   51.414  1.00 39.56 ? 249  ARG A N     1 
ATOM   2058 C  CA    . ARG A 1 249 ? -15.978 1.521   51.452  1.00 41.54 ? 249  ARG A CA    1 
ATOM   2059 C  C     . ARG A 1 249 ? -14.569 2.086   51.438  1.00 40.59 ? 249  ARG A C     1 
ATOM   2060 O  O     . ARG A 1 249 ? -14.276 3.019   50.685  1.00 38.27 ? 249  ARG A O     1 
ATOM   2061 C  CB    . ARG A 1 249 ? -16.212 0.618   50.232  1.00 43.74 ? 249  ARG A CB    1 
ATOM   2062 C  CG    . ARG A 1 249 ? -15.499 -0.744  50.270  1.00 51.94 ? 249  ARG A CG    1 
ATOM   2063 C  CD    . ARG A 1 249 ? -15.395 -1.398  48.870  1.00 57.37 ? 249  ARG A CD    1 
ATOM   2064 N  NE    . ARG A 1 249 ? -14.656 -0.557  47.916  1.00 61.93 ? 249  ARG A NE    1 
ATOM   2065 C  CZ    . ARG A 1 249 ? -15.207 0.112   46.900  1.00 63.49 ? 249  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG A 1 249 ? -16.514 0.032   46.669  1.00 67.23 ? 249  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG A 1 249 ? -14.453 0.860   46.104  1.00 57.54 ? 249  ARG A NH2   1 
ATOM   2068 N  N     . VAL A 1 250 ? -13.705 1.544   52.288  1.00 40.71 ? 250  VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 250 ? -12.290 1.863   52.221  1.00 42.39 ? 250  VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 250 ? -11.705 1.084   51.047  1.00 45.50 ? 250  VAL A C     1 
ATOM   2071 O  O     . VAL A 1 250 ? -11.839 -0.141  50.977  1.00 45.51 ? 250  VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 250 ? -11.547 1.482   53.517  1.00 44.42 ? 250  VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 250 ? -10.033 1.621   53.328  1.00 43.65 ? 250  VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 250 ? -12.038 2.334   54.709  1.00 41.87 ? 250  VAL A CG2   1 
ATOM   2075 N  N     . LYS A 1 251 ? -11.073 1.793   50.117  1.00 46.35 ? 251  LYS A N     1 
ATOM   2076 C  CA    . LYS A 1 251 ? -10.484 1.138   48.958  1.00 48.43 ? 251  LYS A CA    1 
ATOM   2077 C  C     . LYS A 1 251 ? -8.965  1.208   48.983  1.00 49.07 ? 251  LYS A C     1 
ATOM   2078 O  O     . LYS A 1 251 ? -8.382  2.271   49.208  1.00 46.76 ? 251  LYS A O     1 
ATOM   2079 C  CB    . LYS A 1 251 ? -11.028 1.713   47.645  1.00 48.37 ? 251  LYS A CB    1 
ATOM   2080 C  CG    . LYS A 1 251 ? -10.736 0.818   46.448  1.00 49.87 ? 251  LYS A CG    1 
ATOM   2081 C  CD    . LYS A 1 251 ? -11.207 1.421   45.141  1.00 54.20 ? 251  LYS A CD    1 
ATOM   2082 C  CE    . LYS A 1 251 ? -11.065 0.403   44.015  1.00 58.24 ? 251  LYS A CE    1 
ATOM   2083 N  NZ    . LYS A 1 251 ? -11.558 0.933   42.716  1.00 59.61 ? 251  LYS A NZ    1 
ATOM   2084 N  N     . VAL A 1 252 ? -8.339  0.057   48.752  1.00 51.64 ? 252  VAL A N     1 
ATOM   2085 C  CA    . VAL A 1 252 ? -6.887  -0.052  48.734  1.00 53.77 ? 252  VAL A CA    1 
ATOM   2086 C  C     . VAL A 1 252 ? -6.372  0.066   47.293  1.00 53.99 ? 252  VAL A C     1 
ATOM   2087 O  O     . VAL A 1 252 ? -6.766  -0.700  46.413  1.00 53.73 ? 252  VAL A O     1 
ATOM   2088 C  CB    . VAL A 1 252 ? -6.387  -1.349  49.469  1.00 56.28 ? 252  VAL A CB    1 
ATOM   2089 C  CG1   . VAL A 1 252 ? -6.899  -2.637  48.786  1.00 57.67 ? 252  VAL A CG1   1 
ATOM   2090 C  CG2   . VAL A 1 252 ? -4.861  -1.355  49.614  1.00 56.80 ? 252  VAL A CG2   1 
ATOM   2091 N  N     . ILE A 1 253 ? -5.520  1.061   47.061  1.00 55.32 ? 253  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 253 ? -4.924  1.295   45.748  1.00 56.79 ? 253  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 253 ? -3.519  0.696   45.731  1.00 58.46 ? 253  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 253 ? -2.619  1.185   46.417  1.00 57.68 ? 253  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 253 ? -4.874  2.819   45.393  1.00 57.03 ? 253  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 253 ? -6.250  3.487   45.551  1.00 55.16 ? 253  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 253 ? -4.301  3.044   43.985  1.00 56.26 ? 253  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 253 ? -7.320  3.027   44.565  1.00 56.98 ? 253  ILE A CD1   1 
ATOM   2099 N  N     . GLU A 1 254 ? -3.346  -0.367  44.949  1.00 61.21 ? 254  GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 254 ? -2.075  -1.089  44.874  1.00 65.53 ? 254  GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 254 ? -1.220  -0.656  43.690  1.00 67.28 ? 254  GLU A C     1 
ATOM   2102 O  O     . GLU A 1 254 ? -1.712  -0.520  42.564  1.00 66.19 ? 254  GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 254 ? -2.317  -2.597  44.796  1.00 66.73 ? 254  GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 254 ? -2.901  -3.205  46.062  1.00 71.14 ? 254  GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 254 ? -3.004  -4.718  45.998  1.00 74.55 ? 254  GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 254 ? -2.413  -5.330  45.082  1.00 76.13 ? 254  GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 254 ? -3.677  -5.298  46.875  1.00 77.57 ? 254  GLU A OE2   1 
ATOM   2108 N  N     . ASN A 1 255 ? 0.065   -0.442  43.957  1.00 69.97 ? 255  ASN A N     1 
ATOM   2109 C  CA    . ASN A 1 255 ? 1.033   -0.149  42.904  1.00 71.99 ? 255  ASN A CA    1 
ATOM   2110 C  C     . ASN A 1 255 ? 2.174   -1.165  42.905  1.00 74.37 ? 255  ASN A C     1 
ATOM   2111 O  O     . ASN A 1 255 ? 2.180   -2.112  43.700  1.00 73.71 ? 255  ASN A O     1 
ATOM   2112 C  CB    . ASN A 1 255 ? 1.548   1.303   42.998  1.00 72.37 ? 255  ASN A CB    1 
ATOM   2113 C  CG    . ASN A 1 255 ? 2.530   1.517   44.146  1.00 72.88 ? 255  ASN A CG    1 
ATOM   2114 O  OD1   . ASN A 1 255 ? 3.715   1.222   44.024  1.00 75.43 ? 255  ASN A OD1   1 
ATOM   2115 N  ND2   . ASN A 1 255 ? 2.042   2.060   45.257  1.00 74.56 ? 255  ASN A ND2   1 
ATOM   2116 N  N     . MET A 1 256 ? 3.125   -0.952  41.999  1.00 76.64 ? 256  MET A N     1 
ATOM   2117 C  CA    . MET A 1 256 ? 4.303   -1.802  41.826  1.00 79.78 ? 256  MET A CA    1 
ATOM   2118 C  C     . MET A 1 256 ? 5.023   -2.113  43.157  1.00 80.23 ? 256  MET A C     1 
ATOM   2119 O  O     . MET A 1 256 ? 5.360   -3.271  43.432  1.00 80.94 ? 256  MET A O     1 
ATOM   2120 C  CB    . MET A 1 256 ? 5.251   -1.117  40.834  1.00 81.24 ? 256  MET A CB    1 
ATOM   2121 C  CG    . MET A 1 256 ? 5.740   -1.984  39.680  1.00 84.72 ? 256  MET A CG    1 
ATOM   2122 S  SD    . MET A 1 256 ? 5.716   -1.098  38.095  1.00 88.27 ? 256  MET A SD    1 
ATOM   2123 C  CE    . MET A 1 256 ? 6.808   0.297   38.401  1.00 88.54 ? 256  MET A CE    1 
ATOM   2124 N  N     . TYR A 1 257 ? 5.238   -1.078  43.975  1.00 78.97 ? 257  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 257 ? 5.917   -1.210  45.268  1.00 78.32 ? 257  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 257 ? 5.140   -0.472  46.360  1.00 75.12 ? 257  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 257 ? 5.468   0.670   46.698  1.00 74.55 ? 257  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 257 ? 7.350   -0.655  45.205  1.00 80.91 ? 257  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 257 ? 8.063   -0.827  43.875  1.00 85.55 ? 257  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 257 ? 7.963   0.151   42.871  1.00 85.94 ? 257  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 257 ? 8.855   -1.953  43.625  1.00 88.05 ? 257  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 257 ? 8.618   -0.000  41.645  1.00 87.72 ? 257  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 257 ? 9.521   -2.111  42.405  1.00 89.91 ? 257  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 257 ? 9.396   -1.136  41.419  1.00 90.11 ? 257  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 257 ? 10.054  -1.295  40.216  1.00 89.82 ? 257  TYR A OH    1 
ATOM   2136 N  N     . GLY A 1 258 ? 4.107   -1.121  46.899  1.00 71.80 ? 258  GLY A N     1 
ATOM   2137 C  CA    . GLY A 1 258 ? 3.310   -0.548  47.988  1.00 66.64 ? 258  GLY A CA    1 
ATOM   2138 C  C     . GLY A 1 258 ? 1.856   -0.258  47.653  1.00 62.65 ? 258  GLY A C     1 
ATOM   2139 O  O     . GLY A 1 258 ? 1.382   -0.563  46.554  1.00 60.80 ? 258  GLY A O     1 
ATOM   2140 N  N     . SER A 1 259 ? 1.145   0.328   48.615  1.00 59.59 ? 259  SER A N     1 
ATOM   2141 C  CA    . SER A 1 259 ? -0.284  0.629   48.461  1.00 57.13 ? 259  SER A CA    1 
ATOM   2142 C  C     . SER A 1 259 ? -0.775  1.737   49.402  1.00 53.96 ? 259  SER A C     1 
ATOM   2143 O  O     . SER A 1 259 ? -0.135  2.041   50.408  1.00 54.19 ? 259  SER A O     1 
ATOM   2144 C  CB    . SER A 1 259 ? -1.132  -0.638  48.654  1.00 57.00 ? 259  SER A CB    1 
ATOM   2145 O  OG    . SER A 1 259 ? -1.165  -1.038  50.011  1.00 56.81 ? 259  SER A OG    1 
ATOM   2146 N  N     . ARG A 1 260 ? -1.921  2.321   49.060  1.00 50.68 ? 260  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 260 ? -2.536  3.408   49.829  1.00 47.62 ? 260  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 260 ? -4.060  3.218   49.892  1.00 45.50 ? 260  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 260 ? -4.612  2.372   49.183  1.00 45.16 ? 260  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 260 ? -2.175  4.773   49.213  1.00 46.77 ? 260  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 260 ? -2.680  4.961   47.777  1.00 45.81 ? 260  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 260 ? -2.109  6.202   47.104  1.00 44.43 ? 260  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 260 ? -2.687  6.383   45.769  1.00 41.98 ? 260  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 260 ? -3.771  7.114   45.506  1.00 39.49 ? 260  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 260 ? -4.407  7.759   46.482  1.00 38.25 ? 260  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 260 ? -4.216  7.210   44.261  1.00 35.84 ? 260  ARG A NH2   1 
ATOM   2157 N  N     . GLU A 1 261 ? -4.728  4.006   50.734  1.00 43.10 ? 261  GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 261 ? -6.177  3.890   50.931  1.00 42.32 ? 261  GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 261 ? -6.938  5.138   50.519  1.00 40.01 ? 261  GLU A C     1 
ATOM   2160 O  O     . GLU A 1 261 ? -6.482  6.264   50.742  1.00 38.59 ? 261  GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 261 ? -6.507  3.581   52.393  1.00 43.34 ? 261  GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 261 ? -5.977  2.233   52.888  1.00 49.47 ? 261  GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 261 ? -6.505  1.871   54.266  1.00 53.50 ? 261  GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 261 ? -6.746  2.792   55.088  1.00 51.34 ? 261  GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 261 ? -6.685  0.659   54.516  1.00 56.20 ? 261  GLU A OE2   1 
ATOM   2166 N  N     . ILE A 1 262 ? -8.108  4.929   49.920  1.00 37.28 ? 262  ILE A N     1 
ATOM   2167 C  CA    . ILE A 1 262 ? -9.033  6.029   49.639  1.00 33.58 ? 262  ILE A CA    1 
ATOM   2168 C  C     . ILE A 1 262 ? -10.426 5.652   50.145  1.00 32.03 ? 262  ILE A C     1 
ATOM   2169 O  O     . ILE A 1 262 ? -10.677 4.485   50.473  1.00 29.93 ? 262  ILE A O     1 
ATOM   2170 C  CB    . ILE A 1 262 ? -9.051  6.428   48.131  1.00 31.06 ? 262  ILE A CB    1 
ATOM   2171 C  CG1   . ILE A 1 262 ? -9.573  5.284   47.257  1.00 35.67 ? 262  ILE A CG1   1 
ATOM   2172 C  CG2   . ILE A 1 262 ? -7.662  6.882   47.675  1.00 30.23 ? 262  ILE A CG2   1 
ATOM   2173 C  CD1   . ILE A 1 262 ? -10.074 5.732   45.883  1.00 37.39 ? 262  ILE A CD1   1 
ATOM   2174 N  N     . ILE A 1 263 ? -11.325 6.628   50.232  1.00 28.62 ? 263  ILE A N     1 
ATOM   2175 C  CA    . ILE A 1 263 ? -12.684 6.319   50.674  1.00 30.48 ? 263  ILE A CA    1 
ATOM   2176 C  C     . ILE A 1 263 ? -13.653 6.484   49.512  1.00 29.83 ? 263  ILE A C     1 
ATOM   2177 O  O     . ILE A 1 263 ? -13.767 7.565   48.932  1.00 31.37 ? 263  ILE A O     1 
ATOM   2178 C  CB    . ILE A 1 263 ? -13.140 7.164   51.908  1.00 30.26 ? 263  ILE A CB    1 
ATOM   2179 C  CG1   . ILE A 1 263 ? -12.087 7.143   53.029  1.00 33.51 ? 263  ILE A CG1   1 
ATOM   2180 C  CG2   . ILE A 1 263 ? -14.505 6.673   52.439  1.00 31.61 ? 263  ILE A CG2   1 
ATOM   2181 C  CD1   . ILE A 1 263 ? -11.795 5.763   53.634  1.00 30.02 ? 263  ILE A CD1   1 
ATOM   2182 N  N     . THR A 1 264 ? -14.322 5.396   49.158  1.00 28.35 ? 264  THR A N     1 
ATOM   2183 C  CA    . THR A 1 264 ? -15.362 5.431   48.134  1.00 28.68 ? 264  THR A CA    1 
ATOM   2184 C  C     . THR A 1 264 ? -16.653 5.919   48.782  1.00 28.54 ? 264  THR A C     1 
ATOM   2185 O  O     . THR A 1 264 ? -17.143 5.293   49.721  1.00 27.76 ? 264  THR A O     1 
ATOM   2186 C  CB    . THR A 1 264 ? -15.577 4.033   47.500  1.00 26.68 ? 264  THR A CB    1 
ATOM   2187 O  OG1   . THR A 1 264 ? -14.352 3.586   46.910  1.00 27.83 ? 264  THR A OG1   1 
ATOM   2188 C  CG2   . THR A 1 264 ? -16.640 4.076   46.417  1.00 28.06 ? 264  THR A CG2   1 
ATOM   2189 N  N     . LEU A 1 265 ? -17.184 7.041   48.290  1.00 27.32 ? 265  LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 265 ? -18.489 7.525   48.718  1.00 25.28 ? 265  LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 265 ? -19.523 7.104   47.691  1.00 26.46 ? 265  LEU A C     1 
ATOM   2192 O  O     . LEU A 1 265 ? -19.551 7.631   46.576  1.00 27.79 ? 265  LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 265 ? -18.488 9.051   48.879  1.00 25.69 ? 265  LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 265 ? -17.382 9.672   49.734  1.00 22.56 ? 265  LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 265 ? -17.374 11.203  49.581  1.00 22.32 ? 265  LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 265 ? -17.501 9.248   51.202  1.00 19.93 ? 265  LEU A CD2   1 
ATOM   2197 N  N     . PHE A 1 266 ? -20.360 6.132   48.048  1.00 26.15 ? 266  PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 266 ? -21.380 5.653   47.129  1.00 24.53 ? 266  PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 266 ? -22.350 6.785   46.834  1.00 24.71 ? 266  PHE A C     1 
ATOM   2200 O  O     . PHE A 1 266 ? -22.779 7.490   47.754  1.00 21.14 ? 266  PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 266 ? -22.126 4.464   47.717  1.00 27.96 ? 266  PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 266 ? -21.422 3.148   47.534  1.00 31.85 ? 266  PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 266 ? -20.274 2.842   48.261  1.00 32.05 ? 266  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 266 ? -21.937 2.189   46.662  1.00 37.52 ? 266  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 266 ? -19.630 1.616   48.103  1.00 35.96 ? 266  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 266 ? -21.296 0.946   46.494  1.00 39.51 ? 266  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 266 ? -20.137 0.665   47.218  1.00 38.75 ? 266  PHE A CZ    1 
ATOM   2208 N  N     . GLY A 1 267 ? -22.675 6.960   45.553  1.00 22.76 ? 267  GLY A N     1 
ATOM   2209 C  CA    . GLY A 1 267 ? -23.588 8.025   45.109  1.00 23.61 ? 267  GLY A CA    1 
ATOM   2210 C  C     . GLY A 1 267 ? -22.939 9.382   44.884  1.00 24.06 ? 267  GLY A C     1 
ATOM   2211 O  O     . GLY A 1 267 ? -23.630 10.390  44.724  1.00 25.86 ? 267  GLY A O     1 
ATOM   2212 N  N     . ILE A 1 268 ? -21.609 9.409   44.876  1.00 23.35 ? 268  ILE A N     1 
ATOM   2213 C  CA    . ILE A 1 268 ? -20.847 10.605  44.516  1.00 23.34 ? 268  ILE A CA    1 
ATOM   2214 C  C     . ILE A 1 268 ? -19.837 10.190  43.439  1.00 22.70 ? 268  ILE A C     1 
ATOM   2215 O  O     . ILE A 1 268 ? -19.327 9.070   43.469  1.00 22.64 ? 268  ILE A O     1 
ATOM   2216 C  CB    . ILE A 1 268 ? -20.106 11.204  45.754  1.00 21.99 ? 268  ILE A CB    1 
ATOM   2217 C  CG1   . ILE A 1 268 ? -21.052 11.360  46.962  1.00 22.31 ? 268  ILE A CG1   1 
ATOM   2218 C  CG2   . ILE A 1 268 ? -19.336 12.491  45.401  1.00 19.82 ? 268  ILE A CG2   1 
ATOM   2219 C  CD1   . ILE A 1 268 ? -21.743 12.671  47.109  1.00 21.69 ? 268  ILE A CD1   1 
ATOM   2220 N  N     . SER A 1 269 ? -19.577 11.074  42.477  1.00 21.34 ? 269  SER A N     1 
ATOM   2221 C  CA    . SER A 1 269 ? -18.565 10.813  41.458  1.00 22.84 ? 269  SER A CA    1 
ATOM   2222 C  C     . SER A 1 269 ? -17.399 11.736  41.729  1.00 22.69 ? 269  SER A C     1 
ATOM   2223 O  O     . SER A 1 269 ? -17.460 12.945  41.433  1.00 21.18 ? 269  SER A O     1 
ATOM   2224 C  CB    . SER A 1 269 ? -19.126 11.017  40.043  1.00 23.51 ? 269  SER A CB    1 
ATOM   2225 O  OG    . SER A 1 269 ? -20.032 9.966   39.697  1.00 25.90 ? 269  SER A OG    1 
ATOM   2226 N  N     . VAL A 1 270 ? -16.355 11.170  42.335  1.00 20.27 ? 270  VAL A N     1 
ATOM   2227 C  CA    . VAL A 1 270 ? -15.173 11.935  42.696  1.00 20.21 ? 270  VAL A CA    1 
ATOM   2228 C  C     . VAL A 1 270 ? -14.245 12.004  41.491  1.00 23.15 ? 270  VAL A C     1 
ATOM   2229 O  O     . VAL A 1 270 ? -13.764 10.968  41.003  1.00 21.12 ? 270  VAL A O     1 
ATOM   2230 C  CB    . VAL A 1 270 ? -14.417 11.328  43.914  1.00 21.43 ? 270  VAL A CB    1 
ATOM   2231 C  CG1   . VAL A 1 270 ? -13.157 12.100  44.183  1.00 21.68 ? 270  VAL A CG1   1 
ATOM   2232 C  CG2   . VAL A 1 270 ? -15.292 11.338  45.157  1.00 20.97 ? 270  VAL A CG2   1 
ATOM   2233 N  N     . LEU A 1 271 ? -14.008 13.224  41.006  1.00 21.72 ? 271  LEU A N     1 
ATOM   2234 C  CA    . LEU A 1 271 ? -13.017 13.452  39.952  1.00 24.95 ? 271  LEU A CA    1 
ATOM   2235 C  C     . LEU A 1 271 ? -11.951 14.395  40.475  1.00 24.89 ? 271  LEU A C     1 
ATOM   2236 O  O     . LEU A 1 271 ? -12.069 15.612  40.323  1.00 26.24 ? 271  LEU A O     1 
ATOM   2237 C  CB    . LEU A 1 271 ? -13.672 14.055  38.694  1.00 25.06 ? 271  LEU A CB    1 
ATOM   2238 C  CG    . LEU A 1 271 ? -14.991 13.459  38.182  1.00 27.39 ? 271  LEU A CG    1 
ATOM   2239 C  CD1   . LEU A 1 271 ? -15.601 14.330  37.072  1.00 30.04 ? 271  LEU A CD1   1 
ATOM   2240 C  CD2   . LEU A 1 271 ? -14.793 12.043  37.688  1.00 23.57 ? 271  LEU A CD2   1 
ATOM   2241 N  N     . ASP A 1 272 ? -10.913 13.836  41.095  1.00 23.74 ? 272  ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 272 ? -9.831  14.643  41.651  1.00 24.87 ? 272  ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 272 ? -9.162  15.435  40.524  1.00 25.69 ? 272  ASP A C     1 
ATOM   2244 O  O     . ASP A 1 272 ? -8.683  14.832  39.560  1.00 25.83 ? 272  ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 272 ? -8.819  13.725  42.347  1.00 22.33 ? 272  ASP A CB    1 
ATOM   2246 C  CG    . ASP A 1 272 ? -7.880  14.469  43.278  1.00 28.15 ? 272  ASP A CG    1 
ATOM   2247 O  OD1   . ASP A 1 272 ? -7.679  15.703  43.108  1.00 27.36 ? 272  ASP A OD1   1 
ATOM   2248 O  OD2   . ASP A 1 272 ? -7.331  13.805  44.193  1.00 27.80 ? 272  ASP A OD2   1 
ATOM   2249 N  N     . TYR A 1 273 ? -9.118  16.768  40.632  1.00 24.70 ? 273  TYR A N     1 
ATOM   2250 C  CA    . TYR A 1 273 ? -8.560  17.575  39.531  1.00 21.98 ? 273  TYR A CA    1 
ATOM   2251 C  C     . TYR A 1 273 ? -7.091  17.289  39.210  1.00 23.01 ? 273  TYR A C     1 
ATOM   2252 O  O     . TYR A 1 273 ? -6.699  17.399  38.054  1.00 22.46 ? 273  TYR A O     1 
ATOM   2253 C  CB    . TYR A 1 273 ? -8.788  19.091  39.681  1.00 21.71 ? 273  TYR A CB    1 
ATOM   2254 C  CG    . TYR A 1 273 ? -9.100  19.719  38.337  1.00 22.96 ? 273  TYR A CG    1 
ATOM   2255 C  CD1   . TYR A 1 273 ? -8.076  20.144  37.476  1.00 24.16 ? 273  TYR A CD1   1 
ATOM   2256 C  CD2   . TYR A 1 273 ? -10.415 19.838  37.900  1.00 23.73 ? 273  TYR A CD2   1 
ATOM   2257 C  CE1   . TYR A 1 273 ? -8.369  20.694  36.219  1.00 24.16 ? 273  TYR A CE1   1 
ATOM   2258 C  CE2   . TYR A 1 273 ? -10.718 20.382  36.646  1.00 23.55 ? 273  TYR A CE2   1 
ATOM   2259 C  CZ    . TYR A 1 273 ? -9.696  20.807  35.814  1.00 26.58 ? 273  TYR A CZ    1 
ATOM   2260 O  OH    . TYR A 1 273 ? -10.009 21.339  34.579  1.00 23.17 ? 273  TYR A OH    1 
ATOM   2261 N  N     . ILE A 1 274 ? -6.277  16.936  40.209  1.00 23.01 ? 274  ILE A N     1 
ATOM   2262 C  CA    . ILE A 1 274 ? -4.887  16.555  39.917  1.00 23.27 ? 274  ILE A CA    1 
ATOM   2263 C  C     . ILE A 1 274 ? -4.854  15.367  38.940  1.00 21.64 ? 274  ILE A C     1 
ATOM   2264 O  O     . ILE A 1 274 ? -4.067  15.349  37.991  1.00 20.94 ? 274  ILE A O     1 
ATOM   2265 C  CB    . ILE A 1 274 ? -4.046  16.257  41.193  1.00 23.79 ? 274  ILE A CB    1 
ATOM   2266 C  CG1   . ILE A 1 274 ? -2.552  16.228  40.845  1.00 26.40 ? 274  ILE A CG1   1 
ATOM   2267 C  CG2   . ILE A 1 274 ? -4.494  14.942  41.857  1.00 27.31 ? 274  ILE A CG2   1 
ATOM   2268 C  CD1   . ILE A 1 274 ? -1.629  15.997  42.052  1.00 31.10 ? 274  ILE A CD1   1 
ATOM   2269 N  N     . ASP A 1 275 ? -5.741  14.403  39.161  1.00 21.09 ? 275  ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 275 ? -5.833  13.225  38.309  1.00 24.47 ? 275  ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 275 ? -6.445  13.589  36.951  1.00 23.86 ? 275  ASP A C     1 
ATOM   2272 O  O     . ASP A 1 275 ? -5.957  13.135  35.916  1.00 21.58 ? 275  ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 275 ? -6.610  12.097  39.015  1.00 22.39 ? 275  ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 275 ? -5.865  11.549  40.248  1.00 24.53 ? 275  ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 275 ? -4.619  11.545  40.258  1.00 24.76 ? 275  ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 275 ? -6.523  11.107  41.209  1.00 28.29 ? 275  ASP A OD2   1 
ATOM   2277 N  N     . LEU A 1 276 ? -7.489  14.419  36.945  1.00 22.05 ? 276  LEU A N     1 
ATOM   2278 C  CA    . LEU A 1 276 ? -8.012  14.930  35.666  1.00 23.50 ? 276  LEU A CA    1 
ATOM   2279 C  C     . LEU A 1 276 ? -6.888  15.611  34.858  1.00 23.11 ? 276  LEU A C     1 
ATOM   2280 O  O     . LEU A 1 276 ? -6.718  15.355  33.662  1.00 25.39 ? 276  LEU A O     1 
ATOM   2281 C  CB    . LEU A 1 276 ? -9.178  15.907  35.896  1.00 23.23 ? 276  LEU A CB    1 
ATOM   2282 C  CG    . LEU A 1 276 ? -10.531 15.355  36.371  1.00 26.28 ? 276  LEU A CG    1 
ATOM   2283 C  CD1   . LEU A 1 276 ? -11.497 16.478  36.685  1.00 24.23 ? 276  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU A 1 276 ? -11.144 14.418  35.325  1.00 27.36 ? 276  LEU A CD2   1 
ATOM   2285 N  N     . TYR A 1 277 ? -6.108  16.455  35.528  1.00 21.68 ? 277  TYR A N     1 
ATOM   2286 C  CA    . TYR A 1 277 ? -5.001  17.169  34.892  1.00 21.69 ? 277  TYR A CA    1 
ATOM   2287 C  C     . TYR A 1 277 ? -3.953  16.191  34.350  1.00 21.89 ? 277  TYR A C     1 
ATOM   2288 O  O     . TYR A 1 277 ? -3.539  16.297  33.204  1.00 23.82 ? 277  TYR A O     1 
ATOM   2289 C  CB    . TYR A 1 277 ? -4.364  18.157  35.875  1.00 20.01 ? 277  TYR A CB    1 
ATOM   2290 C  CG    . TYR A 1 277 ? -3.349  19.094  35.252  1.00 21.70 ? 277  TYR A CG    1 
ATOM   2291 C  CD1   . TYR A 1 277 ? -3.750  20.320  34.726  1.00 19.59 ? 277  TYR A CD1   1 
ATOM   2292 C  CD2   . TYR A 1 277 ? -1.987  18.760  35.200  1.00 19.26 ? 277  TYR A CD2   1 
ATOM   2293 C  CE1   . TYR A 1 277 ? -2.837  21.191  34.157  1.00 20.39 ? 277  TYR A CE1   1 
ATOM   2294 C  CE2   . TYR A 1 277 ? -1.052  19.632  34.636  1.00 19.86 ? 277  TYR A CE2   1 
ATOM   2295 C  CZ    . TYR A 1 277 ? -1.490  20.841  34.113  1.00 22.68 ? 277  TYR A CZ    1 
ATOM   2296 O  OH    . TYR A 1 277 ? -0.605  21.715  33.550  1.00 20.11 ? 277  TYR A OH    1 
ATOM   2297 N  N     . LYS A 1 278 ? -3.539  15.223  35.161  1.00 22.55 ? 278  LYS A N     1 
ATOM   2298 C  CA    . LYS A 1 278 ? -2.547  14.246  34.698  1.00 22.84 ? 278  LYS A CA    1 
ATOM   2299 C  C     . LYS A 1 278 ? -3.000  13.470  33.461  1.00 21.92 ? 278  LYS A C     1 
ATOM   2300 O  O     . LYS A 1 278 ? -2.189  13.153  32.588  1.00 21.40 ? 278  LYS A O     1 
ATOM   2301 C  CB    . LYS A 1 278 ? -2.161  13.281  35.821  1.00 22.56 ? 278  LYS A CB    1 
ATOM   2302 C  CG    . LYS A 1 278 ? -1.140  13.878  36.780  1.00 28.47 ? 278  LYS A CG    1 
ATOM   2303 C  CD    . LYS A 1 278 ? -1.032  13.056  38.058  1.00 26.71 ? 278  LYS A CD    1 
ATOM   2304 C  CE    . LYS A 1 278 ? -0.068  13.698  39.042  1.00 28.20 ? 278  LYS A CE    1 
ATOM   2305 N  NZ    . LYS A 1 278 ? -0.045  12.943  40.322  1.00 30.04 ? 278  LYS A NZ    1 
ATOM   2306 N  N     . LYS A 1 279 ? -4.289  13.137  33.395  1.00 22.42 ? 279  LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 279 ? -4.792  12.370  32.259  1.00 22.72 ? 279  LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 279 ? -4.956  13.227  31.009  1.00 23.36 ? 279  LYS A C     1 
ATOM   2309 O  O     . LYS A 1 279 ? -4.609  12.800  29.909  1.00 26.51 ? 279  LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 279 ? -6.118  11.679  32.595  1.00 24.31 ? 279  LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 279 ? -6.664  10.795  31.454  1.00 23.15 ? 279  LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 279 ? -7.911  10.067  31.875  1.00 26.75 ? 279  LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 279 ? -8.680  9.512   30.675  1.00 27.26 ? 279  LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 279 ? -8.004  8.383   30.019  1.00 20.62 ? 279  LYS A NZ    1 
ATOM   2315 N  N     . PHE A 1 280 ? -5.474  14.440  31.177  1.00 22.94 ? 280  PHE A N     1 
ATOM   2316 C  CA    . PHE A 1 280 ? -5.999  15.178  30.032  1.00 23.95 ? 280  PHE A CA    1 
ATOM   2317 C  C     . PHE A 1 280 ? -5.128  16.314  29.512  1.00 22.41 ? 280  PHE A C     1 
ATOM   2318 O  O     . PHE A 1 280 ? -5.355  16.782  28.401  1.00 24.48 ? 280  PHE A O     1 
ATOM   2319 C  CB    . PHE A 1 280 ? -7.400  15.732  30.353  1.00 23.19 ? 280  PHE A CB    1 
ATOM   2320 C  CG    . PHE A 1 280 ? -8.468  14.677  30.576  1.00 22.03 ? 280  PHE A CG    1 
ATOM   2321 C  CD1   . PHE A 1 280 ? -9.353  14.793  31.644  1.00 23.87 ? 280  PHE A CD1   1 
ATOM   2322 C  CD2   . PHE A 1 280 ? -8.632  13.619  29.691  1.00 25.08 ? 280  PHE A CD2   1 
ATOM   2323 C  CE1   . PHE A 1 280 ? -10.370 13.849  31.850  1.00 25.19 ? 280  PHE A CE1   1 
ATOM   2324 C  CE2   . PHE A 1 280 ? -9.645  12.673  29.878  1.00 28.62 ? 280  PHE A CE2   1 
ATOM   2325 C  CZ    . PHE A 1 280 ? -10.517 12.789  30.966  1.00 26.32 ? 280  PHE A CZ    1 
ATOM   2326 N  N     . SER A 1 281 ? -4.164  16.777  30.308  1.00 21.69 ? 281  SER A N     1 
ATOM   2327 C  CA    . SER A 1 281 ? -3.391  17.986  29.963  1.00 21.86 ? 281  SER A CA    1 
ATOM   2328 C  C     . SER A 1 281 ? -2.272  17.768  28.957  1.00 22.78 ? 281  SER A C     1 
ATOM   2329 O  O     . SER A 1 281 ? -1.873  18.711  28.275  1.00 22.79 ? 281  SER A O     1 
ATOM   2330 C  CB    . SER A 1 281 ? -2.801  18.639  31.220  1.00 22.62 ? 281  SER A CB    1 
ATOM   2331 O  OG    . SER A 1 281 ? -1.750  17.851  31.756  1.00 23.84 ? 281  SER A OG    1 
ATOM   2332 N  N     . PHE A 1 282 ? -1.784  16.529  28.875  1.00 22.32 ? 282  PHE A N     1 
ATOM   2333 C  CA    . PHE A 1 282 ? -0.619  16.157  28.073  1.00 26.84 ? 282  PHE A CA    1 
ATOM   2334 C  C     . PHE A 1 282 ? 0.596   17.032  28.331  1.00 29.56 ? 282  PHE A C     1 
ATOM   2335 O  O     . PHE A 1 282 ? 1.203   17.590  27.418  1.00 27.98 ? 282  PHE A O     1 
ATOM   2336 C  CB    . PHE A 1 282 ? -0.965  15.974  26.584  1.00 29.89 ? 282  PHE A CB    1 
ATOM   2337 C  CG    . PHE A 1 282 ? -1.821  14.774  26.346  1.00 31.26 ? 282  PHE A CG    1 
ATOM   2338 C  CD1   . PHE A 1 282 ? -1.246  13.508  26.249  1.00 33.86 ? 282  PHE A CD1   1 
ATOM   2339 C  CD2   . PHE A 1 282 ? -3.207  14.889  26.319  1.00 30.13 ? 282  PHE A CD2   1 
ATOM   2340 C  CE1   . PHE A 1 282 ? -2.040  12.379  26.088  1.00 35.51 ? 282  PHE A CE1   1 
ATOM   2341 C  CE2   . PHE A 1 282 ? -4.009  13.767  26.150  1.00 31.54 ? 282  PHE A CE2   1 
ATOM   2342 C  CZ    . PHE A 1 282 ? -3.424  12.507  26.037  1.00 29.33 ? 282  PHE A CZ    1 
ATOM   2343 N  N     . THR A 1 283 ? 0.916   17.129  29.618  1.00 30.03 ? 283  THR A N     1 
ATOM   2344 C  CA    . THR A 1 283 ? 2.128   17.736  30.111  1.00 32.53 ? 283  THR A CA    1 
ATOM   2345 C  C     . THR A 1 283 ? 2.755   16.702  31.044  1.00 36.37 ? 283  THR A C     1 
ATOM   2346 O  O     . THR A 1 283 ? 2.096   15.744  31.470  1.00 36.30 ? 283  THR A O     1 
ATOM   2347 C  CB    . THR A 1 283 ? 1.838   19.014  30.934  1.00 32.52 ? 283  THR A CB    1 
ATOM   2348 O  OG1   . THR A 1 283 ? 1.161   18.654  32.144  1.00 34.00 ? 283  THR A OG1   1 
ATOM   2349 C  CG2   . THR A 1 283 ? 0.991   20.034  30.138  1.00 27.84 ? 283  THR A CG2   1 
ATOM   2350 N  N     . ASN A 1 284 ? 4.036   16.875  31.339  1.00 37.31 ? 284  ASN A N     1 
ATOM   2351 C  CA    . ASN A 1 284 ? 4.649   16.183  32.458  1.00 37.80 ? 284  ASN A CA    1 
ATOM   2352 C  C     . ASN A 1 284 ? 5.370   17.276  33.215  1.00 36.61 ? 284  ASN A C     1 
ATOM   2353 O  O     . ASN A 1 284 ? 6.305   17.892  32.696  1.00 37.53 ? 284  ASN A O     1 
ATOM   2354 C  CB    . ASN A 1 284 ? 5.603   15.075  31.999  1.00 39.63 ? 284  ASN A CB    1 
ATOM   2355 C  CG    . ASN A 1 284 ? 6.009   14.130  33.136  1.00 42.05 ? 284  ASN A CG    1 
ATOM   2356 O  OD1   . ASN A 1 284 ? 5.548   14.255  34.275  1.00 39.48 ? 284  ASN A OD1   1 
ATOM   2357 N  ND2   . ASN A 1 284 ? 6.870   13.174  32.820  1.00 40.70 ? 284  ASN A ND2   1 
ATOM   2358 N  N     . GLN A 1 285 ? 4.905   17.532  34.432  1.00 32.33 ? 285  GLN A N     1 
ATOM   2359 C  CA    . GLN A 1 285 ? 5.344   18.691  35.188  1.00 29.90 ? 285  GLN A CA    1 
ATOM   2360 C  C     . GLN A 1 285 ? 6.420   18.342  36.207  1.00 29.38 ? 285  GLN A C     1 
ATOM   2361 O  O     . GLN A 1 285 ? 6.364   17.265  36.805  1.00 28.14 ? 285  GLN A O     1 
ATOM   2362 C  CB    . GLN A 1 285 ? 4.135   19.304  35.899  1.00 29.95 ? 285  GLN A CB    1 
ATOM   2363 C  CG    . GLN A 1 285 ? 3.045   19.756  34.948  1.00 29.76 ? 285  GLN A CG    1 
ATOM   2364 C  CD    . GLN A 1 285 ? 3.398   21.038  34.232  1.00 32.68 ? 285  GLN A CD    1 
ATOM   2365 O  OE1   . GLN A 1 285 ? 4.521   21.540  34.333  1.00 34.49 ? 285  GLN A OE1   1 
ATOM   2366 N  NE2   . GLN A 1 285 ? 2.432   21.590  33.511  1.00 31.14 ? 285  GLN A NE2   1 
ATOM   2367 N  N     . PRO A 1 286 ? 7.386   19.265  36.435  1.00 27.75 ? 286  PRO A N     1 
ATOM   2368 C  CA    . PRO A 1 286 ? 8.386   19.098  37.505  1.00 27.83 ? 286  PRO A CA    1 
ATOM   2369 C  C     . PRO A 1 286 ? 7.738   18.967  38.886  1.00 27.33 ? 286  PRO A C     1 
ATOM   2370 O  O     . PRO A 1 286 ? 8.326   18.383  39.785  1.00 30.83 ? 286  PRO A O     1 
ATOM   2371 C  CB    . PRO A 1 286 ? 9.209   20.390  37.448  1.00 27.78 ? 286  PRO A CB    1 
ATOM   2372 C  CG    . PRO A 1 286 ? 8.904   21.007  36.147  1.00 27.46 ? 286  PRO A CG    1 
ATOM   2373 C  CD    . PRO A 1 286 ? 7.565   20.530  35.698  1.00 28.28 ? 286  PRO A CD    1 
ATOM   2374 N  N     . SER A 1 287 ? 6.532   19.496  39.039  1.00 24.83 ? 287  SER A N     1 
ATOM   2375 C  CA    . SER A 1 287 ? 5.800   19.433  40.306  1.00 25.68 ? 287  SER A CA    1 
ATOM   2376 C  C     . SER A 1 287 ? 4.304   19.524  40.083  1.00 25.99 ? 287  SER A C     1 
ATOM   2377 O  O     . SER A 1 287 ? 3.853   20.181  39.146  1.00 25.84 ? 287  SER A O     1 
ATOM   2378 C  CB    . SER A 1 287 ? 6.231   20.568  41.231  1.00 25.41 ? 287  SER A CB    1 
ATOM   2379 O  OG    . SER A 1 287 ? 5.311   20.716  42.290  1.00 27.91 ? 287  SER A OG    1 
ATOM   2380 N  N     . TYR A 1 288 ? 3.543   18.886  40.970  1.00 26.59 ? 288  TYR A N     1 
ATOM   2381 C  CA    . TYR A 1 288 ? 2.076   18.955  40.935  1.00 29.43 ? 288  TYR A CA    1 
ATOM   2382 C  C     . TYR A 1 288 ? 1.414   19.637  42.139  1.00 30.47 ? 288  TYR A C     1 
ATOM   2383 O  O     . TYR A 1 288 ? 0.233   19.408  42.417  1.00 33.53 ? 288  TYR A O     1 
ATOM   2384 C  CB    . TYR A 1 288 ? 1.476   17.566  40.690  1.00 28.59 ? 288  TYR A CB    1 
ATOM   2385 C  CG    . TYR A 1 288 ? 1.739   17.102  39.281  1.00 30.39 ? 288  TYR A CG    1 
ATOM   2386 C  CD1   . TYR A 1 288 ? 2.931   16.453  38.958  1.00 31.06 ? 288  TYR A CD1   1 
ATOM   2387 C  CD2   . TYR A 1 288 ? 0.814   17.342  38.259  1.00 26.91 ? 288  TYR A CD2   1 
ATOM   2388 C  CE1   . TYR A 1 288 ? 3.195   16.045  37.659  1.00 31.32 ? 288  TYR A CE1   1 
ATOM   2389 C  CE2   . TYR A 1 288 ? 1.073   16.943  36.953  1.00 27.93 ? 288  TYR A CE2   1 
ATOM   2390 C  CZ    . TYR A 1 288 ? 2.264   16.291  36.666  1.00 26.92 ? 288  TYR A CZ    1 
ATOM   2391 O  OH    . TYR A 1 288 ? 2.539   15.889  35.384  1.00 29.56 ? 288  TYR A OH    1 
ATOM   2392 N  N     . SER A 1 289 ? 2.157   20.489  42.837  1.00 31.82 ? 289  SER A N     1 
ATOM   2393 C  CA    . SER A 1 289 ? 1.532   21.352  43.840  1.00 34.31 ? 289  SER A CA    1 
ATOM   2394 C  C     . SER A 1 289 ? 0.634   22.341  43.108  1.00 36.14 ? 289  SER A C     1 
ATOM   2395 O  O     . SER A 1 289 ? 0.909   22.710  41.956  1.00 35.93 ? 289  SER A O     1 
ATOM   2396 C  CB    . SER A 1 289 ? 2.573   22.095  44.679  1.00 32.73 ? 289  SER A CB    1 
ATOM   2397 O  OG    . SER A 1 289 ? 3.220   23.089  43.915  1.00 39.17 ? 289  SER A OG    1 
ATOM   2398 N  N     . LEU A 1 290 ? -0.434  22.768  43.771  1.00 33.82 ? 290  LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 290 ? -1.400  23.656  43.143  1.00 31.85 ? 290  LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 290 ? -0.778  24.988  42.711  1.00 31.53 ? 290  LEU A C     1 
ATOM   2401 O  O     . LEU A 1 290 ? -1.109  25.510  41.641  1.00 29.12 ? 290  LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 290 ? -2.626  23.861  44.047  1.00 29.70 ? 290  LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 290 ? -3.788  24.687  43.489  1.00 28.97 ? 290  LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 290 ? -4.265  24.164  42.140  1.00 25.25 ? 290  LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 290 ? -4.943  24.723  44.482  1.00 26.12 ? 290  LEU A CD2   1 
ATOM   2406 N  N     . ASP A 1 291 ? 0.122   25.532  43.526  1.00 31.92 ? 291  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 291 ? 0.803   26.782  43.167  1.00 36.09 ? 291  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 291 ? 1.593   26.630  41.874  1.00 33.69 ? 291  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 291 ? 1.540   27.496  41.004  1.00 32.93 ? 291  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 291 ? 1.730   27.261  44.285  1.00 41.58 ? 291  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 291 ? 0.989   28.023  45.363  1.00 50.35 ? 291  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 291 ? 0.263   27.379  46.153  1.00 51.85 ? 291  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 291 ? 1.131   29.266  45.414  1.00 54.47 ? 291  ASP A OD2   1 
ATOM   2414 N  N     . TYR A 1 292 ? 2.306   25.516  41.754  1.00 31.07 ? 292  TYR A N     1 
ATOM   2415 C  CA    . TYR A 1 292 ? 3.076   25.242  40.557  1.00 31.16 ? 292  TYR A CA    1 
ATOM   2416 C  C     . TYR A 1 292 ? 2.180   25.155  39.324  1.00 29.50 ? 292  TYR A C     1 
ATOM   2417 O  O     . TYR A 1 292 ? 2.425   25.834  38.324  1.00 28.25 ? 292  TYR A O     1 
ATOM   2418 C  CB    . TYR A 1 292 ? 3.885   23.954  40.703  1.00 30.63 ? 292  TYR A CB    1 
ATOM   2419 C  CG    . TYR A 1 292 ? 5.021   23.921  39.734  1.00 28.95 ? 292  TYR A CG    1 
ATOM   2420 C  CD1   . TYR A 1 292 ? 4.855   23.397  38.452  1.00 24.58 ? 292  TYR A CD1   1 
ATOM   2421 C  CD2   . TYR A 1 292 ? 6.258   24.460  40.080  1.00 28.88 ? 292  TYR A CD2   1 
ATOM   2422 C  CE1   . TYR A 1 292 ? 5.914   23.394  37.544  1.00 28.21 ? 292  TYR A CE1   1 
ATOM   2423 C  CE2   . TYR A 1 292 ? 7.311   24.466  39.183  1.00 29.53 ? 292  TYR A CE2   1 
ATOM   2424 C  CZ    . TYR A 1 292 ? 7.135   23.931  37.924  1.00 25.97 ? 292  TYR A CZ    1 
ATOM   2425 O  OH    . TYR A 1 292 ? 8.189   23.932  37.053  1.00 35.78 ? 292  TYR A OH    1 
ATOM   2426 N  N     . ILE A 1 293 ? 1.138   24.331  39.406  1.00 26.66 ? 293  ILE A N     1 
ATOM   2427 C  CA    . ILE A 1 293 ? 0.238   24.161  38.280  1.00 25.00 ? 293  ILE A CA    1 
ATOM   2428 C  C     . ILE A 1 293 ? -0.497  25.464  37.931  1.00 26.52 ? 293  ILE A C     1 
ATOM   2429 O  O     . ILE A 1 293 ? -0.640  25.799  36.753  1.00 26.03 ? 293  ILE A O     1 
ATOM   2430 C  CB    . ILE A 1 293 ? -0.747  22.992  38.512  1.00 23.99 ? 293  ILE A CB    1 
ATOM   2431 C  CG1   . ILE A 1 293 ? 0.023   21.670  38.699  1.00 19.63 ? 293  ILE A CG1   1 
ATOM   2432 C  CG2   . ILE A 1 293 ? -1.746  22.900  37.367  1.00 22.26 ? 293  ILE A CG2   1 
ATOM   2433 C  CD1   . ILE A 1 293 ? 0.955   21.291  37.543  1.00 21.19 ? 293  ILE A CD1   1 
ATOM   2434 N  N     . SER A 1 294 ? -0.932  26.198  38.957  1.00 28.30 ? 294  SER A N     1 
ATOM   2435 C  CA    . SER A 1 294 ? -1.671  27.444  38.775  1.00 29.83 ? 294  SER A CA    1 
ATOM   2436 C  C     . SER A 1 294 ? -0.827  28.464  38.064  1.00 30.03 ? 294  SER A C     1 
ATOM   2437 O  O     . SER A 1 294 ? -1.294  29.141  37.149  1.00 30.04 ? 294  SER A O     1 
ATOM   2438 C  CB    . SER A 1 294 ? -2.137  28.019  40.118  1.00 29.14 ? 294  SER A CB    1 
ATOM   2439 O  OG    . SER A 1 294 ? -3.116  27.170  40.685  1.00 33.95 ? 294  SER A OG    1 
ATOM   2440 N  N     . GLU A 1 295 ? 0.422   28.565  38.496  1.00 31.26 ? 295  GLU A N     1 
ATOM   2441 C  CA    . GLU A 1 295 ? 1.373   29.468  37.893  1.00 32.90 ? 295  GLU A CA    1 
ATOM   2442 C  C     . GLU A 1 295 ? 1.574   29.088  36.433  1.00 30.57 ? 295  GLU A C     1 
ATOM   2443 O  O     . GLU A 1 295 ? 1.516   29.949  35.558  1.00 32.07 ? 295  GLU A O     1 
ATOM   2444 C  CB    . GLU A 1 295 ? 2.683   29.465  38.699  1.00 37.06 ? 295  GLU A CB    1 
ATOM   2445 C  CG    . GLU A 1 295 ? 3.974   29.591  37.891  1.00 49.80 ? 295  GLU A CG    1 
ATOM   2446 C  CD    . GLU A 1 295 ? 4.423   31.018  37.669  1.00 58.52 ? 295  GLU A CD    1 
ATOM   2447 O  OE1   . GLU A 1 295 ? 3.628   31.828  37.136  1.00 62.24 ? 295  GLU A OE1   1 
ATOM   2448 O  OE2   . GLU A 1 295 ? 5.589   31.322  38.017  1.00 60.67 ? 295  GLU A OE2   1 
ATOM   2449 N  N     . PHE A 1 296 ? 1.760   27.797  36.168  1.00 27.64 ? 296  PHE A N     1 
ATOM   2450 C  CA    . PHE A 1 296 ? 2.011   27.340  34.804  1.00 28.72 ? 296  PHE A CA    1 
ATOM   2451 C  C     . PHE A 1 296 ? 0.824   27.662  33.891  1.00 27.50 ? 296  PHE A C     1 
ATOM   2452 O  O     . PHE A 1 296 ? 1.001   28.172  32.792  1.00 28.22 ? 296  PHE A O     1 
ATOM   2453 C  CB    . PHE A 1 296 ? 2.323   25.836  34.776  1.00 27.70 ? 296  PHE A CB    1 
ATOM   2454 C  CG    . PHE A 1 296 ? 2.569   25.291  33.391  1.00 29.13 ? 296  PHE A CG    1 
ATOM   2455 C  CD1   . PHE A 1 296 ? 3.842   25.365  32.816  1.00 30.38 ? 296  PHE A CD1   1 
ATOM   2456 C  CD2   . PHE A 1 296 ? 1.534   24.701  32.666  1.00 28.76 ? 296  PHE A CD2   1 
ATOM   2457 C  CE1   . PHE A 1 296 ? 4.080   24.867  31.534  1.00 30.30 ? 296  PHE A CE1   1 
ATOM   2458 C  CE2   . PHE A 1 296 ? 1.753   24.196  31.382  1.00 31.36 ? 296  PHE A CE2   1 
ATOM   2459 C  CZ    . PHE A 1 296 ? 3.031   24.284  30.811  1.00 33.23 ? 296  PHE A CZ    1 
ATOM   2460 N  N     . GLU A 1 297 ? -0.381  27.364  34.366  1.00 26.81 ? 297  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 297 ? -1.583  27.467  33.550  1.00 24.86 ? 297  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 297 ? -2.109  28.900  33.443  1.00 26.14 ? 297  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 297 ? -2.575  29.304  32.382  1.00 23.69 ? 297  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 297 ? -2.680  26.568  34.120  1.00 23.86 ? 297  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 297 ? -2.380  25.070  34.057  1.00 23.65 ? 297  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 297 ? -2.462  24.505  32.646  1.00 23.87 ? 297  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 297 ? -3.245  25.025  31.816  1.00 26.17 ? 297  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 297 ? -1.746  23.530  32.367  1.00 27.36 ? 297  GLU A OE2   1 
ATOM   2469 N  N     . LEU A 1 298 ? -2.048  29.654  34.540  1.00 23.75 ? 298  LEU A N     1 
ATOM   2470 C  CA    . LEU A 1 298 ? -2.702  30.965  34.601  1.00 25.87 ? 298  LEU A CA    1 
ATOM   2471 C  C     . LEU A 1 298 ? -1.737  32.147  34.656  1.00 28.65 ? 298  LEU A C     1 
ATOM   2472 O  O     . LEU A 1 298 ? -2.164  33.296  34.531  1.00 27.28 ? 298  LEU A O     1 
ATOM   2473 C  CB    . LEU A 1 298 ? -3.621  31.033  35.824  1.00 23.68 ? 298  LEU A CB    1 
ATOM   2474 C  CG    . LEU A 1 298 ? -4.544  29.837  36.044  1.00 20.70 ? 298  LEU A CG    1 
ATOM   2475 C  CD1   . LEU A 1 298 ? -5.081  29.817  37.480  1.00 20.74 ? 298  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU A 1 298 ? -5.669  29.859  35.013  1.00 18.63 ? 298  LEU A CD2   1 
ATOM   2477 N  N     . ASN A 1 299 ? -0.448  31.871  34.859  1.00 29.48 ? 299  ASN A N     1 
ATOM   2478 C  CA    . ASN A 1 299 ? 0.532   32.931  35.122  1.00 37.17 ? 299  ASN A CA    1 
ATOM   2479 C  C     . ASN A 1 299 ? 0.125   33.810  36.307  1.00 38.48 ? 299  ASN A C     1 
ATOM   2480 O  O     . ASN A 1 299 ? 0.201   35.035  36.239  1.00 40.13 ? 299  ASN A O     1 
ATOM   2481 C  CB    . ASN A 1 299 ? 0.791   33.792  33.870  1.00 39.33 ? 299  ASN A CB    1 
ATOM   2482 C  CG    . ASN A 1 299 ? 1.486   33.020  32.765  1.00 47.22 ? 299  ASN A CG    1 
ATOM   2483 O  OD1   . ASN A 1 299 ? 2.543   32.409  32.973  1.00 53.94 ? 299  ASN A OD1   1 
ATOM   2484 N  ND2   . ASN A 1 299 ? 0.896   33.042  31.577  1.00 50.14 ? 299  ASN A ND2   1 
ATOM   2485 N  N     . VAL A 1 300 ? -0.324  33.167  37.380  1.00 39.52 ? 300  VAL A N     1 
ATOM   2486 C  CA    . VAL A 1 300 ? -0.626  33.855  38.629  1.00 43.95 ? 300  VAL A CA    1 
ATOM   2487 C  C     . VAL A 1 300 ? 0.562   33.674  39.563  1.00 48.50 ? 300  VAL A C     1 
ATOM   2488 O  O     . VAL A 1 300 ? 1.229   32.632  39.536  1.00 48.89 ? 300  VAL A O     1 
ATOM   2489 C  CB    . VAL A 1 300 ? -1.923  33.335  39.302  1.00 41.68 ? 300  VAL A CB    1 
ATOM   2490 C  CG1   . VAL A 1 300 ? -3.151  33.853  38.575  1.00 39.97 ? 300  VAL A CG1   1 
ATOM   2491 C  CG2   . VAL A 1 300 ? -1.941  31.800  39.380  1.00 43.15 ? 300  VAL A CG2   1 
ATOM   2492 N  N     . GLY A 1 301 ? 0.840   34.697  40.368  1.00 52.52 ? 301  GLY A N     1 
ATOM   2493 C  CA    . GLY A 1 301 ? 1.960   34.646  41.305  1.00 57.20 ? 301  GLY A CA    1 
ATOM   2494 C  C     . GLY A 1 301 ? 1.707   33.657  42.426  1.00 59.63 ? 301  GLY A C     1 
ATOM   2495 O  O     . GLY A 1 301 ? 0.559   33.443  42.824  1.00 58.76 ? 301  GLY A O     1 
ATOM   2496 N  N     . LYS A 1 302 ? 2.782   33.051  42.928  1.00 63.34 ? 302  LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 302 ? 2.716   32.164  44.096  1.00 66.22 ? 302  LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 302 ? 2.104   32.888  45.308  1.00 67.55 ? 302  LYS A C     1 
ATOM   2499 O  O     . LYS A 1 302 ? 2.388   34.071  45.543  1.00 67.72 ? 302  LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 302 ? 4.119   31.646  44.441  1.00 67.52 ? 302  LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 302 ? 4.151   30.477  45.432  1.00 68.57 ? 302  LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 302 ? 5.580   30.030  45.756  1.00 70.46 ? 302  LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 302 ? 6.253   30.952  46.769  1.00 71.14 ? 302  LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 302 ? 7.632   30.491  47.105  1.00 71.13 ? 302  LYS A NZ    1 
ATOM   2505 N  N     . LEU A 1 303 ? 1.256   32.181  46.057  1.00 67.64 ? 303  LEU A N     1 
ATOM   2506 C  CA    . LEU A 1 303 ? 0.701   32.708  47.309  1.00 68.58 ? 303  LEU A CA    1 
ATOM   2507 C  C     . LEU A 1 303 ? 1.808   32.890  48.351  1.00 69.07 ? 303  LEU A C     1 
ATOM   2508 O  O     . LEU A 1 303 ? 2.247   31.914  48.975  1.00 70.29 ? 303  LEU A O     1 
ATOM   2509 C  CB    . LEU A 1 303 ? -0.381  31.777  47.875  1.00 67.89 ? 303  LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1 303 ? -1.798  31.672  47.296  1.00 66.96 ? 303  LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1 303 ? -2.245  32.942  46.565  1.00 66.49 ? 303  LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1 303 ? -1.929  30.428  46.423  1.00 68.12 ? 303  LEU A CD2   1 
ATOM   2513 N  N     . LYS A 1 304 ? 2.256   34.132  48.531  1.00 67.41 ? 304  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 304 ? 3.336   34.428  49.466  1.00 66.79 ? 304  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 304 ? 2.836   34.455  50.911  1.00 64.86 ? 304  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 304 ? 1.801   35.056  51.207  1.00 64.72 ? 304  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 304 ? 3.999   35.766  49.123  1.00 68.64 ? 304  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 304 ? 5.302   36.037  49.890  1.00 71.87 ? 304  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 304 ? 5.327   37.448  50.479  1.00 75.17 ? 304  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 304 ? 4.528   37.521  51.785  1.00 76.70 ? 304  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 304 ? 4.009   38.889  52.070  1.00 77.37 ? 304  LYS A NZ    1 
ATOM   2522 N  N     . TYR A 1 305 ? 3.575   33.786  51.794  1.00 62.51 ? 305  TYR A N     1 
ATOM   2523 C  CA    . TYR A 1 305 ? 3.424   33.932  53.243  1.00 60.68 ? 305  TYR A CA    1 
ATOM   2524 C  C     . TYR A 1 305 ? 4.764   33.684  53.926  1.00 60.61 ? 305  TYR A C     1 
ATOM   2525 O  O     . TYR A 1 305 ? 5.661   33.075  53.336  1.00 60.02 ? 305  TYR A O     1 
ATOM   2526 C  CB    . TYR A 1 305 ? 2.331   33.007  53.807  1.00 61.29 ? 305  TYR A CB    1 
ATOM   2527 C  CG    . TYR A 1 305 ? 2.505   31.529  53.501  1.00 61.51 ? 305  TYR A CG    1 
ATOM   2528 C  CD1   . TYR A 1 305 ? 3.184   30.684  54.387  1.00 61.04 ? 305  TYR A CD1   1 
ATOM   2529 C  CD2   . TYR A 1 305 ? 1.973   30.973  52.335  1.00 60.73 ? 305  TYR A CD2   1 
ATOM   2530 C  CE1   . TYR A 1 305 ? 3.344   29.325  54.110  1.00 60.13 ? 305  TYR A CE1   1 
ATOM   2531 C  CE2   . TYR A 1 305 ? 2.125   29.615  52.046  1.00 60.69 ? 305  TYR A CE2   1 
ATOM   2532 C  CZ    . TYR A 1 305 ? 2.810   28.800  52.936  1.00 60.79 ? 305  TYR A CZ    1 
ATOM   2533 O  OH    . TYR A 1 305 ? 2.957   27.465  52.648  1.00 57.24 ? 305  TYR A OH    1 
ATOM   2534 N  N     . ASP A 1 306 ? 4.899   34.174  55.160  1.00 60.51 ? 306  ASP A N     1 
ATOM   2535 C  CA    . ASP A 1 306 ? 6.100   33.950  55.969  1.00 59.67 ? 306  ASP A CA    1 
ATOM   2536 C  C     . ASP A 1 306 ? 5.906   32.770  56.917  1.00 59.16 ? 306  ASP A C     1 
ATOM   2537 O  O     . ASP A 1 306 ? 4.798   32.528  57.411  1.00 57.96 ? 306  ASP A O     1 
ATOM   2538 C  CB    . ASP A 1 306 ? 6.450   35.195  56.788  1.00 60.03 ? 306  ASP A CB    1 
ATOM   2539 C  CG    . ASP A 1 306 ? 6.533   36.463  55.947  1.00 62.73 ? 306  ASP A CG    1 
ATOM   2540 O  OD1   . ASP A 1 306 ? 6.395   37.554  56.537  1.00 63.42 ? 306  ASP A OD1   1 
ATOM   2541 O  OD2   . ASP A 1 306 ? 6.740   36.383  54.715  1.00 62.93 ? 306  ASP A OD2   1 
ATOM   2542 N  N     . GLY A 1 307 ? 6.991   32.048  57.181  1.00 58.79 ? 307  GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 307 ? 6.957   30.904  58.089  1.00 57.94 ? 307  GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 307 ? 6.363   29.662  57.447  1.00 56.72 ? 307  GLY A C     1 
ATOM   2545 O  O     . GLY A 1 307 ? 5.915   29.706  56.294  1.00 56.66 ? 307  GLY A O     1 
ATOM   2546 N  N     . PRO A 1 308 ? 6.356   28.537  58.186  1.00 55.15 ? 308  PRO A N     1 
ATOM   2547 C  CA    . PRO A 1 308 ? 5.779   27.304  57.649  1.00 52.85 ? 308  PRO A CA    1 
ATOM   2548 C  C     . PRO A 1 308 ? 4.254   27.347  57.706  1.00 50.52 ? 308  PRO A C     1 
ATOM   2549 O  O     . PRO A 1 308 ? 3.690   28.100  58.496  1.00 50.49 ? 308  PRO A O     1 
ATOM   2550 C  CB    . PRO A 1 308 ? 6.319   26.228  58.588  1.00 53.92 ? 308  PRO A CB    1 
ATOM   2551 C  CG    . PRO A 1 308 ? 6.528   26.940  59.898  1.00 55.01 ? 308  PRO A CG    1 
ATOM   2552 C  CD    . PRO A 1 308 ? 6.831   28.380  59.575  1.00 55.46 ? 308  PRO A CD    1 
ATOM   2553 N  N     . ILE A 1 309 ? 3.597   26.550  56.869  1.00 49.12 ? 309  ILE A N     1 
ATOM   2554 C  CA    . ILE A 1 309 ? 2.134   26.485  56.851  1.00 48.03 ? 309  ILE A CA    1 
ATOM   2555 C  C     . ILE A 1 309 ? 1.584   26.074  58.222  1.00 46.73 ? 309  ILE A C     1 
ATOM   2556 O  O     . ILE A 1 309 ? 0.493   26.482  58.608  1.00 44.80 ? 309  ILE A O     1 
ATOM   2557 C  CB    . ILE A 1 309 ? 1.618   25.561  55.695  1.00 48.18 ? 309  ILE A CB    1 
ATOM   2558 C  CG1   . ILE A 1 309 ? 0.301   26.089  55.089  1.00 48.53 ? 309  ILE A CG1   1 
ATOM   2559 C  CG2   . ILE A 1 309 ? 1.591   24.086  56.107  1.00 48.48 ? 309  ILE A CG2   1 
ATOM   2560 C  CD1   . ILE A 1 309 ? -0.979  25.643  55.790  1.00 48.82 ? 309  ILE A CD1   1 
ATOM   2561 N  N     . SER A 1 310 ? 2.376   25.295  58.958  1.00 46.62 ? 310  SER A N     1 
ATOM   2562 C  CA    . SER A 1 310 ? 2.000   24.783  60.270  1.00 45.34 ? 310  SER A CA    1 
ATOM   2563 C  C     . SER A 1 310 ? 1.932   25.852  61.373  1.00 43.94 ? 310  SER A C     1 
ATOM   2564 O  O     . SER A 1 310 ? 1.366   25.608  62.443  1.00 41.96 ? 310  SER A O     1 
ATOM   2565 C  CB    . SER A 1 310 ? 2.962   23.664  60.679  1.00 47.91 ? 310  SER A CB    1 
ATOM   2566 O  OG    . SER A 1 310 ? 4.282   24.155  60.828  1.00 50.90 ? 310  SER A OG    1 
ATOM   2567 N  N     . LYS A 1 311 ? 2.515   27.021  61.116  1.00 40.87 ? 311  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 311 ? 2.421   28.147  62.045  1.00 40.66 ? 311  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 311 ? 1.640   29.315  61.442  1.00 38.26 ? 311  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 311 ? 1.505   30.367  62.067  1.00 36.51 ? 311  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 311 ? 3.814   28.616  62.482  1.00 42.76 ? 311  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 311 ? 4.584   27.599  63.302  1.00 48.70 ? 311  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 311 ? 5.694   28.273  64.102  1.00 57.06 ? 311  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 311 ? 6.184   27.390  65.252  1.00 60.03 ? 311  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 311 ? 6.903   26.171  64.774  1.00 63.49 ? 311  LYS A NZ    1 
ATOM   2576 N  N     . LEU A 1 312 ? 1.122   29.121  60.231  1.00 36.14 ? 312  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 312 ? 0.442   30.189  59.508  1.00 36.36 ? 312  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 312 ? -0.896  30.600  60.126  1.00 35.69 ? 312  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 312 ? -1.183  31.789  60.216  1.00 36.37 ? 312  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 312 ? 0.286   29.842  58.020  1.00 38.32 ? 312  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 312 ? -0.370  30.893  57.115  1.00 38.42 ? 312  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 312 ? 0.366   32.243  57.151  1.00 38.44 ? 312  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 312 ? -0.469  30.370  55.688  1.00 39.33 ? 312  LEU A CD2   1 
ATOM   2584 N  N     . ARG A 1 313 ? -1.703  29.633  60.553  1.00 33.52 ? 313  ARG A N     1 
ATOM   2585 C  CA    . ARG A 1 313 ? -2.994  29.948  61.172  1.00 34.53 ? 313  ARG A CA    1 
ATOM   2586 C  C     . ARG A 1 313 ? -2.865  30.852  62.402  1.00 36.04 ? 313  ARG A C     1 
ATOM   2587 O  O     . ARG A 1 313 ? -3.574  31.852  62.516  1.00 34.95 ? 313  ARG A O     1 
ATOM   2588 C  CB    . ARG A 1 313 ? -3.778  28.675  61.526  1.00 33.49 ? 313  ARG A CB    1 
ATOM   2589 C  CG    . ARG A 1 313 ? -5.156  28.944  62.131  1.00 33.76 ? 313  ARG A CG    1 
ATOM   2590 C  CD    . ARG A 1 313 ? -5.913  27.638  62.433  1.00 36.81 ? 313  ARG A CD    1 
ATOM   2591 N  NE    . ARG A 1 313 ? -7.135  27.860  63.215  1.00 31.38 ? 313  ARG A NE    1 
ATOM   2592 C  CZ    . ARG A 1 313 ? -7.164  27.944  64.546  1.00 33.74 ? 313  ARG A CZ    1 
ATOM   2593 N  NH1   . ARG A 1 313 ? -6.044  27.818  65.240  1.00 29.78 ? 313  ARG A NH1   1 
ATOM   2594 N  NH2   . ARG A 1 313 ? -8.312  28.150  65.189  1.00 32.02 ? 313  ARG A NH2   1 
ATOM   2595 N  N     . GLU A 1 314 ? -1.975  30.504  63.328  1.00 38.04 ? 314  GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 314 ? -1.833  31.323  64.536  1.00 40.86 ? 314  GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 314 ? -1.129  32.655  64.289  1.00 37.58 ? 314  GLU A C     1 
ATOM   2598 O  O     . GLU A 1 314 ? -1.442  33.639  64.954  1.00 37.59 ? 314  GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 314 ? -1.176  30.556  65.695  1.00 47.01 ? 314  GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 314 ? 0.241   30.036  65.418  1.00 56.55 ? 314  GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 314 ? 1.059   29.836  66.689  1.00 61.40 ? 314  GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 314 ? 0.664   30.372  67.750  1.00 65.13 ? 314  GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 314 ? 2.103   29.149  66.623  1.00 63.26 ? 314  GLU A OE2   1 
ATOM   2604 N  N     . SER A 1 315 ? -0.199  32.696  63.339  1.00 33.52 ? 315  SER A N     1 
ATOM   2605 C  CA    . SER A 1 315 ? 0.543   33.934  63.077  1.00 36.00 ? 315  SER A CA    1 
ATOM   2606 C  C     . SER A 1 315 ? -0.227  34.884  62.171  1.00 36.19 ? 315  SER A C     1 
ATOM   2607 O  O     . SER A 1 315 ? -0.135  36.095  62.332  1.00 39.87 ? 315  SER A O     1 
ATOM   2608 C  CB    . SER A 1 315 ? 1.931   33.656  62.498  1.00 35.38 ? 315  SER A CB    1 
ATOM   2609 O  OG    . SER A 1 315 ? 1.851   32.948  61.273  1.00 37.97 ? 315  SER A OG    1 
ATOM   2610 N  N     . ASN A 1 316 ? -0.999  34.327  61.235  1.00 34.88 ? 316  ASN A N     1 
ATOM   2611 C  CA    . ASN A 1 316 ? -1.768  35.121  60.286  1.00 33.96 ? 316  ASN A CA    1 
ATOM   2612 C  C     . ASN A 1 316 ? -2.997  34.368  59.777  1.00 32.46 ? 316  ASN A C     1 
ATOM   2613 O  O     . ASN A 1 316 ? -3.070  33.999  58.600  1.00 30.83 ? 316  ASN A O     1 
ATOM   2614 C  CB    . ASN A 1 316 ? -0.877  35.565  59.113  1.00 33.34 ? 316  ASN A CB    1 
ATOM   2615 C  CG    . ASN A 1 316 ? -1.425  36.788  58.388  1.00 34.13 ? 316  ASN A CG    1 
ATOM   2616 O  OD1   . ASN A 1 316 ? -2.585  37.165  58.557  1.00 35.77 ? 316  ASN A OD1   1 
ATOM   2617 N  ND2   . ASN A 1 316 ? -0.591  37.405  57.568  1.00 30.93 ? 316  ASN A ND2   1 
ATOM   2618 N  N     . HIS A 1 317 ? -3.962  34.165  60.674  1.00 31.49 ? 317  HIS A N     1 
ATOM   2619 C  CA    . HIS A 1 317 ? -5.236  33.512  60.365  1.00 28.56 ? 317  HIS A CA    1 
ATOM   2620 C  C     . HIS A 1 317 ? -5.960  34.187  59.205  1.00 29.80 ? 317  HIS A C     1 
ATOM   2621 O  O     . HIS A 1 317 ? -6.602  33.516  58.386  1.00 29.30 ? 317  HIS A O     1 
ATOM   2622 C  CB    . HIS A 1 317 ? -6.137  33.476  61.609  1.00 28.61 ? 317  HIS A CB    1 
ATOM   2623 C  CG    . HIS A 1 317 ? -7.515  32.946  61.349  1.00 28.06 ? 317  HIS A CG    1 
ATOM   2624 N  ND1   . HIS A 1 317 ? -8.627  33.761  61.294  1.00 27.58 ? 317  HIS A ND1   1 
ATOM   2625 C  CD2   . HIS A 1 317 ? -7.959  31.688  61.110  1.00 26.16 ? 317  HIS A CD2   1 
ATOM   2626 C  CE1   . HIS A 1 317 ? -9.698  33.027  61.055  1.00 27.70 ? 317  HIS A CE1   1 
ATOM   2627 N  NE2   . HIS A 1 317 ? -9.320  31.766  60.931  1.00 28.78 ? 317  HIS A NE2   1 
ATOM   2628 N  N     . GLN A 1 318 ? -5.854  35.513  59.151  1.00 29.33 ? 318  GLN A N     1 
ATOM   2629 C  CA    . GLN A 1 318 ? -6.390  36.314  58.061  1.00 30.53 ? 318  GLN A CA    1 
ATOM   2630 C  C     . GLN A 1 318 ? -5.908  35.802  56.708  1.00 31.07 ? 318  GLN A C     1 
ATOM   2631 O  O     . GLN A 1 318 ? -6.718  35.532  55.825  1.00 31.79 ? 318  GLN A O     1 
ATOM   2632 C  CB    . GLN A 1 318 ? -6.021  37.797  58.245  1.00 31.53 ? 318  GLN A CB    1 
ATOM   2633 C  CG    . GLN A 1 318 ? -6.385  38.713  57.062  1.00 32.04 ? 318  GLN A CG    1 
ATOM   2634 C  CD    . GLN A 1 318 ? -7.882  38.753  56.763  1.00 32.19 ? 318  GLN A CD    1 
ATOM   2635 O  OE1   . GLN A 1 318 ? -8.710  38.795  57.670  1.00 29.99 ? 318  GLN A OE1   1 
ATOM   2636 N  NE2   . GLN A 1 318 ? -8.229  38.751  55.483  1.00 28.05 ? 318  GLN A NE2   1 
ATOM   2637 N  N     . ARG A 1 319 ? -4.598  35.641  56.551  1.00 33.18 ? 319  ARG A N     1 
ATOM   2638 C  CA    . ARG A 1 319 ? -4.051  35.157  55.282  1.00 32.12 ? 319  ARG A CA    1 
ATOM   2639 C  C     . ARG A 1 319 ? -4.351  33.675  55.087  1.00 30.19 ? 319  ARG A C     1 
ATOM   2640 O  O     . ARG A 1 319 ? -4.597  33.227  53.963  1.00 28.53 ? 319  ARG A O     1 
ATOM   2641 C  CB    . ARG A 1 319 ? -2.552  35.427  55.179  1.00 33.13 ? 319  ARG A CB    1 
ATOM   2642 C  CG    . ARG A 1 319 ? -1.976  35.065  53.820  1.00 41.28 ? 319  ARG A CG    1 
ATOM   2643 C  CD    . ARG A 1 319 ? -0.802  35.923  53.451  1.00 46.24 ? 319  ARG A CD    1 
ATOM   2644 N  NE    . ARG A 1 319 ? -1.232  37.249  53.029  1.00 49.97 ? 319  ARG A NE    1 
ATOM   2645 C  CZ    . ARG A 1 319 ? -0.406  38.274  52.866  1.00 55.10 ? 319  ARG A CZ    1 
ATOM   2646 N  NH1   . ARG A 1 319 ? 0.895   38.122  53.089  1.00 57.06 ? 319  ARG A NH1   1 
ATOM   2647 N  NH2   . ARG A 1 319 ? -0.880  39.451  52.483  1.00 57.29 ? 319  ARG A NH2   1 
ATOM   2648 N  N     . TYR A 1 320 ? -4.341  32.930  56.189  1.00 29.95 ? 320  TYR A N     1 
ATOM   2649 C  CA    . TYR A 1 320 ? -4.653  31.494  56.192  1.00 28.13 ? 320  TYR A CA    1 
ATOM   2650 C  C     . TYR A 1 320 ? -5.973  31.180  55.512  1.00 27.67 ? 320  TYR A C     1 
ATOM   2651 O  O     . TYR A 1 320 ? -6.050  30.288  54.669  1.00 27.65 ? 320  TYR A O     1 
ATOM   2652 C  CB    . TYR A 1 320 ? -4.730  31.020  57.630  1.00 27.35 ? 320  TYR A CB    1 
ATOM   2653 C  CG    . TYR A 1 320 ? -4.760  29.524  57.875  1.00 25.67 ? 320  TYR A CG    1 
ATOM   2654 C  CD1   . TYR A 1 320 ? -3.619  28.749  57.710  1.00 24.64 ? 320  TYR A CD1   1 
ATOM   2655 C  CD2   . TYR A 1 320 ? -5.907  28.906  58.370  1.00 24.73 ? 320  TYR A CD2   1 
ATOM   2656 C  CE1   . TYR A 1 320 ? -3.625  27.380  57.987  1.00 25.81 ? 320  TYR A CE1   1 
ATOM   2657 C  CE2   . TYR A 1 320 ? -5.927  27.530  58.658  1.00 24.34 ? 320  TYR A CE2   1 
ATOM   2658 C  CZ    . TYR A 1 320 ? -4.780  26.782  58.469  1.00 23.58 ? 320  TYR A CZ    1 
ATOM   2659 O  OH    . TYR A 1 320 ? -4.782  25.437  58.754  1.00 29.42 ? 320  TYR A OH    1 
ATOM   2660 N  N     . ILE A 1 321 ? -7.018  31.902  55.897  1.00 28.22 ? 321  ILE A N     1 
ATOM   2661 C  CA    . ILE A 1 321 ? -8.348  31.664  55.339  1.00 26.98 ? 321  ILE A CA    1 
ATOM   2662 C  C     . ILE A 1 321 ? -8.427  32.148  53.897  1.00 26.42 ? 321  ILE A C     1 
ATOM   2663 O  O     . ILE A 1 321 ? -8.976  31.453  53.038  1.00 25.90 ? 321  ILE A O     1 
ATOM   2664 C  CB    . ILE A 1 321 ? -9.444  32.316  56.200  1.00 28.21 ? 321  ILE A CB    1 
ATOM   2665 C  CG1   . ILE A 1 321 ? -9.501  31.657  57.593  1.00 26.99 ? 321  ILE A CG1   1 
ATOM   2666 C  CG2   . ILE A 1 321 ? -10.796 32.286  55.488  1.00 28.72 ? 321  ILE A CG2   1 
ATOM   2667 C  CD1   . ILE A 1 321 ? -9.771  30.147  57.600  1.00 26.13 ? 321  ILE A CD1   1 
ATOM   2668 N  N     . SER A 1 322 ? -7.868  33.326  53.628  1.00 26.87 ? 322  SER A N     1 
ATOM   2669 C  CA    . SER A 1 322 ? -7.855  33.853  52.269  1.00 28.49 ? 322  SER A CA    1 
ATOM   2670 C  C     . SER A 1 322 ? -7.193  32.881  51.284  1.00 28.34 ? 322  SER A C     1 
ATOM   2671 O  O     . SER A 1 322 ? -7.656  32.717  50.155  1.00 28.80 ? 322  SER A O     1 
ATOM   2672 C  CB    . SER A 1 322 ? -7.186  35.223  52.225  1.00 28.49 ? 322  SER A CB    1 
ATOM   2673 O  OG    . SER A 1 322 ? -8.032  36.220  52.784  1.00 32.51 ? 322  SER A OG    1 
ATOM   2674 N  N     . TYR A 1 323 ? -6.132  32.216  51.729  1.00 29.64 ? 323  TYR A N     1 
ATOM   2675 C  CA    . TYR A 1 323 ? -5.378  31.310  50.868  1.00 31.32 ? 323  TYR A CA    1 
ATOM   2676 C  C     . TYR A 1 323 ? -6.121  30.005  50.637  1.00 30.51 ? 323  TYR A C     1 
ATOM   2677 O  O     . TYR A 1 323 ? -6.016  29.414  49.563  1.00 30.47 ? 323  TYR A O     1 
ATOM   2678 C  CB    . TYR A 1 323 ? -3.951  31.116  51.402  1.00 35.09 ? 323  TYR A CB    1 
ATOM   2679 C  CG    . TYR A 1 323 ? -3.042  32.299  51.044  1.00 43.08 ? 323  TYR A CG    1 
ATOM   2680 C  CD1   . TYR A 1 323 ? -1.660  32.239  51.238  1.00 47.72 ? 323  TYR A CD1   1 
ATOM   2681 C  CD2   . TYR A 1 323 ? -3.575  33.477  50.483  1.00 45.18 ? 323  TYR A CD2   1 
ATOM   2682 C  CE1   . TYR A 1 323 ? -0.835  33.328  50.896  1.00 48.26 ? 323  TYR A CE1   1 
ATOM   2683 C  CE2   . TYR A 1 323 ? -2.765  34.558  50.131  1.00 44.58 ? 323  TYR A CE2   1 
ATOM   2684 C  CZ    . TYR A 1 323 ? -1.402  34.478  50.341  1.00 49.68 ? 323  TYR A CZ    1 
ATOM   2685 O  OH    . TYR A 1 323 ? -0.610  35.554  50.004  1.00 55.25 ? 323  TYR A OH    1 
ATOM   2686 N  N     . ASN A 1 324 ? -6.900  29.583  51.632  1.00 27.75 ? 324  ASN A N     1 
ATOM   2687 C  CA    . ASN A 1 324 ? -7.826  28.463  51.470  1.00 26.42 ? 324  ASN A CA    1 
ATOM   2688 C  C     . ASN A 1 324 ? -8.926  28.774  50.440  1.00 26.39 ? 324  ASN A C     1 
ATOM   2689 O  O     . ASN A 1 324 ? -9.270  27.916  49.637  1.00 24.71 ? 324  ASN A O     1 
ATOM   2690 C  CB    . ASN A 1 324 ? -8.429  28.074  52.822  1.00 25.40 ? 324  ASN A CB    1 
ATOM   2691 C  CG    . ASN A 1 324 ? -9.439  26.921  52.723  1.00 29.26 ? 324  ASN A CG    1 
ATOM   2692 O  OD1   . ASN A 1 324 ? -10.621 27.092  53.025  1.00 29.08 ? 324  ASN A OD1   1 
ATOM   2693 N  ND2   . ASN A 1 324 ? -8.966  25.745  52.330  1.00 30.99 ? 324  ASN A ND2   1 
ATOM   2694 N  N     . ILE A 1 325 ? -9.467  29.996  50.458  1.00 24.68 ? 325  ILE A N     1 
ATOM   2695 C  CA    . ILE A 1 325 ? -10.445 30.412  49.437  1.00 24.20 ? 325  ILE A CA    1 
ATOM   2696 C  C     . ILE A 1 325 ? -9.805  30.462  48.036  1.00 24.58 ? 325  ILE A C     1 
ATOM   2697 O  O     . ILE A 1 325 ? -10.359 29.921  47.061  1.00 21.84 ? 325  ILE A O     1 
ATOM   2698 C  CB    . ILE A 1 325 ? -11.116 31.774  49.778  1.00 24.29 ? 325  ILE A CB    1 
ATOM   2699 C  CG1   . ILE A 1 325 ? -11.893 31.680  51.098  1.00 25.16 ? 325  ILE A CG1   1 
ATOM   2700 C  CG2   . ILE A 1 325 ? -12.055 32.246  48.644  1.00 22.15 ? 325  ILE A CG2   1 
ATOM   2701 C  CD1   . ILE A 1 325 ? -12.331 33.043  51.671  1.00 24.58 ? 325  ILE A CD1   1 
ATOM   2702 N  N     . ILE A 1 326 ? -8.646  31.114  47.939  1.00 23.41 ? 326  ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 326 ? -7.939  31.239  46.661  1.00 23.00 ? 326  ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 326 ? -7.584  29.849  46.091  1.00 22.57 ? 326  ILE A C     1 
ATOM   2705 O  O     . ILE A 1 326 ? -7.709  29.619  44.894  1.00 24.53 ? 326  ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 326 ? -6.698  32.161  46.776  1.00 23.62 ? 326  ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 326 ? -7.138  33.607  47.091  1.00 25.92 ? 326  ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 326 ? -5.852  32.093  45.505  1.00 25.68 ? 326  ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 326 ? -5.987  34.606  47.406  1.00 27.29 ? 326  ILE A CD1   1 
ATOM   2710 N  N     . ALA A 1 327 ? -7.189  28.924  46.956  1.00 22.34 ? 327  ALA A N     1 
ATOM   2711 C  CA    . ALA A 1 327 ? -6.906  27.559  46.533  1.00 24.40 ? 327  ALA A CA    1 
ATOM   2712 C  C     . ALA A 1 327 ? -8.081  26.918  45.771  1.00 24.89 ? 327  ALA A C     1 
ATOM   2713 O  O     . ALA A 1 327 ? -7.874  26.246  44.766  1.00 25.26 ? 327  ALA A O     1 
ATOM   2714 C  CB    . ALA A 1 327 ? -6.509  26.705  47.723  1.00 24.72 ? 327  ALA A CB    1 
ATOM   2715 N  N     . VAL A 1 328 ? -9.305  27.151  46.234  1.00 23.54 ? 328  VAL A N     1 
ATOM   2716 C  CA    . VAL A 1 328 ? -10.497 26.583  45.587  1.00 25.68 ? 328  VAL A CA    1 
ATOM   2717 C  C     . VAL A 1 328 ? -10.766 27.239  44.229  1.00 24.33 ? 328  VAL A C     1 
ATOM   2718 O  O     . VAL A 1 328 ? -11.054 26.565  43.232  1.00 23.89 ? 328  VAL A O     1 
ATOM   2719 C  CB    . VAL A 1 328 ? -11.728 26.693  46.512  1.00 26.53 ? 328  VAL A CB    1 
ATOM   2720 C  CG1   . VAL A 1 328 ? -13.032 26.417  45.749  1.00 25.97 ? 328  VAL A CG1   1 
ATOM   2721 C  CG2   . VAL A 1 328 ? -11.569 25.734  47.693  1.00 25.73 ? 328  VAL A CG2   1 
ATOM   2722 N  N     . TYR A 1 329 ? -10.651 28.556  44.207  1.00 24.06 ? 329  TYR A N     1 
ATOM   2723 C  CA    . TYR A 1 329 ? -10.831 29.334  43.005  1.00 24.30 ? 329  TYR A CA    1 
ATOM   2724 C  C     . TYR A 1 329 ? -9.792  29.004  41.921  1.00 25.21 ? 329  TYR A C     1 
ATOM   2725 O  O     . TYR A 1 329 ? -10.139 28.973  40.747  1.00 29.05 ? 329  TYR A O     1 
ATOM   2726 C  CB    . TYR A 1 329 ? -10.835 30.824  43.350  1.00 23.56 ? 329  TYR A CB    1 
ATOM   2727 C  CG    . TYR A 1 329 ? -11.176 31.723  42.181  1.00 24.74 ? 329  TYR A CG    1 
ATOM   2728 C  CD1   . TYR A 1 329 ? -12.237 31.425  41.331  1.00 21.78 ? 329  TYR A CD1   1 
ATOM   2729 C  CD2   . TYR A 1 329 ? -10.445 32.883  41.939  1.00 23.10 ? 329  TYR A CD2   1 
ATOM   2730 C  CE1   . TYR A 1 329 ? -12.553 32.253  40.255  1.00 23.14 ? 329  TYR A CE1   1 
ATOM   2731 C  CE2   . TYR A 1 329 ? -10.751 33.714  40.865  1.00 27.27 ? 329  TYR A CE2   1 
ATOM   2732 C  CZ    . TYR A 1 329 ? -11.806 33.393  40.035  1.00 23.75 ? 329  TYR A CZ    1 
ATOM   2733 O  OH    . TYR A 1 329 ? -12.120 34.219  38.985  1.00 28.69 ? 329  TYR A OH    1 
ATOM   2734 N  N     . ARG A 1 330 ? -8.536  28.745  42.302  1.00 26.62 ? 330  ARG A N     1 
ATOM   2735 C  CA    A ARG A 1 330 ? -7.510  28.380  41.317  0.50 25.93 ? 330  ARG A CA    1 
ATOM   2736 C  CA    B ARG A 1 330 ? -7.492  28.373  41.330  0.50 25.19 ? 330  ARG A CA    1 
ATOM   2737 C  C     . ARG A 1 330 ? -7.887  27.128  40.525  1.00 24.70 ? 330  ARG A C     1 
ATOM   2738 O  O     . ARG A 1 330 ? -7.724  27.084  39.311  1.00 24.94 ? 330  ARG A O     1 
ATOM   2739 C  CB    A ARG A 1 330 ? -6.120  28.275  41.962  0.50 26.14 ? 330  ARG A CB    1 
ATOM   2740 C  CB    B ARG A 1 330 ? -6.129  28.169  42.012  0.50 24.52 ? 330  ARG A CB    1 
ATOM   2741 C  CG    A ARG A 1 330 ? -5.545  29.651  42.310  0.50 27.02 ? 330  ARG A CG    1 
ATOM   2742 C  CG    B ARG A 1 330 ? -5.495  29.430  42.637  0.50 22.60 ? 330  ARG A CG    1 
ATOM   2743 C  CD    A ARG A 1 330 ? -4.104  29.641  42.786  0.50 24.94 ? 330  ARG A CD    1 
ATOM   2744 C  CD    B ARG A 1 330 ? -5.295  30.571  41.631  0.50 20.14 ? 330  ARG A CD    1 
ATOM   2745 N  NE    A ARG A 1 330 ? -3.613  31.016  42.915  0.50 29.31 ? 330  ARG A NE    1 
ATOM   2746 N  NE    B ARG A 1 330 ? -4.525  31.684  42.200  0.50 17.24 ? 330  ARG A NE    1 
ATOM   2747 C  CZ    A ARG A 1 330 ? -2.336  31.366  43.050  0.50 27.78 ? 330  ARG A CZ    1 
ATOM   2748 C  CZ    B ARG A 1 330 ? -4.884  32.966  42.148  0.50 18.81 ? 330  ARG A CZ    1 
ATOM   2749 N  NH1   A ARG A 1 330 ? -1.378  30.446  43.084  0.50 25.28 ? 330  ARG A NH1   1 
ATOM   2750 N  NH1   B ARG A 1 330 ? -6.003  33.328  41.535  0.50 14.87 ? 330  ARG A NH1   1 
ATOM   2751 N  NH2   A ARG A 1 330 ? -2.020  32.647  43.155  0.50 26.09 ? 330  ARG A NH2   1 
ATOM   2752 N  NH2   B ARG A 1 330 ? -4.114  33.895  42.703  0.50 14.97 ? 330  ARG A NH2   1 
ATOM   2753 N  N     . VAL A 1 331 ? -8.416  26.114  41.197  1.00 24.31 ? 331  VAL A N     1 
ATOM   2754 C  CA    . VAL A 1 331 ? -8.880  24.926  40.478  1.00 24.26 ? 331  VAL A CA    1 
ATOM   2755 C  C     . VAL A 1 331 ? -10.018 25.298  39.507  1.00 25.82 ? 331  VAL A C     1 
ATOM   2756 O  O     . VAL A 1 331 ? -10.045 24.830  38.368  1.00 27.85 ? 331  VAL A O     1 
ATOM   2757 C  CB    . VAL A 1 331 ? -9.311  23.790  41.435  1.00 26.46 ? 331  VAL A CB    1 
ATOM   2758 C  CG1   . VAL A 1 331 ? -9.845  22.583  40.653  1.00 25.66 ? 331  VAL A CG1   1 
ATOM   2759 C  CG2   . VAL A 1 331 ? -8.147  23.370  42.337  1.00 23.32 ? 331  VAL A CG2   1 
ATOM   2760 N  N     . LEU A 1 332 ? -10.926 26.167  39.939  1.00 22.65 ? 332  LEU A N     1 
ATOM   2761 C  CA    . LEU A 1 332 ? -11.993 26.640  39.054  1.00 24.49 ? 332  LEU A CA    1 
ATOM   2762 C  C     . LEU A 1 332 ? -11.472 27.435  37.856  1.00 22.80 ? 332  LEU A C     1 
ATOM   2763 O  O     . LEU A 1 332 ? -12.043 27.369  36.769  1.00 23.16 ? 332  LEU A O     1 
ATOM   2764 C  CB    . LEU A 1 332 ? -13.004 27.481  39.820  1.00 20.97 ? 332  LEU A CB    1 
ATOM   2765 C  CG    . LEU A 1 332 ? -13.830 26.791  40.898  1.00 27.21 ? 332  LEU A CG    1 
ATOM   2766 C  CD1   . LEU A 1 332 ? -14.556 27.863  41.701  1.00 24.02 ? 332  LEU A CD1   1 
ATOM   2767 C  CD2   . LEU A 1 332 ? -14.809 25.739  40.307  1.00 22.40 ? 332  LEU A CD2   1 
ATOM   2768 N  N     . GLN A 1 333 ? -10.391 28.183  38.059  1.00 22.21 ? 333  GLN A N     1 
ATOM   2769 C  CA    . GLN A 1 333 ? -9.802  28.976  36.978  1.00 24.65 ? 333  GLN A CA    1 
ATOM   2770 C  C     . GLN A 1 333 ? -9.109  28.087  35.967  1.00 23.23 ? 333  GLN A C     1 
ATOM   2771 O  O     . GLN A 1 333 ? -9.220  28.301  34.769  1.00 23.31 ? 333  GLN A O     1 
ATOM   2772 C  CB    . GLN A 1 333 ? -8.816  29.999  37.518  1.00 22.42 ? 333  GLN A CB    1 
ATOM   2773 C  CG    . GLN A 1 333 ? -9.473  31.133  38.262  1.00 23.90 ? 333  GLN A CG    1 
ATOM   2774 C  CD    . GLN A 1 333 ? -8.456  32.144  38.726  1.00 27.00 ? 333  GLN A CD    1 
ATOM   2775 O  OE1   . GLN A 1 333 ? -8.360  33.237  38.171  1.00 35.00 ? 333  GLN A OE1   1 
ATOM   2776 N  NE2   . GLN A 1 333 ? -7.672  31.779  39.720  1.00 25.53 ? 333  GLN A NE2   1 
ATOM   2777 N  N     . ILE A 1 334 ? -8.406  27.077  36.460  1.00 24.47 ? 334  ILE A N     1 
ATOM   2778 C  CA    . ILE A 1 334 ? -7.816  26.077  35.581  1.00 24.45 ? 334  ILE A CA    1 
ATOM   2779 C  C     . ILE A 1 334 ? -8.911  25.402  34.755  1.00 23.78 ? 334  ILE A C     1 
ATOM   2780 O  O     . ILE A 1 334 ? -8.764  25.222  33.540  1.00 22.68 ? 334  ILE A O     1 
ATOM   2781 C  CB    . ILE A 1 334 ? -7.011  25.045  36.391  1.00 24.56 ? 334  ILE A CB    1 
ATOM   2782 C  CG1   . ILE A 1 334 ? -5.790  25.739  37.014  1.00 22.91 ? 334  ILE A CG1   1 
ATOM   2783 C  CG2   . ILE A 1 334 ? -6.620  23.871  35.511  1.00 22.06 ? 334  ILE A CG2   1 
ATOM   2784 C  CD1   . ILE A 1 334 ? -5.294  25.115  38.296  1.00 18.87 ? 334  ILE A CD1   1 
ATOM   2785 N  N     . ASP A 1 335 ? -10.013 25.044  35.408  1.00 24.70 ? 335  ASP A N     1 
ATOM   2786 C  CA    . ASP A 1 335 ? -11.081 24.377  34.692  1.00 24.36 ? 335  ASP A CA    1 
ATOM   2787 C  C     . ASP A 1 335 ? -11.730 25.250  33.642  1.00 23.75 ? 335  ASP A C     1 
ATOM   2788 O  O     . ASP A 1 335 ? -12.009 24.759  32.551  1.00 24.71 ? 335  ASP A O     1 
ATOM   2789 C  CB    . ASP A 1 335 ? -12.151 23.785  35.593  1.00 25.33 ? 335  ASP A CB    1 
ATOM   2790 C  CG    . ASP A 1 335 ? -12.984 22.766  34.851  1.00 27.29 ? 335  ASP A CG    1 
ATOM   2791 O  OD1   . ASP A 1 335 ? -12.392 21.804  34.303  1.00 25.43 ? 335  ASP A OD1   1 
ATOM   2792 O  OD2   . ASP A 1 335 ? -14.206 22.952  34.754  1.00 23.88 ? 335  ASP A OD2   1 
ATOM   2793 N  N     . ALA A 1 336 ? -11.958 26.533  33.955  1.00 19.81 ? 336  ALA A N     1 
ATOM   2794 C  CA    . ALA A 1 336 ? -12.456 27.478  32.951  1.00 21.27 ? 336  ALA A CA    1 
ATOM   2795 C  C     . ALA A 1 336 ? -11.584 27.452  31.705  1.00 25.44 ? 336  ALA A C     1 
ATOM   2796 O  O     . ALA A 1 336 ? -12.084 27.587  30.579  1.00 26.10 ? 336  ALA A O     1 
ATOM   2797 C  CB    . ALA A 1 336 ? -12.526 28.918  33.517  1.00 23.41 ? 336  ALA A CB    1 
ATOM   2798 N  N     . LYS A 1 337 ? -10.276 27.277  31.906  1.00 25.48 ? 337  LYS A N     1 
ATOM   2799 C  CA    . LYS A 1 337 ? -9.343  27.217  30.786  1.00 24.27 ? 337  LYS A CA    1 
ATOM   2800 C  C     . LYS A 1 337 ? -9.317  25.831  30.113  1.00 22.10 ? 337  LYS A C     1 
ATOM   2801 O  O     . LYS A 1 337 ? -9.607  25.700  28.925  1.00 23.51 ? 337  LYS A O     1 
ATOM   2802 C  CB    . LYS A 1 337 ? -7.949  27.643  31.243  1.00 22.21 ? 337  LYS A CB    1 
ATOM   2803 C  CG    . LYS A 1 337 ? -6.921  27.535  30.164  1.00 23.65 ? 337  LYS A CG    1 
ATOM   2804 C  CD    . LYS A 1 337 ? -5.536  27.787  30.712  1.00 24.18 ? 337  LYS A CD    1 
ATOM   2805 C  CE    . LYS A 1 337 ? -4.508  27.692  29.596  1.00 25.56 ? 337  LYS A CE    1 
ATOM   2806 N  NZ    . LYS A 1 337 ? -3.135  27.574  30.156  1.00 28.74 ? 337  LYS A NZ    1 
ATOM   2807 N  N     . ARG A 1 338 ? -8.989  24.800  30.880  1.00 22.83 ? 338  ARG A N     1 
ATOM   2808 C  CA    . ARG A 1 338 ? -8.810  23.449  30.343  1.00 19.79 ? 338  ARG A CA    1 
ATOM   2809 C  C     . ARG A 1 338 ? -10.102 22.699  30.011  1.00 21.08 ? 338  ARG A C     1 
ATOM   2810 O  O     . ARG A 1 338 ? -10.110 21.855  29.118  1.00 20.13 ? 338  ARG A O     1 
ATOM   2811 C  CB    . ARG A 1 338 ? -7.968  22.605  31.303  1.00 21.00 ? 338  ARG A CB    1 
ATOM   2812 C  CG    . ARG A 1 338 ? -6.489  23.015  31.391  1.00 22.45 ? 338  ARG A CG    1 
ATOM   2813 C  CD    . ARG A 1 338 ? -5.746  22.858  30.063  1.00 20.37 ? 338  ARG A CD    1 
ATOM   2814 N  NE    . ARG A 1 338 ? -4.309  22.895  30.292  1.00 22.15 ? 338  ARG A NE    1 
ATOM   2815 C  CZ    . ARG A 1 338 ? -3.411  22.174  29.627  1.00 24.94 ? 338  ARG A CZ    1 
ATOM   2816 N  NH1   . ARG A 1 338 ? -3.790  21.330  28.664  1.00 21.42 ? 338  ARG A NH1   1 
ATOM   2817 N  NH2   . ARG A 1 338 ? -2.123  22.281  29.943  1.00 22.85 ? 338  ARG A NH2   1 
ATOM   2818 N  N     . GLN A 1 339 ? -11.174 22.977  30.750  1.00 21.68 ? 339  GLN A N     1 
ATOM   2819 C  CA    . GLN A 1 339 ? -12.488 22.333  30.553  1.00 22.19 ? 339  GLN A CA    1 
ATOM   2820 C  C     . GLN A 1 339 ? -12.487 20.799  30.656  1.00 21.32 ? 339  GLN A C     1 
ATOM   2821 O  O     . GLN A 1 339 ? -13.104 20.102  29.845  1.00 23.16 ? 339  GLN A O     1 
ATOM   2822 C  CB    . GLN A 1 339 ? -13.151 22.826  29.255  1.00 23.16 ? 339  GLN A CB    1 
ATOM   2823 C  CG    . GLN A 1 339 ? -13.322 24.360  29.216  1.00 28.42 ? 339  GLN A CG    1 
ATOM   2824 C  CD    . GLN A 1 339 ? -13.969 24.884  27.933  1.00 38.24 ? 339  GLN A CD    1 
ATOM   2825 O  OE1   . GLN A 1 339 ? -13.916 26.081  27.652  1.00 41.56 ? 339  GLN A OE1   1 
ATOM   2826 N  NE2   . GLN A 1 339 ? -14.574 23.993  27.151  1.00 41.35 ? 339  GLN A NE2   1 
ATOM   2827 N  N     . PHE A 1 340 ? -11.805 20.286  31.673  1.00 22.37 ? 340  PHE A N     1 
ATOM   2828 C  CA    . PHE A 1 340 ? -11.699 18.850  31.875  1.00 23.06 ? 340  PHE A CA    1 
ATOM   2829 C  C     . PHE A 1 340 ? -12.960 18.250  32.495  1.00 24.46 ? 340  PHE A C     1 
ATOM   2830 O  O     . PHE A 1 340 ? -13.219 17.063  32.320  1.00 23.85 ? 340  PHE A O     1 
ATOM   2831 C  CB    . PHE A 1 340 ? -10.458 18.476  32.717  1.00 23.57 ? 340  PHE A CB    1 
ATOM   2832 C  CG    . PHE A 1 340 ? -9.129  18.807  32.055  1.00 21.13 ? 340  PHE A CG    1 
ATOM   2833 C  CD1   . PHE A 1 340 ? -8.994  18.800  30.673  1.00 18.30 ? 340  PHE A CD1   1 
ATOM   2834 C  CD2   . PHE A 1 340 ? -8.003  19.085  32.831  1.00 21.03 ? 340  PHE A CD2   1 
ATOM   2835 C  CE1   . PHE A 1 340 ? -7.781  19.096  30.070  1.00 19.24 ? 340  PHE A CE1   1 
ATOM   2836 C  CE2   . PHE A 1 340 ? -6.777  19.377  32.244  1.00 19.39 ? 340  PHE A CE2   1 
ATOM   2837 C  CZ    . PHE A 1 340 ? -6.663  19.376  30.855  1.00 24.16 ? 340  PHE A CZ    1 
ATOM   2838 N  N     . ILE A 1 341 ? -13.732 19.062  33.219  1.00 25.19 ? 341  ILE A N     1 
ATOM   2839 C  CA    . ILE A 1 341 ? -14.995 18.597  33.805  1.00 26.83 ? 341  ILE A CA    1 
ATOM   2840 C  C     . ILE A 1 341 ? -16.033 18.375  32.696  1.00 25.25 ? 341  ILE A C     1 
ATOM   2841 O  O     . ILE A 1 341 ? -16.645 17.301  32.596  1.00 23.54 ? 341  ILE A O     1 
ATOM   2842 C  CB    . ILE A 1 341 ? -15.537 19.586  34.883  1.00 29.01 ? 341  ILE A CB    1 
ATOM   2843 C  CG1   . ILE A 1 341 ? -14.543 19.737  36.057  1.00 29.93 ? 341  ILE A CG1   1 
ATOM   2844 C  CG2   . ILE A 1 341 ? -16.949 19.175  35.366  1.00 26.58 ? 341  ILE A CG2   1 
ATOM   2845 C  CD1   . ILE A 1 341 ? -14.536 18.567  37.054  1.00 29.71 ? 341  ILE A CD1   1 
ATOM   2846 N  N     . ASN A 1 342 ? -16.204 19.403  31.868  1.00 26.43 ? 342  ASN A N     1 
ATOM   2847 C  CA    . ASN A 1 342 ? -17.023 19.345  30.659  1.00 25.45 ? 342  ASN A CA    1 
ATOM   2848 C  C     . ASN A 1 342 ? -16.701 18.115  29.811  1.00 23.30 ? 342  ASN A C     1 
ATOM   2849 O  O     . ASN A 1 342 ? -17.605 17.384  29.376  1.00 25.73 ? 342  ASN A O     1 
ATOM   2850 C  CB    . ASN A 1 342 ? -16.816 20.622  29.835  1.00 23.76 ? 342  ASN A CB    1 
ATOM   2851 C  CG    . ASN A 1 342 ? -17.547 20.584  28.515  1.00 32.60 ? 342  ASN A CG    1 
ATOM   2852 O  OD1   . ASN A 1 342 ? -18.773 20.746  28.469  1.00 29.37 ? 342  ASN A OD1   1 
ATOM   2853 N  ND2   . ASN A 1 342 ? -16.796 20.379  27.418  1.00 29.31 ? 342  ASN A ND2   1 
ATOM   2854 N  N     . LEU A 1 343 ? -15.410 17.887  29.594  1.00 23.17 ? 343  LEU A N     1 
ATOM   2855 C  CA    . LEU A 1 343 ? -14.925 16.701  28.882  1.00 20.94 ? 343  LEU A CA    1 
ATOM   2856 C  C     . LEU A 1 343 ? -15.370 15.408  29.541  1.00 20.14 ? 343  LEU A C     1 
ATOM   2857 O  O     . LEU A 1 343 ? -15.839 14.500  28.879  1.00 22.79 ? 343  LEU A O     1 
ATOM   2858 C  CB    . LEU A 1 343 ? -13.402 16.728  28.787  1.00 21.44 ? 343  LEU A CB    1 
ATOM   2859 C  CG    . LEU A 1 343 ? -12.729 15.483  28.174  1.00 24.27 ? 343  LEU A CG    1 
ATOM   2860 C  CD1   . LEU A 1 343 ? -12.992 15.345  26.647  1.00 20.37 ? 343  LEU A CD1   1 
ATOM   2861 C  CD2   . LEU A 1 343 ? -11.259 15.555  28.451  1.00 21.24 ? 343  LEU A CD2   1 
ATOM   2862 N  N     . SER A 1 344 ? -15.218 15.325  30.855  1.00 22.43 ? 344  SER A N     1 
ATOM   2863 C  CA    . SER A 1 344 ? -15.533 14.107  31.580  1.00 23.52 ? 344  SER A CA    1 
ATOM   2864 C  C     . SER A 1 344 ? -17.019 13.794  31.480  1.00 23.14 ? 344  SER A C     1 
ATOM   2865 O  O     . SER A 1 344 ? -17.413 12.639  31.276  1.00 25.21 ? 344  SER A O     1 
ATOM   2866 C  CB    . SER A 1 344 ? -15.111 14.254  33.047  1.00 22.97 ? 344  SER A CB    1 
ATOM   2867 O  OG    . SER A 1 344 ? -13.708 14.444  33.123  1.00 25.60 ? 344  SER A OG    1 
ATOM   2868 N  N     . LEU A 1 345 ? -17.840 14.827  31.633  1.00 21.67 ? 345  LEU A N     1 
ATOM   2869 C  CA    . LEU A 1 345 ? -19.288 14.674  31.517  1.00 24.04 ? 345  LEU A CA    1 
ATOM   2870 C  C     . LEU A 1 345 ? -19.678 14.208  30.109  1.00 23.43 ? 345  LEU A C     1 
ATOM   2871 O  O     . LEU A 1 345 ? -20.442 13.253  29.963  1.00 24.10 ? 345  LEU A O     1 
ATOM   2872 C  CB    . LEU A 1 345 ? -20.007 15.975  31.913  1.00 22.83 ? 345  LEU A CB    1 
ATOM   2873 C  CG    . LEU A 1 345 ? -19.867 16.416  33.377  1.00 24.67 ? 345  LEU A CG    1 
ATOM   2874 C  CD1   . LEU A 1 345 ? -20.297 17.890  33.576  1.00 22.53 ? 345  LEU A CD1   1 
ATOM   2875 C  CD2   . LEU A 1 345 ? -20.633 15.493  34.338  1.00 19.91 ? 345  LEU A CD2   1 
ATOM   2876 N  N     . ASP A 1 346 ? -19.120 14.854  29.082  1.00 26.07 ? 346  ASP A N     1 
ATOM   2877 C  CA    . ASP A 1 346 ? -19.334 14.443  27.689  1.00 24.92 ? 346  ASP A CA    1 
ATOM   2878 C  C     . ASP A 1 346 ? -19.019 12.952  27.473  1.00 26.77 ? 346  ASP A C     1 
ATOM   2879 O  O     . ASP A 1 346 ? -19.849 12.198  26.944  1.00 22.92 ? 346  ASP A O     1 
ATOM   2880 C  CB    . ASP A 1 346 ? -18.471 15.279  26.731  1.00 25.49 ? 346  ASP A CB    1 
ATOM   2881 C  CG    . ASP A 1 346 ? -19.038 16.678  26.469  1.00 30.38 ? 346  ASP A CG    1 
ATOM   2882 O  OD1   . ASP A 1 346 ? -20.118 17.027  26.980  1.00 31.91 ? 346  ASP A OD1   1 
ATOM   2883 O  OD2   . ASP A 1 346 ? -18.386 17.436  25.736  1.00 33.27 ? 346  ASP A OD2   1 
ATOM   2884 N  N     . MET A 1 347 ? -17.815 12.536  27.864  1.00 24.75 ? 347  MET A N     1 
ATOM   2885 C  CA    . MET A 1 347 ? -17.383 11.146  27.647  1.00 27.19 ? 347  MET A CA    1 
ATOM   2886 C  C     . MET A 1 347 ? -18.201 10.153  28.475  1.00 25.02 ? 347  MET A C     1 
ATOM   2887 O  O     . MET A 1 347 ? -18.630 9.112   27.966  1.00 24.58 ? 347  MET A O     1 
ATOM   2888 C  CB    . MET A 1 347 ? -15.893 10.983  27.950  1.00 30.03 ? 347  MET A CB    1 
ATOM   2889 C  CG    . MET A 1 347 ? -14.960 11.659  26.942  1.00 37.45 ? 347  MET A CG    1 
ATOM   2890 S  SD    . MET A 1 347 ? -13.215 11.542  27.410  1.00 51.35 ? 347  MET A SD    1 
ATOM   2891 C  CE    . MET A 1 347 ? -13.024 9.789   27.786  1.00 44.19 ? 347  MET A CE    1 
ATOM   2892 N  N     . GLY A 1 348 ? -18.401 10.484  29.750  1.00 23.52 ? 348  GLY A N     1 
ATOM   2893 C  CA    . GLY A 1 348 ? -19.190 9.662   30.664  1.00 21.98 ? 348  GLY A CA    1 
ATOM   2894 C  C     . GLY A 1 348 ? -20.608 9.423   30.179  1.00 23.78 ? 348  GLY A C     1 
ATOM   2895 O  O     . GLY A 1 348 ? -21.077 8.280   30.167  1.00 25.07 ? 348  GLY A O     1 
ATOM   2896 N  N     . TYR A 1 349 ? -21.288 10.488  29.758  1.00 22.19 ? 349  TYR A N     1 
ATOM   2897 C  CA    . TYR A 1 349 ? -22.659 10.352  29.273  1.00 25.06 ? 349  TYR A CA    1 
ATOM   2898 C  C     . TYR A 1 349 ? -22.750 9.667   27.911  1.00 25.53 ? 349  TYR A C     1 
ATOM   2899 O  O     . TYR A 1 349 ? -23.725 8.969   27.615  1.00 25.00 ? 349  TYR A O     1 
ATOM   2900 C  CB    . TYR A 1 349 ? -23.397 11.697  29.272  1.00 24.95 ? 349  TYR A CB    1 
ATOM   2901 C  CG    . TYR A 1 349 ? -23.818 12.148  30.650  1.00 25.16 ? 349  TYR A CG    1 
ATOM   2902 C  CD1   . TYR A 1 349 ? -24.704 11.386  31.414  1.00 24.13 ? 349  TYR A CD1   1 
ATOM   2903 C  CD2   . TYR A 1 349 ? -23.329 13.336  31.197  1.00 24.13 ? 349  TYR A CD2   1 
ATOM   2904 C  CE1   . TYR A 1 349 ? -25.084 11.786  32.690  1.00 21.18 ? 349  TYR A CE1   1 
ATOM   2905 C  CE2   . TYR A 1 349 ? -23.711 13.751  32.472  1.00 22.86 ? 349  TYR A CE2   1 
ATOM   2906 C  CZ    . TYR A 1 349 ? -24.582 12.969  33.210  1.00 22.72 ? 349  TYR A CZ    1 
ATOM   2907 O  OH    . TYR A 1 349 ? -24.960 13.384  34.468  1.00 25.22 ? 349  TYR A OH    1 
ATOM   2908 N  N     . TYR A 1 350 ? -21.739 9.882   27.079  1.00 25.37 ? 350  TYR A N     1 
ATOM   2909 C  CA    . TYR A 1 350 ? -21.671 9.214   25.785  1.00 25.28 ? 350  TYR A CA    1 
ATOM   2910 C  C     . TYR A 1 350 ? -21.573 7.699   25.992  1.00 26.19 ? 350  TYR A C     1 
ATOM   2911 O  O     . TYR A 1 350 ? -22.316 6.938   25.372  1.00 25.94 ? 350  TYR A O     1 
ATOM   2912 C  CB    . TYR A 1 350 ? -20.485 9.742   24.968  1.00 24.90 ? 350  TYR A CB    1 
ATOM   2913 C  CG    . TYR A 1 350 ? -20.360 9.131   23.588  1.00 28.51 ? 350  TYR A CG    1 
ATOM   2914 C  CD1   . TYR A 1 350 ? -21.030 9.690   22.500  1.00 29.11 ? 350  TYR A CD1   1 
ATOM   2915 C  CD2   . TYR A 1 350 ? -19.572 7.991   23.373  1.00 25.96 ? 350  TYR A CD2   1 
ATOM   2916 C  CE1   . TYR A 1 350 ? -20.922 9.137   21.230  1.00 32.86 ? 350  TYR A CE1   1 
ATOM   2917 C  CE2   . TYR A 1 350 ? -19.456 7.427   22.106  1.00 30.30 ? 350  TYR A CE2   1 
ATOM   2918 C  CZ    . TYR A 1 350 ? -20.136 8.008   21.037  1.00 31.99 ? 350  TYR A CZ    1 
ATOM   2919 O  OH    . TYR A 1 350 ? -20.035 7.466   19.775  1.00 31.63 ? 350  TYR A OH    1 
ATOM   2920 N  N     . ALA A 1 351 ? -20.676 7.273   26.885  1.00 25.94 ? 351  ALA A N     1 
ATOM   2921 C  CA    . ALA A 1 351 ? -20.455 5.849   27.144  1.00 24.02 ? 351  ALA A CA    1 
ATOM   2922 C  C     . ALA A 1 351 ? -21.575 5.193   27.966  1.00 24.42 ? 351  ALA A C     1 
ATOM   2923 O  O     . ALA A 1 351 ? -21.795 3.989   27.854  1.00 23.18 ? 351  ALA A O     1 
ATOM   2924 C  CB    . ALA A 1 351 ? -19.105 5.642   27.816  1.00 23.95 ? 351  ALA A CB    1 
ATOM   2925 N  N     . LYS A 1 352 ? -22.287 5.999   28.759  1.00 24.50 ? 352  LYS A N     1 
ATOM   2926 C  CA    . LYS A 1 352 ? -23.279 5.530   29.751  1.00 25.04 ? 352  LYS A CA    1 
ATOM   2927 C  C     . LYS A 1 352 ? -22.611 4.771   30.900  1.00 24.85 ? 352  LYS A C     1 
ATOM   2928 O  O     . LYS A 1 352 ? -22.904 3.594   31.185  1.00 23.21 ? 352  LYS A O     1 
ATOM   2929 C  CB    . LYS A 1 352 ? -24.427 4.729   29.109  1.00 29.31 ? 352  LYS A CB    1 
ATOM   2930 C  CG    . LYS A 1 352 ? -25.368 5.586   28.286  1.00 33.30 ? 352  LYS A CG    1 
ATOM   2931 C  CD    . LYS A 1 352 ? -26.266 4.742   27.382  1.00 35.92 ? 352  LYS A CD    1 
ATOM   2932 C  CE    . LYS A 1 352 ? -27.013 5.648   26.416  1.00 33.11 ? 352  LYS A CE    1 
ATOM   2933 N  NZ    . LYS A 1 352 ? -27.984 4.918   25.570  1.00 37.64 ? 352  LYS A NZ    1 
ATOM   2934 N  N     . ILE A 1 353 ? -21.685 5.466   31.549  1.00 22.85 ? 353  ILE A N     1 
ATOM   2935 C  CA    . ILE A 1 353 ? -20.923 4.902   32.647  1.00 23.76 ? 353  ILE A CA    1 
ATOM   2936 C  C     . ILE A 1 353 ? -21.033 5.848   33.824  1.00 24.36 ? 353  ILE A C     1 
ATOM   2937 O  O     . ILE A 1 353 ? -21.504 6.987   33.672  1.00 21.95 ? 353  ILE A O     1 
ATOM   2938 C  CB    . ILE A 1 353 ? -19.414 4.727   32.285  1.00 23.02 ? 353  ILE A CB    1 
ATOM   2939 C  CG1   . ILE A 1 353 ? -18.804 6.051   31.778  1.00 24.50 ? 353  ILE A CG1   1 
ATOM   2940 C  CG2   . ILE A 1 353 ? -19.224 3.589   31.287  1.00 26.84 ? 353  ILE A CG2   1 
ATOM   2941 C  CD1   . ILE A 1 353 ? -17.329 5.951   31.375  1.00 22.59 ? 353  ILE A CD1   1 
ATOM   2942 N  N     . GLN A 1 354 ? -20.582 5.386   34.989  1.00 24.43 ? 354  GLN A N     1 
ATOM   2943 C  CA    . GLN A 1 354 ? -20.338 6.300   36.092  1.00 25.30 ? 354  GLN A CA    1 
ATOM   2944 C  C     . GLN A 1 354 ? -19.310 7.290   35.572  1.00 23.76 ? 354  GLN A C     1 
ATOM   2945 O  O     . GLN A 1 354 ? -18.308 6.887   34.976  1.00 24.34 ? 354  GLN A O     1 
ATOM   2946 C  CB    . GLN A 1 354 ? -19.783 5.556   37.302  1.00 25.74 ? 354  GLN A CB    1 
ATOM   2947 C  CG    . GLN A 1 354 ? -20.714 4.497   37.879  1.00 29.28 ? 354  GLN A CG    1 
ATOM   2948 C  CD    . GLN A 1 354 ? -20.176 3.918   39.174  1.00 33.70 ? 354  GLN A CD    1 
ATOM   2949 O  OE1   . GLN A 1 354 ? -20.819 3.996   40.229  1.00 36.31 ? 354  GLN A OE1   1 
ATOM   2950 N  NE2   . GLN A 1 354 ? -18.987 3.346   39.105  1.00 30.81 ? 354  GLN A NE2   1 
ATOM   2951 N  N     . ILE A 1 355 ? -19.550 8.576   35.792  1.00 23.11 ? 355  ILE A N     1 
ATOM   2952 C  CA    . ILE A 1 355 ? -18.637 9.604   35.274  1.00 25.18 ? 355  ILE A CA    1 
ATOM   2953 C  C     . ILE A 1 355 ? -17.181 9.360   35.698  1.00 23.16 ? 355  ILE A C     1 
ATOM   2954 O  O     . ILE A 1 355 ? -16.279 9.604   34.919  1.00 23.76 ? 355  ILE A O     1 
ATOM   2955 C  CB    . ILE A 1 355 ? -19.090 11.064  35.620  1.00 23.10 ? 355  ILE A CB    1 
ATOM   2956 C  CG1   . ILE A 1 355 ? -20.539 11.315  35.172  1.00 21.71 ? 355  ILE A CG1   1 
ATOM   2957 C  CG2   . ILE A 1 355 ? -18.141 12.105  34.988  1.00 21.69 ? 355  ILE A CG2   1 
ATOM   2958 C  CD1   . ILE A 1 355 ? -20.780 11.263  33.663  1.00 24.32 ? 355  ILE A CD1   1 
ATOM   2959 N  N     . GLN A 1 356 ? -16.952 8.852   36.906  1.00 23.71 ? 356  GLN A N     1 
ATOM   2960 C  CA    . GLN A 1 356 ? -15.576 8.625   37.360  1.00 21.78 ? 356  GLN A CA    1 
ATOM   2961 C  C     . GLN A 1 356 ? -14.859 7.525   36.552  1.00 23.80 ? 356  GLN A C     1 
ATOM   2962 O  O     . GLN A 1 356 ? -13.630 7.441   36.566  1.00 21.92 ? 356  GLN A O     1 
ATOM   2963 C  CB    . GLN A 1 356 ? -15.501 8.376   38.876  1.00 21.49 ? 356  GLN A CB    1 
ATOM   2964 C  CG    . GLN A 1 356 ? -16.151 7.066   39.381  1.00 25.03 ? 356  GLN A CG    1 
ATOM   2965 C  CD    . GLN A 1 356 ? -17.619 7.234   39.761  1.00 28.16 ? 356  GLN A CD    1 
ATOM   2966 O  OE1   . GLN A 1 356 ? -18.325 8.106   39.237  1.00 26.27 ? 356  GLN A OE1   1 
ATOM   2967 N  NE2   . GLN A 1 356 ? -18.085 6.395   40.682  1.00 25.25 ? 356  GLN A NE2   1 
ATOM   2968 N  N     . SER A 1 357 ? -15.626 6.718   35.820  1.00 22.14 ? 357  SER A N     1 
ATOM   2969 C  CA    . SER A 1 357 ? -15.054 5.688   34.957  1.00 23.47 ? 357  SER A CA    1 
ATOM   2970 C  C     . SER A 1 357 ? -14.320 6.218   33.709  1.00 22.96 ? 357  SER A C     1 
ATOM   2971 O  O     . SER A 1 357 ? -13.614 5.451   33.054  1.00 22.30 ? 357  SER A O     1 
ATOM   2972 C  CB    . SER A 1 357 ? -16.125 4.678   34.532  1.00 23.84 ? 357  SER A CB    1 
ATOM   2973 O  OG    . SER A 1 357 ? -16.389 3.763   35.572  1.00 23.85 ? 357  SER A OG    1 
ATOM   2974 N  N     . VAL A 1 358 ? -14.480 7.502   33.379  1.00 21.88 ? 358  VAL A N     1 
ATOM   2975 C  CA    . VAL A 1 358 ? -13.688 8.118   32.284  1.00 22.03 ? 358  VAL A CA    1 
ATOM   2976 C  C     . VAL A 1 358 ? -12.167 7.933   32.457  1.00 22.27 ? 358  VAL A C     1 
ATOM   2977 O  O     . VAL A 1 358 ? -11.426 8.029   31.491  1.00 23.88 ? 358  VAL A O     1 
ATOM   2978 C  CB    . VAL A 1 358 ? -14.010 9.632   32.050  1.00 23.38 ? 358  VAL A CB    1 
ATOM   2979 C  CG1   . VAL A 1 358 ? -15.485 9.839   31.691  1.00 24.06 ? 358  VAL A CG1   1 
ATOM   2980 C  CG2   . VAL A 1 358 ? -13.618 10.488  33.266  1.00 22.43 ? 358  VAL A CG2   1 
ATOM   2981 N  N     . PHE A 1 359 ? -11.706 7.680   33.683  1.00 21.75 ? 359  PHE A N     1 
ATOM   2982 C  CA    . PHE A 1 359 ? -10.292 7.368   33.928  1.00 23.37 ? 359  PHE A CA    1 
ATOM   2983 C  C     . PHE A 1 359 ? -9.891  6.014   33.329  1.00 25.70 ? 359  PHE A C     1 
ATOM   2984 O  O     . PHE A 1 359 ? -8.700  5.713   33.209  1.00 25.23 ? 359  PHE A O     1 
ATOM   2985 C  CB    . PHE A 1 359 ? -9.965  7.382   35.431  1.00 23.63 ? 359  PHE A CB    1 
ATOM   2986 C  CG    . PHE A 1 359 ? -9.920  8.765   36.033  1.00 24.44 ? 359  PHE A CG    1 
ATOM   2987 C  CD1   . PHE A 1 359 ? -8.916  9.667   35.676  1.00 23.06 ? 359  PHE A CD1   1 
ATOM   2988 C  CD2   . PHE A 1 359 ? -10.876 9.166   36.953  1.00 25.74 ? 359  PHE A CD2   1 
ATOM   2989 C  CE1   . PHE A 1 359 ? -8.875  10.950  36.217  1.00 22.96 ? 359  PHE A CE1   1 
ATOM   2990 C  CE2   . PHE A 1 359 ? -10.844 10.455  37.509  1.00 29.08 ? 359  PHE A CE2   1 
ATOM   2991 C  CZ    . PHE A 1 359 ? -9.839  11.345  37.139  1.00 25.98 ? 359  PHE A CZ    1 
ATOM   2992 N  N     . SER A 1 360 ? -10.883 5.209   32.949  1.00 23.38 ? 360  SER A N     1 
ATOM   2993 C  CA    . SER A 1 360 ? -10.617 3.872   32.439  1.00 23.65 ? 360  SER A CA    1 
ATOM   2994 C  C     . SER A 1 360 ? -11.174 3.678   31.025  1.00 24.61 ? 360  SER A C     1 
ATOM   2995 O  O     . SER A 1 360 ? -12.376 3.453   30.846  1.00 24.44 ? 360  SER A O     1 
ATOM   2996 C  CB    . SER A 1 360 ? -11.178 2.815   33.387  1.00 23.99 ? 360  SER A CB    1 
ATOM   2997 O  OG    . SER A 1 360 ? -11.199 1.550   32.744  1.00 27.58 ? 360  SER A OG    1 
ATOM   2998 N  N     . PRO A 1 361 ? -10.294 3.766   30.017  1.00 24.20 ? 361  PRO A N     1 
ATOM   2999 C  CA    . PRO A 1 361 ? -10.636 3.505   28.613  1.00 23.64 ? 361  PRO A CA    1 
ATOM   3000 C  C     . PRO A 1 361 ? -11.211 2.099   28.448  1.00 22.38 ? 361  PRO A C     1 
ATOM   3001 O  O     . PRO A 1 361 ? -12.078 1.888   27.610  1.00 21.56 ? 361  PRO A O     1 
ATOM   3002 C  CB    . PRO A 1 361 ? -9.281  3.580   27.890  1.00 26.10 ? 361  PRO A CB    1 
ATOM   3003 C  CG    . PRO A 1 361 ? -8.361  4.289   28.828  1.00 26.93 ? 361  PRO A CG    1 
ATOM   3004 C  CD    . PRO A 1 361 ? -8.858  4.041   30.213  1.00 24.30 ? 361  PRO A CD    1 
ATOM   3005 N  N     . ILE A 1 362 ? -10.730 1.145   29.238  1.00 23.12 ? 362  ILE A N     1 
ATOM   3006 C  CA    . ILE A 1 362 ? -11.263 -0.219  29.170  1.00 26.23 ? 362  ILE A CA    1 
ATOM   3007 C  C     . ILE A 1 362 ? -12.733 -0.250  29.587  1.00 25.60 ? 362  ILE A C     1 
ATOM   3008 O  O     . ILE A 1 362 ? -13.562 -0.869  28.913  1.00 25.89 ? 362  ILE A O     1 
ATOM   3009 C  CB    . ILE A 1 362 ? -10.394 -1.223  29.967  1.00 26.22 ? 362  ILE A CB    1 
ATOM   3010 C  CG1   . ILE A 1 362 ? -9.215  -1.655  29.094  1.00 28.84 ? 362  ILE A CG1   1 
ATOM   3011 C  CG2   . ILE A 1 362 ? -11.202 -2.455  30.388  1.00 30.37 ? 362  ILE A CG2   1 
ATOM   3012 C  CD1   . ILE A 1 362 ? -7.998  -2.108  29.848  1.00 32.13 ? 362  ILE A CD1   1 
ATOM   3013 N  N     . LYS A 1 363 ? -13.054 0.438   30.679  1.00 23.76 ? 363  LYS A N     1 
ATOM   3014 C  CA    . LYS A 1 363 ? -14.422 0.486   31.159  1.00 25.63 ? 363  LYS A CA    1 
ATOM   3015 C  C     . LYS A 1 363 ? -15.291 1.285   30.176  1.00 24.99 ? 363  LYS A C     1 
ATOM   3016 O  O     . LYS A 1 363 ? -16.429 0.894   29.881  1.00 23.44 ? 363  LYS A O     1 
ATOM   3017 C  CB    . LYS A 1 363 ? -14.488 1.066   32.583  1.00 23.45 ? 363  LYS A CB    1 
ATOM   3018 C  CG    . LYS A 1 363 ? -15.896 1.129   33.179  1.00 29.20 ? 363  LYS A CG    1 
ATOM   3019 C  CD    . LYS A 1 363 ? -16.575 -0.247  33.271  1.00 31.70 ? 363  LYS A CD    1 
ATOM   3020 C  CE    . LYS A 1 363 ? -16.462 -0.846  34.656  1.00 34.89 ? 363  LYS A CE    1 
ATOM   3021 N  NZ    . LYS A 1 363 ? -17.152 -2.167  34.775  1.00 34.95 ? 363  LYS A NZ    1 
ATOM   3022 N  N     . THR A 1 364 ? -14.730 2.380   29.661  1.00 22.40 ? 364  THR A N     1 
ATOM   3023 C  CA    . THR A 1 364 ? -15.415 3.279   28.727  1.00 21.24 ? 364  THR A CA    1 
ATOM   3024 C  C     . THR A 1 364 ? -15.794 2.555   27.445  1.00 23.65 ? 364  THR A C     1 
ATOM   3025 O  O     . THR A 1 364 ? -16.933 2.646   26.978  1.00 25.39 ? 364  THR A O     1 
ATOM   3026 C  CB    . THR A 1 364 ? -14.528 4.514   28.396  1.00 21.39 ? 364  THR A CB    1 
ATOM   3027 O  OG1   . THR A 1 364 ? -14.166 5.181   29.615  1.00 19.38 ? 364  THR A OG1   1 
ATOM   3028 C  CG2   . THR A 1 364 ? -15.259 5.516   27.481  1.00 19.35 ? 364  THR A CG2   1 
ATOM   3029 N  N     . TRP A 1 365 ? -14.836 1.835   26.873  1.00 22.84 ? 365  TRP A N     1 
ATOM   3030 C  CA    . TRP A 1 365 ? -15.084 1.101   25.650  1.00 22.77 ? 365  TRP A CA    1 
ATOM   3031 C  C     . TRP A 1 365 ? -15.973 -0.125  25.863  1.00 24.01 ? 365  TRP A C     1 
ATOM   3032 O  O     . TRP A 1 365 ? -16.761 -0.458  24.988  1.00 25.84 ? 365  TRP A O     1 
ATOM   3033 C  CB    . TRP A 1 365 ? -13.767 0.753   24.935  1.00 25.57 ? 365  TRP A CB    1 
ATOM   3034 C  CG    . TRP A 1 365 ? -13.229 1.935   24.167  1.00 24.58 ? 365  TRP A CG    1 
ATOM   3035 C  CD1   . TRP A 1 365 ? -12.076 2.634   24.416  1.00 23.33 ? 365  TRP A CD1   1 
ATOM   3036 C  CD2   . TRP A 1 365 ? -13.854 2.575   23.045  1.00 23.44 ? 365  TRP A CD2   1 
ATOM   3037 N  NE1   . TRP A 1 365 ? -11.944 3.661   23.501  1.00 20.15 ? 365  TRP A NE1   1 
ATOM   3038 C  CE2   . TRP A 1 365 ? -13.024 3.651   22.659  1.00 22.08 ? 365  TRP A CE2   1 
ATOM   3039 C  CE3   . TRP A 1 365 ? -15.033 2.332   22.318  1.00 22.03 ? 365  TRP A CE3   1 
ATOM   3040 C  CZ2   . TRP A 1 365 ? -13.331 4.484   21.574  1.00 23.73 ? 365  TRP A CZ2   1 
ATOM   3041 C  CZ3   . TRP A 1 365 ? -15.340 3.160   21.247  1.00 21.92 ? 365  TRP A CZ3   1 
ATOM   3042 C  CH2   . TRP A 1 365 ? -14.492 4.228   20.889  1.00 24.33 ? 365  TRP A CH2   1 
ATOM   3043 N  N     . ASP A 1 366 ? -15.865 -0.782  27.019  1.00 23.45 ? 366  ASP A N     1 
ATOM   3044 C  CA    . ASP A 1 366 ? -16.737 -1.926  27.322  1.00 23.16 ? 366  ASP A CA    1 
ATOM   3045 C  C     . ASP A 1 366 ? -18.202 -1.502  27.296  1.00 21.97 ? 366  ASP A C     1 
ATOM   3046 O  O     . ASP A 1 366 ? -19.049 -2.196  26.729  1.00 24.25 ? 366  ASP A O     1 
ATOM   3047 C  CB    . ASP A 1 366 ? -16.382 -2.564  28.676  1.00 24.80 ? 366  ASP A CB    1 
ATOM   3048 C  CG    . ASP A 1 366 ? -16.934 -3.987  28.830  1.00 30.30 ? 366  ASP A CG    1 
ATOM   3049 O  OD1   . ASP A 1 366 ? -16.875 -4.786  27.864  1.00 26.32 ? 366  ASP A OD1   1 
ATOM   3050 O  OD2   . ASP A 1 366 ? -17.427 -4.314  29.932  1.00 26.00 ? 366  ASP A OD2   1 
ATOM   3051 N  N     . ALA A 1 367 ? -18.483 -0.352  27.901  1.00 22.51 ? 367  ALA A N     1 
ATOM   3052 C  CA    . ALA A 1 367 ? -19.815 0.234   27.914  1.00 23.91 ? 367  ALA A CA    1 
ATOM   3053 C  C     . ALA A 1 367 ? -20.322 0.658   26.541  1.00 23.56 ? 367  ALA A C     1 
ATOM   3054 O  O     . ALA A 1 367 ? -21.488 0.397   26.204  1.00 24.62 ? 367  ALA A O     1 
ATOM   3055 C  CB    . ALA A 1 367 ? -19.862 1.415   28.865  1.00 23.97 ? 367  ALA A CB    1 
ATOM   3056 N  N     . ILE A 1 368 ? -19.464 1.332   25.767  1.00 22.92 ? 368  ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 368 ? -19.817 1.768   24.411  1.00 21.54 ? 368  ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 368 ? -20.156 0.568   23.515  1.00 24.92 ? 368  ILE A C     1 
ATOM   3059 O  O     . ILE A 1 368 ? -21.166 0.569   22.813  1.00 24.75 ? 368  ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 368 ? -18.694 2.634   23.768  1.00 24.02 ? 368  ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 368 ? -18.614 4.014   24.459  1.00 20.59 ? 368  ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 368 ? -18.919 2.792   22.260  1.00 21.12 ? 368  ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 368 ? -17.331 4.800   24.143  1.00 20.89 ? 368  ILE A CD1   1 
ATOM   3064 N  N     . ILE A 1 369 ? -19.318 -0.460  23.562  1.00 25.67 ? 369  ILE A N     1 
ATOM   3065 C  CA    . ILE A 1 369 ? -19.518 -1.634  22.718  1.00 26.34 ? 369  ILE A CA    1 
ATOM   3066 C  C     . ILE A 1 369 ? -20.753 -2.430  23.176  1.00 28.41 ? 369  ILE A C     1 
ATOM   3067 O  O     . ILE A 1 369 ? -21.572 -2.854  22.348  1.00 29.02 ? 369  ILE A O     1 
ATOM   3068 C  CB    . ILE A 1 369 ? -18.230 -2.479  22.660  1.00 22.02 ? 369  ILE A CB    1 
ATOM   3069 C  CG1   . ILE A 1 369 ? -17.154 -1.718  21.872  1.00 22.63 ? 369  ILE A CG1   1 
ATOM   3070 C  CG2   . ILE A 1 369 ? -18.486 -3.849  22.052  1.00 20.64 ? 369  ILE A CG2   1 
ATOM   3071 C  CD1   . ILE A 1 369 ? -15.723 -2.166  22.178  1.00 18.12 ? 369  ILE A CD1   1 
ATOM   3072 N  N     . PHE A 1 370 ? -20.900 -2.595  24.490  1.00 28.95 ? 370  PHE A N     1 
ATOM   3073 C  CA    . PHE A 1 370 ? -22.106 -3.221  25.054  1.00 28.88 ? 370  PHE A CA    1 
ATOM   3074 C  C     . PHE A 1 370 ? -23.386 -2.527  24.586  1.00 27.40 ? 370  PHE A C     1 
ATOM   3075 O  O     . PHE A 1 370 ? -24.306 -3.197  24.106  1.00 29.14 ? 370  PHE A O     1 
ATOM   3076 C  CB    . PHE A 1 370 ? -22.042 -3.281  26.588  1.00 26.98 ? 370  PHE A CB    1 
ATOM   3077 C  CG    . PHE A 1 370 ? -23.387 -3.483  27.266  1.00 26.70 ? 370  PHE A CG    1 
ATOM   3078 C  CD1   . PHE A 1 370 ? -23.893 -2.506  28.121  1.00 27.88 ? 370  PHE A CD1   1 
ATOM   3079 C  CD2   . PHE A 1 370 ? -24.130 -4.652  27.071  1.00 29.08 ? 370  PHE A CD2   1 
ATOM   3080 C  CE1   . PHE A 1 370 ? -25.117 -2.677  28.759  1.00 29.22 ? 370  PHE A CE1   1 
ATOM   3081 C  CE2   . PHE A 1 370 ? -25.368 -4.839  27.706  1.00 28.21 ? 370  PHE A CE2   1 
ATOM   3082 C  CZ    . PHE A 1 370 ? -25.863 -3.853  28.549  1.00 28.64 ? 370  PHE A CZ    1 
ATOM   3083 N  N     . ASN A 1 371 ? -23.445 -1.202  24.711  1.00 26.30 ? 371  ASN A N     1 
ATOM   3084 C  CA    . ASN A 1 371 ? -24.641 -0.453  24.291  1.00 25.37 ? 371  ASN A CA    1 
ATOM   3085 C  C     . ASN A 1 371 ? -24.915 -0.582  22.802  1.00 26.26 ? 371  ASN A C     1 
ATOM   3086 O  O     . ASN A 1 371 ? -26.074 -0.704  22.384  1.00 27.15 ? 371  ASN A O     1 
ATOM   3087 C  CB    . ASN A 1 371 ? -24.579 1.019   24.712  1.00 24.95 ? 371  ASN A CB    1 
ATOM   3088 C  CG    . ASN A 1 371 ? -25.035 1.225   26.143  1.00 26.53 ? 371  ASN A CG    1 
ATOM   3089 O  OD1   . ASN A 1 371 ? -26.230 1.192   26.429  1.00 29.03 ? 371  ASN A OD1   1 
ATOM   3090 N  ND2   . ASN A 1 371 ? -24.082 1.413   27.059  1.00 27.98 ? 371  ASN A ND2   1 
ATOM   3091 N  N     . SER A 1 372 ? -23.845 -0.578  22.008  1.00 24.25 ? 372  SER A N     1 
ATOM   3092 C  CA    . SER A 1 372 ? -23.974 -0.716  20.559  1.00 25.10 ? 372  SER A CA    1 
ATOM   3093 C  C     . SER A 1 372 ? -24.516 -2.093  20.176  1.00 27.00 ? 372  SER A C     1 
ATOM   3094 O  O     . SER A 1 372 ? -25.407 -2.204  19.333  1.00 29.11 ? 372  SER A O     1 
ATOM   3095 C  CB    . SER A 1 372 ? -22.626 -0.487  19.895  1.00 25.59 ? 372  SER A CB    1 
ATOM   3096 O  OG    . SER A 1 372 ? -22.780 -0.375  18.496  1.00 31.30 ? 372  SER A OG    1 
ATOM   3097 N  N     . LEU A 1 373 ? -23.977 -3.138  20.805  1.00 25.82 ? 373  LEU A N     1 
ATOM   3098 C  CA    . LEU A 1 373 ? -24.401 -4.504  20.516  1.00 28.14 ? 373  LEU A CA    1 
ATOM   3099 C  C     . LEU A 1 373 ? -25.811 -4.775  21.036  1.00 29.56 ? 373  LEU A C     1 
ATOM   3100 O  O     . LEU A 1 373 ? -26.608 -5.435  20.361  1.00 32.34 ? 373  LEU A O     1 
ATOM   3101 C  CB    . LEU A 1 373 ? -23.403 -5.522  21.090  1.00 24.82 ? 373  LEU A CB    1 
ATOM   3102 C  CG    . LEU A 1 373 ? -22.021 -5.546  20.430  1.00 27.19 ? 373  LEU A CG    1 
ATOM   3103 C  CD1   . LEU A 1 373 ? -21.016 -6.411  21.212  1.00 24.37 ? 373  LEU A CD1   1 
ATOM   3104 C  CD2   . LEU A 1 373 ? -22.091 -5.989  18.970  1.00 27.27 ? 373  LEU A CD2   1 
ATOM   3105 N  N     . LYS A 1 374 ? -26.116 -4.265  22.229  1.00 30.05 ? 374  LYS A N     1 
ATOM   3106 C  CA    . LYS A 1 374 ? -27.439 -4.452  22.820  1.00 31.30 ? 374  LYS A CA    1 
ATOM   3107 C  C     . LYS A 1 374 ? -28.557 -3.964  21.887  1.00 33.44 ? 374  LYS A C     1 
ATOM   3108 O  O     . LYS A 1 374 ? -29.601 -4.610  21.781  1.00 31.34 ? 374  LYS A O     1 
ATOM   3109 C  CB    . LYS A 1 374 ? -27.526 -3.792  24.196  1.00 29.54 ? 374  LYS A CB    1 
ATOM   3110 C  CG    . LYS A 1 374 ? -28.897 -3.909  24.860  1.00 30.54 ? 374  LYS A CG    1 
ATOM   3111 C  CD    . LYS A 1 374 ? -28.833 -3.438  26.302  1.00 33.22 ? 374  LYS A CD    1 
ATOM   3112 C  CE    . LYS A 1 374 ? -30.176 -2.927  26.768  1.00 30.97 ? 374  LYS A CE    1 
ATOM   3113 N  NZ    . LYS A 1 374 ? -30.541 -1.653  26.098  1.00 39.14 ? 374  LYS A NZ    1 
ATOM   3114 N  N     . GLU A 1 375 ? -28.302 -2.854  21.194  1.00 36.46 ? 375  GLU A N     1 
ATOM   3115 C  CA    . GLU A 1 375 ? -29.206 -2.291  20.177  1.00 39.31 ? 375  GLU A CA    1 
ATOM   3116 C  C     . GLU A 1 375 ? -29.607 -3.252  19.049  1.00 38.84 ? 375  GLU A C     1 
ATOM   3117 O  O     . GLU A 1 375 ? -30.692 -3.132  18.482  1.00 38.95 ? 375  GLU A O     1 
ATOM   3118 C  CB    . GLU A 1 375 ? -28.578 -1.034  19.558  1.00 43.14 ? 375  GLU A CB    1 
ATOM   3119 C  CG    . GLU A 1 375 ? -28.899 0.256   20.290  1.00 51.98 ? 375  GLU A CG    1 
ATOM   3120 C  CD    . GLU A 1 375 ? -30.375 0.643   20.202  1.00 60.33 ? 375  GLU A CD    1 
ATOM   3121 O  OE1   . GLU A 1 375 ? -31.004 0.433   19.140  1.00 63.17 ? 375  GLU A OE1   1 
ATOM   3122 O  OE2   . GLU A 1 375 ? -30.908 1.165   21.203  1.00 64.76 ? 375  GLU A OE2   1 
ATOM   3123 N  N     . GLN A 1 376 ? -28.728 -4.192  18.723  1.00 37.12 ? 376  GLN A N     1 
ATOM   3124 C  CA    . GLN A 1 376 ? -28.990 -5.170  17.676  1.00 36.05 ? 376  GLN A CA    1 
ATOM   3125 C  C     . GLN A 1 376 ? -29.337 -6.529  18.287  1.00 35.76 ? 376  GLN A C     1 
ATOM   3126 O  O     . GLN A 1 376 ? -29.234 -7.557  17.622  1.00 35.33 ? 376  GLN A O     1 
ATOM   3127 C  CB    . GLN A 1 376 ? -27.771 -5.284  16.756  1.00 36.56 ? 376  GLN A CB    1 
ATOM   3128 C  CG    . GLN A 1 376 ? -27.185 -3.930  16.316  1.00 38.71 ? 376  GLN A CG    1 
ATOM   3129 C  CD    . GLN A 1 376 ? -25.690 -3.995  16.048  1.00 43.66 ? 376  GLN A CD    1 
ATOM   3130 O  OE1   . GLN A 1 376 ? -24.901 -3.299  16.695  1.00 49.70 ? 376  GLN A OE1   1 
ATOM   3131 N  NE2   . GLN A 1 376 ? -25.287 -4.845  15.101  1.00 44.86 ? 376  GLN A NE2   1 
ATOM   3132 N  N     . ASN A 1 377 ? -29.737 -6.524  19.559  1.00 33.49 ? 377  ASN A N     1 
ATOM   3133 C  CA    . ASN A 1 377 ? -30.043 -7.753  20.308  1.00 32.11 ? 377  ASN A CA    1 
ATOM   3134 C  C     . ASN A 1 377 ? -28.894 -8.760  20.348  1.00 30.86 ? 377  ASN A C     1 
ATOM   3135 O  O     . ASN A 1 377 ? -29.098 -9.960  20.527  1.00 28.59 ? 377  ASN A O     1 
ATOM   3136 C  CB    . ASN A 1 377 ? -31.340 -8.395  19.796  1.00 32.57 ? 377  ASN A CB    1 
ATOM   3137 C  CG    . ASN A 1 377 ? -32.563 -7.577  20.157  1.00 33.12 ? 377  ASN A CG    1 
ATOM   3138 O  OD1   . ASN A 1 377 ? -32.631 -7.004  21.241  1.00 32.16 ? 377  ASN A OD1   1 
ATOM   3139 N  ND2   . ASN A 1 377 ? -33.536 -7.518  19.255  1.00 33.16 ? 377  ASN A ND2   1 
ATOM   3140 N  N     . LYS A 1 378 ? -27.677 -8.255  20.186  1.00 29.24 ? 378  LYS A N     1 
ATOM   3141 C  CA    . LYS A 1 378 ? -26.505 -9.100  20.276  1.00 30.20 ? 378  LYS A CA    1 
ATOM   3142 C  C     . LYS A 1 378 ? -26.021 -9.156  21.713  1.00 29.91 ? 378  LYS A C     1 
ATOM   3143 O  O     . LYS A 1 378 ? -26.272 -8.242  22.498  1.00 30.63 ? 378  LYS A O     1 
ATOM   3144 C  CB    . LYS A 1 378 ? -25.412 -8.613  19.331  1.00 32.59 ? 378  LYS A CB    1 
ATOM   3145 C  CG    . LYS A 1 378 ? -25.756 -8.814  17.873  1.00 33.94 ? 378  LYS A CG    1 
ATOM   3146 C  CD    . LYS A 1 378 ? -24.664 -8.241  16.997  1.00 37.49 ? 378  LYS A CD    1 
ATOM   3147 C  CE    . LYS A 1 378 ? -25.005 -8.350  15.517  1.00 35.89 ? 378  LYS A CE    1 
ATOM   3148 N  NZ    . LYS A 1 378 ? -23.779 -8.026  14.731  1.00 40.44 ? 378  LYS A NZ    1 
ATOM   3149 N  N     . VAL A 1 379 ? -25.318 -10.234 22.038  1.00 29.28 ? 379  VAL A N     1 
ATOM   3150 C  CA    . VAL A 1 379 ? -24.940 -10.566 23.400  1.00 29.50 ? 379  VAL A CA    1 
ATOM   3151 C  C     . VAL A 1 379 ? -23.414 -10.587 23.533  1.00 29.52 ? 379  VAL A C     1 
ATOM   3152 O  O     . VAL A 1 379 ? -22.733 -11.310 22.794  1.00 30.35 ? 379  VAL A O     1 
ATOM   3153 C  CB    . VAL A 1 379 ? -25.527 -11.957 23.777  1.00 31.31 ? 379  VAL A CB    1 
ATOM   3154 C  CG1   . VAL A 1 379 ? -25.082 -12.388 25.167  1.00 31.30 ? 379  VAL A CG1   1 
ATOM   3155 C  CG2   . VAL A 1 379 ? -27.053 -11.935 23.674  1.00 32.46 ? 379  VAL A CG2   1 
ATOM   3156 N  N     . ILE A 1 380 ? -22.877 -9.810  24.473  1.00 27.70 ? 380  ILE A N     1 
ATOM   3157 C  CA    . ILE A 1 380 ? -21.418 -9.696  24.631  1.00 27.24 ? 380  ILE A CA    1 
ATOM   3158 C  C     . ILE A 1 380 ? -20.812 -10.986 25.221  1.00 28.16 ? 380  ILE A C     1 
ATOM   3159 O  O     . ILE A 1 380 ? -21.474 -11.675 26.005  1.00 25.42 ? 380  ILE A O     1 
ATOM   3160 C  CB    . ILE A 1 380 ? -21.019 -8.442  25.470  1.00 29.40 ? 380  ILE A CB    1 
ATOM   3161 C  CG1   . ILE A 1 380 ? -21.499 -8.547  26.921  1.00 27.16 ? 380  ILE A CG1   1 
ATOM   3162 C  CG2   . ILE A 1 380 ? -21.598 -7.157  24.845  1.00 30.12 ? 380  ILE A CG2   1 
ATOM   3163 C  CD1   . ILE A 1 380 ? -21.039 -7.379  27.791  1.00 24.72 ? 380  ILE A CD1   1 
ATOM   3164 N  N     . PRO A 1 381 ? -19.561 -11.327 24.837  1.00 27.67 ? 381  PRO A N     1 
ATOM   3165 C  CA    . PRO A 1 381 ? -18.927 -12.536 25.405  1.00 28.19 ? 381  PRO A CA    1 
ATOM   3166 C  C     . PRO A 1 381 ? -18.527 -12.331 26.868  1.00 29.13 ? 381  PRO A C     1 
ATOM   3167 O  O     . PRO A 1 381 ? -18.418 -11.187 27.325  1.00 24.80 ? 381  PRO A O     1 
ATOM   3168 C  CB    . PRO A 1 381 ? -17.674 -12.706 24.547  1.00 27.85 ? 381  PRO A CB    1 
ATOM   3169 C  CG    . PRO A 1 381 ? -17.325 -11.304 24.126  1.00 26.93 ? 381  PRO A CG    1 
ATOM   3170 C  CD    . PRO A 1 381 ? -18.643 -10.587 23.953  1.00 26.45 ? 381  PRO A CD    1 
ATOM   3171 N  N     . GLN A 1 382 ? -18.313 -13.422 27.599  1.00 28.94 ? 382  GLN A N     1 
ATOM   3172 C  CA    . GLN A 1 382 ? -17.760 -13.307 28.942  1.00 30.35 ? 382  GLN A CA    1 
ATOM   3173 C  C     . GLN A 1 382 ? -16.305 -12.856 28.897  1.00 32.25 ? 382  GLN A C     1 
ATOM   3174 O  O     . GLN A 1 382 ? -15.565 -13.218 27.983  1.00 32.99 ? 382  GLN A O     1 
ATOM   3175 C  CB    . GLN A 1 382 ? -17.850 -14.631 29.691  1.00 31.00 ? 382  GLN A CB    1 
ATOM   3176 C  CG    . GLN A 1 382 ? -17.586 -14.497 31.181  1.00 27.12 ? 382  GLN A CG    1 
ATOM   3177 C  CD    . GLN A 1 382 ? -17.831 -15.782 31.947  1.00 34.34 ? 382  GLN A CD    1 
ATOM   3178 O  OE1   . GLN A 1 382 ? -17.845 -16.883 31.376  1.00 28.65 ? 382  GLN A OE1   1 
ATOM   3179 N  NE2   . GLN A 1 382 ? -18.032 -15.649 33.256  1.00 33.91 ? 382  GLN A NE2   1 
ATOM   3180 N  N     . GLY A 1 383 ? -15.900 -12.069 29.891  1.00 33.35 ? 383  GLY A N     1 
ATOM   3181 C  CA    . GLY A 1 383 ? -14.498 -11.720 30.067  1.00 34.78 ? 383  GLY A CA    1 
ATOM   3182 C  C     . GLY A 1 383 ? -13.728 -12.951 30.500  1.00 37.05 ? 383  GLY A C     1 
ATOM   3183 O  O     . GLY A 1 383 ? -14.208 -13.725 31.330  1.00 37.65 ? 383  GLY A O     1 
ATOM   3184 N  N     . ARG A 1 384 ? -12.547 -13.146 29.924  1.00 39.56 ? 384  ARG A N     1 
ATOM   3185 C  CA    . ARG A 1 384 ? -11.718 -14.314 30.236  1.00 42.67 ? 384  ARG A CA    1 
ATOM   3186 C  C     . ARG A 1 384 ? -10.341 -13.908 30.752  1.00 43.11 ? 384  ARG A C     1 
ATOM   3187 O  O     . ARG A 1 384 ? -9.931  -12.753 30.625  1.00 42.48 ? 384  ARG A O     1 
ATOM   3188 C  CB    . ARG A 1 384 ? -11.577 -15.221 29.012  1.00 43.82 ? 384  ARG A CB    1 
ATOM   3189 C  CG    . ARG A 1 384 ? -12.856 -15.934 28.624  1.00 51.66 ? 384  ARG A CG    1 
ATOM   3190 C  CD    . ARG A 1 384 ? -12.714 -16.668 27.295  1.00 59.17 ? 384  ARG A CD    1 
ATOM   3191 N  NE    . ARG A 1 384 ? -13.642 -17.800 27.197  1.00 66.09 ? 384  ARG A NE    1 
ATOM   3192 C  CZ    . ARG A 1 384 ? -14.927 -17.713 26.850  1.00 67.60 ? 384  ARG A CZ    1 
ATOM   3193 N  NH1   . ARG A 1 384 ? -15.474 -16.535 26.552  1.00 68.84 ? 384  ARG A NH1   1 
ATOM   3194 N  NH2   . ARG A 1 384 ? -15.669 -18.813 26.799  1.00 66.40 ? 384  ARG A NH2   1 
ATOM   3195 N  N     . SER A 1 385 ? -9.640  -14.874 31.339  1.00 43.76 ? 385  SER A N     1 
ATOM   3196 C  CA    . SER A 1 385 ? -8.299  -14.673 31.870  1.00 44.15 ? 385  SER A CA    1 
ATOM   3197 C  C     . SER A 1 385 ? -7.250  -14.934 30.784  1.00 41.88 ? 385  SER A C     1 
ATOM   3198 O  O     . SER A 1 385 ? -7.351  -15.908 30.036  1.00 42.83 ? 385  SER A O     1 
ATOM   3199 C  CB    . SER A 1 385 ? -8.077  -15.626 33.049  1.00 44.71 ? 385  SER A CB    1 
ATOM   3200 O  OG    . SER A 1 385 ? -7.082  -15.131 33.920  1.00 51.14 ? 385  SER A OG    1 
ATOM   3201 N  N     . HIS A 1 386 ? -6.250  -14.063 30.695  1.00 39.79 ? 386  HIS A N     1 
ATOM   3202 C  CA    . HIS A 1 386 ? -5.149  -14.261 29.745  1.00 37.89 ? 386  HIS A CA    1 
ATOM   3203 C  C     . HIS A 1 386 ? -3.807  -13.935 30.377  1.00 36.44 ? 386  HIS A C     1 
ATOM   3204 O  O     . HIS A 1 386 ? -3.696  -12.954 31.117  1.00 36.99 ? 386  HIS A O     1 
ATOM   3205 C  CB    . HIS A 1 386 ? -5.311  -13.387 28.498  1.00 34.70 ? 386  HIS A CB    1 
ATOM   3206 C  CG    . HIS A 1 386 ? -6.700  -13.357 27.947  1.00 31.42 ? 386  HIS A CG    1 
ATOM   3207 N  ND1   . HIS A 1 386 ? -7.164  -14.289 27.045  1.00 32.67 ? 386  HIS A ND1   1 
ATOM   3208 C  CD2   . HIS A 1 386 ? -7.719  -12.487 28.150  1.00 32.65 ? 386  HIS A CD2   1 
ATOM   3209 C  CE1   . HIS A 1 386 ? -8.415  -14.004 26.727  1.00 36.14 ? 386  HIS A CE1   1 
ATOM   3210 N  NE2   . HIS A 1 386 ? -8.775  -12.914 27.383  1.00 34.28 ? 386  HIS A NE2   1 
ATOM   3211 N  N     . PRO A 1 387 ? -2.778  -14.748 30.074  1.00 36.71 ? 387  PRO A N     1 
ATOM   3212 C  CA    . PRO A 1 387 ? -1.411  -14.402 30.475  1.00 36.35 ? 387  PRO A CA    1 
ATOM   3213 C  C     . PRO A 1 387 ? -0.928  -13.189 29.680  1.00 35.62 ? 387  PRO A C     1 
ATOM   3214 O  O     . PRO A 1 387 ? -1.232  -13.073 28.492  1.00 32.35 ? 387  PRO A O     1 
ATOM   3215 C  CB    . PRO A 1 387 ? -0.603  -15.642 30.088  1.00 36.20 ? 387  PRO A CB    1 
ATOM   3216 C  CG    . PRO A 1 387 ? -1.391  -16.261 28.955  1.00 38.57 ? 387  PRO A CG    1 
ATOM   3217 C  CD    . PRO A 1 387 ? -2.831  -15.993 29.282  1.00 36.80 ? 387  PRO A CD    1 
ATOM   3218 N  N     . VAL A 1 388 ? -0.203  -12.289 30.337  1.00 36.44 ? 388  VAL A N     1 
ATOM   3219 C  CA    . VAL A 1 388 ? 0.348   -11.116 29.667  1.00 35.98 ? 388  VAL A CA    1 
ATOM   3220 C  C     . VAL A 1 388 ? 1.457   -11.584 28.733  1.00 36.84 ? 388  VAL A C     1 
ATOM   3221 O  O     . VAL A 1 388 ? 2.335   -12.348 29.139  1.00 37.31 ? 388  VAL A O     1 
ATOM   3222 C  CB    . VAL A 1 388 ? 0.868   -10.054 30.679  1.00 36.37 ? 388  VAL A CB    1 
ATOM   3223 C  CG1   . VAL A 1 388 ? 1.507   -8.876  29.956  1.00 34.57 ? 388  VAL A CG1   1 
ATOM   3224 C  CG2   . VAL A 1 388 ? -0.272  -9.557  31.591  1.00 35.25 ? 388  VAL A CG2   1 
ATOM   3225 N  N     . GLN A 1 389 ? 1.377   -11.145 27.477  1.00 36.86 ? 389  GLN A N     1 
ATOM   3226 C  CA    A GLN A 1 389 ? 2.359   -11.505 26.460  0.50 37.76 ? 389  GLN A CA    1 
ATOM   3227 C  CA    B GLN A 1 389 ? 2.346   -11.507 26.443  0.50 37.05 ? 389  GLN A CA    1 
ATOM   3228 C  C     . GLN A 1 389 ? 2.833   -10.241 25.735  1.00 37.40 ? 389  GLN A C     1 
ATOM   3229 O  O     . GLN A 1 389 ? 2.017   -9.390  25.362  1.00 36.88 ? 389  GLN A O     1 
ATOM   3230 C  CB    A GLN A 1 389 ? 1.746   -12.497 25.465  0.50 37.43 ? 389  GLN A CB    1 
ATOM   3231 C  CB    B GLN A 1 389 ? 1.711   -12.459 25.419  0.50 35.92 ? 389  GLN A CB    1 
ATOM   3232 C  CG    A GLN A 1 389 ? 2.470   -13.839 25.370  0.50 39.94 ? 389  GLN A CG    1 
ATOM   3233 C  CG    B GLN A 1 389 ? 1.449   -13.879 25.916  0.50 34.99 ? 389  GLN A CG    1 
ATOM   3234 C  CD    A GLN A 1 389 ? 3.729   -13.796 24.520  0.50 40.23 ? 389  GLN A CD    1 
ATOM   3235 C  CD    B GLN A 1 389 ? 0.947   -14.805 24.812  0.50 34.94 ? 389  GLN A CD    1 
ATOM   3236 O  OE1   A GLN A 1 389 ? 3.991   -12.821 23.817  0.50 40.83 ? 389  GLN A OE1   1 
ATOM   3237 O  OE1   B GLN A 1 389 ? -0.185  -14.676 24.335  0.50 30.80 ? 389  GLN A OE1   1 
ATOM   3238 N  NE2   A GLN A 1 389 ? 4.514   -14.863 24.582  0.50 38.93 ? 389  GLN A NE2   1 
ATOM   3239 N  NE2   B GLN A 1 389 ? 1.791   -15.752 24.407  0.50 32.51 ? 389  GLN A NE2   1 
ATOM   3240 N  N     . PRO A 1 390 ? 4.165   -10.095 25.544  1.00 32.66 ? 390  PRO A N     1 
ATOM   3241 C  CA    . PRO A 1 390 ? 4.609   -8.919  24.775  1.00 31.69 ? 390  PRO A CA    1 
ATOM   3242 C  C     . PRO A 1 390 ? 4.163   -9.035  23.314  1.00 29.12 ? 390  PRO A C     1 
ATOM   3243 O  O     . PRO A 1 390 ? 3.923   -10.141 22.837  1.00 29.45 ? 390  PRO A O     1 
ATOM   3244 C  CB    . PRO A 1 390 ? 6.143   -8.986  24.863  1.00 30.98 ? 390  PRO A CB    1 
ATOM   3245 C  CG    . PRO A 1 390 ? 6.437   -9.885  26.035  1.00 34.93 ? 390  PRO A CG    1 
ATOM   3246 C  CD    . PRO A 1 390 ? 5.309   -10.893 26.032  1.00 33.57 ? 390  PRO A CD    1 
ATOM   3247 N  N     . TYR A 1 391 ? 4.020   -7.905  22.624  1.00 28.15 ? 391  TYR A N     1 
ATOM   3248 C  CA    . TYR A 1 391 ? 3.722   -7.924  21.191  1.00 26.55 ? 391  TYR A CA    1 
ATOM   3249 C  C     . TYR A 1 391 ? 4.319   -6.696  20.494  1.00 27.14 ? 391  TYR A C     1 
ATOM   3250 O  O     . TYR A 1 391 ? 4.546   -5.678  21.144  1.00 25.84 ? 391  TYR A O     1 
ATOM   3251 C  CB    . TYR A 1 391 ? 2.210   -8.076  20.935  1.00 25.43 ? 391  TYR A CB    1 
ATOM   3252 C  CG    . TYR A 1 391 ? 1.367   -6.862  21.263  1.00 27.31 ? 391  TYR A CG    1 
ATOM   3253 C  CD1   . TYR A 1 391 ? 0.874   -6.657  22.558  1.00 26.20 ? 391  TYR A CD1   1 
ATOM   3254 C  CD2   . TYR A 1 391 ? 1.049   -5.923  20.280  1.00 24.02 ? 391  TYR A CD2   1 
ATOM   3255 C  CE1   . TYR A 1 391 ? 0.073   -5.539  22.861  1.00 26.75 ? 391  TYR A CE1   1 
ATOM   3256 C  CE2   . TYR A 1 391 ? 0.256   -4.802  20.575  1.00 23.21 ? 391  TYR A CE2   1 
ATOM   3257 C  CZ    . TYR A 1 391 ? -0.223  -4.623  21.866  1.00 23.36 ? 391  TYR A CZ    1 
ATOM   3258 O  OH    . TYR A 1 391 ? -0.987  -3.526  22.169  1.00 28.48 ? 391  TYR A OH    1 
ATOM   3259 N  N     . PRO A 1 392 ? 4.565   -6.786  19.166  1.00 28.50 ? 392  PRO A N     1 
ATOM   3260 C  CA    . PRO A 1 392 ? 5.269   -5.730  18.436  1.00 26.43 ? 392  PRO A CA    1 
ATOM   3261 C  C     . PRO A 1 392 ? 4.416   -4.500  18.140  1.00 26.40 ? 392  PRO A C     1 
ATOM   3262 O  O     . PRO A 1 392 ? 3.201   -4.605  17.989  1.00 27.15 ? 392  PRO A O     1 
ATOM   3263 C  CB    . PRO A 1 392 ? 5.682   -6.422  17.140  1.00 27.56 ? 392  PRO A CB    1 
ATOM   3264 C  CG    . PRO A 1 392 ? 4.647   -7.445  16.925  1.00 30.72 ? 392  PRO A CG    1 
ATOM   3265 C  CD    . PRO A 1 392 ? 4.245   -7.930  18.293  1.00 28.74 ? 392  PRO A CD    1 
ATOM   3266 N  N     . GLY A 1 393 ? 5.074   -3.344  18.060  1.00 26.26 ? 393  GLY A N     1 
ATOM   3267 C  CA    . GLY A 1 393 ? 4.404   -2.068  17.869  1.00 23.66 ? 393  GLY A CA    1 
ATOM   3268 C  C     . GLY A 1 393 ? 4.806   -1.407  16.568  1.00 23.81 ? 393  GLY A C     1 
ATOM   3269 O  O     . GLY A 1 393 ? 4.768   -2.027  15.506  1.00 24.47 ? 393  GLY A O     1 
ATOM   3270 N  N     . ALA A 1 394 ? 5.211   -0.149  16.661  1.00 23.38 ? 394  ALA A N     1 
ATOM   3271 C  CA    . ALA A 1 394 ? 5.512   0.676   15.493  1.00 22.60 ? 394  ALA A CA    1 
ATOM   3272 C  C     . ALA A 1 394 ? 6.929   0.496   14.968  1.00 24.79 ? 394  ALA A C     1 
ATOM   3273 O  O     . ALA A 1 394 ? 7.831   0.038   15.697  1.00 21.70 ? 394  ALA A O     1 
ATOM   3274 C  CB    . ALA A 1 394 ? 5.282   2.134   15.824  1.00 21.41 ? 394  ALA A CB    1 
ATOM   3275 N  N     . PHE A 1 395 ? 7.109   0.883   13.703  1.00 22.27 ? 395  PHE A N     1 
ATOM   3276 C  CA    . PHE A 1 395 ? 8.423   1.023   13.096  1.00 22.52 ? 395  PHE A CA    1 
ATOM   3277 C  C     . PHE A 1 395 ? 8.900   2.463   13.220  1.00 24.57 ? 395  PHE A C     1 
ATOM   3278 O  O     . PHE A 1 395 ? 8.142   3.418   12.996  1.00 24.62 ? 395  PHE A O     1 
ATOM   3279 C  CB    . PHE A 1 395 ? 8.376   0.615   11.616  1.00 24.77 ? 395  PHE A CB    1 
ATOM   3280 C  CG    . PHE A 1 395 ? 9.646   0.910   10.848  1.00 27.08 ? 395  PHE A CG    1 
ATOM   3281 C  CD1   . PHE A 1 395 ? 10.742  0.032   10.900  1.00 25.46 ? 395  PHE A CD1   1 
ATOM   3282 C  CD2   . PHE A 1 395 ? 9.742   2.054   10.063  1.00 24.77 ? 395  PHE A CD2   1 
ATOM   3283 C  CE1   . PHE A 1 395 ? 11.908  0.300   10.174  1.00 30.66 ? 395  PHE A CE1   1 
ATOM   3284 C  CE2   . PHE A 1 395 ? 10.916  2.337   9.334   1.00 31.49 ? 395  PHE A CE2   1 
ATOM   3285 C  CZ    . PHE A 1 395 ? 11.997  1.463   9.387   1.00 25.15 ? 395  PHE A CZ    1 
ATOM   3286 N  N     . VAL A 1 396 ? 10.166  2.608   13.586  1.00 25.16 ? 396  VAL A N     1 
ATOM   3287 C  CA    . VAL A 1 396 ? 10.809  3.910   13.652  1.00 25.48 ? 396  VAL A CA    1 
ATOM   3288 C  C     . VAL A 1 396 ? 12.073  3.807   12.796  1.00 27.87 ? 396  VAL A C     1 
ATOM   3289 O  O     . VAL A 1 396 ? 12.854  2.863   12.947  1.00 26.43 ? 396  VAL A O     1 
ATOM   3290 C  CB    . VAL A 1 396 ? 11.134  4.308   15.107  1.00 24.56 ? 396  VAL A CB    1 
ATOM   3291 C  CG1   . VAL A 1 396 ? 11.644  5.735   15.171  1.00 25.28 ? 396  VAL A CG1   1 
ATOM   3292 C  CG2   . VAL A 1 396 ? 9.885   4.143   16.015  1.00 23.32 ? 396  VAL A CG2   1 
ATOM   3293 N  N     . LYS A 1 397 ? 12.235  4.743   11.865  1.00 26.37 ? 397  LYS A N     1 
ATOM   3294 C  CA    . LYS A 1 397 ? 13.358  4.712   10.935  1.00 28.03 ? 397  LYS A CA    1 
ATOM   3295 C  C     . LYS A 1 397 ? 14.576  5.324   11.603  1.00 27.97 ? 397  LYS A C     1 
ATOM   3296 O  O     . LYS A 1 397 ? 14.462  6.346   12.272  1.00 25.51 ? 397  LYS A O     1 
ATOM   3297 C  CB    . LYS A 1 397 ? 13.010  5.473   9.649   1.00 28.06 ? 397  LYS A CB    1 
ATOM   3298 C  CG    . LYS A 1 397 ? 14.120  5.497   8.615   1.00 28.75 ? 397  LYS A CG    1 
ATOM   3299 C  CD    . LYS A 1 397 ? 13.748  6.333   7.405   1.00 28.39 ? 397  LYS A CD    1 
ATOM   3300 C  CE    . LYS A 1 397 ? 14.916  6.433   6.444   1.00 30.75 ? 397  LYS A CE    1 
ATOM   3301 N  NZ    . LYS A 1 397 ? 15.202  5.136   5.767   1.00 29.20 ? 397  LYS A NZ    1 
ATOM   3302 N  N     . GLU A 1 398 ? 15.729  4.682   11.430  1.00 28.04 ? 398  GLU A N     1 
ATOM   3303 C  CA    . GLU A 1 398 ? 16.996  5.211   11.925  1.00 29.54 ? 398  GLU A CA    1 
ATOM   3304 C  C     . GLU A 1 398 ? 17.486  6.354   11.021  1.00 29.43 ? 398  GLU A C     1 
ATOM   3305 O  O     . GLU A 1 398 ? 17.820  6.121   9.860   1.00 29.64 ? 398  GLU A O     1 
ATOM   3306 C  CB    . GLU A 1 398 ? 18.042  4.090   12.009  1.00 29.97 ? 398  GLU A CB    1 
ATOM   3307 C  CG    . GLU A 1 398 ? 19.340  4.490   12.719  1.00 32.19 ? 398  GLU A CG    1 
ATOM   3308 C  CD    . GLU A 1 398 ? 19.170  4.646   14.230  1.00 31.71 ? 398  GLU A CD    1 
ATOM   3309 O  OE1   . GLU A 1 398 ? 18.953  3.625   14.919  1.00 32.00 ? 398  GLU A OE1   1 
ATOM   3310 O  OE2   . GLU A 1 398 ? 19.269  5.787   14.728  1.00 30.62 ? 398  GLU A OE2   1 
ATOM   3311 N  N     . PRO A 1 399 ? 17.518  7.597   11.547  1.00 28.28 ? 399  PRO A N     1 
ATOM   3312 C  CA    . PRO A 1 399 ? 17.927  8.712   10.691  1.00 27.69 ? 399  PRO A CA    1 
ATOM   3313 C  C     . PRO A 1 399 ? 19.434  8.896   10.678  1.00 29.29 ? 399  PRO A C     1 
ATOM   3314 O  O     . PRO A 1 399 ? 20.113  8.545   11.643  1.00 29.31 ? 399  PRO A O     1 
ATOM   3315 C  CB    . PRO A 1 399 ? 17.283  9.912   11.368  1.00 26.33 ? 399  PRO A CB    1 
ATOM   3316 C  CG    . PRO A 1 399 ? 17.385  9.564   12.847  1.00 27.53 ? 399  PRO A CG    1 
ATOM   3317 C  CD    . PRO A 1 399 ? 17.247  8.039   12.930  1.00 23.65 ? 399  PRO A CD    1 
ATOM   3318 N  N     . ILE A 1 400 ? 19.959  9.437   9.589   1.00 31.51 ? 400  ILE A N     1 
ATOM   3319 C  CA    . ILE A 1 400 ? 21.370  9.790   9.558   1.00 30.90 ? 400  ILE A CA    1 
ATOM   3320 C  C     . ILE A 1 400 ? 21.525  11.098  10.334  1.00 30.33 ? 400  ILE A C     1 
ATOM   3321 O  O     . ILE A 1 400 ? 20.943  12.111  9.950   1.00 29.16 ? 400  ILE A O     1 
ATOM   3322 C  CB    . ILE A 1 400 ? 21.899  9.914   8.119   1.00 31.46 ? 400  ILE A CB    1 
ATOM   3323 C  CG1   . ILE A 1 400 ? 21.733  8.571   7.385   1.00 34.08 ? 400  ILE A CG1   1 
ATOM   3324 C  CG2   . ILE A 1 400 ? 23.379  10.399  8.111   1.00 29.99 ? 400  ILE A CG2   1 
ATOM   3325 C  CD1   . ILE A 1 400 ? 21.961  8.651   5.872   1.00 35.95 ? 400  ILE A CD1   1 
ATOM   3326 N  N     . PRO A 1 401 ? 22.285  11.071  11.446  1.00 30.78 ? 401  PRO A N     1 
ATOM   3327 C  CA    . PRO A 1 401 ? 22.475  12.322  12.193  1.00 32.31 ? 401  PRO A CA    1 
ATOM   3328 C  C     . PRO A 1 401 ? 23.060  13.398  11.278  1.00 31.63 ? 401  PRO A C     1 
ATOM   3329 O  O     . PRO A 1 401 ? 24.086  13.174  10.638  1.00 35.57 ? 401  PRO A O     1 
ATOM   3330 C  CB    . PRO A 1 401 ? 23.483  11.947  13.295  1.00 32.10 ? 401  PRO A CB    1 
ATOM   3331 C  CG    . PRO A 1 401 ? 23.489  10.442  13.344  1.00 35.58 ? 401  PRO A CG    1 
ATOM   3332 C  CD    . PRO A 1 401 ? 23.137  9.980   11.954  1.00 32.17 ? 401  PRO A CD    1 
ATOM   3333 N  N     . ASN A 1 402 ? 22.394  14.542  11.194  1.00 29.95 ? 402  ASN A N     1 
ATOM   3334 C  CA    . ASN A 1 402 ? 22.824  15.616  10.303  1.00 29.96 ? 402  ASN A CA    1 
ATOM   3335 C  C     . ASN A 1 402 ? 21.974  16.840  10.499  1.00 28.45 ? 402  ASN A C     1 
ATOM   3336 O  O     . ASN A 1 402 ? 20.918  16.771  11.135  1.00 28.15 ? 402  ASN A O     1 
ATOM   3337 C  CB    . ASN A 1 402 ? 22.732  15.181  8.835   1.00 29.71 ? 402  ASN A CB    1 
ATOM   3338 C  CG    . ASN A 1 402 ? 23.796  15.837  7.950   1.00 33.80 ? 402  ASN A CG    1 
ATOM   3339 O  OD1   . ASN A 1 402 ? 24.466  16.792  8.344   1.00 34.46 ? 402  ASN A OD1   1 
ATOM   3340 N  ND2   . ASN A 1 402 ? 23.947  15.318  6.745   1.00 32.74 ? 402  ASN A ND2   1 
ATOM   3341 N  N     . ARG A 1 403 ? 22.441  17.965  9.964   1.00 28.42 ? 403  ARG A N     1 
ATOM   3342 C  CA    . ARG A 1 403 ? 21.566  19.103  9.725   1.00 29.22 ? 403  ARG A CA    1 
ATOM   3343 C  C     . ARG A 1 403 ? 20.708  18.759  8.509   1.00 30.66 ? 403  ARG A C     1 
ATOM   3344 O  O     . ARG A 1 403 ? 21.145  18.017  7.613   1.00 32.85 ? 403  ARG A O     1 
ATOM   3345 C  CB    . ARG A 1 403 ? 22.365  20.391  9.473   1.00 29.92 ? 403  ARG A CB    1 
ATOM   3346 C  CG    . ARG A 1 403 ? 23.187  20.383  8.188   1.00 34.00 ? 403  ARG A CG    1 
ATOM   3347 C  CD    . ARG A 1 403 ? 23.980  21.664  8.020   1.00 38.83 ? 403  ARG A CD    1 
ATOM   3348 N  NE    . ARG A 1 403 ? 25.082  21.754  8.973   1.00 39.43 ? 403  ARG A NE    1 
ATOM   3349 C  CZ    . ARG A 1 403 ? 25.901  22.796  9.070   1.00 43.39 ? 403  ARG A CZ    1 
ATOM   3350 N  NH1   . ARG A 1 403 ? 25.752  23.849  8.273   1.00 42.51 ? 403  ARG A NH1   1 
ATOM   3351 N  NH2   . ARG A 1 403 ? 26.880  22.782  9.959   1.00 43.60 ? 403  ARG A NH2   1 
ATOM   3352 N  N     . TYR A 1 404 ? 19.483  19.274  8.502   1.00 29.95 ? 404  TYR A N     1 
ATOM   3353 C  CA    . TYR A 1 404 ? 18.584  19.150  7.359   1.00 30.63 ? 404  TYR A CA    1 
ATOM   3354 C  C     . TYR A 1 404 ? 17.963  20.520  7.092   1.00 31.82 ? 404  TYR A C     1 
ATOM   3355 O  O     . TYR A 1 404 ? 17.229  21.052  7.923   1.00 32.81 ? 404  TYR A O     1 
ATOM   3356 C  CB    . TYR A 1 404 ? 17.522  18.058  7.608   1.00 28.27 ? 404  TYR A CB    1 
ATOM   3357 C  CG    . TYR A 1 404 ? 18.119  16.663  7.646   1.00 30.01 ? 404  TYR A CG    1 
ATOM   3358 C  CD1   . TYR A 1 404 ? 18.247  15.905  6.480   1.00 32.37 ? 404  TYR A CD1   1 
ATOM   3359 C  CD2   . TYR A 1 404 ? 18.596  16.115  8.842   1.00 30.31 ? 404  TYR A CD2   1 
ATOM   3360 C  CE1   . TYR A 1 404 ? 18.814  14.628  6.505   1.00 30.77 ? 404  TYR A CE1   1 
ATOM   3361 C  CE2   . TYR A 1 404 ? 19.167  14.843  8.878   1.00 31.11 ? 404  TYR A CE2   1 
ATOM   3362 C  CZ    . TYR A 1 404 ? 19.273  14.105  7.705   1.00 34.45 ? 404  TYR A CZ    1 
ATOM   3363 O  OH    . TYR A 1 404 ? 19.837  12.844  7.734   1.00 29.56 ? 404  TYR A OH    1 
ATOM   3364 N  N     . LYS A 1 405 ? 18.286  21.087  5.933   1.00 33.38 ? 405  LYS A N     1 
ATOM   3365 C  CA    . LYS A 1 405 ? 17.964  22.479  5.610   1.00 33.98 ? 405  LYS A CA    1 
ATOM   3366 C  C     . LYS A 1 405 ? 16.475  22.735  5.345   1.00 33.92 ? 405  LYS A C     1 
ATOM   3367 O  O     . LYS A 1 405 ? 15.843  23.505  6.069   1.00 32.19 ? 405  LYS A O     1 
ATOM   3368 C  CB    . LYS A 1 405 ? 18.812  22.942  4.426   1.00 33.79 ? 405  LYS A CB    1 
ATOM   3369 C  CG    . LYS A 1 405 ? 18.829  24.440  4.201   1.00 35.36 ? 405  LYS A CG    1 
ATOM   3370 C  CD    . LYS A 1 405 ? 19.783  24.759  3.069   1.00 37.05 ? 405  LYS A CD    1 
ATOM   3371 C  CE    . LYS A 1 405 ? 19.833  26.242  2.767   1.00 44.59 ? 405  LYS A CE    1 
ATOM   3372 N  NZ    . LYS A 1 405 ? 20.641  26.495  1.538   1.00 45.70 ? 405  LYS A NZ    1 
ATOM   3373 N  N     . TYR A 1 406 ? 15.934  22.098  4.305   1.00 32.86 ? 406  TYR A N     1 
ATOM   3374 C  CA    . TYR A 1 406 ? 14.519  22.215  3.960   1.00 33.79 ? 406  TYR A CA    1 
ATOM   3375 C  C     . TYR A 1 406 ? 13.802  20.888  4.203   1.00 34.25 ? 406  TYR A C     1 
ATOM   3376 O  O     . TYR A 1 406 ? 14.200  19.843  3.677   1.00 34.21 ? 406  TYR A O     1 
ATOM   3377 C  CB    . TYR A 1 406 ? 14.340  22.668  2.505   1.00 32.56 ? 406  TYR A CB    1 
ATOM   3378 C  CG    . TYR A 1 406 ? 14.826  24.075  2.246   1.00 34.52 ? 406  TYR A CG    1 
ATOM   3379 C  CD1   . TYR A 1 406 ? 16.038  24.310  1.581   1.00 36.06 ? 406  TYR A CD1   1 
ATOM   3380 C  CD2   . TYR A 1 406 ? 14.078  25.177  2.668   1.00 31.65 ? 406  TYR A CD2   1 
ATOM   3381 C  CE1   . TYR A 1 406 ? 16.493  25.615  1.348   1.00 35.47 ? 406  TYR A CE1   1 
ATOM   3382 C  CE2   . TYR A 1 406 ? 14.518  26.478  2.440   1.00 35.69 ? 406  TYR A CE2   1 
ATOM   3383 C  CZ    . TYR A 1 406 ? 15.726  26.692  1.782   1.00 37.98 ? 406  TYR A CZ    1 
ATOM   3384 O  OH    . TYR A 1 406 ? 16.158  27.981  1.576   1.00 37.38 ? 406  TYR A OH    1 
ATOM   3385 N  N     . VAL A 1 407 ? 12.745  20.938  5.006   1.00 34.27 ? 407  VAL A N     1 
ATOM   3386 C  CA    . VAL A 1 407 ? 12.016  19.730  5.388   1.00 34.51 ? 407  VAL A CA    1 
ATOM   3387 C  C     . VAL A 1 407 ? 10.508  19.919  5.261   1.00 34.19 ? 407  VAL A C     1 
ATOM   3388 O  O     . VAL A 1 407 ? 9.970   20.953  5.648   1.00 34.52 ? 407  VAL A O     1 
ATOM   3389 C  CB    . VAL A 1 407 ? 12.371  19.282  6.839   1.00 32.02 ? 407  VAL A CB    1 
ATOM   3390 C  CG1   . VAL A 1 407 ? 11.581  18.061  7.239   1.00 27.06 ? 407  VAL A CG1   1 
ATOM   3391 C  CG2   . VAL A 1 407 ? 13.868  18.997  6.969   1.00 31.15 ? 407  VAL A CG2   1 
ATOM   3392 N  N     . MET A 1 408 ? 9.843   18.907  4.714   1.00 34.78 ? 408  MET A N     1 
ATOM   3393 C  CA    . MET A 1 408 ? 8.392   18.822  4.719   1.00 34.00 ? 408  MET A CA    1 
ATOM   3394 C  C     . MET A 1 408 ? 7.968   17.513  5.367   1.00 33.71 ? 408  MET A C     1 
ATOM   3395 O  O     . MET A 1 408 ? 8.519   16.452  5.055   1.00 33.72 ? 408  MET A O     1 
ATOM   3396 C  CB    . MET A 1 408 ? 7.841   18.904  3.300   1.00 36.22 ? 408  MET A CB    1 
ATOM   3397 C  CG    . MET A 1 408 ? 7.527   20.314  2.859   1.00 39.98 ? 408  MET A CG    1 
ATOM   3398 S  SD    . MET A 1 408 ? 6.430   20.415  1.429   1.00 49.31 ? 408  MET A SD    1 
ATOM   3399 C  CE    . MET A 1 408 ? 7.284   19.367  0.219   1.00 30.78 ? 408  MET A CE    1 
ATOM   3400 N  N     . SER A 1 409 ? 6.998   17.579  6.276   1.00 31.17 ? 409  SER A N     1 
ATOM   3401 C  CA    . SER A 1 409 ? 6.533   16.359  6.931   1.00 28.36 ? 409  SER A CA    1 
ATOM   3402 C  C     . SER A 1 409 ? 5.088   15.980  6.581   1.00 29.03 ? 409  SER A C     1 
ATOM   3403 O  O     . SER A 1 409 ? 4.268   16.836  6.225   1.00 26.66 ? 409  SER A O     1 
ATOM   3404 C  CB    . SER A 1 409 ? 6.738   16.435  8.446   1.00 26.90 ? 409  SER A CB    1 
ATOM   3405 O  OG    . SER A 1 409 ? 5.902   17.399  9.043   1.00 23.54 ? 409  SER A OG    1 
ATOM   3406 N  N     . PHE A 1 410 ? 4.802   14.682  6.677   1.00 29.79 ? 410  PHE A N     1 
ATOM   3407 C  CA    . PHE A 1 410 ? 3.476   14.140  6.427   1.00 30.84 ? 410  PHE A CA    1 
ATOM   3408 C  C     . PHE A 1 410 ? 3.126   13.130  7.512   1.00 32.11 ? 410  PHE A C     1 
ATOM   3409 O  O     . PHE A 1 410 ? 3.996   12.387  7.973   1.00 33.72 ? 410  PHE A O     1 
ATOM   3410 C  CB    . PHE A 1 410 ? 3.427   13.489  5.040   1.00 32.91 ? 410  PHE A CB    1 
ATOM   3411 C  CG    . PHE A 1 410 ? 3.727   14.444  3.902   1.00 31.20 ? 410  PHE A CG    1 
ATOM   3412 C  CD1   . PHE A 1 410 ? 5.043   14.761  3.565   1.00 31.64 ? 410  PHE A CD1   1 
ATOM   3413 C  CD2   . PHE A 1 410 ? 2.690   15.025  3.168   1.00 34.33 ? 410  PHE A CD2   1 
ATOM   3414 C  CE1   . PHE A 1 410 ? 5.332   15.648  2.514   1.00 31.02 ? 410  PHE A CE1   1 
ATOM   3415 C  CE2   . PHE A 1 410 ? 2.962   15.918  2.109   1.00 34.19 ? 410  PHE A CE2   1 
ATOM   3416 C  CZ    . PHE A 1 410 ? 4.292   16.222  1.779   1.00 33.97 ? 410  PHE A CZ    1 
ATOM   3417 N  N     . ASP A 1 411 ? 1.854   13.097  7.913   1.00 30.42 ? 411  ASP A N     1 
ATOM   3418 C  CA    . ASP A 1 411 ? 1.414   12.262  9.028   1.00 29.77 ? 411  ASP A CA    1 
ATOM   3419 C  C     . ASP A 1 411 ? -0.012  11.742  8.793   1.00 28.19 ? 411  ASP A C     1 
ATOM   3420 O  O     . ASP A 1 411 ? -0.901  12.502  8.413   1.00 29.29 ? 411  ASP A O     1 
ATOM   3421 C  CB    . ASP A 1 411 ? 1.510   13.057  10.342  1.00 28.00 ? 411  ASP A CB    1 
ATOM   3422 C  CG    . ASP A 1 411 ? 1.290   12.193  11.577  1.00 34.59 ? 411  ASP A CG    1 
ATOM   3423 O  OD1   . ASP A 1 411 ? 0.125   11.834  11.867  1.00 30.84 ? 411  ASP A OD1   1 
ATOM   3424 O  OD2   . ASP A 1 411 ? 2.278   11.893  12.287  1.00 38.16 ? 411  ASP A OD2   1 
ATOM   3425 N  N     . LEU A 1 412 ? -0.213  10.445  9.014   1.00 26.55 ? 412  LEU A N     1 
ATOM   3426 C  CA    . LEU A 1 412 ? -1.530  9.824   8.888   1.00 26.51 ? 412  LEU A CA    1 
ATOM   3427 C  C     . LEU A 1 412 ? -2.542  10.342  9.914   1.00 25.44 ? 412  LEU A C     1 
ATOM   3428 O  O     . LEU A 1 412 ? -2.263  10.364  11.109  1.00 24.27 ? 412  LEU A O     1 
ATOM   3429 C  CB    . LEU A 1 412 ? -1.414  8.309   9.028   1.00 24.79 ? 412  LEU A CB    1 
ATOM   3430 C  CG    . LEU A 1 412 ? -0.834  7.508   7.863   1.00 25.88 ? 412  LEU A CG    1 
ATOM   3431 C  CD1   . LEU A 1 412 ? -0.672  6.056   8.279   1.00 26.50 ? 412  LEU A CD1   1 
ATOM   3432 C  CD2   . LEU A 1 412 ? -1.717  7.598   6.632   1.00 20.71 ? 412  LEU A CD2   1 
ATOM   3433 N  N     . THR A 1 413 ? -3.714  10.754  9.433   1.00 25.34 ? 413  THR A N     1 
ATOM   3434 C  CA    . THR A 1 413 ? -4.818  11.147  10.302  1.00 24.59 ? 413  THR A CA    1 
ATOM   3435 C  C     . THR A 1 413 ? -5.309  9.922   11.079  1.00 24.13 ? 413  THR A C     1 
ATOM   3436 O  O     . THR A 1 413 ? -5.639  8.887   10.478  1.00 22.10 ? 413  THR A O     1 
ATOM   3437 C  CB    . THR A 1 413 ? -5.974  11.729  9.491   1.00 25.15 ? 413  THR A CB    1 
ATOM   3438 O  OG1   . THR A 1 413 ? -5.475  12.793  8.678   1.00 30.60 ? 413  THR A OG1   1 
ATOM   3439 C  CG2   . THR A 1 413 ? -7.070  12.271  10.412  1.00 24.01 ? 413  THR A CG2   1 
ATOM   3440 N  N     . SER A 1 414 ? -5.339  10.058  12.407  1.00 22.82 ? 414  SER A N     1 
ATOM   3441 C  CA    . SER A 1 414 ? -5.703  8.978   13.331  1.00 23.22 ? 414  SER A CA    1 
ATOM   3442 C  C     . SER A 1 414 ? -5.267  7.617   12.814  1.00 20.92 ? 414  SER A C     1 
ATOM   3443 O  O     . SER A 1 414 ? -6.091  6.766   12.470  1.00 24.07 ? 414  SER A O     1 
ATOM   3444 C  CB    . SER A 1 414 ? -7.192  9.016   13.659  1.00 22.37 ? 414  SER A CB    1 
ATOM   3445 O  OG    . SER A 1 414 ? -7.517  10.235  14.319  1.00 35.09 ? 414  SER A OG    1 
ATOM   3446 N  N     . ALA A 1 415 ? -3.957  7.428   12.762  1.00 22.72 ? 415  ALA A N     1 
ATOM   3447 C  CA    . ALA A 1 415 ? -3.372  6.243   12.128  1.00 23.75 ? 415  ALA A CA    1 
ATOM   3448 C  C     . ALA A 1 415 ? -4.062  4.953   12.550  1.00 23.80 ? 415  ALA A C     1 
ATOM   3449 O  O     . ALA A 1 415 ? -4.664  4.283   11.717  1.00 24.22 ? 415  ALA A O     1 
ATOM   3450 C  CB    . ALA A 1 415 ? -1.898  6.176   12.389  1.00 21.49 ? 415  ALA A CB    1 
ATOM   3451 N  N     . TYR A 1 416 ? -4.001  4.614   13.839  1.00 24.52 ? 416  TYR A N     1 
ATOM   3452 C  CA    . TYR A 1 416 ? -4.476  3.295   14.281  1.00 24.71 ? 416  TYR A CA    1 
ATOM   3453 C  C     . TYR A 1 416 ? -5.978  3.091   14.137  1.00 21.23 ? 416  TYR A C     1 
ATOM   3454 O  O     . TYR A 1 416 ? -6.391  2.031   13.705  1.00 23.54 ? 416  TYR A O     1 
ATOM   3455 C  CB    . TYR A 1 416 ? -4.012  2.953   15.708  1.00 25.07 ? 416  TYR A CB    1 
ATOM   3456 C  CG    . TYR A 1 416 ? -2.573  2.477   15.809  1.00 25.64 ? 416  TYR A CG    1 
ATOM   3457 C  CD1   . TYR A 1 416 ? -1.676  2.660   14.751  1.00 23.00 ? 416  TYR A CD1   1 
ATOM   3458 C  CD2   . TYR A 1 416 ? -2.096  1.883   16.983  1.00 23.98 ? 416  TYR A CD2   1 
ATOM   3459 C  CE1   . TYR A 1 416 ? -0.355  2.247   14.848  1.00 23.55 ? 416  TYR A CE1   1 
ATOM   3460 C  CE2   . TYR A 1 416 ? -0.764  1.466   17.092  1.00 23.51 ? 416  TYR A CE2   1 
ATOM   3461 C  CZ    . TYR A 1 416 ? 0.095   1.659   16.019  1.00 25.19 ? 416  TYR A CZ    1 
ATOM   3462 O  OH    . TYR A 1 416 ? 1.403   1.251   16.100  1.00 23.88 ? 416  TYR A OH    1 
ATOM   3463 N  N     . PRO A 1 417 ? -6.800  4.091   14.518  1.00 23.00 ? 417  PRO A N     1 
ATOM   3464 C  CA    . PRO A 1 417 ? -8.242  3.949   14.270  1.00 22.00 ? 417  PRO A CA    1 
ATOM   3465 C  C     . PRO A 1 417 ? -8.555  3.854   12.771  1.00 25.37 ? 417  PRO A C     1 
ATOM   3466 O  O     . PRO A 1 417 ? -9.455  3.095   12.374  1.00 27.78 ? 417  PRO A O     1 
ATOM   3467 C  CB    . PRO A 1 417 ? -8.833  5.227   14.897  1.00 21.69 ? 417  PRO A CB    1 
ATOM   3468 C  CG    . PRO A 1 417 ? -7.828  5.554   16.012  1.00 22.81 ? 417  PRO A CG    1 
ATOM   3469 C  CD    . PRO A 1 417 ? -6.510  5.283   15.346  1.00 19.69 ? 417  PRO A CD    1 
ATOM   3470 N  N     . SER A 1 418 ? -7.802  4.587   11.947  1.00 23.85 ? 418  SER A N     1 
ATOM   3471 C  CA    . SER A 1 418 ? -7.953  4.488   10.494  1.00 23.91 ? 418  SER A CA    1 
ATOM   3472 C  C     . SER A 1 418 ? -7.607  3.097   9.979   1.00 24.58 ? 418  SER A C     1 
ATOM   3473 O  O     . SER A 1 418 ? -8.271  2.593   9.071   1.00 26.35 ? 418  SER A O     1 
ATOM   3474 C  CB    . SER A 1 418 ? -7.124  5.547   9.775   1.00 23.08 ? 418  SER A CB    1 
ATOM   3475 O  OG    . SER A 1 418 ? -7.621  6.846   10.065  1.00 20.64 ? 418  SER A OG    1 
ATOM   3476 N  N     . ILE A 1 419 ? -6.595  2.461   10.573  1.00 23.49 ? 419  ILE A N     1 
ATOM   3477 C  CA    . ILE A 1 419 ? -6.250  1.094   10.183  1.00 22.44 ? 419  ILE A CA    1 
ATOM   3478 C  C     . ILE A 1 419 ? -7.385  0.142   10.536  1.00 22.41 ? 419  ILE A C     1 
ATOM   3479 O  O     . ILE A 1 419 ? -7.806  -0.635  9.695   1.00 23.67 ? 419  ILE A O     1 
ATOM   3480 C  CB    . ILE A 1 419 ? -4.909  0.607   10.762  1.00 22.24 ? 419  ILE A CB    1 
ATOM   3481 C  CG1   . ILE A 1 419 ? -3.739  1.417   10.171  1.00 20.18 ? 419  ILE A CG1   1 
ATOM   3482 C  CG2   . ILE A 1 419 ? -4.708  -0.862  10.456  1.00 19.30 ? 419  ILE A CG2   1 
ATOM   3483 C  CD1   . ILE A 1 419 ? -2.459  1.299   10.975  1.00 16.69 ? 419  ILE A CD1   1 
ATOM   3484 N  N     . ILE A 1 420 ? -7.887  0.241   11.765  1.00 22.97 ? 420  ILE A N     1 
ATOM   3485 C  CA    . ILE A 1 420 ? -9.041  -0.530  12.229  1.00 23.59 ? 420  ILE A CA    1 
ATOM   3486 C  C     . ILE A 1 420 ? -10.230 -0.452  11.265  1.00 24.20 ? 420  ILE A C     1 
ATOM   3487 O  O     . ILE A 1 420 ? -10.829 -1.475  10.925  1.00 23.65 ? 420  ILE A O     1 
ATOM   3488 C  CB    . ILE A 1 420 ? -9.487  -0.071  13.652  1.00 21.96 ? 420  ILE A CB    1 
ATOM   3489 C  CG1   . ILE A 1 420 ? -8.449  -0.529  14.691  1.00 24.12 ? 420  ILE A CG1   1 
ATOM   3490 C  CG2   . ILE A 1 420 ? -10.873 -0.593  13.969  1.00 21.85 ? 420  ILE A CG2   1 
ATOM   3491 C  CD1   . ILE A 1 420 ? -8.652  -0.012  16.107  1.00 17.94 ? 420  ILE A CD1   1 
ATOM   3492 N  N     . ARG A 1 421 ? -10.547 0.765   10.833  1.00 22.46 ? 421  ARG A N     1 
ATOM   3493 C  CA    . ARG A 1 421 ? -11.677 1.029   9.958   1.00 24.31 ? 421  ARG A CA    1 
ATOM   3494 C  C     . ARG A 1 421 ? -11.426 0.499   8.561   1.00 26.64 ? 421  ARG A C     1 
ATOM   3495 O  O     . ARG A 1 421 ? -12.319 -0.110  7.961   1.00 29.48 ? 421  ARG A O     1 
ATOM   3496 C  CB    . ARG A 1 421 ? -11.986 2.532   9.906   1.00 22.11 ? 421  ARG A CB    1 
ATOM   3497 C  CG    . ARG A 1 421 ? -12.416 3.113   11.240  1.00 22.77 ? 421  ARG A CG    1 
ATOM   3498 C  CD    . ARG A 1 421 ? -12.474 4.619   11.179  1.00 25.97 ? 421  ARG A CD    1 
ATOM   3499 N  NE    . ARG A 1 421 ? -13.446 5.088   10.194  1.00 27.42 ? 421  ARG A NE    1 
ATOM   3500 C  CZ    . ARG A 1 421 ? -13.316 6.205   9.486   1.00 29.72 ? 421  ARG A CZ    1 
ATOM   3501 N  NH1   . ARG A 1 421 ? -12.255 6.994   9.652   1.00 22.45 ? 421  ARG A NH1   1 
ATOM   3502 N  NH2   . ARG A 1 421 ? -14.253 6.535   8.611   1.00 29.52 ? 421  ARG A NH2   1 
ATOM   3503 N  N     . GLN A 1 422 ? -10.216 0.727   8.052   1.00 26.06 ? 422  GLN A N     1 
ATOM   3504 C  CA    . GLN A 1 422 ? -9.826  0.276   6.712   1.00 26.58 ? 422  GLN A CA    1 
ATOM   3505 C  C     . GLN A 1 422 ? -9.769  -1.251  6.608   1.00 26.71 ? 422  GLN A C     1 
ATOM   3506 O  O     . GLN A 1 422 ? -10.295 -1.837  5.664   1.00 29.45 ? 422  GLN A O     1 
ATOM   3507 C  CB    . GLN A 1 422 ? -8.487  0.903   6.302   1.00 22.90 ? 422  GLN A CB    1 
ATOM   3508 C  CG    . GLN A 1 422 ? -7.747  0.167   5.196   1.00 22.40 ? 422  GLN A CG    1 
ATOM   3509 C  CD    . GLN A 1 422 ? -6.869  1.081   4.355   1.00 23.03 ? 422  GLN A CD    1 
ATOM   3510 O  OE1   . GLN A 1 422 ? -6.934  2.310   4.464   1.00 22.96 ? 422  GLN A OE1   1 
ATOM   3511 N  NE2   . GLN A 1 422 ? -6.052  0.481   3.494   1.00 20.57 ? 422  GLN A NE2   1 
ATOM   3512 N  N     . VAL A 1 423 ? -9.130  -1.891  7.579   1.00 26.08 ? 423  VAL A N     1 
ATOM   3513 C  CA    . VAL A 1 423 ? -8.977  -3.340  7.542   1.00 25.02 ? 423  VAL A CA    1 
ATOM   3514 C  C     . VAL A 1 423 ? -10.256 -4.062  8.003   1.00 23.40 ? 423  VAL A C     1 
ATOM   3515 O  O     . VAL A 1 423 ? -10.481 -5.212  7.625   1.00 24.38 ? 423  VAL A O     1 
ATOM   3516 C  CB    . VAL A 1 423 ? -7.734  -3.817  8.347   1.00 24.15 ? 423  VAL A CB    1 
ATOM   3517 C  CG1   . VAL A 1 423 ? -7.527  -5.342  8.187   1.00 19.26 ? 423  VAL A CG1   1 
ATOM   3518 C  CG2   . VAL A 1 423 ? -6.464  -3.059  7.885   1.00 17.94 ? 423  VAL A CG2   1 
ATOM   3519 N  N     . ASN A 1 424 ? -11.077 -3.363  8.793   1.00 19.32 ? 424  ASN A N     1 
ATOM   3520 C  CA    . ASN A 1 424 ? -12.280 -3.904  9.444   1.00 22.20 ? 424  ASN A CA    1 
ATOM   3521 C  C     . ASN A 1 424 ? -11.921 -4.861  10.588  1.00 24.16 ? 424  ASN A C     1 
ATOM   3522 O  O     . ASN A 1 424 ? -12.472 -5.957  10.717  1.00 24.95 ? 424  ASN A O     1 
ATOM   3523 C  CB    . ASN A 1 424 ? -13.258 -4.537  8.433   1.00 21.85 ? 424  ASN A CB    1 
ATOM   3524 C  CG    . ASN A 1 424 ? -14.673 -4.684  8.994   1.00 27.05 ? 424  ASN A CG    1 
ATOM   3525 O  OD1   . ASN A 1 424 ? -15.130 -3.862  9.794   1.00 30.16 ? 424  ASN A OD1   1 
ATOM   3526 N  ND2   . ASN A 1 424 ? -15.371 -5.735  8.575   1.00 24.51 ? 424  ASN A ND2   1 
ATOM   3527 N  N     . ILE A 1 425 ? -10.998 -4.415  11.429  1.00 23.85 ? 425  ILE A N     1 
ATOM   3528 C  CA    . ILE A 1 425 ? -10.488 -5.208  12.537  1.00 25.83 ? 425  ILE A CA    1 
ATOM   3529 C  C     . ILE A 1 425 ? -11.445 -5.151  13.724  1.00 25.54 ? 425  ILE A C     1 
ATOM   3530 O  O     . ILE A 1 425 ? -11.689 -4.081  14.278  1.00 24.54 ? 425  ILE A O     1 
ATOM   3531 C  CB    . ILE A 1 425 ? -9.087  -4.708  12.955  1.00 26.29 ? 425  ILE A CB    1 
ATOM   3532 C  CG1   . ILE A 1 425 ? -8.090  -4.933  11.808  1.00 23.68 ? 425  ILE A CG1   1 
ATOM   3533 C  CG2   . ILE A 1 425 ? -8.630  -5.386  14.256  1.00 23.79 ? 425  ILE A CG2   1 
ATOM   3534 C  CD1   . ILE A 1 425 ? -6.738  -4.242  11.998  1.00 22.50 ? 425  ILE A CD1   1 
ATOM   3535 N  N     . SER A 1 426 ? -11.967 -6.310  14.117  1.00 23.51 ? 426  SER A N     1 
ATOM   3536 C  CA    . SER A 1 426 ? -12.966 -6.387  15.176  1.00 25.19 ? 426  SER A CA    1 
ATOM   3537 C  C     . SER A 1 426 ? -12.997 -7.833  15.687  1.00 27.21 ? 426  SER A C     1 
ATOM   3538 O  O     . SER A 1 426 ? -12.605 -8.749  14.962  1.00 30.51 ? 426  SER A O     1 
ATOM   3539 C  CB    . SER A 1 426 ? -14.341 -5.965  14.625  1.00 24.57 ? 426  SER A CB    1 
ATOM   3540 O  OG    . SER A 1 426 ? -15.249 -5.600  15.651  1.00 30.52 ? 426  SER A OG    1 
ATOM   3541 N  N     . PRO A 1 427 ? -13.446 -8.047  16.935  1.00 27.16 ? 427  PRO A N     1 
ATOM   3542 C  CA    . PRO A 1 427 ? -13.590 -9.413  17.454  1.00 27.67 ? 427  PRO A CA    1 
ATOM   3543 C  C     . PRO A 1 427 ? -14.442 -10.324 16.564  1.00 29.87 ? 427  PRO A C     1 
ATOM   3544 O  O     . PRO A 1 427 ? -14.114 -11.505 16.391  1.00 30.78 ? 427  PRO A O     1 
ATOM   3545 C  CB    . PRO A 1 427 ? -14.289 -9.203  18.816  1.00 27.58 ? 427  PRO A CB    1 
ATOM   3546 C  CG    . PRO A 1 427 ? -14.743 -7.744  18.830  1.00 29.10 ? 427  PRO A CG    1 
ATOM   3547 C  CD    . PRO A 1 427 ? -13.734 -7.040  17.972  1.00 25.07 ? 427  PRO A CD    1 
ATOM   3548 N  N     . GLU A 1 428 ? -15.513 -9.783  15.985  1.00 28.72 ? 428  GLU A N     1 
ATOM   3549 C  CA    . GLU A 1 428 ? -16.487 -10.625 15.280  1.00 30.02 ? 428  GLU A CA    1 
ATOM   3550 C  C     . GLU A 1 428 ? -16.328 -10.653 13.745  1.00 29.82 ? 428  GLU A C     1 
ATOM   3551 O  O     . GLU A 1 428 ? -17.108 -11.331 13.045  1.00 28.02 ? 428  GLU A O     1 
ATOM   3552 C  CB    . GLU A 1 428 ? -17.926 -10.269 15.696  1.00 30.61 ? 428  GLU A CB    1 
ATOM   3553 C  CG    . GLU A 1 428 ? -18.570 -9.076  14.965  1.00 29.55 ? 428  GLU A CG    1 
ATOM   3554 C  CD    . GLU A 1 428 ? -18.004 -7.725  15.377  1.00 32.47 ? 428  GLU A CD    1 
ATOM   3555 O  OE1   . GLU A 1 428 ? -16.866 -7.665  15.903  1.00 35.61 ? 428  GLU A OE1   1 
ATOM   3556 O  OE2   . GLU A 1 428 ? -18.703 -6.707  15.168  1.00 31.78 ? 428  GLU A OE2   1 
ATOM   3557 N  N     . THR A 1 429 ? -15.314 -9.944  13.238  1.00 25.20 ? 429  THR A N     1 
ATOM   3558 C  CA    . THR A 1 429 ? -15.034 -9.912  11.793  1.00 24.50 ? 429  THR A CA    1 
ATOM   3559 C  C     . THR A 1 429 ? -13.857 -10.789 11.363  1.00 24.14 ? 429  THR A C     1 
ATOM   3560 O  O     . THR A 1 429 ? -13.519 -10.840 10.175  1.00 24.85 ? 429  THR A O     1 
ATOM   3561 C  CB    . THR A 1 429 ? -14.783 -8.497  11.269  1.00 23.14 ? 429  THR A CB    1 
ATOM   3562 O  OG1   . THR A 1 429 ? -13.764 -7.878  12.055  1.00 24.06 ? 429  THR A OG1   1 
ATOM   3563 C  CG2   . THR A 1 429 ? -16.053 -7.681  11.339  1.00 21.59 ? 429  THR A CG2   1 
ATOM   3564 N  N     . ILE A 1 430 ? -13.225 -11.464 12.315  1.00 24.13 ? 430  ILE A N     1 
ATOM   3565 C  CA    . ILE A 1 430 ? -12.149 -12.391 11.976  1.00 26.13 ? 430  ILE A CA    1 
ATOM   3566 C  C     . ILE A 1 430 ? -12.716 -13.466 11.049  1.00 28.31 ? 430  ILE A C     1 
ATOM   3567 O  O     . ILE A 1 430 ? -13.684 -14.145 11.392  1.00 32.12 ? 430  ILE A O     1 
ATOM   3568 C  CB    . ILE A 1 430 ? -11.472 -12.989 13.231  1.00 25.58 ? 430  ILE A CB    1 
ATOM   3569 C  CG1   . ILE A 1 430 ? -10.748 -11.868 13.997  1.00 23.44 ? 430  ILE A CG1   1 
ATOM   3570 C  CG2   . ILE A 1 430 ? -10.505 -14.118 12.839  1.00 24.96 ? 430  ILE A CG2   1 
ATOM   3571 C  CD1   . ILE A 1 430 ? -10.408 -12.180 15.429  1.00 22.83 ? 430  ILE A CD1   1 
ATOM   3572 N  N     . ALA A 1 431 ? -12.136 -13.564 9.856   1.00 29.57 ? 431  ALA A N     1 
ATOM   3573 C  CA    . ALA A 1 431 ? -12.544 -14.543 8.851   1.00 31.97 ? 431  ALA A CA    1 
ATOM   3574 C  C     . ALA A 1 431 ? -11.570 -15.720 8.741   1.00 32.90 ? 431  ALA A C     1 
ATOM   3575 O  O     . ALA A 1 431 ? -11.926 -16.777 8.224   1.00 35.31 ? 431  ALA A O     1 
ATOM   3576 C  CB    . ALA A 1 431 ? -12.688 -13.858 7.491   1.00 31.90 ? 431  ALA A CB    1 
ATOM   3577 N  N     . GLY A 1 432 ? -10.337 -15.534 9.207   1.00 33.25 ? 432  GLY A N     1 
ATOM   3578 C  CA    . GLY A 1 432 ? -9.313  -16.577 9.086   1.00 31.72 ? 432  GLY A CA    1 
ATOM   3579 C  C     . GLY A 1 432 ? -7.911  -16.022 8.968   1.00 31.29 ? 432  GLY A C     1 
ATOM   3580 O  O     . GLY A 1 432 ? -7.674  -14.848 9.273   1.00 31.37 ? 432  GLY A O     1 
ATOM   3581 N  N     . THR A 1 433 ? -6.975  -16.871 8.541   1.00 30.21 ? 433  THR A N     1 
ATOM   3582 C  CA    . THR A 1 433 ? -5.575  -16.470 8.342   1.00 30.25 ? 433  THR A CA    1 
ATOM   3583 C  C     . THR A 1 433 ? -5.088  -16.812 6.937   1.00 31.64 ? 433  THR A C     1 
ATOM   3584 O  O     . THR A 1 433 ? -5.741  -17.553 6.216   1.00 31.40 ? 433  THR A O     1 
ATOM   3585 C  CB    . THR A 1 433 ? -4.594  -17.153 9.356   1.00 32.76 ? 433  THR A CB    1 
ATOM   3586 O  OG1   . THR A 1 433 ? -4.612  -18.578 9.172   1.00 28.45 ? 433  THR A OG1   1 
ATOM   3587 C  CG2   . THR A 1 433 ? -4.934  -16.795 10.813  1.00 29.11 ? 433  THR A CG2   1 
ATOM   3588 N  N     . PHE A 1 434 ? -3.944  -16.246 6.560   1.00 32.35 ? 434  PHE A N     1 
ATOM   3589 C  CA    . PHE A 1 434 ? -3.228  -16.623 5.346   1.00 32.72 ? 434  PHE A CA    1 
ATOM   3590 C  C     . PHE A 1 434 ? -1.760  -16.793 5.737   1.00 34.79 ? 434  PHE A C     1 
ATOM   3591 O  O     . PHE A 1 434 ? -1.338  -16.353 6.815   1.00 32.51 ? 434  PHE A O     1 
ATOM   3592 C  CB    . PHE A 1 434 ? -3.383  -15.554 4.243   1.00 30.31 ? 434  PHE A CB    1 
ATOM   3593 C  CG    . PHE A 1 434 ? -2.793  -14.194 4.603   1.00 29.87 ? 434  PHE A CG    1 
ATOM   3594 C  CD1   . PHE A 1 434 ? -3.574  -13.217 5.221   1.00 25.05 ? 434  PHE A CD1   1 
ATOM   3595 C  CD2   . PHE A 1 434 ? -1.465  -13.889 4.299   1.00 31.12 ? 434  PHE A CD2   1 
ATOM   3596 C  CE1   . PHE A 1 434 ? -3.042  -11.969 5.556   1.00 23.81 ? 434  PHE A CE1   1 
ATOM   3597 C  CE2   . PHE A 1 434 ? -0.927  -12.643 4.623   1.00 28.69 ? 434  PHE A CE2   1 
ATOM   3598 C  CZ    . PHE A 1 434 ? -1.723  -11.681 5.255   1.00 29.41 ? 434  PHE A CZ    1 
ATOM   3599 N  N     . LYS A 1 435 ? -0.990  -17.413 4.855   1.00 34.26 ? 435  LYS A N     1 
ATOM   3600 C  CA    . LYS A 1 435 ? 0.410   -17.713 5.107   1.00 36.94 ? 435  LYS A CA    1 
ATOM   3601 C  C     . LYS A 1 435 ? 1.240   -16.446 4.922   1.00 37.25 ? 435  LYS A C     1 
ATOM   3602 O  O     . LYS A 1 435 ? 1.235   -15.856 3.837   1.00 37.29 ? 435  LYS A O     1 
ATOM   3603 C  CB    . LYS A 1 435 ? 0.855   -18.800 4.130   1.00 38.93 ? 435  LYS A CB    1 
ATOM   3604 C  CG    . LYS A 1 435 ? 1.801   -19.836 4.702   1.00 42.52 ? 435  LYS A CG    1 
ATOM   3605 C  CD    . LYS A 1 435 ? 1.675   -21.187 3.976   1.00 42.48 ? 435  LYS A CD    1 
ATOM   3606 C  CE    . LYS A 1 435 ? 2.436   -21.222 2.649   1.00 40.41 ? 435  LYS A CE    1 
ATOM   3607 N  NZ    . LYS A 1 435 ? 2.533   -22.614 2.119   1.00 33.46 ? 435  LYS A NZ    1 
ATOM   3608 N  N     . VAL A 1 436 ? 1.954   -16.025 5.968   1.00 35.64 ? 436  VAL A N     1 
ATOM   3609 C  CA    . VAL A 1 436 ? 2.646   -14.732 5.927   1.00 35.82 ? 436  VAL A CA    1 
ATOM   3610 C  C     . VAL A 1 436 ? 4.062   -14.814 5.366   1.00 37.19 ? 436  VAL A C     1 
ATOM   3611 O  O     . VAL A 1 436 ? 4.833   -15.706 5.718   1.00 39.31 ? 436  VAL A O     1 
ATOM   3612 C  CB    . VAL A 1 436 ? 2.646   -13.972 7.298   1.00 34.52 ? 436  VAL A CB    1 
ATOM   3613 C  CG1   . VAL A 1 436 ? 1.267   -13.977 7.911   1.00 33.25 ? 436  VAL A CG1   1 
ATOM   3614 C  CG2   . VAL A 1 436 ? 3.655   -14.565 8.278   1.00 39.60 ? 436  VAL A CG2   1 
ATOM   3615 N  N     . ALA A 1 437 ? 4.368   -13.869 4.482   1.00 35.96 ? 437  ALA A N     1 
ATOM   3616 C  CA    . ALA A 1 437 ? 5.703   -13.647 3.967   1.00 37.48 ? 437  ALA A CA    1 
ATOM   3617 C  C     . ALA A 1 437 ? 6.376   -12.551 4.808   1.00 39.40 ? 437  ALA A C     1 
ATOM   3618 O  O     . ALA A 1 437 ? 5.682   -11.791 5.495   1.00 38.02 ? 437  ALA A O     1 
ATOM   3619 C  CB    . ALA A 1 437 ? 5.622   -13.233 2.522   1.00 37.05 ? 437  ALA A CB    1 
ATOM   3620 N  N     . PRO A 1 438 ? 7.723   -12.464 4.768   1.00 40.27 ? 438  PRO A N     1 
ATOM   3621 C  CA    . PRO A 1 438 ? 8.395   -11.399 5.500   1.00 40.74 ? 438  PRO A CA    1 
ATOM   3622 C  C     . PRO A 1 438 ? 7.851   -10.024 5.145   1.00 39.22 ? 438  PRO A C     1 
ATOM   3623 O  O     . PRO A 1 438 ? 7.529   -9.761  3.983   1.00 37.98 ? 438  PRO A O     1 
ATOM   3624 C  CB    . PRO A 1 438 ? 9.844   -11.536 5.045   1.00 42.38 ? 438  PRO A CB    1 
ATOM   3625 C  CG    . PRO A 1 438 ? 9.993   -12.980 4.824   1.00 43.62 ? 438  PRO A CG    1 
ATOM   3626 C  CD    . PRO A 1 438 ? 8.700   -13.386 4.166   1.00 43.21 ? 438  PRO A CD    1 
ATOM   3627 N  N     . LEU A 1 439 ? 7.741   -9.166  6.155   1.00 38.76 ? 439  LEU A N     1 
ATOM   3628 C  CA    . LEU A 1 439 ? 7.161   -7.835  5.993   1.00 38.15 ? 439  LEU A CA    1 
ATOM   3629 C  C     . LEU A 1 439 ? 7.758   -7.069  4.811   1.00 38.39 ? 439  LEU A C     1 
ATOM   3630 O  O     . LEU A 1 439 ? 7.029   -6.403  4.068   1.00 40.65 ? 439  LEU A O     1 
ATOM   3631 C  CB    . LEU A 1 439 ? 7.314   -7.027  7.286   1.00 36.07 ? 439  LEU A CB    1 
ATOM   3632 C  CG    . LEU A 1 439 ? 6.426   -5.786  7.350   1.00 36.97 ? 439  LEU A CG    1 
ATOM   3633 C  CD1   . LEU A 1 439 ? 4.965   -6.191  7.540   1.00 34.38 ? 439  LEU A CD1   1 
ATOM   3634 C  CD2   . LEU A 1 439 ? 6.896   -4.846  8.464   1.00 37.85 ? 439  LEU A CD2   1 
ATOM   3635 N  N     . HIS A 1 440 ? 9.079   -7.177  4.656   1.00 38.19 ? 440  HIS A N     1 
ATOM   3636 C  CA    A HIS A 1 440 ? 9.766   -6.488  3.569   0.50 39.45 ? 440  HIS A CA    1 
ATOM   3637 C  CA    B HIS A 1 440 ? 9.861   -6.592  3.557   0.50 39.32 ? 440  HIS A CA    1 
ATOM   3638 C  C     . HIS A 1 440 ? 9.199   -6.846  2.195   1.00 40.31 ? 440  HIS A C     1 
ATOM   3639 O  O     . HIS A 1 440 ? 9.166   -5.984  1.308   1.00 39.88 ? 440  HIS A O     1 
ATOM   3640 C  CB    A HIS A 1 440 ? 11.285  -6.683  3.630   0.50 40.70 ? 440  HIS A CB    1 
ATOM   3641 C  CB    B HIS A 1 440 ? 11.258  -7.232  3.614   0.50 40.62 ? 440  HIS A CB    1 
ATOM   3642 C  CG    A HIS A 1 440 ? 11.963  -5.808  4.641   0.50 42.63 ? 440  HIS A CG    1 
ATOM   3643 C  CG    B HIS A 1 440 ? 12.216  -6.764  2.561   0.50 43.24 ? 440  HIS A CG    1 
ATOM   3644 N  ND1   A HIS A 1 440 ? 13.064  -6.216  5.366   0.50 43.18 ? 440  HIS A ND1   1 
ATOM   3645 N  ND1   B HIS A 1 440 ? 12.689  -7.596  1.568   0.50 44.90 ? 440  HIS A ND1   1 
ATOM   3646 C  CD2   A HIS A 1 440 ? 11.680  -4.552  5.063   0.50 41.33 ? 440  HIS A CD2   1 
ATOM   3647 C  CD2   B HIS A 1 440 ? 12.830  -5.571  2.376   0.50 43.56 ? 440  HIS A CD2   1 
ATOM   3648 C  CE1   A HIS A 1 440 ? 13.435  -5.246  6.183   0.50 43.55 ? 440  HIS A CE1   1 
ATOM   3649 C  CE1   B HIS A 1 440 ? 13.535  -6.929  0.804   0.50 45.71 ? 440  HIS A CE1   1 
ATOM   3650 N  NE2   A HIS A 1 440 ? 12.610  -4.227  6.021   0.50 41.97 ? 440  HIS A NE2   1 
ATOM   3651 N  NE2   B HIS A 1 440 ? 13.641  -5.699  1.274   0.50 44.79 ? 440  HIS A NE2   1 
ATOM   3652 N  N     . ASP A 1 441 ? 8.694   -8.069  2.039   1.00 38.77 ? 441  ASP A N     1 
ATOM   3653 C  CA    . ASP A 1 441 ? 8.095   -8.509  0.785   1.00 38.52 ? 441  ASP A CA    1 
ATOM   3654 C  C     . ASP A 1 441 ? 6.775   -7.794  0.463   1.00 37.31 ? 441  ASP A C     1 
ATOM   3655 O  O     . ASP A 1 441 ? 6.520   -7.466  -0.698  1.00 39.94 ? 441  ASP A O     1 
ATOM   3656 C  CB    . ASP A 1 441 ? 7.934   -10.035 0.773   1.00 39.45 ? 441  ASP A CB    1 
ATOM   3657 C  CG    . ASP A 1 441 ? 9.278   -10.769 0.709   1.00 41.48 ? 441  ASP A CG    1 
ATOM   3658 O  OD1   . ASP A 1 441 ? 10.314  -10.135 0.406   1.00 38.37 ? 441  ASP A OD1   1 
ATOM   3659 O  OD2   . ASP A 1 441 ? 9.295   -11.988 0.964   1.00 43.85 ? 441  ASP A OD2   1 
ATOM   3660 N  N     . TYR A 1 442 ? 5.955   -7.539  1.483   1.00 32.35 ? 442  TYR A N     1 
ATOM   3661 C  CA    . TYR A 1 442 ? 4.748   -6.733  1.311   1.00 32.98 ? 442  TYR A CA    1 
ATOM   3662 C  C     . TYR A 1 442 ? 5.091   -5.268  1.020   1.00 33.94 ? 442  TYR A C     1 
ATOM   3663 O  O     . TYR A 1 442 ? 4.492   -4.650  0.132   1.00 34.76 ? 442  TYR A O     1 
ATOM   3664 C  CB    . TYR A 1 442 ? 3.801   -6.868  2.517   1.00 31.35 ? 442  TYR A CB    1 
ATOM   3665 C  CG    . TYR A 1 442 ? 3.288   -8.287  2.709   1.00 29.32 ? 442  TYR A CG    1 
ATOM   3666 C  CD1   . TYR A 1 442 ? 2.444   -8.890  1.761   1.00 28.87 ? 442  TYR A CD1   1 
ATOM   3667 C  CD2   . TYR A 1 442 ? 3.661   -9.030  3.821   1.00 29.76 ? 442  TYR A CD2   1 
ATOM   3668 C  CE1   . TYR A 1 442 ? 1.983   -10.204 1.930   1.00 30.17 ? 442  TYR A CE1   1 
ATOM   3669 C  CE2   . TYR A 1 442 ? 3.213   -10.347 3.997   1.00 33.14 ? 442  TYR A CE2   1 
ATOM   3670 C  CZ    . TYR A 1 442 ? 2.380   -10.923 3.050   1.00 31.43 ? 442  TYR A CZ    1 
ATOM   3671 O  OH    . TYR A 1 442 ? 1.951   -12.213 3.244   1.00 37.70 ? 442  TYR A OH    1 
ATOM   3672 N  N     . ILE A 1 443 ? 6.078   -4.738  1.744   1.00 33.00 ? 443  ILE A N     1 
ATOM   3673 C  CA    . ILE A 1 443 ? 6.531   -3.356  1.582   1.00 32.90 ? 443  ILE A CA    1 
ATOM   3674 C  C     . ILE A 1 443 ? 6.979   -3.064  0.155   1.00 34.68 ? 443  ILE A C     1 
ATOM   3675 O  O     . ILE A 1 443 ? 6.682   -1.995  -0.389  1.00 33.84 ? 443  ILE A O     1 
ATOM   3676 C  CB    . ILE A 1 443 ? 7.668   -3.016  2.582   1.00 32.13 ? 443  ILE A CB    1 
ATOM   3677 C  CG1   . ILE A 1 443 ? 7.135   -3.076  4.020   1.00 33.03 ? 443  ILE A CG1   1 
ATOM   3678 C  CG2   . ILE A 1 443 ? 8.273   -1.635  2.284   1.00 30.44 ? 443  ILE A CG2   1 
ATOM   3679 C  CD1   . ILE A 1 443 ? 8.218   -3.193  5.107   1.00 33.34 ? 443  ILE A CD1   1 
ATOM   3680 N  N     . ASN A 1 444 ? 7.677   -4.026  -0.446  1.00 37.36 ? 444  ASN A N     1 
ATOM   3681 C  CA    . ASN A 1 444 ? 8.156   -3.901  -1.825  1.00 41.08 ? 444  ASN A CA    1 
ATOM   3682 C  C     . ASN A 1 444 ? 7.217   -4.532  -2.859  1.00 42.97 ? 444  ASN A C     1 
ATOM   3683 O  O     . ASN A 1 444 ? 7.559   -4.658  -4.038  1.00 44.87 ? 444  ASN A O     1 
ATOM   3684 C  CB    . ASN A 1 444 ? 9.583   -4.448  -1.942  1.00 42.63 ? 444  ASN A CB    1 
ATOM   3685 C  CG    . ASN A 1 444 ? 10.568  -3.675  -1.076  1.00 45.91 ? 444  ASN A CG    1 
ATOM   3686 O  OD1   . ASN A 1 444 ? 10.605  -2.446  -1.105  1.00 47.38 ? 444  ASN A OD1   1 
ATOM   3687 N  ND2   . ASN A 1 444 ? 11.353  -4.392  -0.287  1.00 48.81 ? 444  ASN A ND2   1 
ATOM   3688 N  N     . ALA A 1 445 ? 6.029   -4.919  -2.401  1.00 42.91 ? 445  ALA A N     1 
ATOM   3689 C  CA    . ALA A 1 445 ? 4.953   -5.411  -3.265  1.00 42.39 ? 445  ALA A CA    1 
ATOM   3690 C  C     . ALA A 1 445 ? 5.305   -6.668  -4.059  1.00 43.40 ? 445  ALA A C     1 
ATOM   3691 O  O     . ALA A 1 445 ? 4.722   -6.912  -5.117  1.00 43.61 ? 445  ALA A O     1 
ATOM   3692 C  CB    . ALA A 1 445 ? 4.446   -4.294  -4.200  1.00 43.00 ? 445  ALA A CB    1 
ATOM   3693 N  N     . VAL A 1 446 ? 6.242   -7.465  -3.543  1.00 44.17 ? 446  VAL A N     1 
ATOM   3694 C  CA    . VAL A 1 446 ? 6.621   -8.722  -4.196  1.00 45.45 ? 446  VAL A CA    1 
ATOM   3695 C  C     . VAL A 1 446 ? 5.951   -9.955  -3.585  1.00 45.32 ? 446  VAL A C     1 
ATOM   3696 O  O     . VAL A 1 446 ? 5.929   -11.021 -4.197  1.00 45.79 ? 446  VAL A O     1 
ATOM   3697 C  CB    . VAL A 1 446 ? 8.173   -8.920  -4.308  1.00 48.05 ? 446  VAL A CB    1 
ATOM   3698 C  CG1   . VAL A 1 446 ? 8.769   -7.938  -5.312  1.00 46.68 ? 446  VAL A CG1   1 
ATOM   3699 C  CG2   . VAL A 1 446 ? 8.862   -8.800  -2.942  1.00 46.37 ? 446  VAL A CG2   1 
ATOM   3700 N  N     . ALA A 1 447 ? 5.389   -9.820  -2.391  1.00 44.08 ? 447  ALA A N     1 
ATOM   3701 C  CA    . ALA A 1 447 ? 4.681   -10.951 -1.796  1.00 44.14 ? 447  ALA A CA    1 
ATOM   3702 C  C     . ALA A 1 447 ? 3.357   -11.249 -2.514  1.00 43.77 ? 447  ALA A C     1 
ATOM   3703 O  O     . ALA A 1 447 ? 2.740   -10.360 -3.109  1.00 41.84 ? 447  ALA A O     1 
ATOM   3704 C  CB    . ALA A 1 447 ? 4.451   -10.725 -0.318  1.00 43.29 ? 447  ALA A CB    1 
ATOM   3705 N  N     . GLU A 1 448 ? 2.950   -12.513 -2.462  1.00 44.05 ? 448  GLU A N     1 
ATOM   3706 C  CA    . GLU A 1 448 ? 1.664   -12.956 -2.985  1.00 44.34 ? 448  GLU A CA    1 
ATOM   3707 C  C     . GLU A 1 448 ? 0.522   -12.201 -2.312  1.00 40.42 ? 448  GLU A C     1 
ATOM   3708 O  O     . GLU A 1 448 ? 0.530   -12.007 -1.099  1.00 36.62 ? 448  GLU A O     1 
ATOM   3709 C  CB    . GLU A 1 448 ? 1.503   -14.457 -2.744  1.00 46.85 ? 448  GLU A CB    1 
ATOM   3710 C  CG    . GLU A 1 448 ? 0.188   -15.041 -3.247  1.00 54.96 ? 448  GLU A CG    1 
ATOM   3711 C  CD    . GLU A 1 448 ? 0.185   -16.560 -3.259  1.00 60.86 ? 448  GLU A CD    1 
ATOM   3712 O  OE1   . GLU A 1 448 ? -0.254  -17.141 -4.277  1.00 63.49 ? 448  GLU A OE1   1 
ATOM   3713 O  OE2   . GLU A 1 448 ? 0.626   -17.171 -2.260  1.00 60.44 ? 448  GLU A OE2   1 
ATOM   3714 N  N     . ARG A 1 449 ? -0.450  -11.774 -3.112  1.00 40.28 ? 449  ARG A N     1 
ATOM   3715 C  CA    . ARG A 1 449 ? -1.627  -11.081 -2.598  1.00 39.41 ? 449  ARG A CA    1 
ATOM   3716 C  C     . ARG A 1 449 ? -2.333  -11.988 -1.582  1.00 36.79 ? 449  ARG A C     1 
ATOM   3717 O  O     . ARG A 1 449 ? -2.729  -13.105 -1.918  1.00 37.07 ? 449  ARG A O     1 
ATOM   3718 C  CB    . ARG A 1 449 ? -2.566  -10.676 -3.742  1.00 40.04 ? 449  ARG A CB    1 
ATOM   3719 C  CG    . ARG A 1 449 ? -3.655  -9.680  -3.347  1.00 42.14 ? 449  ARG A CG    1 
ATOM   3720 C  CD    . ARG A 1 449 ? -4.269  -9.005  -4.584  1.00 44.65 ? 449  ARG A CD    1 
ATOM   3721 N  NE    . ARG A 1 449 ? -5.342  -8.068  -4.231  1.00 40.01 ? 449  ARG A NE    1 
ATOM   3722 C  CZ    . ARG A 1 449 ? -6.642  -8.352  -4.285  1.00 40.66 ? 449  ARG A CZ    1 
ATOM   3723 N  NH1   . ARG A 1 449 ? -7.051  -9.553  -4.683  1.00 36.74 ? 449  ARG A NH1   1 
ATOM   3724 N  NH2   . ARG A 1 449 ? -7.542  -7.434  -3.946  1.00 34.97 ? 449  ARG A NH2   1 
ATOM   3725 N  N     . PRO A 1 450 ? -2.463  -11.513 -0.332  1.00 33.72 ? 450  PRO A N     1 
ATOM   3726 C  CA    . PRO A 1 450 ? -2.977  -12.326 0.780   1.00 33.23 ? 450  PRO A CA    1 
ATOM   3727 C  C     . PRO A 1 450 ? -4.326  -12.988 0.518   1.00 32.31 ? 450  PRO A C     1 
ATOM   3728 O  O     . PRO A 1 450 ? -4.489  -14.181 0.791   1.00 31.96 ? 450  PRO A O     1 
ATOM   3729 C  CB    . PRO A 1 450 ? -3.101  -11.314 1.915   1.00 29.91 ? 450  PRO A CB    1 
ATOM   3730 C  CG    . PRO A 1 450 ? -2.003  -10.338 1.642   1.00 31.59 ? 450  PRO A CG    1 
ATOM   3731 C  CD    . PRO A 1 450 ? -1.998  -10.191 0.136   1.00 33.13 ? 450  PRO A CD    1 
ATOM   3732 N  N     . SER A 1 451 ? -5.287  -12.222 0.010   1.00 31.23 ? 451  SER A N     1 
ATOM   3733 C  CA    . SER A 1 451 ? -6.629  -12.743 -0.170  1.00 32.92 ? 451  SER A CA    1 
ATOM   3734 C  C     . SER A 1 451 ? -7.329  -12.076 -1.327  1.00 34.16 ? 451  SER A C     1 
ATOM   3735 O  O     . SER A 1 451 ? -7.050  -10.925 -1.658  1.00 33.06 ? 451  SER A O     1 
ATOM   3736 C  CB    . SER A 1 451 ? -7.475  -12.584 1.096   1.00 31.23 ? 451  SER A CB    1 
ATOM   3737 O  OG    . SER A 1 451 ? -8.760  -13.166 0.915   1.00 31.69 ? 451  SER A OG    1 
ATOM   3738 N  N     . ASP A 1 452 ? -8.242  -12.827 -1.926  1.00 32.27 ? 452  ASP A N     1 
ATOM   3739 C  CA    . ASP A 1 452 ? -9.078  -12.325 -2.991  1.00 35.15 ? 452  ASP A CA    1 
ATOM   3740 C  C     . ASP A 1 452 ? -10.539 -12.291 -2.542  1.00 33.37 ? 452  ASP A C     1 
ATOM   3741 O  O     . ASP A 1 452 ? -11.446 -12.093 -3.351  1.00 34.12 ? 452  ASP A O     1 
ATOM   3742 C  CB    . ASP A 1 452 ? -8.895  -13.198 -4.235  1.00 37.42 ? 452  ASP A CB    1 
ATOM   3743 C  CG    . ASP A 1 452 ? -8.853  -12.388 -5.505  1.00 43.96 ? 452  ASP A CG    1 
ATOM   3744 O  OD1   . ASP A 1 452 ? -9.035  -11.152 -5.438  1.00 50.43 ? 452  ASP A OD1   1 
ATOM   3745 O  OD2   . ASP A 1 452 ? -8.635  -12.984 -6.576  1.00 51.23 ? 452  ASP A OD2   1 
ATOM   3746 N  N     . VAL A 1 453 ? -10.760 -12.495 -1.244  1.00 30.47 ? 453  VAL A N     1 
ATOM   3747 C  CA    . VAL A 1 453 ? -12.105 -12.503 -0.681  1.00 29.99 ? 453  VAL A CA    1 
ATOM   3748 C  C     . VAL A 1 453 ? -12.213 -11.557 0.518   1.00 31.07 ? 453  VAL A C     1 
ATOM   3749 O  O     . VAL A 1 453 ? -13.189 -10.800 0.648   1.00 30.26 ? 453  VAL A O     1 
ATOM   3750 C  CB    . VAL A 1 453 ? -12.531 -13.931 -0.249  1.00 30.19 ? 453  VAL A CB    1 
ATOM   3751 C  CG1   . VAL A 1 453 ? -14.021 -13.979 0.047   1.00 34.93 ? 453  VAL A CG1   1 
ATOM   3752 C  CG2   . VAL A 1 453 ? -12.169 -14.960 -1.322  1.00 28.89 ? 453  VAL A CG2   1 
ATOM   3753 N  N     . TYR A 1 454 ? -11.204 -11.618 1.387   1.00 27.32 ? 454  TYR A N     1 
ATOM   3754 C  CA    . TYR A 1 454 ? -11.242 -10.959 2.676   1.00 27.66 ? 454  TYR A CA    1 
ATOM   3755 C  C     . TYR A 1 454 ? -10.221 -9.819  2.763   1.00 27.90 ? 454  TYR A C     1 
ATOM   3756 O  O     . TYR A 1 454 ? -9.254  -9.773  1.991   1.00 28.56 ? 454  TYR A O     1 
ATOM   3757 C  CB    . TYR A 1 454 ? -10.980 -11.991 3.783   1.00 28.32 ? 454  TYR A CB    1 
ATOM   3758 C  CG    . TYR A 1 454 ? -11.982 -13.130 3.811   1.00 27.15 ? 454  TYR A CG    1 
ATOM   3759 C  CD1   . TYR A 1 454 ? -13.346 -12.878 3.987   1.00 25.89 ? 454  TYR A CD1   1 
ATOM   3760 C  CD2   . TYR A 1 454 ? -11.569 -14.460 3.663   1.00 28.52 ? 454  TYR A CD2   1 
ATOM   3761 C  CE1   . TYR A 1 454 ? -14.281 -13.923 4.005   1.00 26.87 ? 454  TYR A CE1   1 
ATOM   3762 C  CE2   . TYR A 1 454 ? -12.497 -15.513 3.685   1.00 27.34 ? 454  TYR A CE2   1 
ATOM   3763 C  CZ    . TYR A 1 454 ? -13.850 -15.229 3.866   1.00 30.02 ? 454  TYR A CZ    1 
ATOM   3764 O  OH    . TYR A 1 454 ? -14.783 -16.246 3.896   1.00 35.72 ? 454  TYR A OH    1 
ATOM   3765 N  N     . SER A 1 455 ? -10.439 -8.921  3.721   1.00 26.48 ? 455  SER A N     1 
ATOM   3766 C  CA    . SER A 1 455 ? -9.571  -7.770  3.951   1.00 27.48 ? 455  SER A CA    1 
ATOM   3767 C  C     . SER A 1 455 ? -8.422  -8.134  4.901   1.00 27.25 ? 455  SER A C     1 
ATOM   3768 O  O     . SER A 1 455 ? -8.656  -8.748  5.935   1.00 27.24 ? 455  SER A O     1 
ATOM   3769 C  CB    . SER A 1 455 ? -10.397 -6.609  4.514   1.00 24.24 ? 455  SER A CB    1 
ATOM   3770 O  OG    . SER A 1 455 ? -9.552  -5.612  5.063   1.00 26.64 ? 455  SER A OG    1 
ATOM   3771 N  N     . CYS A 1 456 ? -7.194  -7.746  4.556   1.00 27.88 ? 456  CYS A N     1 
ATOM   3772 C  CA    . CYS A 1 456 ? -6.009  -8.308  5.226   1.00 27.84 ? 456  CYS A CA    1 
ATOM   3773 C  C     . CYS A 1 456 ? -5.040  -7.349  5.898   1.00 28.41 ? 456  CYS A C     1 
ATOM   3774 O  O     . CYS A 1 456 ? -4.906  -6.178  5.519   1.00 28.03 ? 456  CYS A O     1 
ATOM   3775 C  CB    . CYS A 1 456 ? -5.221  -9.201  4.264   1.00 29.01 ? 456  CYS A CB    1 
ATOM   3776 S  SG    . CYS A 1 456 ? -6.184  -10.574 3.663   1.00 33.13 ? 456  CYS A SG    1 
ATOM   3777 N  N     . SER A 1 457 ? -4.363  -7.883  6.910   1.00 26.26 ? 457  SER A N     1 
ATOM   3778 C  CA    . SER A 1 457 ? -3.235  -7.231  7.523   1.00 26.86 ? 457  SER A CA    1 
ATOM   3779 C  C     . SER A 1 457 ? -2.037  -8.151  7.342   1.00 27.01 ? 457  SER A C     1 
ATOM   3780 O  O     . SER A 1 457 ? -2.189  -9.364  7.438   1.00 27.61 ? 457  SER A O     1 
ATOM   3781 C  CB    . SER A 1 457 ? -3.493  -6.998  9.003   1.00 24.36 ? 457  SER A CB    1 
ATOM   3782 O  OG    . SER A 1 457 ? -2.321  -6.483  9.614   1.00 27.19 ? 457  SER A OG    1 
ATOM   3783 N  N     . PRO A 1 458 ? -0.844  -7.577  7.080   1.00 26.96 ? 458  PRO A N     1 
ATOM   3784 C  CA    . PRO A 1 458 ? 0.400   -8.339  6.866   1.00 29.38 ? 458  PRO A CA    1 
ATOM   3785 C  C     . PRO A 1 458 ? 0.873   -9.207  8.047   1.00 29.88 ? 458  PRO A C     1 
ATOM   3786 O  O     . PRO A 1 458 ? 1.890   -9.895  7.916   1.00 30.08 ? 458  PRO A O     1 
ATOM   3787 C  CB    . PRO A 1 458 ? 1.438   -7.245  6.556   1.00 29.16 ? 458  PRO A CB    1 
ATOM   3788 C  CG    . PRO A 1 458 ? 0.828   -5.982  7.084   1.00 27.28 ? 458  PRO A CG    1 
ATOM   3789 C  CD    . PRO A 1 458 ? -0.633  -6.137  6.855   1.00 26.14 ? 458  PRO A CD    1 
ATOM   3790 N  N     . ASN A 1 459 ? 0.162   -9.169  9.179   1.00 28.70 ? 459  ASN A N     1 
ATOM   3791 C  CA    . ASN A 1 459 ? 0.414   -10.112 10.279  1.00 27.65 ? 459  ASN A CA    1 
ATOM   3792 C  C     . ASN A 1 459 ? -0.191  -11.500 10.035  1.00 29.27 ? 459  ASN A C     1 
ATOM   3793 O  O     . ASN A 1 459 ? 0.041   -12.427 10.808  1.00 29.92 ? 459  ASN A O     1 
ATOM   3794 C  CB    . ASN A 1 459 ? -0.062  -9.547  11.630  1.00 27.35 ? 459  ASN A CB    1 
ATOM   3795 C  CG    . ASN A 1 459 ? -1.570  -9.679  11.844  1.00 27.83 ? 459  ASN A CG    1 
ATOM   3796 O  OD1   . ASN A 1 459 ? -2.364  -9.569  10.907  1.00 26.05 ? 459  ASN A OD1   1 
ATOM   3797 N  ND2   . ASN A 1 459 ? -1.969  -9.897  13.094  1.00 27.69 ? 459  ASN A ND2   1 
ATOM   3798 N  N     . GLY A 1 460 ? -0.973  -11.636 8.965   1.00 27.70 ? 460  GLY A N     1 
ATOM   3799 C  CA    . GLY A 1 460 ? -1.586  -12.920 8.633   1.00 28.51 ? 460  GLY A CA    1 
ATOM   3800 C  C     . GLY A 1 460 ? -3.084  -13.007 8.843   1.00 29.01 ? 460  GLY A C     1 
ATOM   3801 O  O     . GLY A 1 460 ? -3.673  -14.046 8.585   1.00 32.10 ? 460  GLY A O     1 
ATOM   3802 N  N     . MET A 1 461 ? -3.704  -11.921 9.292   1.00 27.51 ? 461  MET A N     1 
ATOM   3803 C  CA    . MET A 1 461 ? -5.127  -11.936 9.624   1.00 27.76 ? 461  MET A CA    1 
ATOM   3804 C  C     . MET A 1 461 ? -6.010  -11.528 8.453   1.00 28.99 ? 461  MET A C     1 
ATOM   3805 O  O     . MET A 1 461 ? -5.624  -10.678 7.641   1.00 29.84 ? 461  MET A O     1 
ATOM   3806 C  CB    . MET A 1 461 ? -5.413  -11.023 10.820  1.00 25.27 ? 461  MET A CB    1 
ATOM   3807 C  CG    . MET A 1 461 ? -4.868  -11.517 12.155  1.00 26.50 ? 461  MET A CG    1 
ATOM   3808 S  SD    . MET A 1 461 ? -5.472  -13.167 12.620  1.00 28.45 ? 461  MET A SD    1 
ATOM   3809 C  CE    . MET A 1 461 ? -7.152  -12.809 13.095  1.00 29.65 ? 461  MET A CE    1 
ATOM   3810 N  N     . MET A 1 462 ? -7.200  -12.128 8.386   1.00 26.45 ? 462  MET A N     1 
ATOM   3811 C  CA    . MET A 1 462 ? -8.201  -11.780 7.376   1.00 28.21 ? 462  MET A CA    1 
ATOM   3812 C  C     . MET A 1 462 ? -9.537  -11.449 8.029   1.00 27.45 ? 462  MET A C     1 
ATOM   3813 O  O     . MET A 1 462 ? -9.953  -12.102 8.998   1.00 24.39 ? 462  MET A O     1 
ATOM   3814 C  CB    . MET A 1 462 ? -8.402  -12.925 6.374   1.00 29.93 ? 462  MET A CB    1 
ATOM   3815 C  CG    . MET A 1 462 ? -7.114  -13.470 5.753   1.00 33.26 ? 462  MET A CG    1 
ATOM   3816 S  SD    . MET A 1 462 ? -7.360  -14.639 4.395   1.00 39.77 ? 462  MET A SD    1 
ATOM   3817 C  CE    . MET A 1 462 ? -8.467  -15.845 5.140   1.00 34.18 ? 462  MET A CE    1 
ATOM   3818 N  N     . TYR A 1 463 ? -10.218 -10.457 7.465   1.00 24.50 ? 463  TYR A N     1 
ATOM   3819 C  CA    . TYR A 1 463 ? -11.469 -9.961  8.019   1.00 25.44 ? 463  TYR A CA    1 
ATOM   3820 C  C     . TYR A 1 463 ? -12.588 -9.909  6.977   1.00 26.51 ? 463  TYR A C     1 
ATOM   3821 O  O     . TYR A 1 463 ? -12.328 -9.742  5.785   1.00 26.09 ? 463  TYR A O     1 
ATOM   3822 C  CB    . TYR A 1 463 ? -11.239 -8.584  8.659   1.00 22.78 ? 463  TYR A CB    1 
ATOM   3823 C  CG    . TYR A 1 463 ? -10.165 -8.599  9.729   1.00 24.80 ? 463  TYR A CG    1 
ATOM   3824 C  CD1   . TYR A 1 463 ? -8.822  -8.370  9.408   1.00 26.32 ? 463  TYR A CD1   1 
ATOM   3825 C  CD2   . TYR A 1 463 ? -10.487 -8.866  11.059  1.00 25.66 ? 463  TYR A CD2   1 
ATOM   3826 C  CE1   . TYR A 1 463 ? -7.832  -8.394  10.392  1.00 25.68 ? 463  TYR A CE1   1 
ATOM   3827 C  CE2   . TYR A 1 463 ? -9.511  -8.892  12.046  1.00 22.06 ? 463  TYR A CE2   1 
ATOM   3828 C  CZ    . TYR A 1 463 ? -8.188  -8.657  11.704  1.00 27.30 ? 463  TYR A CZ    1 
ATOM   3829 O  OH    . TYR A 1 463 ? -7.224  -8.682  12.683  1.00 26.80 ? 463  TYR A OH    1 
ATOM   3830 N  N     . TYR A 1 464 ? -13.829 -10.080 7.429   1.00 28.31 ? 464  TYR A N     1 
ATOM   3831 C  CA    . TYR A 1 464 ? -14.999 -9.987  6.553   1.00 28.91 ? 464  TYR A CA    1 
ATOM   3832 C  C     . TYR A 1 464 ? -15.102 -8.606  5.911   1.00 28.98 ? 464  TYR A C     1 
ATOM   3833 O  O     . TYR A 1 464 ? -14.724 -7.600  6.521   1.00 26.57 ? 464  TYR A O     1 
ATOM   3834 C  CB    . TYR A 1 464 ? -16.295 -10.250 7.336   1.00 31.39 ? 464  TYR A CB    1 
ATOM   3835 C  CG    . TYR A 1 464 ? -16.407 -11.601 8.003   1.00 33.29 ? 464  TYR A CG    1 
ATOM   3836 C  CD1   . TYR A 1 464 ? -16.910 -11.711 9.301   1.00 35.99 ? 464  TYR A CD1   1 
ATOM   3837 C  CD2   . TYR A 1 464 ? -16.032 -12.774 7.339   1.00 37.35 ? 464  TYR A CD2   1 
ATOM   3838 C  CE1   . TYR A 1 464 ? -17.026 -12.952 9.929   1.00 37.35 ? 464  TYR A CE1   1 
ATOM   3839 C  CE2   . TYR A 1 464 ? -16.140 -14.022 7.960   1.00 38.09 ? 464  TYR A CE2   1 
ATOM   3840 C  CZ    . TYR A 1 464 ? -16.637 -14.100 9.255   1.00 38.74 ? 464  TYR A CZ    1 
ATOM   3841 O  OH    . TYR A 1 464 ? -16.745 -15.323 9.875   1.00 41.50 ? 464  TYR A OH    1 
ATOM   3842 N  N     . LYS A 1 465 ? -15.635 -8.561  4.696   1.00 27.51 ? 465  LYS A N     1 
ATOM   3843 C  CA    . LYS A 1 465 ? -15.854 -7.302  3.989   1.00 30.81 ? 465  LYS A CA    1 
ATOM   3844 C  C     . LYS A 1 465 ? -17.341 -6.975  3.804   1.00 33.43 ? 465  LYS A C     1 
ATOM   3845 O  O     . LYS A 1 465 ? -17.696 -5.894  3.331   1.00 34.84 ? 465  LYS A O     1 
ATOM   3846 C  CB    . LYS A 1 465 ? -15.157 -7.326  2.622   1.00 30.81 ? 465  LYS A CB    1 
ATOM   3847 C  CG    . LYS A 1 465 ? -13.630 -7.368  2.686   1.00 29.86 ? 465  LYS A CG    1 
ATOM   3848 C  CD    . LYS A 1 465 ? -12.997 -7.252  1.304   1.00 27.78 ? 465  LYS A CD    1 
ATOM   3849 C  CE    . LYS A 1 465 ? -12.923 -5.790  0.843   1.00 28.25 ? 465  LYS A CE    1 
ATOM   3850 N  NZ    . LYS A 1 465 ? -12.166 -5.606  -0.431  1.00 28.88 ? 465  LYS A NZ    1 
ATOM   3851 N  N     . ASP A 1 466 ? -18.216 -7.903  4.164   1.00 34.80 ? 466  ASP A N     1 
ATOM   3852 C  CA    . ASP A 1 466 ? -19.642 -7.692  3.926   1.00 36.45 ? 466  ASP A CA    1 
ATOM   3853 C  C     . ASP A 1 466 ? -20.252 -6.640  4.863   1.00 36.91 ? 466  ASP A C     1 
ATOM   3854 O  O     . ASP A 1 466 ? -21.177 -5.928  4.476   1.00 37.00 ? 466  ASP A O     1 
ATOM   3855 C  CB    . ASP A 1 466 ? -20.416 -9.011  3.997   1.00 37.51 ? 466  ASP A CB    1 
ATOM   3856 C  CG    . ASP A 1 466 ? -20.356 -9.661  5.374   1.00 41.02 ? 466  ASP A CG    1 
ATOM   3857 O  OD1   . ASP A 1 466 ? -19.245 -9.822  5.921   1.00 39.93 ? 466  ASP A OD1   1 
ATOM   3858 O  OD2   . ASP A 1 466 ? -21.428 -10.023 5.901   1.00 43.58 ? 466  ASP A OD2   1 
ATOM   3859 N  N     . ARG A 1 467 ? -19.718 -6.532  6.080   1.00 33.09 ? 467  ARG A N     1 
ATOM   3860 C  CA    . ARG A 1 467 ? -20.310 -5.671  7.098   1.00 33.03 ? 467  ARG A CA    1 
ATOM   3861 C  C     . ARG A 1 467 ? -19.254 -5.156  8.077   1.00 32.31 ? 467  ARG A C     1 
ATOM   3862 O  O     . ARG A 1 467 ? -18.275 -5.854  8.402   1.00 28.99 ? 467  ARG A O     1 
ATOM   3863 C  CB    . ARG A 1 467 ? -21.410 -6.426  7.857   1.00 34.87 ? 467  ARG A CB    1 
ATOM   3864 C  CG    . ARG A 1 467 ? -20.908 -7.723  8.505   1.00 42.99 ? 467  ARG A CG    1 
ATOM   3865 C  CD    . ARG A 1 467 ? -22.011 -8.594  9.097   1.00 49.70 ? 467  ARG A CD    1 
ATOM   3866 N  NE    . ARG A 1 467 ? -21.510 -9.945  9.383   1.00 53.50 ? 467  ARG A NE    1 
ATOM   3867 C  CZ    . ARG A 1 467 ? -21.091 -10.371 10.577  1.00 55.82 ? 467  ARG A CZ    1 
ATOM   3868 N  NH1   . ARG A 1 467 ? -21.113 -9.563  11.634  1.00 53.44 ? 467  ARG A NH1   1 
ATOM   3869 N  NH2   . ARG A 1 467 ? -20.655 -11.619 10.717  1.00 55.99 ? 467  ARG A NH2   1 
ATOM   3870 N  N     . ASP A 1 468 ? -19.468 -3.932  8.546   1.00 31.43 ? 468  ASP A N     1 
ATOM   3871 C  CA    . ASP A 1 468 ? -18.591 -3.313  9.528   1.00 30.76 ? 468  ASP A CA    1 
ATOM   3872 C  C     . ASP A 1 468 ? -18.665 -4.032  10.862  1.00 29.46 ? 468  ASP A C     1 
ATOM   3873 O  O     . ASP A 1 468 ? -19.756 -4.386  11.343  1.00 30.08 ? 468  ASP A O     1 
ATOM   3874 C  CB    . ASP A 1 468 ? -18.956 -1.843  9.718   1.00 32.92 ? 468  ASP A CB    1 
ATOM   3875 C  CG    . ASP A 1 468 ? -18.334 -0.932  8.658   1.00 35.51 ? 468  ASP A CG    1 
ATOM   3876 O  OD1   . ASP A 1 468 ? -17.461 -1.377  7.890   1.00 37.69 ? 468  ASP A OD1   1 
ATOM   3877 O  OD2   . ASP A 1 468 ? -18.715 0.253   8.601   1.00 39.21 ? 468  ASP A OD2   1 
ATOM   3878 N  N     . GLY A 1 469 ? -17.501 -4.268  11.450  1.00 27.85 ? 469  GLY A N     1 
ATOM   3879 C  CA    . GLY A 1 469 ? -17.442 -4.721  12.835  1.00 27.91 ? 469  GLY A CA    1 
ATOM   3880 C  C     . GLY A 1 469 ? -17.908 -3.639  13.797  1.00 26.08 ? 469  GLY A C     1 
ATOM   3881 O  O     . GLY A 1 469 ? -17.945 -2.454  13.447  1.00 23.87 ? 469  GLY A O     1 
ATOM   3882 N  N     . VAL A 1 470 ? -18.255 -4.047  15.017  1.00 25.99 ? 470  VAL A N     1 
ATOM   3883 C  CA    . VAL A 1 470 ? -18.687 -3.106  16.062  1.00 25.62 ? 470  VAL A CA    1 
ATOM   3884 C  C     . VAL A 1 470 ? -17.566 -2.131  16.468  1.00 25.24 ? 470  VAL A C     1 
ATOM   3885 O  O     . VAL A 1 470 ? -17.816 -0.943  16.707  1.00 28.23 ? 470  VAL A O     1 
ATOM   3886 C  CB    . VAL A 1 470 ? -19.310 -3.851  17.299  1.00 26.12 ? 470  VAL A CB    1 
ATOM   3887 C  CG1   . VAL A 1 470 ? -18.310 -4.799  17.971  1.00 26.85 ? 470  VAL A CG1   1 
ATOM   3888 C  CG2   . VAL A 1 470 ? -19.872 -2.875  18.296  1.00 25.02 ? 470  VAL A CG2   1 
ATOM   3889 N  N     . VAL A 1 471 ? -16.337 -2.629  16.516  1.00 24.47 ? 471  VAL A N     1 
ATOM   3890 C  CA    . VAL A 1 471 ? -15.161 -1.789  16.787  1.00 23.63 ? 471  VAL A CA    1 
ATOM   3891 C  C     . VAL A 1 471 ? -14.939 -0.692  15.711  1.00 25.11 ? 471  VAL A C     1 
ATOM   3892 O  O     . VAL A 1 471 ? -14.844 0.486   16.057  1.00 26.17 ? 471  VAL A O     1 
ATOM   3893 C  CB    . VAL A 1 471 ? -13.886 -2.649  17.063  1.00 24.14 ? 471  VAL A CB    1 
ATOM   3894 C  CG1   . VAL A 1 471 ? -12.644 -1.788  17.128  1.00 21.26 ? 471  VAL A CG1   1 
ATOM   3895 C  CG2   . VAL A 1 471 ? -14.054 -3.445  18.378  1.00 23.51 ? 471  VAL A CG2   1 
ATOM   3896 N  N     . PRO A 1 472 ? -14.865 -1.058  14.412  1.00 25.41 ? 472  PRO A N     1 
ATOM   3897 C  CA    . PRO A 1 472 ? -14.867 0.024   13.420  1.00 25.00 ? 472  PRO A CA    1 
ATOM   3898 C  C     . PRO A 1 472 ? -16.053 0.987   13.534  1.00 27.12 ? 472  PRO A C     1 
ATOM   3899 O  O     . PRO A 1 472 ? -15.859 2.209   13.448  1.00 27.37 ? 472  PRO A O     1 
ATOM   3900 C  CB    . PRO A 1 472 ? -14.913 -0.727  12.089  1.00 23.90 ? 472  PRO A CB    1 
ATOM   3901 C  CG    . PRO A 1 472 ? -14.112 -1.953  12.368  1.00 24.82 ? 472  PRO A CG    1 
ATOM   3902 C  CD    . PRO A 1 472 ? -14.507 -2.348  13.789  1.00 25.66 ? 472  PRO A CD    1 
ATOM   3903 N  N     . THR A 1 473 ? -17.259 0.457   13.734  1.00 25.41 ? 473  THR A N     1 
ATOM   3904 C  CA    . THR A 1 473 ? -18.453 1.307   13.802  1.00 25.63 ? 473  THR A CA    1 
ATOM   3905 C  C     . THR A 1 473 ? -18.358 2.355   14.924  1.00 24.58 ? 473  THR A C     1 
ATOM   3906 O  O     . THR A 1 473 ? -18.625 3.540   14.707  1.00 23.77 ? 473  THR A O     1 
ATOM   3907 C  CB    . THR A 1 473 ? -19.742 0.473   13.950  1.00 24.99 ? 473  THR A CB    1 
ATOM   3908 O  OG1   . THR A 1 473 ? -19.894 -0.379  12.806  1.00 26.01 ? 473  THR A OG1   1 
ATOM   3909 C  CG2   . THR A 1 473 ? -20.973 1.387   14.045  1.00 28.04 ? 473  THR A CG2   1 
ATOM   3910 N  N     . GLU A 1 474 ? -17.960 1.910   16.112  1.00 24.24 ? 474  GLU A N     1 
ATOM   3911 C  CA    . GLU A 1 474 ? -17.973 2.771   17.288  1.00 25.24 ? 474  GLU A CA    1 
ATOM   3912 C  C     . GLU A 1 474 ? -16.762 3.677   17.355  1.00 23.79 ? 474  GLU A C     1 
ATOM   3913 O  O     . GLU A 1 474 ? -16.872 4.832   17.778  1.00 22.87 ? 474  GLU A O     1 
ATOM   3914 C  CB    . GLU A 1 474 ? -18.139 1.946   18.569  1.00 24.65 ? 474  GLU A CB    1 
ATOM   3915 C  CG    . GLU A 1 474 ? -19.496 1.241   18.656  1.00 26.20 ? 474  GLU A CG    1 
ATOM   3916 C  CD    . GLU A 1 474 ? -20.692 2.205   18.564  1.00 30.59 ? 474  GLU A CD    1 
ATOM   3917 O  OE1   . GLU A 1 474 ? -21.684 1.845   17.886  1.00 31.54 ? 474  GLU A OE1   1 
ATOM   3918 O  OE2   . GLU A 1 474 ? -20.649 3.309   19.165  1.00 27.43 ? 474  GLU A OE2   1 
ATOM   3919 N  N     . ILE A 1 475 ? -15.612 3.169   16.916  1.00 23.65 ? 475  ILE A N     1 
ATOM   3920 C  CA    . ILE A 1 475 ? -14.407 4.003   16.829  1.00 23.11 ? 475  ILE A CA    1 
ATOM   3921 C  C     . ILE A 1 475 ? -14.613 5.141   15.807  1.00 23.11 ? 475  ILE A C     1 
ATOM   3922 O  O     . ILE A 1 475 ? -14.094 6.231   15.984  1.00 22.80 ? 475  ILE A O     1 
ATOM   3923 C  CB    . ILE A 1 475 ? -13.141 3.153   16.531  1.00 24.01 ? 475  ILE A CB    1 
ATOM   3924 C  CG1   . ILE A 1 475 ? -11.899 3.757   17.198  1.00 21.99 ? 475  ILE A CG1   1 
ATOM   3925 C  CG2   . ILE A 1 475 ? -12.943 2.929   15.025  1.00 22.77 ? 475  ILE A CG2   1 
ATOM   3926 C  CD1   . ILE A 1 475 ? -10.651 2.899   17.043  1.00 24.29 ? 475  ILE A CD1   1 
ATOM   3927 N  N     . THR A 1 476 ? -15.400 4.885   14.760  1.00 24.57 ? 476  THR A N     1 
ATOM   3928 C  CA    . THR A 1 476 ? -15.679 5.888   13.721  1.00 25.31 ? 476  THR A CA    1 
ATOM   3929 C  C     . THR A 1 476 ? -16.430 7.079   14.303  1.00 26.36 ? 476  THR A C     1 
ATOM   3930 O  O     . THR A 1 476 ? -16.098 8.230   14.017  1.00 25.90 ? 476  THR A O     1 
ATOM   3931 C  CB    . THR A 1 476 ? -16.467 5.265   12.537  1.00 27.00 ? 476  THR A CB    1 
ATOM   3932 O  OG1   . THR A 1 476 ? -15.652 4.270   11.907  1.00 22.62 ? 476  THR A OG1   1 
ATOM   3933 C  CG2   . THR A 1 476 ? -16.872 6.323   11.492  1.00 23.90 ? 476  THR A CG2   1 
ATOM   3934 N  N     . LYS A 1 477 ? -17.415 6.778   15.148  1.00 28.02 ? 477  LYS A N     1 
ATOM   3935 C  CA    . LYS A 1 477 ? -18.280 7.778   15.762  1.00 27.72 ? 477  LYS A CA    1 
ATOM   3936 C  C     . LYS A 1 477 ? -17.512 8.765   16.634  1.00 27.22 ? 477  LYS A C     1 
ATOM   3937 O  O     . LYS A 1 477 ? -17.739 9.971   16.555  1.00 30.06 ? 477  LYS A O     1 
ATOM   3938 C  CB    . LYS A 1 477 ? -19.382 7.098   16.570  1.00 27.08 ? 477  LYS A CB    1 
ATOM   3939 C  CG    . LYS A 1 477 ? -20.469 6.451   15.728  1.00 29.43 ? 477  LYS A CG    1 
ATOM   3940 C  CD    . LYS A 1 477 ? -21.475 5.720   16.621  1.00 29.43 ? 477  LYS A CD    1 
ATOM   3941 C  CE    . LYS A 1 477 ? -22.347 4.783   15.802  1.00 35.65 ? 477  LYS A CE    1 
ATOM   3942 N  NZ    . LYS A 1 477 ? -23.284 4.008   16.663  1.00 34.59 ? 477  LYS A NZ    1 
ATOM   3943 N  N     . VAL A 1 478 ? -16.605 8.253   17.459  1.00 25.69 ? 478  VAL A N     1 
ATOM   3944 C  CA    . VAL A 1 478 ? -15.745 9.112   18.269  1.00 26.81 ? 478  VAL A CA    1 
ATOM   3945 C  C     . VAL A 1 478 ? -14.683 9.826   17.414  1.00 25.86 ? 478  VAL A C     1 
ATOM   3946 O  O     . VAL A 1 478 ? -14.365 10.983  17.679  1.00 29.07 ? 478  VAL A O     1 
ATOM   3947 C  CB    . VAL A 1 478 ? -15.099 8.349   19.452  1.00 26.65 ? 478  VAL A CB    1 
ATOM   3948 C  CG1   . VAL A 1 478 ? -14.264 9.305   20.341  1.00 20.21 ? 478  VAL A CG1   1 
ATOM   3949 C  CG2   . VAL A 1 478 ? -16.182 7.656   20.286  1.00 23.93 ? 478  VAL A CG2   1 
ATOM   3950 N  N     . PHE A 1 479 ? -14.149 9.154   16.393  1.00 22.61 ? 479  PHE A N     1 
ATOM   3951 C  CA    . PHE A 1 479 ? -13.240 9.830   15.454  1.00 24.44 ? 479  PHE A CA    1 
ATOM   3952 C  C     . PHE A 1 479 ? -13.854 11.096  14.829  1.00 23.69 ? 479  PHE A C     1 
ATOM   3953 O  O     . PHE A 1 479 ? -13.187 12.133  14.754  1.00 25.43 ? 479  PHE A O     1 
ATOM   3954 C  CB    . PHE A 1 479 ? -12.731 8.905   14.344  1.00 21.80 ? 479  PHE A CB    1 
ATOM   3955 C  CG    . PHE A 1 479 ? -12.051 9.646   13.215  1.00 24.52 ? 479  PHE A CG    1 
ATOM   3956 C  CD1   . PHE A 1 479 ? -10.789 10.215  13.397  1.00 24.25 ? 479  PHE A CD1   1 
ATOM   3957 C  CD2   . PHE A 1 479 ? -12.680 9.797   11.976  1.00 24.46 ? 479  PHE A CD2   1 
ATOM   3958 C  CE1   . PHE A 1 479 ? -10.157 10.919  12.363  1.00 26.09 ? 479  PHE A CE1   1 
ATOM   3959 C  CE2   . PHE A 1 479 ? -12.055 10.503  10.923  1.00 23.63 ? 479  PHE A CE2   1 
ATOM   3960 C  CZ    . PHE A 1 479 ? -10.790 11.058  11.118  1.00 23.77 ? 479  PHE A CZ    1 
ATOM   3961 N  N     . ASN A 1 480 ? -15.105 11.001  14.380  1.00 23.30 ? 480  ASN A N     1 
ATOM   3962 C  CA    . ASN A 1 480 ? -15.805 12.156  13.798  1.00 26.64 ? 480  ASN A CA    1 
ATOM   3963 C  C     . ASN A 1 480 ? -16.008 13.294  14.793  1.00 25.61 ? 480  ASN A C     1 
ATOM   3964 O  O     . ASN A 1 480 ? -15.937 14.456  14.427  1.00 28.07 ? 480  ASN A O     1 
ATOM   3965 C  CB    . ASN A 1 480 ? -17.141 11.738  13.169  1.00 26.42 ? 480  ASN A CB    1 
ATOM   3966 C  CG    . ASN A 1 480 ? -16.953 10.872  11.915  1.00 30.54 ? 480  ASN A CG    1 
ATOM   3967 O  OD1   . ASN A 1 480 ? -15.939 10.976  11.211  1.00 30.44 ? 480  ASN A OD1   1 
ATOM   3968 N  ND2   . ASN A 1 480 ? -17.937 10.027  11.630  1.00 24.37 ? 480  ASN A ND2   1 
ATOM   3969 N  N     . GLN A 1 481 ? -16.259 12.958  16.052  1.00 26.18 ? 481  GLN A N     1 
ATOM   3970 C  CA    . GLN A 1 481 ? -16.303 13.969  17.096  1.00 26.58 ? 481  GLN A CA    1 
ATOM   3971 C  C     . GLN A 1 481 ? -14.933 14.620  17.230  1.00 24.14 ? 481  GLN A C     1 
ATOM   3972 O  O     . GLN A 1 481 ? -14.845 15.832  17.319  1.00 22.92 ? 481  GLN A O     1 
ATOM   3973 C  CB    . GLN A 1 481 ? -16.720 13.372  18.431  1.00 27.57 ? 481  GLN A CB    1 
ATOM   3974 C  CG    . GLN A 1 481 ? -18.192 13.003  18.555  1.00 33.81 ? 481  GLN A CG    1 
ATOM   3975 C  CD    . GLN A 1 481 ? -18.492 12.339  19.893  1.00 36.03 ? 481  GLN A CD    1 
ATOM   3976 O  OE1   . GLN A 1 481 ? -17.603 12.180  20.735  1.00 34.99 ? 481  GLN A OE1   1 
ATOM   3977 N  NE2   . GLN A 1 481 ? -19.740 11.956  20.096  1.00 39.81 ? 481  GLN A NE2   1 
ATOM   3978 N  N     . ARG A 1 482 ? -13.878 13.805  17.239  1.00 23.58 ? 482  ARG A N     1 
ATOM   3979 C  CA    . ARG A 1 482 ? -12.494 14.299  17.312  1.00 24.67 ? 482  ARG A CA    1 
ATOM   3980 C  C     . ARG A 1 482 ? -12.197 15.262  16.178  1.00 26.19 ? 482  ARG A C     1 
ATOM   3981 O  O     . ARG A 1 482 ? -11.602 16.324  16.395  1.00 28.96 ? 482  ARG A O     1 
ATOM   3982 C  CB    . ARG A 1 482 ? -11.495 13.141  17.245  1.00 21.80 ? 482  ARG A CB    1 
ATOM   3983 C  CG    . ARG A 1 482 ? -10.045 13.533  17.479  1.00 18.86 ? 482  ARG A CG    1 
ATOM   3984 C  CD    . ARG A 1 482 ? -9.299  13.872  16.198  1.00 20.21 ? 482  ARG A CD    1 
ATOM   3985 N  NE    . ARG A 1 482 ? -7.962  14.428  16.464  1.00 20.14 ? 482  ARG A NE    1 
ATOM   3986 C  CZ    . ARG A 1 482 ? -6.880  14.146  15.736  1.00 22.99 ? 482  ARG A CZ    1 
ATOM   3987 N  NH1   . ARG A 1 482 ? -6.972  13.301  14.724  1.00 19.59 ? 482  ARG A NH1   1 
ATOM   3988 N  NH2   . ARG A 1 482 ? -5.697  14.694  16.021  1.00 23.87 ? 482  ARG A NH2   1 
ATOM   3989 N  N     . LYS A 1 483 ? -12.602 14.871  14.973  1.00 27.17 ? 483  LYS A N     1 
ATOM   3990 C  CA    . LYS A 1 483 ? -12.337 15.639  13.759  1.00 29.89 ? 483  LYS A CA    1 
ATOM   3991 C  C     . LYS A 1 483 ? -12.995 17.018  13.813  1.00 30.19 ? 483  LYS A C     1 
ATOM   3992 O  O     . LYS A 1 483 ? -12.383 18.027  13.444  1.00 29.04 ? 483  LYS A O     1 
ATOM   3993 C  CB    . LYS A 1 483 ? -12.811 14.862  12.520  1.00 32.43 ? 483  LYS A CB    1 
ATOM   3994 C  CG    . LYS A 1 483 ? -13.013 15.732  11.265  1.00 37.18 ? 483  LYS A CG    1 
ATOM   3995 C  CD    . LYS A 1 483 ? -12.674 14.991  9.985   1.00 47.52 ? 483  LYS A CD    1 
ATOM   3996 C  CE    . LYS A 1 483 ? -11.156 14.898  9.829   1.00 55.19 ? 483  LYS A CE    1 
ATOM   3997 N  NZ    . LYS A 1 483 ? -10.729 14.721  8.417   1.00 61.35 ? 483  LYS A NZ    1 
ATOM   3998 N  N     . GLU A 1 484 ? -14.243 17.049  14.268  1.00 28.61 ? 484  GLU A N     1 
ATOM   3999 C  CA    . GLU A 1 484 ? -14.973 18.308  14.410  1.00 31.52 ? 484  GLU A CA    1 
ATOM   4000 C  C     . GLU A 1 484 ? -14.217 19.268  15.349  1.00 30.36 ? 484  GLU A C     1 
ATOM   4001 O  O     . GLU A 1 484 ? -13.975 20.426  15.010  1.00 29.04 ? 484  GLU A O     1 
ATOM   4002 C  CB    . GLU A 1 484 ? -16.393 18.046  14.927  1.00 31.02 ? 484  GLU A CB    1 
ATOM   4003 C  CG    . GLU A 1 484 ? -17.220 19.302  15.132  1.00 38.44 ? 484  GLU A CG    1 
ATOM   4004 C  CD    . GLU A 1 484 ? -18.540 19.053  15.868  1.00 45.19 ? 484  GLU A CD    1 
ATOM   4005 O  OE1   . GLU A 1 484 ? -18.896 17.882  16.125  1.00 43.88 ? 484  GLU A OE1   1 
ATOM   4006 O  OE2   . GLU A 1 484 ? -19.227 20.046  16.195  1.00 48.52 ? 484  GLU A OE2   1 
ATOM   4007 N  N     . HIS A 1 485 ? -13.831 18.771  16.522  1.00 29.38 ? 485  HIS A N     1 
ATOM   4008 C  CA    . HIS A 1 485 ? -13.228 19.630  17.530  1.00 28.31 ? 485  HIS A CA    1 
ATOM   4009 C  C     . HIS A 1 485 ? -11.845 20.104  17.121  1.00 26.34 ? 485  HIS A C     1 
ATOM   4010 O  O     . HIS A 1 485 ? -11.447 21.219  17.462  1.00 26.93 ? 485  HIS A O     1 
ATOM   4011 C  CB    . HIS A 1 485 ? -13.222 18.953  18.895  1.00 27.80 ? 485  HIS A CB    1 
ATOM   4012 C  CG    . HIS A 1 485 ? -14.570 18.918  19.545  1.00 27.03 ? 485  HIS A CG    1 
ATOM   4013 N  ND1   . HIS A 1 485 ? -15.121 20.017  20.171  1.00 30.75 ? 485  HIS A ND1   1 
ATOM   4014 C  CD2   . HIS A 1 485 ? -15.485 17.925  19.651  1.00 27.30 ? 485  HIS A CD2   1 
ATOM   4015 C  CE1   . HIS A 1 485 ? -16.316 19.701  20.639  1.00 31.65 ? 485  HIS A CE1   1 
ATOM   4016 N  NE2   . HIS A 1 485 ? -16.561 18.437  20.337  1.00 32.43 ? 485  HIS A NE2   1 
ATOM   4017 N  N     . LYS A 1 486 ? -11.141 19.277  16.357  1.00 25.90 ? 486  LYS A N     1 
ATOM   4018 C  CA    . LYS A 1 486 ? -9.836  19.651  15.836  1.00 25.30 ? 486  LYS A CA    1 
ATOM   4019 C  C     . LYS A 1 486 ? -9.986  20.801  14.843  1.00 25.26 ? 486  LYS A C     1 
ATOM   4020 O  O     . LYS A 1 486 ? -9.144  21.702  14.798  1.00 25.75 ? 486  LYS A O     1 
ATOM   4021 C  CB    . LYS A 1 486 ? -9.119  18.452  15.202  1.00 25.35 ? 486  LYS A CB    1 
ATOM   4022 C  CG    . LYS A 1 486 ? -7.770  18.819  14.582  1.00 24.46 ? 486  LYS A CG    1 
ATOM   4023 C  CD    . LYS A 1 486 ? -6.952  17.605  14.200  1.00 30.00 ? 486  LYS A CD    1 
ATOM   4024 C  CE    . LYS A 1 486 ? -5.794  18.033  13.299  1.00 33.32 ? 486  LYS A CE    1 
ATOM   4025 N  NZ    . LYS A 1 486 ? -4.754  16.985  13.135  1.00 37.55 ? 486  LYS A NZ    1 
ATOM   4026 N  N     . GLY A 1 487 ? -11.072 20.775  14.076  1.00 24.64 ? 487  GLY A N     1 
ATOM   4027 C  CA    . GLY A 1 487 ? -11.399 21.863  13.154  1.00 25.23 ? 487  GLY A CA    1 
ATOM   4028 C  C     . GLY A 1 487 ? -11.546 23.201  13.860  1.00 26.90 ? 487  GLY A C     1 
ATOM   4029 O  O     . GLY A 1 487 ? -10.986 24.216  13.413  1.00 25.07 ? 487  GLY A O     1 
ATOM   4030 N  N     . TYR A 1 488 ? -12.282 23.206  14.974  1.00 27.40 ? 488  TYR A N     1 
ATOM   4031 C  CA    . TYR A 1 488 ? -12.414 24.413  15.802  1.00 28.40 ? 488  TYR A CA    1 
ATOM   4032 C  C     . TYR A 1 488 ? -11.073 24.848  16.379  1.00 26.94 ? 488  TYR A C     1 
ATOM   4033 O  O     . TYR A 1 488 ? -10.772 26.035  16.419  1.00 29.53 ? 488  TYR A O     1 
ATOM   4034 C  CB    . TYR A 1 488 ? -13.401 24.208  16.952  1.00 29.47 ? 488  TYR A CB    1 
ATOM   4035 C  CG    . TYR A 1 488 ? -14.774 23.736  16.555  1.00 31.45 ? 488  TYR A CG    1 
ATOM   4036 C  CD1   . TYR A 1 488 ? -15.387 24.181  15.383  1.00 35.20 ? 488  TYR A CD1   1 
ATOM   4037 C  CD2   . TYR A 1 488 ? -15.478 22.859  17.373  1.00 34.12 ? 488  TYR A CD2   1 
ATOM   4038 C  CE1   . TYR A 1 488 ? -16.661 23.747  15.030  1.00 34.06 ? 488  TYR A CE1   1 
ATOM   4039 C  CE2   . TYR A 1 488 ? -16.752 22.416  17.030  1.00 36.46 ? 488  TYR A CE2   1 
ATOM   4040 C  CZ    . TYR A 1 488 ? -17.334 22.861  15.861  1.00 35.80 ? 488  TYR A CZ    1 
ATOM   4041 O  OH    . TYR A 1 488 ? -18.590 22.414  15.532  1.00 37.64 ? 488  TYR A OH    1 
ATOM   4042 N  N     . MET A 1 489 ? -10.270 23.882  16.817  1.00 26.70 ? 489  MET A N     1 
ATOM   4043 C  CA    . MET A 1 489 ? -8.969  24.174  17.395  1.00 24.85 ? 489  MET A CA    1 
ATOM   4044 C  C     . MET A 1 489 ? -8.050  24.845  16.381  1.00 26.51 ? 489  MET A C     1 
ATOM   4045 O  O     . MET A 1 489 ? -7.374  25.814  16.708  1.00 26.02 ? 489  MET A O     1 
ATOM   4046 C  CB    . MET A 1 489 ? -8.306  22.895  17.899  1.00 24.86 ? 489  MET A CB    1 
ATOM   4047 C  CG    . MET A 1 489 ? -6.926  23.113  18.482  1.00 25.04 ? 489  MET A CG    1 
ATOM   4048 S  SD    . MET A 1 489 ? -6.014  21.590  18.739  1.00 34.31 ? 489  MET A SD    1 
ATOM   4049 C  CE    . MET A 1 489 ? -5.557  21.176  17.041  1.00 27.95 ? 489  MET A CE    1 
ATOM   4050 N  N     . LEU A 1 490 ? -8.018  24.317  15.159  1.00 25.57 ? 490  LEU A N     1 
ATOM   4051 C  CA    . LEU A 1 490 ? -7.144  24.859  14.123  1.00 28.08 ? 490  LEU A CA    1 
ATOM   4052 C  C     . LEU A 1 490 ? -7.629  26.220  13.614  1.00 27.46 ? 490  LEU A C     1 
ATOM   4053 O  O     . LEU A 1 490 ? -6.815  27.108  13.344  1.00 26.48 ? 490  LEU A O     1 
ATOM   4054 C  CB    . LEU A 1 490 ? -6.960  23.862  12.970  1.00 29.69 ? 490  LEU A CB    1 
ATOM   4055 C  CG    . LEU A 1 490 ? -6.095  22.619  13.269  1.00 31.83 ? 490  LEU A CG    1 
ATOM   4056 C  CD1   . LEU A 1 490 ? -6.040  21.667  12.068  1.00 32.97 ? 490  LEU A CD1   1 
ATOM   4057 C  CD2   . LEU A 1 490 ? -4.675  22.999  13.716  1.00 28.59 ? 490  LEU A CD2   1 
ATOM   4058 N  N     . ALA A 1 491 ? -8.946  26.391  13.504  1.00 27.48 ? 491  ALA A N     1 
ATOM   4059 C  CA    . ALA A 1 491 ? -9.503  27.695  13.142  1.00 28.57 ? 491  ALA A CA    1 
ATOM   4060 C  C     . ALA A 1 491 ? -9.125  28.757  14.177  1.00 27.78 ? 491  ALA A C     1 
ATOM   4061 O  O     . ALA A 1 491 ? -8.808  29.884  13.818  1.00 29.44 ? 491  ALA A O     1 
ATOM   4062 C  CB    . ALA A 1 491 ? -11.016 27.620  12.974  1.00 27.45 ? 491  ALA A CB    1 
ATOM   4063 N  N     . ALA A 1 492 ? -9.153  28.382  15.456  1.00 26.66 ? 492  ALA A N     1 
ATOM   4064 C  CA    . ALA A 1 492 ? -8.791  29.287  16.549  1.00 27.73 ? 492  ALA A CA    1 
ATOM   4065 C  C     . ALA A 1 492 ? -7.310  29.646  16.502  1.00 26.48 ? 492  ALA A C     1 
ATOM   4066 O  O     . ALA A 1 492 ? -6.926  30.787  16.743  1.00 24.94 ? 492  ALA A O     1 
ATOM   4067 C  CB    . ALA A 1 492 ? -9.160  28.670  17.892  1.00 25.86 ? 492  ALA A CB    1 
ATOM   4068 N  N     . GLN A 1 493 ? -6.490  28.659  16.163  1.00 27.90 ? 493  GLN A N     1 
ATOM   4069 C  CA    . GLN A 1 493 ? -5.059  28.852  15.983  1.00 27.69 ? 493  GLN A CA    1 
ATOM   4070 C  C     . GLN A 1 493 ? -4.751  29.819  14.830  1.00 29.68 ? 493  GLN A C     1 
ATOM   4071 O  O     . GLN A 1 493 ? -3.893  30.700  14.956  1.00 28.51 ? 493  GLN A O     1 
ATOM   4072 C  CB    . GLN A 1 493 ? -4.426  27.492  15.715  1.00 28.50 ? 493  GLN A CB    1 
ATOM   4073 C  CG    . GLN A 1 493 ? -2.926  27.427  15.821  1.00 23.80 ? 493  GLN A CG    1 
ATOM   4074 C  CD    . GLN A 1 493 ? -2.435  26.021  15.551  1.00 30.32 ? 493  GLN A CD    1 
ATOM   4075 O  OE1   . GLN A 1 493 ? -2.069  25.688  14.425  1.00 31.52 ? 493  GLN A OE1   1 
ATOM   4076 N  NE2   . GLN A 1 493 ? -2.473  25.172  16.570  1.00 23.94 ? 493  GLN A NE2   1 
ATOM   4077 N  N     . ARG A 1 494 ? -5.451  29.653  13.707  1.00 29.44 ? 494  ARG A N     1 
ATOM   4078 C  CA    . ARG A 1 494 ? -5.216  30.506  12.537  1.00 30.52 ? 494  ARG A CA    1 
ATOM   4079 C  C     . ARG A 1 494 ? -5.687  31.939  12.795  1.00 29.68 ? 494  ARG A C     1 
ATOM   4080 O  O     . ARG A 1 494 ? -5.045  32.895  12.358  1.00 28.83 ? 494  ARG A O     1 
ATOM   4081 C  CB    . ARG A 1 494 ? -5.870  29.932  11.265  1.00 30.49 ? 494  ARG A CB    1 
ATOM   4082 C  CG    . ARG A 1 494 ? -5.316  28.564  10.820  1.00 30.94 ? 494  ARG A CG    1 
ATOM   4083 C  CD    . ARG A 1 494 ? -5.894  28.141  9.458   1.00 29.28 ? 494  ARG A CD    1 
ATOM   4084 N  NE    . ARG A 1 494 ? -7.326  27.849  9.543   1.00 27.12 ? 494  ARG A NE    1 
ATOM   4085 C  CZ    . ARG A 1 494 ? -7.842  26.632  9.721   1.00 31.05 ? 494  ARG A CZ    1 
ATOM   4086 N  NH1   . ARG A 1 494 ? -7.052  25.567  9.839   1.00 27.31 ? 494  ARG A NH1   1 
ATOM   4087 N  NH2   . ARG A 1 494 ? -9.158  26.477  9.789   1.00 31.98 ? 494  ARG A NH2   1 
ATOM   4088 N  N     . ASN A 1 495 ? -6.809  32.068  13.499  1.00 27.91 ? 495  ASN A N     1 
ATOM   4089 C  CA    . ASN A 1 495 ? -7.328  33.361  13.919  1.00 28.39 ? 495  ASN A CA    1 
ATOM   4090 C  C     . ASN A 1 495 ? -6.359  34.085  14.841  1.00 30.64 ? 495  ASN A C     1 
ATOM   4091 O  O     . ASN A 1 495 ? -6.210  35.309  14.760  1.00 29.87 ? 495  ASN A O     1 
ATOM   4092 C  CB    . ASN A 1 495 ? -8.679  33.192  14.609  1.00 28.93 ? 495  ASN A CB    1 
ATOM   4093 C  CG    . ASN A 1 495 ? -9.817  32.927  13.622  1.00 32.60 ? 495  ASN A CG    1 
ATOM   4094 O  OD1   . ASN A 1 495 ? -9.727  33.260  12.437  1.00 29.21 ? 495  ASN A OD1   1 
ATOM   4095 N  ND2   . ASN A 1 495 ? -10.893 32.327  14.116  1.00 31.99 ? 495  ASN A ND2   1 
ATOM   4096 N  N     . GLY A 1 496 ? -5.706  33.316  15.717  1.00 30.50 ? 496  GLY A N     1 
ATOM   4097 C  CA    . GLY A 1 496 ? -4.651  33.838  16.577  1.00 30.57 ? 496  GLY A CA    1 
ATOM   4098 C  C     . GLY A 1 496 ? -3.558  34.537  15.788  1.00 32.30 ? 496  GLY A C     1 
ATOM   4099 O  O     . GLY A 1 496 ? -3.137  35.646  16.144  1.00 32.99 ? 496  GLY A O     1 
ATOM   4100 N  N     . GLU A 1 497 ? -3.103  33.900  14.707  1.00 31.82 ? 497  GLU A N     1 
ATOM   4101 C  CA    . GLU A 1 497 ? -2.004  34.452  13.911  1.00 32.49 ? 497  GLU A CA    1 
ATOM   4102 C  C     . GLU A 1 497 ? -2.394  35.764  13.231  1.00 31.70 ? 497  GLU A C     1 
ATOM   4103 O  O     . GLU A 1 497 ? -1.574  36.671  13.117  1.00 31.97 ? 497  GLU A O     1 
ATOM   4104 C  CB    . GLU A 1 497 ? -1.470  33.434  12.901  1.00 32.08 ? 497  GLU A CB    1 
ATOM   4105 C  CG    . GLU A 1 497 ? -0.798  32.205  13.537  1.00 32.41 ? 497  GLU A CG    1 
ATOM   4106 C  CD    . GLU A 1 497 ? 0.307   32.543  14.534  1.00 33.19 ? 497  GLU A CD    1 
ATOM   4107 O  OE1   . GLU A 1 497 ? 1.188   33.375  14.219  1.00 34.69 ? 497  GLU A OE1   1 
ATOM   4108 O  OE2   . GLU A 1 497 ? 0.309   31.948  15.637  1.00 34.69 ? 497  GLU A OE2   1 
ATOM   4109 N  N     . ILE A 1 498 ? -3.651  35.861  12.804  1.00 31.15 ? 498  ILE A N     1 
ATOM   4110 C  CA    . ILE A 1 498 ? -4.193  37.111  12.270  1.00 33.75 ? 498  ILE A CA    1 
ATOM   4111 C  C     . ILE A 1 498 ? -4.074  38.230  13.329  1.00 33.53 ? 498  ILE A C     1 
ATOM   4112 O  O     . ILE A 1 498 ? -3.525  39.302  13.056  1.00 32.43 ? 498  ILE A O     1 
ATOM   4113 C  CB    . ILE A 1 498 ? -5.649  36.926  11.752  1.00 35.47 ? 498  ILE A CB    1 
ATOM   4114 C  CG1   . ILE A 1 498 ? -5.684  35.884  10.631  1.00 35.64 ? 498  ILE A CG1   1 
ATOM   4115 C  CG2   . ILE A 1 498 ? -6.252  38.252  11.267  1.00 31.34 ? 498  ILE A CG2   1 
ATOM   4116 C  CD1   . ILE A 1 498 ? -7.069  35.346  10.348  1.00 36.48 ? 498  ILE A CD1   1 
ATOM   4117 N  N     . ILE A 1 499 ? -4.546  37.961  14.542  1.00 32.28 ? 499  ILE A N     1 
ATOM   4118 C  CA    . ILE A 1 499 ? -4.384  38.907  15.652  1.00 32.80 ? 499  ILE A CA    1 
ATOM   4119 C  C     . ILE A 1 499 ? -2.910  39.299  15.922  1.00 35.87 ? 499  ILE A C     1 
ATOM   4120 O  O     . ILE A 1 499 ? -2.592  40.487  16.068  1.00 34.61 ? 499  ILE A O     1 
ATOM   4121 C  CB    . ILE A 1 499 ? -5.094  38.393  16.922  1.00 33.49 ? 499  ILE A CB    1 
ATOM   4122 C  CG1   . ILE A 1 499 ? -6.596  38.244  16.637  1.00 33.64 ? 499  ILE A CG1   1 
ATOM   4123 C  CG2   . ILE A 1 499 ? -4.850  39.327  18.112  1.00 28.66 ? 499  ILE A CG2   1 
ATOM   4124 C  CD1   . ILE A 1 499 ? -7.339  37.390  17.639  1.00 35.19 ? 499  ILE A CD1   1 
ATOM   4125 N  N     . LYS A 1 500 ? -2.020  38.309  15.964  1.00 37.55 ? 500  LYS A N     1 
ATOM   4126 C  CA    . LYS A 1 500 ? -0.589  38.571  16.162  1.00 39.41 ? 500  LYS A CA    1 
ATOM   4127 C  C     . LYS A 1 500 ? -0.021  39.502  15.090  1.00 41.76 ? 500  LYS A C     1 
ATOM   4128 O  O     . LYS A 1 500 ? 0.780   40.387  15.397  1.00 42.19 ? 500  LYS A O     1 
ATOM   4129 C  CB    . LYS A 1 500 ? 0.217   37.269  16.209  1.00 38.61 ? 500  LYS A CB    1 
ATOM   4130 C  CG    . LYS A 1 500 ? 0.079   36.483  17.492  1.00 34.83 ? 500  LYS A CG    1 
ATOM   4131 C  CD    . LYS A 1 500 ? 0.904   35.224  17.431  1.00 35.31 ? 500  LYS A CD    1 
ATOM   4132 C  CE    . LYS A 1 500 ? 0.526   34.271  18.551  1.00 37.22 ? 500  LYS A CE    1 
ATOM   4133 N  NZ    . LYS A 1 500 ? 1.087   32.916  18.316  1.00 41.35 ? 500  LYS A NZ    1 
ATOM   4134 N  N     . GLU A 1 501 ? -0.443  39.316  13.840  1.00 42.96 ? 501  GLU A N     1 
ATOM   4135 C  CA    . GLU A 1 501 ? -0.000  40.203  12.761  1.00 45.35 ? 501  GLU A CA    1 
ATOM   4136 C  C     . GLU A 1 501 ? -0.438  41.639  12.982  1.00 45.41 ? 501  GLU A C     1 
ATOM   4137 O  O     . GLU A 1 501 ? 0.380   42.555  12.884  1.00 46.58 ? 501  GLU A O     1 
ATOM   4138 C  CB    . GLU A 1 501 ? -0.447  39.703  11.380  1.00 48.18 ? 501  GLU A CB    1 
ATOM   4139 C  CG    . GLU A 1 501 ? 0.556   38.746  10.705  1.00 55.81 ? 501  GLU A CG    1 
ATOM   4140 C  CD    . GLU A 1 501 ? 1.886   39.414  10.344  1.00 59.97 ? 501  GLU A CD    1 
ATOM   4141 O  OE1   . GLU A 1 501 ? 1.871   40.566  9.857   1.00 61.94 ? 501  GLU A OE1   1 
ATOM   4142 O  OE2   . GLU A 1 501 ? 2.948   38.780  10.540  1.00 61.33 ? 501  GLU A OE2   1 
ATOM   4143 N  N     . ALA A 1 502 ? -1.718  41.826  13.300  1.00 44.90 ? 502  ALA A N     1 
ATOM   4144 C  CA    . ALA A 1 502 ? -2.290  43.154  13.503  1.00 44.86 ? 502  ALA A CA    1 
ATOM   4145 C  C     . ALA A 1 502 ? -1.623  43.885  14.670  1.00 47.73 ? 502  ALA A C     1 
ATOM   4146 O  O     . ALA A 1 502 ? -1.490  45.116  14.649  1.00 49.72 ? 502  ALA A O     1 
ATOM   4147 C  CB    . ALA A 1 502 ? -3.779  43.057  13.724  1.00 43.68 ? 502  ALA A CB    1 
ATOM   4148 N  N     . LEU A 1 503 ? -1.199  43.122  15.674  1.00 46.19 ? 503  LEU A N     1 
ATOM   4149 C  CA    . LEU A 1 503 ? -0.497  43.671  16.833  1.00 47.63 ? 503  LEU A CA    1 
ATOM   4150 C  C     . LEU A 1 503 ? 0.808   44.399  16.505  1.00 49.66 ? 503  LEU A C     1 
ATOM   4151 O  O     . LEU A 1 503 ? 1.240   45.243  17.287  1.00 51.44 ? 503  LEU A O     1 
ATOM   4152 C  CB    . LEU A 1 503 ? -0.238  42.583  17.879  1.00 43.83 ? 503  LEU A CB    1 
ATOM   4153 C  CG    . LEU A 1 503 ? -1.370  42.334  18.879  1.00 43.63 ? 503  LEU A CG    1 
ATOM   4154 C  CD1   . LEU A 1 503 ? -1.298  40.924  19.470  1.00 36.60 ? 503  LEU A CD1   1 
ATOM   4155 C  CD2   . LEU A 1 503 ? -1.378  43.399  19.974  1.00 41.15 ? 503  LEU A CD2   1 
ATOM   4156 N  N     . HIS A 1 504 ? 1.431   44.079  15.368  1.00 52.87 ? 504  HIS A N     1 
ATOM   4157 C  CA    . HIS A 1 504 ? 2.660   44.771  14.951  1.00 56.78 ? 504  HIS A CA    1 
ATOM   4158 C  C     . HIS A 1 504 ? 2.385   46.248  14.701  1.00 58.27 ? 504  HIS A C     1 
ATOM   4159 O  O     . HIS A 1 504 ? 3.178   47.101  15.086  1.00 61.61 ? 504  HIS A O     1 
ATOM   4160 C  CB    . HIS A 1 504 ? 3.285   44.141  13.700  1.00 56.98 ? 504  HIS A CB    1 
ATOM   4161 C  CG    . HIS A 1 504 ? 3.715   42.717  13.880  1.00 60.42 ? 504  HIS A CG    1 
ATOM   4162 N  ND1   . HIS A 1 504 ? 4.304   42.253  15.037  1.00 62.69 ? 504  HIS A ND1   1 
ATOM   4163 C  CD2   . HIS A 1 504 ? 3.665   41.660  13.035  1.00 60.82 ? 504  HIS A CD2   1 
ATOM   4164 C  CE1   . HIS A 1 504 ? 4.581   40.968  14.904  1.00 61.96 ? 504  HIS A CE1   1 
ATOM   4165 N  NE2   . HIS A 1 504 ? 4.205   40.585  13.697  1.00 62.24 ? 504  HIS A NE2   1 
ATOM   4166 N  N     . ASN A 1 505 ? 1.252   46.540  14.068  1.00 59.73 ? 505  ASN A N     1 
ATOM   4167 C  CA    . ASN A 1 505 ? 0.841   47.916  13.799  1.00 62.00 ? 505  ASN A CA    1 
ATOM   4168 C  C     . ASN A 1 505 ? -0.545  48.237  14.377  1.00 61.53 ? 505  ASN A C     1 
ATOM   4169 O  O     . ASN A 1 505 ? -1.523  48.335  13.626  1.00 61.52 ? 505  ASN A O     1 
ATOM   4170 C  CB    . ASN A 1 505 ? 0.870   48.202  12.291  1.00 63.43 ? 505  ASN A CB    1 
ATOM   4171 C  CG    . ASN A 1 505 ? 2.253   48.046  11.692  1.00 67.07 ? 505  ASN A CG    1 
ATOM   4172 O  OD1   . ASN A 1 505 ? 2.660   46.943  11.323  1.00 69.12 ? 505  ASN A OD1   1 
ATOM   4173 N  ND2   . ASN A 1 505 ? 2.982   49.155  11.581  1.00 68.09 ? 505  ASN A ND2   1 
ATOM   4174 N  N     . PRO A 1 506 ? -0.637  48.408  15.712  1.00 60.60 ? 506  PRO A N     1 
ATOM   4175 C  CA    . PRO A 1 506 ? -1.939  48.656  16.333  1.00 61.05 ? 506  PRO A CA    1 
ATOM   4176 C  C     . PRO A 1 506 ? -2.393  50.113  16.216  1.00 62.22 ? 506  PRO A C     1 
ATOM   4177 O  O     . PRO A 1 506 ? -1.559  51.015  16.145  1.00 62.53 ? 506  PRO A O     1 
ATOM   4178 C  CB    . PRO A 1 506 ? -1.703  48.282  17.798  1.00 60.93 ? 506  PRO A CB    1 
ATOM   4179 C  CG    . PRO A 1 506 ? -0.250  48.526  18.027  1.00 61.50 ? 506  PRO A CG    1 
ATOM   4180 C  CD    . PRO A 1 506 ? 0.459   48.428  16.700  1.00 61.05 ? 506  PRO A CD    1 
ATOM   4181 N  N     . ASN A 1 507 ? -3.706  50.329  16.187  1.00 63.12 ? 507  ASN A N     1 
ATOM   4182 C  CA    . ASN A 1 507 ? -4.268  51.680  16.157  1.00 64.65 ? 507  ASN A CA    1 
ATOM   4183 C  C     . ASN A 1 507 ? -4.193  52.375  17.504  1.00 64.42 ? 507  ASN A C     1 
ATOM   4184 O  O     . ASN A 1 507 ? -4.328  51.737  18.551  1.00 62.66 ? 507  ASN A O     1 
ATOM   4185 C  CB    . ASN A 1 507 ? -5.719  51.674  15.672  1.00 65.39 ? 507  ASN A CB    1 
ATOM   4186 C  CG    . ASN A 1 507 ? -5.859  52.186  14.257  1.00 69.26 ? 507  ASN A CG    1 
ATOM   4187 O  OD1   . ASN A 1 507 ? -5.505  51.499  13.295  1.00 71.81 ? 507  ASN A OD1   1 
ATOM   4188 N  ND2   . ASN A 1 507 ? -6.383  53.399  14.118  1.00 68.77 ? 507  ASN A ND2   1 
ATOM   4189 N  N     . LEU A 1 508 ? -3.969  53.686  17.463  1.00 65.19 ? 508  LEU A N     1 
ATOM   4190 C  CA    . LEU A 1 508 ? -3.959  54.508  18.665  1.00 65.57 ? 508  LEU A CA    1 
ATOM   4191 C  C     . LEU A 1 508 ? -5.361  55.058  18.877  1.00 65.54 ? 508  LEU A C     1 
ATOM   4192 O  O     . LEU A 1 508 ? -5.724  56.108  18.333  1.00 65.61 ? 508  LEU A O     1 
ATOM   4193 C  CB    . LEU A 1 508 ? -2.923  55.635  18.556  1.00 66.45 ? 508  LEU A CB    1 
ATOM   4194 C  CG    . LEU A 1 508 ? -1.441  55.241  18.585  1.00 67.52 ? 508  LEU A CG    1 
ATOM   4195 C  CD1   . LEU A 1 508 ? -0.566  56.436  18.210  1.00 68.24 ? 508  LEU A CD1   1 
ATOM   4196 C  CD2   . LEU A 1 508 ? -1.023  54.664  19.945  1.00 67.35 ? 508  LEU A CD2   1 
ATOM   4197 N  N     . SER A 1 509 ? -6.149  54.320  19.659  1.00 64.52 ? 509  SER A N     1 
ATOM   4198 C  CA    . SER A 1 509 ? -7.563  54.625  19.864  1.00 63.85 ? 509  SER A CA    1 
ATOM   4199 C  C     . SER A 1 509 ? -8.133  53.942  21.105  1.00 62.22 ? 509  SER A C     1 
ATOM   4200 O  O     . SER A 1 509 ? -7.481  53.099  21.723  1.00 61.89 ? 509  SER A O     1 
ATOM   4201 C  CB    . SER A 1 509 ? -8.376  54.223  18.627  1.00 63.85 ? 509  SER A CB    1 
ATOM   4202 O  OG    . SER A 1 509 ? -8.176  52.857  18.308  1.00 63.80 ? 509  SER A OG    1 
ATOM   4203 N  N     . VAL A 1 510 ? -9.350  54.337  21.470  1.00 62.28 ? 510  VAL A N     1 
ATOM   4204 C  CA    . VAL A 1 510 ? -10.124 53.658  22.502  1.00 61.57 ? 510  VAL A CA    1 
ATOM   4205 C  C     . VAL A 1 510 ? -11.308 52.981  21.818  1.00 60.39 ? 510  VAL A C     1 
ATOM   4206 O  O     . VAL A 1 510 ? -12.058 53.620  21.071  1.00 61.18 ? 510  VAL A O     1 
ATOM   4207 C  CB    . VAL A 1 510 ? -10.569 54.627  23.640  1.00 63.57 ? 510  VAL A CB    1 
ATOM   4208 C  CG1   . VAL A 1 510 ? -11.663 54.007  24.513  1.00 64.36 ? 510  VAL A CG1   1 
ATOM   4209 C  CG2   . VAL A 1 510 ? -9.373  55.020  24.503  1.00 63.77 ? 510  VAL A CG2   1 
ATOM   4210 N  N     . ASP A 1 511 ? -11.438 51.677  22.052  1.00 58.87 ? 511  ASP A N     1 
ATOM   4211 C  CA    . ASP A 1 511 ? -12.459 50.844  21.416  1.00 57.49 ? 511  ASP A CA    1 
ATOM   4212 C  C     . ASP A 1 511 ? -12.592 49.525  22.177  1.00 55.50 ? 511  ASP A C     1 
ATOM   4213 O  O     . ASP A 1 511 ? -12.001 49.362  23.247  1.00 54.03 ? 511  ASP A O     1 
ATOM   4214 C  CB    . ASP A 1 511 ? -12.104 50.585  19.944  1.00 57.52 ? 511  ASP A CB    1 
ATOM   4215 C  CG    . ASP A 1 511 ? -10.668 50.100  19.757  1.00 58.88 ? 511  ASP A CG    1 
ATOM   4216 O  OD1   . ASP A 1 511 ? -10.093 49.488  20.686  1.00 60.49 ? 511  ASP A OD1   1 
ATOM   4217 O  OD2   . ASP A 1 511 ? -10.111 50.330  18.665  1.00 61.61 ? 511  ASP A OD2   1 
ATOM   4218 N  N     . GLU A 1 512 ? -13.357 48.587  21.622  1.00 54.07 ? 512  GLU A N     1 
ATOM   4219 C  CA    . GLU A 1 512 ? -13.592 47.302  22.282  1.00 53.24 ? 512  GLU A CA    1 
ATOM   4220 C  C     . GLU A 1 512 ? -13.195 46.111  21.410  1.00 50.39 ? 512  GLU A C     1 
ATOM   4221 O  O     . GLU A 1 512 ? -13.170 46.234  20.183  1.00 48.30 ? 512  GLU A O     1 
ATOM   4222 C  CB    . GLU A 1 512 ? -15.063 47.176  22.709  1.00 56.13 ? 512  GLU A CB    1 
ATOM   4223 C  CG    . GLU A 1 512 ? -15.531 48.212  23.743  1.00 60.95 ? 512  GLU A CG    1 
ATOM   4224 C  CD    . GLU A 1 512 ? -14.805 48.114  25.087  1.00 64.99 ? 512  GLU A CD    1 
ATOM   4225 O  OE1   . GLU A 1 512 ? -14.252 47.039  25.417  1.00 65.11 ? 512  GLU A OE1   1 
ATOM   4226 O  OE2   . GLU A 1 512 ? -14.794 49.125  25.822  1.00 67.86 ? 512  GLU A OE2   1 
ATOM   4227 N  N     . PRO A 1 513 ? -12.864 44.956  22.041  1.00 48.60 ? 513  PRO A N     1 
ATOM   4228 C  CA    . PRO A 1 513 ? -12.670 43.733  21.268  1.00 47.48 ? 513  PRO A CA    1 
ATOM   4229 C  C     . PRO A 1 513 ? -13.960 43.353  20.541  1.00 47.88 ? 513  PRO A C     1 
ATOM   4230 O  O     . PRO A 1 513 ? -15.055 43.601  21.060  1.00 46.39 ? 513  PRO A O     1 
ATOM   4231 C  CB    . PRO A 1 513 ? -12.335 42.681  22.335  1.00 47.65 ? 513  PRO A CB    1 
ATOM   4232 C  CG    . PRO A 1 513 ? -12.800 43.263  23.627  1.00 49.04 ? 513  PRO A CG    1 
ATOM   4233 C  CD    . PRO A 1 513 ? -12.610 44.733  23.477  1.00 47.71 ? 513  PRO A CD    1 
ATOM   4234 N  N     . LEU A 1 514 ? -13.814 42.787  19.343  1.00 47.28 ? 514  LEU A N     1 
ATOM   4235 C  CA    . LEU A 1 514 ? -14.938 42.309  18.541  1.00 48.96 ? 514  LEU A CA    1 
ATOM   4236 C  C     . LEU A 1 514 ? -15.610 41.101  19.175  1.00 48.21 ? 514  LEU A C     1 
ATOM   4237 O  O     . LEU A 1 514 ? -14.946 40.220  19.714  1.00 46.94 ? 514  LEU A O     1 
ATOM   4238 C  CB    . LEU A 1 514 ? -14.459 41.919  17.136  1.00 50.59 ? 514  LEU A CB    1 
ATOM   4239 C  CG    . LEU A 1 514 ? -14.586 42.849  15.926  1.00 54.55 ? 514  LEU A CG    1 
ATOM   4240 C  CD1   . LEU A 1 514 ? -14.148 44.284  16.210  1.00 57.15 ? 514  LEU A CD1   1 
ATOM   4241 C  CD2   . LEU A 1 514 ? -13.797 42.264  14.758  1.00 55.45 ? 514  LEU A CD2   1 
ATOM   4242 N  N     . ASP A 1 515 ? -16.933 41.061  19.091  1.00 49.80 ? 515  ASP A N     1 
ATOM   4243 C  CA    . ASP A 1 515 ? -17.693 39.905  19.532  1.00 50.42 ? 515  ASP A CA    1 
ATOM   4244 C  C     . ASP A 1 515 ? -17.706 38.879  18.393  1.00 46.65 ? 515  ASP A C     1 
ATOM   4245 O  O     . ASP A 1 515 ? -18.465 39.022  17.434  1.00 47.62 ? 515  ASP A O     1 
ATOM   4246 C  CB    . ASP A 1 515 ? -19.115 40.336  19.912  1.00 54.19 ? 515  ASP A CB    1 
ATOM   4247 C  CG    . ASP A 1 515 ? -19.833 39.318  20.796  1.00 61.08 ? 515  ASP A CG    1 
ATOM   4248 O  OD1   . ASP A 1 515 ? -20.873 39.699  21.386  1.00 65.38 ? 515  ASP A OD1   1 
ATOM   4249 O  OD2   . ASP A 1 515 ? -19.373 38.153  20.905  1.00 61.01 ? 515  ASP A OD2   1 
ATOM   4250 N  N     . VAL A 1 516 ? -16.850 37.862  18.493  1.00 41.88 ? 516  VAL A N     1 
ATOM   4251 C  CA    . VAL A 1 516 ? -16.705 36.857  17.428  1.00 39.49 ? 516  VAL A CA    1 
ATOM   4252 C  C     . VAL A 1 516 ? -16.611 35.419  17.952  1.00 36.53 ? 516  VAL A C     1 
ATOM   4253 O  O     . VAL A 1 516 ? -16.292 35.188  19.118  1.00 36.32 ? 516  VAL A O     1 
ATOM   4254 C  CB    . VAL A 1 516 ? -15.456 37.130  16.534  1.00 40.48 ? 516  VAL A CB    1 
ATOM   4255 C  CG1   . VAL A 1 516 ? -15.603 38.427  15.761  1.00 42.61 ? 516  VAL A CG1   1 
ATOM   4256 C  CG2   . VAL A 1 516 ? -14.166 37.138  17.374  1.00 41.17 ? 516  VAL A CG2   1 
ATOM   4257 N  N     . ASP A 1 517 ? -16.872 34.460  17.070  1.00 34.37 ? 517  ASP A N     1 
ATOM   4258 C  CA    . ASP A 1 517 ? -16.679 33.045  17.371  1.00 33.97 ? 517  ASP A CA    1 
ATOM   4259 C  C     . ASP A 1 517 ? -15.342 32.574  16.777  1.00 30.78 ? 517  ASP A C     1 
ATOM   4260 O  O     . ASP A 1 517 ? -15.209 32.407  15.568  1.00 29.38 ? 517  ASP A O     1 
ATOM   4261 C  CB    . ASP A 1 517 ? -17.857 32.227  16.830  1.00 33.68 ? 517  ASP A CB    1 
ATOM   4262 C  CG    . ASP A 1 517 ? -17.858 30.783  17.325  1.00 33.30 ? 517  ASP A CG    1 
ATOM   4263 O  OD1   . ASP A 1 517 ? -18.916 30.135  17.224  1.00 34.02 ? 517  ASP A OD1   1 
ATOM   4264 O  OD2   . ASP A 1 517 ? -16.815 30.284  17.795  1.00 32.92 ? 517  ASP A OD2   1 
ATOM   4265 N  N     . TYR A 1 518 ? -14.358 32.368  17.646  1.00 29.86 ? 518  TYR A N     1 
ATOM   4266 C  CA    . TYR A 1 518 ? -12.991 32.039  17.238  1.00 29.00 ? 518  TYR A CA    1 
ATOM   4267 C  C     . TYR A 1 518 ? -12.847 30.608  16.697  1.00 29.89 ? 518  TYR A C     1 
ATOM   4268 O  O     . TYR A 1 518 ? -11.781 30.232  16.189  1.00 27.07 ? 518  TYR A O     1 
ATOM   4269 C  CB    . TYR A 1 518 ? -12.029 32.261  18.412  1.00 29.19 ? 518  TYR A CB    1 
ATOM   4270 C  CG    . TYR A 1 518 ? -11.999 33.689  18.943  1.00 28.91 ? 518  TYR A CG    1 
ATOM   4271 C  CD1   . TYR A 1 518 ? -12.866 34.103  19.955  1.00 28.45 ? 518  TYR A CD1   1 
ATOM   4272 C  CD2   . TYR A 1 518 ? -11.097 34.616  18.435  1.00 30.94 ? 518  TYR A CD2   1 
ATOM   4273 C  CE1   . TYR A 1 518 ? -12.834 35.415  20.442  1.00 30.81 ? 518  TYR A CE1   1 
ATOM   4274 C  CE2   . TYR A 1 518 ? -11.054 35.922  18.913  1.00 28.88 ? 518  TYR A CE2   1 
ATOM   4275 C  CZ    . TYR A 1 518 ? -11.923 36.317  19.908  1.00 32.34 ? 518  TYR A CZ    1 
ATOM   4276 O  OH    . TYR A 1 518 ? -11.868 37.622  20.360  1.00 36.42 ? 518  TYR A OH    1 
ATOM   4277 N  N     . ARG A 1 519 ? -13.914 29.819  16.805  1.00 27.27 ? 519  ARG A N     1 
ATOM   4278 C  CA    . ARG A 1 519 ? -13.925 28.457  16.268  1.00 31.37 ? 519  ARG A CA    1 
ATOM   4279 C  C     . ARG A 1 519 ? -14.060 28.436  14.745  1.00 32.89 ? 519  ARG A C     1 
ATOM   4280 O  O     . ARG A 1 519 ? -13.953 27.373  14.127  1.00 33.21 ? 519  ARG A O     1 
ATOM   4281 C  CB    . ARG A 1 519 ? -15.064 27.641  16.873  1.00 31.21 ? 519  ARG A CB    1 
ATOM   4282 C  CG    . ARG A 1 519 ? -14.985 27.450  18.392  1.00 30.45 ? 519  ARG A CG    1 
ATOM   4283 C  CD    . ARG A 1 519 ? -16.224 26.721  18.899  1.00 31.19 ? 519  ARG A CD    1 
ATOM   4284 N  NE    . ARG A 1 519 ? -17.454 27.420  18.531  1.00 33.16 ? 519  ARG A NE    1 
ATOM   4285 C  CZ    . ARG A 1 519 ? -18.659 26.853  18.469  1.00 37.66 ? 519  ARG A CZ    1 
ATOM   4286 N  NH1   . ARG A 1 519 ? -18.818 25.555  18.749  1.00 33.10 ? 519  ARG A NH1   1 
ATOM   4287 N  NH2   . ARG A 1 519 ? -19.713 27.591  18.125  1.00 32.93 ? 519  ARG A NH2   1 
ATOM   4288 N  N     . PHE A 1 520 ? -14.308 29.602  14.153  1.00 31.91 ? 520  PHE A N     1 
ATOM   4289 C  CA    . PHE A 1 520 ? -14.446 29.721  12.710  1.00 33.53 ? 520  PHE A CA    1 
ATOM   4290 C  C     . PHE A 1 520 ? -13.530 30.801  12.155  1.00 34.88 ? 520  PHE A C     1 
ATOM   4291 O  O     . PHE A 1 520 ? -13.339 31.861  12.777  1.00 31.35 ? 520  PHE A O     1 
ATOM   4292 C  CB    . PHE A 1 520 ? -15.913 29.967  12.314  1.00 36.00 ? 520  PHE A CB    1 
ATOM   4293 C  CG    . PHE A 1 520 ? -16.850 28.888  12.797  1.00 38.37 ? 520  PHE A CG    1 
ATOM   4294 C  CD1   . PHE A 1 520 ? -16.944 27.668  12.116  1.00 41.45 ? 520  PHE A CD1   1 
ATOM   4295 C  CD2   . PHE A 1 520 ? -17.617 29.076  13.947  1.00 38.24 ? 520  PHE A CD2   1 
ATOM   4296 C  CE1   . PHE A 1 520 ? -17.805 26.653  12.561  1.00 41.86 ? 520  PHE A CE1   1 
ATOM   4297 C  CE2   . PHE A 1 520 ? -18.483 28.072  14.408  1.00 42.39 ? 520  PHE A CE2   1 
ATOM   4298 C  CZ    . PHE A 1 520 ? -18.577 26.854  13.713  1.00 43.34 ? 520  PHE A CZ    1 
ATOM   4299 N  N     . ASP A 1 521 ? -12.951 30.508  10.992  1.00 34.19 ? 521  ASP A N     1 
ATOM   4300 C  CA    . ASP A 1 521 ? -12.041 31.422  10.324  1.00 35.31 ? 521  ASP A CA    1 
ATOM   4301 C  C     . ASP A 1 521 ? -12.689 32.791  10.154  1.00 36.02 ? 521  ASP A C     1 
ATOM   4302 O  O     . ASP A 1 521 ? -13.848 32.895  9.724   1.00 35.66 ? 521  ASP A O     1 
ATOM   4303 C  CB    . ASP A 1 521 ? -11.587 30.835  8.983   1.00 35.04 ? 521  ASP A CB    1 
ATOM   4304 C  CG    . ASP A 1 521 ? -10.648 29.649  9.158   1.00 37.22 ? 521  ASP A CG    1 
ATOM   4305 O  OD1   . ASP A 1 521 ? -9.484  29.846  9.552   1.00 34.98 ? 521  ASP A OD1   1 
ATOM   4306 O  OD2   . ASP A 1 521 ? -11.074 28.508  8.909   1.00 44.08 ? 521  ASP A OD2   1 
ATOM   4307 N  N     . PHE A 1 522 ? -11.943 33.830  10.528  1.00 34.94 ? 522  PHE A N     1 
ATOM   4308 C  CA    . PHE A 1 522 ? -12.432 35.200  10.459  1.00 35.58 ? 522  PHE A CA    1 
ATOM   4309 C  C     . PHE A 1 522 ? -12.833 35.575  9.045   1.00 37.52 ? 522  PHE A C     1 
ATOM   4310 O  O     . PHE A 1 522 ? -12.068 35.367  8.095   1.00 37.99 ? 522  PHE A O     1 
ATOM   4311 C  CB    . PHE A 1 522 ? -11.376 36.189  10.962  1.00 34.99 ? 522  PHE A CB    1 
ATOM   4312 C  CG    . PHE A 1 522 ? -11.164 36.156  12.443  1.00 35.67 ? 522  PHE A CG    1 
ATOM   4313 C  CD1   . PHE A 1 522 ? -12.178 35.726  13.303  1.00 35.09 ? 522  PHE A CD1   1 
ATOM   4314 C  CD2   . PHE A 1 522 ? -9.955  36.576  12.987  1.00 33.44 ? 522  PHE A CD2   1 
ATOM   4315 C  CE1   . PHE A 1 522 ? -11.982 35.704  14.676  1.00 34.08 ? 522  PHE A CE1   1 
ATOM   4316 C  CE2   . PHE A 1 522 ? -9.748  36.562  14.361  1.00 30.88 ? 522  PHE A CE2   1 
ATOM   4317 C  CZ    . PHE A 1 522 ? -10.762 36.124  15.208  1.00 33.57 ? 522  PHE A CZ    1 
ATOM   4318 N  N     . SER A 1 523 ? -14.039 36.120  8.917   1.00 38.16 ? 523  SER A N     1 
ATOM   4319 C  CA    . SER A 1 523 ? -14.508 36.695  7.664   1.00 39.10 ? 523  SER A CA    1 
ATOM   4320 C  C     . SER A 1 523 ? -13.643 37.897  7.287   1.00 40.52 ? 523  SER A C     1 
ATOM   4321 O  O     . SER A 1 523 ? -12.928 38.447  8.130   1.00 40.49 ? 523  SER A O     1 
ATOM   4322 C  CB    . SER A 1 523 ? -15.966 37.142  7.809   1.00 38.61 ? 523  SER A CB    1 
ATOM   4323 O  OG    . SER A 1 523 ? -16.055 38.321  8.586   1.00 34.09 ? 523  SER A OG    1 
ATOM   4324 N  N     . ASP A 1 524 ? -13.726 38.305  6.021   1.00 43.05 ? 524  ASP A N     1 
ATOM   4325 C  CA    . ASP A 1 524 ? -13.052 39.509  5.531   1.00 44.03 ? 524  ASP A CA    1 
ATOM   4326 C  C     . ASP A 1 524 ? -13.486 40.785  6.264   1.00 44.41 ? 524  ASP A C     1 
ATOM   4327 O  O     . ASP A 1 524 ? -12.670 41.690  6.471   1.00 42.96 ? 524  ASP A O     1 
ATOM   4328 C  CB    . ASP A 1 524 ? -13.273 39.666  4.022   1.00 46.77 ? 524  ASP A CB    1 
ATOM   4329 C  CG    . ASP A 1 524 ? -12.573 38.583  3.207   1.00 47.18 ? 524  ASP A CG    1 
ATOM   4330 O  OD1   . ASP A 1 524 ? -11.787 37.794  3.778   1.00 48.03 ? 524  ASP A OD1   1 
ATOM   4331 O  OD2   . ASP A 1 524 ? -12.812 38.525  1.985   1.00 47.61 ? 524  ASP A OD2   1 
ATOM   4332 N  N     . GLU A 1 525 ? -14.765 40.857  6.642   1.00 45.18 ? 525  GLU A N     1 
ATOM   4333 C  CA    . GLU A 1 525 ? -15.289 42.009  7.378   1.00 46.80 ? 525  GLU A CA    1 
ATOM   4334 C  C     . GLU A 1 525 ? -14.594 42.103  8.730   1.00 45.10 ? 525  GLU A C     1 
ATOM   4335 O  O     . GLU A 1 525 ? -14.113 43.168  9.117   1.00 44.20 ? 525  GLU A O     1 
ATOM   4336 C  CB    . GLU A 1 525 ? -16.811 41.919  7.554   1.00 49.36 ? 525  GLU A CB    1 
ATOM   4337 C  CG    . GLU A 1 525 ? -17.409 43.111  8.324   1.00 57.51 ? 525  GLU A CG    1 
ATOM   4338 C  CD    . GLU A 1 525 ? -18.938 43.082  8.437   1.00 63.13 ? 525  GLU A CD    1 
ATOM   4339 O  OE1   . GLU A 1 525 ? -19.557 42.006  8.273   1.00 63.56 ? 525  GLU A OE1   1 
ATOM   4340 O  OE2   . GLU A 1 525 ? -19.527 44.155  8.695   1.00 67.55 ? 525  GLU A OE2   1 
ATOM   4341 N  N     . ILE A 1 526 ? -14.531 40.971  9.429   1.00 44.65 ? 526  ILE A N     1 
ATOM   4342 C  CA    . ILE A 1 526 ? -13.832 40.870  10.710  1.00 42.19 ? 526  ILE A CA    1 
ATOM   4343 C  C     . ILE A 1 526 ? -12.342 41.197  10.582  1.00 41.91 ? 526  ILE A C     1 
ATOM   4344 O  O     . ILE A 1 526 ? -11.775 41.876  11.445  1.00 42.66 ? 526  ILE A O     1 
ATOM   4345 C  CB    . ILE A 1 526 ? -14.022 39.469  11.341  1.00 42.01 ? 526  ILE A CB    1 
ATOM   4346 C  CG1   . ILE A 1 526 ? -15.460 39.317  11.835  1.00 38.75 ? 526  ILE A CG1   1 
ATOM   4347 C  CG2   . ILE A 1 526 ? -13.021 39.245  12.476  1.00 36.47 ? 526  ILE A CG2   1 
ATOM   4348 C  CD1   . ILE A 1 526 ? -15.906 37.889  11.987  1.00 41.02 ? 526  ILE A CD1   1 
ATOM   4349 N  N     . LYS A 1 527 ? -11.715 40.721  9.508   1.00 40.97 ? 527  LYS A N     1 
ATOM   4350 C  CA    . LYS A 1 527 ? -10.299 40.996  9.278   1.00 43.04 ? 527  LYS A CA    1 
ATOM   4351 C  C     . LYS A 1 527 ? -10.010 42.494  9.143   1.00 44.94 ? 527  LYS A C     1 
ATOM   4352 O  O     . LYS A 1 527 ? -9.012  42.983  9.669   1.00 45.40 ? 527  LYS A O     1 
ATOM   4353 C  CB    . LYS A 1 527 ? -9.771  40.216  8.070   1.00 42.84 ? 527  LYS A CB    1 
ATOM   4354 C  CG    . LYS A 1 527 ? -9.313  38.807  8.423   1.00 43.29 ? 527  LYS A CG    1 
ATOM   4355 C  CD    . LYS A 1 527 ? -8.450  38.161  7.337   1.00 41.49 ? 527  LYS A CD    1 
ATOM   4356 C  CE    . LYS A 1 527 ? -9.298  37.364  6.364   1.00 44.15 ? 527  LYS A CE    1 
ATOM   4357 N  NZ    . LYS A 1 527 ? -8.628  36.116  5.897   1.00 41.76 ? 527  LYS A NZ    1 
ATOM   4358 N  N     . GLU A 1 528 ? -10.898 43.217  8.465   1.00 46.16 ? 528  GLU A N     1 
ATOM   4359 C  CA    . GLU A 1 528 ? -10.728 44.652  8.257   1.00 49.37 ? 528  GLU A CA    1 
ATOM   4360 C  C     . GLU A 1 528 ? -10.860 45.440  9.549   1.00 48.61 ? 528  GLU A C     1 
ATOM   4361 O  O     . GLU A 1 528 ? -10.044 46.324  9.810   1.00 49.33 ? 528  GLU A O     1 
ATOM   4362 C  CB    . GLU A 1 528 ? -11.694 45.188  7.186   1.00 51.57 ? 528  GLU A CB    1 
ATOM   4363 C  CG    . GLU A 1 528 ? -11.375 44.723  5.766   1.00 55.91 ? 528  GLU A CG    1 
ATOM   4364 C  CD    . GLU A 1 528 ? -9.942  45.036  5.345   1.00 59.97 ? 528  GLU A CD    1 
ATOM   4365 O  OE1   . GLU A 1 528 ? -9.092  44.121  5.423   1.00 59.02 ? 528  GLU A OE1   1 
ATOM   4366 O  OE2   . GLU A 1 528 ? -9.667  46.193  4.948   1.00 61.08 ? 528  GLU A OE2   1 
ATOM   4367 N  N     . LYS A 1 529 ? -11.873 45.113  10.354  1.00 48.73 ? 529  LYS A N     1 
ATOM   4368 C  CA    . LYS A 1 529 ? -12.071 45.746  11.669  1.00 48.92 ? 529  LYS A CA    1 
ATOM   4369 C  C     . LYS A 1 529 ? -10.862 45.536  12.594  1.00 47.79 ? 529  LYS A C     1 
ATOM   4370 O  O     . LYS A 1 529 ? -10.455 46.445  13.336  1.00 46.09 ? 529  LYS A O     1 
ATOM   4371 C  CB    . LYS A 1 529 ? -13.346 45.221  12.336  1.00 49.08 ? 529  LYS A CB    1 
ATOM   4372 C  CG    . LYS A 1 529 ? -14.628 45.793  11.762  1.00 48.34 ? 529  LYS A CG    1 
ATOM   4373 C  CD    . LYS A 1 529 ? -15.840 45.002  12.226  1.00 50.30 ? 529  LYS A CD    1 
ATOM   4374 C  CE    . LYS A 1 529 ? -17.107 45.478  11.537  1.00 49.59 ? 529  LYS A CE    1 
ATOM   4375 N  NZ    . LYS A 1 529 ? -18.251 44.550  11.759  1.00 48.75 ? 529  LYS A NZ    1 
ATOM   4376 N  N     . ILE A 1 530 ? -10.293 44.335  12.520  1.00 46.21 ? 530  ILE A N     1 
ATOM   4377 C  CA    . ILE A 1 530 ? -9.119  43.961  13.299  1.00 47.17 ? 530  ILE A CA    1 
ATOM   4378 C  C     . ILE A 1 530 ? -7.926  44.900  13.066  1.00 48.76 ? 530  ILE A C     1 
ATOM   4379 O  O     . ILE A 1 530 ? -7.230  45.273  14.014  1.00 48.39 ? 530  ILE A O     1 
ATOM   4380 C  CB    . ILE A 1 530 ? -8.742  42.475  13.046  1.00 45.29 ? 530  ILE A CB    1 
ATOM   4381 C  CG1   . ILE A 1 530 ? -9.546  41.565  13.984  1.00 44.32 ? 530  ILE A CG1   1 
ATOM   4382 C  CG2   . ILE A 1 530 ? -7.250  42.238  13.229  1.00 48.00 ? 530  ILE A CG2   1 
ATOM   4383 C  CD1   . ILE A 1 530 ? -9.451  40.071  13.659  1.00 40.27 ? 530  ILE A CD1   1 
ATOM   4384 N  N     . LYS A 1 531 ? -7.717  45.297  11.812  1.00 51.82 ? 531  LYS A N     1 
ATOM   4385 C  CA    . LYS A 1 531 ? -6.614  46.193  11.445  1.00 55.08 ? 531  LYS A CA    1 
ATOM   4386 C  C     . LYS A 1 531 ? -6.769  47.618  11.993  1.00 55.56 ? 531  LYS A C     1 
ATOM   4387 O  O     . LYS A 1 531 ? -5.805  48.389  12.023  1.00 57.29 ? 531  LYS A O     1 
ATOM   4388 C  CB    . LYS A 1 531 ? -6.399  46.195  9.925   1.00 56.36 ? 531  LYS A CB    1 
ATOM   4389 C  CG    . LYS A 1 531 ? -5.961  44.832  9.392   1.00 57.76 ? 531  LYS A CG    1 
ATOM   4390 C  CD    . LYS A 1 531 ? -5.512  44.890  7.940   1.00 60.52 ? 531  LYS A CD    1 
ATOM   4391 C  CE    . LYS A 1 531 ? -5.037  43.511  7.479   1.00 58.67 ? 531  LYS A CE    1 
ATOM   4392 N  NZ    . LYS A 1 531 ? -4.628  43.489  6.042   1.00 59.17 ? 531  LYS A NZ    1 
ATOM   4393 N  N     . LYS A 1 532 ? -7.971  47.943  12.457  1.00 54.71 ? 532  LYS A N     1 
ATOM   4394 C  CA    . LYS A 1 532 ? -8.269  49.266  12.986  1.00 54.32 ? 532  LYS A CA    1 
ATOM   4395 C  C     . LYS A 1 532 ? -8.399  49.288  14.515  1.00 53.24 ? 532  LYS A C     1 
ATOM   4396 O  O     . LYS A 1 532 ? -8.800  50.303  15.094  1.00 53.21 ? 532  LYS A O     1 
ATOM   4397 C  CB    . LYS A 1 532 ? -9.531  49.833  12.314  1.00 56.01 ? 532  LYS A CB    1 
ATOM   4398 C  CG    . LYS A 1 532 ? -9.486  49.810  10.782  1.00 58.01 ? 532  LYS A CG    1 
ATOM   4399 C  CD    . LYS A 1 532 ? -10.378 50.880  10.169  1.00 62.40 ? 532  LYS A CD    1 
ATOM   4400 C  CE    . LYS A 1 532 ? -10.312 50.841  8.643   1.00 65.98 ? 532  LYS A CE    1 
ATOM   4401 N  NZ    . LYS A 1 532 ? -10.753 52.125  8.017   1.00 65.67 ? 532  LYS A NZ    1 
ATOM   4402 N  N     . LEU A 1 533 ? -8.042  48.181  15.170  1.00 51.63 ? 533  LEU A N     1 
ATOM   4403 C  CA    . LEU A 1 533 ? -8.188  48.077  16.623  1.00 49.57 ? 533  LEU A CA    1 
ATOM   4404 C  C     . LEU A 1 533 ? -6.931  48.457  17.417  1.00 48.31 ? 533  LEU A C     1 
ATOM   4405 O  O     . LEU A 1 533 ? -5.825  48.495  16.871  1.00 47.44 ? 533  LEU A O     1 
ATOM   4406 C  CB    . LEU A 1 533 ? -8.681  46.676  17.022  1.00 50.06 ? 533  LEU A CB    1 
ATOM   4407 C  CG    . LEU A 1 533 ? -10.163 46.353  16.771  1.00 50.23 ? 533  LEU A CG    1 
ATOM   4408 C  CD1   . LEU A 1 533 ? -10.419 44.868  16.960  1.00 49.96 ? 533  LEU A CD1   1 
ATOM   4409 C  CD2   . LEU A 1 533 ? -11.107 47.182  17.652  1.00 49.52 ? 533  LEU A CD2   1 
ATOM   4410 N  N     . SER A 1 534 ? -7.125  48.745  18.705  1.00 47.59 ? 534  SER A N     1 
ATOM   4411 C  CA    . SER A 1 534 ? -6.037  49.076  19.627  1.00 46.48 ? 534  SER A CA    1 
ATOM   4412 C  C     . SER A 1 534 ? -5.292  47.837  20.099  1.00 46.29 ? 534  SER A C     1 
ATOM   4413 O  O     . SER A 1 534 ? -5.791  46.713  19.966  1.00 42.97 ? 534  SER A O     1 
ATOM   4414 C  CB    . SER A 1 534 ? -6.586  49.822  20.845  1.00 48.91 ? 534  SER A CB    1 
ATOM   4415 O  OG    . SER A 1 534 ? -7.507  49.024  21.576  1.00 48.97 ? 534  SER A OG    1 
ATOM   4416 N  N     . ALA A 1 535 ? -4.105  48.053  20.668  1.00 46.38 ? 535  ALA A N     1 
ATOM   4417 C  CA    . ALA A 1 535 ? -3.323  46.976  21.276  1.00 47.81 ? 535  ALA A CA    1 
ATOM   4418 C  C     . ALA A 1 535 ? -4.075  46.314  22.436  1.00 47.79 ? 535  ALA A C     1 
ATOM   4419 O  O     . ALA A 1 535 ? -4.086  45.086  22.561  1.00 47.58 ? 535  ALA A O     1 
ATOM   4420 C  CB    . ALA A 1 535 ? -1.965  47.494  21.739  1.00 48.39 ? 535  ALA A CB    1 
ATOM   4421 N  N     . LYS A 1 536 ? -4.703  47.136  23.272  1.00 47.93 ? 536  LYS A N     1 
ATOM   4422 C  CA    . LYS A 1 536 ? -5.512  46.651  24.386  1.00 48.43 ? 536  LYS A CA    1 
ATOM   4423 C  C     . LYS A 1 536 ? -6.599  45.687  23.889  1.00 47.70 ? 536  LYS A C     1 
ATOM   4424 O  O     . LYS A 1 536 ? -6.711  44.566  24.386  1.00 47.37 ? 536  LYS A O     1 
ATOM   4425 C  CB    . LYS A 1 536 ? -6.108  47.836  25.154  1.00 50.56 ? 536  LYS A CB    1 
ATOM   4426 C  CG    . LYS A 1 536 ? -6.989  47.479  26.347  1.00 52.58 ? 536  LYS A CG    1 
ATOM   4427 C  CD    . LYS A 1 536 ? -7.053  48.654  27.326  1.00 55.33 ? 536  LYS A CD    1 
ATOM   4428 C  CE    . LYS A 1 536 ? -8.458  48.879  27.872  1.00 56.40 ? 536  LYS A CE    1 
ATOM   4429 N  NZ    . LYS A 1 536 ? -9.060  47.659  28.460  1.00 55.07 ? 536  LYS A NZ    1 
ATOM   4430 N  N     . SER A 1 537 ? -7.366  46.114  22.885  1.00 46.68 ? 537  SER A N     1 
ATOM   4431 C  CA    . SER A 1 537 ? -8.420  45.281  22.319  1.00 44.03 ? 537  SER A CA    1 
ATOM   4432 C  C     . SER A 1 537 ? -7.873  44.043  21.594  1.00 41.78 ? 537  SER A C     1 
ATOM   4433 O  O     . SER A 1 537 ? -8.421  42.942  21.733  1.00 39.00 ? 537  SER A O     1 
ATOM   4434 C  CB    . SER A 1 537 ? -9.315  46.104  21.395  1.00 45.26 ? 537  SER A CB    1 
ATOM   4435 O  OG    . SER A 1 537 ? -10.174 46.950  22.140  1.00 47.37 ? 537  SER A OG    1 
ATOM   4436 N  N     . LEU A 1 538 ? -6.796  44.230  20.829  1.00 40.75 ? 538  LEU A N     1 
ATOM   4437 C  CA    . LEU A 1 538 ? -6.158  43.125  20.108  1.00 39.10 ? 538  LEU A CA    1 
ATOM   4438 C  C     . LEU A 1 538 ? -5.646  42.029  21.039  1.00 37.96 ? 538  LEU A C     1 
ATOM   4439 O  O     . LEU A 1 538 ? -5.916  40.857  20.798  1.00 37.52 ? 538  LEU A O     1 
ATOM   4440 C  CB    . LEU A 1 538 ? -5.040  43.622  19.187  1.00 38.02 ? 538  LEU A CB    1 
ATOM   4441 C  CG    . LEU A 1 538 ? -5.466  44.361  17.911  1.00 36.57 ? 538  LEU A CG    1 
ATOM   4442 C  CD1   . LEU A 1 538 ? -4.299  45.153  17.357  1.00 37.88 ? 538  LEU A CD1   1 
ATOM   4443 C  CD2   . LEU A 1 538 ? -6.041  43.434  16.849  1.00 35.56 ? 538  LEU A CD2   1 
ATOM   4444 N  N     . ASN A 1 539 ? -4.932  42.417  22.098  1.00 36.20 ? 539  ASN A N     1 
ATOM   4445 C  CA    . ASN A 1 539 ? -4.449  41.480  23.106  1.00 37.50 ? 539  ASN A CA    1 
ATOM   4446 C  C     . ASN A 1 539 ? -5.558  40.707  23.810  1.00 37.05 ? 539  ASN A C     1 
ATOM   4447 O  O     . ASN A 1 539 ? -5.389  39.531  24.119  1.00 34.35 ? 539  ASN A O     1 
ATOM   4448 C  CB    . ASN A 1 539 ? -3.577  42.180  24.150  1.00 37.53 ? 539  ASN A CB    1 
ATOM   4449 C  CG    . ASN A 1 539 ? -2.141  42.330  23.705  1.00 40.98 ? 539  ASN A CG    1 
ATOM   4450 O  OD1   . ASN A 1 539 ? -1.582  43.427  23.750  1.00 43.10 ? 539  ASN A OD1   1 
ATOM   4451 N  ND2   . ASN A 1 539 ? -1.528  41.230  23.276  1.00 40.46 ? 539  ASN A ND2   1 
ATOM   4452 N  N     . GLU A 1 540 ? -6.684  41.371  24.065  1.00 37.93 ? 540  GLU A N     1 
ATOM   4453 C  CA    . GLU A 1 540 ? -7.828  40.707  24.685  1.00 37.24 ? 540  GLU A CA    1 
ATOM   4454 C  C     . GLU A 1 540 ? -8.417  39.683  23.717  1.00 35.28 ? 540  GLU A C     1 
ATOM   4455 O  O     . GLU A 1 540 ? -8.764  38.567  24.124  1.00 33.07 ? 540  GLU A O     1 
ATOM   4456 C  CB    . GLU A 1 540 ? -8.876  41.725  25.160  1.00 39.13 ? 540  GLU A CB    1 
ATOM   4457 C  CG    . GLU A 1 540 ? -10.121 41.134  25.866  1.00 47.84 ? 540  GLU A CG    1 
ATOM   4458 C  CD    . GLU A 1 540 ? -9.804  40.169  27.022  1.00 54.08 ? 540  GLU A CD    1 
ATOM   4459 O  OE1   . GLU A 1 540 ? -8.820  40.400  27.766  1.00 55.51 ? 540  GLU A OE1   1 
ATOM   4460 O  OE2   . GLU A 1 540 ? -10.556 39.177  27.190  1.00 53.29 ? 540  GLU A OE2   1 
ATOM   4461 N  N     . MET A 1 541 ? -8.496  40.059  22.437  1.00 32.51 ? 541  MET A N     1 
ATOM   4462 C  CA    . MET A 1 541 ? -8.920  39.138  21.372  1.00 30.12 ? 541  MET A CA    1 
ATOM   4463 C  C     . MET A 1 541 ? -7.980  37.943  21.244  1.00 28.09 ? 541  MET A C     1 
ATOM   4464 O  O     . MET A 1 541 ? -8.428  36.819  21.036  1.00 27.52 ? 541  MET A O     1 
ATOM   4465 C  CB    . MET A 1 541 ? -9.057  39.861  20.032  1.00 29.55 ? 541  MET A CB    1 
ATOM   4466 C  CG    . MET A 1 541 ? -10.278 40.766  19.967  1.00 33.98 ? 541  MET A CG    1 
ATOM   4467 S  SD    . MET A 1 541 ? -10.679 41.404  18.333  1.00 35.63 ? 541  MET A SD    1 
ATOM   4468 C  CE    . MET A 1 541 ? -11.313 39.947  17.486  1.00 29.08 ? 541  MET A CE    1 
ATOM   4469 N  N     . LEU A 1 542 ? -6.681  38.197  21.388  1.00 28.99 ? 542  LEU A N     1 
ATOM   4470 C  CA    . LEU A 1 542 ? -5.680  37.145  21.310  1.00 29.26 ? 542  LEU A CA    1 
ATOM   4471 C  C     . LEU A 1 542 ? -5.891  36.154  22.445  1.00 29.00 ? 542  LEU A C     1 
ATOM   4472 O  O     . LEU A 1 542 ? -5.865  34.946  22.223  1.00 28.10 ? 542  LEU A O     1 
ATOM   4473 C  CB    . LEU A 1 542 ? -4.257  37.719  21.345  1.00 28.36 ? 542  LEU A CB    1 
ATOM   4474 C  CG    . LEU A 1 542 ? -3.089  36.718  21.254  1.00 29.99 ? 542  LEU A CG    1 
ATOM   4475 C  CD1   . LEU A 1 542 ? -3.122  35.891  19.963  1.00 26.69 ? 542  LEU A CD1   1 
ATOM   4476 C  CD2   . LEU A 1 542 ? -1.740  37.414  21.403  1.00 26.10 ? 542  LEU A CD2   1 
ATOM   4477 N  N     . PHE A 1 543 ? -6.116  36.681  23.648  1.00 29.92 ? 543  PHE A N     1 
ATOM   4478 C  CA    . PHE A 1 543 ? -6.362  35.854  24.825  1.00 31.01 ? 543  PHE A CA    1 
ATOM   4479 C  C     . PHE A 1 543 ? -7.573  34.960  24.600  1.00 30.00 ? 543  PHE A C     1 
ATOM   4480 O  O     . PHE A 1 543 ? -7.500  33.759  24.830  1.00 30.26 ? 543  PHE A O     1 
ATOM   4481 C  CB    . PHE A 1 543 ? -6.535  36.719  26.083  1.00 34.20 ? 543  PHE A CB    1 
ATOM   4482 C  CG    . PHE A 1 543 ? -6.931  35.939  27.312  1.00 35.27 ? 543  PHE A CG    1 
ATOM   4483 C  CD1   . PHE A 1 543 ? -5.971  35.276  28.077  1.00 38.70 ? 543  PHE A CD1   1 
ATOM   4484 C  CD2   . PHE A 1 543 ? -8.267  35.875  27.712  1.00 39.39 ? 543  PHE A CD2   1 
ATOM   4485 C  CE1   . PHE A 1 543 ? -6.336  34.543  29.218  1.00 39.53 ? 543  PHE A CE1   1 
ATOM   4486 C  CE2   . PHE A 1 543 ? -8.647  35.153  28.855  1.00 40.27 ? 543  PHE A CE2   1 
ATOM   4487 C  CZ    . PHE A 1 543 ? -7.677  34.487  29.607  1.00 38.43 ? 543  PHE A CZ    1 
ATOM   4488 N  N     . ARG A 1 544 ? -8.668  35.547  24.120  1.00 29.08 ? 544  ARG A N     1 
ATOM   4489 C  CA    . ARG A 1 544 ? -9.892  34.800  23.826  1.00 31.20 ? 544  ARG A CA    1 
ATOM   4490 C  C     . ARG A 1 544 ? -9.712  33.756  22.711  1.00 32.88 ? 544  ARG A C     1 
ATOM   4491 O  O     . ARG A 1 544 ? -10.243 32.642  22.804  1.00 32.95 ? 544  ARG A O     1 
ATOM   4492 C  CB    . ARG A 1 544 ? -11.053 35.749  23.512  1.00 29.23 ? 544  ARG A CB    1 
ATOM   4493 C  CG    . ARG A 1 544 ? -11.494 36.600  24.711  1.00 32.18 ? 544  ARG A CG    1 
ATOM   4494 C  CD    . ARG A 1 544 ? -12.515 37.667  24.317  1.00 30.84 ? 544  ARG A CD    1 
ATOM   4495 N  NE    . ARG A 1 544 ? -12.658 38.684  25.359  1.00 35.97 ? 544  ARG A NE    1 
ATOM   4496 C  CZ    . ARG A 1 544 ? -13.547 39.678  25.341  1.00 38.32 ? 544  ARG A CZ    1 
ATOM   4497 N  NH1   . ARG A 1 544 ? -14.400 39.811  24.332  1.00 35.84 ? 544  ARG A NH1   1 
ATOM   4498 N  NH2   . ARG A 1 544 ? -13.584 40.549  26.340  1.00 38.89 ? 544  ARG A NH2   1 
ATOM   4499 N  N     . ALA A 1 545 ? -8.966  34.122  21.667  1.00 32.31 ? 545  ALA A N     1 
ATOM   4500 C  CA    . ALA A 1 545 ? -8.627  33.186  20.602  1.00 30.48 ? 545  ALA A CA    1 
ATOM   4501 C  C     . ALA A 1 545 ? -7.845  32.002  21.176  1.00 31.33 ? 545  ALA A C     1 
ATOM   4502 O  O     . ALA A 1 545 ? -8.151  30.838  20.891  1.00 30.33 ? 545  ALA A O     1 
ATOM   4503 C  CB    . ALA A 1 545 ? -7.820  33.892  19.506  1.00 31.03 ? 545  ALA A CB    1 
ATOM   4504 N  N     . GLN A 1 546 ? -6.849  32.305  22.005  1.00 30.54 ? 546  GLN A N     1 
ATOM   4505 C  CA    . GLN A 1 546 ? -6.037  31.259  22.633  1.00 30.30 ? 546  GLN A CA    1 
ATOM   4506 C  C     . GLN A 1 546 ? -6.783  30.373  23.628  1.00 30.48 ? 546  GLN A C     1 
ATOM   4507 O  O     . GLN A 1 546 ? -6.510  29.169  23.711  1.00 31.51 ? 546  GLN A O     1 
ATOM   4508 C  CB    . GLN A 1 546 ? -4.769  31.848  23.230  1.00 30.35 ? 546  GLN A CB    1 
ATOM   4509 C  CG    . GLN A 1 546 ? -3.781  32.224  22.123  1.00 29.47 ? 546  GLN A CG    1 
ATOM   4510 C  CD    . GLN A 1 546 ? -2.594  33.007  22.607  1.00 31.17 ? 546  GLN A CD    1 
ATOM   4511 O  OE1   . GLN A 1 546 ? -1.633  33.191  21.868  1.00 35.31 ? 546  GLN A OE1   1 
ATOM   4512 N  NE2   . GLN A 1 546 ? -2.651  33.483  23.847  1.00 31.41 ? 546  GLN A NE2   1 
ATOM   4513 N  N     . ARG A 1 547 ? -7.739  30.945  24.355  1.00 27.66 ? 547  ARG A N     1 
ATOM   4514 C  CA    . ARG A 1 547 ? -8.622  30.132  25.186  1.00 28.37 ? 547  ARG A CA    1 
ATOM   4515 C  C     . ARG A 1 547 ? -9.491  29.198  24.334  1.00 26.91 ? 547  ARG A C     1 
ATOM   4516 O  O     . ARG A 1 547 ? -9.638  28.014  24.645  1.00 28.33 ? 547  ARG A O     1 
ATOM   4517 C  CB    . ARG A 1 547 ? -9.470  31.008  26.117  1.00 28.92 ? 547  ARG A CB    1 
ATOM   4518 C  CG    . ARG A 1 547 ? -8.693  31.572  27.309  1.00 33.90 ? 547  ARG A CG    1 
ATOM   4519 C  CD    . ARG A 1 547 ? -8.231  30.442  28.229  1.00 37.34 ? 547  ARG A CD    1 
ATOM   4520 N  NE    . ARG A 1 547 ? -7.352  30.897  29.301  1.00 40.29 ? 547  ARG A NE    1 
ATOM   4521 C  CZ    . ARG A 1 547 ? -7.772  31.232  30.513  1.00 42.66 ? 547  ARG A CZ    1 
ATOM   4522 N  NH1   . ARG A 1 547 ? -9.065  31.173  30.814  1.00 46.20 ? 547  ARG A NH1   1 
ATOM   4523 N  NH2   . ARG A 1 547 ? -6.901  31.629  31.426  1.00 41.98 ? 547  ARG A NH2   1 
ATOM   4524 N  N     . THR A 1 548 ? -10.037 29.719  23.244  1.00 25.05 ? 548  THR A N     1 
ATOM   4525 C  CA    . THR A 1 548 ? -10.800 28.899  22.306  1.00 26.50 ? 548  THR A CA    1 
ATOM   4526 C  C     . THR A 1 548 ? -9.948  27.764  21.744  1.00 25.73 ? 548  THR A C     1 
ATOM   4527 O  O     . THR A 1 548 ? -10.399 26.605  21.704  1.00 25.68 ? 548  THR A O     1 
ATOM   4528 C  CB    . THR A 1 548 ? -11.370 29.733  21.147  1.00 27.81 ? 548  THR A CB    1 
ATOM   4529 O  OG1   . THR A 1 548 ? -12.112 30.837  21.678  1.00 29.87 ? 548  THR A OG1   1 
ATOM   4530 C  CG2   . THR A 1 548 ? -12.279 28.876  20.283  1.00 22.71 ? 548  THR A CG2   1 
ATOM   4531 N  N     . GLU A 1 549 ? -8.720  28.088  21.334  1.00 23.47 ? 549  GLU A N     1 
ATOM   4532 C  CA    . GLU A 1 549 ? -7.779  27.064  20.882  1.00 24.79 ? 549  GLU A CA    1 
ATOM   4533 C  C     . GLU A 1 549 ? -7.569  25.974  21.927  1.00 23.04 ? 549  GLU A C     1 
ATOM   4534 O  O     . GLU A 1 549 ? -7.537  24.800  21.584  1.00 23.64 ? 549  GLU A O     1 
ATOM   4535 C  CB    . GLU A 1 549 ? -6.433  27.663  20.467  1.00 25.82 ? 549  GLU A CB    1 
ATOM   4536 C  CG    . GLU A 1 549 ? -5.534  26.669  19.723  1.00 28.14 ? 549  GLU A CG    1 
ATOM   4537 C  CD    . GLU A 1 549 ? -4.139  27.199  19.443  1.00 30.54 ? 549  GLU A CD    1 
ATOM   4538 O  OE1   . GLU A 1 549 ? -3.945  28.439  19.401  1.00 31.83 ? 549  GLU A OE1   1 
ATOM   4539 O  OE2   . GLU A 1 549 ? -3.234  26.359  19.253  1.00 28.52 ? 549  GLU A OE2   1 
ATOM   4540 N  N     . VAL A 1 550 ? -7.439  26.365  23.192  1.00 24.42 ? 550  VAL A N     1 
ATOM   4541 C  CA    . VAL A 1 550 ? -7.251  25.408  24.288  1.00 24.27 ? 550  VAL A CA    1 
ATOM   4542 C  C     . VAL A 1 550 ? -8.490  24.535  24.491  1.00 25.46 ? 550  VAL A C     1 
ATOM   4543 O  O     . VAL A 1 550 ? -8.363  23.323  24.686  1.00 28.61 ? 550  VAL A O     1 
ATOM   4544 C  CB    . VAL A 1 550 ? -6.855  26.100  25.622  1.00 25.47 ? 550  VAL A CB    1 
ATOM   4545 C  CG1   . VAL A 1 550 ? -6.733  25.068  26.770  1.00 23.86 ? 550  VAL A CG1   1 
ATOM   4546 C  CG2   . VAL A 1 550 ? -5.540  26.860  25.469  1.00 24.41 ? 550  VAL A CG2   1 
ATOM   4547 N  N     . ALA A 1 551 ? -9.676  25.147  24.447  1.00 24.81 ? 551  ALA A N     1 
ATOM   4548 C  CA    . ALA A 1 551 ? -10.936 24.404  24.555  1.00 24.79 ? 551  ALA A CA    1 
ATOM   4549 C  C     . ALA A 1 551 ? -10.990 23.326  23.474  1.00 26.39 ? 551  ALA A C     1 
ATOM   4550 O  O     . ALA A 1 551 ? -11.317 22.164  23.757  1.00 26.92 ? 551  ALA A O     1 
ATOM   4551 C  CB    . ALA A 1 551 ? -12.146 25.349  24.458  1.00 24.49 ? 551  ALA A CB    1 
ATOM   4552 N  N     . GLY A 1 552 ? -10.635 23.722  22.250  1.00 24.05 ? 552  GLY A N     1 
ATOM   4553 C  CA    . GLY A 1 552 ? -10.536 22.819  21.112  1.00 24.47 ? 552  GLY A CA    1 
ATOM   4554 C  C     . GLY A 1 552 ? -9.533  21.686  21.309  1.00 24.35 ? 552  GLY A C     1 
ATOM   4555 O  O     . GLY A 1 552 ? -9.844  20.531  21.012  1.00 23.08 ? 552  GLY A O     1 
ATOM   4556 N  N     . MET A 1 553 ? -8.342  22.025  21.809  1.00 20.72 ? 553  MET A N     1 
ATOM   4557 C  CA    . MET A 1 553 ? -7.285  21.051  22.096  1.00 22.44 ? 553  MET A CA    1 
ATOM   4558 C  C     . MET A 1 553 ? -7.746  19.971  23.076  1.00 22.55 ? 553  MET A C     1 
ATOM   4559 O  O     . MET A 1 553 ? -7.585  18.784  22.809  1.00 22.83 ? 553  MET A O     1 
ATOM   4560 C  CB    . MET A 1 553 ? -6.030  21.753  22.629  1.00 22.60 ? 553  MET A CB    1 
ATOM   4561 C  CG    . MET A 1 553 ? -4.908  20.803  23.071  1.00 23.59 ? 553  MET A CG    1 
ATOM   4562 S  SD    . MET A 1 553 ? -4.275  19.771  21.724  1.00 34.33 ? 553  MET A SD    1 
ATOM   4563 C  CE    . MET A 1 553 ? -2.824  20.686  21.169  1.00 23.27 ? 553  MET A CE    1 
ATOM   4564 N  N     . THR A 1 554 ? -8.331  20.399  24.193  1.00 22.98 ? 554  THR A N     1 
ATOM   4565 C  CA    . THR A 1 554 ? -8.845  19.490  25.207  1.00 23.55 ? 554  THR A CA    1 
ATOM   4566 C  C     . THR A 1 554 ? -9.798  18.482  24.578  1.00 24.96 ? 554  THR A C     1 
ATOM   4567 O  O     . THR A 1 554 ? -9.633  17.270  24.771  1.00 25.92 ? 554  THR A O     1 
ATOM   4568 C  CB    . THR A 1 554 ? -9.599  20.255  26.307  1.00 24.03 ? 554  THR A CB    1 
ATOM   4569 O  OG1   . THR A 1 554 ? -8.672  21.056  27.053  1.00 27.56 ? 554  THR A OG1   1 
ATOM   4570 C  CG2   . THR A 1 554 ? -10.321 19.288  27.249  1.00 22.88 ? 554  THR A CG2   1 
ATOM   4571 N  N     . ALA A 1 555 ? -10.781 18.996  23.835  1.00 21.23 ? 555  ALA A N     1 
ATOM   4572 C  CA    . ALA A 1 555 ? -11.844 18.176  23.249  1.00 24.16 ? 555  ALA A CA    1 
ATOM   4573 C  C     . ALA A 1 555 ? -11.313 17.194  22.214  1.00 24.26 ? 555  ALA A C     1 
ATOM   4574 O  O     . ALA A 1 555 ? -11.727 16.042  22.178  1.00 23.87 ? 555  ALA A O     1 
ATOM   4575 C  CB    . ALA A 1 555 ? -12.930 19.063  22.609  1.00 18.56 ? 555  ALA A CB    1 
ATOM   4576 N  N     . GLN A 1 556 ? -10.403 17.662  21.367  1.00 24.96 ? 556  GLN A N     1 
ATOM   4577 C  CA    . GLN A 1 556 ? -9.920  16.840  20.274  1.00 24.25 ? 556  GLN A CA    1 
ATOM   4578 C  C     . GLN A 1 556 ? -8.880  15.817  20.725  1.00 24.69 ? 556  GLN A C     1 
ATOM   4579 O  O     . GLN A 1 556 ? -9.004  14.627  20.415  1.00 23.56 ? 556  GLN A O     1 
ATOM   4580 C  CB    . GLN A 1 556 ? -9.453  17.700  19.085  1.00 25.15 ? 556  GLN A CB    1 
ATOM   4581 C  CG    . GLN A 1 556 ? -8.115  18.413  19.232  1.00 25.22 ? 556  GLN A CG    1 
ATOM   4582 C  CD    . GLN A 1 556 ? -6.933  17.502  18.891  1.00 24.43 ? 556  GLN A CD    1 
ATOM   4583 O  OE1   . GLN A 1 556 ? -7.092  16.473  18.234  1.00 22.87 ? 556  GLN A OE1   1 
ATOM   4584 N  NE2   . GLN A 1 556 ? -5.754  17.875  19.349  1.00 18.24 ? 556  GLN A NE2   1 
ATOM   4585 N  N     . ILE A 1 557 ? -7.887  16.258  21.494  1.00 25.60 ? 557  ILE A N     1 
ATOM   4586 C  CA    . ILE A 1 557 ? -6.774  15.372  21.828  1.00 23.53 ? 557  ILE A CA    1 
ATOM   4587 C  C     . ILE A 1 557 ? -7.221  14.211  22.693  1.00 23.81 ? 557  ILE A C     1 
ATOM   4588 O  O     . ILE A 1 557 ? -6.671  13.118  22.605  1.00 24.90 ? 557  ILE A O     1 
ATOM   4589 C  CB    . ILE A 1 557 ? -5.563  16.117  22.461  1.00 25.71 ? 557  ILE A CB    1 
ATOM   4590 C  CG1   . ILE A 1 557 ? -4.278  15.280  22.263  1.00 24.44 ? 557  ILE A CG1   1 
ATOM   4591 C  CG2   . ILE A 1 557 ? -5.835  16.468  23.945  1.00 22.81 ? 557  ILE A CG2   1 
ATOM   4592 C  CD1   . ILE A 1 557 ? -2.975  16.063  22.376  1.00 25.98 ? 557  ILE A CD1   1 
ATOM   4593 N  N     . ASN A 1 558 ? -8.234  14.444  23.518  1.00 21.59 ? 558  ASN A N     1 
ATOM   4594 C  CA    . ASN A 1 558 ? -8.648  13.429  24.450  1.00 21.84 ? 558  ASN A CA    1 
ATOM   4595 C  C     . ASN A 1 558 ? -9.669  12.486  23.832  1.00 20.32 ? 558  ASN A C     1 
ATOM   4596 O  O     . ASN A 1 558 ? -9.836  11.364  24.293  1.00 20.98 ? 558  ASN A O     1 
ATOM   4597 C  CB    . ASN A 1 558 ? -9.121  14.070  25.746  1.00 22.65 ? 558  ASN A CB    1 
ATOM   4598 C  CG    . ASN A 1 558 ? -7.976  14.648  26.536  1.00 22.73 ? 558  ASN A CG    1 
ATOM   4599 O  OD1   . ASN A 1 558 ? -7.095  13.912  26.975  1.00 23.63 ? 558  ASN A OD1   1 
ATOM   4600 N  ND2   . ASN A 1 558 ? -7.969  15.973  26.716  1.00 21.74 ? 558  ASN A ND2   1 
ATOM   4601 N  N     . ARG A 1 559 ? -10.326 12.939  22.770  1.00 19.50 ? 559  ARG A N     1 
ATOM   4602 C  CA    . ARG A 1 559 ? -11.113 12.030  21.943  1.00 21.18 ? 559  ARG A CA    1 
ATOM   4603 C  C     . ARG A 1 559 ? -10.177 11.135  21.118  1.00 21.76 ? 559  ARG A C     1 
ATOM   4604 O  O     . ARG A 1 559 ? -10.403 9.930   21.014  1.00 22.85 ? 559  ARG A O     1 
ATOM   4605 C  CB    . ARG A 1 559 ? -12.132 12.795  21.089  1.00 21.50 ? 559  ARG A CB    1 
ATOM   4606 C  CG    . ARG A 1 559 ? -13.334 13.242  21.919  1.00 21.59 ? 559  ARG A CG    1 
ATOM   4607 C  CD    . ARG A 1 559 ? -14.292 14.142  21.154  1.00 23.20 ? 559  ARG A CD    1 
ATOM   4608 N  NE    . ARG A 1 559 ? -15.509 14.396  21.936  1.00 24.93 ? 559  ARG A NE    1 
ATOM   4609 C  CZ    . ARG A 1 559 ? -15.635 15.323  22.885  1.00 25.65 ? 559  ARG A CZ    1 
ATOM   4610 N  NH1   . ARG A 1 559 ? -14.614 16.116  23.210  1.00 21.97 ? 559  ARG A NH1   1 
ATOM   4611 N  NH2   . ARG A 1 559 ? -16.790 15.455  23.518  1.00 23.30 ? 559  ARG A NH2   1 
ATOM   4612 N  N     . LYS A 1 560 ? -9.105  11.721  20.577  1.00 21.20 ? 560  LYS A N     1 
ATOM   4613 C  CA    . LYS A 1 560 ? -8.015  10.945  19.973  1.00 22.25 ? 560  LYS A CA    1 
ATOM   4614 C  C     . LYS A 1 560 ? -7.384  9.961   20.960  1.00 22.86 ? 560  LYS A C     1 
ATOM   4615 O  O     . LYS A 1 560 ? -7.042  8.841   20.588  1.00 24.97 ? 560  LYS A O     1 
ATOM   4616 C  CB    . LYS A 1 560 ? -6.937  11.870  19.391  1.00 24.26 ? 560  LYS A CB    1 
ATOM   4617 C  CG    . LYS A 1 560 ? -5.644  11.149  18.988  1.00 25.40 ? 560  LYS A CG    1 
ATOM   4618 C  CD    . LYS A 1 560 ? -4.698  12.051  18.199  1.00 30.11 ? 560  LYS A CD    1 
ATOM   4619 C  CE    . LYS A 1 560 ? -3.843  12.947  19.098  1.00 29.44 ? 560  LYS A CE    1 
ATOM   4620 N  NZ    . LYS A 1 560 ? -2.991  13.838  18.249  1.00 31.78 ? 560  LYS A NZ    1 
ATOM   4621 N  N     . ALA A 1 561 ? -7.221  10.372  22.216  1.00 21.90 ? 561  ALA A N     1 
ATOM   4622 C  CA    . ALA A 1 561 ? -6.621  9.489   23.212  1.00 21.85 ? 561  ALA A CA    1 
ATOM   4623 C  C     . ALA A 1 561 ? -7.564  8.323   23.509  1.00 21.44 ? 561  ALA A C     1 
ATOM   4624 O  O     . ALA A 1 561 ? -7.122  7.207   23.775  1.00 22.97 ? 561  ALA A O     1 
ATOM   4625 C  CB    . ALA A 1 561 ? -6.277  10.256  24.491  1.00 22.41 ? 561  ALA A CB    1 
ATOM   4626 N  N     . LEU A 1 562 ? -8.860  8.605   23.459  1.00 20.21 ? 562  LEU A N     1 
ATOM   4627 C  CA    . LEU A 1 562 ? -9.888  7.592   23.659  1.00 21.54 ? 562  LEU A CA    1 
ATOM   4628 C  C     . LEU A 1 562 ? -9.888  6.548   22.544  1.00 20.61 ? 562  LEU A C     1 
ATOM   4629 O  O     . LEU A 1 562 ? -9.863  5.343   22.821  1.00 24.17 ? 562  LEU A O     1 
ATOM   4630 C  CB    . LEU A 1 562 ? -11.278 8.224   23.808  1.00 19.04 ? 562  LEU A CB    1 
ATOM   4631 C  CG    . LEU A 1 562 ? -12.381 7.210   24.158  1.00 22.53 ? 562  LEU A CG    1 
ATOM   4632 C  CD1   . LEU A 1 562 ? -12.094 6.497   25.494  1.00 23.07 ? 562  LEU A CD1   1 
ATOM   4633 C  CD2   . LEU A 1 562 ? -13.739 7.884   24.187  1.00 22.32 ? 562  LEU A CD2   1 
ATOM   4634 N  N     . ILE A 1 563 ? -9.914  6.991   21.291  1.00 19.93 ? 563  ILE A N     1 
ATOM   4635 C  CA    . ILE A 1 563 ? -9.919  6.026   20.181  1.00 23.35 ? 563  ILE A CA    1 
ATOM   4636 C  C     . ILE A 1 563 ? -8.602  5.254   20.063  1.00 21.98 ? 563  ILE A C     1 
ATOM   4637 O  O     . ILE A 1 563 ? -8.617  4.070   19.758  1.00 23.43 ? 563  ILE A O     1 
ATOM   4638 C  CB    . ILE A 1 563 ? -10.361 6.631   18.809  1.00 22.07 ? 563  ILE A CB    1 
ATOM   4639 C  CG1   . ILE A 1 563 ? -9.446  7.779   18.372  1.00 20.10 ? 563  ILE A CG1   1 
ATOM   4640 C  CG2   . ILE A 1 563 ? -11.819 7.081   18.887  1.00 21.69 ? 563  ILE A CG2   1 
ATOM   4641 C  CD1   . ILE A 1 563 ? -9.913  8.472   17.107  1.00 22.21 ? 563  ILE A CD1   1 
ATOM   4642 N  N     . ASN A 1 564 ? -7.482  5.924   20.319  1.00 19.89 ? 564  ASN A N     1 
ATOM   4643 C  CA    . ASN A 1 564 ? -6.186  5.256   20.380  1.00 22.83 ? 564  ASN A CA    1 
ATOM   4644 C  C     . ASN A 1 564 ? -6.102  4.266   21.540  1.00 24.28 ? 564  ASN A C     1 
ATOM   4645 O  O     . ASN A 1 564 ? -5.447  3.226   21.422  1.00 25.25 ? 564  ASN A O     1 
ATOM   4646 C  CB    . ASN A 1 564 ? -5.053  6.274   20.488  1.00 22.54 ? 564  ASN A CB    1 
ATOM   4647 C  CG    . ASN A 1 564 ? -4.761  6.961   19.167  1.00 26.72 ? 564  ASN A CG    1 
ATOM   4648 O  OD1   . ASN A 1 564 ? -5.345  6.619   18.138  1.00 27.83 ? 564  ASN A OD1   1 
ATOM   4649 N  ND2   . ASN A 1 564 ? -3.845  7.929   19.186  1.00 21.20 ? 564  ASN A ND2   1 
ATOM   4650 N  N     . GLY A 1 565 ? -6.757  4.609   22.653  1.00 21.48 ? 565  GLY A N     1 
ATOM   4651 C  CA    . GLY A 1 565 ? -6.904  3.710   23.802  1.00 22.92 ? 565  GLY A CA    1 
ATOM   4652 C  C     . GLY A 1 565 ? -7.626  2.407   23.469  1.00 22.99 ? 565  GLY A C     1 
ATOM   4653 O  O     . GLY A 1 565 ? -7.297  1.355   24.020  1.00 23.86 ? 565  GLY A O     1 
ATOM   4654 N  N     . LEU A 1 566 ? -8.596  2.458   22.555  1.00 23.28 ? 566  LEU A N     1 
ATOM   4655 C  CA    . LEU A 1 566 ? -9.268  1.222   22.112  1.00 23.60 ? 566  LEU A CA    1 
ATOM   4656 C  C     . LEU A 1 566 ? -8.325  0.259   21.361  1.00 24.45 ? 566  LEU A C     1 
ATOM   4657 O  O     . LEU A 1 566 ? -8.388  -0.952  21.565  1.00 24.65 ? 566  LEU A O     1 
ATOM   4658 C  CB    . LEU A 1 566 ? -10.508 1.530   21.266  1.00 20.30 ? 566  LEU A CB    1 
ATOM   4659 C  CG    . LEU A 1 566 ? -11.268 0.348   20.633  1.00 21.42 ? 566  LEU A CG    1 
ATOM   4660 C  CD1   . LEU A 1 566 ? -11.755 -0.670  21.682  1.00 16.78 ? 566  LEU A CD1   1 
ATOM   4661 C  CD2   . LEU A 1 566 ? -12.442 0.856   19.805  1.00 21.46 ? 566  LEU A CD2   1 
ATOM   4662 N  N     . ALA A 1 567 ? -7.477  0.808   20.488  1.00 24.67 ? 567  ALA A N     1 
ATOM   4663 C  CA    . ALA A 1 567 ? -6.445  0.029   19.788  1.00 25.55 ? 567  ALA A CA    1 
ATOM   4664 C  C     . ALA A 1 567 ? -5.467  -0.617  20.761  1.00 26.52 ? 567  ALA A C     1 
ATOM   4665 O  O     . ALA A 1 567 ? -5.115  -1.790  20.611  1.00 26.60 ? 567  ALA A O     1 
ATOM   4666 C  CB    . ALA A 1 567 ? -5.686  0.913   18.795  1.00 23.98 ? 567  ALA A CB    1 
ATOM   4667 N  N     . GLY A 1 568 ? -5.021  0.159   21.749  1.00 26.24 ? 568  GLY A N     1 
ATOM   4668 C  CA    . GLY A 1 568 ? -4.196  -0.365  22.842  1.00 24.45 ? 568  GLY A CA    1 
ATOM   4669 C  C     . GLY A 1 568 ? -4.923  -1.366  23.746  1.00 25.76 ? 568  GLY A C     1 
ATOM   4670 O  O     . GLY A 1 568 ? -4.317  -2.338  24.205  1.00 23.51 ? 568  GLY A O     1 
ATOM   4671 N  N     . ALA A 1 569 ? -6.214  -1.133  23.997  1.00 22.84 ? 569  ALA A N     1 
ATOM   4672 C  CA    . ALA A 1 569 ? -6.999  -2.005  24.874  1.00 26.33 ? 569  ALA A CA    1 
ATOM   4673 C  C     . ALA A 1 569 ? -7.096  -3.442  24.351  1.00 27.14 ? 569  ALA A C     1 
ATOM   4674 O  O     . ALA A 1 569 ? -7.269  -4.379  25.130  1.00 26.71 ? 569  ALA A O     1 
ATOM   4675 C  CB    . ALA A 1 569 ? -8.390  -1.430  25.103  1.00 25.92 ? 569  ALA A CB    1 
ATOM   4676 N  N     . LEU A 1 570 ? -6.970  -3.602  23.034  1.00 27.18 ? 570  LEU A N     1 
ATOM   4677 C  CA    . LEU A 1 570 ? -6.982  -4.916  22.397  1.00 26.51 ? 570  LEU A CA    1 
ATOM   4678 C  C     . LEU A 1 570 ? -5.753  -5.732  22.783  1.00 25.90 ? 570  LEU A C     1 
ATOM   4679 O  O     . LEU A 1 570 ? -5.754  -6.951  22.632  1.00 24.59 ? 570  LEU A O     1 
ATOM   4680 C  CB    . LEU A 1 570 ? -7.083  -4.780  20.869  1.00 26.39 ? 570  LEU A CB    1 
ATOM   4681 C  CG    . LEU A 1 570 ? -8.391  -4.215  20.289  1.00 27.42 ? 570  LEU A CG    1 
ATOM   4682 C  CD1   . LEU A 1 570 ? -8.170  -3.733  18.862  1.00 24.11 ? 570  LEU A CD1   1 
ATOM   4683 C  CD2   . LEU A 1 570 ? -9.529  -5.230  20.337  1.00 24.95 ? 570  LEU A CD2   1 
ATOM   4684 N  N     . GLY A 1 571 ? -4.716  -5.040  23.270  1.00 26.45 ? 571  GLY A N     1 
ATOM   4685 C  CA    . GLY A 1 571 ? -3.512  -5.666  23.827  1.00 26.26 ? 571  GLY A CA    1 
ATOM   4686 C  C     . GLY A 1 571 ? -3.400  -5.599  25.357  1.00 29.11 ? 571  GLY A C     1 
ATOM   4687 O  O     . GLY A 1 571 ? -2.296  -5.708  25.906  1.00 26.64 ? 571  GLY A O     1 
ATOM   4688 N  N     . ASN A 1 572 ? -4.537  -5.418  26.041  1.00 26.82 ? 572  ASN A N     1 
ATOM   4689 C  CA    . ASN A 1 572 ? -4.602  -5.499  27.506  1.00 25.97 ? 572  ASN A CA    1 
ATOM   4690 C  C     . ASN A 1 572 ? -5.498  -6.654  27.981  1.00 25.98 ? 572  ASN A C     1 
ATOM   4691 O  O     . ASN A 1 572 ? -6.673  -6.723  27.600  1.00 23.73 ? 572  ASN A O     1 
ATOM   4692 C  CB    . ASN A 1 572 ? -5.081  -4.171  28.103  1.00 26.03 ? 572  ASN A CB    1 
ATOM   4693 C  CG    . ASN A 1 572 ? -5.280  -4.249  29.603  1.00 27.30 ? 572  ASN A CG    1 
ATOM   4694 O  OD1   . ASN A 1 572 ? -6.183  -4.924  30.085  1.00 34.59 ? 572  ASN A OD1   1 
ATOM   4695 N  ND2   . ASN A 1 572 ? -4.436  -3.558  30.346  1.00 26.07 ? 572  ASN A ND2   1 
ATOM   4696 N  N     . VAL A 1 573 ? -4.938  -7.535  28.819  1.00 24.19 ? 573  VAL A N     1 
ATOM   4697 C  CA    . VAL A 1 573 ? -5.590  -8.783  29.234  1.00 24.81 ? 573  VAL A CA    1 
ATOM   4698 C  C     . VAL A 1 573 ? -6.936  -8.615  29.970  1.00 28.04 ? 573  VAL A C     1 
ATOM   4699 O  O     . VAL A 1 573 ? -7.745  -9.535  29.977  1.00 29.77 ? 573  VAL A O     1 
ATOM   4700 C  CB    . VAL A 1 573 ? -4.633  -9.732  30.048  1.00 27.65 ? 573  VAL A CB    1 
ATOM   4701 C  CG1   . VAL A 1 573 ? -3.355  -10.059 29.252  1.00 27.82 ? 573  VAL A CG1   1 
ATOM   4702 C  CG2   . VAL A 1 573 ? -4.275  -9.149  31.417  1.00 25.59 ? 573  VAL A CG2   1 
ATOM   4703 N  N     . TRP A 1 574 ? -7.172  -7.444  30.562  1.00 27.17 ? 574  TRP A N     1 
ATOM   4704 C  CA    . TRP A 1 574 ? -8.427  -7.158  31.267  1.00 29.63 ? 574  TRP A CA    1 
ATOM   4705 C  C     . TRP A 1 574 ? -9.564  -6.687  30.350  1.00 27.75 ? 574  TRP A C     1 
ATOM   4706 O  O     . TRP A 1 574 ? -10.729 -6.714  30.733  1.00 25.35 ? 574  TRP A O     1 
ATOM   4707 C  CB    . TRP A 1 574 ? -8.183  -6.161  32.414  1.00 32.25 ? 574  TRP A CB    1 
ATOM   4708 C  CG    . TRP A 1 574 ? -7.209  -6.700  33.417  1.00 40.26 ? 574  TRP A CG    1 
ATOM   4709 C  CD1   . TRP A 1 574 ? -5.936  -6.257  33.649  1.00 44.23 ? 574  TRP A CD1   1 
ATOM   4710 C  CD2   . TRP A 1 574 ? -7.414  -7.812  34.298  1.00 43.59 ? 574  TRP A CD2   1 
ATOM   4711 N  NE1   . TRP A 1 574 ? -5.344  -7.012  34.634  1.00 46.24 ? 574  TRP A NE1   1 
ATOM   4712 C  CE2   . TRP A 1 574 ? -6.227  -7.975  35.047  1.00 48.02 ? 574  TRP A CE2   1 
ATOM   4713 C  CE3   . TRP A 1 574 ? -8.490  -8.681  34.533  1.00 47.75 ? 574  TRP A CE3   1 
ATOM   4714 C  CZ2   . TRP A 1 574 ? -6.084  -8.975  36.020  1.00 50.56 ? 574  TRP A CZ2   1 
ATOM   4715 C  CZ3   . TRP A 1 574 ? -8.349  -9.678  35.505  1.00 51.54 ? 574  TRP A CZ3   1 
ATOM   4716 C  CH2   . TRP A 1 574 ? -7.152  -9.815  36.234  1.00 51.00 ? 574  TRP A CH2   1 
ATOM   4717 N  N     . PHE A 1 575 ? -9.228  -6.283  29.127  1.00 26.68 ? 575  PHE A N     1 
ATOM   4718 C  CA    . PHE A 1 575 ? -10.248 -5.890  28.174  1.00 23.37 ? 575  PHE A CA    1 
ATOM   4719 C  C     . PHE A 1 575 ? -11.087 -7.094  27.705  1.00 25.77 ? 575  PHE A C     1 
ATOM   4720 O  O     . PHE A 1 575 ? -10.552 -8.176  27.399  1.00 25.89 ? 575  PHE A O     1 
ATOM   4721 C  CB    . PHE A 1 575 ? -9.604  -5.169  27.001  1.00 24.49 ? 575  PHE A CB    1 
ATOM   4722 C  CG    . PHE A 1 575 ? -10.576 -4.471  26.101  1.00 22.46 ? 575  PHE A CG    1 
ATOM   4723 C  CD1   . PHE A 1 575 ? -11.646 -3.753  26.625  1.00 26.08 ? 575  PHE A CD1   1 
ATOM   4724 C  CD2   . PHE A 1 575 ? -10.405 -4.510  24.718  1.00 23.77 ? 575  PHE A CD2   1 
ATOM   4725 C  CE1   . PHE A 1 575 ? -12.545 -3.094  25.783  1.00 25.30 ? 575  PHE A CE1   1 
ATOM   4726 C  CE2   . PHE A 1 575 ? -11.288 -3.852  23.866  1.00 23.12 ? 575  PHE A CE2   1 
ATOM   4727 C  CZ    . PHE A 1 575 ? -12.362 -3.139  24.401  1.00 25.36 ? 575  PHE A CZ    1 
ATOM   4728 N  N     . ARG A 1 576 ? -12.402 -6.908  27.648  1.00 24.76 ? 576  ARG A N     1 
ATOM   4729 C  CA    . ARG A 1 576 ? -13.304 -7.991  27.218  1.00 25.78 ? 576  ARG A CA    1 
ATOM   4730 C  C     . ARG A 1 576 ? -12.937 -8.526  25.832  1.00 25.18 ? 576  ARG A C     1 
ATOM   4731 O  O     . ARG A 1 576 ? -13.093 -9.720  25.562  1.00 24.97 ? 576  ARG A O     1 
ATOM   4732 C  CB    . ARG A 1 576 ? -14.773 -7.539  27.233  1.00 22.95 ? 576  ARG A CB    1 
ATOM   4733 C  CG    . ARG A 1 576 ? -15.782 -8.677  26.991  1.00 25.16 ? 576  ARG A CG    1 
ATOM   4734 C  CD    . ARG A 1 576 ? -17.227 -8.172  27.027  1.00 25.12 ? 576  ARG A CD    1 
ATOM   4735 N  NE    . ARG A 1 576 ? -17.476 -7.381  28.227  1.00 24.03 ? 576  ARG A NE    1 
ATOM   4736 C  CZ    . ARG A 1 576 ? -17.935 -7.877  29.370  1.00 25.20 ? 576  ARG A CZ    1 
ATOM   4737 N  NH1   . ARG A 1 576 ? -18.236 -9.175  29.486  1.00 23.77 ? 576  ARG A NH1   1 
ATOM   4738 N  NH2   . ARG A 1 576 ? -18.115 -7.064  30.393  1.00 16.36 ? 576  ARG A NH2   1 
ATOM   4739 N  N     . TYR A 1 577 ? -12.445 -7.637  24.967  1.00 24.67 ? 577  TYR A N     1 
ATOM   4740 C  CA    . TYR A 1 577 ? -12.145 -8.000  23.591  1.00 24.00 ? 577  TYR A CA    1 
ATOM   4741 C  C     . TYR A 1 577 ? -10.643 -8.118  23.317  1.00 24.87 ? 577  TYR A C     1 
ATOM   4742 O  O     . TYR A 1 577 ? -10.195 -7.964  22.179  1.00 23.67 ? 577  TYR A O     1 
ATOM   4743 C  CB    . TYR A 1 577 ? -12.856 -7.044  22.626  1.00 24.75 ? 577  TYR A CB    1 
ATOM   4744 C  CG    . TYR A 1 577 ? -14.336 -6.938  22.936  1.00 22.78 ? 577  TYR A CG    1 
ATOM   4745 C  CD1   . TYR A 1 577 ? -14.843 -5.830  23.621  1.00 23.60 ? 577  TYR A CD1   1 
ATOM   4746 C  CD2   . TYR A 1 577 ? -15.217 -7.969  22.594  1.00 20.11 ? 577  TYR A CD2   1 
ATOM   4747 C  CE1   . TYR A 1 577 ? -16.189 -5.737  23.943  1.00 23.48 ? 577  TYR A CE1   1 
ATOM   4748 C  CE2   . TYR A 1 577 ? -16.574 -7.881  22.898  1.00 22.96 ? 577  TYR A CE2   1 
ATOM   4749 C  CZ    . TYR A 1 577 ? -17.046 -6.764  23.574  1.00 21.28 ? 577  TYR A CZ    1 
ATOM   4750 O  OH    . TYR A 1 577 ? -18.370 -6.671  23.889  1.00 25.88 ? 577  TYR A OH    1 
ATOM   4751 N  N     . TYR A 1 578 ? -9.878  -8.390  24.372  1.00 22.78 ? 578  TYR A N     1 
ATOM   4752 C  CA    . TYR A 1 578 ? -8.461  -8.665  24.238  1.00 23.62 ? 578  TYR A CA    1 
ATOM   4753 C  C     . TYR A 1 578 ? -8.245  -9.742  23.191  1.00 24.94 ? 578  TYR A C     1 
ATOM   4754 O  O     . TYR A 1 578 ? -8.865  -10.803 23.243  1.00 27.66 ? 578  TYR A O     1 
ATOM   4755 C  CB    . TYR A 1 578 ? -7.881  -9.137  25.566  1.00 22.24 ? 578  TYR A CB    1 
ATOM   4756 C  CG    . TYR A 1 578 ? -6.453  -9.674  25.492  1.00 25.94 ? 578  TYR A CG    1 
ATOM   4757 C  CD1   . TYR A 1 578 ? -6.198  -11.050 25.468  1.00 25.46 ? 578  TYR A CD1   1 
ATOM   4758 C  CD2   . TYR A 1 578 ? -5.364  -8.809  25.472  1.00 23.31 ? 578  TYR A CD2   1 
ATOM   4759 C  CE1   . TYR A 1 578 ? -4.889  -11.546 25.424  1.00 26.34 ? 578  TYR A CE1   1 
ATOM   4760 C  CE2   . TYR A 1 578 ? -4.058  -9.289  25.422  1.00 21.79 ? 578  TYR A CE2   1 
ATOM   4761 C  CZ    . TYR A 1 578 ? -3.827  -10.649 25.399  1.00 27.52 ? 578  TYR A CZ    1 
ATOM   4762 O  OH    . TYR A 1 578 ? -2.529  -11.104 25.368  1.00 30.56 ? 578  TYR A OH    1 
ATOM   4763 N  N     . ASP A 1 579 ? -7.365  -9.451  22.241  1.00 26.20 ? 579  ASP A N     1 
ATOM   4764 C  CA    . ASP A 1 579 ? -6.963  -10.418 21.232  1.00 26.94 ? 579  ASP A CA    1 
ATOM   4765 C  C     . ASP A 1 579 ? -5.680  -9.908  20.580  1.00 27.79 ? 579  ASP A C     1 
ATOM   4766 O  O     . ASP A 1 579 ? -5.679  -8.854  19.922  1.00 25.56 ? 579  ASP A O     1 
ATOM   4767 C  CB    . ASP A 1 579 ? -8.077  -10.602 20.191  1.00 28.78 ? 579  ASP A CB    1 
ATOM   4768 C  CG    . ASP A 1 579 ? -7.855  -11.830 19.302  1.00 29.73 ? 579  ASP A CG    1 
ATOM   4769 O  OD1   . ASP A 1 579 ? -8.849  -12.401 18.808  1.00 25.44 ? 579  ASP A OD1   1 
ATOM   4770 O  OD2   . ASP A 1 579 ? -6.687  -12.223 19.107  1.00 27.60 ? 579  ASP A OD2   1 
ATOM   4771 N  N     . LEU A 1 580 ? -4.585  -10.636 20.788  1.00 26.93 ? 580  LEU A N     1 
ATOM   4772 C  CA    . LEU A 1 580 ? -3.296  -10.254 20.212  1.00 28.08 ? 580  LEU A CA    1 
ATOM   4773 C  C     . LEU A 1 580 ? -3.268  -10.351 18.689  1.00 26.81 ? 580  LEU A C     1 
ATOM   4774 O  O     . LEU A 1 580 ? -2.463  -9.691  18.046  1.00 28.13 ? 580  LEU A O     1 
ATOM   4775 C  CB    . LEU A 1 580 ? -2.154  -11.067 20.825  1.00 30.84 ? 580  LEU A CB    1 
ATOM   4776 C  CG    . LEU A 1 580 ? -1.136  -10.352 21.725  1.00 33.93 ? 580  LEU A CG    1 
ATOM   4777 C  CD1   . LEU A 1 580 ? -1.756  -9.324  22.666  1.00 30.93 ? 580  LEU A CD1   1 
ATOM   4778 C  CD2   . LEU A 1 580 ? -0.299  -11.362 22.508  1.00 33.63 ? 580  LEU A CD2   1 
ATOM   4779 N  N     . ARG A 1 581 ? -4.148  -11.160 18.111  1.00 25.82 ? 581  ARG A N     1 
ATOM   4780 C  CA    . ARG A 1 581 ? -4.264  -11.223 16.648  1.00 25.61 ? 581  ARG A CA    1 
ATOM   4781 C  C     . ARG A 1 581 ? -4.705  -9.867  16.090  1.00 25.65 ? 581  ARG A C     1 
ATOM   4782 O  O     . ARG A 1 581 ? -4.171  -9.388  15.084  1.00 24.98 ? 581  ARG A O     1 
ATOM   4783 C  CB    . ARG A 1 581 ? -5.236  -12.317 16.229  1.00 23.98 ? 581  ARG A CB    1 
ATOM   4784 C  CG    . ARG A 1 581 ? -4.780  -13.729 16.615  1.00 28.90 ? 581  ARG A CG    1 
ATOM   4785 C  CD    . ARG A 1 581 ? -5.845  -14.762 16.343  1.00 28.37 ? 581  ARG A CD    1 
ATOM   4786 N  NE    . ARG A 1 581 ? -7.095  -14.445 17.039  1.00 27.11 ? 581  ARG A NE    1 
ATOM   4787 C  CZ    . ARG A 1 581 ? -8.205  -15.169 16.936  1.00 28.69 ? 581  ARG A CZ    1 
ATOM   4788 N  NH1   . ARG A 1 581 ? -8.220  -16.243 16.160  1.00 26.21 ? 581  ARG A NH1   1 
ATOM   4789 N  NH2   . ARG A 1 581 ? -9.303  -14.815 17.597  1.00 23.87 ? 581  ARG A NH2   1 
ATOM   4790 N  N     . ASN A 1 582 ? -5.659  -9.246  16.775  1.00 24.58 ? 582  ASN A N     1 
ATOM   4791 C  CA    . ASN A 1 582 ? -6.198  -7.963  16.361  1.00 25.47 ? 582  ASN A CA    1 
ATOM   4792 C  C     . ASN A 1 582 ? -5.265  -6.807  16.710  1.00 25.21 ? 582  ASN A C     1 
ATOM   4793 O  O     . ASN A 1 582 ? -5.074  -5.901  15.895  1.00 25.03 ? 582  ASN A O     1 
ATOM   4794 C  CB    . ASN A 1 582 ? -7.601  -7.751  16.953  1.00 24.31 ? 582  ASN A CB    1 
ATOM   4795 C  CG    . ASN A 1 582 ? -8.671  -8.601  16.262  1.00 27.40 ? 582  ASN A CG    1 
ATOM   4796 O  OD1   . ASN A 1 582 ? -8.420  -9.219  15.223  1.00 25.81 ? 582  ASN A OD1   1 
ATOM   4797 N  ND2   . ASN A 1 582 ? -9.869  -8.635  16.843  1.00 24.64 ? 582  ASN A ND2   1 
ATOM   4798 N  N     . ALA A 1 583 ? -4.671  -6.846  17.906  1.00 24.16 ? 583  ALA A N     1 
ATOM   4799 C  CA    . ALA A 1 583 ? -3.704  -5.819  18.304  1.00 23.28 ? 583  ALA A CA    1 
ATOM   4800 C  C     . ALA A 1 583 ? -2.521  -5.827  17.337  1.00 24.62 ? 583  ALA A C     1 
ATOM   4801 O  O     . ALA A 1 583 ? -2.068  -4.773  16.900  1.00 22.55 ? 583  ALA A O     1 
ATOM   4802 C  CB    . ALA A 1 583 ? -3.220  -6.025  19.766  1.00 18.90 ? 583  ALA A CB    1 
ATOM   4803 N  N     . THR A 1 584 ? -2.024  -7.018  16.993  1.00 24.86 ? 584  THR A N     1 
ATOM   4804 C  CA    . THR A 1 584 ? -0.856  -7.078  16.113  1.00 25.17 ? 584  THR A CA    1 
ATOM   4805 C  C     . THR A 1 584 ? -1.225  -6.816  14.661  1.00 23.88 ? 584  THR A C     1 
ATOM   4806 O  O     . THR A 1 584 ? -0.387  -6.354  13.900  1.00 26.52 ? 584  THR A O     1 
ATOM   4807 C  CB    . THR A 1 584 ? -0.026  -8.380  16.265  1.00 25.28 ? 584  THR A CB    1 
ATOM   4808 O  OG1   . THR A 1 584 ? -0.829  -9.516  15.908  1.00 28.31 ? 584  THR A OG1   1 
ATOM   4809 C  CG2   . THR A 1 584 ? 0.456   -8.519  17.693  1.00 20.71 ? 584  THR A CG2   1 
ATOM   4810 N  N     . ALA A 1 585 ? -2.476  -7.086  14.284  1.00 23.94 ? 585  ALA A N     1 
ATOM   4811 C  CA    . ALA A 1 585 ? -2.947  -6.729  12.939  1.00 24.60 ? 585  ALA A CA    1 
ATOM   4812 C  C     . ALA A 1 585 ? -2.833  -5.224  12.690  1.00 24.51 ? 585  ALA A C     1 
ATOM   4813 O  O     . ALA A 1 585 ? -2.392  -4.798  11.619  1.00 24.67 ? 585  ALA A O     1 
ATOM   4814 C  CB    . ALA A 1 585 ? -4.383  -7.203  12.712  1.00 22.25 ? 585  ALA A CB    1 
ATOM   4815 N  N     . ILE A 1 586 ? -3.234  -4.441  13.688  1.00 22.66 ? 586  ILE A N     1 
ATOM   4816 C  CA    . ILE A 1 586 ? -3.139  -2.985  13.649  1.00 24.05 ? 586  ILE A CA    1 
ATOM   4817 C  C     . ILE A 1 586 ? -1.695  -2.504  13.530  1.00 22.94 ? 586  ILE A C     1 
ATOM   4818 O  O     . ILE A 1 586 ? -1.366  -1.730  12.633  1.00 23.32 ? 586  ILE A O     1 
ATOM   4819 C  CB    . ILE A 1 586 ? -3.780  -2.343  14.918  1.00 25.04 ? 586  ILE A CB    1 
ATOM   4820 C  CG1   . ILE A 1 586 ? -5.269  -2.689  15.021  1.00 21.15 ? 586  ILE A CG1   1 
ATOM   4821 C  CG2   . ILE A 1 586 ? -3.600  -0.830  14.909  1.00 25.28 ? 586  ILE A CG2   1 
ATOM   4822 C  CD1   . ILE A 1 586 ? -5.853  -2.424  16.409  1.00 18.93 ? 586  ILE A CD1   1 
ATOM   4823 N  N     . THR A 1 587 ? -0.839  -2.958  14.446  1.00 26.09 ? 587  THR A N     1 
ATOM   4824 C  CA    . THR A 1 587 ? 0.525   -2.429  14.548  1.00 24.67 ? 587  THR A CA    1 
ATOM   4825 C  C     . THR A 1 587 ? 1.417   -2.883  13.394  1.00 26.17 ? 587  THR A C     1 
ATOM   4826 O  O     . THR A 1 587 ? 2.303   -2.132  12.967  1.00 23.73 ? 587  THR A O     1 
ATOM   4827 C  CB    . THR A 1 587 ? 1.207   -2.787  15.888  1.00 27.14 ? 587  THR A CB    1 
ATOM   4828 O  OG1   . THR A 1 587 ? 1.462   -4.194  15.951  1.00 27.69 ? 587  THR A OG1   1 
ATOM   4829 C  CG2   . THR A 1 587 ? 0.344   -2.339  17.095  1.00 23.52 ? 587  THR A CG2   1 
ATOM   4830 N  N     . THR A 1 588 ? 1.172   -4.097  12.892  1.00 22.84 ? 588  THR A N     1 
ATOM   4831 C  CA    . THR A 1 588 ? 1.950   -4.646  11.789  1.00 24.71 ? 588  THR A CA    1 
ATOM   4832 C  C     . THR A 1 588 ? 1.586   -3.962  10.464  1.00 26.96 ? 588  THR A C     1 
ATOM   4833 O  O     . THR A 1 588 ? 2.450   -3.740  9.622   1.00 26.26 ? 588  THR A O     1 
ATOM   4834 C  CB    . THR A 1 588 ? 1.778   -6.195  11.667  1.00 25.04 ? 588  THR A CB    1 
ATOM   4835 O  OG1   . THR A 1 588 ? 1.938   -6.814  12.952  1.00 23.00 ? 588  THR A OG1   1 
ATOM   4836 C  CG2   . THR A 1 588 ? 2.803   -6.787  10.707  1.00 20.84 ? 588  THR A CG2   1 
ATOM   4837 N  N     . PHE A 1 589 ? 0.305   -3.643  10.287  1.00 27.48 ? 589  PHE A N     1 
ATOM   4838 C  CA    . PHE A 1 589 ? -0.182  -2.926  9.107   1.00 25.65 ? 589  PHE A CA    1 
ATOM   4839 C  C     . PHE A 1 589 ? 0.421   -1.527  9.109   1.00 25.66 ? 589  PHE A C     1 
ATOM   4840 O  O     . PHE A 1 589 ? 0.787   -1.003  8.063   1.00 27.47 ? 589  PHE A O     1 
ATOM   4841 C  CB    . PHE A 1 589 ? -1.706  -2.831  9.175   1.00 25.61 ? 589  PHE A CB    1 
ATOM   4842 C  CG    . PHE A 1 589 ? -2.358  -2.293  7.930   1.00 23.65 ? 589  PHE A CG    1 
ATOM   4843 C  CD1   . PHE A 1 589 ? -2.483  -0.919  7.722   1.00 23.02 ? 589  PHE A CD1   1 
ATOM   4844 C  CD2   . PHE A 1 589 ? -2.881  -3.161  6.977   1.00 20.22 ? 589  PHE A CD2   1 
ATOM   4845 C  CE1   . PHE A 1 589 ? -3.111  -0.418  6.572   1.00 19.67 ? 589  PHE A CE1   1 
ATOM   4846 C  CE2   . PHE A 1 589 ? -3.508  -2.668  5.827   1.00 21.34 ? 589  PHE A CE2   1 
ATOM   4847 C  CZ    . PHE A 1 589 ? -3.621  -1.289  5.631   1.00 22.63 ? 589  PHE A CZ    1 
ATOM   4848 N  N     . GLY A 1 590 ? 0.528   -0.936  10.299  1.00 23.86 ? 590  GLY A N     1 
ATOM   4849 C  CA    . GLY A 1 590 ? 1.122   0.389   10.473  1.00 22.23 ? 590  GLY A CA    1 
ATOM   4850 C  C     . GLY A 1 590 ? 2.572   0.408   10.021  1.00 24.36 ? 590  GLY A C     1 
ATOM   4851 O  O     . GLY A 1 590 ? 2.999   1.358   9.352   1.00 22.62 ? 590  GLY A O     1 
ATOM   4852 N  N     . GLN A 1 591 ? 3.323   -0.649  10.368  1.00 23.24 ? 591  GLN A N     1 
ATOM   4853 C  CA    . GLN A 1 591 ? 4.718   -0.788  9.945   1.00 26.06 ? 591  GLN A CA    1 
ATOM   4854 C  C     . GLN A 1 591 ? 4.820   -0.853  8.439   1.00 27.15 ? 591  GLN A C     1 
ATOM   4855 O  O     . GLN A 1 591 ? 5.651   -0.173  7.843   1.00 30.58 ? 591  GLN A O     1 
ATOM   4856 C  CB    . GLN A 1 591 ? 5.372   -2.035  10.532  1.00 25.87 ? 591  GLN A CB    1 
ATOM   4857 C  CG    . GLN A 1 591 ? 5.661   -1.949  12.018  1.00 31.15 ? 591  GLN A CG    1 
ATOM   4858 C  CD    . GLN A 1 591 ? 6.784   -2.888  12.446  1.00 35.09 ? 591  GLN A CD    1 
ATOM   4859 O  OE1   . GLN A 1 591 ? 7.561   -3.378  11.614  1.00 37.62 ? 591  GLN A OE1   1 
ATOM   4860 N  NE2   . GLN A 1 591 ? 6.882   -3.133  13.749  1.00 30.14 ? 591  GLN A NE2   1 
ATOM   4861 N  N     . MET A 1 592 ? 3.977   -1.684  7.834   1.00 27.41 ? 592  MET A N     1 
ATOM   4862 C  CA    . MET A 1 592 ? 3.934   -1.814  6.391   1.00 28.76 ? 592  MET A CA    1 
ATOM   4863 C  C     . MET A 1 592 ? 3.617   -0.477  5.749   1.00 28.91 ? 592  MET A C     1 
ATOM   4864 O  O     . MET A 1 592 ? 4.342   -0.031  4.874   1.00 31.73 ? 592  MET A O     1 
ATOM   4865 C  CB    . MET A 1 592 ? 2.889   -2.845  5.974   1.00 27.27 ? 592  MET A CB    1 
ATOM   4866 C  CG    . MET A 1 592 ? 2.717   -2.937  4.464   1.00 28.05 ? 592  MET A CG    1 
ATOM   4867 S  SD    . MET A 1 592 ? 1.431   -4.101  4.000   1.00 32.91 ? 592  MET A SD    1 
ATOM   4868 C  CE    . MET A 1 592 ? -0.019  -3.233  4.632   1.00 29.95 ? 592  MET A CE    1 
ATOM   4869 N  N     . ALA A 1 593 ? 2.535   0.153   6.206   1.00 30.04 ? 593  ALA A N     1 
ATOM   4870 C  CA    . ALA A 1 593 ? 2.046   1.413   5.654   1.00 30.42 ? 593  ALA A CA    1 
ATOM   4871 C  C     . ALA A 1 593 ? 3.131   2.476   5.584   1.00 29.88 ? 593  ALA A C     1 
ATOM   4872 O  O     . ALA A 1 593 ? 3.293   3.138   4.564   1.00 31.41 ? 593  ALA A O     1 
ATOM   4873 C  CB    . ALA A 1 593 ? 0.863   1.926   6.473   1.00 28.37 ? 593  ALA A CB    1 
ATOM   4874 N  N     . LEU A 1 594 ? 3.867   2.639   6.677   1.00 30.76 ? 594  LEU A N     1 
ATOM   4875 C  CA    . LEU A 1 594 ? 4.907   3.654   6.739   1.00 29.24 ? 594  LEU A CA    1 
ATOM   4876 C  C     . LEU A 1 594 ? 6.023   3.352   5.727   1.00 30.66 ? 594  LEU A C     1 
ATOM   4877 O  O     . LEU A 1 594 ? 6.437   4.225   4.948   1.00 31.39 ? 594  LEU A O     1 
ATOM   4878 C  CB    . LEU A 1 594 ? 5.455   3.774   8.169   1.00 29.13 ? 594  LEU A CB    1 
ATOM   4879 C  CG    . LEU A 1 594 ? 6.559   4.804   8.458   1.00 31.31 ? 594  LEU A CG    1 
ATOM   4880 C  CD1   . LEU A 1 594 ? 6.288   6.091   7.736   1.00 32.29 ? 594  LEU A CD1   1 
ATOM   4881 C  CD2   . LEU A 1 594 ? 6.690   5.068   9.946   1.00 29.86 ? 594  LEU A CD2   1 
ATOM   4882 N  N     . GLN A 1 595 ? 6.484   2.106   5.719   1.00 28.95 ? 595  GLN A N     1 
ATOM   4883 C  CA    . GLN A 1 595 ? 7.597   1.734   4.860   1.00 29.41 ? 595  GLN A CA    1 
ATOM   4884 C  C     . GLN A 1 595 ? 7.179   1.664   3.386   1.00 30.99 ? 595  GLN A C     1 
ATOM   4885 O  O     . GLN A 1 595 ? 7.971   1.992   2.494   1.00 32.04 ? 595  GLN A O     1 
ATOM   4886 C  CB    . GLN A 1 595 ? 8.262   0.464   5.385   1.00 27.03 ? 595  GLN A CB    1 
ATOM   4887 C  CG    . GLN A 1 595 ? 8.835   0.682   6.794   1.00 28.15 ? 595  GLN A CG    1 
ATOM   4888 C  CD    . GLN A 1 595 ? 9.407   -0.579  7.423   1.00 30.99 ? 595  GLN A CD    1 
ATOM   4889 O  OE1   . GLN A 1 595 ? 10.545  -0.961  7.150   1.00 34.01 ? 595  GLN A OE1   1 
ATOM   4890 N  NE2   . GLN A 1 595 ? 8.622   -1.219  8.290   1.00 32.69 ? 595  GLN A NE2   1 
ATOM   4891 N  N     . TRP A 1 596 ? 5.922   1.281   3.150   1.00 29.18 ? 596  TRP A N     1 
ATOM   4892 C  CA    . TRP A 1 596 ? 5.315   1.320   1.823   1.00 30.51 ? 596  TRP A CA    1 
ATOM   4893 C  C     . TRP A 1 596 ? 5.314   2.747   1.282   1.00 31.39 ? 596  TRP A C     1 
ATOM   4894 O  O     . TRP A 1 596 ? 5.774   2.996   0.166   1.00 32.78 ? 596  TRP A O     1 
ATOM   4895 C  CB    . TRP A 1 596 ? 3.883   0.776   1.872   1.00 29.62 ? 596  TRP A CB    1 
ATOM   4896 C  CG    . TRP A 1 596 ? 3.139   0.830   0.555   1.00 30.30 ? 596  TRP A CG    1 
ATOM   4897 C  CD1   . TRP A 1 596 ? 2.543   1.924   -0.009  1.00 29.02 ? 596  TRP A CD1   1 
ATOM   4898 C  CD2   . TRP A 1 596 ? 2.905   -0.263  -0.347  1.00 26.28 ? 596  TRP A CD2   1 
ATOM   4899 N  NE1   . TRP A 1 596 ? 1.962   1.582   -1.210  1.00 28.23 ? 596  TRP A NE1   1 
ATOM   4900 C  CE2   . TRP A 1 596 ? 2.170   0.248   -1.442  1.00 26.72 ? 596  TRP A CE2   1 
ATOM   4901 C  CE3   . TRP A 1 596 ? 3.251   -1.619  -0.337  1.00 27.74 ? 596  TRP A CE3   1 
ATOM   4902 C  CZ2   . TRP A 1 596 ? 1.773   -0.552  -2.524  1.00 27.67 ? 596  TRP A CZ2   1 
ATOM   4903 C  CZ3   . TRP A 1 596 ? 2.858   -2.418  -1.417  1.00 32.71 ? 596  TRP A CZ3   1 
ATOM   4904 C  CH2   . TRP A 1 596 ? 2.122   -1.879  -2.491  1.00 30.30 ? 596  TRP A CH2   1 
ATOM   4905 N  N     . ILE A 1 597 ? 4.792   3.687   2.065   1.00 30.19 ? 597  ILE A N     1 
ATOM   4906 C  CA    . ILE A 1 597 ? 4.698   5.052   1.567   1.00 31.24 ? 597  ILE A CA    1 
ATOM   4907 C  C     . ILE A 1 597 ? 6.084   5.703   1.464   1.00 34.14 ? 597  ILE A C     1 
ATOM   4908 O  O     . ILE A 1 597 ? 6.282   6.590   0.632   1.00 35.55 ? 597  ILE A O     1 
ATOM   4909 C  CB    . ILE A 1 597 ? 3.666   5.909   2.344   1.00 28.06 ? 597  ILE A CB    1 
ATOM   4910 C  CG1   . ILE A 1 597 ? 3.031   6.956   1.424   1.00 29.22 ? 597  ILE A CG1   1 
ATOM   4911 C  CG2   . ILE A 1 597 ? 4.278   6.547   3.589   1.00 26.66 ? 597  ILE A CG2   1 
ATOM   4912 C  CD1   . ILE A 1 597 ? 2.204   6.368   0.275   1.00 29.71 ? 597  ILE A CD1   1 
ATOM   4913 N  N     . GLU A 1 598 ? 7.034   5.241   2.282   1.00 32.10 ? 598  GLU A N     1 
ATOM   4914 C  CA    . GLU A 1 598 ? 8.431   5.676   2.166   1.00 32.53 ? 598  GLU A CA    1 
ATOM   4915 C  C     . GLU A 1 598 ? 8.982   5.357   0.782   1.00 32.14 ? 598  GLU A C     1 
ATOM   4916 O  O     . GLU A 1 598 ? 9.586   6.214   0.131   1.00 30.69 ? 598  GLU A O     1 
ATOM   4917 C  CB    . GLU A 1 598 ? 9.310   5.023   3.243   1.00 32.43 ? 598  GLU A CB    1 
ATOM   4918 C  CG    . GLU A 1 598 ? 10.782  5.454   3.200   1.00 34.97 ? 598  GLU A CG    1 
ATOM   4919 C  CD    . GLU A 1 598 ? 11.688  4.649   4.131   1.00 39.32 ? 598  GLU A CD    1 
ATOM   4920 O  OE1   . GLU A 1 598 ? 11.218  3.662   4.741   1.00 38.81 ? 598  GLU A OE1   1 
ATOM   4921 O  OE2   . GLU A 1 598 ? 12.888  4.999   4.241   1.00 42.00 ? 598  GLU A OE2   1 
ATOM   4922 N  N     . ARG A 1 599 ? 8.774   4.115   0.347   1.00 33.21 ? 599  ARG A N     1 
ATOM   4923 C  CA    . ARG A 1 599 ? 9.218   3.661   -0.964  1.00 35.25 ? 599  ARG A CA    1 
ATOM   4924 C  C     . ARG A 1 599 ? 8.539   4.457   -2.078  1.00 35.83 ? 599  ARG A C     1 
ATOM   4925 O  O     . ARG A 1 599 ? 9.187   4.844   -3.057  1.00 37.53 ? 599  ARG A O     1 
ATOM   4926 C  CB    . ARG A 1 599 ? 8.968   2.156   -1.130  1.00 34.49 ? 599  ARG A CB    1 
ATOM   4927 C  CG    . ARG A 1 599 ? 9.498   1.575   -2.444  1.00 38.47 ? 599  ARG A CG    1 
ATOM   4928 C  CD    . ARG A 1 599 ? 9.208   0.079   -2.592  1.00 32.19 ? 599  ARG A CD    1 
ATOM   4929 N  NE    . ARG A 1 599 ? 7.804   -0.256  -2.335  1.00 31.72 ? 599  ARG A NE    1 
ATOM   4930 C  CZ    . ARG A 1 599 ? 6.846   -0.286  -3.261  1.00 36.36 ? 599  ARG A CZ    1 
ATOM   4931 N  NH1   . ARG A 1 599 ? 7.119   0.015   -4.524  1.00 34.12 ? 599  ARG A NH1   1 
ATOM   4932 N  NH2   . ARG A 1 599 ? 5.607   -0.622  -2.923  1.00 35.71 ? 599  ARG A NH2   1 
ATOM   4933 N  N     . LYS A 1 600 ? 7.244   4.722   -1.905  1.00 34.52 ? 600  LYS A N     1 
ATOM   4934 C  CA    . LYS A 1 600 ? 6.449   5.416   -2.922  1.00 35.88 ? 600  LYS A CA    1 
ATOM   4935 C  C     . LYS A 1 600 ? 6.859   6.872   -3.092  1.00 36.02 ? 600  LYS A C     1 
ATOM   4936 O  O     . LYS A 1 600 ? 6.946   7.374   -4.215  1.00 36.98 ? 600  LYS A O     1 
ATOM   4937 C  CB    . LYS A 1 600 ? 4.949   5.322   -2.606  1.00 35.02 ? 600  LYS A CB    1 
ATOM   4938 C  CG    . LYS A 1 600 ? 4.343   3.939   -2.837  1.00 37.59 ? 600  LYS A CG    1 
ATOM   4939 C  CD    . LYS A 1 600 ? 4.244   3.578   -4.320  1.00 40.14 ? 600  LYS A CD    1 
ATOM   4940 C  CE    . LYS A 1 600 ? 3.414   2.312   -4.522  1.00 39.51 ? 600  LYS A CE    1 
ATOM   4941 N  NZ    . LYS A 1 600 ? 3.264   1.968   -5.969  1.00 41.97 ? 600  LYS A NZ    1 
ATOM   4942 N  N     . VAL A 1 601 ? 7.103   7.546   -1.974  1.00 34.26 ? 601  VAL A N     1 
ATOM   4943 C  CA    . VAL A 1 601 ? 7.525   8.940   -1.998  1.00 35.19 ? 601  VAL A CA    1 
ATOM   4944 C  C     . VAL A 1 601 ? 8.932   9.068   -2.596  1.00 36.14 ? 601  VAL A C     1 
ATOM   4945 O  O     . VAL A 1 601 ? 9.180   9.946   -3.426  1.00 37.37 ? 601  VAL A O     1 
ATOM   4946 C  CB    . VAL A 1 601 ? 7.415   9.598   -0.588  1.00 33.35 ? 601  VAL A CB    1 
ATOM   4947 C  CG1   . VAL A 1 601 ? 8.092   10.956  -0.562  1.00 30.10 ? 601  VAL A CG1   1 
ATOM   4948 C  CG2   . VAL A 1 601 ? 5.948   9.752   -0.208  1.00 30.72 ? 601  VAL A CG2   1 
ATOM   4949 N  N     . ASN A 1 602 ? 9.838   8.185   -2.185  1.00 37.06 ? 602  ASN A N     1 
ATOM   4950 C  CA    . ASN A 1 602 ? 11.173  8.131   -2.775  1.00 39.17 ? 602  ASN A CA    1 
ATOM   4951 C  C     . ASN A 1 602 ? 11.116  7.927   -4.281  1.00 40.66 ? 602  ASN A C     1 
ATOM   4952 O  O     . ASN A 1 602 ? 11.785  8.637   -5.036  1.00 42.12 ? 602  ASN A O     1 
ATOM   4953 C  CB    . ASN A 1 602 ? 12.011  7.028   -2.137  1.00 38.55 ? 602  ASN A CB    1 
ATOM   4954 C  CG    . ASN A 1 602 ? 12.627  7.454   -0.829  1.00 38.02 ? 602  ASN A CG    1 
ATOM   4955 O  OD1   . ASN A 1 602 ? 12.739  8.644   -0.540  1.00 39.56 ? 602  ASN A OD1   1 
ATOM   4956 N  ND2   . ASN A 1 602 ? 13.043  6.483   -0.032  1.00 35.30 ? 602  ASN A ND2   1 
ATOM   4957 N  N     . GLU A 1 603 ? 10.306  6.961   -4.708  1.00 39.83 ? 603  GLU A N     1 
ATOM   4958 C  CA    . GLU A 1 603 ? 10.173  6.648   -6.130  1.00 40.43 ? 603  GLU A CA    1 
ATOM   4959 C  C     . GLU A 1 603 ? 9.667   7.849   -6.904  1.00 40.07 ? 603  GLU A C     1 
ATOM   4960 O  O     . GLU A 1 603 ? 10.163  8.144   -7.986  1.00 41.00 ? 603  GLU A O     1 
ATOM   4961 C  CB    . GLU A 1 603 ? 9.254   5.448   -6.340  1.00 40.49 ? 603  GLU A CB    1 
ATOM   4962 C  CG    . GLU A 1 603 ? 9.933   4.104   -6.083  1.00 44.14 ? 603  GLU A CG    1 
ATOM   4963 C  CD    . GLU A 1 603 ? 8.974   2.920   -6.169  1.00 44.95 ? 603  GLU A CD    1 
ATOM   4964 O  OE1   . GLU A 1 603 ? 7.803   3.112   -6.567  1.00 43.66 ? 603  GLU A OE1   1 
ATOM   4965 O  OE2   . GLU A 1 603 ? 9.396   1.790   -5.843  1.00 44.04 ? 603  GLU A OE2   1 
ATOM   4966 N  N     . TYR A 1 604 ? 8.694   8.551   -6.328  1.00 39.61 ? 604  TYR A N     1 
ATOM   4967 C  CA    . TYR A 1 604 ? 8.093   9.710   -6.969  1.00 39.93 ? 604  TYR A CA    1 
ATOM   4968 C  C     . TYR A 1 604 ? 9.090   10.864  -7.083  1.00 41.04 ? 604  TYR A C     1 
ATOM   4969 O  O     . TYR A 1 604 ? 9.206   11.497  -8.142  1.00 42.50 ? 604  TYR A O     1 
ATOM   4970 C  CB    . TYR A 1 604 ? 6.827   10.149  -6.222  1.00 40.07 ? 604  TYR A CB    1 
ATOM   4971 C  CG    . TYR A 1 604 ? 6.192   11.402  -6.782  1.00 42.91 ? 604  TYR A CG    1 
ATOM   4972 C  CD1   . TYR A 1 604 ? 6.344   12.632  -6.135  1.00 42.63 ? 604  TYR A CD1   1 
ATOM   4973 C  CD2   . TYR A 1 604 ? 5.450   11.363  -7.970  1.00 43.87 ? 604  TYR A CD2   1 
ATOM   4974 C  CE1   . TYR A 1 604 ? 5.774   13.794  -6.654  1.00 43.40 ? 604  TYR A CE1   1 
ATOM   4975 C  CE2   . TYR A 1 604 ? 4.870   12.516  -8.495  1.00 43.88 ? 604  TYR A CE2   1 
ATOM   4976 C  CZ    . TYR A 1 604 ? 5.038   13.727  -7.833  1.00 45.80 ? 604  TYR A CZ    1 
ATOM   4977 O  OH    . TYR A 1 604 ? 4.469   14.868  -8.348  1.00 48.06 ? 604  TYR A OH    1 
ATOM   4978 N  N     . LEU A 1 605 ? 9.823   11.127  -6.007  1.00 38.57 ? 605  LEU A N     1 
ATOM   4979 C  CA    . LEU A 1 605 ? 10.713  12.283  -5.987  1.00 38.18 ? 605  LEU A CA    1 
ATOM   4980 C  C     . LEU A 1 605 ? 11.947  12.103  -6.867  1.00 39.74 ? 605  LEU A C     1 
ATOM   4981 O  O     . LEU A 1 605 ? 12.389  13.053  -7.506  1.00 37.73 ? 605  LEU A O     1 
ATOM   4982 C  CB    . LEU A 1 605 ? 11.077  12.691  -4.558  1.00 33.42 ? 605  LEU A CB    1 
ATOM   4983 C  CG    . LEU A 1 605 ? 9.890   13.311  -3.811  1.00 34.28 ? 605  LEU A CG    1 
ATOM   4984 C  CD1   . LEU A 1 605 ? 10.246  13.577  -2.378  1.00 32.11 ? 605  LEU A CD1   1 
ATOM   4985 C  CD2   . LEU A 1 605 ? 9.381   14.589  -4.475  1.00 31.87 ? 605  LEU A CD2   1 
ATOM   4986 N  N     . ASN A 1 606 ? 12.481  10.885  -6.903  1.00 42.29 ? 606  ASN A N     1 
ATOM   4987 C  CA    . ASN A 1 606 ? 13.534  10.533  -7.842  1.00 47.45 ? 606  ASN A CA    1 
ATOM   4988 C  C     . ASN A 1 606 ? 13.091  10.755  -9.289  1.00 51.51 ? 606  ASN A C     1 
ATOM   4989 O  O     . ASN A 1 606 ? 13.892  11.151  -10.142 1.00 52.86 ? 606  ASN A O     1 
ATOM   4990 C  CB    . ASN A 1 606 ? 13.961  9.077   -7.637  1.00 47.67 ? 606  ASN A CB    1 
ATOM   4991 C  CG    . ASN A 1 606 ? 15.034  8.928   -6.576  1.00 47.52 ? 606  ASN A CG    1 
ATOM   4992 O  OD1   . ASN A 1 606 ? 16.187  9.316   -6.784  1.00 48.79 ? 606  ASN A OD1   1 
ATOM   4993 N  ND2   . ASN A 1 606 ? 14.665  8.353   -5.436  1.00 42.80 ? 606  ASN A ND2   1 
ATOM   4994 N  N     . GLU A 1 607 ? 11.808  10.501  -9.543  1.00 53.55 ? 607  GLU A N     1 
ATOM   4995 C  CA    . GLU A 1 607 ? 11.198  10.676  -10.857 1.00 58.19 ? 607  GLU A CA    1 
ATOM   4996 C  C     . GLU A 1 607 ? 11.079  12.152  -11.247 1.00 58.98 ? 607  GLU A C     1 
ATOM   4997 O  O     . GLU A 1 607 ? 11.456  12.518  -12.359 1.00 61.04 ? 607  GLU A O     1 
ATOM   4998 C  CB    . GLU A 1 607 ? 9.831   9.982   -10.903 1.00 58.97 ? 607  GLU A CB    1 
ATOM   4999 C  CG    . GLU A 1 607 ? 9.109   10.033  -12.250 1.00 66.13 ? 607  GLU A CG    1 
ATOM   5000 C  CD    . GLU A 1 607 ? 7.771   9.289   -12.244 1.00 70.56 ? 607  GLU A CD    1 
ATOM   5001 O  OE1   . GLU A 1 607 ? 7.052   9.350   -13.266 1.00 73.98 ? 607  GLU A OE1   1 
ATOM   5002 O  OE2   . GLU A 1 607 ? 7.433   8.640   -11.226 1.00 71.46 ? 607  GLU A OE2   1 
ATOM   5003 N  N     . VAL A 1 608 ? 10.570  12.996  -10.349 1.00 58.92 ? 608  VAL A N     1 
ATOM   5004 C  CA    . VAL A 1 608 ? 10.449  14.433  -10.657 1.00 60.75 ? 608  VAL A CA    1 
ATOM   5005 C  C     . VAL A 1 608 ? 11.814  15.130  -10.723 1.00 61.44 ? 608  VAL A C     1 
ATOM   5006 O  O     . VAL A 1 608 ? 12.003  16.048  -11.520 1.00 60.63 ? 608  VAL A O     1 
ATOM   5007 C  CB    . VAL A 1 608 ? 9.486   15.214  -9.708  1.00 60.63 ? 608  VAL A CB    1 
ATOM   5008 C  CG1   . VAL A 1 608 ? 8.084   14.619  -9.733  1.00 61.99 ? 608  VAL A CG1   1 
ATOM   5009 C  CG2   . VAL A 1 608 ? 10.024  15.277  -8.290  1.00 60.73 ? 608  VAL A CG2   1 
ATOM   5010 N  N     . CYS A 1 609 ? 12.759  14.678  -9.899  1.00 61.13 ? 609  CYS A N     1 
ATOM   5011 C  CA    . CYS A 1 609 ? 14.102  15.257  -9.873  1.00 61.79 ? 609  CYS A CA    1 
ATOM   5012 C  C     . CYS A 1 609 ? 15.034  14.691  -10.940 1.00 63.61 ? 609  CYS A C     1 
ATOM   5013 O  O     . CYS A 1 609 ? 16.033  15.312  -11.290 1.00 64.75 ? 609  CYS A O     1 
ATOM   5014 C  CB    . CYS A 1 609 ? 14.725  15.103  -8.489  1.00 60.41 ? 609  CYS A CB    1 
ATOM   5015 S  SG    . CYS A 1 609 ? 13.905  16.109  -7.241  1.00 57.88 ? 609  CYS A SG    1 
ATOM   5016 N  N     . GLY A 1 610 ? 14.699  13.516  -11.457 1.00 65.14 ? 610  GLY A N     1 
ATOM   5017 C  CA    . GLY A 1 610 ? 15.521  12.870  -12.467 1.00 67.63 ? 610  GLY A CA    1 
ATOM   5018 C  C     . GLY A 1 610 ? 16.733  12.180  -11.876 1.00 69.29 ? 610  GLY A C     1 
ATOM   5019 O  O     . GLY A 1 610 ? 17.735  11.984  -12.569 1.00 70.82 ? 610  GLY A O     1 
ATOM   5020 N  N     . THR A 1 611 ? 16.647  11.824  -10.594 1.00 68.17 ? 611  THR A N     1 
ATOM   5021 C  CA    . THR A 1 611 ? 17.694  11.048  -9.925  1.00 69.05 ? 611  THR A CA    1 
ATOM   5022 C  C     . THR A 1 611 ? 17.282  9.582   -9.788  1.00 70.07 ? 611  THR A C     1 
ATOM   5023 O  O     . THR A 1 611 ? 16.181  9.198   -10.203 1.00 69.45 ? 611  THR A O     1 
ATOM   5024 C  CB    . THR A 1 611 ? 18.050  11.626  -8.536  1.00 69.41 ? 611  THR A CB    1 
ATOM   5025 O  OG1   . THR A 1 611 ? 16.850  11.916  -7.805  1.00 67.47 ? 611  THR A OG1   1 
ATOM   5026 C  CG2   . THR A 1 611 ? 18.882  12.892  -8.680  1.00 69.99 ? 611  THR A CG2   1 
ATOM   5027 N  N     . GLU A 1 612 ? 18.166  8.768   -9.211  1.00 70.88 ? 612  GLU A N     1 
ATOM   5028 C  CA    . GLU A 1 612 ? 17.906  7.338   -9.033  1.00 72.16 ? 612  GLU A CA    1 
ATOM   5029 C  C     . GLU A 1 612 ? 18.496  6.802   -7.726  1.00 70.59 ? 612  GLU A C     1 
ATOM   5030 O  O     . GLU A 1 612 ? 19.673  7.022   -7.429  1.00 71.41 ? 612  GLU A O     1 
ATOM   5031 C  CB    . GLU A 1 612 ? 18.445  6.541   -10.228 1.00 74.89 ? 612  GLU A CB    1 
ATOM   5032 C  CG    . GLU A 1 612 ? 18.026  5.073   -10.243 1.00 78.30 ? 612  GLU A CG    1 
ATOM   5033 C  CD    . GLU A 1 612 ? 18.817  4.229   -11.234 1.00 82.92 ? 612  GLU A CD    1 
ATOM   5034 O  OE1   . GLU A 1 612 ? 19.830  4.720   -11.785 1.00 84.73 ? 612  GLU A OE1   1 
ATOM   5035 O  OE2   . GLU A 1 612 ? 18.423  3.064   -11.460 1.00 84.68 ? 612  GLU A OE2   1 
ATOM   5036 N  N     . GLY A 1 613 ? 17.662  6.105   -6.954  1.00 68.46 ? 613  GLY A N     1 
ATOM   5037 C  CA    . GLY A 1 613 ? 18.091  5.445   -5.719  1.00 66.07 ? 613  GLY A CA    1 
ATOM   5038 C  C     . GLY A 1 613 ? 18.526  6.374   -4.597  1.00 64.75 ? 613  GLY A C     1 
ATOM   5039 O  O     . GLY A 1 613 ? 19.231  5.951   -3.674  1.00 64.95 ? 613  GLY A O     1 
ATOM   5040 N  N     . GLU A 1 614 ? 18.107  7.636   -4.673  1.00 61.88 ? 614  GLU A N     1 
ATOM   5041 C  CA    . GLU A 1 614 ? 18.404  8.609   -3.629  1.00 59.76 ? 614  GLU A CA    1 
ATOM   5042 C  C     . GLU A 1 614 ? 17.299  8.680   -2.568  1.00 54.98 ? 614  GLU A C     1 
ATOM   5043 O  O     . GLU A 1 614 ? 16.115  8.572   -2.887  1.00 53.69 ? 614  GLU A O     1 
ATOM   5044 C  CB    . GLU A 1 614 ? 18.632  9.986   -4.238  1.00 61.86 ? 614  GLU A CB    1 
ATOM   5045 C  CG    . GLU A 1 614 ? 19.570  10.841  -3.413  1.00 66.21 ? 614  GLU A CG    1 
ATOM   5046 C  CD    . GLU A 1 614 ? 19.395  12.312  -3.685  1.00 69.74 ? 614  GLU A CD    1 
ATOM   5047 O  OE1   . GLU A 1 614 ? 19.703  12.747  -4.816  1.00 69.86 ? 614  GLU A OE1   1 
ATOM   5048 O  OE2   . GLU A 1 614 ? 18.954  13.032  -2.761  1.00 69.53 ? 614  GLU A OE2   1 
ATOM   5049 N  N     . ALA A 1 615 ? 17.700  8.869   -1.313  1.00 52.20 ? 615  ALA A N     1 
ATOM   5050 C  CA    . ALA A 1 615 ? 16.771  8.907   -0.178  1.00 50.02 ? 615  ALA A CA    1 
ATOM   5051 C  C     . ALA A 1 615 ? 16.244  10.313  0.119   1.00 47.45 ? 615  ALA A C     1 
ATOM   5052 O  O     . ALA A 1 615 ? 16.968  11.151  0.650   1.00 50.82 ? 615  ALA A O     1 
ATOM   5053 C  CB    . ALA A 1 615 ? 17.429  8.307   1.070   1.00 48.09 ? 615  ALA A CB    1 
ATOM   5054 N  N     . PHE A 1 616 ? 14.978  10.554  -0.212  1.00 43.50 ? 616  PHE A N     1 
ATOM   5055 C  CA    . PHE A 1 616 ? 14.306  11.829  0.069   1.00 37.60 ? 616  PHE A CA    1 
ATOM   5056 C  C     . PHE A 1 616 ? 13.659  11.832  1.448   1.00 35.67 ? 616  PHE A C     1 
ATOM   5057 O  O     . PHE A 1 616 ? 13.671  12.861  2.153   1.00 32.71 ? 616  PHE A O     1 
ATOM   5058 C  CB    . PHE A 1 616 ? 13.246  12.127  -0.996  1.00 37.71 ? 616  PHE A CB    1 
ATOM   5059 C  CG    . PHE A 1 616 ? 13.819  12.565  -2.326  1.00 38.94 ? 616  PHE A CG    1 
ATOM   5060 C  CD1   . PHE A 1 616 ? 13.934  13.922  -2.636  1.00 40.44 ? 616  PHE A CD1   1 
ATOM   5061 C  CD2   . PHE A 1 616 ? 14.249  11.624  -3.262  1.00 36.48 ? 616  PHE A CD2   1 
ATOM   5062 C  CE1   . PHE A 1 616 ? 14.472  14.341  -3.863  1.00 39.44 ? 616  PHE A CE1   1 
ATOM   5063 C  CE2   . PHE A 1 616 ? 14.790  12.027  -4.495  1.00 43.97 ? 616  PHE A CE2   1 
ATOM   5064 C  CZ    . PHE A 1 616 ? 14.898  13.390  -4.796  1.00 40.55 ? 616  PHE A CZ    1 
ATOM   5065 N  N     . VAL A 1 617 ? 13.076  10.692  1.818   1.00 32.09 ? 617  VAL A N     1 
ATOM   5066 C  CA    . VAL A 1 617 ? 12.528  10.511  3.164   1.00 31.64 ? 617  VAL A CA    1 
ATOM   5067 C  C     . VAL A 1 617 ? 13.708  10.231  4.088   1.00 31.00 ? 617  VAL A C     1 
ATOM   5068 O  O     . VAL A 1 617 ? 14.427  9.242   3.913   1.00 32.37 ? 617  VAL A O     1 
ATOM   5069 C  CB    . VAL A 1 617 ? 11.490  9.350   3.238   1.00 31.07 ? 617  VAL A CB    1 
ATOM   5070 C  CG1   . VAL A 1 617 ? 11.037  9.118   4.676   1.00 28.07 ? 617  VAL A CG1   1 
ATOM   5071 C  CG2   . VAL A 1 617 ? 10.289  9.636   2.350   1.00 27.56 ? 617  VAL A CG2   1 
ATOM   5072 N  N     . LEU A 1 618 ? 13.919  11.115  5.054   1.00 29.39 ? 618  LEU A N     1 
ATOM   5073 C  CA    . LEU A 1 618 ? 15.084  11.022  5.930   1.00 29.47 ? 618  LEU A CA    1 
ATOM   5074 C  C     . LEU A 1 618 ? 14.740  10.335  7.248   1.00 28.47 ? 618  LEU A C     1 
ATOM   5075 O  O     . LEU A 1 618 ? 15.626  9.861   7.971   1.00 28.49 ? 618  LEU A O     1 
ATOM   5076 C  CB    . LEU A 1 618 ? 15.653  12.417  6.212   1.00 30.42 ? 618  LEU A CB    1 
ATOM   5077 C  CG    . LEU A 1 618 ? 14.725  13.408  6.934   1.00 30.04 ? 618  LEU A CG    1 
ATOM   5078 C  CD1   . LEU A 1 618 ? 15.335  13.859  8.228   1.00 26.91 ? 618  LEU A CD1   1 
ATOM   5079 C  CD2   . LEU A 1 618 ? 14.384  14.603  6.048   1.00 34.33 ? 618  LEU A CD2   1 
ATOM   5080 N  N     . TYR A 1 619 ? 13.449  10.300  7.561   1.00 27.49 ? 619  TYR A N     1 
ATOM   5081 C  CA    . TYR A 1 619 ? 12.985  9.841   8.860   1.00 25.83 ? 619  TYR A CA    1 
ATOM   5082 C  C     . TYR A 1 619 ? 11.502  9.560   8.849   1.00 26.40 ? 619  TYR A C     1 
ATOM   5083 O  O     . TYR A 1 619 ? 10.742  10.121  8.053   1.00 28.04 ? 619  TYR A O     1 
ATOM   5084 C  CB    . TYR A 1 619 ? 13.309  10.888  9.936   1.00 26.46 ? 619  TYR A CB    1 
ATOM   5085 C  CG    . TYR A 1 619 ? 12.931  10.485  11.349  1.00 26.19 ? 619  TYR A CG    1 
ATOM   5086 C  CD1   . TYR A 1 619 ? 11.961  11.188  12.062  1.00 23.54 ? 619  TYR A CD1   1 
ATOM   5087 C  CD2   . TYR A 1 619 ? 13.549  9.399   11.970  1.00 27.78 ? 619  TYR A CD2   1 
ATOM   5088 C  CE1   . TYR A 1 619 ? 11.616  10.817  13.375  1.00 25.48 ? 619  TYR A CE1   1 
ATOM   5089 C  CE2   . TYR A 1 619 ? 13.211  9.019   13.259  1.00 22.00 ? 619  TYR A CE2   1 
ATOM   5090 C  CZ    . TYR A 1 619 ? 12.256  9.727   13.959  1.00 22.30 ? 619  TYR A CZ    1 
ATOM   5091 O  OH    . TYR A 1 619 ? 11.946  9.329   15.238  1.00 25.59 ? 619  TYR A OH    1 
ATOM   5092 N  N     . GLY A 1 620 ? 11.098  8.681   9.751   1.00 26.06 ? 620  GLY A N     1 
ATOM   5093 C  CA    . GLY A 1 620 ? 9.709   8.412   10.003  1.00 26.39 ? 620  GLY A CA    1 
ATOM   5094 C  C     . GLY A 1 620 ? 9.582   7.706   11.330  1.00 27.12 ? 620  GLY A C     1 
ATOM   5095 O  O     . GLY A 1 620 ? 10.519  7.040   11.784  1.00 28.77 ? 620  GLY A O     1 
ATOM   5096 N  N     . ASP A 1 621 ? 8.416   7.850   11.945  1.00 24.91 ? 621  ASP A N     1 
ATOM   5097 C  CA    . ASP A 1 621 ? 8.135   7.230   13.222  1.00 24.98 ? 621  ASP A CA    1 
ATOM   5098 C  C     . ASP A 1 621 ? 6.648   6.930   13.310  1.00 24.86 ? 621  ASP A C     1 
ATOM   5099 O  O     . ASP A 1 621 ? 5.833   7.853   13.400  1.00 25.43 ? 621  ASP A O     1 
ATOM   5100 C  CB    . ASP A 1 621 ? 8.541   8.174   14.357  1.00 24.31 ? 621  ASP A CB    1 
ATOM   5101 C  CG    . ASP A 1 621 ? 8.313   7.576   15.739  1.00 25.71 ? 621  ASP A CG    1 
ATOM   5102 O  OD1   . ASP A 1 621 ? 7.550   6.593   15.857  1.00 24.06 ? 621  ASP A OD1   1 
ATOM   5103 O  OD2   . ASP A 1 621 ? 8.887   8.114   16.717  1.00 25.19 ? 621  ASP A OD2   1 
ATOM   5104 N  N     . THR A 1 622 ? 6.317   5.640   13.318  1.00 24.99 ? 622  THR A N     1 
ATOM   5105 C  CA    . THR A 1 622 ? 4.933   5.142   13.452  1.00 24.84 ? 622  THR A CA    1 
ATOM   5106 C  C     . THR A 1 622 ? 4.056   5.407   12.222  1.00 24.34 ? 622  THR A C     1 
ATOM   5107 O  O     . THR A 1 622 ? 3.609   4.457   11.574  1.00 26.75 ? 622  THR A O     1 
ATOM   5108 C  CB    . THR A 1 622 ? 4.218   5.636   14.738  1.00 23.42 ? 622  THR A CB    1 
ATOM   5109 O  OG1   . THR A 1 622 ? 5.054   5.415   15.880  1.00 24.53 ? 622  THR A OG1   1 
ATOM   5110 C  CG2   . THR A 1 622 ? 2.896   4.894   14.937  1.00 20.98 ? 622  THR A CG2   1 
ATOM   5111 N  N     . ASP A 1 623 ? 3.819   6.681   11.904  1.00 24.37 ? 623  ASP A N     1 
ATOM   5112 C  CA    . ASP A 1 623 ? 2.906   7.054   10.816  1.00 25.25 ? 623  ASP A CA    1 
ATOM   5113 C  C     . ASP A 1 623 ? 3.290   8.365   10.143  1.00 25.23 ? 623  ASP A C     1 
ATOM   5114 O  O     . ASP A 1 623 ? 2.449   9.008   9.523   1.00 25.78 ? 623  ASP A O     1 
ATOM   5115 C  CB    . ASP A 1 623 ? 1.456   7.144   11.326  1.00 24.47 ? 623  ASP A CB    1 
ATOM   5116 C  CG    . ASP A 1 623 ? 1.213   8.371   12.191  1.00 25.57 ? 623  ASP A CG    1 
ATOM   5117 O  OD1   . ASP A 1 623 ? 0.070   8.887   12.242  1.00 26.17 ? 623  ASP A OD1   1 
ATOM   5118 O  OD2   . ASP A 1 623 ? 2.170   8.844   12.822  1.00 27.96 ? 623  ASP A OD2   1 
ATOM   5119 N  N     . SER A 1 624 ? 4.556   8.757   10.261  1.00 26.30 ? 624  SER A N     1 
ATOM   5120 C  CA    . SER A 1 624 ? 5.027   10.000  9.663   1.00 26.11 ? 624  SER A CA    1 
ATOM   5121 C  C     . SER A 1 624 ? 6.226   9.793   8.749   1.00 29.26 ? 624  SER A C     1 
ATOM   5122 O  O     . SER A 1 624 ? 6.990   8.830   8.908   1.00 28.47 ? 624  SER A O     1 
ATOM   5123 C  CB    . SER A 1 624 ? 5.427   10.980  10.755  1.00 28.33 ? 624  SER A CB    1 
ATOM   5124 O  OG    . SER A 1 624 ? 6.556   10.482  11.445  1.00 27.58 ? 624  SER A OG    1 
ATOM   5125 N  N     . ILE A 1 625 ? 6.384   10.707  7.794   1.00 26.22 ? 625  ILE A N     1 
ATOM   5126 C  CA    . ILE A 1 625 ? 7.610   10.801  7.024   1.00 26.62 ? 625  ILE A CA    1 
ATOM   5127 C  C     . ILE A 1 625 ? 8.117   12.230  7.022   1.00 27.42 ? 625  ILE A C     1 
ATOM   5128 O  O     . ILE A 1 625 ? 7.329   13.184  7.031   1.00 26.62 ? 625  ILE A O     1 
ATOM   5129 C  CB    . ILE A 1 625 ? 7.456   10.304  5.555   1.00 26.41 ? 625  ILE A CB    1 
ATOM   5130 C  CG1   . ILE A 1 625 ? 6.283   10.996  4.851   1.00 25.35 ? 625  ILE A CG1   1 
ATOM   5131 C  CG2   . ILE A 1 625 ? 7.333   8.776   5.510   1.00 25.81 ? 625  ILE A CG2   1 
ATOM   5132 C  CD1   . ILE A 1 625 ? 6.307   10.881  3.326   1.00 28.75 ? 625  ILE A CD1   1 
ATOM   5133 N  N     . TYR A 1 626 ? 9.440   12.358  7.014   1.00 27.34 ? 626  TYR A N     1 
ATOM   5134 C  CA    . TYR A 1 626 ? 10.097  13.642  6.907   1.00 27.01 ? 626  TYR A CA    1 
ATOM   5135 C  C     . TYR A 1 626 ? 10.888  13.665  5.621   1.00 29.67 ? 626  TYR A C     1 
ATOM   5136 O  O     . TYR A 1 626 ? 11.776  12.846  5.401   1.00 30.14 ? 626  TYR A O     1 
ATOM   5137 C  CB    . TYR A 1 626 ? 10.957  13.911  8.144   1.00 27.53 ? 626  TYR A CB    1 
ATOM   5138 C  CG    . TYR A 1 626 ? 10.094  14.153  9.364   1.00 28.12 ? 626  TYR A CG    1 
ATOM   5139 C  CD1   . TYR A 1 626 ? 9.486   13.083  10.029  1.00 26.17 ? 626  TYR A CD1   1 
ATOM   5140 C  CD2   . TYR A 1 626 ? 9.848   15.450  9.827   1.00 27.94 ? 626  TYR A CD2   1 
ATOM   5141 C  CE1   . TYR A 1 626 ? 8.662   13.292  11.118  1.00 27.04 ? 626  TYR A CE1   1 
ATOM   5142 C  CE2   . TYR A 1 626 ? 9.029   15.671  10.930  1.00 28.46 ? 626  TYR A CE2   1 
ATOM   5143 C  CZ    . TYR A 1 626 ? 8.436   14.584  11.563  1.00 29.46 ? 626  TYR A CZ    1 
ATOM   5144 O  OH    . TYR A 1 626 ? 7.622   14.776  12.650  1.00 30.66 ? 626  TYR A OH    1 
ATOM   5145 N  N     . VAL A 1 627 ? 10.523  14.606  4.760   1.00 31.60 ? 627  VAL A N     1 
ATOM   5146 C  CA    . VAL A 1 627 ? 11.019  14.657  3.398   1.00 32.13 ? 627  VAL A CA    1 
ATOM   5147 C  C     . VAL A 1 627 ? 11.944  15.847  3.230   1.00 33.99 ? 627  VAL A C     1 
ATOM   5148 O  O     . VAL A 1 627 ? 11.559  16.986  3.491   1.00 33.69 ? 627  VAL A O     1 
ATOM   5149 C  CB    . VAL A 1 627 ? 9.846   14.747  2.395   1.00 33.10 ? 627  VAL A CB    1 
ATOM   5150 C  CG1   . VAL A 1 627 ? 10.351  14.862  0.956   1.00 34.48 ? 627  VAL A CG1   1 
ATOM   5151 C  CG2   . VAL A 1 627 ? 8.925   13.539  2.555   1.00 32.66 ? 627  VAL A CG2   1 
ATOM   5152 N  N     . SER A 1 628 ? 13.168  15.558  2.797   1.00 34.13 ? 628  SER A N     1 
ATOM   5153 C  CA    . SER A 1 628 ? 14.143  16.575  2.450   1.00 33.96 ? 628  SER A CA    1 
ATOM   5154 C  C     . SER A 1 628 ? 13.695  17.262  1.170   1.00 32.67 ? 628  SER A C     1 
ATOM   5155 O  O     . SER A 1 628 ? 13.451  16.596  0.166   1.00 32.51 ? 628  SER A O     1 
ATOM   5156 C  CB    . SER A 1 628 ? 15.517  15.924  2.251   1.00 34.66 ? 628  SER A CB    1 
ATOM   5157 O  OG    . SER A 1 628 ? 16.473  16.881  1.856   1.00 38.06 ? 628  SER A OG    1 
ATOM   5158 N  N     . ALA A 1 629 ? 13.575  18.588  1.218   1.00 33.92 ? 629  ALA A N     1 
ATOM   5159 C  CA    . ALA A 1 629 ? 13.133  19.385  0.066   1.00 34.28 ? 629  ALA A CA    1 
ATOM   5160 C  C     . ALA A 1 629 ? 14.210  20.326  -0.492  1.00 36.05 ? 629  ALA A C     1 
ATOM   5161 O  O     . ALA A 1 629 ? 13.903  21.226  -1.275  1.00 34.86 ? 629  ALA A O     1 
ATOM   5162 C  CB    . ALA A 1 629 ? 11.878  20.170  0.420   1.00 34.63 ? 629  ALA A CB    1 
ATOM   5163 N  N     . ASP A 1 630 ? 15.466  20.118  -0.097  1.00 36.70 ? 630  ASP A N     1 
ATOM   5164 C  CA    . ASP A 1 630 ? 16.581  20.900  -0.631  1.00 37.66 ? 630  ASP A CA    1 
ATOM   5165 C  C     . ASP A 1 630 ? 16.544  20.916  -2.149  1.00 40.37 ? 630  ASP A C     1 
ATOM   5166 O  O     . ASP A 1 630 ? 16.697  21.972  -2.770  1.00 40.35 ? 630  ASP A O     1 
ATOM   5167 C  CB    . ASP A 1 630 ? 17.916  20.310  -0.190  1.00 37.92 ? 630  ASP A CB    1 
ATOM   5168 C  CG    . ASP A 1 630 ? 18.138  20.408  1.298   1.00 39.24 ? 630  ASP A CG    1 
ATOM   5169 O  OD1   . ASP A 1 630 ? 17.212  20.825  2.033   1.00 37.57 ? 630  ASP A OD1   1 
ATOM   5170 O  OD2   . ASP A 1 630 ? 19.254  20.060  1.727   1.00 40.40 ? 630  ASP A OD2   1 
ATOM   5171 N  N     . LYS A 1 631 ? 16.328  19.738  -2.734  1.00 40.99 ? 631  LYS A N     1 
ATOM   5172 C  CA    . LYS A 1 631 ? 16.392  19.568  -4.186  1.00 43.97 ? 631  LYS A CA    1 
ATOM   5173 C  C     . LYS A 1 631 ? 15.240  20.252  -4.911  1.00 44.34 ? 631  LYS A C     1 
ATOM   5174 O  O     . LYS A 1 631 ? 15.404  20.722  -6.041  1.00 46.75 ? 631  LYS A O     1 
ATOM   5175 C  CB    . LYS A 1 631 ? 16.458  18.089  -4.554  1.00 44.17 ? 631  LYS A CB    1 
ATOM   5176 C  CG    . LYS A 1 631 ? 17.764  17.450  -4.145  1.00 48.95 ? 631  LYS A CG    1 
ATOM   5177 C  CD    . LYS A 1 631 ? 17.978  16.101  -4.797  1.00 51.59 ? 631  LYS A CD    1 
ATOM   5178 C  CE    . LYS A 1 631 ? 19.454  15.749  -4.767  1.00 55.68 ? 631  LYS A CE    1 
ATOM   5179 N  NZ    . LYS A 1 631 ? 19.943  15.631  -3.360  1.00 57.45 ? 631  LYS A NZ    1 
ATOM   5180 N  N     . ILE A 1 632 ? 14.081  20.286  -4.259  1.00 42.58 ? 632  ILE A N     1 
ATOM   5181 C  CA    . ILE A 1 632 ? 12.906  20.967  -4.796  1.00 42.40 ? 632  ILE A CA    1 
ATOM   5182 C  C     . ILE A 1 632 ? 13.176  22.465  -4.809  1.00 40.93 ? 632  ILE A C     1 
ATOM   5183 O  O     . ILE A 1 632 ? 12.945  23.121  -5.811  1.00 41.48 ? 632  ILE A O     1 
ATOM   5184 C  CB    . ILE A 1 632 ? 11.624  20.663  -3.972  1.00 40.79 ? 632  ILE A CB    1 
ATOM   5185 C  CG1   . ILE A 1 632 ? 11.485  19.161  -3.681  1.00 42.05 ? 632  ILE A CG1   1 
ATOM   5186 C  CG2   . ILE A 1 632 ? 10.370  21.214  -4.671  1.00 40.76 ? 632  ILE A CG2   1 
ATOM   5187 C  CD1   . ILE A 1 632 ? 11.388  18.275  -4.909  1.00 47.09 ? 632  ILE A CD1   1 
ATOM   5188 N  N     . ILE A 1 633 ? 13.684  22.984  -3.693  1.00 40.93 ? 633  ILE A N     1 
ATOM   5189 C  CA    . ILE A 1 633 ? 14.047  24.393  -3.578  1.00 40.52 ? 633  ILE A CA    1 
ATOM   5190 C  C     . ILE A 1 633 ? 15.127  24.787  -4.591  1.00 43.04 ? 633  ILE A C     1 
ATOM   5191 O  O     . ILE A 1 633 ? 14.987  25.804  -5.269  1.00 41.79 ? 633  ILE A O     1 
ATOM   5192 C  CB    . ILE A 1 633 ? 14.496  24.760  -2.132  1.00 38.32 ? 633  ILE A CB    1 
ATOM   5193 C  CG1   . ILE A 1 633 ? 13.303  24.759  -1.161  1.00 37.36 ? 633  ILE A CG1   1 
ATOM   5194 C  CG2   . ILE A 1 633 ? 15.250  26.102  -2.099  1.00 38.91 ? 633  ILE A CG2   1 
ATOM   5195 C  CD1   . ILE A 1 633 ? 12.158  25.696  -1.534  1.00 36.88 ? 633  ILE A CD1   1 
ATOM   5196 N  N     . ASP A 1 634 ? 16.185  23.978  -4.687  1.00 44.12 ? 634  ASP A N     1 
ATOM   5197 C  CA    . ASP A 1 634 ? 17.322  24.268  -5.567  1.00 47.98 ? 634  ASP A CA    1 
ATOM   5198 C  C     . ASP A 1 634 ? 16.960  24.283  -7.047  1.00 49.72 ? 634  ASP A C     1 
ATOM   5199 O  O     . ASP A 1 634 ? 17.625  24.948  -7.846  1.00 49.80 ? 634  ASP A O     1 
ATOM   5200 C  CB    . ASP A 1 634 ? 18.468  23.276  -5.331  1.00 49.73 ? 634  ASP A CB    1 
ATOM   5201 C  CG    . ASP A 1 634 ? 19.201  23.524  -4.029  1.00 49.23 ? 634  ASP A CG    1 
ATOM   5202 O  OD1   . ASP A 1 634 ? 18.907  24.526  -3.347  1.00 46.81 ? 634  ASP A OD1   1 
ATOM   5203 O  OD2   . ASP A 1 634 ? 20.077  22.704  -3.684  1.00 54.11 ? 634  ASP A OD2   1 
ATOM   5204 N  N     . LYS A 1 635 ? 15.910  23.544  -7.402  1.00 49.53 ? 635  LYS A N     1 
ATOM   5205 C  CA    . LYS A 1 635 ? 15.459  23.452  -8.787  1.00 50.94 ? 635  LYS A CA    1 
ATOM   5206 C  C     . LYS A 1 635 ? 14.930  24.773  -9.332  1.00 50.54 ? 635  LYS A C     1 
ATOM   5207 O  O     . LYS A 1 635 ? 14.986  25.013  -10.534 1.00 49.25 ? 635  LYS A O     1 
ATOM   5208 C  CB    . LYS A 1 635 ? 14.423  22.343  -8.944  1.00 51.30 ? 635  LYS A CB    1 
ATOM   5209 C  CG    . LYS A 1 635 ? 14.990  21.113  -9.614  1.00 57.49 ? 635  LYS A CG    1 
ATOM   5210 C  CD    . LYS A 1 635 ? 14.310  19.837  -9.146  1.00 58.87 ? 635  LYS A CD    1 
ATOM   5211 C  CE    . LYS A 1 635 ? 14.687  18.657  -10.032 1.00 64.00 ? 635  LYS A CE    1 
ATOM   5212 N  NZ    . LYS A 1 635 ? 16.162  18.412  -10.158 1.00 66.06 ? 635  LYS A NZ    1 
ATOM   5213 N  N     . VAL A 1 636 ? 14.420  25.628  -8.451  1.00 50.31 ? 636  VAL A N     1 
ATOM   5214 C  CA    . VAL A 1 636 ? 14.051  26.976  -8.868  1.00 50.80 ? 636  VAL A CA    1 
ATOM   5215 C  C     . VAL A 1 636 ? 15.170  27.951  -8.494  1.00 51.92 ? 636  VAL A C     1 
ATOM   5216 O  O     . VAL A 1 636 ? 15.370  28.962  -9.171  1.00 52.97 ? 636  VAL A O     1 
ATOM   5217 C  CB    . VAL A 1 636 ? 12.639  27.427  -8.352  1.00 48.96 ? 636  VAL A CB    1 
ATOM   5218 C  CG1   . VAL A 1 636 ? 11.749  26.229  -8.037  1.00 44.57 ? 636  VAL A CG1   1 
ATOM   5219 C  CG2   . VAL A 1 636 ? 12.740  28.366  -7.180  1.00 46.32 ? 636  VAL A CG2   1 
ATOM   5220 N  N     . GLY A 1 637 ? 15.908  27.615  -7.434  1.00 51.48 ? 637  GLY A N     1 
ATOM   5221 C  CA    . GLY A 1 637 ? 17.023  28.421  -6.951  1.00 52.92 ? 637  GLY A CA    1 
ATOM   5222 C  C     . GLY A 1 637 ? 16.575  29.461  -5.944  1.00 53.87 ? 637  GLY A C     1 
ATOM   5223 O  O     . GLY A 1 637 ? 15.597  30.173  -6.183  1.00 54.12 ? 637  GLY A O     1 
ATOM   5224 N  N     . GLU A 1 638 ? 17.299  29.550  -4.826  1.00 53.97 ? 638  GLU A N     1 
ATOM   5225 C  CA    . GLU A 1 638 ? 16.990  30.489  -3.739  1.00 55.30 ? 638  GLU A CA    1 
ATOM   5226 C  C     . GLU A 1 638 ? 16.891  31.958  -4.178  1.00 56.11 ? 638  GLU A C     1 
ATOM   5227 O  O     . GLU A 1 638 ? 16.179  32.745  -3.549  1.00 56.15 ? 638  GLU A O     1 
ATOM   5228 C  CB    . GLU A 1 638 ? 18.003  30.345  -2.592  1.00 56.26 ? 638  GLU A CB    1 
ATOM   5229 C  CG    . GLU A 1 638 ? 17.702  29.211  -1.590  1.00 58.50 ? 638  GLU A CG    1 
ATOM   5230 C  CD    . GLU A 1 638 ? 18.869  28.909  -0.643  1.00 61.50 ? 638  GLU A CD    1 
ATOM   5231 O  OE1   . GLU A 1 638 ? 18.623  28.476  0.504   1.00 58.28 ? 638  GLU A OE1   1 
ATOM   5232 O  OE2   . GLU A 1 638 ? 20.038  29.095  -1.046  1.00 65.75 ? 638  GLU A OE2   1 
ATOM   5233 N  N     . SER A 1 639 ? 17.593  32.313  -5.255  1.00 57.24 ? 639  SER A N     1 
ATOM   5234 C  CA    . SER A 1 639 ? 17.595  33.680  -5.800  1.00 58.98 ? 639  SER A CA    1 
ATOM   5235 C  C     . SER A 1 639 ? 16.251  34.134  -6.364  1.00 57.98 ? 639  SER A C     1 
ATOM   5236 O  O     . SER A 1 639 ? 15.992  35.333  -6.454  1.00 59.15 ? 639  SER A O     1 
ATOM   5237 C  CB    . SER A 1 639 ? 18.661  33.820  -6.890  1.00 61.11 ? 639  SER A CB    1 
ATOM   5238 O  OG    . SER A 1 639 ? 19.959  33.695  -6.343  1.00 64.10 ? 639  SER A OG    1 
ATOM   5239 N  N     . LYS A 1 640 ? 15.415  33.178  -6.760  1.00 56.44 ? 640  LYS A N     1 
ATOM   5240 C  CA    . LYS A 1 640 ? 14.099  33.473  -7.325  1.00 55.97 ? 640  LYS A CA    1 
ATOM   5241 C  C     . LYS A 1 640 ? 13.069  33.940  -6.297  1.00 54.50 ? 640  LYS A C     1 
ATOM   5242 O  O     . LYS A 1 640 ? 12.059  34.546  -6.670  1.00 54.99 ? 640  LYS A O     1 
ATOM   5243 C  CB    . LYS A 1 640 ? 13.552  32.262  -8.093  1.00 56.93 ? 640  LYS A CB    1 
ATOM   5244 C  CG    . LYS A 1 640 ? 13.636  32.379  -9.613  1.00 62.60 ? 640  LYS A CG    1 
ATOM   5245 C  CD    . LYS A 1 640 ? 15.054  32.207  -10.140 1.00 65.22 ? 640  LYS A CD    1 
ATOM   5246 C  CE    . LYS A 1 640 ? 15.189  32.808  -11.531 1.00 69.18 ? 640  LYS A CE    1 
ATOM   5247 N  NZ    . LYS A 1 640 ? 16.457  32.405  -12.193 1.00 69.85 ? 640  LYS A NZ    1 
ATOM   5248 N  N     . PHE A 1 641 ? 13.318  33.666  -5.014  1.00 50.44 ? 641  PHE A N     1 
ATOM   5249 C  CA    . PHE A 1 641 ? 12.333  33.962  -3.967  1.00 47.93 ? 641  PHE A CA    1 
ATOM   5250 C  C     . PHE A 1 641 ? 12.413  35.365  -3.396  1.00 47.22 ? 641  PHE A C     1 
ATOM   5251 O  O     . PHE A 1 641 ? 13.480  35.829  -2.994  1.00 46.93 ? 641  PHE A O     1 
ATOM   5252 C  CB    . PHE A 1 641 ? 12.381  32.919  -2.842  1.00 45.21 ? 641  PHE A CB    1 
ATOM   5253 C  CG    . PHE A 1 641 ? 12.033  31.532  -3.298  1.00 44.98 ? 641  PHE A CG    1 
ATOM   5254 C  CD1   . PHE A 1 641 ? 13.006  30.534  -3.332  1.00 41.89 ? 641  PHE A CD1   1 
ATOM   5255 C  CD2   . PHE A 1 641 ? 10.740  31.231  -3.731  1.00 42.34 ? 641  PHE A CD2   1 
ATOM   5256 C  CE1   . PHE A 1 641 ? 12.695  29.252  -3.766  1.00 44.18 ? 641  PHE A CE1   1 
ATOM   5257 C  CE2   . PHE A 1 641 ? 10.414  29.951  -4.169  1.00 43.14 ? 641  PHE A CE2   1 
ATOM   5258 C  CZ    . PHE A 1 641 ? 11.391  28.954  -4.183  1.00 42.93 ? 641  PHE A CZ    1 
ATOM   5259 N  N     . ARG A 1 642 ? 11.260  36.028  -3.373  1.00 47.98 ? 642  ARG A N     1 
ATOM   5260 C  CA    . ARG A 1 642 ? 11.119  37.360  -2.794  1.00 49.75 ? 642  ARG A CA    1 
ATOM   5261 C  C     . ARG A 1 642 ? 11.492  37.377  -1.312  1.00 46.84 ? 642  ARG A C     1 
ATOM   5262 O  O     . ARG A 1 642 ? 12.313  38.190  -0.878  1.00 47.12 ? 642  ARG A O     1 
ATOM   5263 C  CB    . ARG A 1 642 ? 9.686   37.864  -2.984  1.00 51.60 ? 642  ARG A CB    1 
ATOM   5264 C  CG    . ARG A 1 642 ? 9.390   38.366  -4.395  1.00 57.78 ? 642  ARG A CG    1 
ATOM   5265 C  CD    . ARG A 1 642 ? 7.946   38.830  -4.549  1.00 61.69 ? 642  ARG A CD    1 
ATOM   5266 N  NE    . ARG A 1 642 ? 7.033   37.731  -4.863  1.00 64.55 ? 642  ARG A NE    1 
ATOM   5267 C  CZ    . ARG A 1 642 ? 6.275   37.099  -3.972  1.00 64.80 ? 642  ARG A CZ    1 
ATOM   5268 N  NH1   . ARG A 1 642 ? 6.311   37.446  -2.690  1.00 66.53 ? 642  ARG A NH1   1 
ATOM   5269 N  NH2   . ARG A 1 642 ? 5.477   36.115  -4.363  1.00 63.40 ? 642  ARG A NH2   1 
ATOM   5270 N  N     . ASP A 1 643 ? 10.893  36.462  -0.553  1.00 43.75 ? 643  ASP A N     1 
ATOM   5271 C  CA    . ASP A 1 643 ? 11.124  36.344  0.881   1.00 41.03 ? 643  ASP A CA    1 
ATOM   5272 C  C     . ASP A 1 643 ? 10.821  34.913  1.343   1.00 40.36 ? 643  ASP A C     1 
ATOM   5273 O  O     . ASP A 1 643 ? 10.482  34.057  0.526   1.00 38.99 ? 643  ASP A O     1 
ATOM   5274 C  CB    . ASP A 1 643 ? 10.273  37.366  1.651   1.00 40.59 ? 643  ASP A CB    1 
ATOM   5275 C  CG    . ASP A 1 643 ? 8.846   37.465  1.122   1.00 41.32 ? 643  ASP A CG    1 
ATOM   5276 O  OD1   . ASP A 1 643 ? 8.256   36.427  0.740   1.00 37.24 ? 643  ASP A OD1   1 
ATOM   5277 O  OD2   . ASP A 1 643 ? 8.312   38.593  1.085   1.00 44.99 ? 643  ASP A OD2   1 
ATOM   5278 N  N     . THR A 1 644 ? 10.947  34.670  2.648   1.00 37.46 ? 644  THR A N     1 
ATOM   5279 C  CA    . THR A 1 644 ? 10.725  33.353  3.237   1.00 36.79 ? 644  THR A CA    1 
ATOM   5280 C  C     . THR A 1 644 ? 9.333   32.831  2.885   1.00 37.47 ? 644  THR A C     1 
ATOM   5281 O  O     . THR A 1 644 ? 9.193   31.716  2.383   1.00 36.59 ? 644  THR A O     1 
ATOM   5282 C  CB    . THR A 1 644 ? 10.904  33.398  4.774   1.00 36.43 ? 644  THR A CB    1 
ATOM   5283 O  OG1   . THR A 1 644 ? 12.291  33.576  5.091   1.00 36.24 ? 644  THR A OG1   1 
ATOM   5284 C  CG2   . THR A 1 644 ? 10.401  32.116  5.423   1.00 34.26 ? 644  THR A CG2   1 
ATOM   5285 N  N     . ASN A 1 645 ? 8.321   33.662  3.125   1.00 37.88 ? 645  ASN A N     1 
ATOM   5286 C  CA    . ASN A 1 645 ? 6.930   33.318  2.862   1.00 38.41 ? 645  ASN A CA    1 
ATOM   5287 C  C     . ASN A 1 645 ? 6.678   32.870  1.419   1.00 40.05 ? 645  ASN A C     1 
ATOM   5288 O  O     . ASN A 1 645 ? 5.742   32.108  1.149   1.00 39.51 ? 645  ASN A O     1 
ATOM   5289 C  CB    . ASN A 1 645 ? 6.025   34.494  3.231   1.00 39.56 ? 645  ASN A CB    1 
ATOM   5290 C  CG    . ASN A 1 645 ? 4.613   34.061  3.560   1.00 42.56 ? 645  ASN A CG    1 
ATOM   5291 O  OD1   . ASN A 1 645 ? 4.380   33.336  4.526   1.00 40.90 ? 645  ASN A OD1   1 
ATOM   5292 N  ND2   . ASN A 1 645 ? 3.658   34.511  2.758   1.00 43.94 ? 645  ASN A ND2   1 
ATOM   5293 N  N     . HIS A 1 646 ? 7.529   33.327  0.501   1.00 41.11 ? 646  HIS A N     1 
ATOM   5294 C  CA    . HIS A 1 646 ? 7.457   32.920  -0.905  1.00 40.49 ? 646  HIS A CA    1 
ATOM   5295 C  C     . HIS A 1 646 ? 7.793   31.430  -1.104  1.00 39.59 ? 646  HIS A C     1 
ATOM   5296 O  O     . HIS A 1 646 ? 6.978   30.682  -1.646  1.00 38.78 ? 646  HIS A O     1 
ATOM   5297 C  CB    . HIS A 1 646 ? 8.354   33.816  -1.762  1.00 43.02 ? 646  HIS A CB    1 
ATOM   5298 C  CG    . HIS A 1 646 ? 8.122   33.687  -3.234  1.00 43.03 ? 646  HIS A CG    1 
ATOM   5299 N  ND1   . HIS A 1 646 ? 9.021   34.155  -4.167  1.00 47.09 ? 646  HIS A ND1   1 
ATOM   5300 C  CD2   . HIS A 1 646 ? 7.101   33.142  -3.937  1.00 44.75 ? 646  HIS A CD2   1 
ATOM   5301 C  CE1   . HIS A 1 646 ? 8.564   33.908  -5.381  1.00 46.08 ? 646  HIS A CE1   1 
ATOM   5302 N  NE2   . HIS A 1 646 ? 7.401   33.291  -5.269  1.00 47.69 ? 646  HIS A NE2   1 
ATOM   5303 N  N     . TRP A 1 647 ? 8.971   30.992  -0.658  1.00 38.05 ? 647  TRP A N     1 
ATOM   5304 C  CA    . TRP A 1 647 ? 9.313   29.563  -0.757  1.00 37.48 ? 647  TRP A CA    1 
ATOM   5305 C  C     . TRP A 1 647 ? 8.424   28.663  0.103   1.00 35.14 ? 647  TRP A C     1 
ATOM   5306 O  O     . TRP A 1 647 ? 8.197   27.499  -0.241  1.00 34.97 ? 647  TRP A O     1 
ATOM   5307 C  CB    . TRP A 1 647 ? 10.811  29.279  -0.542  1.00 36.90 ? 647  TRP A CB    1 
ATOM   5308 C  CG    . TRP A 1 647 ? 11.380  29.466  0.864   1.00 36.36 ? 647  TRP A CG    1 
ATOM   5309 C  CD1   . TRP A 1 647 ? 12.145  30.515  1.301   1.00 34.77 ? 647  TRP A CD1   1 
ATOM   5310 C  CD2   . TRP A 1 647 ? 11.289  28.552  1.977   1.00 33.03 ? 647  TRP A CD2   1 
ATOM   5311 N  NE1   . TRP A 1 647 ? 12.516  30.322  2.613   1.00 35.57 ? 647  TRP A NE1   1 
ATOM   5312 C  CE2   . TRP A 1 647 ? 11.995  29.133  3.055   1.00 34.08 ? 647  TRP A CE2   1 
ATOM   5313 C  CE3   . TRP A 1 647 ? 10.666  27.313  2.172   1.00 31.30 ? 647  TRP A CE3   1 
ATOM   5314 C  CZ2   . TRP A 1 647 ? 12.092  28.518  4.306   1.00 31.89 ? 647  TRP A CZ2   1 
ATOM   5315 C  CZ3   . TRP A 1 647 ? 10.759  26.702  3.425   1.00 27.90 ? 647  TRP A CZ3   1 
ATOM   5316 C  CH2   . TRP A 1 647 ? 11.473  27.304  4.470   1.00 28.10 ? 647  TRP A CH2   1 
ATOM   5317 N  N     . VAL A 1 648 ? 7.903   29.204  1.202   1.00 35.24 ? 648  VAL A N     1 
ATOM   5318 C  CA    . VAL A 1 648 ? 6.942   28.466  2.022   1.00 35.01 ? 648  VAL A CA    1 
ATOM   5319 C  C     . VAL A 1 648 ? 5.670   28.169  1.212   1.00 36.68 ? 648  VAL A C     1 
ATOM   5320 O  O     . VAL A 1 648 ? 5.170   27.037  1.236   1.00 38.05 ? 648  VAL A O     1 
ATOM   5321 C  CB    . VAL A 1 648 ? 6.630   29.208  3.341   1.00 35.26 ? 648  VAL A CB    1 
ATOM   5322 C  CG1   . VAL A 1 648 ? 5.507   28.519  4.106   1.00 30.95 ? 648  VAL A CG1   1 
ATOM   5323 C  CG2   . VAL A 1 648 ? 7.886   29.293  4.211   1.00 34.17 ? 648  VAL A CG2   1 
ATOM   5324 N  N     . ASP A 1 649 ? 5.179   29.176  0.484   1.00 37.11 ? 649  ASP A N     1 
ATOM   5325 C  CA    . ASP A 1 649 ? 4.013   29.048  -0.411  1.00 39.17 ? 649  ASP A CA    1 
ATOM   5326 C  C     . ASP A 1 649 ? 4.247   28.019  -1.500  1.00 39.76 ? 649  ASP A C     1 
ATOM   5327 O  O     . ASP A 1 649 ? 3.374   27.197  -1.788  1.00 41.68 ? 649  ASP A O     1 
ATOM   5328 C  CB    . ASP A 1 649 ? 3.682   30.391  -1.096  1.00 41.67 ? 649  ASP A CB    1 
ATOM   5329 C  CG    . ASP A 1 649 ? 2.873   31.332  -0.221  1.00 42.52 ? 649  ASP A CG    1 
ATOM   5330 O  OD1   . ASP A 1 649 ? 2.289   30.905  0.800   1.00 42.61 ? 649  ASP A OD1   1 
ATOM   5331 O  OD2   . ASP A 1 649 ? 2.817   32.522  -0.572  1.00 48.49 ? 649  ASP A OD2   1 
ATOM   5332 N  N     . PHE A 1 650 ? 5.422   28.094  -2.118  1.00 39.72 ? 650  PHE A N     1 
ATOM   5333 C  CA    . PHE A 1 650 ? 5.826   27.163  -3.169  1.00 40.76 ? 650  PHE A CA    1 
ATOM   5334 C  C     . PHE A 1 650 ? 5.851   25.713  -2.667  1.00 40.59 ? 650  PHE A C     1 
ATOM   5335 O  O     . PHE A 1 650 ? 5.342   24.807  -3.340  1.00 41.74 ? 650  PHE A O     1 
ATOM   5336 C  CB    . PHE A 1 650 ? 7.183   27.580  -3.748  1.00 42.26 ? 650  PHE A CB    1 
ATOM   5337 C  CG    . PHE A 1 650 ? 7.814   26.547  -4.635  1.00 47.41 ? 650  PHE A CG    1 
ATOM   5338 C  CD1   . PHE A 1 650 ? 7.404   26.399  -5.954  1.00 50.46 ? 650  PHE A CD1   1 
ATOM   5339 C  CD2   . PHE A 1 650 ? 8.830   25.730  -4.154  1.00 49.41 ? 650  PHE A CD2   1 
ATOM   5340 C  CE1   . PHE A 1 650 ? 7.986   25.444  -6.778  1.00 53.47 ? 650  PHE A CE1   1 
ATOM   5341 C  CE2   . PHE A 1 650 ? 9.419   24.770  -4.972  1.00 52.00 ? 650  PHE A CE2   1 
ATOM   5342 C  CZ    . PHE A 1 650 ? 8.996   24.628  -6.284  1.00 53.07 ? 650  PHE A CZ    1 
ATOM   5343 N  N     . LEU A 1 651 ? 6.429   25.499  -1.485  1.00 38.88 ? 651  LEU A N     1 
ATOM   5344 C  CA    . LEU A 1 651 ? 6.458   24.165  -0.877  1.00 38.21 ? 651  LEU A CA    1 
ATOM   5345 C  C     . LEU A 1 651 ? 5.066   23.695  -0.464  1.00 37.65 ? 651  LEU A C     1 
ATOM   5346 O  O     . LEU A 1 651 ? 4.735   22.512  -0.598  1.00 37.45 ? 651  LEU A O     1 
ATOM   5347 C  CB    . LEU A 1 651 ? 7.422   24.111  0.324   1.00 37.61 ? 651  LEU A CB    1 
ATOM   5348 C  CG    . LEU A 1 651 ? 8.938   24.075  0.055   1.00 38.21 ? 651  LEU A CG    1 
ATOM   5349 C  CD1   . LEU A 1 651 ? 9.711   23.826  1.338   1.00 29.06 ? 651  LEU A CD1   1 
ATOM   5350 C  CD2   . LEU A 1 651 ? 9.299   23.015  -0.988  1.00 38.69 ? 651  LEU A CD2   1 
ATOM   5351 N  N     . ASP A 1 652 ? 4.252   24.621  0.037   1.00 38.19 ? 652  ASP A N     1 
ATOM   5352 C  CA    . ASP A 1 652 ? 2.867   24.308  0.378   1.00 38.45 ? 652  ASP A CA    1 
ATOM   5353 C  C     . ASP A 1 652 ? 2.112   23.846  -0.866  1.00 38.53 ? 652  ASP A C     1 
ATOM   5354 O  O     . ASP A 1 652 ? 1.420   22.827  -0.843  1.00 38.86 ? 652  ASP A O     1 
ATOM   5355 C  CB    . ASP A 1 652 ? 2.172   25.517  1.004   1.00 39.94 ? 652  ASP A CB    1 
ATOM   5356 C  CG    . ASP A 1 652 ? 0.697   25.265  1.271   1.00 43.32 ? 652  ASP A CG    1 
ATOM   5357 O  OD1   . ASP A 1 652 ? 0.360   24.190  1.817   1.00 43.96 ? 652  ASP A OD1   1 
ATOM   5358 O  OD2   . ASP A 1 652 ? -0.128  26.136  0.923   1.00 46.33 ? 652  ASP A OD2   1 
ATOM   5359 N  N     . LYS A 1 653 ? 2.272   24.593  -1.952  1.00 39.11 ? 653  LYS A N     1 
ATOM   5360 C  CA    . LYS A 1 653 ? 1.613   24.270  -3.213  1.00 39.92 ? 653  LYS A CA    1 
ATOM   5361 C  C     . LYS A 1 653 ? 2.133   22.951  -3.796  1.00 39.26 ? 653  LYS A C     1 
ATOM   5362 O  O     . LYS A 1 653 ? 1.352   22.148  -4.303  1.00 38.42 ? 653  LYS A O     1 
ATOM   5363 C  CB    . LYS A 1 653 ? 1.789   25.411  -4.214  1.00 40.40 ? 653  LYS A CB    1 
ATOM   5364 C  CG    . LYS A 1 653 ? 0.878   25.332  -5.428  1.00 44.53 ? 653  LYS A CG    1 
ATOM   5365 C  CD    . LYS A 1 653 ? 1.100   26.519  -6.368  1.00 49.76 ? 653  LYS A CD    1 
ATOM   5366 C  CE    . LYS A 1 653 ? 0.165   26.470  -7.579  1.00 53.73 ? 653  LYS A CE    1 
ATOM   5367 N  NZ    . LYS A 1 653 ? 0.559   27.472  -8.621  1.00 57.08 ? 653  LYS A NZ    1 
ATOM   5368 N  N     . PHE A 1 654 ? 3.443   22.723  -3.709  1.00 38.57 ? 654  PHE A N     1 
ATOM   5369 C  CA    . PHE A 1 654 ? 4.024   21.489  -4.229  1.00 37.56 ? 654  PHE A CA    1 
ATOM   5370 C  C     . PHE A 1 654 ? 3.514   20.235  -3.490  1.00 37.35 ? 654  PHE A C     1 
ATOM   5371 O  O     . PHE A 1 654 ? 3.238   19.207  -4.120  1.00 37.53 ? 654  PHE A O     1 
ATOM   5372 C  CB    . PHE A 1 654 ? 5.549   21.551  -4.209  1.00 36.78 ? 654  PHE A CB    1 
ATOM   5373 C  CG    . PHE A 1 654 ? 6.206   20.374  -4.882  1.00 39.66 ? 654  PHE A CG    1 
ATOM   5374 C  CD1   . PHE A 1 654 ? 6.584   19.253  -4.146  1.00 36.43 ? 654  PHE A CD1   1 
ATOM   5375 C  CD2   . PHE A 1 654 ? 6.437   20.381  -6.256  1.00 41.17 ? 654  PHE A CD2   1 
ATOM   5376 C  CE1   . PHE A 1 654 ? 7.191   18.163  -4.765  1.00 37.48 ? 654  PHE A CE1   1 
ATOM   5377 C  CE2   . PHE A 1 654 ? 7.041   19.288  -6.883  1.00 41.72 ? 654  PHE A CE2   1 
ATOM   5378 C  CZ    . PHE A 1 654 ? 7.418   18.180  -6.137  1.00 37.57 ? 654  PHE A CZ    1 
ATOM   5379 N  N     . ALA A 1 655 ? 3.390   20.333  -2.168  1.00 34.39 ? 655  ALA A N     1 
ATOM   5380 C  CA    . ALA A 1 655 ? 2.880   19.238  -1.344  1.00 36.25 ? 655  ALA A CA    1 
ATOM   5381 C  C     . ALA A 1 655 ? 1.432   18.894  -1.687  1.00 37.70 ? 655  ALA A C     1 
ATOM   5382 O  O     . ALA A 1 655 ? 1.104   17.726  -1.888  1.00 38.69 ? 655  ALA A O     1 
ATOM   5383 C  CB    . ALA A 1 655 ? 3.008   19.576  0.132   1.00 32.81 ? 655  ALA A CB    1 
ATOM   5384 N  N     . ARG A 1 656 ? 0.581   19.916  -1.766  1.00 39.09 ? 656  ARG A N     1 
ATOM   5385 C  CA    . ARG A 1 656 ? -0.845  19.727  -2.024  1.00 41.82 ? 656  ARG A CA    1 
ATOM   5386 C  C     . ARG A 1 656 ? -1.138  19.250  -3.451  1.00 42.86 ? 656  ARG A C     1 
ATOM   5387 O  O     . ARG A 1 656 ? -2.012  18.411  -3.657  1.00 42.68 ? 656  ARG A O     1 
ATOM   5388 C  CB    . ARG A 1 656 ? -1.612  21.023  -1.715  1.00 44.20 ? 656  ARG A CB    1 
ATOM   5389 C  CG    . ARG A 1 656 ? -3.078  21.044  -2.163  1.00 50.52 ? 656  ARG A CG    1 
ATOM   5390 C  CD    . ARG A 1 656 ? -3.774  22.385  -1.859  1.00 56.13 ? 656  ARG A CD    1 
ATOM   5391 N  NE    . ARG A 1 656 ? -3.111  23.534  -2.491  1.00 58.51 ? 656  ARG A NE    1 
ATOM   5392 C  CZ    . ARG A 1 656 ? -2.352  24.421  -1.847  1.00 55.11 ? 656  ARG A CZ    1 
ATOM   5393 N  NH1   . ARG A 1 656 ? -2.146  24.316  -0.540  1.00 53.26 ? 656  ARG A NH1   1 
ATOM   5394 N  NH2   . ARG A 1 656 ? -1.797  25.420  -2.513  1.00 57.69 ? 656  ARG A NH2   1 
ATOM   5395 N  N     . GLU A 1 657 ? -0.403  19.777  -4.429  1.00 44.24 ? 657  GLU A N     1 
ATOM   5396 C  CA    . GLU A 1 657 ? -0.721  19.538  -5.840  1.00 45.09 ? 657  GLU A CA    1 
ATOM   5397 C  C     . GLU A 1 657 ? 0.042   18.380  -6.470  1.00 44.52 ? 657  GLU A C     1 
ATOM   5398 O  O     . GLU A 1 657 ? -0.441  17.759  -7.408  1.00 45.65 ? 657  GLU A O     1 
ATOM   5399 C  CB    . GLU A 1 657 ? -0.514  20.809  -6.662  1.00 47.02 ? 657  GLU A CB    1 
ATOM   5400 C  CG    . GLU A 1 657 ? -1.508  21.910  -6.338  1.00 49.16 ? 657  GLU A CG    1 
ATOM   5401 C  CD    . GLU A 1 657 ? -1.375  23.113  -7.251  1.00 53.43 ? 657  GLU A CD    1 
ATOM   5402 O  OE1   . GLU A 1 657 ? -0.422  23.159  -8.065  1.00 54.01 ? 657  GLU A OE1   1 
ATOM   5403 O  OE2   . GLU A 1 657 ? -2.229  24.018  -7.150  1.00 52.74 ? 657  GLU A OE2   1 
ATOM   5404 N  N     . ARG A 1 658 ? 1.230   18.091  -5.953  1.00 43.32 ? 658  ARG A N     1 
ATOM   5405 C  CA    . ARG A 1 658 ? 2.066   17.041  -6.517  1.00 42.77 ? 658  ARG A CA    1 
ATOM   5406 C  C     . ARG A 1 658 ? 2.230   15.856  -5.574  1.00 42.38 ? 658  ARG A C     1 
ATOM   5407 O  O     . ARG A 1 658 ? 1.996   14.714  -5.966  1.00 42.58 ? 658  ARG A O     1 
ATOM   5408 C  CB    . ARG A 1 658 ? 3.440   17.602  -6.900  1.00 44.10 ? 658  ARG A CB    1 
ATOM   5409 C  CG    . ARG A 1 658 ? 3.398   18.775  -7.874  1.00 48.09 ? 658  ARG A CG    1 
ATOM   5410 C  CD    . ARG A 1 658 ? 2.881   18.363  -9.246  1.00 53.09 ? 658  ARG A CD    1 
ATOM   5411 N  NE    . ARG A 1 658 ? 2.416   19.521  -10.004 1.00 60.06 ? 658  ARG A NE    1 
ATOM   5412 C  CZ    . ARG A 1 658 ? 1.608   19.462  -11.060 1.00 63.18 ? 658  ARG A CZ    1 
ATOM   5413 N  NH1   . ARG A 1 658 ? 1.155   18.294  -11.502 1.00 62.99 ? 658  ARG A NH1   1 
ATOM   5414 N  NH2   . ARG A 1 658 ? 1.246   20.582  -11.670 1.00 64.58 ? 658  ARG A NH2   1 
ATOM   5415 N  N     . MET A 1 659 ? 2.625   16.125  -4.332  1.00 39.63 ? 659  MET A N     1 
ATOM   5416 C  CA    . MET A 1 659 ? 2.976   15.040  -3.422  1.00 39.67 ? 659  MET A CA    1 
ATOM   5417 C  C     . MET A 1 659 ? 1.791   14.271  -2.854  1.00 38.80 ? 659  MET A C     1 
ATOM   5418 O  O     . MET A 1 659 ? 1.825   13.037  -2.800  1.00 37.88 ? 659  MET A O     1 
ATOM   5419 C  CB    . MET A 1 659 ? 3.914   15.524  -2.320  1.00 39.85 ? 659  MET A CB    1 
ATOM   5420 C  CG    . MET A 1 659 ? 5.329   15.718  -2.841  1.00 46.12 ? 659  MET A CG    1 
ATOM   5421 S  SD    . MET A 1 659 ? 6.517   16.115  -1.567  1.00 50.07 ? 659  MET A SD    1 
ATOM   5422 C  CE    . MET A 1 659 ? 6.658   14.539  -0.711  1.00 47.86 ? 659  MET A CE    1 
ATOM   5423 N  N     . GLU A 1 660 ? 0.742   14.988  -2.463  1.00 38.47 ? 660  GLU A N     1 
ATOM   5424 C  CA    . GLU A 1 660 ? -0.441  14.352  -1.883  1.00 40.28 ? 660  GLU A CA    1 
ATOM   5425 C  C     . GLU A 1 660 ? -1.236  13.473  -2.865  1.00 40.58 ? 660  GLU A C     1 
ATOM   5426 O  O     . GLU A 1 660 ? -1.732  12.421  -2.462  1.00 40.97 ? 660  GLU A O     1 
ATOM   5427 C  CB    . GLU A 1 660 ? -1.331  15.379  -1.168  1.00 41.43 ? 660  GLU A CB    1 
ATOM   5428 C  CG    . GLU A 1 660 ? -0.917  15.611  0.286   1.00 48.57 ? 660  GLU A CG    1 
ATOM   5429 C  CD    . GLU A 1 660 ? -1.574  16.836  0.910   1.00 57.39 ? 660  GLU A CD    1 
ATOM   5430 O  OE1   . GLU A 1 660 ? -2.799  16.803  1.171   1.00 62.47 ? 660  GLU A OE1   1 
ATOM   5431 O  OE2   . GLU A 1 660 ? -0.864  17.836  1.152   1.00 60.99 ? 660  GLU A OE2   1 
ATOM   5432 N  N     . PRO A 1 661 ? -1.356  13.881  -4.152  1.00 41.94 ? 661  PRO A N     1 
ATOM   5433 C  CA    . PRO A 1 661 ? -1.960  12.935  -5.104  1.00 41.83 ? 661  PRO A CA    1 
ATOM   5434 C  C     . PRO A 1 661 ? -1.096  11.686  -5.326  1.00 41.35 ? 661  PRO A C     1 
ATOM   5435 O  O     . PRO A 1 661 ? -1.631  10.585  -5.493  1.00 39.16 ? 661  PRO A O     1 
ATOM   5436 C  CB    . PRO A 1 661 ? -2.074  13.760  -6.391  1.00 41.81 ? 661  PRO A CB    1 
ATOM   5437 C  CG    . PRO A 1 661 ? -2.157  15.170  -5.909  1.00 42.12 ? 661  PRO A CG    1 
ATOM   5438 C  CD    . PRO A 1 661 ? -1.189  15.212  -4.762  1.00 41.06 ? 661  PRO A CD    1 
ATOM   5439 N  N     . ALA A 1 662 ? 0.226   11.859  -5.313  1.00 41.10 ? 662  ALA A N     1 
ATOM   5440 C  CA    . ALA A 1 662 ? 1.149   10.727  -5.397  1.00 40.20 ? 662  ALA A CA    1 
ATOM   5441 C  C     . ALA A 1 662 ? 1.027   9.843   -4.163  1.00 38.83 ? 662  ALA A C     1 
ATOM   5442 O  O     . ALA A 1 662 ? 1.061   8.620   -4.265  1.00 37.76 ? 662  ALA A O     1 
ATOM   5443 C  CB    . ALA A 1 662 ? 2.574   11.206  -5.561  1.00 41.20 ? 662  ALA A CB    1 
ATOM   5444 N  N     . ILE A 1 663 ? 0.881   10.474  -2.998  1.00 37.39 ? 663  ILE A N     1 
ATOM   5445 C  CA    . ILE A 1 663 ? 0.723   9.745   -1.738  1.00 36.08 ? 663  ILE A CA    1 
ATOM   5446 C  C     . ILE A 1 663 ? -0.602  8.978   -1.754  1.00 34.22 ? 663  ILE A C     1 
ATOM   5447 O  O     . ILE A 1 663 ? -0.643  7.800   -1.397  1.00 33.58 ? 663  ILE A O     1 
ATOM   5448 C  CB    . ILE A 1 663 ? 0.868   10.683  -0.493  1.00 34.75 ? 663  ILE A CB    1 
ATOM   5449 C  CG1   . ILE A 1 663 ? 2.342   11.069  -0.304  1.00 37.05 ? 663  ILE A CG1   1 
ATOM   5450 C  CG2   . ILE A 1 663 ? 0.315   10.019  0.787   1.00 29.54 ? 663  ILE A CG2   1 
ATOM   5451 C  CD1   . ILE A 1 663 ? 2.596   12.131  0.771   1.00 36.56 ? 663  ILE A CD1   1 
ATOM   5452 N  N     . ASP A 1 664 ? -1.669  9.635   -2.207  1.00 33.08 ? 664  ASP A N     1 
ATOM   5453 C  CA    . ASP A 1 664 ? -2.961  8.975   -2.284  1.00 34.93 ? 664  ASP A CA    1 
ATOM   5454 C  C     . ASP A 1 664 ? -2.948  7.788   -3.253  1.00 35.68 ? 664  ASP A C     1 
ATOM   5455 O  O     . ASP A 1 664 ? -3.460  6.720   -2.922  1.00 36.43 ? 664  ASP A O     1 
ATOM   5456 C  CB    . ASP A 1 664 ? -4.090  9.946   -2.630  1.00 35.59 ? 664  ASP A CB    1 
ATOM   5457 C  CG    . ASP A 1 664 ? -5.456  9.359   -2.328  1.00 36.35 ? 664  ASP A CG    1 
ATOM   5458 O  OD1   . ASP A 1 664 ? -6.257  9.164   -3.273  1.00 37.43 ? 664  ASP A OD1   1 
ATOM   5459 O  OD2   . ASP A 1 664 ? -5.714  9.063   -1.142  1.00 38.70 ? 664  ASP A OD2   1 
ATOM   5460 N  N     . ARG A 1 665 ? -2.350  7.966   -4.431  1.00 36.32 ? 665  ARG A N     1 
ATOM   5461 C  CA    . ARG A 1 665 ? -2.222  6.862   -5.383  1.00 36.04 ? 665  ARG A CA    1 
ATOM   5462 C  C     . ARG A 1 665 ? -1.463  5.691   -4.758  1.00 34.19 ? 665  ARG A C     1 
ATOM   5463 O  O     . ARG A 1 665 ? -1.878  4.537   -4.884  1.00 33.29 ? 665  ARG A O     1 
ATOM   5464 C  CB    . ARG A 1 665 ? -1.568  7.321   -6.690  1.00 37.91 ? 665  ARG A CB    1 
ATOM   5465 C  CG    . ARG A 1 665 ? -2.534  8.070   -7.610  1.00 42.09 ? 665  ARG A CG    1 
ATOM   5466 C  CD    . ARG A 1 665 ? -1.956  8.350   -9.007  1.00 44.29 ? 665  ARG A CD    1 
ATOM   5467 N  NE    . ARG A 1 665 ? -0.615  8.946   -8.978  1.00 46.61 ? 665  ARG A NE    1 
ATOM   5468 C  CZ    . ARG A 1 665 ? -0.355  10.250  -8.861  1.00 48.02 ? 665  ARG A CZ    1 
ATOM   5469 N  NH1   . ARG A 1 665 ? -1.341  11.138  -8.755  1.00 45.42 ? 665  ARG A NH1   1 
ATOM   5470 N  NH2   . ARG A 1 665 ? 0.907   10.668  -8.851  1.00 46.66 ? 665  ARG A NH2   1 
ATOM   5471 N  N     . GLY A 1 666 ? -0.370  6.000   -4.062  1.00 32.44 ? 666  GLY A N     1 
ATOM   5472 C  CA    . GLY A 1 666 ? 0.429   4.986   -3.382  1.00 32.93 ? 666  GLY A CA    1 
ATOM   5473 C  C     . GLY A 1 666 ? -0.369  4.165   -2.372  1.00 33.58 ? 666  GLY A C     1 
ATOM   5474 O  O     . GLY A 1 666 ? -0.252  2.934   -2.330  1.00 32.83 ? 666  GLY A O     1 
ATOM   5475 N  N     . PHE A 1 667 ? -1.182  4.838   -1.558  1.00 30.72 ? 667  PHE A N     1 
ATOM   5476 C  CA    . PHE A 1 667 ? -1.959  4.136   -0.530  1.00 31.70 ? 667  PHE A CA    1 
ATOM   5477 C  C     . PHE A 1 667 ? -3.154  3.358   -1.096  1.00 32.21 ? 667  PHE A C     1 
ATOM   5478 O  O     . PHE A 1 667 ? -3.485  2.280   -0.594  1.00 32.19 ? 667  PHE A O     1 
ATOM   5479 C  CB    . PHE A 1 667 ? -2.401  5.076   0.598   1.00 27.80 ? 667  PHE A CB    1 
ATOM   5480 C  CG    . PHE A 1 667 ? -1.364  5.275   1.669   1.00 28.69 ? 667  PHE A CG    1 
ATOM   5481 C  CD1   . PHE A 1 667 ? -0.729  4.188   2.257   1.00 28.56 ? 667  PHE A CD1   1 
ATOM   5482 C  CD2   . PHE A 1 667 ? -1.045  6.551   2.109   1.00 30.19 ? 667  PHE A CD2   1 
ATOM   5483 C  CE1   . PHE A 1 667 ? 0.219   4.366   3.253   1.00 32.10 ? 667  PHE A CE1   1 
ATOM   5484 C  CE2   . PHE A 1 667 ? -0.104  6.743   3.110   1.00 29.36 ? 667  PHE A CE2   1 
ATOM   5485 C  CZ    . PHE A 1 667 ? 0.533   5.646   3.682   1.00 30.77 ? 667  PHE A CZ    1 
ATOM   5486 N  N     . ARG A 1 668 ? -3.788  3.889   -2.137  1.00 31.65 ? 668  ARG A N     1 
ATOM   5487 C  CA    . ARG A 1 668 ? -4.863  3.148   -2.816  1.00 33.31 ? 668  ARG A CA    1 
ATOM   5488 C  C     . ARG A 1 668 ? -4.372  1.794   -3.335  1.00 34.18 ? 668  ARG A C     1 
ATOM   5489 O  O     . ARG A 1 668 ? -5.069  0.781   -3.195  1.00 36.33 ? 668  ARG A O     1 
ATOM   5490 C  CB    . ARG A 1 668 ? -5.462  3.961   -3.956  1.00 32.55 ? 668  ARG A CB    1 
ATOM   5491 C  CG    . ARG A 1 668 ? -6.257  5.152   -3.501  1.00 35.85 ? 668  ARG A CG    1 
ATOM   5492 C  CD    . ARG A 1 668 ? -6.827  5.935   -4.680  1.00 42.72 ? 668  ARG A CD    1 
ATOM   5493 N  NE    . ARG A 1 668 ? -7.635  7.065   -4.221  1.00 48.43 ? 668  ARG A NE    1 
ATOM   5494 C  CZ    . ARG A 1 668 ? -8.928  6.994   -3.901  1.00 50.50 ? 668  ARG A CZ    1 
ATOM   5495 N  NH1   . ARG A 1 668 ? -9.588  5.844   -3.993  1.00 50.80 ? 668  ARG A NH1   1 
ATOM   5496 N  NH2   . ARG A 1 668 ? -9.567  8.080   -3.491  1.00 48.51 ? 668  ARG A NH2   1 
ATOM   5497 N  N     . GLU A 1 669 ? -3.178  1.773   -3.925  1.00 33.19 ? 669  GLU A N     1 
ATOM   5498 C  CA    . GLU A 1 669 ? -2.608  0.520   -4.437  1.00 35.86 ? 669  GLU A CA    1 
ATOM   5499 C  C     . GLU A 1 669 ? -2.431  -0.499  -3.304  1.00 34.24 ? 669  GLU A C     1 
ATOM   5500 O  O     . GLU A 1 669 ? -2.788  -1.670  -3.446  1.00 34.27 ? 669  GLU A O     1 
ATOM   5501 C  CB    . GLU A 1 669 ? -1.283  0.765   -5.179  1.00 36.28 ? 669  GLU A CB    1 
ATOM   5502 C  CG    . GLU A 1 669 ? -0.704  -0.491  -5.844  1.00 40.79 ? 669  GLU A CG    1 
ATOM   5503 C  CD    . GLU A 1 669 ? 0.607   -0.230  -6.563  1.00 42.05 ? 669  GLU A CD    1 
ATOM   5504 O  OE1   . GLU A 1 669 ? 0.577   0.182   -7.740  1.00 48.04 ? 669  GLU A OE1   1 
ATOM   5505 O  OE2   . GLU A 1 669 ? 1.674   -0.448  -5.960  1.00 41.60 ? 669  GLU A OE2   1 
ATOM   5506 N  N     . MET A 1 670 ? -1.890  -0.029  -2.183  1.00 33.74 ? 670  MET A N     1 
ATOM   5507 C  CA    . MET A 1 670 ? -1.727  -0.835  -0.971  1.00 32.08 ? 670  MET A CA    1 
ATOM   5508 C  C     . MET A 1 670 ? -3.058  -1.381  -0.433  1.00 32.11 ? 670  MET A C     1 
ATOM   5509 O  O     . MET A 1 670 ? -3.136  -2.532  0.020   1.00 30.13 ? 670  MET A O     1 
ATOM   5510 C  CB    . MET A 1 670 ? -1.060  0.005   0.119   1.00 28.81 ? 670  MET A CB    1 
ATOM   5511 C  CG    . MET A 1 670 ? -0.627  -0.802  1.319   1.00 32.99 ? 670  MET A CG    1 
ATOM   5512 S  SD    . MET A 1 670 ? 0.127   0.251   2.543   1.00 30.17 ? 670  MET A SD    1 
ATOM   5513 C  CE    . MET A 1 670 ? -1.286  0.718   3.543   1.00 28.95 ? 670  MET A CE    1 
ATOM   5514 N  N     . CYS A 1 671 ? -4.089  -0.536  -0.458  1.00 32.28 ? 671  CYS A N     1 
ATOM   5515 C  CA    . CYS A 1 671 ? -5.422  -0.923  -0.014  1.00 32.75 ? 671  CYS A CA    1 
ATOM   5516 C  C     . CYS A 1 671 ? -5.927  -2.119  -0.823  1.00 33.30 ? 671  CYS A C     1 
ATOM   5517 O  O     . CYS A 1 671 ? -6.422  -3.093  -0.260  1.00 33.98 ? 671  CYS A O     1 
ATOM   5518 C  CB    . CYS A 1 671 ? -6.384  0.260   -0.145  1.00 34.19 ? 671  CYS A CB    1 
ATOM   5519 S  SG    . CYS A 1 671 ? -8.098  -0.118  0.243   1.00 32.89 ? 671  CYS A SG    1 
ATOM   5520 N  N     . GLU A 1 672 ? -5.783  -2.034  -2.144  1.00 33.36 ? 672  GLU A N     1 
ATOM   5521 C  CA    . GLU A 1 672 ? -6.186  -3.106  -3.049  1.00 35.99 ? 672  GLU A CA    1 
ATOM   5522 C  C     . GLU A 1 672 ? -5.305  -4.330  -2.865  1.00 34.22 ? 672  GLU A C     1 
ATOM   5523 O  O     . GLU A 1 672 ? -5.793  -5.466  -2.875  1.00 33.60 ? 672  GLU A O     1 
ATOM   5524 C  CB    . GLU A 1 672 ? -6.127  -2.634  -4.504  1.00 38.75 ? 672  GLU A CB    1 
ATOM   5525 C  CG    . GLU A 1 672 ? -7.225  -1.644  -4.850  1.00 49.28 ? 672  GLU A CG    1 
ATOM   5526 C  CD    . GLU A 1 672 ? -7.193  -1.209  -6.297  1.00 55.90 ? 672  GLU A CD    1 
ATOM   5527 O  OE1   . GLU A 1 672 ? -7.220  0.015   -6.541  1.00 59.26 ? 672  GLU A OE1   1 
ATOM   5528 O  OE2   . GLU A 1 672 ? -7.137  -2.088  -7.187  1.00 61.07 ? 672  GLU A OE2   1 
ATOM   5529 N  N     . TYR A 1 673 ? -4.007  -4.091  -2.699  1.00 30.70 ? 673  TYR A N     1 
ATOM   5530 C  CA    . TYR A 1 673 ? -3.052  -5.164  -2.428  1.00 30.30 ? 673  TYR A CA    1 
ATOM   5531 C  C     . TYR A 1 673 ? -3.491  -5.966  -1.194  1.00 29.13 ? 673  TYR A C     1 
ATOM   5532 O  O     . TYR A 1 673 ? -3.532  -7.198  -1.231  1.00 27.70 ? 673  TYR A O     1 
ATOM   5533 C  CB    . TYR A 1 673 ? -1.648  -4.578  -2.276  1.00 28.82 ? 673  TYR A CB    1 
ATOM   5534 C  CG    . TYR A 1 673 ? -0.503  -5.563  -2.130  1.00 31.32 ? 673  TYR A CG    1 
ATOM   5535 C  CD1   . TYR A 1 673 ? -0.530  -6.825  -2.743  1.00 31.44 ? 673  TYR A CD1   1 
ATOM   5536 C  CD2   . TYR A 1 673 ? 0.643   -5.205  -1.414  1.00 29.47 ? 673  TYR A CD2   1 
ATOM   5537 C  CE1   . TYR A 1 673 ? 0.543   -7.718  -2.611  1.00 31.24 ? 673  TYR A CE1   1 
ATOM   5538 C  CE2   . TYR A 1 673 ? 1.725   -6.078  -1.289  1.00 33.11 ? 673  TYR A CE2   1 
ATOM   5539 C  CZ    . TYR A 1 673 ? 1.666   -7.330  -1.891  1.00 32.52 ? 673  TYR A CZ    1 
ATOM   5540 O  OH    . TYR A 1 673 ? 2.733   -8.178  -1.757  1.00 36.03 ? 673  TYR A OH    1 
ATOM   5541 N  N     . MET A 1 674 ? -3.872  -5.264  -0.127  1.00 27.97 ? 674  MET A N     1 
ATOM   5542 C  CA    . MET A 1 674 ? -4.382  -5.926  1.082   1.00 28.86 ? 674  MET A CA    1 
ATOM   5543 C  C     . MET A 1 674 ? -5.878  -6.281  1.004   1.00 28.45 ? 674  MET A C     1 
ATOM   5544 O  O     . MET A 1 674 ? -6.423  -6.849  1.953   1.00 27.47 ? 674  MET A O     1 
ATOM   5545 C  CB    . MET A 1 674 ? -4.105  -5.071  2.332   1.00 26.95 ? 674  MET A CB    1 
ATOM   5546 C  CG    . MET A 1 674 ? -2.636  -4.923  2.704   1.00 31.15 ? 674  MET A CG    1 
ATOM   5547 S  SD    . MET A 1 674 ? -1.814  -6.470  3.186   1.00 36.85 ? 674  MET A SD    1 
ATOM   5548 C  CE    . MET A 1 674 ? -0.728  -6.729  1.787   1.00 33.08 ? 674  MET A CE    1 
ATOM   5549 N  N     . ASN A 1 675 ? -6.529  -5.944  -0.120  1.00 29.73 ? 675  ASN A N     1 
ATOM   5550 C  CA    . ASN A 1 675 ? -7.981  -6.168  -0.326  1.00 29.70 ? 675  ASN A CA    1 
ATOM   5551 C  C     . ASN A 1 675 ? -8.841  -5.555  0.790   1.00 29.79 ? 675  ASN A C     1 
ATOM   5552 O  O     . ASN A 1 675 ? -9.831  -6.151  1.234   1.00 29.91 ? 675  ASN A O     1 
ATOM   5553 C  CB    . ASN A 1 675 ? -8.307  -7.665  -0.509  1.00 30.39 ? 675  ASN A CB    1 
ATOM   5554 C  CG    . ASN A 1 675 ? -9.740  -7.910  -1.042  1.00 30.87 ? 675  ASN A CG    1 
ATOM   5555 O  OD1   . ASN A 1 675 ? -10.267 -7.141  -1.844  1.00 31.33 ? 675  ASN A OD1   1 
ATOM   5556 N  ND2   . ASN A 1 675 ? -10.359 -8.994  -0.591  1.00 31.60 ? 675  ASN A ND2   1 
ATOM   5557 N  N     . ASN A 1 676 ? -8.449  -4.369  1.247   1.00 25.77 ? 676  ASN A N     1 
ATOM   5558 C  CA    . ASN A 1 676 ? -9.084  -3.758  2.397   1.00 25.74 ? 676  ASN A CA    1 
ATOM   5559 C  C     . ASN A 1 676 ? -10.469 -3.256  2.074   1.00 28.43 ? 676  ASN A C     1 
ATOM   5560 O  O     . ASN A 1 676 ? -10.820 -3.047  0.902   1.00 28.02 ? 676  ASN A O     1 
ATOM   5561 C  CB    . ASN A 1 676 ? -8.230  -2.625  2.990   1.00 25.26 ? 676  ASN A CB    1 
ATOM   5562 C  CG    . ASN A 1 676 ? -6.930  -3.120  3.617   1.00 25.30 ? 676  ASN A CG    1 
ATOM   5563 O  OD1   . ASN A 1 676 ? -5.897  -2.464  3.500   1.00 31.35 ? 676  ASN A OD1   1 
ATOM   5564 N  ND2   . ASN A 1 676 ? -6.975  -4.270  4.288   1.00 25.41 ? 676  ASN A ND2   1 
ATOM   5565 N  N     . LYS A 1 677 ? -11.262 -3.080  3.122   1.00 28.67 ? 677  LYS A N     1 
ATOM   5566 C  CA    . LYS A 1 677 ? -12.654 -2.721  2.963   1.00 30.29 ? 677  LYS A CA    1 
ATOM   5567 C  C     . LYS A 1 677 ? -12.789 -1.315  2.397   1.00 31.97 ? 677  LYS A C     1 
ATOM   5568 O  O     . LYS A 1 677 ? -13.583 -1.081  1.485   1.00 32.59 ? 677  LYS A O     1 
ATOM   5569 C  CB    . LYS A 1 677 ? -13.361 -2.822  4.319   1.00 31.76 ? 677  LYS A CB    1 
ATOM   5570 C  CG    . LYS A 1 677 ? -14.874 -2.756  4.260   1.00 32.05 ? 677  LYS A CG    1 
ATOM   5571 C  CD    . LYS A 1 677 ? -15.477 -3.065  5.634   1.00 32.88 ? 677  LYS A CD    1 
ATOM   5572 C  CE    . LYS A 1 677 ? -16.938 -3.471  5.509   1.00 34.98 ? 677  LYS A CE    1 
ATOM   5573 N  NZ    . LYS A 1 677 ? -17.790 -2.306  5.152   1.00 36.40 ? 677  LYS A NZ    1 
ATOM   5574 N  N     . GLN A 1 678 ? -11.991 -0.392  2.927   1.00 30.49 ? 678  GLN A N     1 
ATOM   5575 C  CA    . GLN A 1 678 ? -12.171 1.030   2.664   1.00 32.00 ? 678  GLN A CA    1 
ATOM   5576 C  C     . GLN A 1 678 ? -10.826 1.752   2.777   1.00 30.00 ? 678  GLN A C     1 
ATOM   5577 O  O     . GLN A 1 678 ? -10.113 1.583   3.753   1.00 31.93 ? 678  GLN A O     1 
ATOM   5578 C  CB    . GLN A 1 678 ? -13.182 1.592   3.670   1.00 31.59 ? 678  GLN A CB    1 
ATOM   5579 C  CG    . GLN A 1 678 ? -13.655 3.018   3.426   1.00 38.36 ? 678  GLN A CG    1 
ATOM   5580 C  CD    . GLN A 1 678 ? -14.490 3.556   4.593   1.00 40.49 ? 678  GLN A CD    1 
ATOM   5581 O  OE1   . GLN A 1 678 ? -14.769 2.847   5.561   1.00 41.17 ? 678  GLN A OE1   1 
ATOM   5582 N  NE2   . GLN A 1 678 ? -14.881 4.815   4.504   1.00 42.70 ? 678  GLN A NE2   1 
ATOM   5583 N  N     . HIS A 1 679 ? -10.485 2.547   1.772   1.00 28.99 ? 679  HIS A N     1 
ATOM   5584 C  CA    . HIS A 1 679 ? -9.230  3.287   1.755   1.00 27.72 ? 679  HIS A CA    1 
ATOM   5585 C  C     . HIS A 1 679 ? -9.315  4.467   2.713   1.00 27.72 ? 679  HIS A C     1 
ATOM   5586 O  O     . HIS A 1 679 ? -10.070 5.402   2.475   1.00 25.14 ? 679  HIS A O     1 
ATOM   5587 C  CB    . HIS A 1 679 ? -8.911  3.770   0.333   1.00 28.93 ? 679  HIS A CB    1 
ATOM   5588 C  CG    . HIS A 1 679 ? -7.901  4.875   0.279   1.00 29.08 ? 679  HIS A CG    1 
ATOM   5589 N  ND1   . HIS A 1 679 ? -6.643  4.757   0.824   1.00 24.98 ? 679  HIS A ND1   1 
ATOM   5590 C  CD2   . HIS A 1 679 ? -7.965  6.118   -0.258  1.00 29.73 ? 679  HIS A CD2   1 
ATOM   5591 C  CE1   . HIS A 1 679 ? -5.975  5.880   0.630   1.00 29.31 ? 679  HIS A CE1   1 
ATOM   5592 N  NE2   . HIS A 1 679 ? -6.753  6.721   -0.029  1.00 26.66 ? 679  HIS A NE2   1 
ATOM   5593 N  N     . LEU A 1 680 ? -8.551  4.414   3.806   1.00 26.78 ? 680  LEU A N     1 
ATOM   5594 C  CA    . LEU A 1 680 ? -8.610  5.474   4.805   1.00 27.22 ? 680  LEU A CA    1 
ATOM   5595 C  C     . LEU A 1 680 ? -7.240  5.968   5.259   1.00 27.32 ? 680  LEU A C     1 
ATOM   5596 O  O     . LEU A 1 680 ? -7.129  6.635   6.292   1.00 28.02 ? 680  LEU A O     1 
ATOM   5597 C  CB    . LEU A 1 680 ? -9.457  5.040   6.013   1.00 26.20 ? 680  LEU A CB    1 
ATOM   5598 C  CG    . LEU A 1 680 ? -10.954 4.829   5.778   1.00 28.11 ? 680  LEU A CG    1 
ATOM   5599 C  CD1   . LEU A 1 680 ? -11.518 3.982   6.899   1.00 25.40 ? 680  LEU A CD1   1 
ATOM   5600 C  CD2   . LEU A 1 680 ? -11.722 6.158   5.638   1.00 28.36 ? 680  LEU A CD2   1 
ATOM   5601 N  N     . MET A 1 681 ? -6.205  5.642   4.490   1.00 27.46 ? 681  MET A N     1 
ATOM   5602 C  CA    . MET A 1 681 ? -4.850  6.096   4.791   1.00 25.53 ? 681  MET A CA    1 
ATOM   5603 C  C     . MET A 1 681 ? -4.669  7.486   4.207   1.00 27.40 ? 681  MET A C     1 
ATOM   5604 O  O     . MET A 1 681 ? -4.416  7.638   3.009   1.00 26.23 ? 681  MET A O     1 
ATOM   5605 C  CB    . MET A 1 681 ? -3.804  5.129   4.224   1.00 27.27 ? 681  MET A CB    1 
ATOM   5606 C  CG    . MET A 1 681 ? -3.809  3.717   4.839   1.00 25.73 ? 681  MET A CG    1 
ATOM   5607 S  SD    . MET A 1 681 ? -3.434  3.657   6.618   1.00 27.25 ? 681  MET A SD    1 
ATOM   5608 C  CE    . MET A 1 681 ? -5.071  3.608   7.341   1.00 20.11 ? 681  MET A CE    1 
ATOM   5609 N  N     . PHE A 1 682 ? -4.830  8.503   5.051   1.00 29.45 ? 682  PHE A N     1 
ATOM   5610 C  CA    . PHE A 1 682 ? -4.772  9.893   4.597   1.00 31.68 ? 682  PHE A CA    1 
ATOM   5611 C  C     . PHE A 1 682 ? -3.626  10.603  5.286   1.00 32.31 ? 682  PHE A C     1 
ATOM   5612 O  O     . PHE A 1 682 ? -3.647  10.809  6.495   1.00 32.28 ? 682  PHE A O     1 
ATOM   5613 C  CB    . PHE A 1 682 ? -6.081  10.635  4.871   1.00 31.70 ? 682  PHE A CB    1 
ATOM   5614 C  CG    . PHE A 1 682 ? -7.294  10.002  4.246   1.00 32.75 ? 682  PHE A CG    1 
ATOM   5615 C  CD1   . PHE A 1 682 ? -7.266  9.535   2.937   1.00 34.13 ? 682  PHE A CD1   1 
ATOM   5616 C  CD2   . PHE A 1 682 ? -8.486  9.914   4.961   1.00 34.20 ? 682  PHE A CD2   1 
ATOM   5617 C  CE1   . PHE A 1 682 ? -8.398  8.962   2.356   1.00 35.12 ? 682  PHE A CE1   1 
ATOM   5618 C  CE2   . PHE A 1 682 ? -9.616  9.345   4.393   1.00 36.18 ? 682  PHE A CE2   1 
ATOM   5619 C  CZ    . PHE A 1 682 ? -9.570  8.869   3.077   1.00 33.27 ? 682  PHE A CZ    1 
ATOM   5620 N  N     . MET A 1 683 ? -2.620  10.967  4.505   1.00 35.31 ? 683  MET A N     1 
ATOM   5621 C  CA    . MET A 1 683 ? -1.379  11.479  5.050   1.00 34.47 ? 683  MET A CA    1 
ATOM   5622 C  C     . MET A 1 683 ? -1.234  12.967  4.726   1.00 34.74 ? 683  MET A C     1 
ATOM   5623 O  O     . MET A 1 683 ? -0.609  13.349  3.738   1.00 36.52 ? 683  MET A O     1 
ATOM   5624 C  CB    . MET A 1 683 ? -0.215  10.660  4.504   1.00 32.83 ? 683  MET A CB    1 
ATOM   5625 C  CG    . MET A 1 683 ? 0.939   10.518  5.459   1.00 35.37 ? 683  MET A CG    1 
ATOM   5626 S  SD    . MET A 1 683 ? 2.289   9.597   4.702   1.00 38.59 ? 683  MET A SD    1 
ATOM   5627 C  CE    . MET A 1 683 ? 3.087   8.943   6.174   1.00 31.89 ? 683  MET A CE    1 
ATOM   5628 N  N     . ASP A 1 684 ? -1.851  13.789  5.567   1.00 37.15 ? 684  ASP A N     1 
ATOM   5629 C  CA    . ASP A 1 684 ? -1.803  15.252  5.464   1.00 37.74 ? 684  ASP A CA    1 
ATOM   5630 C  C     . ASP A 1 684 ? -0.394  15.813  5.640   1.00 35.20 ? 684  ASP A C     1 
ATOM   5631 O  O     . ASP A 1 684 ? 0.372   15.348  6.492   1.00 35.34 ? 684  ASP A O     1 
ATOM   5632 C  CB    . ASP A 1 684 ? -2.693  15.880  6.544   1.00 36.80 ? 684  ASP A CB    1 
ATOM   5633 C  CG    . ASP A 1 684 ? -4.173  15.676  6.286   1.00 43.62 ? 684  ASP A CG    1 
ATOM   5634 O  OD1   . ASP A 1 684 ? -4.529  15.182  5.196   1.00 47.34 ? 684  ASP A OD1   1 
ATOM   5635 O  OD2   . ASP A 1 684 ? -4.988  16.025  7.172   1.00 43.62 ? 684  ASP A OD2   1 
ATOM   5636 N  N     . ARG A 1 685 ? -0.066  16.822  4.842   1.00 32.88 ? 685  ARG A N     1 
ATOM   5637 C  CA    . ARG A 1 685 ? 1.144   17.598  5.062   1.00 32.22 ? 685  ARG A CA    1 
ATOM   5638 C  C     . ARG A 1 685 ? 1.051   18.251  6.448   1.00 30.05 ? 685  ARG A C     1 
ATOM   5639 O  O     . ARG A 1 685 ? 0.060   18.891  6.768   1.00 28.96 ? 685  ARG A O     1 
ATOM   5640 C  CB    . ARG A 1 685 ? 1.323   18.643  3.952   1.00 32.35 ? 685  ARG A CB    1 
ATOM   5641 C  CG    . ARG A 1 685 ? 2.718   19.273  3.884   1.00 32.35 ? 685  ARG A CG    1 
ATOM   5642 C  CD    . ARG A 1 685 ? 2.822   20.530  4.757   1.00 36.67 ? 685  ARG A CD    1 
ATOM   5643 N  NE    . ARG A 1 685 ? 2.037   21.660  4.255   1.00 30.76 ? 685  ARG A NE    1 
ATOM   5644 C  CZ    . ARG A 1 685 ? 1.737   22.737  4.980   1.00 34.77 ? 685  ARG A CZ    1 
ATOM   5645 N  NH1   . ARG A 1 685 ? 2.142   22.830  6.243   1.00 34.76 ? 685  ARG A NH1   1 
ATOM   5646 N  NH2   . ARG A 1 685 ? 1.024   23.722  4.451   1.00 33.46 ? 685  ARG A NH2   1 
ATOM   5647 N  N     . GLU A 1 686 ? 2.077   18.053  7.270   1.00 30.70 ? 686  GLU A N     1 
ATOM   5648 C  CA    . GLU A 1 686 ? 2.124   18.655  8.594   1.00 33.58 ? 686  GLU A CA    1 
ATOM   5649 C  C     . GLU A 1 686 ? 3.034   19.907  8.598   1.00 34.09 ? 686  GLU A C     1 
ATOM   5650 O  O     . GLU A 1 686 ? 2.534   21.030  8.607   1.00 34.79 ? 686  GLU A O     1 
ATOM   5651 C  CB    . GLU A 1 686 ? 2.559   17.615  9.638   1.00 35.56 ? 686  GLU A CB    1 
ATOM   5652 C  CG    . GLU A 1 686 ? 1.753   17.680  10.952  1.00 47.55 ? 686  GLU A CG    1 
ATOM   5653 C  CD    . GLU A 1 686 ? 2.124   16.584  11.956  1.00 49.51 ? 686  GLU A CD    1 
ATOM   5654 O  OE1   . GLU A 1 686 ? 1.199   16.009  12.580  1.00 51.50 ? 686  GLU A OE1   1 
ATOM   5655 O  OE2   . GLU A 1 686 ? 3.335   16.295  12.121  1.00 50.86 ? 686  GLU A OE2   1 
ATOM   5656 N  N     . ALA A 1 687 ? 4.354   19.717  8.551   1.00 31.33 ? 687  ALA A N     1 
ATOM   5657 C  CA    . ALA A 1 687 ? 5.291   20.828  8.704   1.00 30.94 ? 687  ALA A CA    1 
ATOM   5658 C  C     . ALA A 1 687 ? 6.015   21.228  7.421   1.00 29.60 ? 687  ALA A C     1 
ATOM   5659 O  O     . ALA A 1 687 ? 6.319   20.381  6.584   1.00 28.28 ? 687  ALA A O     1 
ATOM   5660 C  CB    . ALA A 1 687 ? 6.305   20.515  9.806   1.00 30.83 ? 687  ALA A CB    1 
ATOM   5661 N  N     . ILE A 1 688 ? 6.270   22.532  7.283   1.00 29.57 ? 688  ILE A N     1 
ATOM   5662 C  CA    . ILE A 1 688 ? 7.183   23.067  6.273   1.00 29.04 ? 688  ILE A CA    1 
ATOM   5663 C  C     . ILE A 1 688 ? 8.261   23.815  7.038   1.00 31.19 ? 688  ILE A C     1 
ATOM   5664 O  O     . ILE A 1 688 ? 7.967   24.769  7.763   1.00 31.39 ? 688  ILE A O     1 
ATOM   5665 C  CB    . ILE A 1 688 ? 6.475   24.051  5.313   1.00 31.48 ? 688  ILE A CB    1 
ATOM   5666 C  CG1   . ILE A 1 688 ? 5.392   23.336  4.502   1.00 28.14 ? 688  ILE A CG1   1 
ATOM   5667 C  CG2   . ILE A 1 688 ? 7.492   24.752  4.389   1.00 30.62 ? 688  ILE A CG2   1 
ATOM   5668 C  CD1   . ILE A 1 688 ? 4.522   24.285  3.693   1.00 34.03 ? 688  ILE A CD1   1 
ATOM   5669 N  N     . ALA A 1 689 ? 9.506   23.374  6.888   1.00 28.92 ? 689  ALA A N     1 
ATOM   5670 C  CA    . ALA A 1 689 ? 10.581  23.876  7.711   1.00 28.06 ? 689  ALA A CA    1 
ATOM   5671 C  C     . ALA A 1 689 ? 11.825  24.214  6.907   1.00 28.65 ? 689  ALA A C     1 
ATOM   5672 O  O     . ALA A 1 689 ? 12.124  23.570  5.908   1.00 31.04 ? 689  ALA A O     1 
ATOM   5673 C  CB    . ALA A 1 689 ? 10.904  22.878  8.827   1.00 26.48 ? 689  ALA A CB    1 
ATOM   5674 N  N     . GLY A 1 690 ? 12.530  25.245  7.358   1.00 29.79 ? 690  GLY A N     1 
ATOM   5675 C  CA    . GLY A 1 690 ? 13.784  25.683  6.755   1.00 31.32 ? 690  GLY A CA    1 
ATOM   5676 C  C     . GLY A 1 690 ? 14.246  26.960  7.431   1.00 32.62 ? 690  GLY A C     1 
ATOM   5677 O  O     . GLY A 1 690 ? 13.522  27.507  8.269   1.00 34.34 ? 690  GLY A O     1 
ATOM   5678 N  N     . PRO A 1 691 ? 15.451  27.447  7.077   1.00 31.83 ? 691  PRO A N     1 
ATOM   5679 C  CA    . PRO A 1 691 ? 15.991  28.676  7.657   1.00 32.73 ? 691  PRO A CA    1 
ATOM   5680 C  C     . PRO A 1 691 ? 15.367  29.929  7.036   1.00 33.12 ? 691  PRO A C     1 
ATOM   5681 O  O     . PRO A 1 691 ? 14.844  29.858  5.924   1.00 33.30 ? 691  PRO A O     1 
ATOM   5682 C  CB    . PRO A 1 691 ? 17.479  28.598  7.293   1.00 34.29 ? 691  PRO A CB    1 
ATOM   5683 C  CG    . PRO A 1 691 ? 17.508  27.846  6.010   1.00 30.60 ? 691  PRO A CG    1 
ATOM   5684 C  CD    . PRO A 1 691 ? 16.375  26.850  6.092   1.00 33.45 ? 691  PRO A CD    1 
ATOM   5685 N  N     . PRO A 1 692 ? 15.423  31.075  7.742   1.00 35.67 ? 692  PRO A N     1 
ATOM   5686 C  CA    . PRO A 1 692 ? 14.956  32.325  7.122   1.00 36.59 ? 692  PRO A CA    1 
ATOM   5687 C  C     . PRO A 1 692 ? 15.736  32.625  5.849   1.00 38.56 ? 692  PRO A C     1 
ATOM   5688 O  O     . PRO A 1 692 ? 16.945  32.416  5.811   1.00 40.69 ? 692  PRO A O     1 
ATOM   5689 C  CB    . PRO A 1 692 ? 15.250  33.380  8.194   1.00 37.68 ? 692  PRO A CB    1 
ATOM   5690 C  CG    . PRO A 1 692 ? 15.228  32.614  9.492   1.00 35.71 ? 692  PRO A CG    1 
ATOM   5691 C  CD    . PRO A 1 692 ? 15.819  31.272  9.153   1.00 35.43 ? 692  PRO A CD    1 
ATOM   5692 N  N     . LEU A 1 693 ? 15.047  33.086  4.811   1.00 40.79 ? 693  LEU A N     1 
ATOM   5693 C  CA    . LEU A 1 693 ? 15.677  33.338  3.516   1.00 41.62 ? 693  LEU A CA    1 
ATOM   5694 C  C     . LEU A 1 693 ? 16.866  34.286  3.686   1.00 41.04 ? 693  LEU A C     1 
ATOM   5695 O  O     . LEU A 1 693 ? 16.738  35.329  4.321   1.00 40.25 ? 693  LEU A O     1 
ATOM   5696 C  CB    . LEU A 1 693 ? 14.661  33.938  2.533   1.00 42.99 ? 693  LEU A CB    1 
ATOM   5697 C  CG    . LEU A 1 693 ? 14.667  33.568  1.039   1.00 46.03 ? 693  LEU A CG    1 
ATOM   5698 C  CD1   . LEU A 1 693 ? 14.521  34.827  0.198   1.00 45.29 ? 693  LEU A CD1   1 
ATOM   5699 C  CD2   . LEU A 1 693 ? 15.902  32.774  0.594   1.00 45.85 ? 693  LEU A CD2   1 
ATOM   5700 N  N     . GLY A 1 694 ? 18.023  33.892  3.153   1.00 41.53 ? 694  GLY A N     1 
ATOM   5701 C  CA    . GLY A 1 694 ? 19.225  34.722  3.190   1.00 41.68 ? 694  GLY A CA    1 
ATOM   5702 C  C     . GLY A 1 694 ? 20.054  34.609  4.454   1.00 43.41 ? 694  GLY A C     1 
ATOM   5703 O  O     . GLY A 1 694 ? 21.151  35.170  4.529   1.00 45.67 ? 694  GLY A O     1 
ATOM   5704 N  N     . SER A 1 695 ? 19.543  33.882  5.447   1.00 40.73 ? 695  SER A N     1 
ATOM   5705 C  CA    . SER A 1 695 ? 20.232  33.717  6.729   1.00 38.95 ? 695  SER A CA    1 
ATOM   5706 C  C     . SER A 1 695 ? 21.285  32.618  6.667   1.00 38.29 ? 695  SER A C     1 
ATOM   5707 O  O     . SER A 1 695 ? 21.406  31.930  5.662   1.00 35.96 ? 695  SER A O     1 
ATOM   5708 C  CB    . SER A 1 695 ? 19.222  33.376  7.825   1.00 37.32 ? 695  SER A CB    1 
ATOM   5709 O  OG    . SER A 1 695 ? 18.733  32.055  7.650   1.00 35.17 ? 695  SER A OG    1 
ATOM   5710 N  N     . LYS A 1 696 ? 22.031  32.451  7.757   1.00 37.34 ? 696  LYS A N     1 
ATOM   5711 C  CA    . LYS A 1 696 ? 22.945  31.321  7.895   1.00 39.17 ? 696  LYS A CA    1 
ATOM   5712 C  C     . LYS A 1 696 ? 22.380  30.213  8.813   1.00 38.32 ? 696  LYS A C     1 
ATOM   5713 O  O     . LYS A 1 696 ? 23.115  29.324  9.247   1.00 37.42 ? 696  LYS A O     1 
ATOM   5714 C  CB    . LYS A 1 696 ? 24.321  31.804  8.372   1.00 40.89 ? 696  LYS A CB    1 
ATOM   5715 C  CG    . LYS A 1 696 ? 24.983  32.763  7.391   1.00 43.07 ? 696  LYS A CG    1 
ATOM   5716 C  CD    . LYS A 1 696 ? 26.145  33.523  7.997   1.00 49.67 ? 696  LYS A CD    1 
ATOM   5717 C  CE    . LYS A 1 696 ? 26.767  34.439  6.936   1.00 53.20 ? 696  LYS A CE    1 
ATOM   5718 N  NZ    . LYS A 1 696 ? 28.019  35.081  7.396   1.00 58.37 ? 696  LYS A NZ    1 
ATOM   5719 N  N     . GLY A 1 697 ? 21.076  30.263  9.096   1.00 36.10 ? 697  GLY A N     1 
ATOM   5720 C  CA    . GLY A 1 697 ? 20.419  29.218  9.896   1.00 35.12 ? 697  GLY A CA    1 
ATOM   5721 C  C     . GLY A 1 697 ? 20.474  27.861  9.202   1.00 35.33 ? 697  GLY A C     1 
ATOM   5722 O  O     . GLY A 1 697 ? 20.479  27.798  7.976   1.00 37.77 ? 697  GLY A O     1 
ATOM   5723 N  N     . ILE A 1 698 ? 20.543  26.776  9.968   1.00 31.63 ? 698  ILE A N     1 
ATOM   5724 C  CA    . ILE A 1 698 ? 20.660  25.442  9.358   1.00 31.81 ? 698  ILE A CA    1 
ATOM   5725 C  C     . ILE A 1 698 ? 19.309  24.789  9.064   1.00 31.65 ? 698  ILE A C     1 
ATOM   5726 O  O     . ILE A 1 698 ? 19.240  23.812  8.314   1.00 31.87 ? 698  ILE A O     1 
ATOM   5727 C  CB    . ILE A 1 698 ? 21.571  24.481  10.170  1.00 33.05 ? 698  ILE A CB    1 
ATOM   5728 C  CG1   . ILE A 1 698 ? 20.952  24.161  11.539  1.00 30.92 ? 698  ILE A CG1   1 
ATOM   5729 C  CG2   . ILE A 1 698 ? 23.003  25.060  10.276  1.00 31.84 ? 698  ILE A CG2   1 
ATOM   5730 C  CD1   . ILE A 1 698 ? 21.571  22.954  12.263  1.00 29.69 ? 698  ILE A CD1   1 
ATOM   5731 N  N     . GLY A 1 699 ? 18.240  25.321  9.655   1.00 29.58 ? 699  GLY A N     1 
ATOM   5732 C  CA    . GLY A 1 699 ? 16.893  24.874  9.317   1.00 29.40 ? 699  GLY A CA    1 
ATOM   5733 C  C     . GLY A 1 699 ? 16.393  23.781  10.240  1.00 28.05 ? 699  GLY A C     1 
ATOM   5734 O  O     . GLY A 1 699 ? 15.357  23.934  10.870  1.00 25.53 ? 699  GLY A O     1 
ATOM   5735 N  N     . GLY A 1 700 ? 17.133  22.681  10.324  1.00 28.47 ? 700  GLY A N     1 
ATOM   5736 C  CA    . GLY A 1 700 ? 16.789  21.599  11.236  1.00 27.17 ? 700  GLY A CA    1 
ATOM   5737 C  C     . GLY A 1 700 ? 17.964  20.681  11.504  1.00 29.91 ? 700  GLY A C     1 
ATOM   5738 O  O     . GLY A 1 700 ? 19.032  20.857  10.903  1.00 30.29 ? 700  GLY A O     1 
ATOM   5739 N  N     . PHE A 1 701 ? 17.769  19.721  12.417  1.00 27.27 ? 701  PHE A N     1 
ATOM   5740 C  CA    . PHE A 1 701 ? 18.722  18.630  12.656  1.00 26.16 ? 701  PHE A CA    1 
ATOM   5741 C  C     . PHE A 1 701 ? 18.069  17.427  13.362  1.00 26.48 ? 701  PHE A C     1 
ATOM   5742 O  O     . PHE A 1 701 ? 17.059  17.574  14.054  1.00 26.18 ? 701  PHE A O     1 
ATOM   5743 C  CB    . PHE A 1 701 ? 19.978  19.107  13.410  1.00 27.63 ? 701  PHE A CB    1 
ATOM   5744 C  CG    . PHE A 1 701 ? 19.727  19.526  14.841  1.00 27.72 ? 701  PHE A CG    1 
ATOM   5745 C  CD1   . PHE A 1 701 ? 19.327  20.829  15.141  1.00 24.88 ? 701  PHE A CD1   1 
ATOM   5746 C  CD2   . PHE A 1 701 ? 19.911  18.623  15.887  1.00 26.68 ? 701  PHE A CD2   1 
ATOM   5747 C  CE1   . PHE A 1 701 ? 19.093  21.220  16.465  1.00 26.24 ? 701  PHE A CE1   1 
ATOM   5748 C  CE2   . PHE A 1 701 ? 19.689  19.004  17.223  1.00 26.66 ? 701  PHE A CE2   1 
ATOM   5749 C  CZ    . PHE A 1 701 ? 19.279  20.304  17.513  1.00 23.92 ? 701  PHE A CZ    1 
ATOM   5750 N  N     . TRP A 1 702 ? 18.638  16.244  13.126  1.00 24.88 ? 702  TRP A N     1 
ATOM   5751 C  CA    . TRP A 1 702 ? 18.311  15.010  13.836  1.00 24.40 ? 702  TRP A CA    1 
ATOM   5752 C  C     . TRP A 1 702 ? 19.576  14.506  14.523  1.00 25.25 ? 702  TRP A C     1 
ATOM   5753 O  O     . TRP A 1 702 ? 20.667  14.559  13.940  1.00 25.92 ? 702  TRP A O     1 
ATOM   5754 C  CB    . TRP A 1 702 ? 17.827  13.936  12.848  1.00 23.91 ? 702  TRP A CB    1 
ATOM   5755 C  CG    . TRP A 1 702 ? 16.331  13.846  12.678  1.00 24.58 ? 702  TRP A CG    1 
ATOM   5756 C  CD1   . TRP A 1 702 ? 15.501  12.873  13.188  1.00 24.09 ? 702  TRP A CD1   1 
ATOM   5757 C  CD2   . TRP A 1 702 ? 15.491  14.734  11.930  1.00 23.91 ? 702  TRP A CD2   1 
ATOM   5758 N  NE1   . TRP A 1 702 ? 14.197  13.121  12.823  1.00 23.54 ? 702  TRP A NE1   1 
ATOM   5759 C  CE2   . TRP A 1 702 ? 14.161  14.253  12.049  1.00 26.88 ? 702  TRP A CE2   1 
ATOM   5760 C  CE3   . TRP A 1 702 ? 15.727  15.899  11.187  1.00 29.16 ? 702  TRP A CE3   1 
ATOM   5761 C  CZ2   . TRP A 1 702 ? 13.073  14.897  11.447  1.00 24.65 ? 702  TRP A CZ2   1 
ATOM   5762 C  CZ3   . TRP A 1 702 ? 14.640  16.547  10.592  1.00 28.90 ? 702  TRP A CZ3   1 
ATOM   5763 C  CH2   . TRP A 1 702 ? 13.332  16.037  10.722  1.00 29.66 ? 702  TRP A CH2   1 
ATOM   5764 N  N     . THR A 1 703 ? 19.441  14.002  15.746  1.00 25.83 ? 703  THR A N     1 
ATOM   5765 C  CA    . THR A 1 703 ? 20.572  13.380  16.424  1.00 26.90 ? 703  THR A CA    1 
ATOM   5766 C  C     . THR A 1 703 ? 20.407  11.857  16.443  1.00 27.00 ? 703  THR A C     1 
ATOM   5767 O  O     . THR A 1 703 ? 21.379  11.120  16.609  1.00 26.97 ? 703  THR A O     1 
ATOM   5768 C  CB    . THR A 1 703 ? 20.766  13.899  17.888  1.00 27.79 ? 703  THR A CB    1 
ATOM   5769 O  OG1   . THR A 1 703 ? 19.896  13.193  18.769  1.00 27.00 ? 703  THR A OG1   1 
ATOM   5770 C  CG2   . THR A 1 703 ? 20.481  15.401  18.013  1.00 30.26 ? 703  THR A CG2   1 
ATOM   5771 N  N     . GLY A 1 704 ? 19.168  11.394  16.283  1.00 29.46 ? 704  GLY A N     1 
ATOM   5772 C  CA    . GLY A 1 704 ? 18.827  9.963   16.363  1.00 25.87 ? 704  GLY A CA    1 
ATOM   5773 C  C     . GLY A 1 704 ? 17.321  9.831   16.331  1.00 25.91 ? 704  GLY A C     1 
ATOM   5774 O  O     . GLY A 1 704 ? 16.633  10.833  16.137  1.00 23.01 ? 704  GLY A O     1 
ATOM   5775 N  N     . LYS A 1 705 ? 16.809  8.609   16.520  1.00 24.36 ? 705  LYS A N     1 
ATOM   5776 C  CA    . LYS A 1 705 ? 15.357  8.361   16.595  1.00 22.83 ? 705  LYS A CA    1 
ATOM   5777 C  C     . LYS A 1 705 ? 14.720  9.192   17.697  1.00 22.87 ? 705  LYS A C     1 
ATOM   5778 O  O     . LYS A 1 705 ? 15.291  9.327   18.772  1.00 22.78 ? 705  LYS A O     1 
ATOM   5779 C  CB    . LYS A 1 705 ? 15.069  6.884   16.878  1.00 22.53 ? 705  LYS A CB    1 
ATOM   5780 C  CG    . LYS A 1 705 ? 15.457  5.949   15.743  1.00 22.37 ? 705  LYS A CG    1 
ATOM   5781 C  CD    . LYS A 1 705 ? 15.225  4.493   16.104  1.00 25.17 ? 705  LYS A CD    1 
ATOM   5782 C  CE    . LYS A 1 705 ? 15.419  3.595   14.889  1.00 27.97 ? 705  LYS A CE    1 
ATOM   5783 N  NZ    . LYS A 1 705 ? 15.193  2.152   15.203  1.00 24.74 ? 705  LYS A NZ    1 
ATOM   5784 N  N     . LYS A 1 706 ? 13.537  9.744   17.422  1.00 24.69 ? 706  LYS A N     1 
ATOM   5785 C  CA    . LYS A 1 706 ? 12.750  10.490  18.417  1.00 22.55 ? 706  LYS A CA    1 
ATOM   5786 C  C     . LYS A 1 706 ? 13.510  11.674  19.035  1.00 24.19 ? 706  LYS A C     1 
ATOM   5787 O  O     . LYS A 1 706 ? 13.234  12.078  20.169  1.00 25.65 ? 706  LYS A O     1 
ATOM   5788 C  CB    . LYS A 1 706 ? 12.238  9.548   19.517  1.00 23.16 ? 706  LYS A CB    1 
ATOM   5789 C  CG    . LYS A 1 706 ? 11.428  8.379   19.000  1.00 23.30 ? 706  LYS A CG    1 
ATOM   5790 C  CD    . LYS A 1 706 ? 10.893  7.507   20.122  1.00 24.21 ? 706  LYS A CD    1 
ATOM   5791 C  CE    . LYS A 1 706 ? 10.176  6.289   19.561  1.00 22.90 ? 706  LYS A CE    1 
ATOM   5792 N  NZ    . LYS A 1 706 ? 8.870   6.619   18.923  1.00 21.99 ? 706  LYS A NZ    1 
ATOM   5793 N  N     . ARG A 1 707 ? 14.457  12.230  18.282  1.00 25.28 ? 707  ARG A N     1 
ATOM   5794 C  CA    . ARG A 1 707 ? 15.257  13.370  18.744  1.00 26.35 ? 707  ARG A CA    1 
ATOM   5795 C  C     . ARG A 1 707 ? 15.578  14.270  17.570  1.00 27.27 ? 707  ARG A C     1 
ATOM   5796 O  O     . ARG A 1 707 ? 16.432  13.931  16.746  1.00 28.92 ? 707  ARG A O     1 
ATOM   5797 C  CB    . ARG A 1 707 ? 16.555  12.891  19.398  1.00 27.12 ? 707  ARG A CB    1 
ATOM   5798 C  CG    . ARG A 1 707 ? 16.396  12.341  20.825  1.00 27.24 ? 707  ARG A CG    1 
ATOM   5799 C  CD    . ARG A 1 707 ? 17.739  11.888  21.411  1.00 27.02 ? 707  ARG A CD    1 
ATOM   5800 N  NE    . ARG A 1 707 ? 18.699  12.992  21.521  1.00 31.01 ? 707  ARG A NE    1 
ATOM   5801 C  CZ    . ARG A 1 707 ? 18.828  13.795  22.581  1.00 32.48 ? 707  ARG A CZ    1 
ATOM   5802 N  NH1   . ARG A 1 707 ? 18.065  13.627  23.662  1.00 28.15 ? 707  ARG A NH1   1 
ATOM   5803 N  NH2   . ARG A 1 707 ? 19.731  14.774  22.561  1.00 28.72 ? 707  ARG A NH2   1 
ATOM   5804 N  N     . TYR A 1 708 ? 14.889  15.410  17.490  1.00 25.63 ? 708  TYR A N     1 
ATOM   5805 C  CA    . TYR A 1 708 ? 15.053  16.333  16.371  1.00 24.68 ? 708  TYR A CA    1 
ATOM   5806 C  C     . TYR A 1 708 ? 14.467  17.720  16.630  1.00 24.60 ? 708  TYR A C     1 
ATOM   5807 O  O     . TYR A 1 708 ? 13.698  17.918  17.567  1.00 23.07 ? 708  TYR A O     1 
ATOM   5808 C  CB    . TYR A 1 708 ? 14.468  15.745  15.076  1.00 25.46 ? 708  TYR A CB    1 
ATOM   5809 C  CG    . TYR A 1 708 ? 12.977  15.452  15.094  1.00 27.44 ? 708  TYR A CG    1 
ATOM   5810 C  CD1   . TYR A 1 708 ? 12.499  14.225  15.558  1.00 26.80 ? 708  TYR A CD1   1 
ATOM   5811 C  CD2   . TYR A 1 708 ? 12.051  16.384  14.625  1.00 25.73 ? 708  TYR A CD2   1 
ATOM   5812 C  CE1   . TYR A 1 708 ? 11.154  13.937  15.577  1.00 25.45 ? 708  TYR A CE1   1 
ATOM   5813 C  CE2   . TYR A 1 708 ? 10.681  16.098  14.622  1.00 28.11 ? 708  TYR A CE2   1 
ATOM   5814 C  CZ    . TYR A 1 708 ? 10.242  14.864  15.104  1.00 31.45 ? 708  TYR A CZ    1 
ATOM   5815 O  OH    . TYR A 1 708 ? 8.896   14.541  15.124  1.00 26.86 ? 708  TYR A OH    1 
ATOM   5816 N  N     . ALA A 1 709 ? 14.851  18.670  15.781  1.00 26.14 ? 709  ALA A N     1 
ATOM   5817 C  CA    . ALA A 1 709 ? 14.390  20.051  15.869  1.00 25.78 ? 709  ALA A CA    1 
ATOM   5818 C  C     . ALA A 1 709 ? 14.237  20.650  14.471  1.00 26.33 ? 709  ALA A C     1 
ATOM   5819 O  O     . ALA A 1 709 ? 15.035  20.361  13.569  1.00 25.15 ? 709  ALA A O     1 
ATOM   5820 C  CB    . ALA A 1 709 ? 15.374  20.887  16.710  1.00 23.92 ? 709  ALA A CB    1 
ATOM   5821 N  N     . LEU A 1 710 ? 13.204  21.478  14.302  1.00 28.40 ? 710  LEU A N     1 
ATOM   5822 C  CA    . LEU A 1 710 ? 12.878  22.106  13.019  1.00 28.07 ? 710  LEU A CA    1 
ATOM   5823 C  C     . LEU A 1 710 ? 12.361  23.516  13.216  1.00 29.96 ? 710  LEU A C     1 
ATOM   5824 O  O     . LEU A 1 710 ? 11.594  23.787  14.145  1.00 28.88 ? 710  LEU A O     1 
ATOM   5825 C  CB    . LEU A 1 710 ? 11.808  21.315  12.274  1.00 27.00 ? 710  LEU A CB    1 
ATOM   5826 C  CG    . LEU A 1 710 ? 12.127  19.907  11.793  1.00 28.03 ? 710  LEU A CG    1 
ATOM   5827 C  CD1   . LEU A 1 710 ? 10.825  19.176  11.478  1.00 30.23 ? 710  LEU A CD1   1 
ATOM   5828 C  CD2   . LEU A 1 710 ? 13.072  19.931  10.581  1.00 27.47 ? 710  LEU A CD2   1 
ATOM   5829 N  N     . ASN A 1 711 ? 12.779  24.406  12.328  1.00 28.01 ? 711  ASN A N     1 
ATOM   5830 C  CA    . ASN A 1 711 ? 12.270  25.765  12.319  1.00 29.03 ? 711  ASN A CA    1 
ATOM   5831 C  C     . ASN A 1 711 ? 11.048  25.832  11.399  1.00 26.69 ? 711  ASN A C     1 
ATOM   5832 O  O     . ASN A 1 711 ? 11.178  25.882  10.187  1.00 26.61 ? 711  ASN A O     1 
ATOM   5833 C  CB    . ASN A 1 711 ? 13.374  26.725  11.881  1.00 27.56 ? 711  ASN A CB    1 
ATOM   5834 C  CG    . ASN A 1 711 ? 12.962  28.166  11.987  1.00 27.94 ? 711  ASN A CG    1 
ATOM   5835 O  OD1   . ASN A 1 711 ? 12.461  28.595  13.014  1.00 28.13 ? 711  ASN A OD1   1 
ATOM   5836 N  ND2   . ASN A 1 711 ? 13.187  28.929  10.926  1.00 28.69 ? 711  ASN A ND2   1 
ATOM   5837 N  N     . VAL A 1 712 ? 9.860   25.797  11.990  1.00 28.15 ? 712  VAL A N     1 
ATOM   5838 C  CA    . VAL A 1 712 ? 8.632   25.627  11.224  1.00 28.81 ? 712  VAL A CA    1 
ATOM   5839 C  C     . VAL A 1 712 ? 7.968   26.960  10.913  1.00 29.74 ? 712  VAL A C     1 
ATOM   5840 O  O     . VAL A 1 712 ? 7.824   27.803  11.793  1.00 31.68 ? 712  VAL A O     1 
ATOM   5841 C  CB    . VAL A 1 712 ? 7.634   24.671  11.941  1.00 29.13 ? 712  VAL A CB    1 
ATOM   5842 C  CG1   . VAL A 1 712 ? 6.365   24.499  11.124  1.00 28.36 ? 712  VAL A CG1   1 
ATOM   5843 C  CG2   . VAL A 1 712 ? 8.277   23.316  12.181  1.00 26.68 ? 712  VAL A CG2   1 
ATOM   5844 N  N     . TRP A 1 713 ? 7.570   27.134  9.651   1.00 28.97 ? 713  TRP A N     1 
ATOM   5845 C  CA    . TRP A 1 713 ? 6.873   28.339  9.195   1.00 28.66 ? 713  TRP A CA    1 
ATOM   5846 C  C     . TRP A 1 713 ? 5.375   28.105  9.035   1.00 28.84 ? 713  TRP A C     1 
ATOM   5847 O  O     . TRP A 1 713 ? 4.575   29.036  9.150   1.00 27.19 ? 713  TRP A O     1 
ATOM   5848 C  CB    . TRP A 1 713 ? 7.461   28.833  7.869   1.00 28.95 ? 713  TRP A CB    1 
ATOM   5849 C  CG    . TRP A 1 713 ? 8.926   29.121  7.958   1.00 30.46 ? 713  TRP A CG    1 
ATOM   5850 C  CD1   . TRP A 1 713 ? 9.944   28.239  7.734   1.00 33.22 ? 713  TRP A CD1   1 
ATOM   5851 C  CD2   . TRP A 1 713 ? 9.542   30.359  8.334   1.00 29.85 ? 713  TRP A CD2   1 
ATOM   5852 N  NE1   . TRP A 1 713 ? 11.157  28.856  7.930   1.00 31.66 ? 713  TRP A NE1   1 
ATOM   5853 C  CE2   . TRP A 1 713 ? 10.942  30.155  8.300   1.00 29.61 ? 713  TRP A CE2   1 
ATOM   5854 C  CE3   . TRP A 1 713 ? 9.049   31.623  8.686   1.00 31.00 ? 713  TRP A CE3   1 
ATOM   5855 C  CZ2   . TRP A 1 713 ? 11.861  31.169  8.606   1.00 28.67 ? 713  TRP A CZ2   1 
ATOM   5856 C  CZ3   . TRP A 1 713 ? 9.962   32.638  8.981   1.00 30.92 ? 713  TRP A CZ3   1 
ATOM   5857 C  CH2   . TRP A 1 713 ? 11.355  32.400  8.940   1.00 30.29 ? 713  TRP A CH2   1 
ATOM   5858 N  N     . ASP A 1 714 ? 5.015   26.856  8.762   1.00 28.13 ? 714  ASP A N     1 
ATOM   5859 C  CA    . ASP A 1 714 ? 3.641   26.473  8.523   1.00 28.83 ? 714  ASP A CA    1 
ATOM   5860 C  C     . ASP A 1 714 ? 3.364   25.064  9.056   1.00 28.08 ? 714  ASP A C     1 
ATOM   5861 O  O     . ASP A 1 714 ? 4.083   24.117  8.747   1.00 26.07 ? 714  ASP A O     1 
ATOM   5862 C  CB    . ASP A 1 714 ? 3.302   26.573  7.027   1.00 30.16 ? 714  ASP A CB    1 
ATOM   5863 C  CG    . ASP A 1 714 ? 1.813   26.466  6.759   1.00 30.57 ? 714  ASP A CG    1 
ATOM   5864 O  OD1   . ASP A 1 714 ? 1.240   25.371  6.944   1.00 32.47 ? 714  ASP A OD1   1 
ATOM   5865 O  OD2   . ASP A 1 714 ? 1.210   27.479  6.374   1.00 33.71 ? 714  ASP A OD2   1 
ATOM   5866 N  N     . MET A 1 715 ? 2.309   24.944  9.857   1.00 28.55 ? 715  MET A N     1 
ATOM   5867 C  CA    . MET A 1 715 ? 1.912   23.665  10.437  1.00 29.34 ? 715  MET A CA    1 
ATOM   5868 C  C     . MET A 1 715 ? 0.445   23.428  10.078  1.00 29.94 ? 715  MET A C     1 
ATOM   5869 O  O     . MET A 1 715 ? -0.439  24.153  10.542  1.00 30.57 ? 715  MET A O     1 
ATOM   5870 C  CB    . MET A 1 715 ? 2.134   23.670  11.957  1.00 29.96 ? 715  MET A CB    1 
ATOM   5871 C  CG    . MET A 1 715 ? 2.006   22.318  12.640  1.00 37.98 ? 715  MET A CG    1 
ATOM   5872 S  SD    . MET A 1 715 ? 3.344   21.166  12.250  1.00 47.32 ? 715  MET A SD    1 
ATOM   5873 C  CE    . MET A 1 715 ? 3.277   20.100  13.693  1.00 52.24 ? 715  MET A CE    1 
ATOM   5874 N  N     . GLU A 1 716 ? 0.216   22.415  9.244   1.00 30.87 ? 716  GLU A N     1 
ATOM   5875 C  CA    . GLU A 1 716 ? -1.080  22.127  8.598   1.00 33.90 ? 716  GLU A CA    1 
ATOM   5876 C  C     . GLU A 1 716 ? -2.046  23.307  8.409   1.00 33.74 ? 716  GLU A C     1 
ATOM   5877 O  O     . GLU A 1 716 ? -3.177  23.307  8.928   1.00 32.88 ? 716  GLU A O     1 
ATOM   5878 C  CB    . GLU A 1 716 ? -1.785  20.916  9.228   1.00 35.55 ? 716  GLU A CB    1 
ATOM   5879 C  CG    . GLU A 1 716 ? -2.060  21.007  10.711  1.00 38.67 ? 716  GLU A CG    1 
ATOM   5880 C  CD    . GLU A 1 716 ? -2.820  19.795  11.227  1.00 42.78 ? 716  GLU A CD    1 
ATOM   5881 O  OE1   . GLU A 1 716 ? -3.782  19.343  10.550  1.00 40.89 ? 716  GLU A OE1   1 
ATOM   5882 O  OE2   . GLU A 1 716 ? -2.445  19.296  12.312  1.00 43.25 ? 716  GLU A OE2   1 
ATOM   5883 N  N     . GLY A 1 717 ? -1.589  24.301  7.653   1.00 32.14 ? 717  GLY A N     1 
ATOM   5884 C  CA    . GLY A 1 717 ? -2.445  25.418  7.254   1.00 32.54 ? 717  GLY A CA    1 
ATOM   5885 C  C     . GLY A 1 717 ? -2.328  26.645  8.136   1.00 32.44 ? 717  GLY A C     1 
ATOM   5886 O  O     . GLY A 1 717 ? -2.807  27.716  7.768   1.00 35.32 ? 717  GLY A O     1 
ATOM   5887 N  N     . THR A 1 718 ? -1.700  26.498  9.299   1.00 29.78 ? 718  THR A N     1 
ATOM   5888 C  CA    . THR A 1 718 ? -1.406  27.651  10.145  1.00 31.28 ? 718  THR A CA    1 
ATOM   5889 C  C     . THR A 1 718 ? -0.085  28.274  9.722   1.00 31.08 ? 718  THR A C     1 
ATOM   5890 O  O     . THR A 1 718 ? 0.979   27.685  9.915   1.00 29.18 ? 718  THR A O     1 
ATOM   5891 C  CB    . THR A 1 718 ? -1.371  27.281  11.635  1.00 31.88 ? 718  THR A CB    1 
ATOM   5892 O  OG1   . THR A 1 718 ? -2.645  26.740  12.005  1.00 30.64 ? 718  THR A OG1   1 
ATOM   5893 C  CG2   . THR A 1 718 ? -1.062  28.519  12.507  1.00 31.46 ? 718  THR A CG2   1 
ATOM   5894 N  N     . ARG A 1 719 ? -0.166  29.455  9.120   1.00 31.16 ? 719  ARG A N     1 
ATOM   5895 C  CA    . ARG A 1 719 ? 1.034   30.188  8.732   1.00 33.96 ? 719  ARG A CA    1 
ATOM   5896 C  C     . ARG A 1 719 ? 1.413   31.126  9.864   1.00 34.01 ? 719  ARG A C     1 
ATOM   5897 O  O     . ARG A 1 719 ? 0.639   32.007  10.227  1.00 34.57 ? 719  ARG A O     1 
ATOM   5898 C  CB    . ARG A 1 719 ? 0.819   30.971  7.430   1.00 33.77 ? 719  ARG A CB    1 
ATOM   5899 C  CG    . ARG A 1 719 ? 2.091   31.649  6.889   1.00 35.66 ? 719  ARG A CG    1 
ATOM   5900 C  CD    . ARG A 1 719 ? 3.101   30.606  6.378   1.00 34.49 ? 719  ARG A CD    1 
ATOM   5901 N  NE    . ARG A 1 719 ? 2.456   29.703  5.436   1.00 34.84 ? 719  ARG A NE    1 
ATOM   5902 C  CZ    . ARG A 1 719 ? 2.359   29.923  4.129   1.00 36.98 ? 719  ARG A CZ    1 
ATOM   5903 N  NH1   . ARG A 1 719 ? 2.903   31.005  3.586   1.00 37.40 ? 719  ARG A NH1   1 
ATOM   5904 N  NH2   . ARG A 1 719 ? 1.734   29.041  3.364   1.00 37.55 ? 719  ARG A NH2   1 
ATOM   5905 N  N     . TYR A 1 720 ? 2.596   30.922  10.429  1.00 35.13 ? 720  TYR A N     1 
ATOM   5906 C  CA    . TYR A 1 720 ? 3.008   31.670  11.609  1.00 38.43 ? 720  TYR A CA    1 
ATOM   5907 C  C     . TYR A 1 720 ? 3.508   33.057  11.250  1.00 40.16 ? 720  TYR A C     1 
ATOM   5908 O  O     . TYR A 1 720 ? 4.175   33.232  10.230  1.00 39.61 ? 720  TYR A O     1 
ATOM   5909 C  CB    . TYR A 1 720 ? 4.096   30.916  12.370  1.00 37.66 ? 720  TYR A CB    1 
ATOM   5910 C  CG    . TYR A 1 720 ? 3.655   29.585  12.938  1.00 37.20 ? 720  TYR A CG    1 
ATOM   5911 C  CD1   . TYR A 1 720 ? 2.688   29.512  13.943  1.00 39.38 ? 720  TYR A CD1   1 
ATOM   5912 C  CD2   . TYR A 1 720 ? 4.223   28.401  12.484  1.00 37.56 ? 720  TYR A CD2   1 
ATOM   5913 C  CE1   . TYR A 1 720 ? 2.284   28.282  14.467  1.00 38.62 ? 720  TYR A CE1   1 
ATOM   5914 C  CE2   . TYR A 1 720 ? 3.834   27.171  13.004  1.00 40.75 ? 720  TYR A CE2   1 
ATOM   5915 C  CZ    . TYR A 1 720 ? 2.868   27.121  13.987  1.00 41.89 ? 720  TYR A CZ    1 
ATOM   5916 O  OH    . TYR A 1 720 ? 2.498   25.898  14.486  1.00 49.24 ? 720  TYR A OH    1 
ATOM   5917 N  N     . ALA A 1 721 ? 3.171   34.036  12.090  1.00 41.37 ? 721  ALA A N     1 
ATOM   5918 C  CA    . ALA A 1 721 ? 3.750   35.378  11.995  1.00 42.57 ? 721  ALA A CA    1 
ATOM   5919 C  C     . ALA A 1 721 ? 5.259   35.317  12.260  1.00 42.49 ? 721  ALA A C     1 
ATOM   5920 O  O     . ALA A 1 721 ? 6.049   35.926  11.534  1.00 42.57 ? 721  ALA A O     1 
ATOM   5921 C  CB    . ALA A 1 721 ? 3.063   36.329  12.971  1.00 43.43 ? 721  ALA A CB    1 
ATOM   5922 N  N     . GLU A 1 722 ? 5.646   34.566  13.294  1.00 41.41 ? 722  GLU A N     1 
ATOM   5923 C  CA    . GLU A 1 722 ? 7.052   34.315  13.610  1.00 41.02 ? 722  GLU A CA    1 
ATOM   5924 C  C     . GLU A 1 722 ? 7.323   32.811  13.575  1.00 38.50 ? 722  GLU A C     1 
ATOM   5925 O  O     . GLU A 1 722 ? 6.506   32.029  14.060  1.00 36.19 ? 722  GLU A O     1 
ATOM   5926 C  CB    . GLU A 1 722 ? 7.413   34.877  14.991  1.00 43.90 ? 722  GLU A CB    1 
ATOM   5927 C  CG    . GLU A 1 722 ? 7.050   36.364  15.226  1.00 50.65 ? 722  GLU A CG    1 
ATOM   5928 C  CD    . GLU A 1 722 ? 7.787   37.347  14.309  1.00 57.32 ? 722  GLU A CD    1 
ATOM   5929 O  OE1   . GLU A 1 722 ? 8.762   36.946  13.633  1.00 58.61 ? 722  GLU A OE1   1 
ATOM   5930 O  OE2   . GLU A 1 722 ? 7.382   38.535  14.268  1.00 60.54 ? 722  GLU A OE2   1 
ATOM   5931 N  N     . PRO A 1 723 ? 8.473   32.397  13.013  1.00 35.95 ? 723  PRO A N     1 
ATOM   5932 C  CA    . PRO A 1 723 ? 8.775   30.961  12.917  1.00 33.95 ? 723  PRO A CA    1 
ATOM   5933 C  C     . PRO A 1 723 ? 8.725   30.272  14.280  1.00 34.06 ? 723  PRO A C     1 
ATOM   5934 O  O     . PRO A 1 723 ? 9.101   30.864  15.292  1.00 33.68 ? 723  PRO A O     1 
ATOM   5935 C  CB    . PRO A 1 723 ? 10.201  30.927  12.353  1.00 32.04 ? 723  PRO A CB    1 
ATOM   5936 C  CG    . PRO A 1 723 ? 10.761  32.303  12.626  1.00 35.34 ? 723  PRO A CG    1 
ATOM   5937 C  CD    . PRO A 1 723 ? 9.582   33.227  12.515  1.00 35.96 ? 723  PRO A CD    1 
ATOM   5938 N  N     . LYS A 1 724 ? 8.261   29.029  14.294  1.00 33.69 ? 724  LYS A N     1 
ATOM   5939 C  CA    . LYS A 1 724 ? 8.054   28.301  15.530  1.00 33.89 ? 724  LYS A CA    1 
ATOM   5940 C  C     . LYS A 1 724 ? 8.983   27.099  15.559  1.00 33.97 ? 724  LYS A C     1 
ATOM   5941 O  O     . LYS A 1 724 ? 9.044   26.328  14.595  1.00 33.65 ? 724  LYS A O     1 
ATOM   5942 C  CB    . LYS A 1 724 ? 6.595   27.844  15.624  1.00 36.26 ? 724  LYS A CB    1 
ATOM   5943 C  CG    . LYS A 1 724 ? 6.235   27.067  16.886  1.00 41.51 ? 724  LYS A CG    1 
ATOM   5944 C  CD    . LYS A 1 724 ? 5.678   27.978  17.970  1.00 51.18 ? 724  LYS A CD    1 
ATOM   5945 C  CE    . LYS A 1 724 ? 4.148   28.008  17.957  1.00 54.10 ? 724  LYS A CE    1 
ATOM   5946 N  NZ    . LYS A 1 724 ? 3.566   26.753  18.519  1.00 54.83 ? 724  LYS A NZ    1 
ATOM   5947 N  N     . LEU A 1 725 ? 9.706   26.941  16.664  1.00 31.08 ? 725  LEU A N     1 
ATOM   5948 C  CA    . LEU A 1 725 ? 10.555  25.771  16.844  1.00 30.33 ? 725  LEU A CA    1 
ATOM   5949 C  C     . LEU A 1 725 ? 9.705   24.549  17.179  1.00 29.14 ? 725  LEU A C     1 
ATOM   5950 O  O     . LEU A 1 725 ? 8.928   24.578  18.119  1.00 29.10 ? 725  LEU A O     1 
ATOM   5951 C  CB    . LEU A 1 725 ? 11.587  26.023  17.945  1.00 30.83 ? 725  LEU A CB    1 
ATOM   5952 C  CG    . LEU A 1 725 ? 12.588  27.170  17.748  1.00 33.52 ? 725  LEU A CG    1 
ATOM   5953 C  CD1   . LEU A 1 725 ? 13.525  27.262  18.937  1.00 33.35 ? 725  LEU A CD1   1 
ATOM   5954 C  CD2   . LEU A 1 725 ? 13.385  27.008  16.459  1.00 34.67 ? 725  LEU A CD2   1 
ATOM   5955 N  N     . LYS A 1 726 ? 9.817   23.497  16.375  1.00 27.95 ? 726  LYS A N     1 
ATOM   5956 C  CA    . LYS A 1 726 ? 9.245   22.216  16.741  1.00 26.35 ? 726  LYS A CA    1 
ATOM   5957 C  C     . LYS A 1 726 ? 10.398  21.317  17.167  1.00 25.56 ? 726  LYS A C     1 
ATOM   5958 O  O     . LYS A 1 726 ? 11.186  20.854  16.331  1.00 25.04 ? 726  LYS A O     1 
ATOM   5959 C  CB    . LYS A 1 726 ? 8.459   21.590  15.586  1.00 27.50 ? 726  LYS A CB    1 
ATOM   5960 C  CG    . LYS A 1 726 ? 7.870   20.220  15.956  1.00 32.94 ? 726  LYS A CG    1 
ATOM   5961 C  CD    . LYS A 1 726 ? 7.174   19.542  14.786  1.00 39.41 ? 726  LYS A CD    1 
ATOM   5962 C  CE    . LYS A 1 726 ? 6.689   18.140  15.152  1.00 43.95 ? 726  LYS A CE    1 
ATOM   5963 N  NZ    . LYS A 1 726 ? 5.656   18.143  16.237  1.00 46.49 ? 726  LYS A NZ    1 
ATOM   5964 N  N     . ILE A 1 727 ? 10.504  21.098  18.473  1.00 24.48 ? 727  ILE A N     1 
ATOM   5965 C  CA    . ILE A 1 727 ? 11.577  20.297  19.044  1.00 24.77 ? 727  ILE A CA    1 
ATOM   5966 C  C     . ILE A 1 727 ? 10.982  19.057  19.697  1.00 25.27 ? 727  ILE A C     1 
ATOM   5967 O  O     . ILE A 1 727 ? 10.141  19.160  20.591  1.00 24.98 ? 727  ILE A O     1 
ATOM   5968 C  CB    . ILE A 1 727 ? 12.360  21.080  20.108  1.00 22.21 ? 727  ILE A CB    1 
ATOM   5969 C  CG1   . ILE A 1 727 ? 12.876  22.407  19.539  1.00 22.63 ? 727  ILE A CG1   1 
ATOM   5970 C  CG2   . ILE A 1 727 ? 13.509  20.231  20.649  1.00 19.39 ? 727  ILE A CG2   1 
ATOM   5971 C  CD1   . ILE A 1 727 ? 13.304  23.409  20.606  1.00 20.15 ? 727  ILE A CD1   1 
ATOM   5972 N  N     . MET A 1 728 ? 11.421  17.889  19.250  1.00 23.86 ? 728  MET A N     1 
ATOM   5973 C  CA    . MET A 1 728 ? 10.911  16.643  19.808  1.00 25.02 ? 728  MET A CA    1 
ATOM   5974 C  C     . MET A 1 728 ? 12.020  15.856  20.481  1.00 25.45 ? 728  MET A C     1 
ATOM   5975 O  O     . MET A 1 728 ? 13.075  15.628  19.889  1.00 27.21 ? 728  MET A O     1 
ATOM   5976 C  CB    . MET A 1 728 ? 10.229  15.781  18.741  1.00 24.93 ? 728  MET A CB    1 
ATOM   5977 C  CG    . MET A 1 728 ? 9.122   16.480  17.930  1.00 30.21 ? 728  MET A CG    1 
ATOM   5978 S  SD    . MET A 1 728 ? 7.844   17.354  18.867  1.00 37.30 ? 728  MET A SD    1 
ATOM   5979 C  CE    . MET A 1 728 ? 7.130   16.034  19.851  1.00 33.36 ? 728  MET A CE    1 
ATOM   5980 N  N     . GLY A 1 729 ? 11.768  15.461  21.729  1.00 24.06 ? 729  GLY A N     1 
ATOM   5981 C  CA    . GLY A 1 729 ? 12.618  14.533  22.454  1.00 22.74 ? 729  GLY A CA    1 
ATOM   5982 C  C     . GLY A 1 729 ? 13.869  15.105  23.085  1.00 22.86 ? 729  GLY A C     1 
ATOM   5983 O  O     . GLY A 1 729 ? 14.331  14.588  24.095  1.00 23.41 ? 729  GLY A O     1 
ATOM   5984 N  N     . LEU A 1 730 ? 14.425  16.161  22.492  1.00 23.10 ? 730  LEU A N     1 
ATOM   5985 C  CA    . LEU A 1 730 ? 15.632  16.806  23.019  1.00 22.59 ? 730  LEU A CA    1 
ATOM   5986 C  C     . LEU A 1 730 ? 15.392  17.341  24.425  1.00 24.55 ? 730  LEU A C     1 
ATOM   5987 O  O     . LEU A 1 730 ? 14.245  17.466  24.859  1.00 22.58 ? 730  LEU A O     1 
ATOM   5988 C  CB    . LEU A 1 730 ? 16.091  17.943  22.102  1.00 22.84 ? 730  LEU A CB    1 
ATOM   5989 C  CG    . LEU A 1 730 ? 16.281  17.630  20.615  1.00 23.01 ? 730  LEU A CG    1 
ATOM   5990 C  CD1   . LEU A 1 730 ? 16.990  18.803  19.925  1.00 18.46 ? 730  LEU A CD1   1 
ATOM   5991 C  CD2   . LEU A 1 730 ? 17.076  16.349  20.422  1.00 22.16 ? 730  LEU A CD2   1 
ATOM   5992 N  N     . GLU A 1 731 ? 16.482  17.667  25.121  1.00 25.46 ? 731  GLU A N     1 
ATOM   5993 C  CA    . GLU A 1 731 ? 16.443  18.016  26.540  1.00 25.24 ? 731  GLU A CA    1 
ATOM   5994 C  C     . GLU A 1 731 ? 15.544  19.210  26.884  1.00 25.86 ? 731  GLU A C     1 
ATOM   5995 O  O     . GLU A 1 731 ? 15.002  19.294  27.988  1.00 27.11 ? 731  GLU A O     1 
ATOM   5996 C  CB    . GLU A 1 731 ? 17.870  18.212  27.063  1.00 27.04 ? 731  GLU A CB    1 
ATOM   5997 C  CG    . GLU A 1 731 ? 18.571  16.893  27.414  1.00 30.71 ? 731  GLU A CG    1 
ATOM   5998 C  CD    . GLU A 1 731 ? 19.081  16.108  26.199  1.00 33.34 ? 731  GLU A CD    1 
ATOM   5999 O  OE1   . GLU A 1 731 ? 18.994  16.605  25.053  1.00 30.30 ? 731  GLU A OE1   1 
ATOM   6000 O  OE2   . GLU A 1 731 ? 19.589  14.983  26.403  1.00 35.42 ? 731  GLU A OE2   1 
ATOM   6001 N  N     . THR A 1 732 ? 15.355  20.113  25.931  1.00 24.64 ? 732  THR A N     1 
ATOM   6002 C  CA    . THR A 1 732 ? 14.436  21.225  26.121  1.00 23.03 ? 732  THR A CA    1 
ATOM   6003 C  C     . THR A 1 732 ? 13.019  20.745  26.381  1.00 24.40 ? 732  THR A C     1 
ATOM   6004 O  O     . THR A 1 732 ? 12.191  21.522  26.859  1.00 25.45 ? 732  THR A O     1 
ATOM   6005 C  CB    . THR A 1 732 ? 14.384  22.145  24.899  1.00 20.89 ? 732  THR A CB    1 
ATOM   6006 O  OG1   . THR A 1 732 ? 14.026  21.378  23.747  1.00 22.74 ? 732  THR A OG1   1 
ATOM   6007 C  CG2   . THR A 1 732 ? 15.722  22.824  24.670  1.00 21.19 ? 732  THR A CG2   1 
ATOM   6008 N  N     . GLN A 1 733 ? 12.739  19.482  26.049  1.00 22.98 ? 733  GLN A N     1 
ATOM   6009 C  CA    . GLN A 1 733 ? 11.375  18.933  26.141  1.00 25.49 ? 733  GLN A CA    1 
ATOM   6010 C  C     . GLN A 1 733 ? 11.167  17.994  27.330  1.00 27.31 ? 733  GLN A C     1 
ATOM   6011 O  O     . GLN A 1 733 ? 10.060  17.521  27.546  1.00 29.19 ? 733  GLN A O     1 
ATOM   6012 C  CB    . GLN A 1 733 ? 10.984  18.195  24.846  1.00 25.35 ? 733  GLN A CB    1 
ATOM   6013 C  CG    . GLN A 1 733 ? 11.251  18.948  23.548  1.00 26.96 ? 733  GLN A CG    1 
ATOM   6014 C  CD    . GLN A 1 733 ? 10.639  20.339  23.532  1.00 28.54 ? 733  GLN A CD    1 
ATOM   6015 O  OE1   . GLN A 1 733 ? 11.353  21.345  23.543  1.00 27.74 ? 733  GLN A OE1   1 
ATOM   6016 N  NE2   . GLN A 1 733 ? 9.314   20.402  23.523  1.00 26.20 ? 733  GLN A NE2   1 
ATOM   6017 N  N     . LYS A 1 734 ? 12.235  17.716  28.077  1.00 29.47 ? 734  LYS A N     1 
ATOM   6018 C  CA    . LYS A 1 734 ? 12.191  16.790  29.208  1.00 30.26 ? 734  LYS A CA    1 
ATOM   6019 C  C     . LYS A 1 734 ? 11.996  17.550  30.516  1.00 30.66 ? 734  LYS A C     1 
ATOM   6020 O  O     . LYS A 1 734 ? 12.691  18.543  30.772  1.00 29.59 ? 734  LYS A O     1 
ATOM   6021 C  CB    . LYS A 1 734 ? 13.484  15.972  29.283  1.00 29.73 ? 734  LYS A CB    1 
ATOM   6022 C  CG    . LYS A 1 734 ? 13.749  15.098  28.065  1.00 34.53 ? 734  LYS A CG    1 
ATOM   6023 C  CD    . LYS A 1 734 ? 15.224  14.707  27.955  1.00 41.80 ? 734  LYS A CD    1 
ATOM   6024 C  CE    . LYS A 1 734 ? 15.590  13.545  28.877  1.00 44.38 ? 734  LYS A CE    1 
ATOM   6025 N  NZ    . LYS A 1 734 ? 15.237  12.245  28.263  1.00 47.47 ? 734  LYS A NZ    1 
ATOM   6026 N  N     . SER A 1 735 ? 11.059  17.080  31.340  1.00 28.43 ? 735  SER A N     1 
ATOM   6027 C  CA    . SER A 1 735 ? 10.805  17.699  32.646  1.00 28.19 ? 735  SER A CA    1 
ATOM   6028 C  C     . SER A 1 735 ? 11.975  17.527  33.611  1.00 28.35 ? 735  SER A C     1 
ATOM   6029 O  O     . SER A 1 735 ? 12.100  18.289  34.561  1.00 28.77 ? 735  SER A O     1 
ATOM   6030 C  CB    . SER A 1 735 ? 9.521   17.157  33.270  1.00 27.78 ? 735  SER A CB    1 
ATOM   6031 O  OG    . SER A 1 735 ? 9.614   15.756  33.451  1.00 25.74 ? 735  SER A OG    1 
ATOM   6032 N  N     . SER A 1 736 ? 12.832  16.536  33.359  1.00 26.65 ? 736  SER A N     1 
ATOM   6033 C  CA    . SER A 1 736 ? 14.033  16.316  34.161  1.00 28.19 ? 736  SER A CA    1 
ATOM   6034 C  C     . SER A 1 736 ? 15.126  17.390  33.990  1.00 28.49 ? 736  SER A C     1 
ATOM   6035 O  O     . SER A 1 736 ? 15.974  17.552  34.870  1.00 27.71 ? 736  SER A O     1 
ATOM   6036 C  CB    . SER A 1 736 ? 14.619  14.927  33.882  1.00 29.49 ? 736  SER A CB    1 
ATOM   6037 O  OG    . SER A 1 736 ? 14.664  14.693  32.486  1.00 31.74 ? 736  SER A OG    1 
ATOM   6038 N  N     . THR A 1 737 ? 15.100  18.111  32.870  1.00 25.22 ? 737  THR A N     1 
ATOM   6039 C  CA    . THR A 1 737 ? 16.074  19.157  32.585  1.00 25.30 ? 737  THR A CA    1 
ATOM   6040 C  C     . THR A 1 737 ? 15.750  20.437  33.376  1.00 27.55 ? 737  THR A C     1 
ATOM   6041 O  O     . THR A 1 737 ? 14.584  20.830  33.461  1.00 29.09 ? 737  THR A O     1 
ATOM   6042 C  CB    . THR A 1 737 ? 16.101  19.444  31.066  1.00 25.39 ? 737  THR A CB    1 
ATOM   6043 O  OG1   . THR A 1 737 ? 16.365  18.221  30.368  1.00 26.80 ? 737  THR A OG1   1 
ATOM   6044 C  CG2   . THR A 1 737 ? 17.166  20.487  30.678  1.00 19.42 ? 737  THR A CG2   1 
ATOM   6045 N  N     . PRO A 1 738 ? 16.777  21.082  33.976  1.00 23.81 ? 738  PRO A N     1 
ATOM   6046 C  CA    . PRO A 1 738 ? 16.528  22.310  34.735  1.00 23.29 ? 738  PRO A CA    1 
ATOM   6047 C  C     . PRO A 1 738 ? 15.859  23.362  33.871  1.00 24.03 ? 738  PRO A C     1 
ATOM   6048 O  O     . PRO A 1 738 ? 16.191  23.489  32.695  1.00 24.62 ? 738  PRO A O     1 
ATOM   6049 C  CB    . PRO A 1 738 ? 17.935  22.776  35.130  1.00 20.85 ? 738  PRO A CB    1 
ATOM   6050 C  CG    . PRO A 1 738 ? 18.735  21.538  35.177  1.00 21.79 ? 738  PRO A CG    1 
ATOM   6051 C  CD    . PRO A 1 738 ? 18.205  20.713  34.012  1.00 22.26 ? 738  PRO A CD    1 
ATOM   6052 N  N     . LYS A 1 739 ? 14.908  24.085  34.456  1.00 25.66 ? 739  LYS A N     1 
ATOM   6053 C  CA    . LYS A 1 739 ? 14.202  25.162  33.776  1.00 28.93 ? 739  LYS A CA    1 
ATOM   6054 C  C     . LYS A 1 739 ? 15.123  26.099  33.005  1.00 27.53 ? 739  LYS A C     1 
ATOM   6055 O  O     . LYS A 1 739 ? 14.963  26.276  31.805  1.00 28.74 ? 739  LYS A O     1 
ATOM   6056 C  CB    . LYS A 1 739 ? 13.347  25.955  34.774  1.00 30.19 ? 739  LYS A CB    1 
ATOM   6057 C  CG    . LYS A 1 739 ? 11.961  25.367  34.964  1.00 38.26 ? 739  LYS A CG    1 
ATOM   6058 C  CD    . LYS A 1 739 ? 11.023  25.819  33.843  1.00 42.51 ? 739  LYS A CD    1 
ATOM   6059 C  CE    . LYS A 1 739 ? 10.274  24.649  33.192  1.00 43.02 ? 739  LYS A CE    1 
ATOM   6060 N  NZ    . LYS A 1 739 ? 9.336   23.923  34.100  1.00 44.61 ? 739  LYS A NZ    1 
ATOM   6061 N  N     . ALA A 1 740 ? 16.094  26.687  33.692  1.00 28.58 ? 740  ALA A N     1 
ATOM   6062 C  CA    . ALA A 1 740 ? 16.996  27.649  33.062  1.00 27.59 ? 740  ALA A CA    1 
ATOM   6063 C  C     . ALA A 1 740 ? 17.796  26.996  31.942  1.00 26.96 ? 740  ALA A C     1 
ATOM   6064 O  O     . ALA A 1 740 ? 18.163  27.657  30.962  1.00 26.89 ? 740  ALA A O     1 
ATOM   6065 C  CB    . ALA A 1 740 ? 17.932  28.273  34.102  1.00 27.97 ? 740  ALA A CB    1 
ATOM   6066 N  N     . VAL A 1 741 ? 18.049  25.695  32.083  1.00 21.18 ? 741  VAL A N     1 
ATOM   6067 C  CA    . VAL A 1 741 ? 18.805  24.958  31.084  1.00 23.66 ? 741  VAL A CA    1 
ATOM   6068 C  C     . VAL A 1 741 ? 17.953  24.642  29.840  1.00 26.69 ? 741  VAL A C     1 
ATOM   6069 O  O     . VAL A 1 741 ? 18.455  24.741  28.718  1.00 27.51 ? 741  VAL A O     1 
ATOM   6070 C  CB    . VAL A 1 741 ? 19.475  23.684  31.682  1.00 22.96 ? 741  VAL A CB    1 
ATOM   6071 C  CG1   . VAL A 1 741 ? 20.059  22.797  30.582  1.00 24.09 ? 741  VAL A CG1   1 
ATOM   6072 C  CG2   . VAL A 1 741 ? 20.560  24.079  32.667  1.00 24.51 ? 741  VAL A CG2   1 
ATOM   6073 N  N     . GLN A 1 742 ? 16.681  24.279  30.041  1.00 25.48 ? 742  GLN A N     1 
ATOM   6074 C  CA    . GLN A 1 742 ? 15.718  24.134  28.936  1.00 27.80 ? 742  GLN A CA    1 
ATOM   6075 C  C     . GLN A 1 742 ? 15.697  25.393  28.082  1.00 27.64 ? 742  GLN A C     1 
ATOM   6076 O  O     . GLN A 1 742 ? 15.729  25.323  26.851  1.00 26.92 ? 742  GLN A O     1 
ATOM   6077 C  CB    . GLN A 1 742 ? 14.293  23.904  29.462  1.00 26.39 ? 742  GLN A CB    1 
ATOM   6078 C  CG    . GLN A 1 742 ? 14.031  22.535  30.062  1.00 28.01 ? 742  GLN A CG    1 
ATOM   6079 C  CD    . GLN A 1 742 ? 12.654  22.447  30.702  1.00 25.87 ? 742  GLN A CD    1 
ATOM   6080 O  OE1   . GLN A 1 742 ? 12.053  23.463  31.057  1.00 25.92 ? 742  GLN A OE1   1 
ATOM   6081 N  NE2   . GLN A 1 742 ? 12.150  21.232  30.851  1.00 26.36 ? 742  GLN A NE2   1 
ATOM   6082 N  N     . LYS A 1 743 ? 15.632  26.536  28.762  1.00 29.88 ? 743  LYS A N     1 
ATOM   6083 C  CA    . LYS A 1 743 ? 15.576  27.860  28.137  1.00 30.56 ? 743  LYS A CA    1 
ATOM   6084 C  C     . LYS A 1 743 ? 16.858  28.154  27.357  1.00 30.15 ? 743  LYS A C     1 
ATOM   6085 O  O     . LYS A 1 743 ? 16.796  28.617  26.220  1.00 34.15 ? 743  LYS A O     1 
ATOM   6086 C  CB    . LYS A 1 743 ? 15.333  28.913  29.221  1.00 31.38 ? 743  LYS A CB    1 
ATOM   6087 C  CG    . LYS A 1 743 ? 15.158  30.350  28.751  1.00 35.19 ? 743  LYS A CG    1 
ATOM   6088 C  CD    . LYS A 1 743 ? 14.853  31.208  29.956  1.00 38.44 ? 743  LYS A CD    1 
ATOM   6089 C  CE    . LYS A 1 743 ? 15.084  32.685  29.708  1.00 45.68 ? 743  LYS A CE    1 
ATOM   6090 N  NZ    . LYS A 1 743 ? 14.056  33.258  28.805  1.00 46.53 ? 743  LYS A NZ    1 
ATOM   6091 N  N     . ALA A 1 744 ? 18.012  27.863  27.959  1.00 29.04 ? 744  ALA A N     1 
ATOM   6092 C  CA    . ALA A 1 744 ? 19.306  28.150  27.334  1.00 28.27 ? 744  ALA A CA    1 
ATOM   6093 C  C     . ALA A 1 744 ? 19.576  27.247  26.144  1.00 28.70 ? 744  ALA A C     1 
ATOM   6094 O  O     . ALA A 1 744 ? 20.025  27.715  25.099  1.00 29.78 ? 744  ALA A O     1 
ATOM   6095 C  CB    . ALA A 1 744 ? 20.430  28.058  28.338  1.00 25.72 ? 744  ALA A CB    1 
ATOM   6096 N  N     . LEU A 1 745 ? 19.289  25.958  26.298  1.00 28.70 ? 745  LEU A N     1 
ATOM   6097 C  CA    . LEU A 1 745 ? 19.371  25.012  25.175  1.00 28.52 ? 745  LEU A CA    1 
ATOM   6098 C  C     . LEU A 1 745 ? 18.441  25.379  24.004  1.00 27.50 ? 745  LEU A C     1 
ATOM   6099 O  O     . LEU A 1 745 ? 18.826  25.273  22.834  1.00 28.22 ? 745  LEU A O     1 
ATOM   6100 C  CB    . LEU A 1 745 ? 19.104  23.577  25.651  1.00 24.71 ? 745  LEU A CB    1 
ATOM   6101 C  CG    . LEU A 1 745 ? 20.196  22.881  26.460  1.00 23.39 ? 745  LEU A CG    1 
ATOM   6102 C  CD1   . LEU A 1 745 ? 19.696  21.525  26.959  1.00 22.74 ? 745  LEU A CD1   1 
ATOM   6103 C  CD2   . LEU A 1 745 ? 21.484  22.711  25.642  1.00 22.61 ? 745  LEU A CD2   1 
ATOM   6104 N  N     . LYS A 1 746 ? 17.226  25.811  24.323  1.00 27.39 ? 746  LYS A N     1 
ATOM   6105 C  CA    . LYS A 1 746 ? 16.274  26.267  23.306  1.00 27.48 ? 746  LYS A CA    1 
ATOM   6106 C  C     . LYS A 1 746 ? 16.765  27.498  22.543  1.00 27.62 ? 746  LYS A C     1 
ATOM   6107 O  O     . LYS A 1 746 ? 16.598  27.579  21.319  1.00 30.00 ? 746  LYS A O     1 
ATOM   6108 C  CB    . LYS A 1 746 ? 14.890  26.515  23.920  1.00 28.69 ? 746  LYS A CB    1 
ATOM   6109 C  CG    . LYS A 1 746 ? 13.847  26.934  22.921  1.00 27.34 ? 746  LYS A CG    1 
ATOM   6110 C  CD    . LYS A 1 746 ? 12.473  26.870  23.523  1.00 32.57 ? 746  LYS A CD    1 
ATOM   6111 C  CE    . LYS A 1 746 ? 11.441  27.417  22.555  1.00 37.01 ? 746  LYS A CE    1 
ATOM   6112 N  NZ    . LYS A 1 746 ? 10.143  27.614  23.247  1.00 43.23 ? 746  LYS A NZ    1 
ATOM   6113 N  N     . GLU A 1 747 ? 17.376  28.453  23.243  1.00 28.18 ? 747  GLU A N     1 
ATOM   6114 C  CA    . GLU A 1 747 ? 17.944  29.610  22.543  1.00 27.67 ? 747  GLU A CA    1 
ATOM   6115 C  C     . GLU A 1 747 ? 19.119  29.183  21.653  1.00 27.82 ? 747  GLU A C     1 
ATOM   6116 O  O     . GLU A 1 747 ? 19.306  29.729  20.565  1.00 29.33 ? 747  GLU A O     1 
ATOM   6117 C  CB    . GLU A 1 747 ? 18.353  30.721  23.514  1.00 28.55 ? 747  GLU A CB    1 
ATOM   6118 C  CG    . GLU A 1 747 ? 19.046  31.922  22.852  1.00 27.39 ? 747  GLU A CG    1 
ATOM   6119 C  CD    . GLU A 1 747 ? 18.142  32.705  21.904  1.00 30.72 ? 747  GLU A CD    1 
ATOM   6120 O  OE1   . GLU A 1 747 ? 18.659  33.591  21.188  1.00 34.96 ? 747  GLU A OE1   1 
ATOM   6121 O  OE2   . GLU A 1 747 ? 16.921  32.445  21.871  1.00 27.58 ? 747  GLU A OE2   1 
ATOM   6122 N  N     . CYS A 1 748 ? 19.898  28.207  22.117  1.00 26.96 ? 748  CYS A N     1 
ATOM   6123 C  CA    . CYS A 1 748 ? 21.021  27.671  21.343  1.00 26.70 ? 748  CYS A CA    1 
ATOM   6124 C  C     . CYS A 1 748 ? 20.518  27.023  20.058  1.00 26.80 ? 748  CYS A C     1 
ATOM   6125 O  O     . CYS A 1 748 ? 21.093  27.229  18.986  1.00 26.06 ? 748  CYS A O     1 
ATOM   6126 C  CB    . CYS A 1 748 ? 21.815  26.650  22.158  1.00 27.61 ? 748  CYS A CB    1 
ATOM   6127 S  SG    . CYS A 1 748 ? 22.933  27.350  23.392  1.00 30.08 ? 748  CYS A SG    1 
ATOM   6128 N  N     . ILE A 1 749 ? 19.440  26.249  20.184  1.00 24.46 ? 749  ILE A N     1 
ATOM   6129 C  CA    . ILE A 1 749 ? 18.757  25.665  19.045  1.00 22.46 ? 749  ILE A CA    1 
ATOM   6130 C  C     . ILE A 1 749 ? 18.148  26.739  18.119  1.00 25.66 ? 749  ILE A C     1 
ATOM   6131 O  O     . ILE A 1 749 ? 18.309  26.659  16.896  1.00 26.80 ? 749  ILE A O     1 
ATOM   6132 C  CB    . ILE A 1 749 ? 17.673  24.665  19.485  1.00 23.07 ? 749  ILE A CB    1 
ATOM   6133 C  CG1   . ILE A 1 749 ? 18.305  23.456  20.188  1.00 17.56 ? 749  ILE A CG1   1 
ATOM   6134 C  CG2   . ILE A 1 749 ? 16.844  24.198  18.277  1.00 21.25 ? 749  ILE A CG2   1 
ATOM   6135 C  CD1   . ILE A 1 749 ? 17.254  22.535  20.844  1.00 18.91 ? 749  ILE A CD1   1 
ATOM   6136 N  N     . ARG A 1 750 ? 17.462  27.733  18.687  1.00 25.90 ? 750  ARG A N     1 
ATOM   6137 C  CA    . ARG A 1 750 ? 16.895  28.819  17.874  1.00 25.46 ? 750  ARG A CA    1 
ATOM   6138 C  C     . ARG A 1 750 ? 17.976  29.445  17.014  1.00 26.10 ? 750  ARG A C     1 
ATOM   6139 O  O     . ARG A 1 750 ? 17.778  29.642  15.818  1.00 28.02 ? 750  ARG A O     1 
ATOM   6140 C  CB    . ARG A 1 750 ? 16.198  29.902  18.714  1.00 25.39 ? 750  ARG A CB    1 
ATOM   6141 C  CG    . ARG A 1 750 ? 15.320  30.838  17.863  1.00 28.42 ? 750  ARG A CG    1 
ATOM   6142 C  CD    . ARG A 1 750 ? 14.972  32.186  18.536  1.00 28.22 ? 750  ARG A CD    1 
ATOM   6143 N  NE    . ARG A 1 750 ? 16.163  32.937  18.948  1.00 32.05 ? 750  ARG A NE    1 
ATOM   6144 C  CZ    . ARG A 1 750 ? 16.933  33.672  18.145  1.00 32.13 ? 750  ARG A CZ    1 
ATOM   6145 N  NH1   . ARG A 1 750 ? 16.664  33.776  16.849  1.00 28.21 ? 750  ARG A NH1   1 
ATOM   6146 N  NH2   . ARG A 1 750 ? 17.989  34.308  18.645  1.00 29.27 ? 750  ARG A NH2   1 
ATOM   6147 N  N     . ARG A 1 751 ? 19.123  29.728  17.625  1.00 26.72 ? 751  ARG A N     1 
ATOM   6148 C  CA    . ARG A 1 751 ? 20.255  30.331  16.927  1.00 29.86 ? 751  ARG A CA    1 
ATOM   6149 C  C     . ARG A 1 751 ? 20.855  29.431  15.843  1.00 31.66 ? 751  ARG A C     1 
ATOM   6150 O  O     . ARG A 1 751 ? 21.119  29.898  14.728  1.00 31.89 ? 751  ARG A O     1 
ATOM   6151 C  CB    . ARG A 1 751 ? 21.316  30.790  17.925  1.00 31.00 ? 751  ARG A CB    1 
ATOM   6152 C  CG    . ARG A 1 751 ? 20.912  32.076  18.649  1.00 32.40 ? 751  ARG A CG    1 
ATOM   6153 C  CD    . ARG A 1 751 ? 21.861  32.397  19.787  1.00 33.23 ? 751  ARG A CD    1 
ATOM   6154 N  NE    . ARG A 1 751 ? 21.421  33.576  20.537  1.00 34.51 ? 751  ARG A NE    1 
ATOM   6155 C  CZ    . ARG A 1 751 ? 22.006  34.770  20.470  1.00 37.42 ? 751  ARG A CZ    1 
ATOM   6156 N  NH1   . ARG A 1 751 ? 23.071  34.956  19.696  1.00 36.51 ? 751  ARG A NH1   1 
ATOM   6157 N  NH2   . ARG A 1 751 ? 21.528  35.781  21.183  1.00 38.91 ? 751  ARG A NH2   1 
ATOM   6158 N  N     . MET A 1 752 ? 21.066  28.154  16.171  1.00 29.03 ? 752  MET A N     1 
ATOM   6159 C  CA    . MET A 1 752 ? 21.482  27.156  15.177  1.00 30.14 ? 752  MET A CA    1 
ATOM   6160 C  C     . MET A 1 752 ? 20.572  27.150  13.947  1.00 30.95 ? 752  MET A C     1 
ATOM   6161 O  O     . MET A 1 752 ? 21.059  27.278  12.825  1.00 32.34 ? 752  MET A O     1 
ATOM   6162 C  CB    . MET A 1 752 ? 21.521  25.751  15.783  1.00 28.86 ? 752  MET A CB    1 
ATOM   6163 C  CG    . MET A 1 752 ? 22.661  25.506  16.748  1.00 27.23 ? 752  MET A CG    1 
ATOM   6164 S  SD    . MET A 1 752 ? 22.427  23.983  17.666  1.00 31.71 ? 752  MET A SD    1 
ATOM   6165 C  CE    . MET A 1 752 ? 22.857  22.765  16.416  1.00 23.33 ? 752  MET A CE    1 
ATOM   6166 N  N     . LEU A 1 753 ? 19.258  27.021  14.165  1.00 32.26 ? 753  LEU A N     1 
ATOM   6167 C  CA    . LEU A 1 753 ? 18.284  26.889  13.067  1.00 31.19 ? 753  LEU A CA    1 
ATOM   6168 C  C     . LEU A 1 753 ? 17.976  28.180  12.311  1.00 31.65 ? 753  LEU A C     1 
ATOM   6169 O  O     . LEU A 1 753 ? 17.649  28.142  11.126  1.00 32.76 ? 753  LEU A O     1 
ATOM   6170 C  CB    . LEU A 1 753 ? 16.962  26.274  13.556  1.00 30.67 ? 753  LEU A CB    1 
ATOM   6171 C  CG    . LEU A 1 753 ? 16.972  25.003  14.414  1.00 33.58 ? 753  LEU A CG    1 
ATOM   6172 C  CD1   . LEU A 1 753 ? 15.566  24.445  14.538  1.00 30.45 ? 753  LEU A CD1   1 
ATOM   6173 C  CD2   . LEU A 1 753 ? 17.951  23.940  13.890  1.00 32.68 ? 753  LEU A CD2   1 
ATOM   6174 N  N     . GLN A 1 754 ? 18.054  29.320  12.986  1.00 32.90 ? 754  GLN A N     1 
ATOM   6175 C  CA    . GLN A 1 754 ? 17.627  30.578  12.370  1.00 33.65 ? 754  GLN A CA    1 
ATOM   6176 C  C     . GLN A 1 754 ? 18.785  31.483  11.971  1.00 35.03 ? 754  GLN A C     1 
ATOM   6177 O  O     . GLN A 1 754 ? 18.669  32.261  11.020  1.00 36.92 ? 754  GLN A O     1 
ATOM   6178 C  CB    . GLN A 1 754 ? 16.663  31.333  13.291  1.00 34.71 ? 754  GLN A CB    1 
ATOM   6179 C  CG    . GLN A 1 754 ? 15.383  30.551  13.643  1.00 34.94 ? 754  GLN A CG    1 
ATOM   6180 C  CD    . GLN A 1 754 ? 14.391  31.354  14.472  1.00 35.79 ? 754  GLN A CD    1 
ATOM   6181 O  OE1   . GLN A 1 754 ? 14.702  32.434  14.974  1.00 35.65 ? 754  GLN A OE1   1 
ATOM   6182 N  NE2   . GLN A 1 754 ? 13.185  30.822  14.620  1.00 38.92 ? 754  GLN A NE2   1 
ATOM   6183 N  N     . GLU A 1 755 ? 19.904  31.373  12.683  1.00 34.01 ? 755  GLU A N     1 
ATOM   6184 C  CA    . GLU A 1 755 ? 20.976  32.354  12.563  1.00 35.09 ? 755  GLU A CA    1 
ATOM   6185 C  C     . GLU A 1 755 ? 22.337  31.769  12.189  1.00 36.04 ? 755  GLU A C     1 
ATOM   6186 O  O     . GLU A 1 755 ? 23.113  32.420  11.498  1.00 39.47 ? 755  GLU A O     1 
ATOM   6187 C  CB    . GLU A 1 755 ? 21.064  33.210  13.834  1.00 34.61 ? 755  GLU A CB    1 
ATOM   6188 C  CG    . GLU A 1 755 ? 19.776  33.991  14.124  1.00 37.26 ? 755  GLU A CG    1 
ATOM   6189 C  CD    . GLU A 1 755 ? 19.785  34.736  15.448  1.00 38.54 ? 755  GLU A CD    1 
ATOM   6190 O  OE1   . GLU A 1 755 ? 18.730  35.292  15.808  1.00 41.54 ? 755  GLU A OE1   1 
ATOM   6191 O  OE2   . GLU A 1 755 ? 20.832  34.778  16.124  1.00 39.29 ? 755  GLU A OE2   1 
ATOM   6192 N  N     . GLY A 1 756 ? 22.637  30.557  12.635  1.00 34.91 ? 756  GLY A N     1 
ATOM   6193 C  CA    . GLY A 1 756 ? 23.878  29.906  12.212  1.00 36.13 ? 756  GLY A CA    1 
ATOM   6194 C  C     . GLY A 1 756 ? 24.905  29.714  13.303  1.00 37.00 ? 756  GLY A C     1 
ATOM   6195 O  O     . GLY A 1 756 ? 24.650  30.018  14.465  1.00 37.17 ? 756  GLY A O     1 
ATOM   6196 N  N     . GLU A 1 757 ? 26.074  29.221  12.907  1.00 38.16 ? 757  GLU A N     1 
ATOM   6197 C  CA    . GLU A 1 757 ? 27.144  28.824  13.821  1.00 39.77 ? 757  GLU A CA    1 
ATOM   6198 C  C     . GLU A 1 757 ? 27.674  29.955  14.705  1.00 41.83 ? 757  GLU A C     1 
ATOM   6199 O  O     . GLU A 1 757 ? 27.735  29.817  15.930  1.00 41.82 ? 757  GLU A O     1 
ATOM   6200 C  CB    . GLU A 1 757 ? 28.291  28.210  13.019  1.00 40.38 ? 757  GLU A CB    1 
ATOM   6201 C  CG    . GLU A 1 757 ? 29.375  27.560  13.857  1.00 42.87 ? 757  GLU A CG    1 
ATOM   6202 C  CD    . GLU A 1 757 ? 30.459  26.923  12.999  1.00 44.82 ? 757  GLU A CD    1 
ATOM   6203 O  OE1   . GLU A 1 757 ? 31.158  27.658  12.269  1.00 49.65 ? 757  GLU A OE1   1 
ATOM   6204 O  OE2   . GLU A 1 757 ? 30.612  25.690  13.057  1.00 41.25 ? 757  GLU A OE2   1 
ATOM   6205 N  N     . GLU A 1 758 ? 28.066  31.066  14.088  1.00 41.93 ? 758  GLU A N     1 
ATOM   6206 C  CA    . GLU A 1 758 ? 28.627  32.177  14.840  1.00 43.94 ? 758  GLU A CA    1 
ATOM   6207 C  C     . GLU A 1 758 ? 27.684  32.705  15.925  1.00 41.04 ? 758  GLU A C     1 
ATOM   6208 O  O     . GLU A 1 758 ? 28.124  32.978  17.043  1.00 39.91 ? 758  GLU A O     1 
ATOM   6209 C  CB    . GLU A 1 758 ? 29.073  33.306  13.910  1.00 47.25 ? 758  GLU A CB    1 
ATOM   6210 C  CG    . GLU A 1 758 ? 29.931  34.345  14.613  1.00 54.34 ? 758  GLU A CG    1 
ATOM   6211 C  CD    . GLU A 1 758 ? 30.115  35.602  13.797  1.00 61.41 ? 758  GLU A CD    1 
ATOM   6212 O  OE1   . GLU A 1 758 ? 31.260  35.871  13.380  1.00 64.07 ? 758  GLU A OE1   1 
ATOM   6213 O  OE2   . GLU A 1 758 ? 29.116  36.319  13.568  1.00 65.84 ? 758  GLU A OE2   1 
ATOM   6214 N  N     . SER A 1 759 ? 26.398  32.832  15.603  1.00 39.34 ? 759  SER A N     1 
ATOM   6215 C  CA    . SER A 1 759 ? 25.409  33.306  16.578  1.00 38.92 ? 759  SER A CA    1 
ATOM   6216 C  C     . SER A 1 759 ? 25.337  32.393  17.802  1.00 36.33 ? 759  SER A C     1 
ATOM   6217 O  O     . SER A 1 759 ? 25.263  32.862  18.944  1.00 36.75 ? 759  SER A O     1 
ATOM   6218 C  CB    . SER A 1 759 ? 24.030  33.429  15.937  1.00 38.66 ? 759  SER A CB    1 
ATOM   6219 O  OG    . SER A 1 759 ? 23.052  33.751  16.912  1.00 38.39 ? 759  SER A OG    1 
ATOM   6220 N  N     . LEU A 1 760 ? 25.362  31.090  17.541  1.00 35.11 ? 760  LEU A N     1 
ATOM   6221 C  CA    . LEU A 1 760 ? 25.378  30.056  18.571  1.00 34.72 ? 760  LEU A CA    1 
ATOM   6222 C  C     . LEU A 1 760 ? 26.614  30.179  19.466  1.00 34.24 ? 760  LEU A C     1 
ATOM   6223 O  O     . LEU A 1 760 ? 26.519  30.062  20.686  1.00 35.64 ? 760  LEU A O     1 
ATOM   6224 C  CB    . LEU A 1 760 ? 25.297  28.670  17.903  1.00 32.98 ? 760  LEU A CB    1 
ATOM   6225 C  CG    . LEU A 1 760 ? 25.201  27.302  18.606  1.00 34.58 ? 760  LEU A CG    1 
ATOM   6226 C  CD1   . LEU A 1 760 ? 26.441  26.457  18.393  1.00 33.12 ? 760  LEU A CD1   1 
ATOM   6227 C  CD2   . LEU A 1 760 ? 24.798  27.326  20.083  1.00 32.01 ? 760  LEU A CD2   1 
ATOM   6228 N  N     . GLN A 1 761 ? 27.765  30.439  18.859  1.00 35.70 ? 761  GLN A N     1 
ATOM   6229 C  CA    . GLN A 1 761 ? 29.013  30.585  19.606  1.00 35.77 ? 761  GLN A CA    1 
ATOM   6230 C  C     . GLN A 1 761 ? 28.984  31.821  20.500  1.00 37.05 ? 761  GLN A C     1 
ATOM   6231 O  O     . GLN A 1 761 ? 29.522  31.799  21.606  1.00 36.13 ? 761  GLN A O     1 
ATOM   6232 C  CB    . GLN A 1 761 ? 30.202  30.646  18.655  1.00 37.30 ? 761  GLN A CB    1 
ATOM   6233 C  CG    . GLN A 1 761 ? 30.470  29.342  17.932  1.00 35.06 ? 761  GLN A CG    1 
ATOM   6234 C  CD    . GLN A 1 761 ? 31.536  29.467  16.858  1.00 36.95 ? 761  GLN A CD    1 
ATOM   6235 O  OE1   . GLN A 1 761 ? 31.841  28.498  16.158  1.00 38.52 ? 761  GLN A OE1   1 
ATOM   6236 N  NE2   . GLN A 1 761 ? 32.106  30.656  16.720  1.00 33.81 ? 761  GLN A NE2   1 
ATOM   6237 N  N     . GLU A 1 762 ? 28.345  32.887  20.017  1.00 37.48 ? 762  GLU A N     1 
ATOM   6238 C  CA    . GLU A 1 762 ? 28.148  34.109  20.802  1.00 39.89 ? 762  GLU A CA    1 
ATOM   6239 C  C     . GLU A 1 762 ? 27.310  33.850  22.063  1.00 38.97 ? 762  GLU A C     1 
ATOM   6240 O  O     . GLU A 1 762 ? 27.631  34.353  23.142  1.00 39.42 ? 762  GLU A O     1 
ATOM   6241 C  CB    . GLU A 1 762 ? 27.521  35.211  19.927  1.00 41.02 ? 762  GLU A CB    1 
ATOM   6242 C  CG    . GLU A 1 762 ? 26.825  36.330  20.693  1.00 46.83 ? 762  GLU A CG    1 
ATOM   6243 C  CD    . GLU A 1 762 ? 26.128  37.328  19.779  1.00 51.02 ? 762  GLU A CD    1 
ATOM   6244 O  OE1   . GLU A 1 762 ? 24.903  37.186  19.555  1.00 48.22 ? 762  GLU A OE1   1 
ATOM   6245 O  OE2   . GLU A 1 762 ? 26.810  38.246  19.275  1.00 52.47 ? 762  GLU A OE2   1 
ATOM   6246 N  N     . TYR A 1 763 ? 26.250  33.055  21.927  1.00 36.74 ? 763  TYR A N     1 
ATOM   6247 C  CA    . TYR A 1 763 ? 25.339  32.822  23.043  1.00 35.51 ? 763  TYR A CA    1 
ATOM   6248 C  C     . TYR A 1 763 ? 25.942  31.882  24.076  1.00 35.65 ? 763  TYR A C     1 
ATOM   6249 O  O     . TYR A 1 763 ? 25.878  32.153  25.275  1.00 36.25 ? 763  TYR A O     1 
ATOM   6250 C  CB    . TYR A 1 763 ? 23.978  32.303  22.573  1.00 34.50 ? 763  TYR A CB    1 
ATOM   6251 C  CG    . TYR A 1 763 ? 22.930  32.327  23.672  1.00 34.40 ? 763  TYR A CG    1 
ATOM   6252 C  CD1   . TYR A 1 763 ? 22.563  31.161  24.354  1.00 32.24 ? 763  TYR A CD1   1 
ATOM   6253 C  CD2   . TYR A 1 763 ? 22.328  33.520  24.045  1.00 34.66 ? 763  TYR A CD2   1 
ATOM   6254 C  CE1   . TYR A 1 763 ? 21.607  31.196  25.381  1.00 31.90 ? 763  TYR A CE1   1 
ATOM   6255 C  CE2   . TYR A 1 763 ? 21.384  33.563  25.055  1.00 36.43 ? 763  TYR A CE2   1 
ATOM   6256 C  CZ    . TYR A 1 763 ? 21.026  32.407  25.720  1.00 35.75 ? 763  TYR A CZ    1 
ATOM   6257 O  OH    . TYR A 1 763 ? 20.076  32.490  26.713  1.00 40.18 ? 763  TYR A OH    1 
ATOM   6258 N  N     . PHE A 1 764 ? 26.525  30.781  23.605  1.00 34.27 ? 764  PHE A N     1 
ATOM   6259 C  CA    . PHE A 1 764 ? 27.183  29.829  24.482  1.00 32.71 ? 764  PHE A CA    1 
ATOM   6260 C  C     . PHE A 1 764 ? 28.188  30.538  25.380  1.00 33.04 ? 764  PHE A C     1 
ATOM   6261 O  O     . PHE A 1 764 ? 28.116  30.419  26.601  1.00 34.83 ? 764  PHE A O     1 
ATOM   6262 C  CB    . PHE A 1 764 ? 27.886  28.727  23.687  1.00 32.05 ? 764  PHE A CB    1 
ATOM   6263 C  CG    . PHE A 1 764 ? 28.720  27.823  24.541  1.00 30.94 ? 764  PHE A CG    1 
ATOM   6264 C  CD1   . PHE A 1 764 ? 28.140  26.742  25.195  1.00 31.35 ? 764  PHE A CD1   1 
ATOM   6265 C  CD2   . PHE A 1 764 ? 30.085  28.063  24.711  1.00 29.68 ? 764  PHE A CD2   1 
ATOM   6266 C  CE1   . PHE A 1 764 ? 28.907  25.899  25.999  1.00 33.86 ? 764  PHE A CE1   1 
ATOM   6267 C  CE2   . PHE A 1 764 ? 30.863  27.230  25.510  1.00 29.42 ? 764  PHE A CE2   1 
ATOM   6268 C  CZ    . PHE A 1 764 ? 30.271  26.146  26.160  1.00 32.58 ? 764  PHE A CZ    1 
ATOM   6269 N  N     . LYS A 1 765 ? 29.111  31.282  24.772  1.00 33.74 ? 765  LYS A N     1 
ATOM   6270 C  CA    . LYS A 1 765 ? 30.137  32.008  25.512  1.00 35.46 ? 765  LYS A CA    1 
ATOM   6271 C  C     . LYS A 1 765 ? 29.510  32.838  26.640  1.00 37.27 ? 765  LYS A C     1 
ATOM   6272 O  O     . LYS A 1 765 ? 30.004  32.830  27.773  1.00 36.24 ? 765  LYS A O     1 
ATOM   6273 C  CB    . LYS A 1 765 ? 30.958  32.894  24.577  1.00 36.93 ? 765  LYS A CB    1 
ATOM   6274 C  CG    . LYS A 1 765 ? 32.227  33.450  25.209  1.00 45.07 ? 765  LYS A CG    1 
ATOM   6275 C  CD    . LYS A 1 765 ? 33.012  34.303  24.226  1.00 51.25 ? 765  LYS A CD    1 
ATOM   6276 C  CE    . LYS A 1 765 ? 34.358  34.706  24.805  1.00 57.61 ? 765  LYS A CE    1 
ATOM   6277 N  NZ    . LYS A 1 765 ? 35.045  35.742  23.969  1.00 63.65 ? 765  LYS A NZ    1 
ATOM   6278 N  N     . GLU A 1 766 ? 28.413  33.527  26.335  1.00 38.15 ? 766  GLU A N     1 
ATOM   6279 C  CA    . GLU A 1 766 ? 27.746  34.349  27.339  1.00 40.36 ? 766  GLU A CA    1 
ATOM   6280 C  C     . GLU A 1 766 ? 27.120  33.523  28.459  1.00 39.15 ? 766  GLU A C     1 
ATOM   6281 O  O     . GLU A 1 766 ? 27.322  33.827  29.639  1.00 39.52 ? 766  GLU A O     1 
ATOM   6282 C  CB    . GLU A 1 766 ? 26.715  35.280  26.706  1.00 43.12 ? 766  GLU A CB    1 
ATOM   6283 C  CG    . GLU A 1 766 ? 26.343  36.456  27.600  1.00 46.70 ? 766  GLU A CG    1 
ATOM   6284 C  CD    . GLU A 1 766 ? 27.547  37.292  27.985  1.00 48.27 ? 766  GLU A CD    1 
ATOM   6285 O  OE1   . GLU A 1 766 ? 28.182  37.893  27.087  1.00 48.97 ? 766  GLU A OE1   1 
ATOM   6286 O  OE2   . GLU A 1 766 ? 27.859  37.342  29.193  1.00 47.33 ? 766  GLU A OE2   1 
ATOM   6287 N  N     . PHE A 1 767 ? 26.392  32.468  28.094  1.00 35.88 ? 767  PHE A N     1 
ATOM   6288 C  CA    . PHE A 1 767 ? 25.738  31.611  29.080  1.00 35.34 ? 767  PHE A CA    1 
ATOM   6289 C  C     . PHE A 1 767 ? 26.729  30.948  30.041  1.00 35.73 ? 767  PHE A C     1 
ATOM   6290 O  O     . PHE A 1 767 ? 26.506  30.924  31.256  1.00 33.24 ? 767  PHE A O     1 
ATOM   6291 C  CB    . PHE A 1 767 ? 24.835  30.565  28.402  1.00 34.15 ? 767  PHE A CB    1 
ATOM   6292 C  CG    . PHE A 1 767 ? 24.071  29.703  29.372  1.00 33.02 ? 767  PHE A CG    1 
ATOM   6293 C  CD1   . PHE A 1 767 ? 24.527  28.425  29.700  1.00 32.30 ? 767  PHE A CD1   1 
ATOM   6294 C  CD2   . PHE A 1 767 ? 22.901  30.164  29.963  1.00 28.46 ? 767  PHE A CD2   1 
ATOM   6295 C  CE1   . PHE A 1 767 ? 23.828  27.620  30.602  1.00 30.34 ? 767  PHE A CE1   1 
ATOM   6296 C  CE2   . PHE A 1 767 ? 22.193  29.364  30.866  1.00 31.28 ? 767  PHE A CE2   1 
ATOM   6297 C  CZ    . PHE A 1 767 ? 22.656  28.088  31.185  1.00 28.57 ? 767  PHE A CZ    1 
ATOM   6298 N  N     . GLU A 1 768 ? 27.825  30.427  29.496  1.00 35.37 ? 768  GLU A N     1 
ATOM   6299 C  CA    . GLU A 1 768 ? 28.879  29.812  30.306  1.00 36.08 ? 768  GLU A CA    1 
ATOM   6300 C  C     . GLU A 1 768 ? 29.434  30.800  31.331  1.00 35.04 ? 768  GLU A C     1 
ATOM   6301 O  O     . GLU A 1 768 ? 29.781  30.424  32.451  1.00 35.47 ? 768  GLU A O     1 
ATOM   6302 C  CB    . GLU A 1 768 ? 30.001  29.282  29.401  1.00 36.94 ? 768  GLU A CB    1 
ATOM   6303 C  CG    . GLU A 1 768 ? 31.078  28.474  30.118  1.00 43.25 ? 768  GLU A CG    1 
ATOM   6304 C  CD    . GLU A 1 768 ? 32.193  27.996  29.182  1.00 50.23 ? 768  GLU A CD    1 
ATOM   6305 O  OE1   . GLU A 1 768 ? 32.553  26.798  29.260  1.00 53.07 ? 768  GLU A OE1   1 
ATOM   6306 O  OE2   . GLU A 1 768 ? 32.707  28.810  28.376  1.00 46.81 ? 768  GLU A OE2   1 
ATOM   6307 N  N     . LYS A 1 769 ? 29.507  32.067  30.939  1.00 34.94 ? 769  LYS A N     1 
ATOM   6308 C  CA    . LYS A 1 769 ? 30.064  33.107  31.794  1.00 38.03 ? 769  LYS A CA    1 
ATOM   6309 C  C     . LYS A 1 769 ? 29.119  33.551  32.922  1.00 35.84 ? 769  LYS A C     1 
ATOM   6310 O  O     . LYS A 1 769 ? 29.581  33.883  34.006  1.00 36.07 ? 769  LYS A O     1 
ATOM   6311 C  CB    . LYS A 1 769 ? 30.554  34.302  30.948  1.00 40.48 ? 769  LYS A CB    1 
ATOM   6312 C  CG    . LYS A 1 769 ? 30.914  35.565  31.749  1.00 49.77 ? 769  LYS A CG    1 
ATOM   6313 C  CD    . LYS A 1 769 ? 32.153  36.303  31.211  1.00 57.50 ? 769  LYS A CD    1 
ATOM   6314 C  CE    . LYS A 1 769 ? 31.903  37.020  29.880  1.00 60.55 ? 769  LYS A CE    1 
ATOM   6315 N  NZ    . LYS A 1 769 ? 31.953  36.107  28.699  1.00 60.37 ? 769  LYS A NZ    1 
ATOM   6316 N  N     . GLU A 1 770 ? 27.810  33.537  32.682  1.00 34.72 ? 770  GLU A N     1 
ATOM   6317 C  CA    . GLU A 1 770 ? 26.856  34.122  33.642  1.00 35.97 ? 770  GLU A CA    1 
ATOM   6318 C  C     . GLU A 1 770 ? 26.052  33.119  34.467  1.00 35.25 ? 770  GLU A C     1 
ATOM   6319 O  O     . GLU A 1 770 ? 25.390  33.501  35.428  1.00 33.65 ? 770  GLU A O     1 
ATOM   6320 C  CB    . GLU A 1 770 ? 25.873  35.075  32.940  1.00 36.45 ? 770  GLU A CB    1 
ATOM   6321 C  CG    . GLU A 1 770 ? 26.490  36.087  31.944  1.00 40.13 ? 770  GLU A CG    1 
ATOM   6322 C  CD    . GLU A 1 770 ? 27.447  37.099  32.573  1.00 42.98 ? 770  GLU A CD    1 
ATOM   6323 O  OE1   . GLU A 1 770 ? 28.187  37.769  31.811  1.00 48.38 ? 770  GLU A OE1   1 
ATOM   6324 O  OE2   . GLU A 1 770 ? 27.470  37.234  33.816  1.00 40.95 ? 770  GLU A OE2   1 
ATOM   6325 N  N     . PHE A 1 771 ? 26.111  31.844  34.104  1.00 35.92 ? 771  PHE A N     1 
ATOM   6326 C  CA    . PHE A 1 771 ? 25.144  30.871  34.615  1.00 35.80 ? 771  PHE A CA    1 
ATOM   6327 C  C     . PHE A 1 771 ? 25.192  30.635  36.130  1.00 36.10 ? 771  PHE A C     1 
ATOM   6328 O  O     . PHE A 1 771 ? 24.190  30.239  36.719  1.00 35.82 ? 771  PHE A O     1 
ATOM   6329 C  CB    . PHE A 1 771 ? 25.248  29.541  33.853  1.00 38.24 ? 771  PHE A CB    1 
ATOM   6330 C  CG    . PHE A 1 771 ? 26.269  28.598  34.415  1.00 38.76 ? 771  PHE A CG    1 
ATOM   6331 C  CD1   . PHE A 1 771 ? 27.624  28.792  34.169  1.00 44.05 ? 771  PHE A CD1   1 
ATOM   6332 C  CD2   . PHE A 1 771 ? 25.874  27.519  35.196  1.00 38.60 ? 771  PHE A CD2   1 
ATOM   6333 C  CE1   . PHE A 1 771 ? 28.582  27.915  34.695  1.00 46.08 ? 771  PHE A CE1   1 
ATOM   6334 C  CE2   . PHE A 1 771 ? 26.809  26.641  35.727  1.00 42.90 ? 771  PHE A CE2   1 
ATOM   6335 C  CZ    . PHE A 1 771 ? 28.174  26.838  35.480  1.00 46.06 ? 771  PHE A CZ    1 
ATOM   6336 N  N     . ARG A 1 772 ? 26.340  30.887  36.756  1.00 37.36 ? 772  ARG A N     1 
ATOM   6337 C  CA    A ARG A 1 772 ? 26.497  30.676  38.199  0.50 38.61 ? 772  ARG A CA    1 
ATOM   6338 C  CA    B ARG A 1 772 ? 26.484  30.667  38.195  0.50 38.14 ? 772  ARG A CA    1 
ATOM   6339 C  C     . ARG A 1 772 ? 25.596  31.606  39.022  1.00 38.66 ? 772  ARG A C     1 
ATOM   6340 O  O     . ARG A 1 772 ? 25.359  31.368  40.203  1.00 38.16 ? 772  ARG A O     1 
ATOM   6341 C  CB    A ARG A 1 772 ? 27.967  30.818  38.624  0.50 40.47 ? 772  ARG A CB    1 
ATOM   6342 C  CB    B ARG A 1 772 ? 27.957  30.755  38.610  0.50 39.49 ? 772  ARG A CB    1 
ATOM   6343 C  CG    A ARG A 1 772 ? 28.881  29.727  38.071  0.50 41.72 ? 772  ARG A CG    1 
ATOM   6344 C  CG    B ARG A 1 772 ? 28.807  29.655  37.985  0.50 38.71 ? 772  ARG A CG    1 
ATOM   6345 C  CD    A ARG A 1 772 ? 30.333  29.933  38.491  0.50 42.71 ? 772  ARG A CD    1 
ATOM   6346 C  CD    B ARG A 1 772 ? 30.284  30.000  37.957  0.50 38.28 ? 772  ARG A CD    1 
ATOM   6347 N  NE    A ARG A 1 772 ? 31.203  28.886  37.955  0.50 42.91 ? 772  ARG A NE    1 
ATOM   6348 N  NE    B ARG A 1 772 ? 31.031  28.994  37.206  0.50 34.60 ? 772  ARG A NE    1 
ATOM   6349 C  CZ    A ARG A 1 772 ? 31.678  27.866  38.665  0.50 41.48 ? 772  ARG A CZ    1 
ATOM   6350 C  CZ    B ARG A 1 772 ? 31.300  29.077  35.907  0.50 31.95 ? 772  ARG A CZ    1 
ATOM   6351 N  NH1   A ARG A 1 772 ? 31.381  27.753  39.951  0.50 40.25 ? 772  ARG A NH1   1 
ATOM   6352 N  NH1   B ARG A 1 772 ? 30.888  30.126  35.205  0.50 31.52 ? 772  ARG A NH1   1 
ATOM   6353 N  NH2   A ARG A 1 772 ? 32.455  26.960  38.090  0.50 39.93 ? 772  ARG A NH2   1 
ATOM   6354 N  NH2   B ARG A 1 772 ? 31.974  28.107  35.310  0.50 28.01 ? 772  ARG A NH2   1 
ATOM   6355 N  N     . GLN A 1 773 ? 25.087  32.659  38.383  1.00 36.77 ? 773  GLN A N     1 
ATOM   6356 C  CA    . GLN A 1 773 ? 24.191  33.613  39.038  1.00 37.68 ? 773  GLN A CA    1 
ATOM   6357 C  C     . GLN A 1 773 ? 22.749  33.118  39.057  1.00 34.86 ? 773  GLN A C     1 
ATOM   6358 O  O     . GLN A 1 773 ? 21.926  33.650  39.799  1.00 32.43 ? 773  GLN A O     1 
ATOM   6359 C  CB    . GLN A 1 773 ? 24.230  34.970  38.336  1.00 38.16 ? 773  GLN A CB    1 
ATOM   6360 C  CG    . GLN A 1 773 ? 25.621  35.546  38.146  1.00 48.18 ? 773  GLN A CG    1 
ATOM   6361 C  CD    . GLN A 1 773 ? 25.722  36.460  36.925  1.00 51.76 ? 773  GLN A CD    1 
ATOM   6362 O  OE1   . GLN A 1 773 ? 26.747  36.483  36.246  1.00 52.23 ? 773  GLN A OE1   1 
ATOM   6363 N  NE2   . GLN A 1 773 ? 24.658  37.211  36.643  1.00 52.54 ? 773  GLN A NE2   1 
ATOM   6364 N  N     . LEU A 1 774 ? 22.449  32.120  38.231  1.00 31.30 ? 774  LEU A N     1 
ATOM   6365 C  CA    . LEU A 1 774 ? 21.094  31.593  38.117  1.00 32.54 ? 774  LEU A CA    1 
ATOM   6366 C  C     . LEU A 1 774 ? 20.568  31.062  39.448  1.00 33.02 ? 774  LEU A C     1 
ATOM   6367 O  O     . LEU A 1 774 ? 21.317  30.490  40.237  1.00 35.82 ? 774  LEU A O     1 
ATOM   6368 C  CB    . LEU A 1 774 ? 21.031  30.505  37.041  1.00 30.51 ? 774  LEU A CB    1 
ATOM   6369 C  CG    . LEU A 1 774 ? 21.109  31.027  35.597  1.00 30.98 ? 774  LEU A CG    1 
ATOM   6370 C  CD1   . LEU A 1 774 ? 21.476  29.921  34.611  1.00 24.58 ? 774  LEU A CD1   1 
ATOM   6371 C  CD2   . LEU A 1 774 ? 19.812  31.728  35.196  1.00 26.02 ? 774  LEU A CD2   1 
ATOM   6372 N  N     . ASN A 1 775 ? 19.286  31.288  39.705  1.00 33.47 ? 775  ASN A N     1 
ATOM   6373 C  CA    . ASN A 1 775 ? 18.648  30.805  40.923  1.00 34.20 ? 775  ASN A CA    1 
ATOM   6374 C  C     . ASN A 1 775 ? 18.764  29.280  41.017  1.00 31.34 ? 775  ASN A C     1 
ATOM   6375 O  O     . ASN A 1 775 ? 18.539  28.576  40.030  1.00 29.95 ? 775  ASN A O     1 
ATOM   6376 C  CB    . ASN A 1 775 ? 17.184  31.237  40.964  1.00 33.70 ? 775  ASN A CB    1 
ATOM   6377 C  CG    . ASN A 1 775 ? 16.476  30.765  42.211  1.00 36.16 ? 775  ASN A CG    1 
ATOM   6378 O  OD1   . ASN A 1 775 ? 16.010  29.629  42.289  1.00 35.92 ? 775  ASN A OD1   1 
ATOM   6379 N  ND2   . ASN A 1 775 ? 16.395  31.636  43.199  1.00 38.43 ? 775  ASN A ND2   1 
ATOM   6380 N  N     . TYR A 1 776 ? 19.108  28.781  42.200  1.00 29.22 ? 776  TYR A N     1 
ATOM   6381 C  CA    . TYR A 1 776 ? 19.404  27.356  42.378  1.00 29.77 ? 776  TYR A CA    1 
ATOM   6382 C  C     . TYR A 1 776 ? 18.285  26.420  41.921  1.00 28.06 ? 776  TYR A C     1 
ATOM   6383 O  O     . TYR A 1 776 ? 18.553  25.321  41.453  1.00 28.40 ? 776  TYR A O     1 
ATOM   6384 C  CB    . TYR A 1 776 ? 19.832  27.056  43.821  1.00 31.72 ? 776  TYR A CB    1 
ATOM   6385 C  CG    . TYR A 1 776 ? 18.701  26.967  44.825  1.00 30.93 ? 776  TYR A CG    1 
ATOM   6386 C  CD1   . TYR A 1 776 ? 18.371  25.749  45.412  1.00 27.05 ? 776  TYR A CD1   1 
ATOM   6387 C  CD2   . TYR A 1 776 ? 17.971  28.096  45.194  1.00 29.14 ? 776  TYR A CD2   1 
ATOM   6388 C  CE1   . TYR A 1 776 ? 17.345  25.651  46.327  1.00 28.23 ? 776  TYR A CE1   1 
ATOM   6389 C  CE2   . TYR A 1 776 ? 16.940  28.010  46.118  1.00 30.06 ? 776  TYR A CE2   1 
ATOM   6390 C  CZ    . TYR A 1 776 ? 16.633  26.777  46.679  1.00 29.78 ? 776  TYR A CZ    1 
ATOM   6391 O  OH    . TYR A 1 776 ? 15.622  26.664  47.599  1.00 27.44 ? 776  TYR A OH    1 
ATOM   6392 N  N     . ILE A 1 777 ? 17.039  26.866  42.034  1.00 29.51 ? 777  ILE A N     1 
ATOM   6393 C  CA    . ILE A 1 777 ? 15.906  26.051  41.612  1.00 28.98 ? 777  ILE A CA    1 
ATOM   6394 C  C     . ILE A 1 777 ? 15.898  25.930  40.085  1.00 28.31 ? 777  ILE A C     1 
ATOM   6395 O  O     . ILE A 1 777 ? 15.678  24.853  39.540  1.00 28.88 ? 777  ILE A O     1 
ATOM   6396 C  CB    . ILE A 1 777 ? 14.571  26.592  42.191  1.00 30.73 ? 777  ILE A CB    1 
ATOM   6397 C  CG1   . ILE A 1 777 ? 14.525  26.312  43.702  1.00 27.67 ? 777  ILE A CG1   1 
ATOM   6398 C  CG2   . ILE A 1 777 ? 13.340  26.007  41.453  1.00 26.82 ? 777  ILE A CG2   1 
ATOM   6399 C  CD1   . ILE A 1 777 ? 13.392  27.012  44.449  1.00 28.98 ? 777  ILE A CD1   1 
ATOM   6400 N  N     . SER A 1 778 ? 16.196  27.030  39.408  1.00 25.84 ? 778  SER A N     1 
ATOM   6401 C  CA    . SER A 1 778 ? 16.234  27.047  37.946  1.00 25.95 ? 778  SER A CA    1 
ATOM   6402 C  C     . SER A 1 778 ? 17.329  26.155  37.338  1.00 24.61 ? 778  SER A C     1 
ATOM   6403 O  O     . SER A 1 778 ? 17.251  25.805  36.156  1.00 25.43 ? 778  SER A O     1 
ATOM   6404 C  CB    . SER A 1 778 ? 16.375  28.483  37.440  1.00 25.03 ? 778  SER A CB    1 
ATOM   6405 O  OG    . SER A 1 778 ? 17.696  28.954  37.635  1.00 29.07 ? 778  SER A OG    1 
ATOM   6406 N  N     . ILE A 1 779 ? 18.333  25.788  38.136  1.00 22.26 ? 779  ILE A N     1 
ATOM   6407 C  CA    . ILE A 1 779 ? 19.426  24.934  37.645  1.00 24.80 ? 779  ILE A CA    1 
ATOM   6408 C  C     . ILE A 1 779 ? 19.455  23.532  38.268  1.00 27.02 ? 779  ILE A C     1 
ATOM   6409 O  O     . ILE A 1 779 ? 20.363  22.723  38.006  1.00 27.88 ? 779  ILE A O     1 
ATOM   6410 C  CB    . ILE A 1 779 ? 20.811  25.644  37.706  1.00 24.69 ? 779  ILE A CB    1 
ATOM   6411 C  CG1   . ILE A 1 779 ? 21.112  26.194  39.105  1.00 21.12 ? 779  ILE A CG1   1 
ATOM   6412 C  CG2   . ILE A 1 779 ? 20.851  26.758  36.678  1.00 24.88 ? 779  ILE A CG2   1 
ATOM   6413 C  CD1   . ILE A 1 779 ? 22.464  26.898  39.225  1.00 23.36 ? 779  ILE A CD1   1 
ATOM   6414 N  N     . ALA A 1 780 ? 18.428  23.238  39.058  1.00 28.00 ? 780  ALA A N     1 
ATOM   6415 C  CA    . ALA A 1 780 ? 18.266  21.913  39.646  1.00 25.42 ? 780  ALA A CA    1 
ATOM   6416 C  C     . ALA A 1 780 ? 17.602  20.951  38.663  1.00 24.55 ? 780  ALA A C     1 
ATOM   6417 O  O     . ALA A 1 780 ? 16.588  21.289  38.036  1.00 24.54 ? 780  ALA A O     1 
ATOM   6418 C  CB    . ALA A 1 780 ? 17.444  22.011  40.925  1.00 22.51 ? 780  ALA A CB    1 
ATOM   6419 N  N     . SER A 1 781 ? 18.162  19.750  38.548  1.00 24.21 ? 781  SER A N     1 
ATOM   6420 C  CA    . SER A 1 781 ? 17.528  18.660  37.812  1.00 24.31 ? 781  SER A CA    1 
ATOM   6421 C  C     . SER A 1 781 ? 16.269  18.202  38.536  1.00 25.07 ? 781  SER A C     1 
ATOM   6422 O  O     . SER A 1 781 ? 16.074  18.527  39.700  1.00 25.22 ? 781  SER A O     1 
ATOM   6423 C  CB    . SER A 1 781 ? 18.485  17.469  37.685  1.00 23.73 ? 781  SER A CB    1 
ATOM   6424 O  OG    . SER A 1 781 ? 19.634  17.815  36.938  1.00 25.49 ? 781  SER A OG    1 
ATOM   6425 N  N     . VAL A 1 782 ? 15.429  17.426  37.848  1.00 26.92 ? 782  VAL A N     1 
ATOM   6426 C  CA    . VAL A 1 782 ? 14.184  16.911  38.425  1.00 26.28 ? 782  VAL A CA    1 
ATOM   6427 C  C     . VAL A 1 782 ? 14.088  15.409  38.155  1.00 26.48 ? 782  VAL A C     1 
ATOM   6428 O  O     . VAL A 1 782 ? 14.426  14.946  37.068  1.00 25.06 ? 782  VAL A O     1 
ATOM   6429 C  CB    . VAL A 1 782 ? 12.928  17.600  37.827  1.00 27.42 ? 782  VAL A CB    1 
ATOM   6430 C  CG1   . VAL A 1 782 ? 11.647  17.049  38.466  1.00 27.22 ? 782  VAL A CG1   1 
ATOM   6431 C  CG2   . VAL A 1 782 ? 12.988  19.135  37.975  1.00 24.28 ? 782  VAL A CG2   1 
ATOM   6432 N  N     . SER A 1 783 ? 13.637  14.650  39.146  1.00 27.17 ? 783  SER A N     1 
ATOM   6433 C  CA    . SER A 1 783 ? 13.334  13.241  38.921  1.00 27.68 ? 783  SER A CA    1 
ATOM   6434 C  C     . SER A 1 783 ? 12.219  12.742  39.813  1.00 28.29 ? 783  SER A C     1 
ATOM   6435 O  O     . SER A 1 783 ? 12.068  13.195  40.948  1.00 29.39 ? 783  SER A O     1 
ATOM   6436 C  CB    . SER A 1 783 ? 14.579  12.369  39.104  1.00 26.92 ? 783  SER A CB    1 
ATOM   6437 O  OG    . SER A 1 783 ? 14.301  11.031  38.725  1.00 27.27 ? 783  SER A OG    1 
ATOM   6438 N  N     . SER A 1 784 ? 11.422  11.824  39.270  1.00 31.44 ? 784  SER A N     1 
ATOM   6439 C  CA    . SER A 1 784 ? 10.543  10.975  40.069  1.00 31.76 ? 784  SER A CA    1 
ATOM   6440 C  C     . SER A 1 784 ? 11.413  10.182  41.035  1.00 33.15 ? 784  SER A C     1 
ATOM   6441 O  O     . SER A 1 784 ? 12.576  9.899   40.739  1.00 33.52 ? 784  SER A O     1 
ATOM   6442 C  CB    . SER A 1 784 ? 9.770   9.996   39.175  1.00 31.34 ? 784  SER A CB    1 
ATOM   6443 O  OG    . SER A 1 784 ? 8.589   10.565  38.624  1.00 31.78 ? 784  SER A OG    1 
ATOM   6444 N  N     . ALA A 1 785 ? 10.850  9.817   42.180  1.00 33.69 ? 785  ALA A N     1 
ATOM   6445 C  CA    . ALA A 1 785 ? 11.600  9.100   43.208  1.00 36.21 ? 785  ALA A CA    1 
ATOM   6446 C  C     . ALA A 1 785 ? 10.855  7.862   43.712  1.00 36.64 ? 785  ALA A C     1 
ATOM   6447 O  O     . ALA A 1 785 ? 10.007  7.957   44.599  1.00 37.49 ? 785  ALA A O     1 
ATOM   6448 C  CB    . ALA A 1 785 ? 11.923  10.041  44.364  1.00 35.80 ? 785  ALA A CB    1 
ATOM   6449 N  N     . ASN A 1 786 ? 11.169  6.705   43.132  1.00 37.98 ? 786  ASN A N     1 
ATOM   6450 C  CA    . ASN A 1 786 ? 10.589  5.437   43.574  1.00 39.62 ? 786  ASN A CA    1 
ATOM   6451 C  C     . ASN A 1 786 ? 11.608  4.608   44.326  1.00 41.12 ? 786  ASN A C     1 
ATOM   6452 O  O     . ASN A 1 786 ? 12.818  4.753   44.112  1.00 40.26 ? 786  ASN A O     1 
ATOM   6453 C  CB    . ASN A 1 786 ? 10.056  4.628   42.384  1.00 38.76 ? 786  ASN A CB    1 
ATOM   6454 C  CG    . ASN A 1 786 ? 9.099   5.427   41.521  1.00 37.78 ? 786  ASN A CG    1 
ATOM   6455 O  OD1   . ASN A 1 786 ? 8.148   6.027   42.022  1.00 38.47 ? 786  ASN A OD1   1 
ATOM   6456 N  ND2   . ASN A 1 786 ? 9.352   5.448   40.217  1.00 34.45 ? 786  ASN A ND2   1 
ATOM   6457 N  N     . ASN A 1 787 ? 11.105  3.737   45.198  1.00 42.68 ? 787  ASN A N     1 
ATOM   6458 C  CA    . ASN A 1 787 ? 11.917  2.740   45.890  1.00 43.85 ? 787  ASN A CA    1 
ATOM   6459 C  C     . ASN A 1 787 ? 13.032  3.341   46.731  1.00 43.09 ? 787  ASN A C     1 
ATOM   6460 O  O     . ASN A 1 787 ? 14.179  2.876   46.694  1.00 43.98 ? 787  ASN A O     1 
ATOM   6461 C  CB    . ASN A 1 787 ? 12.487  1.730   44.893  1.00 44.67 ? 787  ASN A CB    1 
ATOM   6462 C  CG    . ASN A 1 787 ? 11.435  0.795   44.357  1.00 50.65 ? 787  ASN A CG    1 
ATOM   6463 O  OD1   . ASN A 1 787 ? 10.676  0.182   45.116  1.00 52.29 ? 787  ASN A OD1   1 
ATOM   6464 N  ND2   . ASN A 1 787 ? 11.386  0.668   43.039  1.00 49.76 ? 787  ASN A ND2   1 
ATOM   6465 N  N     . ILE A 1 788 ? 12.687  4.373   47.491  1.00 39.85 ? 788  ILE A N     1 
ATOM   6466 C  CA    . ILE A 1 788 ? 13.664  5.043   48.330  1.00 40.07 ? 788  ILE A CA    1 
ATOM   6467 C  C     . ILE A 1 788 ? 14.146  4.099   49.429  1.00 41.95 ? 788  ILE A C     1 
ATOM   6468 O  O     . ILE A 1 788 ? 15.332  4.080   49.746  1.00 43.42 ? 788  ILE A O     1 
ATOM   6469 C  CB    . ILE A 1 788 ? 13.120  6.359   48.925  1.00 38.82 ? 788  ILE A CB    1 
ATOM   6470 C  CG1   . ILE A 1 788 ? 12.661  7.291   47.805  1.00 37.08 ? 788  ILE A CG1   1 
ATOM   6471 C  CG2   . ILE A 1 788 ? 14.182  7.038   49.790  1.00 38.16 ? 788  ILE A CG2   1 
ATOM   6472 C  CD1   . ILE A 1 788 ? 12.000  8.573   48.285  1.00 44.51 ? 788  ILE A CD1   1 
ATOM   6473 N  N     . ALA A 1 789 ? 13.231  3.306   49.983  1.00 42.80 ? 789  ALA A N     1 
ATOM   6474 C  CA    . ALA A 1 789 ? 13.568  2.347   51.040  1.00 44.34 ? 789  ALA A CA    1 
ATOM   6475 C  C     . ALA A 1 789 ? 14.527  1.256   50.555  1.00 44.81 ? 789  ALA A C     1 
ATOM   6476 O  O     . ALA A 1 789 ? 15.470  0.905   51.266  1.00 46.61 ? 789  ALA A O     1 
ATOM   6477 C  CB    . ALA A 1 789 ? 12.303  1.733   51.639  1.00 45.03 ? 789  ALA A CB    1 
ATOM   6478 N  N     . LYS A 1 790 ? 14.291  0.755   49.340  1.00 45.27 ? 790  LYS A N     1 
ATOM   6479 C  CA    . LYS A 1 790 ? 15.100  -0.313  48.730  1.00 46.89 ? 790  LYS A CA    1 
ATOM   6480 C  C     . LYS A 1 790 ? 16.614  -0.034  48.746  1.00 45.74 ? 790  LYS A C     1 
ATOM   6481 O  O     . LYS A 1 790 ? 17.410  -0.943  48.957  1.00 46.40 ? 790  LYS A O     1 
ATOM   6482 C  CB    . LYS A 1 790 ? 14.625  -0.589  47.293  1.00 47.35 ? 790  LYS A CB    1 
ATOM   6483 C  CG    . LYS A 1 790 ? 15.347  -1.744  46.583  1.00 52.00 ? 790  LYS A CG    1 
ATOM   6484 C  CD    . LYS A 1 790 ? 14.926  -1.908  45.116  1.00 57.21 ? 790  LYS A CD    1 
ATOM   6485 C  CE    . LYS A 1 790 ? 13.772  -2.904  44.958  1.00 63.43 ? 790  LYS A CE    1 
ATOM   6486 N  NZ    . LYS A 1 790 ? 13.492  -3.258  43.530  1.00 63.76 ? 790  LYS A NZ    1 
ATOM   6487 N  N     . TYR A 1 791 ? 16.994  1.224   48.534  1.00 43.69 ? 791  TYR A N     1 
ATOM   6488 C  CA    . TYR A 1 791 ? 18.402  1.608   48.409  1.00 43.08 ? 791  TYR A CA    1 
ATOM   6489 C  C     . TYR A 1 791 ? 18.967  2.242   49.681  1.00 44.28 ? 791  TYR A C     1 
ATOM   6490 O  O     . TYR A 1 791 ? 20.116  2.708   49.709  1.00 44.08 ? 791  TYR A O     1 
ATOM   6491 C  CB    . TYR A 1 791 ? 18.585  2.534   47.202  1.00 41.82 ? 791  TYR A CB    1 
ATOM   6492 C  CG    . TYR A 1 791 ? 18.319  1.840   45.886  1.00 39.26 ? 791  TYR A CG    1 
ATOM   6493 C  CD1   . TYR A 1 791 ? 17.134  2.059   45.179  1.00 34.74 ? 791  TYR A CD1   1 
ATOM   6494 C  CD2   . TYR A 1 791 ? 19.243  0.931   45.367  1.00 38.17 ? 791  TYR A CD2   1 
ATOM   6495 C  CE1   . TYR A 1 791 ? 16.892  1.399   43.966  1.00 34.89 ? 791  TYR A CE1   1 
ATOM   6496 C  CE2   . TYR A 1 791 ? 19.012  0.273   44.177  1.00 36.39 ? 791  TYR A CE2   1 
ATOM   6497 C  CZ    . TYR A 1 791 ? 17.845  0.509   43.478  1.00 35.37 ? 791  TYR A CZ    1 
ATOM   6498 O  OH    . TYR A 1 791 ? 17.651  -0.161  42.297  1.00 30.93 ? 791  TYR A OH    1 
ATOM   6499 N  N     . ASP A 1 792 ? 18.151  2.238   50.730  1.00 45.26 ? 792  ASP A N     1 
ATOM   6500 C  CA    . ASP A 1 792 ? 18.514  2.811   52.016  1.00 46.64 ? 792  ASP A CA    1 
ATOM   6501 C  C     . ASP A 1 792 ? 19.100  1.736   52.942  1.00 48.53 ? 792  ASP A C     1 
ATOM   6502 O  O     . ASP A 1 792 ? 18.382  0.868   53.445  1.00 49.83 ? 792  ASP A O     1 
ATOM   6503 C  CB    . ASP A 1 792 ? 17.274  3.465   52.637  1.00 47.52 ? 792  ASP A CB    1 
ATOM   6504 C  CG    . ASP A 1 792 ? 17.575  4.228   53.914  1.00 47.71 ? 792  ASP A CG    1 
ATOM   6505 O  OD1   . ASP A 1 792 ? 18.517  3.864   54.646  1.00 47.83 ? 792  ASP A OD1   1 
ATOM   6506 O  OD2   . ASP A 1 792 ? 16.833  5.188   54.197  1.00 49.42 ? 792  ASP A OD2   1 
ATOM   6507 N  N     . VAL A 1 793 ? 20.412  1.801   53.147  1.00 47.69 ? 793  VAL A N     1 
ATOM   6508 C  CA    . VAL A 1 793 ? 21.095  0.937   54.093  1.00 49.81 ? 793  VAL A CA    1 
ATOM   6509 C  C     . VAL A 1 793 ? 21.640  1.804   55.232  1.00 51.25 ? 793  VAL A C     1 
ATOM   6510 O  O     . VAL A 1 793 ? 22.686  2.445   55.099  1.00 50.76 ? 793  VAL A O     1 
ATOM   6511 C  CB    . VAL A 1 793 ? 22.217  0.104   53.413  1.00 50.87 ? 793  VAL A CB    1 
ATOM   6512 C  CG1   . VAL A 1 793 ? 22.935  -0.792  54.430  1.00 54.12 ? 793  VAL A CG1   1 
ATOM   6513 C  CG2   . VAL A 1 793 ? 21.643  -0.747  52.286  1.00 50.65 ? 793  VAL A CG2   1 
ATOM   6514 N  N     . GLY A 1 794 ? 20.898  1.833   56.338  1.00 52.43 ? 794  GLY A N     1 
ATOM   6515 C  CA    . GLY A 1 794 ? 21.238  2.641   57.511  1.00 53.88 ? 794  GLY A CA    1 
ATOM   6516 C  C     . GLY A 1 794 ? 21.396  4.126   57.225  1.00 52.26 ? 794  GLY A C     1 
ATOM   6517 O  O     . GLY A 1 794 ? 22.283  4.771   57.779  1.00 52.74 ? 794  GLY A O     1 
ATOM   6518 N  N     . GLY A 1 795 ? 20.545  4.660   56.349  1.00 51.03 ? 795  GLY A N     1 
ATOM   6519 C  CA    . GLY A 1 795 ? 20.606  6.070   55.947  1.00 48.08 ? 795  GLY A CA    1 
ATOM   6520 C  C     . GLY A 1 795 ? 21.619  6.372   54.854  1.00 47.75 ? 795  GLY A C     1 
ATOM   6521 O  O     . GLY A 1 795 ? 21.806  7.536   54.478  1.00 46.66 ? 795  GLY A O     1 
ATOM   6522 N  N     . PHE A 1 796 ? 22.271  5.324   54.348  1.00 46.86 ? 796  PHE A N     1 
ATOM   6523 C  CA    . PHE A 1 796 ? 23.310  5.443   53.322  1.00 45.27 ? 796  PHE A CA    1 
ATOM   6524 C  C     . PHE A 1 796 ? 22.956  4.621   52.071  1.00 43.06 ? 796  PHE A C     1 
ATOM   6525 O  O     . PHE A 1 796 ? 22.179  3.672   52.160  1.00 43.49 ? 796  PHE A O     1 
ATOM   6526 C  CB    . PHE A 1 796 ? 24.678  5.024   53.887  1.00 47.40 ? 796  PHE A CB    1 
ATOM   6527 C  CG    . PHE A 1 796 ? 25.291  6.041   54.817  1.00 50.61 ? 796  PHE A CG    1 
ATOM   6528 C  CD1   . PHE A 1 796 ? 25.959  7.155   54.311  1.00 50.56 ? 796  PHE A CD1   1 
ATOM   6529 C  CD2   . PHE A 1 796 ? 25.201  5.887   56.199  1.00 54.40 ? 796  PHE A CD2   1 
ATOM   6530 C  CE1   . PHE A 1 796 ? 26.524  8.105   55.162  1.00 51.86 ? 796  PHE A CE1   1 
ATOM   6531 C  CE2   . PHE A 1 796 ? 25.764  6.833   57.065  1.00 54.81 ? 796  PHE A CE2   1 
ATOM   6532 C  CZ    . PHE A 1 796 ? 26.427  7.942   56.545  1.00 53.62 ? 796  PHE A CZ    1 
ATOM   6533 N  N     . PRO A 1 797 ? 23.503  5.002   50.895  1.00 40.30 ? 797  PRO A N     1 
ATOM   6534 C  CA    . PRO A 1 797 ? 23.182  4.310   49.643  1.00 38.69 ? 797  PRO A CA    1 
ATOM   6535 C  C     . PRO A 1 797 ? 23.598  2.845   49.608  1.00 40.26 ? 797  PRO A C     1 
ATOM   6536 O  O     . PRO A 1 797 ? 24.741  2.520   49.910  1.00 39.49 ? 797  PRO A O     1 
ATOM   6537 C  CB    . PRO A 1 797 ? 23.964  5.103   48.587  1.00 37.69 ? 797  PRO A CB    1 
ATOM   6538 C  CG    . PRO A 1 797 ? 24.898  5.990   49.346  1.00 38.95 ? 797  PRO A CG    1 
ATOM   6539 C  CD    . PRO A 1 797 ? 24.229  6.259   50.640  1.00 39.04 ? 797  PRO A CD    1 
ATOM   6540 N  N     . GLY A 1 798 ? 22.659  1.981   49.240  1.00 41.41 ? 798  GLY A N     1 
ATOM   6541 C  CA    . GLY A 1 798 ? 22.936  0.566   49.024  1.00 42.95 ? 798  GLY A CA    1 
ATOM   6542 C  C     . GLY A 1 798 ? 23.492  0.338   47.629  1.00 43.24 ? 798  GLY A C     1 
ATOM   6543 O  O     . GLY A 1 798 ? 23.573  1.285   46.836  1.00 40.68 ? 798  GLY A O     1 
ATOM   6544 N  N     . PRO A 1 799 ? 23.890  -0.916  47.320  1.00 44.79 ? 799  PRO A N     1 
ATOM   6545 C  CA    . PRO A 1 799 ? 24.341  -1.275  45.972  1.00 45.30 ? 799  PRO A CA    1 
ATOM   6546 C  C     . PRO A 1 799 ? 23.410  -0.748  44.880  1.00 43.92 ? 799  PRO A C     1 
ATOM   6547 O  O     . PRO A 1 799 ? 22.185  -0.765  45.049  1.00 43.90 ? 799  PRO A O     1 
ATOM   6548 C  CB    . PRO A 1 799 ? 24.323  -2.806  46.001  1.00 46.11 ? 799  PRO A CB    1 
ATOM   6549 C  CG    . PRO A 1 799 ? 24.667  -3.143  47.416  1.00 48.71 ? 799  PRO A CG    1 
ATOM   6550 C  CD    . PRO A 1 799 ? 24.102  -2.024  48.276  1.00 47.95 ? 799  PRO A CD    1 
ATOM   6551 N  N     . LYS A 1 800 ? 24.000  -0.267  43.787  1.00 44.34 ? 800  LYS A N     1 
ATOM   6552 C  CA    . LYS A 1 800 ? 23.261  0.222   42.608  1.00 44.40 ? 800  LYS A CA    1 
ATOM   6553 C  C     . LYS A 1 800 ? 22.318  1.397   42.883  1.00 41.84 ? 800  LYS A C     1 
ATOM   6554 O  O     . LYS A 1 800 ? 21.347  1.598   42.141  1.00 39.60 ? 800  LYS A O     1 
ATOM   6555 C  CB    . LYS A 1 800 ? 22.484  -0.920  41.934  1.00 46.67 ? 800  LYS A CB    1 
ATOM   6556 C  CG    . LYS A 1 800 ? 23.302  -1.731  40.945  1.00 54.26 ? 800  LYS A CG    1 
ATOM   6557 C  CD    . LYS A 1 800 ? 22.771  -3.156  40.801  1.00 59.03 ? 800  LYS A CD    1 
ATOM   6558 C  CE    . LYS A 1 800 ? 23.894  -4.108  40.384  1.00 62.65 ? 800  LYS A CE    1 
ATOM   6559 N  NZ    . LYS A 1 800 ? 23.481  -5.540  40.415  1.00 63.69 ? 800  LYS A NZ    1 
ATOM   6560 N  N     . CYS A 1 801 ? 22.604  2.166   43.935  1.00 40.42 ? 801  CYS A N     1 
ATOM   6561 C  CA    . CYS A 1 801 ? 21.746  3.292   44.311  1.00 39.59 ? 801  CYS A CA    1 
ATOM   6562 C  C     . CYS A 1 801 ? 21.694  4.357   43.217  1.00 36.36 ? 801  CYS A C     1 
ATOM   6563 O  O     . CYS A 1 801 ? 22.730  4.913   42.841  1.00 34.43 ? 801  CYS A O     1 
ATOM   6564 C  CB    . CYS A 1 801 ? 22.181  3.920   45.636  1.00 38.69 ? 801  CYS A CB    1 
ATOM   6565 S  SG    . CYS A 1 801 ? 21.064  5.249   46.210  1.00 39.42 ? 801  CYS A SG    1 
ATOM   6566 N  N     . PRO A 1 802 ? 20.484  4.634   42.694  1.00 35.38 ? 802  PRO A N     1 
ATOM   6567 C  CA    . PRO A 1 802 ? 20.337  5.687   41.687  1.00 33.35 ? 802  PRO A CA    1 
ATOM   6568 C  C     . PRO A 1 802 ? 20.791  7.041   42.238  1.00 31.15 ? 802  PRO A C     1 
ATOM   6569 O  O     . PRO A 1 802 ? 20.732  7.266   43.448  1.00 29.33 ? 802  PRO A O     1 
ATOM   6570 C  CB    . PRO A 1 802 ? 18.834  5.692   41.394  1.00 31.51 ? 802  PRO A CB    1 
ATOM   6571 C  CG    . PRO A 1 802 ? 18.366  4.331   41.770  1.00 35.64 ? 802  PRO A CG    1 
ATOM   6572 C  CD    . PRO A 1 802 ? 19.204  3.958   42.970  1.00 35.36 ? 802  PRO A CD    1 
ATOM   6573 N  N     . PHE A 1 803 ? 21.259  7.910   41.348  1.00 29.32 ? 803  PHE A N     1 
ATOM   6574 C  CA    . PHE A 1 803 ? 21.854  9.193   41.722  1.00 30.38 ? 803  PHE A CA    1 
ATOM   6575 C  C     . PHE A 1 803 ? 20.871  10.100  42.456  1.00 30.69 ? 803  PHE A C     1 
ATOM   6576 O  O     . PHE A 1 803 ? 21.234  10.747  43.434  1.00 31.20 ? 803  PHE A O     1 
ATOM   6577 C  CB    . PHE A 1 803 ? 22.383  9.880   40.466  1.00 30.06 ? 803  PHE A CB    1 
ATOM   6578 C  CG    . PHE A 1 803 ? 23.120  11.178  40.716  1.00 24.65 ? 803  PHE A CG    1 
ATOM   6579 C  CD1   . PHE A 1 803 ? 24.494  11.179  40.957  1.00 26.26 ? 803  PHE A CD1   1 
ATOM   6580 C  CD2   . PHE A 1 803 ? 22.457  12.399  40.615  1.00 22.33 ? 803  PHE A CD2   1 
ATOM   6581 C  CE1   . PHE A 1 803 ? 25.188  12.379  41.148  1.00 20.77 ? 803  PHE A CE1   1 
ATOM   6582 C  CE2   . PHE A 1 803 ? 23.144  13.618  40.803  1.00 21.41 ? 803  PHE A CE2   1 
ATOM   6583 C  CZ    . PHE A 1 803 ? 24.508  13.601  41.068  1.00 24.94 ? 803  PHE A CZ    1 
ATOM   6584 N  N     . HIS A 1 804 ? 19.631  10.152  41.985  1.00 30.08 ? 804  HIS A N     1 
ATOM   6585 C  CA    . HIS A 1 804 ? 18.617  10.980  42.644  1.00 29.70 ? 804  HIS A CA    1 
ATOM   6586 C  C     . HIS A 1 804 ? 18.177  10.414  43.996  1.00 30.51 ? 804  HIS A C     1 
ATOM   6587 O  O     . HIS A 1 804 ? 17.853  11.178  44.906  1.00 30.42 ? 804  HIS A O     1 
ATOM   6588 C  CB    . HIS A 1 804 ? 17.415  11.229  41.728  1.00 29.03 ? 804  HIS A CB    1 
ATOM   6589 C  CG    . HIS A 1 804 ? 16.653  9.993   41.369  1.00 29.31 ? 804  HIS A CG    1 
ATOM   6590 N  ND1   . HIS A 1 804 ? 17.156  9.023   40.530  1.00 30.84 ? 804  HIS A ND1   1 
ATOM   6591 C  CD2   . HIS A 1 804 ? 15.411  9.583   41.713  1.00 29.42 ? 804  HIS A CD2   1 
ATOM   6592 C  CE1   . HIS A 1 804 ? 16.264  8.060   40.385  1.00 30.80 ? 804  HIS A CE1   1 
ATOM   6593 N  NE2   . HIS A 1 804 ? 15.193  8.376   41.090  1.00 31.37 ? 804  HIS A NE2   1 
ATOM   6594 N  N     . ILE A 1 805 ? 18.180  9.083   44.127  1.00 30.25 ? 805  ILE A N     1 
ATOM   6595 C  CA    . ILE A 1 805 ? 17.869  8.435   45.404  1.00 30.98 ? 805  ILE A CA    1 
ATOM   6596 C  C     . ILE A 1 805 ? 18.999  8.698   46.398  1.00 33.44 ? 805  ILE A C     1 
ATOM   6597 O  O     . ILE A 1 805 ? 18.750  8.976   47.574  1.00 36.88 ? 805  ILE A O     1 
ATOM   6598 C  CB    . ILE A 1 805 ? 17.606  6.911   45.256  1.00 31.60 ? 805  ILE A CB    1 
ATOM   6599 C  CG1   . ILE A 1 805 ? 16.510  6.635   44.214  1.00 31.87 ? 805  ILE A CG1   1 
ATOM   6600 C  CG2   . ILE A 1 805 ? 17.263  6.285   46.615  1.00 28.64 ? 805  ILE A CG2   1 
ATOM   6601 C  CD1   . ILE A 1 805 ? 15.130  7.247   44.514  1.00 31.80 ? 805  ILE A CD1   1 
ATOM   6602 N  N     . ARG A 1 806 ? 20.237  8.636   45.915  1.00 32.11 ? 806  ARG A N     1 
ATOM   6603 C  CA    . ARG A 1 806 ? 21.396  9.069   46.701  1.00 33.83 ? 806  ARG A CA    1 
ATOM   6604 C  C     . ARG A 1 806 ? 21.194  10.480  47.275  1.00 33.01 ? 806  ARG A C     1 
ATOM   6605 O  O     . ARG A 1 806 ? 21.475  10.728  48.454  1.00 33.24 ? 806  ARG A O     1 
ATOM   6606 C  CB    . ARG A 1 806 ? 22.674  9.013   45.857  1.00 33.23 ? 806  ARG A CB    1 
ATOM   6607 C  CG    . ARG A 1 806 ? 23.934  9.458   46.588  1.00 33.16 ? 806  ARG A CG    1 
ATOM   6608 C  CD    . ARG A 1 806 ? 25.153  9.331   45.690  1.00 35.65 ? 806  ARG A CD    1 
ATOM   6609 N  NE    . ARG A 1 806 ? 25.464  7.935   45.389  1.00 33.78 ? 806  ARG A NE    1 
ATOM   6610 C  CZ    . ARG A 1 806 ? 26.331  7.197   46.074  1.00 35.22 ? 806  ARG A CZ    1 
ATOM   6611 N  NH1   . ARG A 1 806 ? 26.996  7.719   47.102  1.00 36.47 ? 806  ARG A NH1   1 
ATOM   6612 N  NH2   . ARG A 1 806 ? 26.536  5.937   45.729  1.00 33.86 ? 806  ARG A NH2   1 
ATOM   6613 N  N     . GLY A 1 807 ? 20.704  11.388  46.432  1.00 30.22 ? 807  GLY A N     1 
ATOM   6614 C  CA    . GLY A 1 807 ? 20.438  12.768  46.829  1.00 29.54 ? 807  GLY A CA    1 
ATOM   6615 C  C     . GLY A 1 807 ? 19.422  12.875  47.951  1.00 30.08 ? 807  GLY A C     1 
ATOM   6616 O  O     . GLY A 1 807 ? 19.569  13.701  48.848  1.00 29.62 ? 807  GLY A O     1 
ATOM   6617 N  N     . ILE A 1 808 ? 18.390  12.036  47.890  1.00 29.87 ? 808  ILE A N     1 
ATOM   6618 C  CA    . ILE A 1 808 ? 17.343  12.002  48.909  1.00 29.81 ? 808  ILE A CA    1 
ATOM   6619 C  C     . ILE A 1 808 ? 17.877  11.520  50.254  1.00 32.40 ? 808  ILE A C     1 
ATOM   6620 O  O     . ILE A 1 808 ? 17.509  12.064  51.302  1.00 33.48 ? 808  ILE A O     1 
ATOM   6621 C  CB    . ILE A 1 808 ? 16.160  11.109  48.471  1.00 31.38 ? 808  ILE A CB    1 
ATOM   6622 C  CG1   . ILE A 1 808 ? 15.328  11.831  47.409  1.00 27.47 ? 808  ILE A CG1   1 
ATOM   6623 C  CG2   . ILE A 1 808 ? 15.288  10.710  49.676  1.00 28.68 ? 808  ILE A CG2   1 
ATOM   6624 C  CD1   . ILE A 1 808 ? 14.474  10.918  46.587  1.00 26.51 ? 808  ILE A CD1   1 
ATOM   6625 N  N     . LEU A 1 809 ? 18.744  10.510  50.216  1.00 31.04 ? 809  LEU A N     1 
ATOM   6626 C  CA    . LEU A 1 809 ? 19.335  9.957   51.427  1.00 34.26 ? 809  LEU A CA    1 
ATOM   6627 C  C     . LEU A 1 809 ? 20.259  10.963  52.088  1.00 34.32 ? 809  LEU A C     1 
ATOM   6628 O  O     . LEU A 1 809 ? 20.265  11.098  53.310  1.00 34.54 ? 809  LEU A O     1 
ATOM   6629 C  CB    . LEU A 1 809 ? 20.086  8.663   51.127  1.00 34.71 ? 809  LEU A CB    1 
ATOM   6630 C  CG    . LEU A 1 809 ? 19.263  7.486   50.608  1.00 35.40 ? 809  LEU A CG    1 
ATOM   6631 C  CD1   . LEU A 1 809 ? 20.194  6.336   50.250  1.00 38.94 ? 809  LEU A CD1   1 
ATOM   6632 C  CD2   . LEU A 1 809 ? 18.229  7.037   51.621  1.00 41.32 ? 809  LEU A CD2   1 
ATOM   6633 N  N     . THR A 1 810 ? 21.028  11.680  51.275  1.00 34.70 ? 810  THR A N     1 
ATOM   6634 C  CA    . THR A 1 810 ? 21.838  12.794  51.778  1.00 34.03 ? 810  THR A CA    1 
ATOM   6635 C  C     . THR A 1 810 ? 20.939  13.794  52.506  1.00 34.16 ? 810  THR A C     1 
ATOM   6636 O  O     . THR A 1 810 ? 21.220  14.184  53.642  1.00 35.21 ? 810  THR A O     1 
ATOM   6637 C  CB    . THR A 1 810 ? 22.575  13.487  50.625  1.00 33.13 ? 810  THR A CB    1 
ATOM   6638 O  OG1   . THR A 1 810 ? 23.307  12.503  49.880  1.00 34.46 ? 810  THR A OG1   1 
ATOM   6639 C  CG2   . THR A 1 810 ? 23.518  14.565  51.143  1.00 27.56 ? 810  THR A CG2   1 
ATOM   6640 N  N     . TYR A 1 811 ? 19.851  14.188  51.845  1.00 33.91 ? 811  TYR A N     1 
ATOM   6641 C  CA    . TYR A 1 811 ? 18.848  15.071  52.441  1.00 34.10 ? 811  TYR A CA    1 
ATOM   6642 C  C     . TYR A 1 811 ? 18.309  14.502  53.757  1.00 34.39 ? 811  TYR A C     1 
ATOM   6643 O  O     . TYR A 1 811 ? 18.268  15.205  54.764  1.00 35.35 ? 811  TYR A O     1 
ATOM   6644 C  CB    . TYR A 1 811 ? 17.698  15.335  51.446  1.00 32.08 ? 811  TYR A CB    1 
ATOM   6645 C  CG    . TYR A 1 811 ? 16.562  16.200  51.975  1.00 31.45 ? 811  TYR A CG    1 
ATOM   6646 C  CD1   . TYR A 1 811 ? 16.701  17.587  52.068  1.00 31.69 ? 811  TYR A CD1   1 
ATOM   6647 C  CD2   . TYR A 1 811 ? 15.348  15.634  52.363  1.00 30.19 ? 811  TYR A CD2   1 
ATOM   6648 C  CE1   . TYR A 1 811 ? 15.664  18.394  52.547  1.00 30.97 ? 811  TYR A CE1   1 
ATOM   6649 C  CE2   . TYR A 1 811 ? 14.298  16.429  52.839  1.00 29.45 ? 811  TYR A CE2   1 
ATOM   6650 C  CZ    . TYR A 1 811 ? 14.467  17.808  52.932  1.00 34.43 ? 811  TYR A CZ    1 
ATOM   6651 O  OH    . TYR A 1 811 ? 13.442  18.609  53.405  1.00 38.35 ? 811  TYR A OH    1 
ATOM   6652 N  N     . ASN A 1 812 ? 17.916  13.230  53.739  1.00 35.77 ? 812  ASN A N     1 
ATOM   6653 C  CA    . ASN A 1 812 ? 17.302  12.582  54.897  1.00 38.32 ? 812  ASN A CA    1 
ATOM   6654 C  C     . ASN A 1 812 ? 18.203  12.603  56.139  1.00 40.47 ? 812  ASN A C     1 
ATOM   6655 O  O     . ASN A 1 812 ? 17.717  12.821  57.245  1.00 42.92 ? 812  ASN A O     1 
ATOM   6656 C  CB    . ASN A 1 812 ? 16.873  11.146  54.562  1.00 38.87 ? 812  ASN A CB    1 
ATOM   6657 C  CG    . ASN A 1 812 ? 15.599  11.074  53.709  1.00 36.93 ? 812  ASN A CG    1 
ATOM   6658 O  OD1   . ASN A 1 812 ? 14.982  12.086  53.374  1.00 34.70 ? 812  ASN A OD1   1 
ATOM   6659 N  ND2   . ASN A 1 812 ? 15.204  9.857   53.363  1.00 33.94 ? 812  ASN A ND2   1 
ATOM   6660 N  N     . ARG A 1 813 ? 19.506  12.394  55.946  1.00 41.41 ? 813  ARG A N     1 
ATOM   6661 C  CA    . ARG A 1 813 ? 20.482  12.494  57.045  1.00 43.17 ? 813  ARG A CA    1 
ATOM   6662 C  C     . ARG A 1 813 ? 20.587  13.924  57.556  1.00 43.98 ? 813  ARG A C     1 
ATOM   6663 O  O     . ARG A 1 813 ? 20.676  14.147  58.766  1.00 47.12 ? 813  ARG A O     1 
ATOM   6664 C  CB    . ARG A 1 813 ? 21.872  12.010  56.621  1.00 41.42 ? 813  ARG A CB    1 
ATOM   6665 C  CG    . ARG A 1 813 ? 21.938  10.549  56.196  1.00 42.48 ? 813  ARG A CG    1 
ATOM   6666 C  CD    . ARG A 1 813 ? 23.378  10.027  56.115  1.00 41.95 ? 813  ARG A CD    1 
ATOM   6667 N  NE    . ARG A 1 813 ? 24.238  10.801  55.218  1.00 42.64 ? 813  ARG A NE    1 
ATOM   6668 C  CZ    . ARG A 1 813 ? 24.341  10.607  53.904  1.00 44.83 ? 813  ARG A CZ    1 
ATOM   6669 N  NH1   . ARG A 1 813 ? 23.623  9.665   53.300  1.00 43.76 ? 813  ARG A NH1   1 
ATOM   6670 N  NH2   . ARG A 1 813 ? 25.161  11.369  53.186  1.00 47.01 ? 813  ARG A NH2   1 
ATOM   6671 N  N     . ALA A 1 814 ? 20.568  14.884  56.630  1.00 41.50 ? 814  ALA A N     1 
ATOM   6672 C  CA    . ALA A 1 814 ? 20.776  16.291  56.961  1.00 41.23 ? 814  ALA A CA    1 
ATOM   6673 C  C     . ALA A 1 814 ? 19.611  16.901  57.747  1.00 41.79 ? 814  ALA A C     1 
ATOM   6674 O  O     . ALA A 1 814 ? 19.811  17.852  58.501  1.00 42.71 ? 814  ALA A O     1 
ATOM   6675 C  CB    . ALA A 1 814 ? 21.069  17.103  55.703  1.00 38.54 ? 814  ALA A CB    1 
ATOM   6676 N  N     . ILE A 1 815 ? 18.407  16.348  57.584  1.00 40.86 ? 815  ILE A N     1 
ATOM   6677 C  CA    . ILE A 1 815 ? 17.234  16.825  58.339  1.00 42.91 ? 815  ILE A CA    1 
ATOM   6678 C  C     . ILE A 1 815 ? 16.767  15.864  59.443  1.00 46.77 ? 815  ILE A C     1 
ATOM   6679 O  O     . ILE A 1 815 ? 15.728  16.095  60.067  1.00 44.48 ? 815  ILE A O     1 
ATOM   6680 C  CB    . ILE A 1 815 ? 16.024  17.146  57.423  1.00 40.74 ? 815  ILE A CB    1 
ATOM   6681 C  CG1   . ILE A 1 815 ? 15.540  15.876  56.712  1.00 36.21 ? 815  ILE A CG1   1 
ATOM   6682 C  CG2   . ILE A 1 815 ? 16.364  18.287  56.442  1.00 40.70 ? 815  ILE A CG2   1 
ATOM   6683 C  CD1   . ILE A 1 815 ? 14.070  15.876  56.370  1.00 33.62 ? 815  ILE A CD1   1 
ATOM   6684 N  N     . LYS A 1 816 ? 17.540  14.803  59.682  1.00 49.80 ? 816  LYS A N     1 
ATOM   6685 C  CA    . LYS A 1 816 ? 17.155  13.739  60.611  1.00 54.39 ? 816  LYS A CA    1 
ATOM   6686 C  C     . LYS A 1 816 ? 16.767  14.261  61.991  1.00 56.05 ? 816  LYS A C     1 
ATOM   6687 O  O     . LYS A 1 816 ? 17.428  15.143  62.543  1.00 55.10 ? 816  LYS A O     1 
ATOM   6688 C  CB    . LYS A 1 816 ? 18.271  12.695  60.732  1.00 56.45 ? 816  LYS A CB    1 
ATOM   6689 C  CG    . LYS A 1 816 ? 17.873  11.434  61.515  1.00 61.44 ? 816  LYS A CG    1 
ATOM   6690 C  CD    . LYS A 1 816 ? 18.968  10.360  61.489  1.00 64.72 ? 816  LYS A CD    1 
ATOM   6691 C  CE    . LYS A 1 816 ? 20.149  10.704  62.398  1.00 65.57 ? 816  LYS A CE    1 
ATOM   6692 N  NZ    . LYS A 1 816 ? 19.829  10.536  63.843  1.00 66.23 ? 816  LYS A NZ    1 
ATOM   6693 N  N     . GLY A 1 817 ? 15.676  13.718  62.526  1.00 58.22 ? 817  GLY A N     1 
ATOM   6694 C  CA    . GLY A 1 817 ? 15.173  14.113  63.835  1.00 62.99 ? 817  GLY A CA    1 
ATOM   6695 C  C     . GLY A 1 817 ? 14.401  15.421  63.827  1.00 64.59 ? 817  GLY A C     1 
ATOM   6696 O  O     . GLY A 1 817 ? 14.104  15.971  64.889  1.00 65.77 ? 817  GLY A O     1 
ATOM   6697 N  N     . ASN A 1 818 ? 14.094  15.925  62.634  1.00 63.71 ? 818  ASN A N     1 
ATOM   6698 C  CA    . ASN A 1 818 ? 13.211  17.079  62.469  1.00 65.64 ? 818  ASN A CA    1 
ATOM   6699 C  C     . ASN A 1 818 ? 11.861  16.646  61.914  1.00 65.96 ? 818  ASN A C     1 
ATOM   6700 O  O     . ASN A 1 818 ? 11.735  16.370  60.717  1.00 65.53 ? 818  ASN A O     1 
ATOM   6701 C  CB    . ASN A 1 818 ? 13.829  18.117  61.531  1.00 65.12 ? 818  ASN A CB    1 
ATOM   6702 C  CG    . ASN A 1 818 ? 14.843  19.002  62.217  1.00 67.02 ? 818  ASN A CG    1 
ATOM   6703 O  OD1   . ASN A 1 818 ? 15.953  18.569  62.547  1.00 66.18 ? 818  ASN A OD1   1 
ATOM   6704 N  ND2   . ASN A 1 818 ? 14.475  20.262  62.414  1.00 65.78 ? 818  ASN A ND2   1 
ATOM   6705 N  N     . ILE A 1 819 ? 10.850  16.586  62.777  1.00 68.01 ? 819  ILE A N     1 
ATOM   6706 C  CA    . ILE A 1 819 ? 9.500   16.213  62.335  1.00 69.33 ? 819  ILE A CA    1 
ATOM   6707 C  C     . ILE A 1 819 ? 8.767   17.426  61.715  1.00 66.78 ? 819  ILE A C     1 
ATOM   6708 O  O     . ILE A 1 819 ? 7.630   17.312  61.251  1.00 67.67 ? 819  ILE A O     1 
ATOM   6709 C  CB    . ILE A 1 819 ? 8.670   15.499  63.469  1.00 72.17 ? 819  ILE A CB    1 
ATOM   6710 C  CG1   . ILE A 1 819 ? 9.548   14.530  64.290  1.00 76.07 ? 819  ILE A CG1   1 
ATOM   6711 C  CG2   . ILE A 1 819 ? 7.451   14.764  62.891  1.00 72.85 ? 819  ILE A CG2   1 
ATOM   6712 C  CD1   . ILE A 1 819 ? 10.066  13.272  63.528  1.00 76.12 ? 819  ILE A CD1   1 
ATOM   6713 N  N     . ASP A 1 820 ? 9.449   18.574  61.690  1.00 64.72 ? 820  ASP A N     1 
ATOM   6714 C  CA    . ASP A 1 820 ? 8.954   19.802  61.048  1.00 62.00 ? 820  ASP A CA    1 
ATOM   6715 C  C     . ASP A 1 820 ? 9.476   20.012  59.615  1.00 58.23 ? 820  ASP A C     1 
ATOM   6716 O  O     . ASP A 1 820 ? 8.837   20.695  58.811  1.00 56.01 ? 820  ASP A O     1 
ATOM   6717 C  CB    . ASP A 1 820 ? 9.264   21.033  61.915  1.00 64.34 ? 820  ASP A CB    1 
ATOM   6718 C  CG    . ASP A 1 820 ? 10.677  21.006  62.522  1.00 67.43 ? 820  ASP A CG    1 
ATOM   6719 O  OD1   . ASP A 1 820 ? 10.908  21.765  63.488  1.00 70.07 ? 820  ASP A OD1   1 
ATOM   6720 O  OD2   . ASP A 1 820 ? 11.553  20.241  62.055  1.00 64.65 ? 820  ASP A OD2   1 
ATOM   6721 N  N     . ALA A 1 821 ? 10.637  19.429  59.309  1.00 55.54 ? 821  ALA A N     1 
ATOM   6722 C  CA    . ALA A 1 821 ? 11.245  19.525  57.979  1.00 52.15 ? 821  ALA A CA    1 
ATOM   6723 C  C     . ALA A 1 821 ? 10.407  18.790  56.930  1.00 49.43 ? 821  ALA A C     1 
ATOM   6724 O  O     . ALA A 1 821 ? 9.877   17.715  57.219  1.00 49.88 ? 821  ALA A O     1 
ATOM   6725 C  CB    . ALA A 1 821 ? 12.663  18.980  58.009  1.00 50.92 ? 821  ALA A CB    1 
ATOM   6726 N  N     . PRO A 1 822 ? 10.264  19.376  55.718  1.00 46.90 ? 822  PRO A N     1 
ATOM   6727 C  CA    . PRO A 1 822 ? 9.536   18.715  54.632  1.00 44.25 ? 822  PRO A CA    1 
ATOM   6728 C  C     . PRO A 1 822 ? 10.111  17.343  54.305  1.00 42.59 ? 822  PRO A C     1 
ATOM   6729 O  O     . PRO A 1 822 ? 11.327  17.193  54.135  1.00 39.56 ? 822  PRO A O     1 
ATOM   6730 C  CB    . PRO A 1 822 ? 9.736   19.662  53.444  1.00 42.98 ? 822  PRO A CB    1 
ATOM   6731 C  CG    . PRO A 1 822 ? 9.901   20.995  54.064  1.00 45.34 ? 822  PRO A CG    1 
ATOM   6732 C  CD    . PRO A 1 822 ? 10.649  20.754  55.351  1.00 46.27 ? 822  PRO A CD    1 
ATOM   6733 N  N     . GLN A 1 823 ? 9.230   16.352  54.226  1.00 40.85 ? 823  GLN A N     1 
ATOM   6734 C  CA    . GLN A 1 823 ? 9.641   14.995  53.926  1.00 40.26 ? 823  GLN A CA    1 
ATOM   6735 C  C     . GLN A 1 823 ? 9.480   14.735  52.441  1.00 39.96 ? 823  GLN A C     1 
ATOM   6736 O  O     . GLN A 1 823 ? 8.509   15.184  51.820  1.00 38.24 ? 823  GLN A O     1 
ATOM   6737 C  CB    . GLN A 1 823 ? 8.820   13.985  54.732  1.00 42.09 ? 823  GLN A CB    1 
ATOM   6738 C  CG    . GLN A 1 823 ? 9.001   14.084  56.259  1.00 45.20 ? 823  GLN A CG    1 
ATOM   6739 C  CD    . GLN A 1 823 ? 10.397  13.668  56.728  1.00 45.88 ? 823  GLN A CD    1 
ATOM   6740 O  OE1   . GLN A 1 823 ? 11.062  14.400  57.459  1.00 48.96 ? 823  GLN A OE1   1 
ATOM   6741 N  NE2   . GLN A 1 823 ? 10.843  12.497  56.301  1.00 47.62 ? 823  GLN A NE2   1 
ATOM   6742 N  N     . VAL A 1 824 ? 10.446  14.017  51.880  1.00 37.21 ? 824  VAL A N     1 
ATOM   6743 C  CA    . VAL A 1 824 ? 10.354  13.541  50.515  1.00 36.86 ? 824  VAL A CA    1 
ATOM   6744 C  C     . VAL A 1 824 ? 9.308   12.433  50.468  1.00 36.53 ? 824  VAL A C     1 
ATOM   6745 O  O     . VAL A 1 824 ? 9.369   11.485  51.247  1.00 37.42 ? 824  VAL A O     1 
ATOM   6746 C  CB    . VAL A 1 824 ? 11.714  13.003  50.023  1.00 35.63 ? 824  VAL A CB    1 
ATOM   6747 C  CG1   . VAL A 1 824 ? 11.567  12.310  48.671  1.00 35.05 ? 824  VAL A CG1   1 
ATOM   6748 C  CG2   . VAL A 1 824 ? 12.726  14.130  49.939  1.00 36.07 ? 824  VAL A CG2   1 
ATOM   6749 N  N     . VAL A 1 825 ? 8.354   12.562  49.553  1.00 38.09 ? 825  VAL A N     1 
ATOM   6750 C  CA    . VAL A 1 825 ? 7.290   11.579  49.410  1.00 38.95 ? 825  VAL A CA    1 
ATOM   6751 C  C     . VAL A 1 825 ? 7.614   10.569  48.308  1.00 39.03 ? 825  VAL A C     1 
ATOM   6752 O  O     . VAL A 1 825 ? 7.775   10.934  47.136  1.00 37.71 ? 825  VAL A O     1 
ATOM   6753 C  CB    . VAL A 1 825 ? 5.930   12.253  49.123  1.00 41.73 ? 825  VAL A CB    1 
ATOM   6754 C  CG1   . VAL A 1 825 ? 4.814   11.200  48.984  1.00 42.47 ? 825  VAL A CG1   1 
ATOM   6755 C  CG2   . VAL A 1 825 ? 5.592   13.281  50.206  1.00 41.58 ? 825  VAL A CG2   1 
ATOM   6756 N  N     . GLU A 1 826 ? 7.718   9.303   48.711  1.00 38.80 ? 826  GLU A N     1 
ATOM   6757 C  CA    . GLU A 1 826 ? 7.874   8.168   47.805  1.00 38.34 ? 826  GLU A CA    1 
ATOM   6758 C  C     . GLU A 1 826 ? 6.909   8.265   46.618  1.00 38.21 ? 826  GLU A C     1 
ATOM   6759 O  O     . GLU A 1 826 ? 5.708   8.479   46.795  1.00 38.89 ? 826  GLU A O     1 
ATOM   6760 C  CB    . GLU A 1 826 ? 7.633   6.868   48.584  1.00 38.81 ? 826  GLU A CB    1 
ATOM   6761 C  CG    . GLU A 1 826 ? 7.318   5.636   47.733  1.00 41.12 ? 826  GLU A CG    1 
ATOM   6762 C  CD    . GLU A 1 826 ? 8.552   5.012   47.096  1.00 43.75 ? 826  GLU A CD    1 
ATOM   6763 O  OE1   . GLU A 1 826 ? 8.406   4.367   46.034  1.00 43.04 ? 826  GLU A OE1   1 
ATOM   6764 O  OE2   . GLU A 1 826 ? 9.665   5.155   47.654  1.00 47.46 ? 826  GLU A OE2   1 
ATOM   6765 N  N     . GLY A 1 827 ? 7.439   8.117   45.409  1.00 36.25 ? 827  GLY A N     1 
ATOM   6766 C  CA    . GLY A 1 827 ? 6.602   8.151   44.213  1.00 36.48 ? 827  GLY A CA    1 
ATOM   6767 C  C     . GLY A 1 827 ? 6.375   9.532   43.624  1.00 36.44 ? 827  GLY A C     1 
ATOM   6768 O  O     . GLY A 1 827 ? 5.816   9.652   42.532  1.00 37.73 ? 827  GLY A O     1 
ATOM   6769 N  N     . GLU A 1 828 ? 6.805   10.573  44.336  1.00 36.25 ? 828  GLU A N     1 
ATOM   6770 C  CA    . GLU A 1 828 ? 6.706   11.952  43.840  1.00 38.03 ? 828  GLU A CA    1 
ATOM   6771 C  C     . GLU A 1 828 ? 8.062   12.469  43.320  1.00 37.32 ? 828  GLU A C     1 
ATOM   6772 O  O     . GLU A 1 828 ? 9.003   11.689  43.150  1.00 37.62 ? 828  GLU A O     1 
ATOM   6773 C  CB    . GLU A 1 828 ? 6.077   12.867  44.904  1.00 40.47 ? 828  GLU A CB    1 
ATOM   6774 C  CG    . GLU A 1 828 ? 4.659   12.394  45.322  1.00 48.00 ? 828  GLU A CG    1 
ATOM   6775 C  CD    . GLU A 1 828 ? 3.839   13.433  46.085  1.00 54.27 ? 828  GLU A CD    1 
ATOM   6776 O  OE1   . GLU A 1 828 ? 2.730   13.078  46.541  1.00 60.54 ? 828  GLU A OE1   1 
ATOM   6777 O  OE2   . GLU A 1 828 ? 4.281   14.595  46.234  1.00 53.73 ? 828  GLU A OE2   1 
ATOM   6778 N  N     . LYS A 1 829 ? 8.163   13.767  43.045  1.00 34.92 ? 829  LYS A N     1 
ATOM   6779 C  CA    . LYS A 1 829 ? 9.348   14.292  42.376  1.00 32.41 ? 829  LYS A CA    1 
ATOM   6780 C  C     . LYS A 1 829 ? 10.248  15.141  43.267  1.00 32.77 ? 829  LYS A C     1 
ATOM   6781 O  O     . LYS A 1 829 ? 9.777   15.806  44.192  1.00 29.30 ? 829  LYS A O     1 
ATOM   6782 C  CB    . LYS A 1 829 ? 8.957   15.057  41.110  1.00 33.28 ? 829  LYS A CB    1 
ATOM   6783 C  CG    . LYS A 1 829 ? 8.310   14.167  40.042  1.00 33.21 ? 829  LYS A CG    1 
ATOM   6784 C  CD    . LYS A 1 829 ? 8.011   14.924  38.764  1.00 28.35 ? 829  LYS A CD    1 
ATOM   6785 C  CE    . LYS A 1 829 ? 7.276   14.029  37.769  1.00 29.05 ? 829  LYS A CE    1 
ATOM   6786 N  NZ    . LYS A 1 829 ? 7.254   14.673  36.424  1.00 25.01 ? 829  LYS A NZ    1 
ATOM   6787 N  N     . VAL A 1 830 ? 11.548  15.101  42.974  1.00 29.05 ? 830  VAL A N     1 
ATOM   6788 C  CA    . VAL A 1 830 ? 12.529  15.886  43.696  1.00 28.48 ? 830  VAL A CA    1 
ATOM   6789 C  C     . VAL A 1 830 ? 13.387  16.720  42.746  1.00 31.28 ? 830  VAL A C     1 
ATOM   6790 O  O     . VAL A 1 830 ? 13.646  16.307  41.608  1.00 31.39 ? 830  VAL A O     1 
ATOM   6791 C  CB    . VAL A 1 830 ? 13.478  14.997  44.548  1.00 28.30 ? 830  VAL A CB    1 
ATOM   6792 C  CG1   . VAL A 1 830 ? 12.731  14.347  45.712  1.00 29.57 ? 830  VAL A CG1   1 
ATOM   6793 C  CG2   . VAL A 1 830 ? 14.159  13.940  43.687  1.00 22.78 ? 830  VAL A CG2   1 
ATOM   6794 N  N     . TYR A 1 831 ? 13.807  17.890  43.229  1.00 28.94 ? 831  TYR A N     1 
ATOM   6795 C  CA    . TYR A 1 831 ? 14.918  18.637  42.649  1.00 28.96 ? 831  TYR A CA    1 
ATOM   6796 C  C     . TYR A 1 831 ? 16.219  17.985  43.076  1.00 27.53 ? 831  TYR A C     1 
ATOM   6797 O  O     . TYR A 1 831 ? 16.316  17.501  44.191  1.00 28.16 ? 831  TYR A O     1 
ATOM   6798 C  CB    . TYR A 1 831 ? 14.935  20.081  43.153  1.00 27.19 ? 831  TYR A CB    1 
ATOM   6799 C  CG    . TYR A 1 831 ? 13.851  20.974  42.613  1.00 24.65 ? 831  TYR A CG    1 
ATOM   6800 C  CD1   . TYR A 1 831 ? 13.552  20.996  41.257  1.00 26.45 ? 831  TYR A CD1   1 
ATOM   6801 C  CD2   . TYR A 1 831 ? 13.152  21.840  43.458  1.00 29.41 ? 831  TYR A CD2   1 
ATOM   6802 C  CE1   . TYR A 1 831 ? 12.565  21.826  40.749  1.00 27.14 ? 831  TYR A CE1   1 
ATOM   6803 C  CE2   . TYR A 1 831 ? 12.159  22.680  42.964  1.00 28.63 ? 831  TYR A CE2   1 
ATOM   6804 C  CZ    . TYR A 1 831 ? 11.875  22.670  41.603  1.00 28.94 ? 831  TYR A CZ    1 
ATOM   6805 O  OH    . TYR A 1 831 ? 10.908  23.496  41.087  1.00 29.79 ? 831  TYR A OH    1 
ATOM   6806 N  N     . VAL A 1 832 ? 17.214  17.983  42.190  1.00 27.31 ? 832  VAL A N     1 
ATOM   6807 C  CA    . VAL A 1 832 ? 18.499  17.331  42.454  1.00 27.39 ? 832  VAL A CA    1 
ATOM   6808 C  C     . VAL A 1 832 ? 19.654  18.272  42.101  1.00 28.14 ? 832  VAL A C     1 
ATOM   6809 O  O     . VAL A 1 832 ? 19.668  18.866  41.021  1.00 27.43 ? 832  VAL A O     1 
ATOM   6810 C  CB    . VAL A 1 832 ? 18.681  16.013  41.639  1.00 24.68 ? 832  VAL A CB    1 
ATOM   6811 C  CG1   . VAL A 1 832 ? 19.952  15.280  42.075  1.00 27.47 ? 832  VAL A CG1   1 
ATOM   6812 C  CG2   . VAL A 1 832 ? 17.473  15.089  41.764  1.00 22.27 ? 832  VAL A CG2   1 
ATOM   6813 N  N     . LEU A 1 833 ? 20.619  18.398  43.010  1.00 27.09 ? 833  LEU A N     1 
ATOM   6814 C  CA    . LEU A 1 833 ? 21.814  19.200  42.752  1.00 26.61 ? 833  LEU A CA    1 
ATOM   6815 C  C     . LEU A 1 833 ? 23.085  18.432  43.092  1.00 28.10 ? 833  LEU A C     1 
ATOM   6816 O  O     . LEU A 1 833 ? 23.136  17.780  44.133  1.00 27.45 ? 833  LEU A O     1 
ATOM   6817 C  CB    . LEU A 1 833 ? 21.778  20.495  43.570  1.00 23.57 ? 833  LEU A CB    1 
ATOM   6818 C  CG    . LEU A 1 833 ? 20.865  21.608  43.048  1.00 26.86 ? 833  LEU A CG    1 
ATOM   6819 C  CD1   . LEU A 1 833 ? 20.832  22.785  44.015  1.00 24.54 ? 833  LEU A CD1   1 
ATOM   6820 C  CD2   . LEU A 1 833 ? 21.324  22.068  41.672  1.00 27.06 ? 833  LEU A CD2   1 
ATOM   6821 N  N     . PRO A 1 834 ? 24.126  18.540  42.237  1.00 30.18 ? 834  PRO A N     1 
ATOM   6822 C  CA    . PRO A 1 834 ? 25.440  17.991  42.598  1.00 30.57 ? 834  PRO A CA    1 
ATOM   6823 C  C     . PRO A 1 834 ? 26.133  18.870  43.639  1.00 32.98 ? 834  PRO A C     1 
ATOM   6824 O  O     . PRO A 1 834 ? 25.872  20.086  43.708  1.00 32.66 ? 834  PRO A O     1 
ATOM   6825 C  CB    . PRO A 1 834 ? 26.215  18.015  41.274  1.00 30.40 ? 834  PRO A CB    1 
ATOM   6826 C  CG    . PRO A 1 834 ? 25.599  19.155  40.495  1.00 29.90 ? 834  PRO A CG    1 
ATOM   6827 C  CD    . PRO A 1 834 ? 24.143  19.217  40.921  1.00 31.67 ? 834  PRO A CD    1 
ATOM   6828 N  N     . LEU A 1 835 ? 27.004  18.250  44.431  1.00 30.90 ? 835  LEU A N     1 
ATOM   6829 C  CA    . LEU A 1 835 ? 27.710  18.918  45.523  1.00 33.74 ? 835  LEU A CA    1 
ATOM   6830 C  C     . LEU A 1 835 ? 29.211  18.738  45.358  1.00 33.72 ? 835  LEU A C     1 
ATOM   6831 O  O     . LEU A 1 835 ? 29.663  17.655  45.007  1.00 33.88 ? 835  LEU A O     1 
ATOM   6832 C  CB    . LEU A 1 835 ? 27.277  18.319  46.868  1.00 34.07 ? 835  LEU A CB    1 
ATOM   6833 C  CG    . LEU A 1 835 ? 26.191  18.918  47.778  1.00 35.14 ? 835  LEU A CG    1 
ATOM   6834 C  CD1   . LEU A 1 835 ? 25.336  20.035  47.157  1.00 32.83 ? 835  LEU A CD1   1 
ATOM   6835 C  CD2   . LEU A 1 835 ? 25.323  17.820  48.342  1.00 30.46 ? 835  LEU A CD2   1 
ATOM   6836 N  N     . ARG A 1 836 ? 29.976  19.796  45.615  1.00 34.76 ? 836  ARG A N     1 
ATOM   6837 C  CA    . ARG A 1 836 ? 31.441  19.741  45.516  1.00 36.61 ? 836  ARG A CA    1 
ATOM   6838 C  C     . ARG A 1 836 ? 32.076  18.806  46.547  1.00 38.56 ? 836  ARG A C     1 
ATOM   6839 O  O     . ARG A 1 836 ? 31.561  18.640  47.655  1.00 36.15 ? 836  ARG A O     1 
ATOM   6840 C  CB    . ARG A 1 836 ? 32.050  21.138  45.661  1.00 35.90 ? 836  ARG A CB    1 
ATOM   6841 C  CG    . ARG A 1 836 ? 31.832  22.049  44.472  1.00 37.47 ? 836  ARG A CG    1 
ATOM   6842 C  CD    . ARG A 1 836 ? 32.818  23.214  44.466  1.00 42.15 ? 836  ARG A CD    1 
ATOM   6843 N  NE    . ARG A 1 836 ? 32.956  23.840  45.780  1.00 46.39 ? 836  ARG A NE    1 
ATOM   6844 C  CZ    . ARG A 1 836 ? 32.015  24.572  46.358  1.00 45.42 ? 836  ARG A CZ    1 
ATOM   6845 N  NH1   . ARG A 1 836 ? 30.859  24.759  45.738  1.00 47.36 ? 836  ARG A NH1   1 
ATOM   6846 N  NH2   . ARG A 1 836 ? 32.222  25.109  47.552  1.00 43.47 ? 836  ARG A NH2   1 
ATOM   6847 N  N     . GLU A 1 837 ? 33.200  18.204  46.163  1.00 41.02 ? 837  GLU A N     1 
ATOM   6848 C  CA    . GLU A 1 837 ? 33.999  17.337  47.042  1.00 44.31 ? 837  GLU A CA    1 
ATOM   6849 C  C     . GLU A 1 837 ? 34.309  18.021  48.380  1.00 44.07 ? 837  GLU A C     1 
ATOM   6850 O  O     . GLU A 1 837 ? 34.718  19.182  48.405  1.00 44.38 ? 837  GLU A O     1 
ATOM   6851 C  CB    . GLU A 1 837 ? 35.317  16.984  46.345  1.00 45.48 ? 837  GLU A CB    1 
ATOM   6852 C  CG    . GLU A 1 837 ? 36.183  15.965  47.080  1.00 53.83 ? 837  GLU A CG    1 
ATOM   6853 C  CD    . GLU A 1 837 ? 35.915  14.526  46.648  1.00 57.80 ? 837  GLU A CD    1 
ATOM   6854 O  OE1   . GLU A 1 837 ? 36.792  13.668  46.883  1.00 60.14 ? 837  GLU A OE1   1 
ATOM   6855 O  OE2   . GLU A 1 837 ? 34.840  14.251  46.069  1.00 57.10 ? 837  GLU A OE2   1 
ATOM   6856 N  N     . GLY A 1 838 ? 34.111  17.298  49.478  1.00 43.28 ? 838  GLY A N     1 
ATOM   6857 C  CA    . GLY A 1 838 ? 34.456  17.803  50.810  1.00 46.41 ? 838  GLY A CA    1 
ATOM   6858 C  C     . GLY A 1 838 ? 33.374  18.637  51.470  1.00 45.08 ? 838  GLY A C     1 
ATOM   6859 O  O     . GLY A 1 838 ? 33.636  19.339  52.442  1.00 45.23 ? 838  GLY A O     1 
ATOM   6860 N  N     . ASN A 1 839 ? 32.158  18.556  50.937  1.00 42.27 ? 839  ASN A N     1 
ATOM   6861 C  CA    . ASN A 1 839 ? 31.002  19.249  51.503  1.00 41.99 ? 839  ASN A CA    1 
ATOM   6862 C  C     . ASN A 1 839 ? 30.564  18.622  52.840  1.00 41.03 ? 839  ASN A C     1 
ATOM   6863 O  O     . ASN A 1 839 ? 30.864  17.456  53.096  1.00 42.34 ? 839  ASN A O     1 
ATOM   6864 C  CB    . ASN A 1 839 ? 29.852  19.228  50.488  1.00 38.54 ? 839  ASN A CB    1 
ATOM   6865 C  CG    . ASN A 1 839 ? 29.255  17.843  50.322  1.00 38.26 ? 839  ASN A CG    1 
ATOM   6866 O  OD1   . ASN A 1 839 ? 28.359  17.459  51.066  1.00 39.16 ? 839  ASN A OD1   1 
ATOM   6867 N  ND2   . ASN A 1 839 ? 29.757  17.083  49.352  1.00 31.36 ? 839  ASN A ND2   1 
ATOM   6868 N  N     . PRO A 1 840 ? 29.856  19.390  53.696  1.00 41.47 ? 840  PRO A N     1 
ATOM   6869 C  CA    . PRO A 1 840 ? 29.435  18.835  54.987  1.00 42.63 ? 840  PRO A CA    1 
ATOM   6870 C  C     . PRO A 1 840 ? 28.320  17.794  54.911  1.00 40.99 ? 840  PRO A C     1 
ATOM   6871 O  O     . PRO A 1 840 ? 28.050  17.129  55.903  1.00 41.61 ? 840  PRO A O     1 
ATOM   6872 C  CB    . PRO A 1 840 ? 28.954  20.072  55.769  1.00 43.76 ? 840  PRO A CB    1 
ATOM   6873 C  CG    . PRO A 1 840 ? 28.624  21.085  54.729  1.00 41.54 ? 840  PRO A CG    1 
ATOM   6874 C  CD    . PRO A 1 840 ? 29.614  20.844  53.628  1.00 41.56 ? 840  PRO A CD    1 
ATOM   6875 N  N     . PHE A 1 841 ? 27.686  17.638  53.754  1.00 40.07 ? 841  PHE A N     1 
ATOM   6876 C  CA    . PHE A 1 841 ? 26.588  16.676  53.621  1.00 38.23 ? 841  PHE A CA    1 
ATOM   6877 C  C     . PHE A 1 841 ? 27.102  15.259  53.415  1.00 38.26 ? 841  PHE A C     1 
ATOM   6878 O  O     . PHE A 1 841 ? 26.343  14.292  53.524  1.00 36.33 ? 841  PHE A O     1 
ATOM   6879 C  CB    . PHE A 1 841 ? 25.643  17.085  52.493  1.00 36.05 ? 841  PHE A CB    1 
ATOM   6880 C  CG    . PHE A 1 841 ? 24.994  18.417  52.711  1.00 38.47 ? 841  PHE A CG    1 
ATOM   6881 C  CD1   . PHE A 1 841 ? 23.868  18.529  53.523  1.00 39.15 ? 841  PHE A CD1   1 
ATOM   6882 C  CD2   . PHE A 1 841 ? 25.514  19.565  52.117  1.00 36.63 ? 841  PHE A CD2   1 
ATOM   6883 C  CE1   . PHE A 1 841 ? 23.267  19.763  53.736  1.00 41.06 ? 841  PHE A CE1   1 
ATOM   6884 C  CE2   . PHE A 1 841 ? 24.918  20.802  52.317  1.00 39.84 ? 841  PHE A CE2   1 
ATOM   6885 C  CZ    . PHE A 1 841 ? 23.796  20.905  53.133  1.00 39.73 ? 841  PHE A CZ    1 
ATOM   6886 N  N     . GLY A 1 842 ? 28.398  15.154  53.126  1.00 41.47 ? 842  GLY A N     1 
ATOM   6887 C  CA    . GLY A 1 842 ? 29.100  13.870  53.030  1.00 41.75 ? 842  GLY A CA    1 
ATOM   6888 C  C     . GLY A 1 842 ? 28.751  13.033  51.812  1.00 41.27 ? 842  GLY A C     1 
ATOM   6889 O  O     . GLY A 1 842 ? 28.903  11.815  51.840  1.00 42.43 ? 842  GLY A O     1 
ATOM   6890 N  N     . ASP A 1 843 ? 28.273  13.676  50.747  1.00 39.95 ? 843  ASP A N     1 
ATOM   6891 C  CA    . ASP A 1 843 ? 27.977  12.964  49.499  1.00 39.22 ? 843  ASP A CA    1 
ATOM   6892 C  C     . ASP A 1 843 ? 27.937  13.884  48.283  1.00 37.33 ? 843  ASP A C     1 
ATOM   6893 O  O     . ASP A 1 843 ? 27.982  15.115  48.416  1.00 36.98 ? 843  ASP A O     1 
ATOM   6894 C  CB    . ASP A 1 843 ? 26.676  12.152  49.610  1.00 38.32 ? 843  ASP A CB    1 
ATOM   6895 C  CG    . ASP A 1 843 ? 26.799  10.766  48.982  1.00 40.53 ? 843  ASP A CG    1 
ATOM   6896 O  OD1   . ASP A 1 843 ? 27.575  10.598  48.011  1.00 33.40 ? 843  ASP A OD1   1 
ATOM   6897 O  OD2   . ASP A 1 843 ? 26.118  9.838   49.468  1.00 44.14 ? 843  ASP A OD2   1 
ATOM   6898 N  N     . LYS A 1 844 ? 27.842  13.275  47.102  1.00 35.86 ? 844  LYS A N     1 
ATOM   6899 C  CA    . LYS A 1 844 ? 28.019  13.986  45.832  1.00 34.17 ? 844  LYS A CA    1 
ATOM   6900 C  C     . LYS A 1 844 ? 26.775  14.726  45.301  1.00 32.19 ? 844  LYS A C     1 
ATOM   6901 O  O     . LYS A 1 844 ? 26.851  15.426  44.289  1.00 29.60 ? 844  LYS A O     1 
ATOM   6902 C  CB    . LYS A 1 844 ? 28.600  13.053  44.765  1.00 33.32 ? 844  LYS A CB    1 
ATOM   6903 C  CG    . LYS A 1 844 ? 27.658  11.976  44.254  1.00 32.18 ? 844  LYS A CG    1 
ATOM   6904 C  CD    . LYS A 1 844 ? 28.393  11.048  43.278  1.00 33.83 ? 844  LYS A CD    1 
ATOM   6905 C  CE    . LYS A 1 844 ? 27.576  9.799   42.969  1.00 30.75 ? 844  LYS A CE    1 
ATOM   6906 N  NZ    . LYS A 1 844 ? 28.021  9.121   41.725  1.00 31.10 ? 844  LYS A NZ    1 
ATOM   6907 N  N     . CYS A 1 845 ? 25.644  14.566  45.979  1.00 30.69 ? 845  CYS A N     1 
ATOM   6908 C  CA    . CYS A 1 845 ? 24.428  15.285  45.605  1.00 31.10 ? 845  CYS A CA    1 
ATOM   6909 C  C     . CYS A 1 845 ? 23.458  15.357  46.762  1.00 31.25 ? 845  CYS A C     1 
ATOM   6910 O  O     . CYS A 1 845 ? 23.592  14.613  47.726  1.00 31.58 ? 845  CYS A O     1 
ATOM   6911 C  CB    . CYS A 1 845 ? 23.728  14.594  44.435  1.00 29.79 ? 845  CYS A CB    1 
ATOM   6912 S  SG    . CYS A 1 845 ? 23.310  12.865  44.778  1.00 31.63 ? 845  CYS A SG    1 
ATOM   6913 N  N     . ILE A 1 846 ? 22.478  16.249  46.630  1.00 30.93 ? 846  ILE A N     1 
ATOM   6914 C  CA    . ILE A 1 846 ? 21.330  16.342  47.532  1.00 31.53 ? 846  ILE A CA    1 
ATOM   6915 C  C     . ILE A 1 846 ? 20.027  16.531  46.726  1.00 30.30 ? 846  ILE A C     1 
ATOM   6916 O  O     . ILE A 1 846 ? 20.025  17.145  45.657  1.00 31.19 ? 846  ILE A O     1 
ATOM   6917 C  CB    . ILE A 1 846 ? 21.530  17.482  48.585  1.00 31.76 ? 846  ILE A CB    1 
ATOM   6918 C  CG1   . ILE A 1 846 ? 20.454  17.408  49.679  1.00 33.18 ? 846  ILE A CG1   1 
ATOM   6919 C  CG2   . ILE A 1 846 ? 21.609  18.863  47.905  1.00 30.17 ? 846  ILE A CG2   1 
ATOM   6920 C  CD1   . ILE A 1 846 ? 20.864  18.013  51.005  1.00 33.96 ? 846  ILE A CD1   1 
ATOM   6921 N  N     . ALA A 1 847 ? 18.926  15.987  47.231  1.00 30.24 ? 847  ALA A N     1 
ATOM   6922 C  CA    . ALA A 1 847 ? 17.628  16.152  46.587  1.00 30.20 ? 847  ALA A CA    1 
ATOM   6923 C  C     . ALA A 1 847 ? 16.611  16.639  47.608  1.00 30.79 ? 847  ALA A C     1 
ATOM   6924 O  O     . ALA A 1 847 ? 16.736  16.321  48.783  1.00 32.89 ? 847  ALA A O     1 
ATOM   6925 C  CB    . ALA A 1 847 ? 17.172  14.832  45.966  1.00 29.42 ? 847  ALA A CB    1 
ATOM   6926 N  N     . TRP A 1 848 ? 15.611  17.402  47.167  1.00 28.05 ? 848  TRP A N     1 
ATOM   6927 C  CA    . TRP A 1 848 ? 14.517  17.839  48.055  1.00 31.13 ? 848  TRP A CA    1 
ATOM   6928 C  C     . TRP A 1 848 ? 13.192  17.929  47.279  1.00 29.56 ? 848  TRP A C     1 
ATOM   6929 O  O     . TRP A 1 848 ? 13.225  17.992  46.059  1.00 31.68 ? 848  TRP A O     1 
ATOM   6930 C  CB    . TRP A 1 848 ? 14.864  19.174  48.727  1.00 30.43 ? 848  TRP A CB    1 
ATOM   6931 C  CG    . TRP A 1 848 ? 14.868  20.356  47.799  1.00 28.88 ? 848  TRP A CG    1 
ATOM   6932 C  CD1   . TRP A 1 848 ? 13.891  21.305  47.679  1.00 27.39 ? 848  TRP A CD1   1 
ATOM   6933 C  CD2   . TRP A 1 848 ? 15.907  20.727  46.879  1.00 27.60 ? 848  TRP A CD2   1 
ATOM   6934 N  NE1   . TRP A 1 848 ? 14.255  22.245  46.737  1.00 26.86 ? 848  TRP A NE1   1 
ATOM   6935 C  CE2   . TRP A 1 848 ? 15.484  21.912  46.229  1.00 28.59 ? 848  TRP A CE2   1 
ATOM   6936 C  CE3   . TRP A 1 848 ? 17.151  20.172  46.535  1.00 27.67 ? 848  TRP A CE3   1 
ATOM   6937 C  CZ2   . TRP A 1 848 ? 16.262  22.554  45.254  1.00 26.39 ? 848  TRP A CZ2   1 
ATOM   6938 C  CZ3   . TRP A 1 848 ? 17.919  20.804  45.564  1.00 24.52 ? 848  TRP A CZ3   1 
ATOM   6939 C  CH2   . TRP A 1 848 ? 17.468  21.991  44.938  1.00 26.25 ? 848  TRP A CH2   1 
ATOM   6940 N  N     . PRO A 1 849 ? 12.029  17.931  47.974  1.00 29.69 ? 849  PRO A N     1 
ATOM   6941 C  CA    . PRO A 1 849 ? 10.759  17.894  47.229  1.00 30.73 ? 849  PRO A CA    1 
ATOM   6942 C  C     . PRO A 1 849 ? 10.680  18.959  46.137  1.00 29.33 ? 849  PRO A C     1 
ATOM   6943 O  O     . PRO A 1 849 ? 11.031  20.122  46.372  1.00 29.08 ? 849  PRO A O     1 
ATOM   6944 C  CB    . PRO A 1 849 ? 9.696   18.148  48.310  1.00 29.83 ? 849  PRO A CB    1 
ATOM   6945 C  CG    . PRO A 1 849 ? 10.345  17.684  49.570  1.00 29.49 ? 849  PRO A CG    1 
ATOM   6946 C  CD    . PRO A 1 849 ? 11.797  18.027  49.428  1.00 30.38 ? 849  PRO A CD    1 
ATOM   6947 N  N     . SER A 1 850 ? 10.247  18.548  44.948  1.00 26.56 ? 850  SER A N     1 
ATOM   6948 C  CA    . SER A 1 850 ? 10.160  19.466  43.809  1.00 28.28 ? 850  SER A CA    1 
ATOM   6949 C  C     . SER A 1 850 ? 9.027   20.470  44.025  1.00 29.04 ? 850  SER A C     1 
ATOM   6950 O  O     . SER A 1 850 ? 8.120   20.236  44.828  1.00 26.04 ? 850  SER A O     1 
ATOM   6951 C  CB    . SER A 1 850 ? 9.956   18.694  42.503  1.00 27.75 ? 850  SER A CB    1 
ATOM   6952 O  OG    . SER A 1 850 ? 8.647   18.147  42.446  1.00 31.74 ? 850  SER A OG    1 
ATOM   6953 N  N     . GLY A 1 851 ? 9.098   21.596  43.321  1.00 30.70 ? 851  GLY A N     1 
ATOM   6954 C  CA    . GLY A 1 851 ? 8.113   22.664  43.479  1.00 31.61 ? 851  GLY A CA    1 
ATOM   6955 C  C     . GLY A 1 851 ? 8.276   23.488  44.743  1.00 34.22 ? 851  GLY A C     1 
ATOM   6956 O  O     . GLY A 1 851 ? 7.481   24.394  44.993  1.00 35.47 ? 851  GLY A O     1 
ATOM   6957 N  N     . THR A 1 852 ? 9.307   23.194  45.539  1.00 34.47 ? 852  THR A N     1 
ATOM   6958 C  CA    . THR A 1 852 ? 9.510   23.900  46.816  1.00 34.08 ? 852  THR A CA    1 
ATOM   6959 C  C     . THR A 1 852 ? 10.924  24.430  46.986  1.00 32.79 ? 852  THR A C     1 
ATOM   6960 O  O     . THR A 1 852 ? 11.879  23.888  46.419  1.00 29.20 ? 852  THR A O     1 
ATOM   6961 C  CB    . THR A 1 852 ? 9.209   23.014  48.064  1.00 33.12 ? 852  THR A CB    1 
ATOM   6962 O  OG1   . THR A 1 852 ? 10.222  22.018  48.193  1.00 32.90 ? 852  THR A OG1   1 
ATOM   6963 C  CG2   . THR A 1 852 ? 7.834   22.338  47.982  1.00 33.90 ? 852  THR A CG2   1 
ATOM   6964 N  N     . GLU A 1 853 ? 11.034  25.492  47.782  1.00 34.83 ? 853  GLU A N     1 
ATOM   6965 C  CA    . GLU A 1 853 ? 12.306  25.972  48.314  1.00 35.64 ? 853  GLU A CA    1 
ATOM   6966 C  C     . GLU A 1 853 ? 12.825  24.935  49.306  1.00 35.49 ? 853  GLU A C     1 
ATOM   6967 O  O     . GLU A 1 853 ? 12.062  24.408  50.124  1.00 33.09 ? 853  GLU A O     1 
ATOM   6968 C  CB    . GLU A 1 853 ? 12.104  27.300  49.053  1.00 37.16 ? 853  GLU A CB    1 
ATOM   6969 C  CG    . GLU A 1 853 ? 11.757  28.499  48.170  1.00 39.85 ? 853  GLU A CG    1 
ATOM   6970 C  CD    . GLU A 1 853 ? 12.983  29.118  47.495  1.00 40.54 ? 853  GLU A CD    1 
ATOM   6971 O  OE1   . GLU A 1 853 ? 14.120  28.892  47.970  1.00 36.58 ? 853  GLU A OE1   1 
ATOM   6972 O  OE2   . GLU A 1 853 ? 12.803  29.836  46.489  1.00 41.79 ? 853  GLU A OE2   1 
ATOM   6973 N  N     . ILE A 1 854 ? 14.117  24.637  49.240  1.00 34.34 ? 854  ILE A N     1 
ATOM   6974 C  CA    . ILE A 1 854 ? 14.713  23.738  50.230  1.00 34.54 ? 854  ILE A CA    1 
ATOM   6975 C  C     . ILE A 1 854 ? 14.689  24.389  51.626  1.00 35.91 ? 854  ILE A C     1 
ATOM   6976 O  O     . ILE A 1 854 ? 14.945  25.600  51.757  1.00 33.97 ? 854  ILE A O     1 
ATOM   6977 C  CB    . ILE A 1 854 ? 16.134  23.287  49.817  1.00 34.00 ? 854  ILE A CB    1 
ATOM   6978 C  CG1   . ILE A 1 854 ? 16.597  22.098  50.675  1.00 35.25 ? 854  ILE A CG1   1 
ATOM   6979 C  CG2   . ILE A 1 854 ? 17.109  24.465  49.841  1.00 36.69 ? 854  ILE A CG2   1 
ATOM   6980 C  CD1   . ILE A 1 854 ? 17.803  21.348  50.118  1.00 30.85 ? 854  ILE A CD1   1 
ATOM   6981 N  N     . THR A 1 855 ? 14.354  23.589  52.645  1.00 34.47 ? 855  THR A N     1 
ATOM   6982 C  CA    . THR A 1 855 ? 14.255  24.065  54.038  1.00 37.14 ? 855  THR A CA    1 
ATOM   6983 C  C     . THR A 1 855 ? 15.433  24.955  54.453  1.00 37.20 ? 855  THR A C     1 
ATOM   6984 O  O     . THR A 1 855 ? 16.584  24.664  54.124  1.00 33.53 ? 855  THR A O     1 
ATOM   6985 C  CB    . THR A 1 855 ? 14.091  22.893  55.058  1.00 36.05 ? 855  THR A CB    1 
ATOM   6986 O  OG1   . THR A 1 855 ? 14.146  23.408  56.388  1.00 42.54 ? 855  THR A OG1   1 
ATOM   6987 C  CG2   . THR A 1 855 ? 15.187  21.839  54.904  1.00 36.93 ? 855  THR A CG2   1 
ATOM   6988 N  N     . ASP A 1 856 ? 15.131  26.033  55.176  1.00 40.90 ? 856  ASP A N     1 
ATOM   6989 C  CA    . ASP A 1 856 ? 16.156  26.990  55.623  1.00 44.00 ? 856  ASP A CA    1 
ATOM   6990 C  C     . ASP A 1 856 ? 17.143  26.370  56.603  1.00 44.89 ? 856  ASP A C     1 
ATOM   6991 O  O     . ASP A 1 856 ? 18.189  26.943  56.886  1.00 45.92 ? 856  ASP A O     1 
ATOM   6992 C  CB    . ASP A 1 856 ? 15.520  28.251  56.216  1.00 46.63 ? 856  ASP A CB    1 
ATOM   6993 C  CG    . ASP A 1 856 ? 15.096  29.253  55.148  1.00 52.26 ? 856  ASP A CG    1 
ATOM   6994 O  OD1   . ASP A 1 856 ? 14.090  29.957  55.364  1.00 56.70 ? 856  ASP A OD1   1 
ATOM   6995 O  OD2   . ASP A 1 856 ? 15.761  29.339  54.090  1.00 54.37 ? 856  ASP A OD2   1 
ATOM   6996 N  N     . LEU A 1 857 ? 16.801  25.191  57.111  1.00 45.51 ? 857  LEU A N     1 
ATOM   6997 C  CA    . LEU A 1 857 ? 17.714  24.395  57.919  1.00 45.90 ? 857  LEU A CA    1 
ATOM   6998 C  C     . LEU A 1 857 ? 19.075  24.180  57.237  1.00 45.07 ? 857  LEU A C     1 
ATOM   6999 O  O     . LEU A 1 857 ? 20.108  24.192  57.904  1.00 46.82 ? 857  LEU A O     1 
ATOM   7000 C  CB    . LEU A 1 857 ? 17.077  23.037  58.254  1.00 45.75 ? 857  LEU A CB    1 
ATOM   7001 C  CG    . LEU A 1 857 ? 15.877  22.967  59.212  1.00 46.96 ? 857  LEU A CG    1 
ATOM   7002 C  CD1   . LEU A 1 857 ? 15.285  21.562  59.216  1.00 46.11 ? 857  LEU A CD1   1 
ATOM   7003 C  CD2   . LEU A 1 857 ? 16.259  23.386  60.637  1.00 46.79 ? 857  LEU A CD2   1 
ATOM   7004 N  N     . ILE A 1 858 ? 19.074  23.996  55.917  1.00 42.70 ? 858  ILE A N     1 
ATOM   7005 C  CA    . ILE A 1 858 ? 20.295  23.616  55.196  1.00 42.35 ? 858  ILE A CA    1 
ATOM   7006 C  C     . ILE A 1 858 ? 20.581  24.455  53.942  1.00 42.67 ? 858  ILE A C     1 
ATOM   7007 O  O     . ILE A 1 858 ? 21.623  24.277  53.295  1.00 41.87 ? 858  ILE A O     1 
ATOM   7008 C  CB    . ILE A 1 858 ? 20.285  22.100  54.804  1.00 42.25 ? 858  ILE A CB    1 
ATOM   7009 C  CG1   . ILE A 1 858 ? 19.049  21.762  53.945  1.00 39.80 ? 858  ILE A CG1   1 
ATOM   7010 C  CG2   . ILE A 1 858 ? 20.405  21.211  56.053  1.00 42.43 ? 858  ILE A CG2   1 
ATOM   7011 C  CD1   . ILE A 1 858 ? 19.001  20.338  53.437  1.00 37.45 ? 858  ILE A CD1   1 
ATOM   7012 N  N     . LYS A 1 859 ? 19.667  25.368  53.613  1.00 42.55 ? 859  LYS A N     1 
ATOM   7013 C  CA    . LYS A 1 859 ? 19.702  26.082  52.327  1.00 42.18 ? 859  LYS A CA    1 
ATOM   7014 C  C     . LYS A 1 859 ? 21.055  26.688  51.959  1.00 42.80 ? 859  LYS A C     1 
ATOM   7015 O  O     . LYS A 1 859 ? 21.651  26.306  50.948  1.00 40.06 ? 859  LYS A O     1 
ATOM   7016 C  CB    . LYS A 1 859 ? 18.592  27.134  52.237  1.00 41.35 ? 859  LYS A CB    1 
ATOM   7017 C  CG    . LYS A 1 859 ? 18.617  27.930  50.946  1.00 41.74 ? 859  LYS A CG    1 
ATOM   7018 C  CD    . LYS A 1 859 ? 17.372  28.778  50.781  1.00 38.27 ? 859  LYS A CD    1 
ATOM   7019 C  CE    . LYS A 1 859 ? 17.527  29.698  49.583  1.00 42.53 ? 859  LYS A CE    1 
ATOM   7020 N  NZ    . LYS A 1 859 ? 16.240  30.319  49.173  1.00 41.01 ? 859  LYS A NZ    1 
ATOM   7021 N  N     . ASP A 1 860 ? 21.548  27.630  52.762  1.00 46.63 ? 860  ASP A N     1 
ATOM   7022 C  CA    . ASP A 1 860 ? 22.765  28.338  52.351  1.00 48.34 ? 860  ASP A CA    1 
ATOM   7023 C  C     . ASP A 1 860 ? 24.008  27.444  52.339  1.00 46.64 ? 860  ASP A C     1 
ATOM   7024 O  O     . ASP A 1 860 ? 24.977  27.748  51.648  1.00 46.85 ? 860  ASP A O     1 
ATOM   7025 C  CB    . ASP A 1 860 ? 22.973  29.691  53.068  1.00 53.51 ? 860  ASP A CB    1 
ATOM   7026 C  CG    . ASP A 1 860 ? 22.789  29.612  54.564  1.00 59.76 ? 860  ASP A CG    1 
ATOM   7027 O  OD1   . ASP A 1 860 ? 21.959  30.380  55.095  1.00 61.62 ? 860  ASP A OD1   1 
ATOM   7028 O  OD2   . ASP A 1 860 ? 23.481  28.803  55.215  1.00 66.92 ? 860  ASP A OD2   1 
ATOM   7029 N  N     . ASP A 1 861 ? 23.959  26.325  53.059  1.00 43.64 ? 861  ASP A N     1 
ATOM   7030 C  CA    . ASP A 1 861 ? 25.016  25.325  52.952  1.00 43.92 ? 861  ASP A CA    1 
ATOM   7031 C  C     . ASP A 1 861 ? 24.987  24.653  51.578  1.00 41.43 ? 861  ASP A C     1 
ATOM   7032 O  O     . ASP A 1 861 ? 26.035  24.451  50.953  1.00 42.03 ? 861  ASP A O     1 
ATOM   7033 C  CB    . ASP A 1 861 ? 24.922  24.283  54.072  1.00 44.92 ? 861  ASP A CB    1 
ATOM   7034 C  CG    . ASP A 1 861 ? 25.594  24.741  55.362  1.00 50.03 ? 861  ASP A CG    1 
ATOM   7035 O  OD1   . ASP A 1 861 ? 25.075  24.408  56.446  1.00 51.56 ? 861  ASP A OD1   1 
ATOM   7036 O  OD2   . ASP A 1 861 ? 26.640  25.427  55.299  1.00 54.06 ? 861  ASP A OD2   1 
ATOM   7037 N  N     . VAL A 1 862 ? 23.784  24.324  51.109  1.00 38.93 ? 862  VAL A N     1 
ATOM   7038 C  CA    . VAL A 1 862 ? 23.603  23.781  49.768  1.00 34.83 ? 862  VAL A CA    1 
ATOM   7039 C  C     . VAL A 1 862 ? 24.119  24.774  48.729  1.00 35.24 ? 862  VAL A C     1 
ATOM   7040 O  O     . VAL A 1 862 ? 24.914  24.401  47.860  1.00 35.11 ? 862  VAL A O     1 
ATOM   7041 C  CB    . VAL A 1 862 ? 22.123  23.408  49.485  1.00 35.91 ? 862  VAL A CB    1 
ATOM   7042 C  CG1   . VAL A 1 862 ? 21.939  22.906  48.053  1.00 30.52 ? 862  VAL A CG1   1 
ATOM   7043 C  CG2   . VAL A 1 862 ? 21.625  22.369  50.483  1.00 32.74 ? 862  VAL A CG2   1 
ATOM   7044 N  N     . LEU A 1 863 ? 23.689  26.035  48.834  1.00 35.16 ? 863  LEU A N     1 
ATOM   7045 C  CA    . LEU A 1 863 ? 24.084  27.071  47.864  1.00 36.86 ? 863  LEU A CA    1 
ATOM   7046 C  C     . LEU A 1 863 ? 25.599  27.254  47.817  1.00 36.86 ? 863  LEU A C     1 
ATOM   7047 O  O     . LEU A 1 863 ? 26.173  27.499  46.754  1.00 35.62 ? 863  LEU A O     1 
ATOM   7048 C  CB    . LEU A 1 863 ? 23.420  28.416  48.179  1.00 37.36 ? 863  LEU A CB    1 
ATOM   7049 C  CG    . LEU A 1 863 ? 21.894  28.536  48.136  1.00 40.16 ? 863  LEU A CG    1 
ATOM   7050 C  CD1   . LEU A 1 863 ? 21.465  29.999  48.101  1.00 42.18 ? 863  LEU A CD1   1 
ATOM   7051 C  CD2   . LEU A 1 863 ? 21.312  27.802  46.955  1.00 36.73 ? 863  LEU A CD2   1 
ATOM   7052 N  N     . HIS A 1 864 ? 26.224  27.120  48.983  1.00 37.97 ? 864  HIS A N     1 
ATOM   7053 C  CA    . HIS A 1 864 ? 27.663  27.275  49.137  1.00 41.29 ? 864  HIS A CA    1 
ATOM   7054 C  C     . HIS A 1 864 ? 28.430  26.116  48.502  1.00 39.70 ? 864  HIS A C     1 
ATOM   7055 O  O     . HIS A 1 864 ? 29.530  26.311  47.983  1.00 39.95 ? 864  HIS A O     1 
ATOM   7056 C  CB    . HIS A 1 864 ? 28.023  27.404  50.623  1.00 43.89 ? 864  HIS A CB    1 
ATOM   7057 C  CG    . HIS A 1 864 ? 29.453  27.775  50.871  1.00 51.38 ? 864  HIS A CG    1 
ATOM   7058 N  ND1   . HIS A 1 864 ? 30.439  26.837  51.095  1.00 51.84 ? 864  HIS A ND1   1 
ATOM   7059 C  CD2   . HIS A 1 864 ? 30.063  28.982  50.927  1.00 54.44 ? 864  HIS A CD2   1 
ATOM   7060 C  CE1   . HIS A 1 864 ? 31.595  27.449  51.277  1.00 54.78 ? 864  HIS A CE1   1 
ATOM   7061 N  NE2   . HIS A 1 864 ? 31.394  28.752  51.182  1.00 57.91 ? 864  HIS A NE2   1 
ATOM   7062 N  N     . TRP A 1 865 ? 27.840  24.922  48.532  1.00 39.04 ? 865  TRP A N     1 
ATOM   7063 C  CA    . TRP A 1 865 ? 28.527  23.709  48.082  1.00 39.30 ? 865  TRP A CA    1 
ATOM   7064 C  C     . TRP A 1 865 ? 28.030  23.125  46.741  1.00 40.17 ? 865  TRP A C     1 
ATOM   7065 O  O     . TRP A 1 865 ? 28.504  22.070  46.303  1.00 40.80 ? 865  TRP A O     1 
ATOM   7066 C  CB    . TRP A 1 865 ? 28.505  22.657  49.194  1.00 39.75 ? 865  TRP A CB    1 
ATOM   7067 C  CG    . TRP A 1 865 ? 29.387  23.021  50.356  1.00 40.98 ? 865  TRP A CG    1 
ATOM   7068 C  CD1   . TRP A 1 865 ? 29.015  23.674  51.500  1.00 42.34 ? 865  TRP A CD1   1 
ATOM   7069 C  CD2   . TRP A 1 865 ? 30.794  22.766  50.479  1.00 41.05 ? 865  TRP A CD2   1 
ATOM   7070 N  NE1   . TRP A 1 865 ? 30.102  23.836  52.328  1.00 43.56 ? 865  TRP A NE1   1 
ATOM   7071 C  CE2   . TRP A 1 865 ? 31.207  23.291  51.726  1.00 44.11 ? 865  TRP A CE2   1 
ATOM   7072 C  CE3   . TRP A 1 865 ? 31.748  22.150  49.653  1.00 41.45 ? 865  TRP A CE3   1 
ATOM   7073 C  CZ2   . TRP A 1 865 ? 32.533  23.207  52.173  1.00 42.79 ? 865  TRP A CZ2   1 
ATOM   7074 C  CZ3   . TRP A 1 865 ? 33.070  22.067  50.102  1.00 41.98 ? 865  TRP A CZ3   1 
ATOM   7075 C  CH2   . TRP A 1 865 ? 33.446  22.593  51.347  1.00 40.03 ? 865  TRP A CH2   1 
ATOM   7076 N  N     . MET A 1 866 ? 27.090  23.819  46.097  1.00 40.16 ? 866  MET A N     1 
ATOM   7077 C  CA    . MET A 1 866 ? 26.630  23.482  44.747  1.00 37.49 ? 866  MET A CA    1 
ATOM   7078 C  C     . MET A 1 866 ? 27.804  23.370  43.796  1.00 36.47 ? 866  MET A C     1 
ATOM   7079 O  O     . MET A 1 866 ? 28.649  24.276  43.743  1.00 37.37 ? 866  MET A O     1 
ATOM   7080 C  CB    . MET A 1 866 ? 25.744  24.602  44.204  1.00 37.40 ? 866  MET A CB    1 
ATOM   7081 C  CG    . MET A 1 866 ? 24.368  24.658  44.748  1.00 36.91 ? 866  MET A CG    1 
ATOM   7082 S  SD    . MET A 1 866 ? 23.539  26.093  44.071  1.00 36.38 ? 866  MET A SD    1 
ATOM   7083 C  CE    . MET A 1 866 ? 23.089  25.506  42.441  1.00 36.14 ? 866  MET A CE    1 
ATOM   7084 N  N     . ASP A 1 867 ? 27.851  22.272  43.041  1.00 34.60 ? 867  ASP A N     1 
ATOM   7085 C  CA    . ASP A 1 867 ? 28.879  22.093  42.026  1.00 34.22 ? 867  ASP A CA    1 
ATOM   7086 C  C     . ASP A 1 867 ? 28.360  22.561  40.672  1.00 33.87 ? 867  ASP A C     1 
ATOM   7087 O  O     . ASP A 1 867 ? 27.795  21.778  39.905  1.00 34.22 ? 867  ASP A O     1 
ATOM   7088 C  CB    . ASP A 1 867 ? 29.357  20.637  41.957  1.00 33.50 ? 867  ASP A CB    1 
ATOM   7089 C  CG    . ASP A 1 867 ? 30.694  20.487  41.233  1.00 32.51 ? 867  ASP A CG    1 
ATOM   7090 O  OD1   . ASP A 1 867 ? 31.015  21.306  40.347  1.00 32.80 ? 867  ASP A OD1   1 
ATOM   7091 O  OD2   . ASP A 1 867 ? 31.443  19.540  41.551  1.00 36.65 ? 867  ASP A OD2   1 
ATOM   7092 N  N     . TYR A 1 868 ? 28.567  23.845  40.395  1.00 32.62 ? 868  TYR A N     1 
ATOM   7093 C  CA    . TYR A 1 868 ? 28.144  24.470  39.149  1.00 31.96 ? 868  TYR A CA    1 
ATOM   7094 C  C     . TYR A 1 868 ? 28.810  23.843  37.929  1.00 32.54 ? 868  TYR A C     1 
ATOM   7095 O  O     . TYR A 1 868 ? 28.174  23.700  36.884  1.00 32.74 ? 868  TYR A O     1 
ATOM   7096 C  CB    . TYR A 1 868 ? 28.456  25.973  39.175  1.00 34.38 ? 868  TYR A CB    1 
ATOM   7097 C  CG    . TYR A 1 868 ? 27.619  26.767  40.152  1.00 36.18 ? 868  TYR A CG    1 
ATOM   7098 C  CD1   . TYR A 1 868 ? 26.340  27.197  39.809  1.00 35.27 ? 868  TYR A CD1   1 
ATOM   7099 C  CD2   . TYR A 1 868 ? 28.111  27.100  41.407  1.00 40.52 ? 868  TYR A CD2   1 
ATOM   7100 C  CE1   . TYR A 1 868 ? 25.567  27.924  40.697  1.00 39.36 ? 868  TYR A CE1   1 
ATOM   7101 C  CE2   . TYR A 1 868 ? 27.345  27.837  42.310  1.00 43.77 ? 868  TYR A CE2   1 
ATOM   7102 C  CZ    . TYR A 1 868 ? 26.074  28.243  41.946  1.00 42.22 ? 868  TYR A CZ    1 
ATOM   7103 O  OH    . TYR A 1 868 ? 25.300  28.964  42.824  1.00 43.07 ? 868  TYR A OH    1 
ATOM   7104 N  N     . THR A 1 869 ? 30.090  23.490  38.062  1.00 30.66 ? 869  THR A N     1 
ATOM   7105 C  CA    . THR A 1 869 ? 30.850  22.863  36.980  1.00 30.73 ? 869  THR A CA    1 
ATOM   7106 C  C     . THR A 1 869 ? 30.202  21.554  36.511  1.00 27.86 ? 869  THR A C     1 
ATOM   7107 O  O     . THR A 1 869 ? 29.928  21.383  35.321  1.00 27.14 ? 869  THR A O     1 
ATOM   7108 C  CB    . THR A 1 869 ? 32.316  22.613  37.390  1.00 31.76 ? 869  THR A CB    1 
ATOM   7109 O  OG1   . THR A 1 869 ? 32.928  23.854  37.760  1.00 37.52 ? 869  THR A OG1   1 
ATOM   7110 C  CG2   . THR A 1 869 ? 33.098  21.999  36.244  1.00 31.75 ? 869  THR A CG2   1 
ATOM   7111 N  N     . VAL A 1 870 ? 29.933  20.653  37.450  1.00 27.26 ? 870  VAL A N     1 
ATOM   7112 C  CA    . VAL A 1 870 ? 29.299  19.369  37.134  1.00 27.99 ? 870  VAL A CA    1 
ATOM   7113 C  C     . VAL A 1 870 ? 27.894  19.601  36.563  1.00 29.17 ? 870  VAL A C     1 
ATOM   7114 O  O     . VAL A 1 870 ? 27.490  18.983  35.565  1.00 27.41 ? 870  VAL A O     1 
ATOM   7115 C  CB    . VAL A 1 870 ? 29.235  18.456  38.380  1.00 27.99 ? 870  VAL A CB    1 
ATOM   7116 C  CG1   . VAL A 1 870 ? 28.322  17.264  38.137  1.00 25.39 ? 870  VAL A CG1   1 
ATOM   7117 C  CG2   . VAL A 1 870 ? 30.638  17.968  38.766  1.00 29.31 ? 870  VAL A CG2   1 
ATOM   7118 N  N     . LEU A 1 871 ? 27.155  20.496  37.210  1.00 29.04 ? 871  LEU A N     1 
ATOM   7119 C  CA    . LEU A 1 871 ? 25.814  20.854  36.787  1.00 30.40 ? 871  LEU A CA    1 
ATOM   7120 C  C     . LEU A 1 871 ? 25.822  21.307  35.320  1.00 30.57 ? 871  LEU A C     1 
ATOM   7121 O  O     . LEU A 1 871 ? 25.002  20.849  34.517  1.00 30.66 ? 871  LEU A O     1 
ATOM   7122 C  CB    . LEU A 1 871 ? 25.290  21.956  37.713  1.00 33.01 ? 871  LEU A CB    1 
ATOM   7123 C  CG    . LEU A 1 871 ? 23.881  22.524  37.658  1.00 37.65 ? 871  LEU A CG    1 
ATOM   7124 C  CD1   . LEU A 1 871 ? 23.635  23.328  38.935  1.00 37.02 ? 871  LEU A CD1   1 
ATOM   7125 C  CD2   . LEU A 1 871 ? 23.680  23.402  36.419  1.00 41.83 ? 871  LEU A CD2   1 
ATOM   7126 N  N     . LEU A 1 872 ? 26.754  22.190  34.972  1.00 31.21 ? 872  LEU A N     1 
ATOM   7127 C  CA    . LEU A 1 872 ? 26.867  22.696  33.599  1.00 33.66 ? 872  LEU A CA    1 
ATOM   7128 C  C     . LEU A 1 872 ? 27.216  21.609  32.593  1.00 34.01 ? 872  LEU A C     1 
ATOM   7129 O  O     . LEU A 1 872 ? 26.595  21.523  31.528  1.00 34.86 ? 872  LEU A O     1 
ATOM   7130 C  CB    . LEU A 1 872 ? 27.906  23.821  33.501  1.00 31.67 ? 872  LEU A CB    1 
ATOM   7131 C  CG    . LEU A 1 872 ? 27.941  24.582  32.169  1.00 33.96 ? 872  LEU A CG    1 
ATOM   7132 C  CD1   . LEU A 1 872 ? 26.628  25.353  31.926  1.00 31.31 ? 872  LEU A CD1   1 
ATOM   7133 C  CD2   . LEU A 1 872 ? 29.156  25.520  32.083  1.00 29.91 ? 872  LEU A CD2   1 
ATOM   7134 N  N     . GLU A 1 873 ? 28.227  20.805  32.913  1.00 34.76 ? 873  GLU A N     1 
ATOM   7135 C  CA    . GLU A 1 873 ? 28.687  19.769  31.995  1.00 35.09 ? 873  GLU A CA    1 
ATOM   7136 C  C     . GLU A 1 873 ? 27.575  18.776  31.722  1.00 33.88 ? 873  GLU A C     1 
ATOM   7137 O  O     . GLU A 1 873 ? 27.357  18.391  30.574  1.00 32.71 ? 873  GLU A O     1 
ATOM   7138 C  CB    . GLU A 1 873 ? 29.922  19.042  32.536  1.00 39.41 ? 873  GLU A CB    1 
ATOM   7139 C  CG    . GLU A 1 873 ? 31.200  19.895  32.583  1.00 48.01 ? 873  GLU A CG    1 
ATOM   7140 C  CD    . GLU A 1 873 ? 31.796  20.202  31.205  1.00 51.66 ? 873  GLU A CD    1 
ATOM   7141 O  OE1   . GLU A 1 873 ? 32.473  21.253  31.070  1.00 49.66 ? 873  GLU A OE1   1 
ATOM   7142 O  OE2   . GLU A 1 873 ? 31.593  19.392  30.268  1.00 52.43 ? 873  GLU A OE2   1 
ATOM   7143 N  N     . LYS A 1 874 ? 26.852  18.398  32.774  1.00 32.04 ? 874  LYS A N     1 
ATOM   7144 C  CA    . LYS A 1 874 ? 25.868  17.315  32.687  1.00 31.70 ? 874  LYS A CA    1 
ATOM   7145 C  C     . LYS A 1 874 ? 24.554  17.725  32.049  1.00 30.41 ? 874  LYS A C     1 
ATOM   7146 O  O     . LYS A 1 874 ? 24.003  16.973  31.246  1.00 29.27 ? 874  LYS A O     1 
ATOM   7147 C  CB    . LYS A 1 874 ? 25.611  16.696  34.069  1.00 33.28 ? 874  LYS A CB    1 
ATOM   7148 C  CG    . LYS A 1 874 ? 26.526  15.535  34.383  1.00 38.23 ? 874  LYS A CG    1 
ATOM   7149 C  CD    . LYS A 1 874 ? 26.706  15.270  35.873  1.00 38.79 ? 874  LYS A CD    1 
ATOM   7150 C  CE    . LYS A 1 874 ? 25.399  15.058  36.604  1.00 39.92 ? 874  LYS A CE    1 
ATOM   7151 N  NZ    . LYS A 1 874 ? 25.631  14.441  37.946  1.00 40.38 ? 874  LYS A NZ    1 
ATOM   7152 N  N     . THR A 1 875 ? 24.051  18.907  32.403  1.00 27.08 ? 875  THR A N     1 
ATOM   7153 C  CA    . THR A 1 875 ? 22.733  19.328  31.933  1.00 28.19 ? 875  THR A CA    1 
ATOM   7154 C  C     . THR A 1 875 ? 22.778  20.179  30.668  1.00 27.72 ? 875  THR A C     1 
ATOM   7155 O  O     . THR A 1 875 ? 21.825  20.172  29.886  1.00 24.58 ? 875  THR A O     1 
ATOM   7156 C  CB    . THR A 1 875 ? 21.903  20.095  33.013  1.00 27.67 ? 875  THR A CB    1 
ATOM   7157 O  OG1   . THR A 1 875 ? 22.494  21.378  33.259  1.00 28.00 ? 875  THR A OG1   1 
ATOM   7158 C  CG2   . THR A 1 875 ? 21.797  19.300  34.324  1.00 25.31 ? 875  THR A CG2   1 
ATOM   7159 N  N     . PHE A 1 876 ? 23.872  20.910  30.467  1.00 26.68 ? 876  PHE A N     1 
ATOM   7160 C  CA    . PHE A 1 876 ? 23.940  21.847  29.350  1.00 27.54 ? 876  PHE A CA    1 
ATOM   7161 C  C     . PHE A 1 876 ? 24.965  21.432  28.290  1.00 27.94 ? 876  PHE A C     1 
ATOM   7162 O  O     . PHE A 1 876 ? 24.604  21.206  27.139  1.00 30.04 ? 876  PHE A O     1 
ATOM   7163 C  CB    . PHE A 1 876 ? 24.191  23.267  29.863  1.00 26.59 ? 876  PHE A CB    1 
ATOM   7164 C  CG    . PHE A 1 876 ? 24.221  24.310  28.787  1.00 27.16 ? 876  PHE A CG    1 
ATOM   7165 C  CD1   . PHE A 1 876 ? 23.052  24.705  28.150  1.00 27.97 ? 876  PHE A CD1   1 
ATOM   7166 C  CD2   . PHE A 1 876 ? 25.413  24.921  28.434  1.00 26.88 ? 876  PHE A CD2   1 
ATOM   7167 C  CE1   . PHE A 1 876 ? 23.075  25.676  27.155  1.00 28.78 ? 876  PHE A CE1   1 
ATOM   7168 C  CE2   . PHE A 1 876 ? 25.443  25.895  27.445  1.00 27.55 ? 876  PHE A CE2   1 
ATOM   7169 C  CZ    . PHE A 1 876 ? 24.277  26.272  26.805  1.00 27.58 ? 876  PHE A CZ    1 
ATOM   7170 N  N     . ILE A 1 877 ? 26.230  21.311  28.678  1.00 30.10 ? 877  ILE A N     1 
ATOM   7171 C  CA    . ILE A 1 877 ? 27.306  21.038  27.712  1.00 29.63 ? 877  ILE A CA    1 
ATOM   7172 C  C     . ILE A 1 877 ? 27.151  19.701  26.974  1.00 31.29 ? 877  ILE A C     1 
ATOM   7173 O  O     . ILE A 1 877 ? 27.141  19.676  25.741  1.00 32.80 ? 877  ILE A O     1 
ATOM   7174 C  CB    . ILE A 1 877 ? 28.714  21.280  28.319  1.00 30.58 ? 877  ILE A CB    1 
ATOM   7175 C  CG1   . ILE A 1 877 ? 28.920  22.796  28.491  1.00 31.32 ? 877  ILE A CG1   1 
ATOM   7176 C  CG2   . ILE A 1 877 ? 29.831  20.716  27.410  1.00 32.00 ? 877  ILE A CG2   1 
ATOM   7177 C  CD1   . ILE A 1 877 ? 30.068  23.197  29.372  1.00 38.18 ? 877  ILE A CD1   1 
ATOM   7178 N  N     . LYS A 1 878 ? 26.979  18.609  27.713  1.00 31.56 ? 878  LYS A N     1 
ATOM   7179 C  CA    . LYS A 1 878 ? 26.801  17.297  27.089  1.00 32.74 ? 878  LYS A CA    1 
ATOM   7180 C  C     . LYS A 1 878 ? 25.629  17.255  26.085  1.00 31.35 ? 878  LYS A C     1 
ATOM   7181 O  O     . LYS A 1 878 ? 25.825  16.796  24.967  1.00 32.55 ? 878  LYS A O     1 
ATOM   7182 C  CB    . LYS A 1 878 ? 26.713  16.171  28.131  1.00 33.42 ? 878  LYS A CB    1 
ATOM   7183 C  CG    . LYS A 1 878 ? 27.102  14.790  27.597  1.00 38.61 ? 878  LYS A CG    1 
ATOM   7184 C  CD    . LYS A 1 878 ? 26.622  13.689  28.542  1.00 47.47 ? 878  LYS A CD    1 
ATOM   7185 C  CE    . LYS A 1 878 ? 27.536  12.457  28.533  1.00 52.13 ? 878  LYS A CE    1 
ATOM   7186 N  NZ    . LYS A 1 878 ? 27.410  11.613  27.309  1.00 53.47 ? 878  LYS A NZ    1 
ATOM   7187 N  N     . PRO A 1 879 ? 24.420  17.745  26.463  1.00 29.90 ? 879  PRO A N     1 
ATOM   7188 C  CA    . PRO A 1 879 ? 23.361  17.814  25.445  1.00 28.38 ? 879  PRO A CA    1 
ATOM   7189 C  C     . PRO A 1 879 ? 23.687  18.714  24.252  1.00 28.01 ? 879  PRO A C     1 
ATOM   7190 O  O     . PRO A 1 879 ? 23.500  18.294  23.110  1.00 27.79 ? 879  PRO A O     1 
ATOM   7191 C  CB    . PRO A 1 879 ? 22.160  18.363  26.219  1.00 30.60 ? 879  PRO A CB    1 
ATOM   7192 C  CG    . PRO A 1 879 ? 22.386  17.892  27.610  1.00 29.37 ? 879  PRO A CG    1 
ATOM   7193 C  CD    . PRO A 1 879 ? 23.878  17.998  27.810  1.00 29.22 ? 879  PRO A CD    1 
ATOM   7194 N  N     . LEU A 1 880 ? 24.161  19.934  24.509  1.00 28.21 ? 880  LEU A N     1 
ATOM   7195 C  CA    . LEU A 1 880 ? 24.628  20.819  23.439  1.00 27.21 ? 880  LEU A CA    1 
ATOM   7196 C  C     . LEU A 1 880 ? 25.670  20.161  22.508  1.00 28.89 ? 880  LEU A C     1 
ATOM   7197 O  O     . LEU A 1 880 ? 25.629  20.358  21.294  1.00 29.56 ? 880  LEU A O     1 
ATOM   7198 C  CB    . LEU A 1 880 ? 25.156  22.146  24.011  1.00 26.47 ? 880  LEU A CB    1 
ATOM   7199 C  CG    . LEU A 1 880 ? 25.470  23.217  22.965  1.00 29.95 ? 880  LEU A CG    1 
ATOM   7200 C  CD1   . LEU A 1 880 ? 24.222  23.665  22.228  1.00 30.48 ? 880  LEU A CD1   1 
ATOM   7201 C  CD2   . LEU A 1 880 ? 26.180  24.405  23.581  1.00 33.20 ? 880  LEU A CD2   1 
ATOM   7202 N  N     . GLU A 1 881 ? 26.598  19.391  23.076  1.00 30.79 ? 881  GLU A N     1 
ATOM   7203 C  CA    A GLU A 1 881 ? 27.604  18.666  22.292  0.50 30.54 ? 881  GLU A CA    1 
ATOM   7204 C  CA    B GLU A 1 881 ? 27.595  18.696  22.273  0.50 31.32 ? 881  GLU A CA    1 
ATOM   7205 C  C     . GLU A 1 881 ? 26.902  17.693  21.347  1.00 31.39 ? 881  GLU A C     1 
ATOM   7206 O  O     . GLU A 1 881 ? 27.252  17.585  20.166  1.00 28.92 ? 881  GLU A O     1 
ATOM   7207 C  CB    A GLU A 1 881 ? 28.588  17.933  23.219  0.50 32.09 ? 881  GLU A CB    1 
ATOM   7208 C  CB    B GLU A 1 881 ? 28.629  18.018  23.172  0.50 33.77 ? 881  GLU A CB    1 
ATOM   7209 C  CG    A GLU A 1 881 ? 29.446  16.848  22.557  0.50 33.87 ? 881  GLU A CG    1 
ATOM   7210 C  CG    B GLU A 1 881 ? 30.057  18.213  22.710  0.50 38.85 ? 881  GLU A CG    1 
ATOM   7211 C  CD    A GLU A 1 881 ? 30.390  17.404  21.507  0.50 35.05 ? 881  GLU A CD    1 
ATOM   7212 C  CD    B GLU A 1 881 ? 31.046  18.179  23.856  0.50 43.27 ? 881  GLU A CD    1 
ATOM   7213 O  OE1   A GLU A 1 881 ? 30.898  16.612  20.685  0.50 33.66 ? 881  GLU A OE1   1 
ATOM   7214 O  OE1   B GLU A 1 881 ? 30.694  17.648  24.932  0.50 45.17 ? 881  GLU A OE1   1 
ATOM   7215 O  OE2   A GLU A 1 881 ? 30.617  18.633  21.504  0.50 35.04 ? 881  GLU A OE2   1 
ATOM   7216 O  OE2   B GLU A 1 881 ? 32.173  18.687  23.682  0.50 41.94 ? 881  GLU A OE2   1 
ATOM   7217 N  N     . GLY A 1 882 ? 25.899  16.991  21.878  1.00 29.49 ? 882  GLY A N     1 
ATOM   7218 C  CA    . GLY A 1 882 ? 25.063  16.111  21.080  1.00 28.54 ? 882  GLY A CA    1 
ATOM   7219 C  C     . GLY A 1 882 ? 24.393  16.837  19.915  1.00 27.81 ? 882  GLY A C     1 
ATOM   7220 O  O     . GLY A 1 882 ? 24.433  16.357  18.784  1.00 28.27 ? 882  GLY A O     1 
ATOM   7221 N  N     . PHE A 1 883 ? 23.801  18.001  20.180  1.00 25.52 ? 883  PHE A N     1 
ATOM   7222 C  CA    . PHE A 1 883 ? 23.112  18.768  19.132  1.00 24.33 ? 883  PHE A CA    1 
ATOM   7223 C  C     . PHE A 1 883 ? 24.058  19.199  18.030  1.00 24.81 ? 883  PHE A C     1 
ATOM   7224 O  O     . PHE A 1 883 ? 23.717  19.101  16.840  1.00 26.07 ? 883  PHE A O     1 
ATOM   7225 C  CB    . PHE A 1 883 ? 22.432  20.037  19.671  1.00 23.76 ? 883  PHE A CB    1 
ATOM   7226 C  CG    . PHE A 1 883 ? 21.478  19.803  20.810  1.00 22.23 ? 883  PHE A CG    1 
ATOM   7227 C  CD1   . PHE A 1 883 ? 20.972  18.535  21.087  1.00 20.50 ? 883  PHE A CD1   1 
ATOM   7228 C  CD2   . PHE A 1 883 ? 21.057  20.874  21.583  1.00 25.45 ? 883  PHE A CD2   1 
ATOM   7229 C  CE1   . PHE A 1 883 ? 20.093  18.333  22.145  1.00 24.93 ? 883  PHE A CE1   1 
ATOM   7230 C  CE2   . PHE A 1 883 ? 20.167  20.686  22.634  1.00 26.38 ? 883  PHE A CE2   1 
ATOM   7231 C  CZ    . PHE A 1 883 ? 19.686  19.409  22.920  1.00 25.25 ? 883  PHE A CZ    1 
ATOM   7232 N  N     . THR A 1 884 ? 25.231  19.687  18.433  1.00 24.27 ? 884  THR A N     1 
ATOM   7233 C  CA    . THR A 1 884 ? 26.143  20.364  17.521  1.00 27.41 ? 884  THR A CA    1 
ATOM   7234 C  C     . THR A 1 884 ? 26.952  19.405  16.653  1.00 30.35 ? 884  THR A C     1 
ATOM   7235 O  O     . THR A 1 884 ? 27.213  19.708  15.489  1.00 33.91 ? 884  THR A O     1 
ATOM   7236 C  CB    . THR A 1 884 ? 27.090  21.336  18.250  1.00 27.93 ? 884  THR A CB    1 
ATOM   7237 O  OG1   . THR A 1 884 ? 27.819  20.642  19.275  1.00 26.65 ? 884  THR A OG1   1 
ATOM   7238 C  CG2   . THR A 1 884 ? 26.305  22.511  18.859  1.00 26.95 ? 884  THR A CG2   1 
ATOM   7239 N  N     . SER A 1 885 ? 27.357  18.263  17.207  1.00 30.30 ? 885  SER A N     1 
ATOM   7240 C  CA    . SER A 1 885 ? 28.096  17.286  16.418  1.00 33.32 ? 885  SER A CA    1 
ATOM   7241 C  C     . SER A 1 885 ? 27.147  16.654  15.409  1.00 33.96 ? 885  SER A C     1 
ATOM   7242 O  O     . SER A 1 885 ? 27.525  16.428  14.268  1.00 35.01 ? 885  SER A O     1 
ATOM   7243 C  CB    . SER A 1 885 ? 28.765  16.231  17.293  1.00 34.03 ? 885  SER A CB    1 
ATOM   7244 O  OG    . SER A 1 885 ? 27.796  15.531  18.046  1.00 39.86 ? 885  SER A OG    1 
ATOM   7245 N  N     . ALA A 1 886 ? 25.901  16.418  15.820  1.00 33.07 ? 886  ALA A N     1 
ATOM   7246 C  CA    . ALA A 1 886 ? 24.870  15.940  14.896  1.00 32.86 ? 886  ALA A CA    1 
ATOM   7247 C  C     . ALA A 1 886 ? 24.712  16.921  13.743  1.00 30.80 ? 886  ALA A C     1 
ATOM   7248 O  O     . ALA A 1 886 ? 24.646  16.515  12.587  1.00 31.66 ? 886  ALA A O     1 
ATOM   7249 C  CB    . ALA A 1 886 ? 23.544  15.747  15.615  1.00 32.27 ? 886  ALA A CB    1 
ATOM   7250 N  N     . ALA A 1 887 ? 24.688  18.212  14.067  1.00 28.69 ? 887  ALA A N     1 
ATOM   7251 C  CA    . ALA A 1 887 ? 24.461  19.259  13.067  1.00 29.26 ? 887  ALA A CA    1 
ATOM   7252 C  C     . ALA A 1 887 ? 25.755  19.713  12.372  1.00 30.54 ? 887  ALA A C     1 
ATOM   7253 O  O     . ALA A 1 887 ? 25.735  20.634  11.550  1.00 32.61 ? 887  ALA A O     1 
ATOM   7254 C  CB    . ALA A 1 887 ? 23.725  20.437  13.693  1.00 23.01 ? 887  ALA A CB    1 
ATOM   7255 N  N     . LYS A 1 888 ? 26.867  19.045  12.696  1.00 32.90 ? 888  LYS A N     1 
ATOM   7256 C  CA    . LYS A 1 888 ? 28.192  19.331  12.126  1.00 31.90 ? 888  LYS A CA    1 
ATOM   7257 C  C     . LYS A 1 888 ? 28.539  20.806  12.288  1.00 34.00 ? 888  LYS A C     1 
ATOM   7258 O  O     . LYS A 1 888 ? 28.786  21.518  11.312  1.00 32.86 ? 888  LYS A O     1 
ATOM   7259 C  CB    . LYS A 1 888 ? 28.290  18.876  10.660  1.00 31.98 ? 888  LYS A CB    1 
ATOM   7260 C  CG    . LYS A 1 888 ? 27.876  17.414  10.427  1.00 33.30 ? 888  LYS A CG    1 
ATOM   7261 C  CD    . LYS A 1 888 ? 28.259  16.928  9.029   1.00 38.85 ? 888  LYS A CD    1 
ATOM   7262 C  CE    . LYS A 1 888 ? 27.603  15.588  8.686   1.00 41.46 ? 888  LYS A CE    1 
ATOM   7263 N  NZ    . LYS A 1 888 ? 28.000  14.472  9.591   1.00 40.69 ? 888  LYS A NZ    1 
ATOM   7264 N  N     . LEU A 1 889 ? 28.553  21.236  13.546  1.00 34.45 ? 889  LEU A N     1 
ATOM   7265 C  CA    . LEU A 1 889 ? 28.722  22.622  13.933  1.00 38.13 ? 889  LEU A CA    1 
ATOM   7266 C  C     . LEU A 1 889 ? 29.581  22.640  15.192  1.00 39.55 ? 889  LEU A C     1 
ATOM   7267 O  O     . LEU A 1 889 ? 29.709  21.620  15.868  1.00 40.10 ? 889  LEU A O     1 
ATOM   7268 C  CB    . LEU A 1 889 ? 27.342  23.199  14.250  1.00 40.91 ? 889  LEU A CB    1 
ATOM   7269 C  CG    . LEU A 1 889 ? 26.873  24.526  13.666  1.00 43.53 ? 889  LEU A CG    1 
ATOM   7270 C  CD1   . LEU A 1 889 ? 27.424  24.742  12.275  1.00 48.89 ? 889  LEU A CD1   1 
ATOM   7271 C  CD2   . LEU A 1 889 ? 25.354  24.570  13.650  1.00 43.13 ? 889  LEU A CD2   1 
ATOM   7272 N  N     . ASP A 1 890 ? 30.177  23.786  15.510  1.00 39.71 ? 890  ASP A N     1 
ATOM   7273 C  CA    . ASP A 1 890 ? 30.930  23.926  16.758  1.00 38.82 ? 890  ASP A CA    1 
ATOM   7274 C  C     . ASP A 1 890 ? 30.323  25.009  17.650  1.00 37.21 ? 890  ASP A C     1 
ATOM   7275 O  O     . ASP A 1 890 ? 29.997  26.102  17.186  1.00 35.30 ? 890  ASP A O     1 
ATOM   7276 C  CB    . ASP A 1 890 ? 32.406  24.227  16.480  1.00 42.09 ? 890  ASP A CB    1 
ATOM   7277 C  CG    . ASP A 1 890 ? 33.186  22.997  16.020  1.00 43.19 ? 890  ASP A CG    1 
ATOM   7278 O  OD1   . ASP A 1 890 ? 33.296  22.016  16.793  1.00 41.77 ? 890  ASP A OD1   1 
ATOM   7279 O  OD2   . ASP A 1 890 ? 33.701  23.026  14.883  1.00 41.38 ? 890  ASP A OD2   1 
ATOM   7280 N  N     . TYR A 1 891 ? 30.162  24.701  18.931  1.00 35.65 ? 891  TYR A N     1 
ATOM   7281 C  CA    . TYR A 1 891 ? 29.643  25.685  19.869  1.00 35.99 ? 891  TYR A CA    1 
ATOM   7282 C  C     . TYR A 1 891 ? 30.763  26.602  20.365  1.00 36.34 ? 891  TYR A C     1 
ATOM   7283 O  O     . TYR A 1 891 ? 30.500  27.666  20.915  1.00 33.72 ? 891  TYR A O     1 
ATOM   7284 C  CB    . TYR A 1 891 ? 28.889  25.015  21.026  1.00 35.39 ? 891  TYR A CB    1 
ATOM   7285 C  CG    . TYR A 1 891 ? 29.708  24.057  21.852  1.00 33.80 ? 891  TYR A CG    1 
ATOM   7286 C  CD1   . TYR A 1 891 ? 29.873  22.733  21.463  1.00 36.22 ? 891  TYR A CD1   1 
ATOM   7287 C  CD2   . TYR A 1 891 ? 30.304  24.473  23.036  1.00 37.29 ? 891  TYR A CD2   1 
ATOM   7288 C  CE1   . TYR A 1 891 ? 30.627  21.850  22.230  1.00 40.56 ? 891  TYR A CE1   1 
ATOM   7289 C  CE2   . TYR A 1 891 ? 31.061  23.603  23.813  1.00 38.78 ? 891  TYR A CE2   1 
ATOM   7290 C  CZ    . TYR A 1 891 ? 31.220  22.294  23.409  1.00 42.36 ? 891  TYR A CZ    1 
ATOM   7291 O  OH    . TYR A 1 891 ? 31.976  21.431  24.180  1.00 41.49 ? 891  TYR A OH    1 
ATOM   7292 N  N     . GLU A 1 892 ? 32.007  26.177  20.141  1.00 39.04 ? 892  GLU A N     1 
ATOM   7293 C  CA    . GLU A 1 892 ? 33.191  26.974  20.460  1.00 41.62 ? 892  GLU A CA    1 
ATOM   7294 C  C     . GLU A 1 892 ? 34.020  27.241  19.217  1.00 43.42 ? 892  GLU A C     1 
ATOM   7295 O  O     . GLU A 1 892 ? 34.305  26.317  18.444  1.00 43.15 ? 892  GLU A O     1 
ATOM   7296 C  CB    . GLU A 1 892 ? 34.058  26.257  21.488  1.00 42.64 ? 892  GLU A CB    1 
ATOM   7297 C  CG    . GLU A 1 892 ? 33.561  26.399  22.912  1.00 46.97 ? 892  GLU A CG    1 
ATOM   7298 C  CD    . GLU A 1 892 ? 34.472  25.729  23.915  1.00 48.62 ? 892  GLU A CD    1 
ATOM   7299 O  OE1   . GLU A 1 892 ? 34.792  26.375  24.928  1.00 51.24 ? 892  GLU A OE1   1 
ATOM   7300 O  OE2   . GLU A 1 892 ? 34.871  24.565  23.693  1.00 53.66 ? 892  GLU A OE2   1 
ATOM   7301 N  N     . LYS A 1 893 ? 34.417  28.500  19.040  1.00 44.72 ? 893  LYS A N     1 
ATOM   7302 C  CA    . LYS A 1 893 ? 35.187  28.904  17.871  1.00 49.34 ? 893  LYS A CA    1 
ATOM   7303 C  C     . LYS A 1 893 ? 36.537  28.192  17.783  1.00 52.26 ? 893  LYS A C     1 
ATOM   7304 O  O     . LYS A 1 893 ? 37.348  28.242  18.712  1.00 53.55 ? 893  LYS A O     1 
ATOM   7305 C  CB    . LYS A 1 893 ? 35.377  30.420  17.825  1.00 49.15 ? 893  LYS A CB    1 
ATOM   7306 C  CG    . LYS A 1 893 ? 35.642  30.939  16.416  1.00 52.44 ? 893  LYS A CG    1 
ATOM   7307 C  CD    . LYS A 1 893 ? 35.941  32.432  16.398  1.00 57.12 ? 893  LYS A CD    1 
ATOM   7308 C  CE    . LYS A 1 893 ? 36.536  32.849  15.059  1.00 59.46 ? 893  LYS A CE    1 
ATOM   7309 N  NZ    . LYS A 1 893 ? 36.482  34.320  14.864  1.00 60.10 ? 893  LYS A NZ    1 
ATOM   7310 N  N     . LYS A 1 894 ? 36.757  27.518  16.659  1.00 54.91 ? 894  LYS A N     1 
ATOM   7311 C  CA    . LYS A 1 894 ? 38.040  26.882  16.374  1.00 58.40 ? 894  LYS A CA    1 
ATOM   7312 C  C     . LYS A 1 894 ? 39.076  27.933  15.958  1.00 60.04 ? 894  LYS A C     1 
ATOM   7313 O  O     . LYS A 1 894 ? 38.733  28.952  15.354  1.00 58.65 ? 894  LYS A O     1 
ATOM   7314 C  CB    . LYS A 1 894 ? 37.892  25.807  15.291  1.00 59.00 ? 894  LYS A CB    1 
ATOM   7315 C  CG    . LYS A 1 894 ? 37.009  26.221  14.122  1.00 63.17 ? 894  LYS A CG    1 
ATOM   7316 C  CD    . LYS A 1 894 ? 37.487  25.634  12.802  1.00 65.92 ? 894  LYS A CD    1 
ATOM   7317 C  CE    . LYS A 1 894 ? 36.652  26.174  11.644  1.00 68.48 ? 894  LYS A CE    1 
ATOM   7318 N  NZ    . LYS A 1 894 ? 37.125  25.695  10.315  1.00 70.08 ? 894  LYS A NZ    1 
ATOM   7319 N  N     . ALA A 1 895 ? 40.336  27.676  16.304  1.00 61.45 ? 895  ALA A N     1 
ATOM   7320 C  CA    . ALA A 1 895 ? 41.447  28.560  15.964  1.00 64.61 ? 895  ALA A CA    1 
ATOM   7321 C  C     . ALA A 1 895 ? 41.655  28.617  14.452  1.00 66.06 ? 895  ALA A C     1 
ATOM   7322 O  O     . ALA A 1 895 ? 41.641  27.587  13.773  1.00 65.50 ? 895  ALA A O     1 
ATOM   7323 C  CB    . ALA A 1 895 ? 42.729  28.103  16.666  1.00 63.77 ? 895  ALA A CB    1 
ATOM   7324 N  N     . SER A 1 896 ? 41.830  29.829  13.935  1.00 67.40 ? 896  SER A N     1 
ATOM   7325 C  CA    . SER A 1 896 ? 42.074  30.039  12.510  1.00 69.42 ? 896  SER A CA    1 
ATOM   7326 C  C     . SER A 1 896 ? 43.426  30.711  12.292  1.00 71.20 ? 896  SER A C     1 
ATOM   7327 O  O     . SER A 1 896 ? 43.975  31.333  13.204  1.00 71.08 ? 896  SER A O     1 
ATOM   7328 C  CB    . SER A 1 896 ? 40.957  30.887  11.891  1.00 69.83 ? 896  SER A CB    1 
ATOM   7329 O  OG    . SER A 1 896 ? 40.813  32.126  12.570  1.00 71.92 ? 896  SER A OG    1 
ATOM   7330 N  N     . LEU A 1 897 ? 43.961  30.588  11.080  1.00 71.85 ? 897  LEU A N     1 
ATOM   7331 C  CA    . LEU A 1 897 ? 45.214  31.253  10.732  1.00 73.65 ? 897  LEU A CA    1 
ATOM   7332 C  C     . LEU A 1 897 ? 45.077  32.777  10.856  1.00 74.23 ? 897  LEU A C     1 
ATOM   7333 O  O     . LEU A 1 897 ? 46.070  33.491  11.012  1.00 75.09 ? 897  LEU A O     1 
ATOM   7334 C  CB    . LEU A 1 897 ? 45.691  30.825  9.337   1.00 74.89 ? 897  LEU A CB    1 
ATOM   7335 C  CG    . LEU A 1 897 ? 46.425  29.476  9.241   1.00 74.84 ? 897  LEU A CG    1 
ATOM   7336 C  CD1   . LEU A 1 897 ? 45.475  28.274  9.303   1.00 74.60 ? 897  LEU A CD1   1 
ATOM   7337 C  CD2   . LEU A 1 897 ? 47.258  29.414  7.971   1.00 77.64 ? 897  LEU A CD2   1 
ATOM   7338 N  N     . PHE A 1 898 ? 43.830  33.246  10.819  1.00 74.14 ? 898  PHE A N     1 
ATOM   7339 C  CA    . PHE A 1 898 ? 43.470  34.646  11.064  1.00 76.38 ? 898  PHE A CA    1 
ATOM   7340 C  C     . PHE A 1 898 ? 43.883  35.183  12.441  1.00 77.29 ? 898  PHE A C     1 
ATOM   7341 O  O     . PHE A 1 898 ? 44.215  36.367  12.574  1.00 78.68 ? 898  PHE A O     1 
ATOM   7342 C  CB    . PHE A 1 898 ? 41.960  34.834  10.863  1.00 76.34 ? 898  PHE A CB    1 
ATOM   7343 C  CG    . PHE A 1 898 ? 41.603  35.616  9.630   1.00 78.31 ? 898  PHE A CG    1 
ATOM   7344 C  CD1   . PHE A 1 898 ? 40.889  36.807  9.735   1.00 79.26 ? 898  PHE A CD1   1 
ATOM   7345 C  CD2   . PHE A 1 898 ? 41.990  35.175  8.367   1.00 79.21 ? 898  PHE A CD2   1 
ATOM   7346 C  CE1   . PHE A 1 898 ? 40.560  37.545  8.602   1.00 80.36 ? 898  PHE A CE1   1 
ATOM   7347 C  CE2   . PHE A 1 898 ? 41.668  35.910  7.229   1.00 80.52 ? 898  PHE A CE2   1 
ATOM   7348 C  CZ    . PHE A 1 898 ? 40.951  37.094  7.348   1.00 80.66 ? 898  PHE A CZ    1 
ATOM   7349 N  N     . ASP A 1 899 ? 43.866  34.308  13.450  1.00 75.78 ? 899  ASP A N     1 
ATOM   7350 C  CA    . ASP A 1 899 ? 44.236  34.659  14.831  1.00 75.82 ? 899  ASP A CA    1 
ATOM   7351 C  C     . ASP A 1 899 ? 45.618  35.296  14.957  1.00 79.10 ? 899  ASP A C     1 
ATOM   7352 O  O     . ASP A 1 899 ? 45.918  35.941  15.963  1.00 80.06 ? 899  ASP A O     1 
ATOM   7353 C  CB    . ASP A 1 899 ? 44.166  33.428  15.742  1.00 73.19 ? 899  ASP A CB    1 
ATOM   7354 C  CG    . ASP A 1 899 ? 42.799  32.771  15.741  1.00 68.98 ? 899  ASP A CG    1 
ATOM   7355 O  OD1   . ASP A 1 899 ? 41.812  33.421  15.331  1.00 67.06 ? 899  ASP A OD1   1 
ATOM   7356 O  OD2   . ASP A 1 899 ? 42.716  31.594  16.151  1.00 66.71 ? 899  ASP A OD2   1 
ATOM   7357 N  N     . MET A 1 900 ? 46.450  35.117  13.934  1.00 81.16 ? 900  MET A N     1 
ATOM   7358 C  CA    . MET A 1 900 ? 47.786  35.709  13.903  1.00 83.67 ? 900  MET A CA    1 
ATOM   7359 C  C     . MET A 1 900 ? 47.736  37.212  13.596  1.00 85.01 ? 900  MET A C     1 
ATOM   7360 O  O     . MET A 1 900 ? 48.769  37.844  13.349  1.00 86.42 ? 900  MET A O     1 
ATOM   7361 C  CB    . MET A 1 900 ? 48.675  34.960  12.903  1.00 85.44 ? 900  MET A CB    1 
ATOM   7362 C  CG    . MET A 1 900 ? 48.792  33.460  13.196  1.00 86.35 ? 900  MET A CG    1 
ATOM   7363 S  SD    . MET A 1 900 ? 50.116  32.606  12.308  1.00 91.23 ? 900  MET A SD    1 
ATOM   7364 C  CE    . MET A 1 900 ? 51.578  33.239  13.138  1.00 91.05 ? 900  MET A CE    1 
ATOM   7365 N  N     . PHE A 1 901 ? 46.525  37.771  13.633  1.00 84.03 ? 901  PHE A N     1 
ATOM   7366 C  CA    . PHE A 1 901 ? 46.291  39.197  13.393  1.00 85.76 ? 901  PHE A CA    1 
ATOM   7367 C  C     . PHE A 1 901 ? 45.454  39.850  14.498  1.00 85.36 ? 901  PHE A C     1 
ATOM   7368 O  O     . PHE A 1 901 ? 45.063  39.192  15.471  1.00 83.94 ? 901  PHE A O     1 
ATOM   7369 C  CB    . PHE A 1 901 ? 45.612  39.408  12.035  1.00 85.43 ? 901  PHE A CB    1 
ATOM   7370 C  CG    . PHE A 1 901 ? 46.519  39.170  10.859  1.00 84.00 ? 901  PHE A CG    1 
ATOM   7371 C  CD1   . PHE A 1 901 ? 47.293  40.205  10.343  1.00 84.43 ? 901  PHE A CD1   1 
ATOM   7372 C  CD2   . PHE A 1 901 ? 46.602  37.912  10.269  1.00 81.14 ? 901  PHE A CD2   1 
ATOM   7373 C  CE1   . PHE A 1 901 ? 48.137  39.993  9.259   1.00 84.32 ? 901  PHE A CE1   1 
ATOM   7374 C  CE2   . PHE A 1 901 ? 47.444  37.692  9.185   1.00 81.32 ? 901  PHE A CE2   1 
ATOM   7375 C  CZ    . PHE A 1 901 ? 48.212  38.734  8.679   1.00 82.52 ? 901  PHE A CZ    1 
ATOM   7376 O  "O5'" . DT  B 2 1   ? -0.992  5.521   37.300  1.00 80.69 ? 1    DT  T "O5'" 1 
ATOM   7377 C  "C5'" . DT  B 2 1   ? 0.372   5.620   37.715  1.00 81.74 ? 1    DT  T "C5'" 1 
ATOM   7378 C  "C4'" . DT  B 2 1   ? 0.557   5.157   39.161  1.00 82.89 ? 1    DT  T "C4'" 1 
ATOM   7379 O  "O4'" . DT  B 2 1   ? 1.959   4.895   39.462  1.00 82.44 ? 1    DT  T "O4'" 1 
ATOM   7380 C  "C3'" . DT  B 2 1   ? 0.104   6.117   40.260  1.00 81.22 ? 1    DT  T "C3'" 1 
ATOM   7381 O  "O3'" . DT  B 2 1   ? -0.242  5.362   41.419  1.00 77.87 ? 1    DT  T "O3'" 1 
ATOM   7382 C  "C2'" . DT  B 2 1   ? 1.371   6.924   40.528  1.00 81.87 ? 1    DT  T "C2'" 1 
ATOM   7383 C  "C1'" . DT  B 2 1   ? 2.427   5.820   40.436  1.00 82.30 ? 1    DT  T "C1'" 1 
ATOM   7384 N  N1    . DT  B 2 1   ? 3.795   6.293   40.045  1.00 82.27 ? 1    DT  T N1    1 
ATOM   7385 C  C2    . DT  B 2 1   ? 4.864   6.117   40.908  1.00 81.05 ? 1    DT  T C2    1 
ATOM   7386 O  O2    . DT  B 2 1   ? 4.778   5.591   42.004  1.00 79.77 ? 1    DT  T O2    1 
ATOM   7387 N  N3    . DT  B 2 1   ? 6.065   6.591   40.431  1.00 81.01 ? 1    DT  T N3    1 
ATOM   7388 C  C4    . DT  B 2 1   ? 6.306   7.204   39.208  1.00 81.29 ? 1    DT  T C4    1 
ATOM   7389 O  O4    . DT  B 2 1   ? 7.430   7.585   38.887  1.00 77.72 ? 1    DT  T O4    1 
ATOM   7390 C  C5    . DT  B 2 1   ? 5.142   7.355   38.353  1.00 82.20 ? 1    DT  T C5    1 
ATOM   7391 C  C7    . DT  B 2 1   ? 5.236   7.995   36.998  1.00 81.27 ? 1    DT  T C7    1 
ATOM   7392 C  C6    . DT  B 2 1   ? 3.966   6.899   38.808  1.00 82.81 ? 1    DT  T C6    1 
ATOM   7393 P  P     . DC  B 2 2   ? -1.710  5.352   42.053  1.00 74.16 ? 2    DC  T P     1 
ATOM   7394 O  OP1   . DC  B 2 2   ? -2.342  6.675   41.849  1.00 75.57 ? 2    DC  T OP1   1 
ATOM   7395 O  OP2   . DC  B 2 2   ? -1.558  4.805   43.421  1.00 76.91 ? 2    DC  T OP2   1 
ATOM   7396 O  "O5'" . DC  B 2 2   ? -2.498  4.296   41.141  1.00 72.11 ? 2    DC  T "O5'" 1 
ATOM   7397 C  "C5'" . DC  B 2 2   ? -1.992  2.977   40.916  1.00 66.96 ? 2    DC  T "C5'" 1 
ATOM   7398 C  "C4'" . DC  B 2 2   ? -2.975  2.169   40.084  1.00 65.86 ? 2    DC  T "C4'" 1 
ATOM   7399 O  "O4'" . DC  B 2 2   ? -4.316  2.256   40.639  1.00 65.67 ? 2    DC  T "O4'" 1 
ATOM   7400 C  "C3'" . DC  B 2 2   ? -3.103  2.583   38.622  1.00 63.88 ? 2    DC  T "C3'" 1 
ATOM   7401 O  "O3'" . DC  B 2 2   ? -3.201  1.394   37.837  1.00 63.10 ? 2    DC  T "O3'" 1 
ATOM   7402 C  "C2'" . DC  B 2 2   ? -4.382  3.422   38.575  1.00 63.79 ? 2    DC  T "C2'" 1 
ATOM   7403 C  "C1'" . DC  B 2 2   ? -5.220  2.807   39.697  1.00 63.92 ? 2    DC  T "C1'" 1 
ATOM   7404 N  N1    . DC  B 2 2   ? -6.157  3.736   40.433  1.00 63.06 ? 2    DC  T N1    1 
ATOM   7405 C  C2    . DC  B 2 2   ? -7.517  3.386   40.533  1.00 63.59 ? 2    DC  T C2    1 
ATOM   7406 O  O2    . DC  B 2 2   ? -7.918  2.335   40.008  1.00 62.38 ? 2    DC  T O2    1 
ATOM   7407 N  N3    . DC  B 2 2   ? -8.363  4.220   41.201  1.00 62.83 ? 2    DC  T N3    1 
ATOM   7408 C  C4    . DC  B 2 2   ? -7.903  5.348   41.759  1.00 61.66 ? 2    DC  T C4    1 
ATOM   7409 N  N4    . DC  B 2 2   ? -8.786  6.124   42.402  1.00 61.38 ? 2    DC  T N4    1 
ATOM   7410 C  C5    . DC  B 2 2   ? -6.524  5.723   41.674  1.00 59.61 ? 2    DC  T C5    1 
ATOM   7411 C  C6    . DC  B 2 2   ? -5.699  4.897   41.013  1.00 61.11 ? 2    DC  T C6    1 
ATOM   7412 P  P     . DG  B 2 3   ? -2.760  1.375   36.299  1.00 59.79 ? 3    DG  T P     1 
ATOM   7413 O  OP1   . DG  B 2 3   ? -2.416  -0.025  35.945  1.00 61.49 ? 3    DG  T OP1   1 
ATOM   7414 O  OP2   . DG  B 2 3   ? -1.793  2.479   36.069  1.00 59.77 ? 3    DG  T OP2   1 
ATOM   7415 O  "O5'" . DG  B 2 3   ? -4.115  1.791   35.561  1.00 59.54 ? 3    DG  T "O5'" 1 
ATOM   7416 C  "C5'" . DG  B 2 3   ? -5.351  1.063   35.688  1.00 54.36 ? 3    DG  T "C5'" 1 
ATOM   7417 C  "C4'" . DG  B 2 3   ? -6.440  1.868   34.994  1.00 53.76 ? 3    DG  T "C4'" 1 
ATOM   7418 O  "O4'" . DG  B 2 3   ? -6.770  3.017   35.827  1.00 51.95 ? 3    DG  T "O4'" 1 
ATOM   7419 C  "C3'" . DG  B 2 3   ? -6.034  2.415   33.609  1.00 47.55 ? 3    DG  T "C3'" 1 
ATOM   7420 O  "O3'" . DG  B 2 3   ? -7.077  2.342   32.643  1.00 38.50 ? 3    DG  T "O3'" 1 
ATOM   7421 C  "C2'" . DG  B 2 3   ? -5.701  3.880   33.878  1.00 48.54 ? 3    DG  T "C2'" 1 
ATOM   7422 C  "C1'" . DG  B 2 3   ? -6.602  4.206   35.071  1.00 51.24 ? 3    DG  T "C1'" 1 
ATOM   7423 N  N9    . DG  B 2 3   ? -6.086  5.308   35.892  1.00 51.59 ? 3    DG  T N9    1 
ATOM   7424 C  C8    . DG  B 2 3   ? -4.855  5.917   35.764  1.00 52.22 ? 3    DG  T C8    1 
ATOM   7425 N  N7    . DG  B 2 3   ? -4.651  6.886   36.609  1.00 53.16 ? 3    DG  T N7    1 
ATOM   7426 C  C5    . DG  B 2 3   ? -5.826  6.929   37.350  1.00 51.77 ? 3    DG  T C5    1 
ATOM   7427 C  C6    . DG  B 2 3   ? -6.183  7.781   38.421  1.00 51.23 ? 3    DG  T C6    1 
ATOM   7428 O  O6    . DG  B 2 3   ? -5.500  8.683   38.921  1.00 52.92 ? 3    DG  T O6    1 
ATOM   7429 N  N1    . DG  B 2 3   ? -7.464  7.513   38.912  1.00 49.71 ? 3    DG  T N1    1 
ATOM   7430 C  C2    . DG  B 2 3   ? -8.294  6.525   38.432  1.00 46.87 ? 3    DG  T C2    1 
ATOM   7431 N  N2    . DG  B 2 3   ? -9.485  6.411   39.036  1.00 40.53 ? 3    DG  T N2    1 
ATOM   7432 N  N3    . DG  B 2 3   ? -7.969  5.708   37.428  1.00 47.50 ? 3    DG  T N3    1 
ATOM   7433 C  C4    . DG  B 2 3   ? -6.725  5.968   36.928  1.00 51.06 ? 3    DG  T C4    1 
ATOM   7434 P  P     . DA  B 2 4   ? -7.472  0.993   31.897  1.00 29.41 ? 4    DA  T P     1 
ATOM   7435 O  OP1   . DA  B 2 4   ? -8.943  1.006   31.760  1.00 33.53 ? 4    DA  T OP1   1 
ATOM   7436 O  OP2   . DA  B 2 4   ? -6.822  -0.159  32.571  1.00 30.55 ? 4    DA  T OP2   1 
ATOM   7437 O  "O5'" . DA  B 2 4   ? -6.831  1.195   30.447  1.00 31.08 ? 4    DA  T "O5'" 1 
ATOM   7438 C  "C5'" . DA  B 2 4   ? -5.425  0.991   30.198  1.00 27.82 ? 4    DA  T "C5'" 1 
ATOM   7439 C  "C4'" . DA  B 2 4   ? -5.290  0.463   28.779  1.00 28.56 ? 4    DA  T "C4'" 1 
ATOM   7440 O  "O4'" . DA  B 2 4   ? -5.902  1.419   27.890  1.00 27.96 ? 4    DA  T "O4'" 1 
ATOM   7441 C  "C3'" . DA  B 2 4   ? -3.888  0.269   28.230  1.00 25.12 ? 4    DA  T "C3'" 1 
ATOM   7442 O  "O3'" . DA  B 2 4   ? -3.376  -1.009  28.623  1.00 25.53 ? 4    DA  T "O3'" 1 
ATOM   7443 C  "C2'" . DA  B 2 4   ? -4.186  0.328   26.746  1.00 27.48 ? 4    DA  T "C2'" 1 
ATOM   7444 C  "C1'" . DA  B 2 4   ? -5.148  1.502   26.702  1.00 26.46 ? 4    DA  T "C1'" 1 
ATOM   7445 N  N9    . DA  B 2 4   ? -4.440  2.779   26.662  1.00 24.35 ? 4    DA  T N9    1 
ATOM   7446 C  C8    . DA  B 2 4   ? -4.384  3.745   27.632  1.00 20.74 ? 4    DA  T C8    1 
ATOM   7447 N  N7    . DA  B 2 4   ? -3.643  4.772   27.281  1.00 25.98 ? 4    DA  T N7    1 
ATOM   7448 C  C5    . DA  B 2 4   ? -3.179  4.465   26.006  1.00 26.23 ? 4    DA  T C5    1 
ATOM   7449 C  C6    . DA  B 2 4   ? -2.345  5.143   25.077  1.00 27.32 ? 4    DA  T C6    1 
ATOM   7450 N  N6    . DA  B 2 4   ? -1.795  6.348   25.306  1.00 26.13 ? 4    DA  T N6    1 
ATOM   7451 N  N1    . DA  B 2 4   ? -2.090  4.534   23.893  1.00 25.41 ? 4    DA  T N1    1 
ATOM   7452 C  C2    . DA  B 2 4   ? -2.634  3.332   23.658  1.00 26.18 ? 4    DA  T C2    1 
ATOM   7453 N  N3    . DA  B 2 4   ? -3.432  2.611   24.448  1.00 19.88 ? 4    DA  T N3    1 
ATOM   7454 C  C4    . DA  B 2 4   ? -3.661  3.229   25.615  1.00 23.16 ? 4    DA  T C4    1 
ATOM   7455 P  P     . DG  B 2 5   ? -1.806  -1.185  28.910  1.00 27.07 ? 5    DG  T P     1 
ATOM   7456 O  OP1   . DG  B 2 5   ? -1.662  -2.500  29.583  1.00 27.80 ? 5    DG  T OP1   1 
ATOM   7457 O  OP2   . DG  B 2 5   ? -1.248  0.059   29.489  1.00 28.73 ? 5    DG  T OP2   1 
ATOM   7458 O  "O5'" . DG  B 2 5   ? -1.162  -1.298  27.458  1.00 22.61 ? 5    DG  T "O5'" 1 
ATOM   7459 C  "C5'" . DG  B 2 5   ? -1.539  -2.318  26.530  1.00 23.42 ? 5    DG  T "C5'" 1 
ATOM   7460 C  "C4'" . DG  B 2 5   ? -0.997  -1.963  25.160  1.00 23.09 ? 5    DG  T "C4'" 1 
ATOM   7461 O  "O4'" . DG  B 2 5   ? -1.453  -0.636  24.777  1.00 22.74 ? 5    DG  T "O4'" 1 
ATOM   7462 C  "C3'" . DG  B 2 5   ? 0.514   -1.840  25.081  1.00 24.97 ? 5    DG  T "C3'" 1 
ATOM   7463 O  "O3'" . DG  B 2 5   ? 1.121   -3.136  24.997  1.00 26.95 ? 5    DG  T "O3'" 1 
ATOM   7464 C  "C2'" . DG  B 2 5   ? 0.673   -1.024  23.804  1.00 25.54 ? 5    DG  T "C2'" 1 
ATOM   7465 C  "C1'" . DG  B 2 5   ? -0.498  -0.052  23.906  1.00 24.17 ? 5    DG  T "C1'" 1 
ATOM   7466 N  N9    . DG  B 2 5   ? -0.098  1.232   24.449  1.00 22.86 ? 5    DG  T N9    1 
ATOM   7467 C  C8    . DG  B 2 5   ? -0.351  1.680   25.722  1.00 24.43 ? 5    DG  T C8    1 
ATOM   7468 N  N7    . DG  B 2 5   ? 0.115   2.872   25.951  1.00 24.24 ? 5    DG  T N7    1 
ATOM   7469 C  C5    . DG  B 2 5   ? 0.709   3.243   24.760  1.00 25.05 ? 5    DG  T C5    1 
ATOM   7470 C  C6    . DG  B 2 5   ? 1.382   4.441   24.416  1.00 24.90 ? 5    DG  T C6    1 
ATOM   7471 O  O6    . DG  B 2 5   ? 1.577   5.416   25.136  1.00 24.78 ? 5    DG  T O6    1 
ATOM   7472 N  N1    . DG  B 2 5   ? 1.854   4.437   23.105  1.00 25.10 ? 5    DG  T N1    1 
ATOM   7473 C  C2    . DG  B 2 5   ? 1.678   3.376   22.235  1.00 23.78 ? 5    DG  T C2    1 
ATOM   7474 N  N2    . DG  B 2 5   ? 2.189   3.508   21.006  1.00 22.77 ? 5    DG  T N2    1 
ATOM   7475 N  N3    . DG  B 2 5   ? 1.054   2.249   22.553  1.00 21.41 ? 5    DG  T N3    1 
ATOM   7476 C  C4    . DG  B 2 5   ? 0.597   2.240   23.823  1.00 21.73 ? 5    DG  T C4    1 
ATOM   7477 P  P     . DT  B 2 6   ? 2.688   -3.314  25.260  1.00 26.50 ? 6    DT  T P     1 
ATOM   7478 O  OP1   . DT  B 2 6   ? 2.965   -4.772  25.270  1.00 31.83 ? 6    DT  T OP1   1 
ATOM   7479 O  OP2   . DT  B 2 6   ? 3.138   -2.449  26.361  1.00 30.07 ? 6    DT  T OP2   1 
ATOM   7480 O  "O5'" . DT  B 2 6   ? 3.370   -2.673  23.965  1.00 25.82 ? 6    DT  T "O5'" 1 
ATOM   7481 C  "C5'" . DT  B 2 6   ? 3.127   -3.178  22.646  1.00 21.94 ? 6    DT  T "C5'" 1 
ATOM   7482 C  "C4'" . DT  B 2 6   ? 4.064   -2.482  21.663  1.00 22.86 ? 6    DT  T "C4'" 1 
ATOM   7483 O  "O4'" . DT  B 2 6   ? 3.888   -1.045  21.767  1.00 25.99 ? 6    DT  T "O4'" 1 
ATOM   7484 C  "C3'" . DT  B 2 6   ? 5.562   -2.717  21.864  1.00 24.59 ? 6    DT  T "C3'" 1 
ATOM   7485 O  "O3'" . DT  B 2 6   ? 6.196   -2.743  20.580  1.00 25.52 ? 6    DT  T "O3'" 1 
ATOM   7486 C  "C2'" . DT  B 2 6   ? 5.989   -1.501  22.686  1.00 25.78 ? 6    DT  T "C2'" 1 
ATOM   7487 C  "C1'" . DT  B 2 6   ? 5.098   -0.411  22.102  1.00 20.85 ? 6    DT  T "C1'" 1 
ATOM   7488 N  N1    . DT  B 2 6   ? 4.855   0.716   23.060  1.00 27.34 ? 6    DT  T N1    1 
ATOM   7489 C  C2    . DT  B 2 6   ? 5.291   1.986   22.705  1.00 24.00 ? 6    DT  T C2    1 
ATOM   7490 O  O2    . DT  B 2 6   ? 5.847   2.241   21.651  1.00 27.63 ? 6    DT  T O2    1 
ATOM   7491 N  N3    . DT  B 2 6   ? 5.040   2.960   23.632  1.00 25.63 ? 6    DT  T N3    1 
ATOM   7492 C  C4    . DT  B 2 6   ? 4.424   2.803   24.866  1.00 25.98 ? 6    DT  T C4    1 
ATOM   7493 O  O4    . DT  B 2 6   ? 4.267   3.754   25.622  1.00 22.82 ? 6    DT  T O4    1 
ATOM   7494 C  C5    . DT  B 2 6   ? 3.991   1.459   25.187  1.00 22.17 ? 6    DT  T C5    1 
ATOM   7495 C  C7    . DT  B 2 6   ? 3.313   1.170   26.497  1.00 24.90 ? 6    DT  T C7    1 
ATOM   7496 C  C6    . DT  B 2 6   ? 4.222   0.491   24.280  1.00 26.88 ? 6    DT  T C6    1 
ATOM   7497 P  P     . DA  B 2 7   ? 7.773   -2.882  20.368  1.00 27.43 ? 7    DA  T P     1 
ATOM   7498 O  OP1   . DA  B 2 7   ? 7.964   -3.522  19.052  1.00 25.93 ? 7    DA  T OP1   1 
ATOM   7499 O  OP2   . DA  B 2 7   ? 8.378   -3.453  21.581  1.00 28.14 ? 7    DA  T OP2   1 
ATOM   7500 O  "O5'" . DA  B 2 7   ? 8.309   -1.388  20.220  1.00 29.29 ? 7    DA  T "O5'" 1 
ATOM   7501 C  "C5'" . DA  B 2 7   ? 7.956   -0.640  19.073  1.00 24.16 ? 7    DA  T "C5'" 1 
ATOM   7502 C  "C4'" . DA  B 2 7   ? 8.877   0.551   18.902  1.00 24.51 ? 7    DA  T "C4'" 1 
ATOM   7503 O  "O4'" . DA  B 2 7   ? 8.538   1.583   19.870  1.00 22.70 ? 7    DA  T "O4'" 1 
ATOM   7504 C  "C3'" . DA  B 2 7   ? 10.352  0.258   19.084  1.00 20.52 ? 7    DA  T "C3'" 1 
ATOM   7505 O  "O3'" . DA  B 2 7   ? 11.034  1.051   18.134  1.00 23.95 ? 7    DA  T "O3'" 1 
ATOM   7506 C  "C2'" . DA  B 2 7   ? 10.624  0.687   20.533  1.00 24.73 ? 7    DA  T "C2'" 1 
ATOM   7507 C  "C1'" . DA  B 2 7   ? 9.647   1.859   20.714  1.00 21.83 ? 7    DA  T "C1'" 1 
ATOM   7508 N  N9    . DA  B 2 7   ? 9.113   2.045   22.064  1.00 19.78 ? 7    DA  T N9    1 
ATOM   7509 C  C8    . DA  B 2 7   ? 8.515   1.097   22.840  1.00 19.88 ? 7    DA  T C8    1 
ATOM   7510 N  N7    . DA  B 2 7   ? 8.118   1.551   24.008  1.00 21.65 ? 7    DA  T N7    1 
ATOM   7511 C  C5    . DA  B 2 7   ? 8.471   2.887   23.997  1.00 21.15 ? 7    DA  T C5    1 
ATOM   7512 C  C6    . DA  B 2 7   ? 8.327   3.926   24.947  1.00 21.12 ? 7    DA  T C6    1 
ATOM   7513 N  N6    . DA  B 2 7   ? 7.755   3.770   26.149  1.00 20.32 ? 7    DA  T N6    1 
ATOM   7514 N  N1    . DA  B 2 7   ? 8.813   5.146   24.633  1.00 21.41 ? 7    DA  T N1    1 
ATOM   7515 C  C2    . DA  B 2 7   ? 9.374   5.315   23.436  1.00 20.38 ? 7    DA  T C2    1 
ATOM   7516 N  N3    . DA  B 2 7   ? 9.561   4.421   22.467  1.00 21.86 ? 7    DA  T N3    1 
ATOM   7517 C  C4    . DA  B 2 7   ? 9.088   3.209   22.809  1.00 20.59 ? 7    DA  T C4    1 
ATOM   7518 P  P     . DA  B 2 8   ? 12.624  0.959   17.935  1.00 26.89 ? 8    DA  T P     1 
ATOM   7519 O  OP1   . DA  B 2 8   ? 12.913  1.407   16.553  1.00 25.08 ? 8    DA  T OP1   1 
ATOM   7520 O  OP2   . DA  B 2 8   ? 13.072  -0.381  18.390  1.00 27.97 ? 8    DA  T OP2   1 
ATOM   7521 O  "O5'" . DA  B 2 8   ? 13.145  2.034   18.981  1.00 27.04 ? 8    DA  T "O5'" 1 
ATOM   7522 C  "C5'" . DA  B 2 8   ? 12.909  3.424   18.777  1.00 28.34 ? 8    DA  T "C5'" 1 
ATOM   7523 C  "C4'" . DA  B 2 8   ? 13.479  4.171   19.967  1.00 29.07 ? 8    DA  T "C4'" 1 
ATOM   7524 O  "O4'" . DA  B 2 8   ? 12.588  3.986   21.096  1.00 27.96 ? 8    DA  T "O4'" 1 
ATOM   7525 C  "C3'" . DA  B 2 8   ? 14.861  3.679   20.416  1.00 29.34 ? 8    DA  T "C3'" 1 
ATOM   7526 O  "O3'" . DA  B 2 8   ? 15.733  4.783   20.471  1.00 31.12 ? 8    DA  T "O3'" 1 
ATOM   7527 C  "C2'" . DA  B 2 8   ? 14.628  3.108   21.811  1.00 26.27 ? 8    DA  T "C2'" 1 
ATOM   7528 C  "C1'" . DA  B 2 8   ? 13.426  3.956   22.232  1.00 30.14 ? 8    DA  T "C1'" 1 
ATOM   7529 N  N9    . DA  B 2 8   ? 12.748  3.490   23.445  1.00 29.01 ? 8    DA  T N9    1 
ATOM   7530 C  C8    . DA  B 2 8   ? 12.433  2.196   23.784  1.00 25.33 ? 8    DA  T C8    1 
ATOM   7531 N  N7    . DA  B 2 8   ? 11.854  2.092   24.954  1.00 28.69 ? 8    DA  T N7    1 
ATOM   7532 C  C5    . DA  B 2 8   ? 11.802  3.403   25.423  1.00 27.30 ? 8    DA  T C5    1 
ATOM   7533 C  C6    . DA  B 2 8   ? 11.298  3.973   26.610  1.00 28.41 ? 8    DA  T C6    1 
ATOM   7534 N  N6    . DA  B 2 8   ? 10.740  3.239   27.576  1.00 26.55 ? 8    DA  T N6    1 
ATOM   7535 N  N1    . DA  B 2 8   ? 11.381  5.321   26.765  1.00 27.86 ? 8    DA  T N1    1 
ATOM   7536 C  C2    . DA  B 2 8   ? 11.951  6.055   25.786  1.00 29.94 ? 8    DA  T C2    1 
ATOM   7537 N  N3    . DA  B 2 8   ? 12.455  5.622   24.621  1.00 26.99 ? 8    DA  T N3    1 
ATOM   7538 C  C4    . DA  B 2 8   ? 12.352  4.281   24.504  1.00 26.85 ? 8    DA  T C4    1 
ATOM   7539 P  P     . DG  B 2 9   ? 17.309  4.680   20.230  1.00 34.00 ? 9    DG  T P     1 
ATOM   7540 O  OP1   . DG  B 2 9   ? 17.620  4.741   18.778  1.00 30.11 ? 9    DG  T OP1   1 
ATOM   7541 O  OP2   . DG  B 2 9   ? 17.869  3.581   21.047  1.00 36.73 ? 9    DG  T OP2   1 
ATOM   7542 O  "O5'" . DG  B 2 9   ? 17.770  6.056   20.883  1.00 30.92 ? 9    DG  T "O5'" 1 
ATOM   7543 C  "C5'" . DG  B 2 9   ? 17.109  7.278   20.547  1.00 33.32 ? 9    DG  T "C5'" 1 
ATOM   7544 C  "C4'" . DG  B 2 9   ? 17.037  8.135   21.791  1.00 33.74 ? 9    DG  T "C4'" 1 
ATOM   7545 O  "O4'" . DG  B 2 9   ? 16.017  7.577   22.657  1.00 34.94 ? 9    DG  T "O4'" 1 
ATOM   7546 C  "C3'" . DG  B 2 9   ? 18.329  8.073   22.590  1.00 34.25 ? 9    DG  T "C3'" 1 
ATOM   7547 O  "O3'" . DG  B 2 9   ? 19.058  9.263   22.429  1.00 37.07 ? 9    DG  T "O3'" 1 
ATOM   7548 C  "C2'" . DG  B 2 9   ? 17.912  7.865   24.041  1.00 34.45 ? 9    DG  T "C2'" 1 
ATOM   7549 C  "C1'" . DG  B 2 9   ? 16.407  7.732   24.007  1.00 32.49 ? 9    DG  T "C1'" 1 
ATOM   7550 N  N9    . DG  B 2 9   ? 15.967  6.572   24.776  1.00 30.52 ? 9    DG  T N9    1 
ATOM   7551 C  C8    . DG  B 2 9   ? 15.886  5.270   24.341  1.00 26.57 ? 9    DG  T C8    1 
ATOM   7552 N  N7    . DG  B 2 9   ? 15.453  4.441   25.252  1.00 30.41 ? 9    DG  T N7    1 
ATOM   7553 C  C5    . DG  B 2 9   ? 15.256  5.249   26.369  1.00 28.99 ? 9    DG  T C5    1 
ATOM   7554 C  C6    . DG  B 2 9   ? 14.795  4.920   27.662  1.00 27.93 ? 9    DG  T C6    1 
ATOM   7555 O  O6    . DG  B 2 9   ? 14.459  3.812   28.089  1.00 28.84 ? 9    DG  T O6    1 
ATOM   7556 N  N1    . DG  B 2 9   ? 14.739  6.035   28.510  1.00 29.34 ? 9    DG  T N1    1 
ATOM   7557 C  C2    . DG  B 2 9   ? 15.080  7.322   28.138  1.00 31.33 ? 9    DG  T C2    1 
ATOM   7558 N  N2    . DG  B 2 9   ? 14.971  8.264   29.085  1.00 30.22 ? 9    DG  T N2    1 
ATOM   7559 N  N3    . DG  B 2 9   ? 15.514  7.651   26.923  1.00 30.57 ? 9    DG  T N3    1 
ATOM   7560 C  C4    . DG  B 2 9   ? 15.573  6.568   26.093  1.00 28.61 ? 9    DG  T C4    1 
ATOM   7561 P  P     . DC  B 2 10  ? 20.561  9.375   22.965  1.00 41.17 ? 10   DC  T P     1 
ATOM   7562 O  OP1   . DC  B 2 10  ? 21.172  10.563  22.312  1.00 41.74 ? 10   DC  T OP1   1 
ATOM   7563 O  OP2   . DC  B 2 10  ? 21.220  8.051   22.877  1.00 40.11 ? 10   DC  T OP2   1 
ATOM   7564 O  "O5'" . DC  B 2 10  ? 20.336  9.644   24.526  1.00 40.57 ? 10   DC  T "O5'" 1 
ATOM   7565 C  "C5'" . DC  B 2 10  ? 19.817  10.891  24.981  1.00 39.48 ? 10   DC  T "C5'" 1 
ATOM   7566 C  "C4'" . DC  B 2 10  ? 19.961  10.937  26.489  1.00 37.54 ? 10   DC  T "C4'" 1 
ATOM   7567 O  "O4'" . DC  B 2 10  ? 19.144  9.897   27.087  1.00 33.03 ? 10   DC  T "O4'" 1 
ATOM   7568 C  "C3'" . DC  B 2 10  ? 21.384  10.719  26.998  1.00 38.39 ? 10   DC  T "C3'" 1 
ATOM   7569 O  "O3'" . DC  B 2 10  ? 21.621  11.691  28.009  1.00 41.43 ? 10   DC  T "O3'" 1 
ATOM   7570 C  "C2'" . DC  B 2 10  ? 21.404  9.283   27.533  1.00 32.76 ? 10   DC  T "C2'" 1 
ATOM   7571 C  "C1'" . DC  B 2 10  ? 19.948  9.107   27.946  1.00 33.00 ? 10   DC  T "C1'" 1 
ATOM   7572 N  N1    . DC  B 2 10  ? 19.446  7.705   27.922  1.00 32.23 ? 10   DC  T N1    1 
ATOM   7573 C  C2    . DC  B 2 10  ? 18.667  7.285   29.006  1.00 32.07 ? 10   DC  T C2    1 
ATOM   7574 O  O2    . DC  B 2 10  ? 18.439  8.080   29.916  1.00 34.03 ? 10   DC  T O2    1 
ATOM   7575 N  N3    . DC  B 2 10  ? 18.187  6.018   29.032  1.00 32.71 ? 10   DC  T N3    1 
ATOM   7576 C  C4    . DC  B 2 10  ? 18.458  5.182   28.025  1.00 30.90 ? 10   DC  T C4    1 
ATOM   7577 N  N4    . DC  B 2 10  ? 17.951  3.949   28.121  1.00 26.22 ? 10   DC  T N4    1 
ATOM   7578 C  C5    . DC  B 2 10  ? 19.250  5.583   26.901  1.00 30.07 ? 10   DC  T C5    1 
ATOM   7579 C  C6    . DC  B 2 10  ? 19.715  6.846   26.890  1.00 29.61 ? 10   DC  T C6    1 
ATOM   7580 P  P     . DA  B 2 11  ? 22.988  11.798  28.836  1.00 37.19 ? 11   DA  T P     1 
ATOM   7581 O  OP1   . DA  B 2 11  ? 23.281  13.245  28.915  1.00 37.31 ? 11   DA  T OP1   1 
ATOM   7582 O  OP2   . DA  B 2 11  ? 23.992  10.852  28.298  1.00 39.97 ? 11   DA  T OP2   1 
ATOM   7583 O  "O5'" . DA  B 2 11  ? 22.576  11.254  30.277  1.00 37.28 ? 11   DA  T "O5'" 1 
ATOM   7584 C  "C5'" . DA  B 2 11  ? 21.540  11.880  31.053  1.00 37.01 ? 11   DA  T "C5'" 1 
ATOM   7585 C  "C4'" . DA  B 2 11  ? 21.576  11.379  32.488  1.00 38.06 ? 11   DA  T "C4'" 1 
ATOM   7586 O  "O4'" . DA  B 2 11  ? 20.929  10.088  32.601  1.00 38.02 ? 11   DA  T "O4'" 1 
ATOM   7587 C  "C3'" . DA  B 2 11  ? 22.972  11.181  33.069  1.00 41.52 ? 11   DA  T "C3'" 1 
ATOM   7588 O  "O3'" . DA  B 2 11  ? 22.956  11.657  34.409  1.00 45.44 ? 11   DA  T "O3'" 1 
ATOM   7589 C  "C2'" . DA  B 2 11  ? 23.228  9.678   32.977  1.00 39.27 ? 11   DA  T "C2'" 1 
ATOM   7590 C  "C1'" . DA  B 2 11  ? 21.823  9.093   33.071  1.00 39.91 ? 11   DA  T "C1'" 1 
ATOM   7591 N  N9    . DA  B 2 11  ? 21.576  7.904   32.246  1.00 39.93 ? 11   DA  T N9    1 
ATOM   7592 C  C8    . DA  B 2 11  ? 21.841  7.751   30.911  1.00 36.48 ? 11   DA  T C8    1 
ATOM   7593 N  N7    . DA  B 2 11  ? 21.495  6.576   30.437  1.00 40.28 ? 11   DA  T N7    1 
ATOM   7594 C  C5    . DA  B 2 11  ? 20.957  5.910   31.532  1.00 38.37 ? 11   DA  T C5    1 
ATOM   7595 C  C6    . DA  B 2 11  ? 20.399  4.615   31.699  1.00 35.40 ? 11   DA  T C6    1 
ATOM   7596 N  N6    . DA  B 2 11  ? 20.293  3.725   30.710  1.00 30.05 ? 11   DA  T N6    1 
ATOM   7597 N  N1    . DA  B 2 11  ? 19.958  4.261   32.925  1.00 35.08 ? 11   DA  T N1    1 
ATOM   7598 C  C2    . DA  B 2 11  ? 20.072  5.146   33.927  1.00 38.99 ? 11   DA  T C2    1 
ATOM   7599 N  N3    . DA  B 2 11  ? 20.571  6.389   33.892  1.00 43.21 ? 11   DA  T N3    1 
ATOM   7600 C  C4    . DA  B 2 11  ? 20.999  6.717   32.655  1.00 40.03 ? 11   DA  T C4    1 
ATOM   7601 P  P     . DG  B 2 12  ? 24.304  11.733  35.259  1.00 43.07 ? 12   DG  T P     1 
ATOM   7602 O  OP1   . DG  B 2 12  ? 24.058  12.692  36.365  1.00 45.79 ? 12   DG  T OP1   1 
ATOM   7603 O  OP2   . DG  B 2 12  ? 25.459  11.871  34.349  1.00 43.28 ? 12   DG  T OP2   1 
ATOM   7604 O  "O5'" . DG  B 2 12  ? 24.367  10.259  35.861  1.00 42.91 ? 12   DG  T "O5'" 1 
ATOM   7605 C  "C5'" . DG  B 2 12  ? 23.426  9.932   36.853  1.00 34.37 ? 12   DG  T "C5'" 1 
ATOM   7606 C  "C4'" . DG  B 2 12  ? 23.524  8.471   37.197  1.00 32.70 ? 12   DG  T "C4'" 1 
ATOM   7607 O  "O4'" . DG  B 2 12  ? 23.079  7.701   36.060  1.00 33.23 ? 12   DG  T "O4'" 1 
ATOM   7608 C  "C3'" . DG  B 2 12  ? 24.934  8.001   37.534  1.00 34.73 ? 12   DG  T "C3'" 1 
ATOM   7609 O  "O3'" . DG  B 2 12  ? 24.956  7.586   38.882  1.00 30.93 ? 12   DG  T "O3'" 1 
ATOM   7610 C  "C2'" . DG  B 2 12  ? 25.163  6.843   36.568  1.00 32.79 ? 12   DG  T "C2'" 1 
ATOM   7611 C  "C1'" . DG  B 2 12  ? 23.757  6.472   36.120  1.00 34.56 ? 12   DG  T "C1'" 1 
ATOM   7612 N  N9    . DG  B 2 12  ? 23.751  5.832   34.807  1.00 34.54 ? 12   DG  T N9    1 
ATOM   7613 C  C8    . DG  B 2 12  ? 24.145  6.369   33.600  1.00 34.28 ? 12   DG  T C8    1 
ATOM   7614 N  N7    . DG  B 2 12  ? 24.047  5.541   32.592  1.00 34.24 ? 12   DG  T N7    1 
ATOM   7615 C  C5    . DG  B 2 12  ? 23.566  4.380   33.176  1.00 35.12 ? 12   DG  T C5    1 
ATOM   7616 C  C6    . DG  B 2 12  ? 23.254  3.144   32.593  1.00 32.41 ? 12   DG  T C6    1 
ATOM   7617 O  O6    . DG  B 2 12  ? 23.357  2.825   31.406  1.00 34.41 ? 12   DG  T O6    1 
ATOM   7618 N  N1    . DG  B 2 12  ? 22.792  2.228   33.533  1.00 36.36 ? 12   DG  T N1    1 
ATOM   7619 C  C2    . DG  B 2 12  ? 22.645  2.475   34.873  1.00 35.81 ? 12   DG  T C2    1 
ATOM   7620 N  N2    . DG  B 2 12  ? 22.180  1.470   35.625  1.00 33.78 ? 12   DG  T N2    1 
ATOM   7621 N  N3    . DG  B 2 12  ? 22.931  3.635   35.437  1.00 35.58 ? 12   DG  T N3    1 
ATOM   7622 C  C4    . DG  B 2 12  ? 23.384  4.537   34.534  1.00 36.39 ? 12   DG  T C4    1 
ATOM   7623 P  P     . DT  B 2 13  ? 26.259  7.018   39.605  1.00 35.11 ? 13   DT  T P     1 
ATOM   7624 O  OP1   . DT  B 2 13  ? 26.164  7.413   41.031  1.00 36.89 ? 13   DT  T OP1   1 
ATOM   7625 O  OP2   . DT  B 2 13  ? 27.472  7.343   38.823  1.00 36.18 ? 13   DT  T OP2   1 
ATOM   7626 O  "O5'" . DT  B 2 13  ? 26.041  5.446   39.521  1.00 32.58 ? 13   DT  T "O5'" 1 
ATOM   7627 C  "C5'" . DT  B 2 13  ? 24.948  4.848   40.208  1.00 33.17 ? 13   DT  T "C5'" 1 
ATOM   7628 C  "C4'" . DT  B 2 13  ? 25.106  3.342   40.192  1.00 34.31 ? 13   DT  T "C4'" 1 
ATOM   7629 O  "O4'" . DT  B 2 13  ? 24.917  2.849   38.846  1.00 35.72 ? 13   DT  T "O4'" 1 
ATOM   7630 C  "C3'" . DT  B 2 13  ? 26.473  2.828   40.633  1.00 35.83 ? 13   DT  T "C3'" 1 
ATOM   7631 O  "O3'" . DT  B 2 13  ? 26.232  1.697   41.442  1.00 39.36 ? 13   DT  T "O3'" 1 
ATOM   7632 C  "C2'" . DT  B 2 13  ? 27.191  2.466   39.331  1.00 35.34 ? 13   DT  T "C2'" 1 
ATOM   7633 C  "C1'" . DT  B 2 13  ? 26.008  2.020   38.479  1.00 34.60 ? 13   DT  T "C1'" 1 
ATOM   7634 N  N1    . DT  B 2 13  ? 26.134  2.153   36.998  1.00 32.96 ? 13   DT  T N1    1 
ATOM   7635 C  C2    . DT  B 2 13  ? 25.722  1.094   36.217  1.00 33.03 ? 13   DT  T C2    1 
ATOM   7636 O  O2    . DT  B 2 13  ? 25.277  0.045   36.661  1.00 34.61 ? 13   DT  T O2    1 
ATOM   7637 N  N3    . DT  B 2 13  ? 25.842  1.308   34.867  1.00 34.24 ? 13   DT  T N3    1 
ATOM   7638 C  C4    . DT  B 2 13  ? 26.315  2.435   34.229  1.00 32.43 ? 13   DT  T C4    1 
ATOM   7639 O  O4    . DT  B 2 13  ? 26.362  2.481   33.010  1.00 38.00 ? 13   DT  T O4    1 
ATOM   7640 C  C5    . DT  B 2 13  ? 26.738  3.514   35.098  1.00 35.50 ? 13   DT  T C5    1 
ATOM   7641 C  C7    . DT  B 2 13  ? 27.276  4.796   34.527  1.00 36.47 ? 13   DT  T C7    1 
ATOM   7642 C  C6    . DT  B 2 13  ? 26.621  3.326   36.428  1.00 36.21 ? 13   DT  T C6    1 
ATOM   7643 P  P     . DC  B 2 14  ? 27.350  1.094   42.403  1.00 38.24 ? 14   DC  T P     1 
ATOM   7644 O  OP1   . DC  B 2 14  ? 26.644  0.575   43.599  1.00 37.49 ? 14   DC  T OP1   1 
ATOM   7645 O  OP2   . DC  B 2 14  ? 28.458  2.060   42.539  1.00 38.90 ? 14   DC  T OP2   1 
ATOM   7646 O  "O5'" . DC  B 2 14  ? 27.909  -0.126  41.533  1.00 40.69 ? 14   DC  T "O5'" 1 
ATOM   7647 C  "C5'" . DC  B 2 14  ? 27.086  -1.241  41.195  1.00 40.80 ? 14   DC  T "C5'" 1 
ATOM   7648 C  "C4'" . DC  B 2 14  ? 27.785  -2.111  40.160  1.00 43.50 ? 14   DC  T "C4'" 1 
ATOM   7649 O  "O4'" . DC  B 2 14  ? 27.795  -1.453  38.873  1.00 44.45 ? 14   DC  T "O4'" 1 
ATOM   7650 C  "C3'" . DC  B 2 14  ? 29.253  -2.429  40.434  1.00 45.46 ? 14   DC  T "C3'" 1 
ATOM   7651 O  "O3'" . DC  B 2 14  ? 29.367  -3.836  40.369  1.00 47.62 ? 14   DC  T "O3'" 1 
ATOM   7652 C  "C2'" . DC  B 2 14  ? 30.030  -1.731  39.312  1.00 42.36 ? 14   DC  T "C2'" 1 
ATOM   7653 C  "C1'" . DC  B 2 14  ? 28.995  -1.780  38.196  1.00 42.68 ? 14   DC  T "C1'" 1 
ATOM   7654 N  N1    . DC  B 2 14  ? 29.143  -0.798  37.068  1.00 41.22 ? 14   DC  T N1    1 
ATOM   7655 C  C2    . DC  B 2 14  ? 28.861  -1.171  35.737  1.00 40.98 ? 14   DC  T C2    1 
ATOM   7656 O  O2    . DC  B 2 14  ? 28.503  -2.323  35.456  1.00 43.82 ? 14   DC  T O2    1 
ATOM   7657 N  N3    . DC  B 2 14  ? 28.990  -0.240  34.757  1.00 41.46 ? 14   DC  T N3    1 
ATOM   7658 C  C4    . DC  B 2 14  ? 29.363  1.006   35.056  1.00 38.98 ? 14   DC  T C4    1 
ATOM   7659 N  N4    . DC  B 2 14  ? 29.480  1.875   34.052  1.00 38.77 ? 14   DC  T N4    1 
ATOM   7660 C  C5    . DC  B 2 14  ? 29.648  1.412   36.396  1.00 40.68 ? 14   DC  T C5    1 
ATOM   7661 C  C6    . DC  B 2 14  ? 29.525  0.489   37.355  1.00 39.70 ? 14   DC  T C6    1 
ATOM   7662 P  P     . DC  B 2 15  ? 30.692  -4.603  40.818  1.00 52.30 ? 15   DC  T P     1 
ATOM   7663 O  OP1   . DC  B 2 15  ? 30.248  -5.949  41.268  1.00 50.51 ? 15   DC  T OP1   1 
ATOM   7664 O  OP2   . DC  B 2 15  ? 31.513  -3.730  41.691  1.00 47.96 ? 15   DC  T OP2   1 
ATOM   7665 O  "O5'" . DC  B 2 15  ? 31.452  -4.758  39.427  1.00 50.33 ? 15   DC  T "O5'" 1 
ATOM   7666 C  "C5'" . DC  B 2 15  ? 30.951  -5.641  38.420  1.00 49.40 ? 15   DC  T "C5'" 1 
ATOM   7667 C  "C4'" . DC  B 2 15  ? 31.803  -5.467  37.186  1.00 50.20 ? 15   DC  T "C4'" 1 
ATOM   7668 O  "O4'" . DC  B 2 15  ? 31.540  -4.162  36.609  1.00 49.00 ? 15   DC  T "O4'" 1 
ATOM   7669 C  "C3'" . DC  B 2 15  ? 33.310  -5.512  37.451  1.00 51.92 ? 15   DC  T "C3'" 1 
ATOM   7670 O  "O3'" . DC  B 2 15  ? 33.858  -6.467  36.576  1.00 54.25 ? 15   DC  T "O3'" 1 
ATOM   7671 C  "C2'" . DC  B 2 15  ? 33.792  -4.099  37.117  1.00 48.98 ? 15   DC  T "C2'" 1 
ATOM   7672 C  "C1'" . DC  B 2 15  ? 32.754  -3.712  36.063  1.00 48.04 ? 15   DC  T "C1'" 1 
ATOM   7673 N  N1    . DC  B 2 15  ? 32.690  -2.252  35.710  1.00 45.56 ? 15   DC  T N1    1 
ATOM   7674 C  C2    . DC  B 2 15  ? 32.365  -1.857  34.393  1.00 43.38 ? 15   DC  T C2    1 
ATOM   7675 O  O2    . DC  B 2 15  ? 32.114  -2.704  33.523  1.00 44.85 ? 15   DC  T O2    1 
ATOM   7676 N  N3    . DC  B 2 15  ? 32.336  -0.533  34.097  1.00 44.00 ? 15   DC  T N3    1 
ATOM   7677 C  C4    . DC  B 2 15  ? 32.615  0.370   35.042  1.00 43.33 ? 15   DC  T C4    1 
ATOM   7678 N  N4    . DC  B 2 15  ? 32.563  1.658   34.704  1.00 44.33 ? 15   DC  T N4    1 
ATOM   7679 C  C5    . DC  B 2 15  ? 32.947  -0.005  36.383  1.00 45.63 ? 15   DC  T C5    1 
ATOM   7680 C  C6    . DC  B 2 15  ? 32.974  -1.313  36.669  1.00 43.99 ? 15   DC  T C6    1 
ATOM   7681 P  P     . DG  B 2 16  ? 35.278  -7.164  36.828  1.00 54.75 ? 16   DG  T P     1 
ATOM   7682 O  OP1   . DG  B 2 16  ? 35.056  -8.390  37.638  1.00 53.94 ? 16   DG  T OP1   1 
ATOM   7683 O  OP2   . DG  B 2 16  ? 36.257  -6.140  37.269  1.00 50.47 ? 16   DG  T OP2   1 
ATOM   7684 O  "O5'" . DG  B 2 16  ? 35.609  -7.631  35.334  1.00 52.90 ? 16   DG  T "O5'" 1 
ATOM   7685 C  "C5'" . DG  B 2 16  ? 34.570  -8.179  34.507  1.00 50.30 ? 16   DG  T "C5'" 1 
ATOM   7686 C  "C4'" . DG  B 2 16  ? 34.630  -7.607  33.097  1.00 49.94 ? 16   DG  T "C4'" 1 
ATOM   7687 O  "O4'" . DG  B 2 16  ? 34.365  -6.180  33.070  1.00 47.00 ? 16   DG  T "O4'" 1 
ATOM   7688 C  "C3'" . DG  B 2 16  ? 35.980  -7.769  32.417  1.00 50.08 ? 16   DG  T "C3'" 1 
ATOM   7689 O  "O3'" . DG  B 2 16  ? 35.750  -8.166  31.097  1.00 53.26 ? 16   DG  T "O3'" 1 
ATOM   7690 C  "C2'" . DG  B 2 16  ? 36.615  -6.387  32.460  1.00 47.12 ? 16   DG  T "C2'" 1 
ATOM   7691 C  "C1'" . DG  B 2 16  ? 35.372  -5.535  32.312  1.00 45.05 ? 16   DG  T "C1'" 1 
ATOM   7692 N  N9    . DG  B 2 16  ? 35.515  -4.182  32.826  1.00 44.60 ? 16   DG  T N9    1 
ATOM   7693 C  C8    . DG  B 2 16  ? 35.786  -3.800  34.122  1.00 43.46 ? 16   DG  T C8    1 
ATOM   7694 N  N7    . DG  B 2 16  ? 35.832  -2.502  34.277  1.00 42.12 ? 16   DG  T N7    1 
ATOM   7695 C  C5    . DG  B 2 16  ? 35.575  -2.002  33.005  1.00 38.83 ? 16   DG  T C5    1 
ATOM   7696 C  C6    . DG  B 2 16  ? 35.499  -0.668  32.554  1.00 39.03 ? 16   DG  T C6    1 
ATOM   7697 O  O6    . DG  B 2 16  ? 35.655  0.352   33.234  1.00 39.95 ? 16   DG  T O6    1 
ATOM   7698 N  N1    . DG  B 2 16  ? 35.215  -0.583  31.186  1.00 37.15 ? 16   DG  T N1    1 
ATOM   7699 C  C2    . DG  B 2 16  ? 35.039  -1.672  30.360  1.00 38.55 ? 16   DG  T C2    1 
ATOM   7700 N  N2    . DG  B 2 16  ? 34.775  -1.431  29.069  1.00 37.70 ? 16   DG  T N2    1 
ATOM   7701 N  N3    . DG  B 2 16  ? 35.108  -2.930  30.778  1.00 40.81 ? 16   DG  T N3    1 
ATOM   7702 C  C4    . DG  B 2 16  ? 35.377  -3.019  32.103  1.00 39.51 ? 16   DG  T C4    1 
ATOM   7703 P  P     . DC  B 2 17  ? 36.870  -9.014  30.354  1.00 53.35 ? 17   DC  T P     1 
ATOM   7704 O  OP1   . DC  B 2 17  ? 36.166  -9.977  29.477  1.00 52.60 ? 17   DC  T OP1   1 
ATOM   7705 O  OP2   . DC  B 2 17  ? 37.867  -9.470  31.347  1.00 55.73 ? 17   DC  T OP2   1 
ATOM   7706 O  "O5'" . DC  B 2 17  ? 37.624  -7.914  29.477  1.00 51.18 ? 17   DC  T "O5'" 1 
ATOM   7707 C  "C5'" . DC  B 2 17  ? 36.965  -7.153  28.480  1.00 47.14 ? 17   DC  T "C5'" 1 
ATOM   7708 C  "C4'" . DC  B 2 17  ? 37.878  -6.013  28.075  1.00 44.74 ? 17   DC  T "C4'" 1 
ATOM   7709 O  "O4'" . DC  B 2 17  ? 37.760  -4.948  29.048  1.00 45.23 ? 17   DC  T "O4'" 1 
ATOM   7710 C  "C3'" . DC  B 2 17  ? 39.368  -6.366  28.018  1.00 45.14 ? 17   DC  T "C3'" 1 
ATOM   7711 O  "O3'" . DC  B 2 17  ? 39.844  -6.076  26.722  1.00 40.61 ? 17   DC  T "O3'" 1 
ATOM   7712 C  "C2'" . DC  B 2 17  ? 40.023  -5.467  29.071  1.00 44.53 ? 17   DC  T "C2'" 1 
ATOM   7713 C  "C1'" . DC  B 2 17  ? 39.020  -4.325  29.146  1.00 44.51 ? 17   DC  T "C1'" 1 
ATOM   7714 N  N1    . DC  B 2 17  ? 39.032  -3.509  30.390  1.00 46.50 ? 17   DC  T N1    1 
ATOM   7715 C  C2    . DC  B 2 17  ? 38.699  -2.152  30.292  1.00 47.72 ? 17   DC  T C2    1 
ATOM   7716 O  O2    . DC  B 2 17  ? 38.411  -1.673  29.184  1.00 48.67 ? 17   DC  T O2    1 
ATOM   7717 N  N3    . DC  B 2 17  ? 38.704  -1.394  31.419  1.00 47.82 ? 17   DC  T N3    1 
ATOM   7718 C  C4    . DC  B 2 17  ? 39.015  -1.939  32.600  1.00 49.70 ? 17   DC  T C4    1 
ATOM   7719 N  N4    . DC  B 2 17  ? 38.997  -1.136  33.670  1.00 46.13 ? 17   DC  T N4    1 
ATOM   7720 C  C5    . DC  B 2 17  ? 39.356  -3.327  32.728  1.00 46.18 ? 17   DC  T C5    1 
ATOM   7721 C  C6    . DC  B 2 17  ? 39.347  -4.063  31.606  1.00 47.84 ? 17   DC  T C6    1 
ATOM   7722 P  P     . DG  B 2 18  ? 41.001  -6.899  26.012  1.00 42.02 ? 18   DG  T P     1 
ATOM   7723 O  OP1   . DG  B 2 18  ? 41.929  -5.927  25.386  1.00 41.56 ? 18   DG  T OP1   1 
ATOM   7724 O  OP2   . DG  B 2 18  ? 40.368  -7.946  25.188  1.00 46.27 ? 18   DG  T OP2   1 
ATOM   7725 O  "O5'" . DG  B 2 18  ? 41.708  -7.692  27.213  1.00 39.94 ? 18   DG  T "O5'" 1 
ATOM   7726 C  "C5'" . DG  B 2 18  ? 43.104  -7.818  27.327  1.00 28.66 ? 18   DG  T "C5'" 1 
ATOM   7727 C  "C4'" . DG  B 2 18  ? 43.490  -7.543  28.773  1.00 26.77 ? 18   DG  T "C4'" 1 
ATOM   7728 O  "O4'" . DG  B 2 18  ? 44.798  -8.109  29.033  1.00 28.97 ? 18   DG  T "O4'" 1 
ATOM   7729 C  "C3'" . DG  B 2 18  ? 43.616  -6.073  29.138  1.00 29.77 ? 18   DG  T "C3'" 1 
ATOM   7730 O  "O3'" . DG  B 2 18  ? 43.227  -5.877  30.514  1.00 29.89 ? 18   DG  T "O3'" 1 
ATOM   7731 C  "C2'" . DG  B 2 18  ? 45.100  -5.803  28.908  1.00 27.52 ? 18   DG  T "C2'" 1 
ATOM   7732 C  "C1'" . DG  B 2 18  ? 45.703  -7.107  29.425  1.00 25.92 ? 18   DG  T "C1'" 1 
ATOM   7733 N  N9    . DG  B 2 18  ? 46.996  -7.473  28.869  1.00 21.54 ? 18   DG  T N9    1 
ATOM   7734 C  C8    . DG  B 2 18  ? 48.119  -7.757  29.592  1.00 27.35 ? 18   DG  T C8    1 
ATOM   7735 N  N7    . DG  B 2 18  ? 49.153  -8.065  28.862  1.00 31.90 ? 18   DG  T N7    1 
ATOM   7736 C  C5    . DG  B 2 18  ? 48.681  -7.990  27.559  1.00 29.51 ? 18   DG  T C5    1 
ATOM   7737 C  C6    . DG  B 2 18  ? 49.358  -8.227  26.335  1.00 29.64 ? 18   DG  T C6    1 
ATOM   7738 O  O6    . DG  B 2 18  ? 50.533  -8.557  26.156  1.00 30.86 ? 18   DG  T O6    1 
ATOM   7739 N  N1    . DG  B 2 18  ? 48.524  -8.041  25.233  1.00 32.23 ? 18   DG  T N1    1 
ATOM   7740 C  C2    . DG  B 2 18  ? 47.193  -7.677  25.309  1.00 29.47 ? 18   DG  T C2    1 
ATOM   7741 N  N2    . DG  B 2 18  ? 46.566  -7.551  24.131  1.00 26.65 ? 18   DG  T N2    1 
ATOM   7742 N  N3    . DG  B 2 18  ? 46.540  -7.449  26.453  1.00 28.71 ? 18   DG  T N3    1 
ATOM   7743 C  C4    . DG  B 2 18  ? 47.345  -7.626  27.542  1.00 29.65 ? 18   DG  T C4    1 
ATOM   7744 O  "O5'" . DG  C 3 1   ? 40.174  7.858   31.084  1.00 65.43 ? 103  DG  P "O5'" 1 
ATOM   7745 C  "C5'" . DG  C 3 1   ? 39.142  8.721   30.560  1.00 69.90 ? 103  DG  P "C5'" 1 
ATOM   7746 C  "C4'" . DG  C 3 1   ? 38.573  8.244   29.220  1.00 68.18 ? 103  DG  P "C4'" 1 
ATOM   7747 O  "O4'" . DG  C 3 1   ? 38.735  6.808   29.037  1.00 65.83 ? 103  DG  P "O4'" 1 
ATOM   7748 C  "C3'" . DG  C 3 1   ? 37.082  8.462   29.003  1.00 68.01 ? 103  DG  P "C3'" 1 
ATOM   7749 O  "O3'" . DG  C 3 1   ? 36.815  8.470   27.591  1.00 72.58 ? 103  DG  P "O3'" 1 
ATOM   7750 C  "C2'" . DG  C 3 1   ? 36.496  7.233   29.694  1.00 64.54 ? 103  DG  P "C2'" 1 
ATOM   7751 C  "C1'" . DG  C 3 1   ? 37.524  6.146   29.368  1.00 60.83 ? 103  DG  P "C1'" 1 
ATOM   7752 N  N9    . DG  C 3 1   ? 37.802  5.258   30.492  1.00 55.50 ? 103  DG  P N9    1 
ATOM   7753 C  C8    . DG  C 3 1   ? 38.021  5.652   31.794  1.00 55.40 ? 103  DG  P C8    1 
ATOM   7754 N  N7    . DG  C 3 1   ? 38.255  4.665   32.608  1.00 53.97 ? 103  DG  P N7    1 
ATOM   7755 C  C5    . DG  C 3 1   ? 38.188  3.542   31.797  1.00 49.49 ? 103  DG  P C5    1 
ATOM   7756 C  C6    . DG  C 3 1   ? 38.356  2.182   32.144  1.00 46.41 ? 103  DG  P C6    1 
ATOM   7757 O  O6    . DG  C 3 1   ? 38.610  1.725   33.266  1.00 44.88 ? 103  DG  P O6    1 
ATOM   7758 N  N1    . DG  C 3 1   ? 38.209  1.337   31.039  1.00 44.54 ? 103  DG  P N1    1 
ATOM   7759 C  C2    . DG  C 3 1   ? 37.933  1.764   29.756  1.00 45.71 ? 103  DG  P C2    1 
ATOM   7760 N  N2    . DG  C 3 1   ? 37.817  0.802   28.822  1.00 44.41 ? 103  DG  P N2    1 
ATOM   7761 N  N3    . DG  C 3 1   ? 37.766  3.047   29.421  1.00 45.87 ? 103  DG  P N3    1 
ATOM   7762 C  C4    . DG  C 3 1   ? 37.911  3.882   30.487  1.00 50.22 ? 103  DG  P C4    1 
ATOM   7763 P  P     . DC  C 3 2   ? 35.336  8.403   26.955  1.00 74.95 ? 104  DC  P P     1 
ATOM   7764 O  OP1   . DC  C 3 2   ? 35.379  9.170   25.687  1.00 76.75 ? 104  DC  P OP1   1 
ATOM   7765 O  OP2   . DC  C 3 2   ? 34.331  8.739   27.993  1.00 74.15 ? 104  DC  P OP2   1 
ATOM   7766 O  "O5'" . DC  C 3 2   ? 35.158  6.854   26.620  1.00 72.09 ? 104  DC  P "O5'" 1 
ATOM   7767 C  "C5'" . DC  C 3 2   ? 35.534  6.301   25.360  1.00 70.30 ? 104  DC  P "C5'" 1 
ATOM   7768 C  "C4'" . DC  C 3 2   ? 35.007  4.877   25.262  1.00 67.25 ? 104  DC  P "C4'" 1 
ATOM   7769 O  "O4'" . DC  C 3 2   ? 35.363  4.139   26.457  1.00 62.14 ? 104  DC  P "O4'" 1 
ATOM   7770 C  "C3'" . DC  C 3 2   ? 33.492  4.751   25.177  1.00 67.34 ? 104  DC  P "C3'" 1 
ATOM   7771 O  "O3'" . DC  C 3 2   ? 33.176  3.608   24.428  1.00 71.37 ? 104  DC  P "O3'" 1 
ATOM   7772 C  "C2'" . DC  C 3 2   ? 33.071  4.537   26.626  1.00 63.29 ? 104  DC  P "C2'" 1 
ATOM   7773 C  "C1'" . DC  C 3 2   ? 34.191  3.588   27.031  1.00 59.04 ? 104  DC  P "C1'" 1 
ATOM   7774 N  N1    . DC  C 3 2   ? 34.423  3.396   28.494  1.00 50.51 ? 104  DC  P N1    1 
ATOM   7775 C  C2    . DC  C 3 2   ? 34.714  2.107   28.959  1.00 45.80 ? 104  DC  P C2    1 
ATOM   7776 O  O2    . DC  C 3 2   ? 34.767  1.164   28.154  1.00 46.63 ? 104  DC  P O2    1 
ATOM   7777 N  N3    . DC  C 3 2   ? 34.934  1.934   30.291  1.00 41.29 ? 104  DC  P N3    1 
ATOM   7778 C  C4    . DC  C 3 2   ? 34.879  2.975   31.128  1.00 40.15 ? 104  DC  P C4    1 
ATOM   7779 N  N4    . DC  C 3 2   ? 35.109  2.744   32.421  1.00 31.96 ? 104  DC  P N4    1 
ATOM   7780 C  C5    . DC  C 3 2   ? 34.580  4.300   30.675  1.00 43.39 ? 104  DC  P C5    1 
ATOM   7781 C  C6    . DC  C 3 2   ? 34.366  4.457   29.361  1.00 47.49 ? 104  DC  P C6    1 
ATOM   7782 P  P     . DG  C 3 3   ? 32.140  3.773   23.233  1.00 75.38 ? 105  DG  P P     1 
ATOM   7783 O  OP1   . DG  C 3 3   ? 32.947  4.208   22.069  1.00 76.03 ? 105  DG  P OP1   1 
ATOM   7784 O  OP2   . DG  C 3 3   ? 31.017  4.609   23.723  1.00 71.72 ? 105  DG  P OP2   1 
ATOM   7785 O  "O5'" . DG  C 3 3   ? 31.566  2.297   22.965  1.00 71.87 ? 105  DG  P "O5'" 1 
ATOM   7786 C  "C5'" . DG  C 3 3   ? 32.268  1.099   23.313  1.00 70.22 ? 105  DG  P "C5'" 1 
ATOM   7787 C  "C4'" . DG  C 3 3   ? 31.380  0.189   24.145  1.00 69.22 ? 105  DG  P "C4'" 1 
ATOM   7788 O  "O4'" . DG  C 3 3   ? 31.836  0.305   25.512  1.00 65.42 ? 105  DG  P "O4'" 1 
ATOM   7789 C  "C3'" . DG  C 3 3   ? 29.900  0.592   24.171  1.00 69.78 ? 105  DG  P "C3'" 1 
ATOM   7790 O  "O3'" . DG  C 3 3   ? 29.028  -0.135  23.263  1.00 72.36 ? 105  DG  P "O3'" 1 
ATOM   7791 C  "C2'" . DG  C 3 3   ? 29.457  0.495   25.628  1.00 66.82 ? 105  DG  P "C2'" 1 
ATOM   7792 C  "C1'" . DG  C 3 3   ? 30.734  0.146   26.386  1.00 62.93 ? 105  DG  P "C1'" 1 
ATOM   7793 N  N9    . DG  C 3 3   ? 30.934  0.962   27.582  1.00 56.28 ? 105  DG  P N9    1 
ATOM   7794 C  C8    . DG  C 3 3   ? 30.816  2.324   27.705  1.00 56.74 ? 105  DG  P C8    1 
ATOM   7795 N  N7    . DG  C 3 3   ? 31.056  2.768   28.909  1.00 53.49 ? 105  DG  P N7    1 
ATOM   7796 C  C5    . DG  C 3 3   ? 31.350  1.614   29.629  1.00 51.56 ? 105  DG  P C5    1 
ATOM   7797 C  C6    . DG  C 3 3   ? 31.693  1.455   30.995  1.00 48.76 ? 105  DG  P C6    1 
ATOM   7798 O  O6    . DG  C 3 3   ? 31.804  2.343   31.856  1.00 45.17 ? 105  DG  P O6    1 
ATOM   7799 N  N1    . DG  C 3 3   ? 31.910  0.115   31.327  1.00 45.96 ? 105  DG  P N1    1 
ATOM   7800 C  C2    . DG  C 3 3   ? 31.810  -0.943  30.445  1.00 48.05 ? 105  DG  P C2    1 
ATOM   7801 N  N2    . DG  C 3 3   ? 32.056  -2.171  30.930  1.00 44.29 ? 105  DG  P N2    1 
ATOM   7802 N  N3    . DG  C 3 3   ? 31.496  -0.803  29.161  1.00 49.71 ? 105  DG  P N3    1 
ATOM   7803 C  C4    . DG  C 3 3   ? 31.278  0.497   28.827  1.00 52.47 ? 105  DG  P C4    1 
ATOM   7804 P  P     . DG  C 3 4   ? 28.740  -1.717  23.147  1.00 74.71 ? 106  DG  P P     1 
ATOM   7805 O  OP1   . DG  C 3 4   ? 29.727  -2.246  22.180  1.00 75.16 ? 106  DG  P OP1   1 
ATOM   7806 O  OP2   . DG  C 3 4   ? 27.300  -1.853  22.847  1.00 73.45 ? 106  DG  P OP2   1 
ATOM   7807 O  "O5'" . DG  C 3 4   ? 28.969  -2.417  24.572  1.00 70.69 ? 106  DG  P "O5'" 1 
ATOM   7808 C  "C5'" . DG  C 3 4   ? 29.226  -3.831  24.589  1.00 65.91 ? 106  DG  P "C5'" 1 
ATOM   7809 C  "C4'" . DG  C 3 4   ? 28.558  -4.589  25.732  1.00 61.11 ? 106  DG  P "C4'" 1 
ATOM   7810 O  "O4'" . DG  C 3 4   ? 28.794  -3.934  27.004  1.00 58.10 ? 106  DG  P "O4'" 1 
ATOM   7811 C  "C3'" . DG  C 3 4   ? 27.047  -4.796  25.663  1.00 61.18 ? 106  DG  P "C3'" 1 
ATOM   7812 O  "O3'" . DG  C 3 4   ? 26.805  -6.107  26.187  1.00 60.66 ? 106  DG  P "O3'" 1 
ATOM   7813 C  "C2'" . DG  C 3 4   ? 26.497  -3.676  26.553  1.00 58.05 ? 106  DG  P "C2'" 1 
ATOM   7814 C  "C1'" . DG  C 3 4   ? 27.568  -3.641  27.644  1.00 54.60 ? 106  DG  P "C1'" 1 
ATOM   7815 N  N9    . DG  C 3 4   ? 27.779  -2.370  28.333  1.00 49.15 ? 106  DG  P N9    1 
ATOM   7816 C  C8    . DG  C 3 4   ? 27.746  -1.100  27.807  1.00 45.63 ? 106  DG  P C8    1 
ATOM   7817 N  N7    . DG  C 3 4   ? 27.995  -0.163  28.685  1.00 45.90 ? 106  DG  P N7    1 
ATOM   7818 C  C5    . DG  C 3 4   ? 28.213  -0.863  29.870  1.00 44.52 ? 106  DG  P C5    1 
ATOM   7819 C  C6    . DG  C 3 4   ? 28.527  -0.393  31.172  1.00 43.16 ? 106  DG  P C6    1 
ATOM   7820 O  O6    . DG  C 3 4   ? 28.675  0.781   31.544  1.00 42.60 ? 106  DG  P O6    1 
ATOM   7821 N  N1    . DG  C 3 4   ? 28.657  -1.438  32.092  1.00 40.72 ? 106  DG  P N1    1 
ATOM   7822 C  C2    . DG  C 3 4   ? 28.512  -2.776  31.791  1.00 42.83 ? 106  DG  P C2    1 
ATOM   7823 N  N2    . DG  C 3 4   ? 28.679  -3.643  32.801  1.00 39.16 ? 106  DG  P N2    1 
ATOM   7824 N  N3    . DG  C 3 4   ? 28.218  -3.231  30.576  1.00 45.32 ? 106  DG  P N3    1 
ATOM   7825 C  C4    . DG  C 3 4   ? 28.086  -2.223  29.668  1.00 46.21 ? 106  DG  P C4    1 
ATOM   7826 P  P     . DA  C 3 5   ? 25.349  -6.754  26.340  1.00 60.67 ? 107  DA  P P     1 
ATOM   7827 O  OP1   . DA  C 3 5   ? 25.463  -8.183  25.957  1.00 59.48 ? 107  DA  P OP1   1 
ATOM   7828 O  OP2   . DA  C 3 5   ? 24.360  -5.866  25.680  1.00 59.89 ? 107  DA  P OP2   1 
ATOM   7829 O  "O5'" . DA  C 3 5   ? 25.094  -6.656  27.911  1.00 58.12 ? 107  DA  P "O5'" 1 
ATOM   7830 C  "C5'" . DA  C 3 5   ? 25.640  -7.616  28.813  1.00 55.11 ? 107  DA  P "C5'" 1 
ATOM   7831 C  "C4'" . DA  C 3 5   ? 25.072  -7.370  30.198  1.00 51.79 ? 107  DA  P "C4'" 1 
ATOM   7832 O  "O4'" . DA  C 3 5   ? 25.460  -6.049  30.662  1.00 46.78 ? 107  DA  P "O4'" 1 
ATOM   7833 C  "C3'" . DA  C 3 5   ? 23.550  -7.419  30.268  1.00 50.69 ? 107  DA  P "C3'" 1 
ATOM   7834 O  "O3'" . DA  C 3 5   ? 23.186  -8.216  31.384  1.00 53.96 ? 107  DA  P "O3'" 1 
ATOM   7835 C  "C2'" . DA  C 3 5   ? 23.123  -5.958  30.428  1.00 46.83 ? 107  DA  P "C2'" 1 
ATOM   7836 C  "C1'" . DA  C 3 5   ? 24.328  -5.356  31.145  1.00 44.39 ? 107  DA  P "C1'" 1 
ATOM   7837 N  N9    . DA  C 3 5   ? 24.568  -3.943  30.873  1.00 42.60 ? 107  DA  P N9    1 
ATOM   7838 C  C8    . DA  C 3 5   ? 24.538  -3.310  29.658  1.00 42.06 ? 107  DA  P C8    1 
ATOM   7839 N  N7    . DA  C 3 5   ? 24.808  -2.024  29.723  1.00 42.06 ? 107  DA  P N7    1 
ATOM   7840 C  C5    . DA  C 3 5   ? 25.042  -1.807  31.068  1.00 38.06 ? 107  DA  P C5    1 
ATOM   7841 C  C6    . DA  C 3 5   ? 25.378  -0.652  31.795  1.00 37.96 ? 107  DA  P C6    1 
ATOM   7842 N  N6    . DA  C 3 5   ? 25.544  0.549   31.226  1.00 37.62 ? 107  DA  P N6    1 
ATOM   7843 N  N1    . DA  C 3 5   ? 25.539  -0.778  33.134  1.00 38.04 ? 107  DA  P N1    1 
ATOM   7844 C  C2    . DA  C 3 5   ? 25.366  -1.978  33.712  1.00 38.57 ? 107  DA  P C2    1 
ATOM   7845 N  N3    . DA  C 3 5   ? 25.047  -3.134  33.125  1.00 38.93 ? 107  DA  P N3    1 
ATOM   7846 C  C4    . DA  C 3 5   ? 24.901  -2.978  31.795  1.00 40.37 ? 107  DA  P C4    1 
ATOM   7847 P  P     . DC  C 3 6   ? 21.659  -8.587  31.655  1.00 55.74 ? 108  DC  P P     1 
ATOM   7848 O  OP1   . DC  C 3 6   ? 21.656  -9.781  32.525  1.00 56.86 ? 108  DC  P OP1   1 
ATOM   7849 O  OP2   . DC  C 3 6   ? 20.930  -8.595  30.365  1.00 55.06 ? 108  DC  P OP2   1 
ATOM   7850 O  "O5'" . DC  C 3 6   ? 21.108  -7.319  32.473  1.00 56.13 ? 108  DC  P "O5'" 1 
ATOM   7851 C  "C5'" . DC  C 3 6   ? 21.467  -7.110  33.831  1.00 53.54 ? 108  DC  P "C5'" 1 
ATOM   7852 C  "C4'" . DC  C 3 6   ? 21.164  -5.690  34.281  1.00 51.23 ? 108  DC  P "C4'" 1 
ATOM   7853 O  "O4'" . DC  C 3 6   ? 21.918  -4.726  33.510  1.00 49.42 ? 108  DC  P "O4'" 1 
ATOM   7854 C  "C3'" . DC  C 3 6   ? 19.736  -5.184  34.127  1.00 50.50 ? 108  DC  P "C3'" 1 
ATOM   7855 O  "O3'" . DC  C 3 6   ? 18.946  -5.646  35.220  1.00 54.01 ? 108  DC  P "O3'" 1 
ATOM   7856 C  "C2'" . DC  C 3 6   ? 19.950  -3.673  34.229  1.00 48.85 ? 108  DC  P "C2'" 1 
ATOM   7857 C  "C1'" . DC  C 3 6   ? 21.427  -3.473  33.913  1.00 43.88 ? 108  DC  P "C1'" 1 
ATOM   7858 N  N1    . DC  C 3 6   ? 21.614  -2.460  32.854  1.00 41.37 ? 108  DC  P N1    1 
ATOM   7859 C  C2    . DC  C 3 6   ? 21.965  -1.163  33.257  1.00 39.45 ? 108  DC  P C2    1 
ATOM   7860 O  O2    . DC  C 3 6   ? 22.119  -0.929  34.462  1.00 34.08 ? 108  DC  P O2    1 
ATOM   7861 N  N3    . DC  C 3 6   ? 22.139  -0.204  32.310  1.00 39.54 ? 108  DC  P N3    1 
ATOM   7862 C  C4    . DC  C 3 6   ? 21.960  -0.501  31.022  1.00 38.43 ? 108  DC  P C4    1 
ATOM   7863 N  N4    . DC  C 3 6   ? 22.142  0.487   30.152  1.00 34.93 ? 108  DC  P N4    1 
ATOM   7864 C  C5    . DC  C 3 6   ? 21.592  -1.816  30.585  1.00 39.73 ? 108  DC  P C5    1 
ATOM   7865 C  C6    . DC  C 3 6   ? 21.430  -2.760  31.528  1.00 39.20 ? 108  DC  P C6    1 
ATOM   7866 P  P     . DT  C 3 7   ? 17.438  -5.154  35.497  1.00 55.33 ? 109  DT  P P     1 
ATOM   7867 O  OP1   . DT  C 3 7   ? 16.867  -6.124  36.460  1.00 55.36 ? 109  DT  P OP1   1 
ATOM   7868 O  OP2   . DT  C 3 7   ? 16.782  -4.889  34.193  1.00 51.95 ? 109  DT  P OP2   1 
ATOM   7869 O  "O5'" . DT  C 3 7   ? 17.569  -3.737  36.239  1.00 51.71 ? 109  DT  P "O5'" 1 
ATOM   7870 C  "C5'" . DT  C 3 7   ? 18.271  -3.559  37.470  1.00 45.38 ? 109  DT  P "C5'" 1 
ATOM   7871 C  "C4'" . DT  C 3 7   ? 18.131  -2.111  37.919  1.00 43.36 ? 109  DT  P "C4'" 1 
ATOM   7872 O  "O4'" . DT  C 3 7   ? 18.805  -1.206  37.004  1.00 39.49 ? 109  DT  P "O4'" 1 
ATOM   7873 C  "C3'" . DT  C 3 7   ? 16.692  -1.612  37.986  1.00 42.38 ? 109  DT  P "C3'" 1 
ATOM   7874 O  "O3'" . DT  C 3 7   ? 16.598  -0.813  39.139  1.00 41.76 ? 109  DT  P "O3'" 1 
ATOM   7875 C  "C2'" . DT  C 3 7   ? 16.502  -0.798  36.705  1.00 39.41 ? 109  DT  P "C2'" 1 
ATOM   7876 C  "C1'" . DT  C 3 7   ? 17.900  -0.232  36.514  1.00 36.95 ? 109  DT  P "C1'" 1 
ATOM   7877 N  N1    . DT  C 3 7   ? 18.245  0.128   35.087  1.00 37.86 ? 109  DT  P N1    1 
ATOM   7878 C  C2    . DT  C 3 7   ? 18.774  1.389   34.805  1.00 34.43 ? 109  DT  P C2    1 
ATOM   7879 O  O2    . DT  C 3 7   ? 18.990  2.249   35.640  1.00 34.58 ? 109  DT  P O2    1 
ATOM   7880 N  N3    . DT  C 3 7   ? 19.052  1.620   33.483  1.00 31.72 ? 109  DT  P N3    1 
ATOM   7881 C  C4    . DT  C 3 7   ? 18.861  0.736   32.434  1.00 31.21 ? 109  DT  P C4    1 
ATOM   7882 O  O4    . DT  C 3 7   ? 19.148  1.063   31.290  1.00 32.08 ? 109  DT  P O4    1 
ATOM   7883 C  C5    . DT  C 3 7   ? 18.297  -0.567  32.780  1.00 31.74 ? 109  DT  P C5    1 
ATOM   7884 C  C7    . DT  C 3 7   ? 18.035  -1.620  31.734  1.00 26.53 ? 109  DT  P C7    1 
ATOM   7885 C  C6    . DT  C 3 7   ? 18.022  -0.802  34.074  1.00 30.52 ? 109  DT  P C6    1 
ATOM   7886 P  P     . DG  C 3 8   ? 15.203  -0.201  39.589  1.00 41.83 ? 110  DG  P P     1 
ATOM   7887 O  OP1   . DG  C 3 8   ? 15.308  -0.077  41.062  1.00 40.12 ? 110  DG  P OP1   1 
ATOM   7888 O  OP2   . DG  C 3 8   ? 14.082  -0.934  38.950  1.00 39.73 ? 110  DG  P OP2   1 
ATOM   7889 O  "O5'" . DG  C 3 8   ? 15.190  1.248   38.928  1.00 39.85 ? 110  DG  P "O5'" 1 
ATOM   7890 C  "C5'" . DG  C 3 8   ? 16.220  2.174   39.221  1.00 36.20 ? 110  DG  P "C5'" 1 
ATOM   7891 C  "C4'" . DG  C 3 8   ? 15.895  3.484   38.538  1.00 34.21 ? 110  DG  P "C4'" 1 
ATOM   7892 O  "O4'" . DG  C 3 8   ? 16.327  3.421   37.162  1.00 34.36 ? 110  DG  P "O4'" 1 
ATOM   7893 C  "C3'" . DG  C 3 8   ? 14.416  3.860   38.509  1.00 34.91 ? 110  DG  P "C3'" 1 
ATOM   7894 O  "O3'" . DG  C 3 8   ? 14.291  5.126   39.151  1.00 32.27 ? 110  DG  P "O3'" 1 
ATOM   7895 C  "C2'" . DG  C 3 8   ? 14.032  3.893   37.025  1.00 34.46 ? 110  DG  P "C2'" 1 
ATOM   7896 C  "C1'" . DG  C 3 8   ? 15.391  4.104   36.361  1.00 34.13 ? 110  DG  P "C1'" 1 
ATOM   7897 N  N9    . DG  C 3 8   ? 15.542  3.585   35.004  1.00 33.22 ? 110  DG  P N9    1 
ATOM   7898 C  C8    . DG  C 3 8   ? 15.208  2.337   34.532  1.00 31.56 ? 110  DG  P C8    1 
ATOM   7899 N  N7    . DG  C 3 8   ? 15.492  2.171   33.268  1.00 31.33 ? 110  DG  P N7    1 
ATOM   7900 C  C5    . DG  C 3 8   ? 16.058  3.381   32.873  1.00 32.96 ? 110  DG  P C5    1 
ATOM   7901 C  C6    . DG  C 3 8   ? 16.556  3.817   31.615  1.00 32.59 ? 110  DG  P C6    1 
ATOM   7902 O  O6    . DG  C 3 8   ? 16.609  3.221   30.536  1.00 32.47 ? 110  DG  P O6    1 
ATOM   7903 N  N1    . DG  C 3 8   ? 17.033  5.124   31.661  1.00 36.33 ? 110  DG  P N1    1 
ATOM   7904 C  C2    . DG  C 3 8   ? 17.029  5.915   32.788  1.00 35.51 ? 110  DG  P C2    1 
ATOM   7905 N  N2    . DG  C 3 8   ? 17.533  7.146   32.644  1.00 33.85 ? 110  DG  P N2    1 
ATOM   7906 N  N3    . DG  C 3 8   ? 16.566  5.526   33.967  1.00 31.71 ? 110  DG  P N3    1 
ATOM   7907 C  C4    . DG  C 3 8   ? 16.094  4.258   33.938  1.00 32.56 ? 110  DG  P C4    1 
ATOM   7908 P  P     . DC  C 3 9   ? 12.868  5.793   39.384  1.00 32.69 ? 111  DC  P P     1 
ATOM   7909 O  OP1   . DC  C 3 9   ? 12.966  6.589   40.635  1.00 33.24 ? 111  DC  P OP1   1 
ATOM   7910 O  OP2   . DC  C 3 9   ? 11.822  4.766   39.217  1.00 30.27 ? 111  DC  P OP2   1 
ATOM   7911 O  "O5'" . DC  C 3 9   ? 12.728  6.778   38.120  1.00 32.97 ? 111  DC  P "O5'" 1 
ATOM   7912 C  "C5'" . DC  C 3 9   ? 13.737  7.728   37.813  1.00 30.43 ? 111  DC  P "C5'" 1 
ATOM   7913 C  "C4'" . DC  C 3 9   ? 13.583  8.270   36.404  1.00 32.77 ? 111  DC  P "C4'" 1 
ATOM   7914 O  "O4'" . DC  C 3 9   ? 13.893  7.253   35.428  1.00 34.89 ? 111  DC  P "O4'" 1 
ATOM   7915 C  "C3'" . DC  C 3 9   ? 12.181  8.749   36.058  1.00 30.91 ? 111  DC  P "C3'" 1 
ATOM   7916 O  "O3'" . DC  C 3 9   ? 12.201  10.154  35.945  1.00 32.43 ? 111  DC  P "O3'" 1 
ATOM   7917 C  "C2'" . DC  C 3 9   ? 11.861  8.102   34.722  1.00 29.20 ? 111  DC  P "C2'" 1 
ATOM   7918 C  "C1'" . DC  C 3 9   ? 13.223  7.624   34.250  1.00 30.39 ? 111  DC  P "C1'" 1 
ATOM   7919 N  N1    . DC  C 3 9   ? 13.184  6.465   33.307  1.00 30.51 ? 111  DC  P N1    1 
ATOM   7920 C  C2    . DC  C 3 9   ? 13.727  6.617   32.018  1.00 32.20 ? 111  DC  P C2    1 
ATOM   7921 O  O2    . DC  C 3 9   ? 14.225  7.694   31.680  1.00 33.25 ? 111  DC  P O2    1 
ATOM   7922 N  N3    . DC  C 3 9   ? 13.701  5.566   31.161  1.00 31.41 ? 111  DC  P N3    1 
ATOM   7923 C  C4    . DC  C 3 9   ? 13.169  4.413   31.541  1.00 27.78 ? 111  DC  P C4    1 
ATOM   7924 N  N4    . DC  C 3 9   ? 13.173  3.431   30.635  1.00 30.71 ? 111  DC  P N4    1 
ATOM   7925 C  C5    . DC  C 3 9   ? 12.604  4.227   32.844  1.00 30.86 ? 111  DC  P C5    1 
ATOM   7926 C  C6    . DC  C 3 9   ? 12.630  5.268   33.688  1.00 27.59 ? 111  DC  P C6    1 
ATOM   7927 P  P     . DT  C 3 10  ? 10.833  10.951  35.684  1.00 32.53 ? 112  DT  P P     1 
ATOM   7928 O  OP1   . DT  C 3 10  ? 10.970  12.245  36.392  1.00 36.48 ? 112  DT  P OP1   1 
ATOM   7929 O  OP2   . DT  C 3 10  ? 9.666   10.084  35.928  1.00 31.55 ? 112  DT  P OP2   1 
ATOM   7930 O  "O5'" . DT  C 3 10  ? 10.858  11.144  34.096  1.00 30.07 ? 112  DT  P "O5'" 1 
ATOM   7931 C  "C5'" . DT  C 3 10  ? 11.975  11.756  33.459  1.00 30.63 ? 112  DT  P "C5'" 1 
ATOM   7932 C  "C4'" . DT  C 3 10  ? 11.834  11.595  31.958  1.00 32.66 ? 112  DT  P "C4'" 1 
ATOM   7933 O  "O4'" . DT  C 3 10  ? 12.055  10.200  31.609  1.00 31.98 ? 112  DT  P "O4'" 1 
ATOM   7934 C  "C3'" . DT  C 3 10  ? 10.448  11.972  31.427  1.00 31.81 ? 112  DT  P "C3'" 1 
ATOM   7935 O  "O3'" . DT  C 3 10  ? 10.490  13.160  30.662  1.00 31.62 ? 112  DT  P "O3'" 1 
ATOM   7936 C  "C2'" . DT  C 3 10  ? 10.026  10.775  30.586  1.00 31.23 ? 112  DT  P "C2'" 1 
ATOM   7937 C  "C1'" . DT  C 3 10  ? 11.296  9.949   30.447  1.00 28.33 ? 112  DT  P "C1'" 1 
ATOM   7938 N  N1    . DT  C 3 10  ? 10.948  8.513   30.343  1.00 27.99 ? 112  DT  P N1    1 
ATOM   7939 C  C2    . DT  C 3 10  ? 11.245  7.845   29.172  1.00 27.54 ? 112  DT  P C2    1 
ATOM   7940 O  O2    . DT  C 3 10  ? 11.808  8.373   28.223  1.00 28.74 ? 112  DT  P O2    1 
ATOM   7941 N  N3    . DT  C 3 10  ? 10.881  6.519   29.167  1.00 23.71 ? 112  DT  P N3    1 
ATOM   7942 C  C4    . DT  C 3 10  ? 10.244  5.818   30.179  1.00 29.46 ? 112  DT  P C4    1 
ATOM   7943 O  O4    . DT  C 3 10  ? 9.952   4.629   30.073  1.00 30.31 ? 112  DT  P O4    1 
ATOM   7944 C  C5    . DT  C 3 10  ? 9.949   6.576   31.375  1.00 33.88 ? 112  DT  P C5    1 
ATOM   7945 C  C7    . DT  C 3 10  ? 9.251   5.912   32.539  1.00 30.07 ? 112  DT  P C7    1 
ATOM   7946 C  C6    . DT  C 3 10  ? 10.309  7.876   31.398  1.00 28.37 ? 112  DT  P C6    1 
ATOM   7947 P  P     . DT  C 3 11  ? 9.159   13.860  30.136  1.00 32.49 ? 113  DT  P P     1 
ATOM   7948 O  OP1   . DT  C 3 11  ? 9.191   15.269  30.569  1.00 32.27 ? 113  DT  P OP1   1 
ATOM   7949 O  OP2   . DT  C 3 11  ? 7.993   13.036  30.511  1.00 33.89 ? 113  DT  P OP2   1 
ATOM   7950 O  "O5'" . DT  C 3 11  ? 9.233   13.743  28.535  1.00 37.17 ? 113  DT  P "O5'" 1 
ATOM   7951 C  "C5'" . DT  C 3 11  ? 10.412  13.853  27.776  1.00 38.43 ? 113  DT  P "C5'" 1 
ATOM   7952 C  "C4'" . DT  C 3 11  ? 10.366  12.973  26.535  1.00 36.04 ? 113  DT  P "C4'" 1 
ATOM   7953 O  "O4'" . DT  C 3 11  ? 10.303  11.576  26.931  1.00 31.88 ? 113  DT  P "O4'" 1 
ATOM   7954 C  "C3'" . DT  C 3 11  ? 9.179   13.213  25.602  1.00 36.02 ? 113  DT  P "C3'" 1 
ATOM   7955 O  "O3'" . DT  C 3 11  ? 9.584   13.925  24.427  1.00 30.51 ? 113  DT  P "O3'" 1 
ATOM   7956 C  "C2'" . DT  C 3 11  ? 8.708   11.808  25.236  1.00 37.60 ? 113  DT  P "C2'" 1 
ATOM   7957 C  "C1'" . DT  C 3 11  ? 9.735   10.869  25.856  1.00 32.37 ? 113  DT  P "C1'" 1 
ATOM   7958 N  N1    . DT  C 3 11  ? 9.108   9.618   26.370  1.00 28.25 ? 113  DT  P N1    1 
ATOM   7959 C  C2    . DT  C 3 11  ? 9.273   8.446   25.647  1.00 28.68 ? 113  DT  P C2    1 
ATOM   7960 O  O2    . DT  C 3 11  ? 9.903   8.370   24.597  1.00 29.99 ? 113  DT  P O2    1 
ATOM   7961 N  N3    . DT  C 3 11  ? 8.662   7.348   26.197  1.00 24.60 ? 113  DT  P N3    1 
ATOM   7962 C  C4    . DT  C 3 11  ? 7.933   7.308   27.373  1.00 26.08 ? 113  DT  P C4    1 
ATOM   7963 O  O4    . DT  C 3 11  ? 7.441   6.257   27.754  1.00 28.13 ? 113  DT  P O4    1 
ATOM   7964 C  C5    . DT  C 3 11  ? 7.797   8.567   28.086  1.00 26.03 ? 113  DT  P C5    1 
ATOM   7965 C  C7    . DT  C 3 11  ? 7.021   8.670   29.376  1.00 23.05 ? 113  DT  P C7    1 
ATOM   7966 C  C6    . DT  C 3 11  ? 8.386   9.651   27.548  1.00 24.47 ? 113  DT  P C6    1 
ATOM   7967 P  P     . DA  C 3 12  ? 8.549   14.372  23.283  1.00 29.63 ? 114  DA  P P     1 
ATOM   7968 O  OP1   . DA  C 3 12  ? 9.151   15.538  22.565  1.00 24.69 ? 114  DA  P OP1   1 
ATOM   7969 O  OP2   . DA  C 3 12  ? 7.207   14.528  23.863  1.00 29.15 ? 114  DA  P OP2   1 
ATOM   7970 O  "O5'" . DA  C 3 12  ? 8.491   13.068  22.360  1.00 23.67 ? 114  DA  P "O5'" 1 
ATOM   7971 C  "C5'" . DA  C 3 12  ? 9.631   12.652  21.630  1.00 26.47 ? 114  DA  P "C5'" 1 
ATOM   7972 C  "C4'" . DA  C 3 12  ? 9.188   11.729  20.508  1.00 27.28 ? 114  DA  P "C4'" 1 
ATOM   7973 O  "O4'" . DA  C 3 12  ? 8.915   10.393  21.027  1.00 30.64 ? 114  DA  P "O4'" 1 
ATOM   7974 C  "C3'" . DA  C 3 12  ? 7.920   12.175  19.795  1.00 28.22 ? 114  DA  P "C3'" 1 
ATOM   7975 O  "O3'" . DA  C 3 12  ? 8.152   11.970  18.415  1.00 29.55 ? 114  DA  P "O3'" 1 
ATOM   7976 C  "C2'" . DA  C 3 12  ? 6.826   11.258  20.358  1.00 25.17 ? 114  DA  P "C2'" 1 
ATOM   7977 C  "C1'" . DA  C 3 12  ? 7.593   9.987   20.714  1.00 23.18 ? 114  DA  P "C1'" 1 
ATOM   7978 N  N9    . DA  C 3 12  ? 7.037   9.314   21.879  1.00 23.50 ? 114  DA  P N9    1 
ATOM   7979 C  C8    . DA  C 3 12  ? 6.656   9.942   23.035  1.00 25.58 ? 114  DA  P C8    1 
ATOM   7980 N  N7    . DA  C 3 12  ? 6.186   9.138   23.952  1.00 24.81 ? 114  DA  P N7    1 
ATOM   7981 C  C5    . DA  C 3 12  ? 6.241   7.894   23.358  1.00 20.87 ? 114  DA  P C5    1 
ATOM   7982 C  C6    . DA  C 3 12  ? 5.880   6.619   23.836  1.00 21.57 ? 114  DA  P C6    1 
ATOM   7983 N  N6    . DA  C 3 12  ? 5.369   6.430   25.060  1.00 24.11 ? 114  DA  P N6    1 
ATOM   7984 N  N1    . DA  C 3 12  ? 6.061   5.559   23.006  1.00 22.02 ? 114  DA  P N1    1 
ATOM   7985 C  C2    . DA  C 3 12  ? 6.577   5.772   21.783  1.00 17.86 ? 114  DA  P C2    1 
ATOM   7986 N  N3    . DA  C 3 12  ? 6.965   6.934   21.232  1.00 22.98 ? 114  DA  P N3    1 
ATOM   7987 C  C4    . DA  C 3 12  ? 6.768   7.972   22.077  1.00 20.91 ? 114  DA  P C4    1 
ATOM   7988 P  P     . DC  C 3 13  ? 7.193   12.472  17.235  1.00 28.35 ? 115  DC  P P     1 
ATOM   7989 O  OP1   . DC  C 3 13  ? 8.043   12.330  16.020  1.00 30.03 ? 115  DC  P OP1   1 
ATOM   7990 O  OP2   . DC  C 3 13  ? 6.571   13.768  17.578  1.00 28.36 ? 115  DC  P OP2   1 
ATOM   7991 O  "O5'" . DC  C 3 13  ? 6.036   11.363  17.188  1.00 25.04 ? 115  DC  P "O5'" 1 
ATOM   7992 C  "C5'" . DC  C 3 13  ? 6.364   10.032  16.786  1.00 23.65 ? 115  DC  P "C5'" 1 
ATOM   7993 C  "C4'" . DC  C 3 13  ? 5.309   9.001   17.144  1.00 23.82 ? 115  DC  P "C4'" 1 
ATOM   7994 O  "O4'" . DC  C 3 13  ? 5.300   8.755   18.576  1.00 25.47 ? 115  DC  P "O4'" 1 
ATOM   7995 C  "C3'" . DC  C 3 13  ? 3.864   9.372   16.866  1.00 20.45 ? 115  DC  P "C3'" 1 
ATOM   7996 O  "O3'" . DC  C 3 13  ? 3.494   9.026   15.550  1.00 24.53 ? 115  DC  P "O3'" 1 
ATOM   7997 C  "C2'" . DC  C 3 13  ? 3.091   8.470   17.828  1.00 25.23 ? 115  DC  P "C2'" 1 
ATOM   7998 C  "C1'" . DC  C 3 13  ? 4.151   7.966   18.800  1.00 22.27 ? 115  DC  P "C1'" 1 
ATOM   7999 N  N1    . DC  C 3 13  ? 3.718   8.044   20.224  1.00 23.37 ? 115  DC  P N1    1 
ATOM   8000 C  C2    . DC  C 3 13  ? 3.354   6.842   20.861  1.00 22.00 ? 115  DC  P C2    1 
ATOM   8001 O  O2    . DC  C 3 13  ? 3.400   5.768   20.235  1.00 24.84 ? 115  DC  P O2    1 
ATOM   8002 N  N3    . DC  C 3 13  ? 2.956   6.886   22.151  1.00 21.19 ? 115  DC  P N3    1 
ATOM   8003 C  C4    . DC  C 3 13  ? 2.901   8.061   22.802  1.00 25.64 ? 115  DC  P C4    1 
ATOM   8004 N  N4    . DC  C 3 13  ? 2.512   8.029   24.083  1.00 25.08 ? 115  DC  P N4    1 
ATOM   8005 C  C5    . DC  C 3 13  ? 3.263   9.300   22.176  1.00 23.86 ? 115  DC  P C5    1 
ATOM   8006 C  C6    . DC  C 3 13  ? 3.665   9.245   20.888  1.00 21.08 ? 115  DC  P C6    1 
HETATM 8007 N  N1    . UPC D 4 .   ? -0.290  6.055   19.427  1.00 23.24 ? 902  UPC A N1    1 
HETATM 8008 C  C2    . UPC D 4 .   ? -0.671  5.321   20.570  1.00 21.90 ? 902  UPC A C2    1 
HETATM 8009 O  O2    . UPC D 4 .   ? -1.040  4.017   20.448  1.00 25.66 ? 902  UPC A O2    1 
HETATM 8010 N  N3    . UPC D 4 .   ? -0.671  5.909   21.781  1.00 26.44 ? 902  UPC A N3    1 
HETATM 8011 C  C4    . UPC D 4 .   ? -0.316  7.208   21.907  1.00 28.52 ? 902  UPC A C4    1 
HETATM 8012 O  O4    . UPC D 4 .   ? -0.341  7.767   23.139  1.00 30.19 ? 902  UPC A O4    1 
HETATM 8013 C  C5    . UPC D 4 .   ? 0.068   7.964   20.796  1.00 24.04 ? 902  UPC A C5    1 
HETATM 8014 C  C6    . UPC D 4 .   ? 0.073   7.354   19.548  1.00 23.25 ? 902  UPC A C6    1 
HETATM 8015 P  PA    . UPC D 4 .   ? 0.051   10.409  16.154  1.00 30.49 ? 902  UPC A PA    1 
HETATM 8016 P  PB    . UPC D 4 .   ? -2.786  9.989   15.316  1.00 23.58 ? 902  UPC A PB    1 
HETATM 8017 P  PG    . UPC D 4 .   ? -3.258  12.543  14.175  1.00 26.10 ? 902  UPC A PG    1 
HETATM 8018 C  "C1'" . UPC D 4 .   ? -0.332  5.364   18.133  1.00 22.41 ? 902  UPC A "C1'" 1 
HETATM 8019 O  O1A   . UPC D 4 .   ? 0.922   11.094  17.157  1.00 33.60 ? 902  UPC A O1A   1 
HETATM 8020 O  O1B   . UPC D 4 .   ? -3.608  8.985   16.087  1.00 23.31 ? 902  UPC A O1B   1 
HETATM 8021 O  O1G   . UPC D 4 .   ? -1.888  12.275  13.599  1.00 27.98 ? 902  UPC A O1G   1 
HETATM 8022 C  "C2'" . UPC D 4 .   ? -1.787  5.462   17.659  1.00 23.39 ? 902  UPC A "C2'" 1 
HETATM 8023 O  O2A   . UPC D 4 .   ? 0.385   10.659  14.701  1.00 26.06 ? 902  UPC A O2A   1 
HETATM 8024 O  O2B   . UPC D 4 .   ? -2.140  9.478   14.060  1.00 24.92 ? 902  UPC A O2B   1 
HETATM 8025 O  O2G   . UPC D 4 .   ? -4.358  12.840  13.183  1.00 29.47 ? 902  UPC A O2G   1 
HETATM 8026 C  "C3'" . UPC D 4 .   ? -1.764  6.651   16.723  1.00 20.10 ? 902  UPC A "C3'" 1 
HETATM 8027 O  "O3'" . UPC D 4 .   ? -2.862  6.616   15.803  1.00 19.80 ? 902  UPC A "O3'" 1 
HETATM 8028 C  C3A   . UPC D 4 .   ? -1.625  10.730  16.372  1.00 26.78 ? 902  UPC A C3A   1 
HETATM 8029 O  O3B   . UPC D 4 .   ? -3.772  11.180  14.888  1.00 26.78 ? 902  UPC A O3B   1 
HETATM 8030 O  O3G   . UPC D 4 .   ? -3.234  13.911  15.379  1.00 31.41 ? 902  UPC A O3G   1 
HETATM 8031 C  "C4'" . UPC D 4 .   ? -0.390  6.505   16.083  1.00 23.80 ? 902  UPC A "C4'" 1 
HETATM 8032 O  "O4'" . UPC D 4 .   ? 0.457   6.004   17.130  1.00 26.36 ? 902  UPC A "O4'" 1 
HETATM 8033 C  "C5'" . UPC D 4 .   ? 0.196   7.798   15.528  1.00 20.92 ? 902  UPC A "C5'" 1 
HETATM 8034 O  "O5'" . UPC D 4 .   ? 0.155   8.825   16.505  1.00 26.74 ? 902  UPC A "O5'" 1 
HETATM 8035 MG MG    . MG  E 5 .   ? -0.962  10.611  12.875  1.00 26.65 ? 903  MG  A MG    1 
HETATM 8036 MG MG    . MG  F 5 .   ? 2.494   10.392  14.019  1.00 39.25 ? 904  MG  A MG    1 
HETATM 8037 MG MG    . MG  G 5 .   ? -4.238  47.315  13.909  1.00 92.56 ? 905  MG  A MG    1 
HETATM 8038 MG MG    . MG  H 5 .   ? -2.619  15.690  10.766  1.00 43.47 ? 906  MG  A MG    1 
HETATM 8039 MG MG    . MG  I 5 .   ? -4.689  24.750  50.739  1.00 55.77 ? 907  MG  A MG    1 
HETATM 8040 O  O     . HOH J 6 .   ? -10.562 11.103  41.098  1.00 18.99 ? 908  HOH A O     1 
HETATM 8041 O  O     . HOH J 6 .   ? -21.652 5.083   64.556  1.00 15.77 ? 909  HOH A O     1 
HETATM 8042 O  O     . HOH J 6 .   ? 5.164   26.840  37.652  1.00 25.38 ? 910  HOH A O     1 
HETATM 8043 O  O     . HOH J 6 .   ? -0.885  27.620  63.211  1.00 16.12 ? 911  HOH A O     1 
HETATM 8044 O  O     . HOH J 6 .   ? -15.271 22.211  32.285  1.00 20.56 ? 912  HOH A O     1 
HETATM 8045 O  O     . HOH J 6 .   ? 9.392   28.757  19.101  1.00 13.93 ? 913  HOH A O     1 
HETATM 8046 O  O     . HOH J 6 .   ? 31.683  24.705  41.034  1.00 15.17 ? 914  HOH A O     1 
HETATM 8047 O  O     . HOH J 6 .   ? -22.239 21.181  46.903  1.00 8.73  ? 915  HOH A O     1 
HETATM 8048 O  O     . HOH J 6 .   ? -17.271 23.307  41.066  1.00 32.05 ? 916  HOH A O     1 
HETATM 8049 O  O     . HOH J 6 .   ? -24.395 11.511  25.333  1.00 25.00 ? 917  HOH A O     1 
HETATM 8050 O  O     . HOH J 6 .   ? -4.121  51.751  51.980  1.00 21.17 ? 918  HOH A O     1 
HETATM 8051 O  O     . HOH J 6 .   ? -19.522 39.846  7.094   1.00 14.88 ? 919  HOH A O     1 
HETATM 8052 O  O     . HOH J 6 .   ? -19.923 4.429   12.524  1.00 14.89 ? 920  HOH A O     1 
HETATM 8053 O  O     . HOH J 6 .   ? 19.417  8.930   54.897  1.00 37.61 ? 921  HOH A O     1 
HETATM 8054 O  O     . HOH J 6 .   ? 14.827  23.375  37.478  1.00 18.87 ? 922  HOH A O     1 
HETATM 8055 O  O     . HOH J 6 .   ? -9.062  28.580  61.169  1.00 19.15 ? 923  HOH A O     1 
HETATM 8056 O  O     . HOH J 6 .   ? -10.188 7.185   11.863  1.00 16.81 ? 924  HOH A O     1 
HETATM 8057 O  O     . HOH J 6 .   ? -27.267 17.970  40.625  1.00 16.81 ? 925  HOH A O     1 
HETATM 8058 O  O     . HOH J 6 .   ? -21.139 1.418   54.419  1.00 20.48 ? 926  HOH A O     1 
HETATM 8059 O  O     . HOH J 6 .   ? -8.796  -15.933 1.104   1.00 17.83 ? 927  HOH A O     1 
HETATM 8060 O  O     . HOH J 6 .   ? 4.768   19.689  -11.650 1.00 39.73 ? 928  HOH A O     1 
HETATM 8061 O  O     . HOH J 6 .   ? -6.430  36.141  64.856  1.00 17.83 ? 929  HOH A O     1 
HETATM 8062 O  O     . HOH J 6 .   ? 21.442  23.301  6.713   1.00 18.89 ? 930  HOH A O     1 
HETATM 8063 O  O     . HOH J 6 .   ? -6.208  8.622   16.629  1.00 26.25 ? 931  HOH A O     1 
HETATM 8064 O  O     . HOH J 6 .   ? -23.556 23.307  37.713  1.00 24.23 ? 932  HOH A O     1 
HETATM 8065 O  O     . HOH J 6 .   ? -29.442 -6.758  32.828  1.00 11.52 ? 933  HOH A O     1 
HETATM 8066 O  O     . HOH J 6 .   ? -8.526  32.558  10.215  1.00 14.99 ? 934  HOH A O     1 
HETATM 8067 O  O     . HOH J 6 .   ? 12.209  22.306  37.119  1.00 7.06  ? 935  HOH A O     1 
HETATM 8068 O  O     . HOH J 6 .   ? -2.969  13.968  9.066   1.00 30.34 ? 936  HOH A O     1 
HETATM 8069 O  O     . HOH J 6 .   ? -5.147  -9.403  -0.219  1.00 22.39 ? 937  HOH A O     1 
HETATM 8070 O  O     . HOH J 6 .   ? -4.958  2.600   1.842   1.00 24.26 ? 938  HOH A O     1 
HETATM 8071 O  O     . HOH J 6 .   ? -18.723 5.204   19.609  1.00 18.67 ? 939  HOH A O     1 
HETATM 8072 O  O     . HOH J 6 .   ? 10.546  1.804   2.958   1.00 22.06 ? 940  HOH A O     1 
HETATM 8073 O  O     . HOH J 6 .   ? -25.454 -21.361 20.702  1.00 23.91 ? 941  HOH A O     1 
HETATM 8074 O  O     . HOH J 6 .   ? -5.209  18.740  26.496  1.00 13.16 ? 942  HOH A O     1 
HETATM 8075 O  O     . HOH J 6 .   ? -6.042  21.313  26.696  1.00 15.30 ? 943  HOH A O     1 
HETATM 8076 O  O     . HOH J 6 .   ? -22.107 7.037   39.338  1.00 15.21 ? 944  HOH A O     1 
HETATM 8077 O  O     . HOH J 6 .   ? -14.215 22.701  20.947  1.00 19.29 ? 945  HOH A O     1 
HETATM 8078 O  O     . HOH J 6 .   ? -1.318  26.607  60.683  1.00 17.14 ? 946  HOH A O     1 
HETATM 8079 O  O     . HOH J 6 .   ? 25.641  32.687  12.651  1.00 25.53 ? 947  HOH A O     1 
HETATM 8080 O  O     . HOH J 6 .   ? -33.064 -15.783 40.221  1.00 17.95 ? 948  HOH A O     1 
HETATM 8081 O  O     . HOH J 6 .   ? 17.832  33.130  37.950  1.00 31.56 ? 949  HOH A O     1 
HETATM 8082 O  O     . HOH J 6 .   ? -30.220 12.864  44.463  1.00 25.50 ? 950  HOH A O     1 
HETATM 8083 O  O     . HOH J 6 .   ? -22.839 4.134   25.287  1.00 19.85 ? 951  HOH A O     1 
HETATM 8084 O  O     . HOH J 6 .   ? -21.606 -22.311 25.968  1.00 21.70 ? 952  HOH A O     1 
HETATM 8085 O  O     . HOH J 6 .   ? 11.628  30.606  18.719  1.00 30.48 ? 953  HOH A O     1 
HETATM 8086 O  O     . HOH J 6 .   ? -30.396 20.455  40.208  1.00 27.37 ? 954  HOH A O     1 
HETATM 8087 O  O     . HOH J 6 .   ? 3.087   14.469  -10.764 1.00 22.48 ? 955  HOH A O     1 
HETATM 8088 O  O     . HOH J 6 .   ? -5.093  31.154  19.217  1.00 15.10 ? 956  HOH A O     1 
HETATM 8089 O  O     . HOH J 6 .   ? -39.409 16.522  42.494  1.00 32.72 ? 957  HOH A O     1 
HETATM 8090 O  O     . HOH J 6 .   ? -24.105 8.888   20.659  1.00 49.33 ? 958  HOH A O     1 
HETATM 8091 O  O     . HOH J 6 .   ? -11.006 9.136   49.051  1.00 16.52 ? 959  HOH A O     1 
HETATM 8092 O  O     . HOH J 6 .   ? -0.807  21.540  46.447  1.00 26.82 ? 960  HOH A O     1 
HETATM 8093 O  O     . HOH J 6 .   ? -30.801 6.597   49.257  1.00 21.87 ? 961  HOH A O     1 
HETATM 8094 O  O     . HOH J 6 .   ? 11.765  1.337   -5.115  1.00 18.52 ? 962  HOH A O     1 
HETATM 8095 O  O     . HOH J 6 .   ? -24.289 -9.226  42.611  1.00 23.64 ? 963  HOH A O     1 
HETATM 8096 O  O     . HOH J 6 .   ? -20.065 11.003  15.693  1.00 20.24 ? 964  HOH A O     1 
HETATM 8097 O  O     . HOH J 6 .   ? -0.295  10.169  23.620  1.00 20.06 ? 965  HOH A O     1 
HETATM 8098 O  O     . HOH J 6 .   ? -19.161 -22.527 26.871  1.00 20.64 ? 966  HOH A O     1 
HETATM 8099 O  O     . HOH J 6 .   ? -21.609 -6.802  11.982  1.00 26.75 ? 967  HOH A O     1 
HETATM 8100 O  O     . HOH J 6 .   ? -22.980 -3.095  39.309  1.00 27.76 ? 968  HOH A O     1 
HETATM 8101 O  O     . HOH J 6 .   ? -26.277 6.727   43.127  1.00 18.67 ? 969  HOH A O     1 
HETATM 8102 O  O     . HOH J 6 .   ? -3.170  9.147   21.896  1.00 20.50 ? 970  HOH A O     1 
HETATM 8103 O  O     . HOH J 6 .   ? 12.147  20.779  34.686  1.00 11.66 ? 971  HOH A O     1 
HETATM 8104 O  O     . HOH J 6 .   ? -20.077 -13.859 40.054  1.00 28.42 ? 972  HOH A O     1 
HETATM 8105 O  O     . HOH J 6 .   ? -0.592  16.254  9.558   1.00 33.49 ? 973  HOH A O     1 
HETATM 8106 O  O     . HOH J 6 .   ? 12.676  3.518   -0.698  1.00 24.62 ? 974  HOH A O     1 
HETATM 8107 O  O     . HOH J 6 .   ? 9.920   21.505  33.144  1.00 21.18 ? 975  HOH A O     1 
HETATM 8108 O  O     . HOH J 6 .   ? -25.785 14.098  54.186  1.00 42.39 ? 976  HOH A O     1 
HETATM 8109 O  O     . HOH J 6 .   ? -2.299  -6.778  29.723  1.00 25.49 ? 977  HOH A O     1 
HETATM 8110 O  O     . HOH J 6 .   ? 9.503   25.475  42.345  1.00 23.23 ? 978  HOH A O     1 
HETATM 8111 O  O     . HOH J 6 .   ? -6.152  9.153   44.718  1.00 21.60 ? 979  HOH A O     1 
HETATM 8112 O  O     . HOH J 6 .   ? -18.238 -17.879 35.103  1.00 28.49 ? 980  HOH A O     1 
HETATM 8113 O  O     . HOH J 6 .   ? -12.774 32.368  24.609  1.00 27.76 ? 981  HOH A O     1 
HETATM 8114 O  O     . HOH J 6 .   ? -15.263 39.095  56.949  1.00 25.23 ? 982  HOH A O     1 
HETATM 8115 O  O     . HOH J 6 .   ? 28.378  15.346  41.813  1.00 27.28 ? 983  HOH A O     1 
HETATM 8116 O  O     . HOH J 6 .   ? 4.079   -4.457  14.547  1.00 19.59 ? 984  HOH A O     1 
HETATM 8117 O  O     . HOH J 6 .   ? -3.074  -5.967  -5.753  1.00 17.25 ? 985  HOH A O     1 
HETATM 8118 O  O     . HOH J 6 .   ? 18.116  9.979   7.390   1.00 26.96 ? 986  HOH A O     1 
HETATM 8119 O  O     . HOH J 6 .   ? -19.112 2.906   35.189  1.00 19.10 ? 987  HOH A O     1 
HETATM 8120 O  O     . HOH J 6 .   ? -29.794 19.578  42.872  1.00 22.15 ? 988  HOH A O     1 
HETATM 8121 O  O     . HOH J 6 .   ? 3.669   30.490  59.235  1.00 28.72 ? 989  HOH A O     1 
HETATM 8122 O  O     . HOH J 6 .   ? -24.235 1.334   29.936  1.00 11.79 ? 990  HOH A O     1 
HETATM 8123 O  O     . HOH J 6 .   ? 13.168  21.001  51.947  1.00 13.72 ? 991  HOH A O     1 
HETATM 8124 O  O     . HOH J 6 .   ? -5.374  4.903   30.602  1.00 29.19 ? 992  HOH A O     1 
HETATM 8125 O  O     . HOH J 6 .   ? 20.772  7.790   14.139  1.00 25.88 ? 993  HOH A O     1 
HETATM 8126 O  O     . HOH J 6 .   ? 22.339  15.931  22.779  1.00 33.70 ? 994  HOH A O     1 
HETATM 8127 O  O     . HOH J 6 .   ? 3.128   2.031   49.796  1.00 53.03 ? 995  HOH A O     1 
HETATM 8128 O  O     . HOH J 6 .   ? -6.313  12.780  -0.240  1.00 41.65 ? 996  HOH A O     1 
HETATM 8129 O  O     . HOH J 6 .   ? -31.080 16.088  49.232  1.00 38.83 ? 997  HOH A O     1 
HETATM 8130 O  O     . HOH J 6 .   ? -40.796 16.718  38.664  1.00 24.34 ? 998  HOH A O     1 
HETATM 8131 O  O     . HOH J 6 .   ? 20.430  30.778  44.122  1.00 16.04 ? 999  HOH A O     1 
HETATM 8132 O  O     . HOH J 6 .   ? -44.943 16.260  35.223  1.00 22.97 ? 1000 HOH A O     1 
HETATM 8133 O  O     . HOH J 6 .   ? -12.071 29.998  28.451  1.00 32.03 ? 1001 HOH A O     1 
HETATM 8134 O  O     . HOH J 6 .   ? -5.015  7.780   7.935   1.00 21.47 ? 1002 HOH A O     1 
HETATM 8135 O  O     . HOH J 6 .   ? 11.603  24.155  26.513  1.00 28.94 ? 1003 HOH A O     1 
HETATM 8136 O  O     . HOH J 6 .   ? -12.163 -9.199  31.134  1.00 29.58 ? 1004 HOH A O     1 
HETATM 8137 O  O     . HOH J 6 .   ? -13.294 21.853  25.473  1.00 21.15 ? 1005 HOH A O     1 
HETATM 8138 O  O     . HOH J 6 .   ? 0.644   16.092  33.653  1.00 24.18 ? 1006 HOH A O     1 
HETATM 8139 O  O     . HOH J 6 .   ? -22.017 8.259   64.436  1.00 19.81 ? 1007 HOH A O     1 
HETATM 8140 O  O     . HOH J 6 .   ? -0.789  -9.277  26.744  1.00 23.01 ? 1008 HOH A O     1 
HETATM 8141 O  O     . HOH J 6 .   ? 23.682  9.827   50.565  1.00 24.17 ? 1009 HOH A O     1 
HETATM 8142 O  O     . HOH J 6 .   ? -13.932 19.896  27.218  1.00 18.73 ? 1010 HOH A O     1 
HETATM 8143 O  O     . HOH J 6 .   ? -11.844 6.795   29.092  1.00 19.73 ? 1011 HOH A O     1 
HETATM 8144 O  O     . HOH J 6 .   ? -15.515 39.098  60.388  1.00 34.43 ? 1012 HOH A O     1 
HETATM 8145 O  O     . HOH J 6 .   ? 30.273  19.560  19.014  1.00 26.24 ? 1013 HOH A O     1 
HETATM 8146 O  O     . HOH J 6 .   ? -1.168  14.227  11.870  1.00 44.57 ? 1014 HOH A O     1 
HETATM 8147 O  O     . HOH J 6 .   ? -25.377 8.538   25.615  1.00 27.82 ? 1015 HOH A O     1 
HETATM 8148 O  O     . HOH J 6 .   ? 22.030  34.367  9.779   1.00 19.38 ? 1016 HOH A O     1 
HETATM 8149 O  O     . HOH J 6 .   ? 16.423  10.344  26.769  1.00 24.69 ? 1017 HOH A O     1 
HETATM 8150 O  O     . HOH J 6 .   ? 24.499  13.670  18.866  1.00 29.34 ? 1018 HOH A O     1 
HETATM 8151 O  O     . HOH J 6 .   ? -33.067 -2.025  26.925  1.00 34.35 ? 1019 HOH A O     1 
HETATM 8152 O  O     . HOH J 6 .   ? -11.833 -11.161 22.056  1.00 29.71 ? 1020 HOH A O     1 
HETATM 8153 O  O     . HOH J 6 .   ? 19.905  18.437  30.321  1.00 22.55 ? 1021 HOH A O     1 
HETATM 8154 O  O     . HOH J 6 .   ? -12.315 -15.418 17.362  1.00 25.27 ? 1022 HOH A O     1 
HETATM 8155 O  O     . HOH J 6 .   ? 21.848  13.046  5.887   1.00 20.76 ? 1023 HOH A O     1 
HETATM 8156 O  O     . HOH J 6 .   ? -25.037 9.255   62.727  1.00 20.60 ? 1024 HOH A O     1 
HETATM 8157 O  O     . HOH J 6 .   ? 8.766   36.163  4.468   1.00 20.88 ? 1025 HOH A O     1 
HETATM 8158 O  O     . HOH J 6 .   ? -31.876 -6.979  42.249  1.00 17.46 ? 1026 HOH A O     1 
HETATM 8159 O  O     . HOH J 6 .   ? -14.697 -22.499 34.161  1.00 33.95 ? 1027 HOH A O     1 
HETATM 8160 O  O     . HOH J 6 .   ? -0.651  -6.628  27.519  1.00 25.55 ? 1028 HOH A O     1 
HETATM 8161 O  O     . HOH J 6 .   ? -9.138  30.686  33.705  1.00 18.08 ? 1029 HOH A O     1 
HETATM 8162 O  O     . HOH J 6 .   ? -20.649 7.177   41.661  1.00 15.25 ? 1030 HOH A O     1 
HETATM 8163 O  O     . HOH J 6 .   ? 1.632   4.144   -6.778  1.00 16.83 ? 1031 HOH A O     1 
HETATM 8164 O  O     . HOH J 6 .   ? -7.405  20.066  50.697  1.00 30.19 ? 1032 HOH A O     1 
HETATM 8165 O  O     . HOH J 6 .   ? 6.605   12.252  13.583  1.00 17.41 ? 1033 HOH A O     1 
HETATM 8166 O  O     . HOH J 6 .   ? -1.868  13.683  29.748  1.00 27.42 ? 1034 HOH A O     1 
HETATM 8167 O  O     . HOH J 6 .   ? 30.126  39.367  28.740  1.00 31.92 ? 1035 HOH A O     1 
HETATM 8168 O  O     . HOH J 6 .   ? 8.823   -10.039 8.845   1.00 26.95 ? 1036 HOH A O     1 
HETATM 8169 O  O     . HOH J 6 .   ? -7.180  11.466  27.686  1.00 22.00 ? 1037 HOH A O     1 
HETATM 8170 O  O     . HOH J 6 .   ? -13.295 37.921  65.996  1.00 18.97 ? 1038 HOH A O     1 
HETATM 8171 O  O     . HOH J 6 .   ? -7.026  -11.551 32.532  1.00 46.81 ? 1039 HOH A O     1 
HETATM 8172 O  O     . HOH J 6 .   ? 22.441  21.726  4.979   1.00 26.13 ? 1040 HOH A O     1 
HETATM 8173 O  O     . HOH J 6 .   ? 4.917   20.209  61.724  1.00 37.20 ? 1041 HOH A O     1 
HETATM 8174 O  O     . HOH J 6 .   ? -2.390  24.266  58.350  1.00 32.57 ? 1042 HOH A O     1 
HETATM 8175 O  O     . HOH J 6 .   ? -18.864 -4.772  25.803  1.00 21.25 ? 1043 HOH A O     1 
HETATM 8176 O  O     . HOH J 6 .   ? -13.606 -5.005  29.611  1.00 36.24 ? 1044 HOH A O     1 
HETATM 8177 O  O     . HOH J 6 .   ? -21.816 9.305   37.898  1.00 14.72 ? 1045 HOH A O     1 
HETATM 8178 O  O     . HOH J 6 .   ? 12.960  5.352   -4.833  1.00 22.12 ? 1046 HOH A O     1 
HETATM 8179 O  O     . HOH J 6 .   ? -1.510  29.085  18.706  1.00 27.66 ? 1047 HOH A O     1 
HETATM 8180 O  O     . HOH J 6 .   ? 14.882  30.746  22.393  1.00 24.41 ? 1048 HOH A O     1 
HETATM 8181 O  O     . HOH J 6 .   ? -26.897 -7.859  33.129  1.00 18.37 ? 1049 HOH A O     1 
HETATM 8182 O  O     . HOH J 6 .   ? 9.523   19.516  30.093  1.00 25.15 ? 1050 HOH A O     1 
HETATM 8183 O  O     . HOH J 6 .   ? -3.755  10.981  -7.249  1.00 34.00 ? 1051 HOH A O     1 
HETATM 8184 O  O     . HOH J 6 .   ? 8.313   18.301  64.812  1.00 26.04 ? 1052 HOH A O     1 
HETATM 8185 O  O     . HOH J 6 .   ? -17.520 39.681  43.686  1.00 41.11 ? 1053 HOH A O     1 
HETATM 8186 O  O     . HOH J 6 .   ? -17.819 -1.315  2.234   1.00 33.89 ? 1054 HOH A O     1 
HETATM 8187 O  O     . HOH J 6 .   ? 1.764   8.017   -8.748  1.00 23.91 ? 1055 HOH A O     1 
HETATM 8188 O  O     . HOH J 6 .   ? 3.714   34.412  34.827  1.00 49.68 ? 1056 HOH A O     1 
HETATM 8189 O  O     . HOH J 6 .   ? -19.629 -18.529 20.191  1.00 23.52 ? 1057 HOH A O     1 
HETATM 8190 O  O     . HOH J 6 .   ? 33.677  17.262  29.817  1.00 33.86 ? 1058 HOH A O     1 
HETATM 8191 O  O     . HOH J 6 .   ? -14.839 -0.335  54.335  1.00 32.98 ? 1059 HOH A O     1 
HETATM 8192 O  O     . HOH J 6 .   ? 18.618  30.287  30.666  1.00 22.04 ? 1060 HOH A O     1 
HETATM 8193 O  O     . HOH J 6 .   ? -20.652 20.065  30.105  1.00 33.54 ? 1061 HOH A O     1 
HETATM 8194 O  O     . HOH J 6 .   ? 31.428  30.042  21.911  1.00 25.21 ? 1062 HOH A O     1 
HETATM 8195 O  O     . HOH J 6 .   ? -10.854 20.854  67.699  1.00 17.64 ? 1063 HOH A O     1 
HETATM 8196 O  O     . HOH J 6 .   ? -6.198  23.786  64.334  1.00 16.92 ? 1064 HOH A O     1 
HETATM 8197 O  O     . HOH J 6 .   ? 14.775  30.248  25.007  1.00 19.32 ? 1065 HOH A O     1 
HETATM 8198 O  O     . HOH J 6 .   ? 6.216   4.834   -7.561  1.00 24.83 ? 1066 HOH A O     1 
HETATM 8199 O  O     . HOH J 6 .   ? -38.044 -1.484  42.129  1.00 26.87 ? 1067 HOH A O     1 
HETATM 8200 O  O     . HOH J 6 .   ? 16.349  9.901   37.144  1.00 26.96 ? 1068 HOH A O     1 
HETATM 8201 O  O     . HOH J 6 .   ? -15.109 17.938  25.401  1.00 19.96 ? 1069 HOH A O     1 
HETATM 8202 O  O     . HOH J 6 .   ? -5.883  11.752  43.831  1.00 20.50 ? 1070 HOH A O     1 
HETATM 8203 O  O     . HOH J 6 .   ? -34.007 19.962  42.032  1.00 25.84 ? 1071 HOH A O     1 
HETATM 8204 O  O     . HOH J 6 .   ? -9.504  34.066  8.074   1.00 19.63 ? 1072 HOH A O     1 
HETATM 8205 O  O     . HOH J 6 .   ? -3.213  12.884  61.237  1.00 19.12 ? 1073 HOH A O     1 
HETATM 8206 O  O     . HOH J 6 .   ? 11.576  -0.580  3.577   1.00 24.54 ? 1074 HOH A O     1 
HETATM 8207 O  O     . HOH J 6 .   ? 25.213  36.519  9.391   1.00 44.00 ? 1075 HOH A O     1 
HETATM 8208 O  O     . HOH J 6 .   ? -14.767 -13.983 13.822  1.00 24.93 ? 1076 HOH A O     1 
HETATM 8209 O  O     . HOH J 6 .   ? -34.500 -16.064 25.199  1.00 18.57 ? 1077 HOH A O     1 
HETATM 8210 O  O     . HOH J 6 .   ? -18.404 -20.580 24.887  1.00 31.15 ? 1078 HOH A O     1 
HETATM 8211 O  O     . HOH J 6 .   ? -16.104 -28.687 32.066  1.00 21.73 ? 1079 HOH A O     1 
HETATM 8212 O  O     . HOH J 6 .   ? -2.766  8.203   55.951  1.00 24.12 ? 1080 HOH A O     1 
HETATM 8213 O  O     . HOH J 6 .   ? 8.908   26.485  49.013  1.00 26.87 ? 1081 HOH A O     1 
HETATM 8214 O  O     . HOH J 6 .   ? -6.706  6.984   32.043  1.00 37.89 ? 1082 HOH A O     1 
HETATM 8215 O  O     . HOH J 6 .   ? -29.494 19.466  56.141  1.00 24.88 ? 1083 HOH A O     1 
HETATM 8216 O  O     . HOH J 6 .   ? -4.244  25.281  10.493  1.00 18.09 ? 1084 HOH A O     1 
HETATM 8217 O  O     . HOH J 6 .   ? -34.774 -6.884  45.420  1.00 28.30 ? 1085 HOH A O     1 
HETATM 8218 O  O     . HOH J 6 .   ? -17.229 27.035  71.646  1.00 45.55 ? 1086 HOH A O     1 
HETATM 8219 O  O     . HOH J 6 .   ? -16.664 8.674   43.548  1.00 27.94 ? 1087 HOH A O     1 
HETATM 8220 O  O     . HOH J 6 .   ? -31.942 16.440  28.831  1.00 48.24 ? 1088 HOH A O     1 
HETATM 8221 O  O     . HOH J 6 .   ? -19.788 13.438  14.955  1.00 31.51 ? 1089 HOH A O     1 
HETATM 8222 O  O     . HOH J 6 .   ? -4.618  37.115  61.353  1.00 26.13 ? 1090 HOH A O     1 
HETATM 8223 O  O     . HOH J 6 .   ? -8.642  20.775  47.177  1.00 28.35 ? 1091 HOH A O     1 
HETATM 8224 O  O     . HOH J 6 .   ? -4.963  10.665  35.961  1.00 23.07 ? 1092 HOH A O     1 
HETATM 8225 O  O     . HOH J 6 .   ? 24.199  7.214   43.041  1.00 21.73 ? 1093 HOH A O     1 
HETATM 8226 O  O     . HOH J 6 .   ? -2.789  30.521  8.797   1.00 21.12 ? 1094 HOH A O     1 
HETATM 8227 O  O     . HOH J 6 .   ? -9.676  -2.305  -1.797  1.00 32.66 ? 1095 HOH A O     1 
HETATM 8228 O  O     . HOH J 6 .   ? -16.049 8.294   46.024  1.00 20.52 ? 1096 HOH A O     1 
HETATM 8229 O  O     . HOH J 6 .   ? -8.673  8.191   7.995   1.00 15.93 ? 1097 HOH A O     1 
HETATM 8230 O  O     . HOH J 6 .   ? 27.550  14.696  56.688  1.00 21.27 ? 1098 HOH A O     1 
HETATM 8231 O  O     . HOH J 6 .   ? -7.081  15.704  10.966  1.00 33.55 ? 1099 HOH A O     1 
HETATM 8232 O  O     . HOH J 6 .   ? -9.649  7.483   27.747  1.00 18.07 ? 1100 HOH A O     1 
HETATM 8233 O  O     . HOH J 6 .   ? -12.916 -18.733 4.119   1.00 30.71 ? 1101 HOH A O     1 
HETATM 8234 O  O     . HOH J 6 .   ? -12.909 -12.953 18.415  1.00 20.76 ? 1102 HOH A O     1 
HETATM 8235 O  O     . HOH J 6 .   ? -15.477 3.919   8.717   1.00 34.37 ? 1103 HOH A O     1 
HETATM 8236 O  O     A HOH J 6 .   ? -2.898  2.612   20.153  0.50 5.63  ? 1104 HOH A O     1 
HETATM 8237 O  O     B HOH J 6 .   ? -1.906  0.880   20.756  0.50 16.95 ? 1104 HOH A O     1 
HETATM 8238 O  O     . HOH J 6 .   ? -28.702 24.764  45.815  1.00 24.99 ? 1105 HOH A O     1 
HETATM 8239 O  O     . HOH J 6 .   ? 10.522  23.808  38.404  1.00 14.43 ? 1106 HOH A O     1 
HETATM 8240 O  O     . HOH J 6 .   ? 28.037  14.089  39.502  1.00 32.05 ? 1107 HOH A O     1 
HETATM 8241 O  O     . HOH J 6 .   ? 5.758   1.434   -6.964  1.00 17.95 ? 1108 HOH A O     1 
HETATM 8242 O  O     . HOH J 6 .   ? 23.328  31.626  42.143  1.00 40.33 ? 1109 HOH A O     1 
HETATM 8243 O  O     . HOH J 6 .   ? -18.640 5.803   44.412  1.00 25.30 ? 1110 HOH A O     1 
HETATM 8244 O  O     . HOH J 6 .   ? -15.073 22.325  23.713  1.00 27.87 ? 1111 HOH A O     1 
HETATM 8245 O  O     . HOH J 6 .   ? 23.835  16.330  38.886  1.00 40.01 ? 1112 HOH A O     1 
HETATM 8246 O  O     . HOH J 6 .   ? -13.692 8.489   41.788  1.00 23.57 ? 1113 HOH A O     1 
HETATM 8247 O  O     . HOH J 6 .   ? 22.396  35.957  41.157  1.00 23.46 ? 1114 HOH A O     1 
HETATM 8248 O  O     . HOH J 6 .   ? 6.952   15.656  46.728  1.00 25.79 ? 1115 HOH A O     1 
HETATM 8249 O  O     . HOH J 6 .   ? -17.363 0.349   57.856  1.00 37.52 ? 1116 HOH A O     1 
HETATM 8250 O  O     . HOH J 6 .   ? 14.637  4.324   42.112  1.00 25.71 ? 1117 HOH A O     1 
HETATM 8251 O  O     . HOH J 6 .   ? -13.279 25.241  20.822  1.00 23.72 ? 1118 HOH A O     1 
HETATM 8252 O  O     . HOH J 6 .   ? -20.430 -12.715 21.915  1.00 22.09 ? 1119 HOH A O     1 
HETATM 8253 O  O     . HOH J 6 .   ? -0.621  21.382  27.799  1.00 41.32 ? 1120 HOH A O     1 
HETATM 8254 O  O     . HOH J 6 .   ? -9.566  10.376  26.733  1.00 13.79 ? 1121 HOH A O     1 
HETATM 8255 O  O     . HOH J 6 .   ? -6.779  17.941  49.185  1.00 26.44 ? 1122 HOH A O     1 
HETATM 8256 O  O     . HOH J 6 .   ? -24.478 12.666  51.195  1.00 33.43 ? 1123 HOH A O     1 
HETATM 8257 O  O     . HOH J 6 .   ? 23.240  39.272  37.736  1.00 24.93 ? 1124 HOH A O     1 
HETATM 8258 O  O     . HOH J 6 .   ? 33.930  22.779  21.794  1.00 39.08 ? 1125 HOH A O     1 
HETATM 8259 O  O     . HOH J 6 .   ? -28.980 1.883   25.701  1.00 30.48 ? 1126 HOH A O     1 
HETATM 8260 O  O     . HOH J 6 .   ? -24.439 -11.980 15.878  1.00 27.41 ? 1127 HOH A O     1 
HETATM 8261 O  O     . HOH J 6 .   ? -8.547  -15.658 -1.796  1.00 19.46 ? 1128 HOH A O     1 
HETATM 8262 O  O     . HOH J 6 .   ? 25.279  1.729   54.738  1.00 28.48 ? 1129 HOH A O     1 
HETATM 8263 O  O     . HOH J 6 .   ? -27.317 17.905  44.999  1.00 23.61 ? 1130 HOH A O     1 
HETATM 8264 O  O     . HOH J 6 .   ? 24.141  14.383  31.230  1.00 28.79 ? 1131 HOH A O     1 
HETATM 8265 O  O     . HOH J 6 .   ? 19.537  19.342  4.210   1.00 25.51 ? 1132 HOH A O     1 
HETATM 8266 O  O     . HOH J 6 .   ? 15.981  2.131   9.654   1.00 14.73 ? 1133 HOH A O     1 
HETATM 8267 O  O     . HOH J 6 .   ? -4.556  -13.117 22.073  1.00 23.10 ? 1134 HOH A O     1 
HETATM 8268 O  O     . HOH J 6 .   ? 12.000  26.336  30.310  1.00 29.01 ? 1135 HOH A O     1 
HETATM 8269 O  O     . HOH J 6 .   ? -4.500  7.688   49.066  1.00 31.87 ? 1136 HOH A O     1 
HETATM 8270 O  O     . HOH J 6 .   ? -15.209 36.726  4.087   1.00 27.71 ? 1137 HOH A O     1 
HETATM 8271 O  O     . HOH J 6 .   ? 12.228  36.644  4.139   1.00 27.86 ? 1138 HOH A O     1 
HETATM 8272 O  O     . HOH J 6 .   ? -1.883  -13.564 26.022  1.00 25.35 ? 1139 HOH A O     1 
HETATM 8273 O  O     . HOH J 6 .   ? 20.927  6.977   38.601  1.00 32.99 ? 1140 HOH A O     1 
HETATM 8274 O  O     . HOH J 6 .   ? 25.950  18.380  6.969   1.00 25.55 ? 1141 HOH A O     1 
HETATM 8275 O  O     . HOH J 6 .   ? -33.054 -4.894  47.034  1.00 35.08 ? 1142 HOH A O     1 
HETATM 8276 O  O     . HOH J 6 .   ? -14.904 -0.551  8.612   1.00 36.70 ? 1143 HOH A O     1 
HETATM 8277 O  O     . HOH J 6 .   ? 2.629   39.825  17.236  1.00 31.19 ? 1144 HOH A O     1 
HETATM 8278 O  O     . HOH J 6 .   ? 12.463  26.543  55.616  1.00 27.90 ? 1145 HOH A O     1 
HETATM 8279 O  O     . HOH J 6 .   ? -13.358 -15.820 15.130  1.00 25.13 ? 1146 HOH A O     1 
HETATM 8280 O  O     . HOH J 6 .   ? -30.697 23.615  44.293  1.00 30.74 ? 1147 HOH A O     1 
HETATM 8281 O  O     . HOH J 6 .   ? 5.735   -6.363  13.595  1.00 26.62 ? 1148 HOH A O     1 
HETATM 8282 O  O     . HOH J 6 .   ? 21.903  14.329  25.145  1.00 26.92 ? 1149 HOH A O     1 
HETATM 8283 O  O     . HOH J 6 .   ? -25.183 21.112  29.242  1.00 30.53 ? 1150 HOH A O     1 
HETATM 8284 O  O     . HOH J 6 .   ? -15.733 3.383   58.110  1.00 32.04 ? 1151 HOH A O     1 
HETATM 8285 O  O     . HOH J 6 .   ? -14.268 38.245  21.550  1.00 35.26 ? 1152 HOH A O     1 
HETATM 8286 O  O     . HOH J 6 .   ? -13.924 26.054  11.803  1.00 27.34 ? 1153 HOH A O     1 
HETATM 8287 O  O     . HOH J 6 .   ? -14.990 20.562  69.184  1.00 18.93 ? 1154 HOH A O     1 
HETATM 8288 O  O     . HOH J 6 .   ? 0.132   16.528  14.843  1.00 37.98 ? 1155 HOH A O     1 
HETATM 8289 O  O     . HOH J 6 .   ? 27.079  20.637  6.992   1.00 25.18 ? 1156 HOH A O     1 
HETATM 8290 O  O     . HOH J 6 .   ? -14.827 -3.164  36.114  1.00 39.91 ? 1157 HOH A O     1 
HETATM 8291 O  O     . HOH J 6 .   ? -19.825 20.212  25.937  1.00 40.86 ? 1158 HOH A O     1 
HETATM 8292 O  O     . HOH J 6 .   ? -23.081 7.028   18.965  1.00 60.13 ? 1159 HOH A O     1 
HETATM 8293 O  O     . HOH J 6 .   ? -35.033 4.068   27.881  1.00 34.65 ? 1160 HOH A O     1 
HETATM 8294 O  O     . HOH J 6 .   ? 9.914   21.333  28.275  1.00 24.31 ? 1161 HOH A O     1 
HETATM 8295 O  O     . HOH J 6 .   ? 5.400   6.903   -6.211  1.00 13.92 ? 1162 HOH A O     1 
HETATM 8296 O  O     . HOH J 6 .   ? 16.685  18.506  4.158   1.00 24.31 ? 1163 HOH A O     1 
HETATM 8297 O  O     . HOH J 6 .   ? 1.601   -17.568 8.506   1.00 27.51 ? 1164 HOH A O     1 
HETATM 8298 O  O     . HOH J 6 .   ? 4.624   -9.706  7.319   1.00 20.91 ? 1165 HOH A O     1 
HETATM 8299 O  O     . HOH J 6 .   ? 17.169  4.064   7.860   1.00 37.32 ? 1166 HOH A O     1 
HETATM 8300 O  O     . HOH J 6 .   ? -9.159  14.682  12.424  1.00 12.05 ? 1167 HOH A O     1 
HETATM 8301 O  O     . HOH J 6 .   ? -4.145  23.124  25.578  1.00 24.54 ? 1168 HOH A O     1 
HETATM 8302 O  O     . HOH J 6 .   ? -22.755 4.593   20.890  1.00 32.23 ? 1169 HOH A O     1 
HETATM 8303 O  O     . HOH J 6 .   ? -3.790  24.615  22.943  1.00 31.35 ? 1170 HOH A O     1 
HETATM 8304 O  O     . HOH J 6 .   ? 25.141  35.479  41.902  1.00 19.27 ? 1171 HOH A O     1 
HETATM 8305 O  O     . HOH J 6 .   ? -2.888  27.384  23.040  1.00 38.21 ? 1172 HOH A O     1 
HETATM 8306 O  O     A HOH J 6 .   ? -3.516  17.417  16.642  0.50 2.00  ? 1173 HOH A O     1 
HETATM 8307 O  O     B HOH J 6 .   ? -3.214  16.466  18.486  0.50 5.05  ? 1173 HOH A O     1 
HETATM 8308 O  O     . HOH J 6 .   ? 2.425   0.965   18.520  1.00 23.11 ? 1174 HOH A O     1 
HETATM 8309 O  O     . HOH J 6 .   ? -7.424  -4.578  35.788  1.00 41.03 ? 1175 HOH A O     1 
HETATM 8310 O  O     . HOH J 6 .   ? -11.234 -11.276 19.457  1.00 13.43 ? 1176 HOH A O     1 
HETATM 8311 O  O     . HOH J 6 .   ? 15.777  11.438  24.013  1.00 21.35 ? 1177 HOH A O     1 
HETATM 8312 O  O     . HOH J 6 .   ? -3.519  7.117   53.485  1.00 30.75 ? 1178 HOH A O     1 
HETATM 8313 O  O     . HOH J 6 .   ? -10.910 -8.366  19.608  1.00 18.68 ? 1179 HOH A O     1 
HETATM 8314 O  O     . HOH J 6 .   ? -4.785  14.739  11.543  1.00 31.32 ? 1180 HOH A O     1 
HETATM 8315 O  O     . HOH J 6 .   ? -10.442 -9.180  -4.532  1.00 20.43 ? 1181 HOH A O     1 
HETATM 8316 O  O     . HOH J 6 .   ? -5.570  21.444  63.453  1.00 24.36 ? 1182 HOH A O     1 
HETATM 8317 O  O     . HOH J 6 .   ? -12.554 40.648  37.320  1.00 37.49 ? 1183 HOH A O     1 
HETATM 8318 O  O     . HOH J 6 .   ? 31.451  23.022  33.281  1.00 36.68 ? 1184 HOH A O     1 
HETATM 8319 O  O     . HOH J 6 .   ? -19.798 15.165  22.699  1.00 35.84 ? 1185 HOH A O     1 
HETATM 8320 O  O     . HOH J 6 .   ? -1.088  -16.643 9.438   1.00 23.46 ? 1186 HOH A O     1 
HETATM 8321 O  O     . HOH J 6 .   ? 9.824   -1.485  15.546  1.00 21.78 ? 1187 HOH A O     1 
HETATM 8322 O  O     . HOH J 6 .   ? 28.844  32.672  36.163  1.00 28.78 ? 1188 HOH A O     1 
HETATM 8323 O  O     . HOH J 6 .   ? 20.803  -2.485  46.463  1.00 18.03 ? 1189 HOH A O     1 
HETATM 8324 O  O     . HOH J 6 .   ? 12.972  27.995  38.065  1.00 25.80 ? 1190 HOH A O     1 
HETATM 8325 O  O     . HOH J 6 .   ? 0.145   17.604  44.558  1.00 30.41 ? 1191 HOH A O     1 
HETATM 8326 O  O     . HOH J 6 .   ? 4.448   25.960  54.256  1.00 39.94 ? 1192 HOH A O     1 
HETATM 8327 O  O     . HOH J 6 .   ? -16.076 35.103  10.686  1.00 29.19 ? 1193 HOH A O     1 
HETATM 8328 O  O     . HOH J 6 .   ? -20.733 -2.189  5.523   1.00 34.75 ? 1194 HOH A O     1 
HETATM 8329 O  O     . HOH J 6 .   ? -8.395  9.399   40.907  1.00 24.84 ? 1195 HOH A O     1 
HETATM 8330 O  O     . HOH J 6 .   ? 15.553  30.020  3.281   1.00 24.52 ? 1196 HOH A O     1 
HETATM 8331 O  O     . HOH J 6 .   ? -3.127  27.628  64.760  1.00 22.87 ? 1197 HOH A O     1 
HETATM 8332 O  O     . HOH J 6 .   ? 11.218  32.033  16.363  1.00 25.41 ? 1198 HOH A O     1 
HETATM 8333 O  O     . HOH J 6 .   ? 0.198   13.782  14.614  1.00 34.43 ? 1199 HOH A O     1 
HETATM 8334 O  O     . HOH J 6 .   ? 11.530  22.690  57.864  1.00 29.61 ? 1200 HOH A O     1 
HETATM 8335 O  O     . HOH J 6 .   ? 28.377  25.891  9.531   1.00 31.61 ? 1201 HOH A O     1 
HETATM 8336 O  O     . HOH J 6 .   ? -30.194 -11.949 47.304  1.00 34.17 ? 1202 HOH A O     1 
HETATM 8337 O  O     . HOH J 6 .   ? 8.668   21.782  20.476  1.00 28.18 ? 1203 HOH A O     1 
HETATM 8338 O  O     . HOH J 6 .   ? 5.331   18.502  29.549  1.00 45.22 ? 1204 HOH A O     1 
HETATM 8339 O  O     . HOH J 6 .   ? -19.550 0.433   36.633  1.00 27.18 ? 1205 HOH A O     1 
HETATM 8340 O  O     . HOH J 6 .   ? -19.907 -12.550 7.384   1.00 35.06 ? 1206 HOH A O     1 
HETATM 8341 O  O     . HOH J 6 .   ? 0.513   21.324  1.840   1.00 26.26 ? 1207 HOH A O     1 
HETATM 8342 O  O     . HOH J 6 .   ? -15.519 -10.839 2.128   1.00 24.00 ? 1208 HOH A O     1 
HETATM 8343 O  O     . HOH J 6 .   ? -25.360 6.982   58.257  1.00 27.34 ? 1209 HOH A O     1 
HETATM 8344 O  O     . HOH J 6 .   ? -17.800 -11.126 32.069  1.00 29.44 ? 1210 HOH A O     1 
HETATM 8345 O  O     . HOH J 6 .   ? -11.200 -11.507 27.797  1.00 28.70 ? 1211 HOH A O     1 
HETATM 8346 O  O     . HOH J 6 .   ? -31.337 -6.850  23.596  1.00 24.66 ? 1212 HOH A O     1 
HETATM 8347 O  O     . HOH J 6 .   ? -12.295 3.087   -0.459  1.00 26.73 ? 1213 HOH A O     1 
HETATM 8348 O  O     . HOH J 6 .   ? -17.092 23.787  20.516  1.00 17.89 ? 1214 HOH A O     1 
HETATM 8349 O  O     . HOH J 6 .   ? -29.808 -21.958 30.539  1.00 43.38 ? 1215 HOH A O     1 
HETATM 8350 O  O     . HOH J 6 .   ? -3.721  34.902  63.482  1.00 23.13 ? 1216 HOH A O     1 
HETATM 8351 O  O     . HOH J 6 .   ? 19.991  27.967  55.623  1.00 26.13 ? 1217 HOH A O     1 
HETATM 8352 O  O     . HOH J 6 .   ? -14.902 31.546  20.119  1.00 27.83 ? 1218 HOH A O     1 
HETATM 8353 O  O     . HOH J 6 .   ? -19.362 -15.131 22.849  1.00 29.12 ? 1219 HOH A O     1 
HETATM 8354 O  O     . HOH J 6 .   ? -14.487 43.283  50.791  1.00 26.86 ? 1220 HOH A O     1 
HETATM 8355 O  O     . HOH J 6 .   ? 17.359  5.791   3.755   1.00 37.66 ? 1221 HOH A O     1 
HETATM 8356 O  O     . HOH J 6 .   ? -2.789  24.771  52.337  1.00 42.67 ? 1222 HOH A O     1 
HETATM 8357 O  O     . HOH J 6 .   ? -33.110 -17.712 35.591  1.00 37.64 ? 1223 HOH A O     1 
HETATM 8358 O  O     . HOH J 6 .   ? -35.318 20.402  27.327  1.00 38.76 ? 1224 HOH A O     1 
HETATM 8359 O  O     . HOH J 6 .   ? -6.149  -16.199 1.362   1.00 15.89 ? 1225 HOH A O     1 
HETATM 8360 O  O     . HOH J 6 .   ? -17.698 -6.218  33.938  1.00 26.29 ? 1226 HOH A O     1 
HETATM 8361 O  O     . HOH J 6 .   ? -13.753 5.245   44.746  1.00 21.72 ? 1227 HOH A O     1 
HETATM 8362 O  O     . HOH J 6 .   ? -3.703  16.487  9.421   1.00 30.44 ? 1228 HOH A O     1 
HETATM 8363 O  O     . HOH J 6 .   ? -3.940  32.726  10.001  1.00 25.04 ? 1229 HOH A O     1 
HETATM 8364 O  O     . HOH J 6 .   ? -7.572  6.378   26.305  1.00 17.75 ? 1230 HOH A O     1 
HETATM 8365 O  O     . HOH J 6 .   ? 10.739  26.379  38.337  1.00 19.80 ? 1231 HOH A O     1 
HETATM 8366 O  O     . HOH J 6 .   ? -3.256  23.929  20.297  1.00 27.01 ? 1232 HOH A O     1 
HETATM 8367 O  O     . HOH J 6 .   ? -5.356  9.824   28.255  1.00 24.40 ? 1233 HOH A O     1 
HETATM 8368 O  O     . HOH J 6 .   ? 14.401  22.085  8.221   1.00 38.34 ? 1234 HOH A O     1 
HETATM 8369 O  O     . HOH J 6 .   ? -2.247  22.206  17.258  1.00 32.65 ? 1235 HOH A O     1 
HETATM 8370 O  O     . HOH J 6 .   ? -22.187 13.085  25.825  1.00 24.62 ? 1236 HOH A O     1 
HETATM 8371 O  O     . HOH J 6 .   ? -12.342 23.112  68.326  1.00 23.15 ? 1237 HOH A O     1 
HETATM 8372 O  O     . HOH J 6 .   ? -23.358 15.602  25.156  1.00 30.39 ? 1238 HOH A O     1 
HETATM 8373 O  O     . HOH J 6 .   ? 26.342  12.383  55.829  1.00 34.79 ? 1239 HOH A O     1 
HETATM 8374 O  O     . HOH J 6 .   ? -28.342 -0.128  23.965  1.00 39.41 ? 1240 HOH A O     1 
HETATM 8375 O  O     . HOH J 6 .   ? 21.207  17.520  4.950   1.00 21.84 ? 1241 HOH A O     1 
HETATM 8376 O  O     . HOH J 6 .   ? 18.486  2.726   17.187  1.00 30.37 ? 1242 HOH A O     1 
HETATM 8377 O  O     . HOH J 6 .   ? 25.585  30.194  51.093  1.00 29.28 ? 1243 HOH A O     1 
HETATM 8378 O  O     . HOH J 6 .   ? -2.076  31.244  16.730  1.00 29.83 ? 1244 HOH A O     1 
HETATM 8379 O  O     . HOH J 6 .   ? -2.845  -19.673 7.410   1.00 30.06 ? 1245 HOH A O     1 
HETATM 8380 O  O     . HOH J 6 .   ? -10.572 27.738  27.392  1.00 32.71 ? 1246 HOH A O     1 
HETATM 8381 O  O     . HOH J 6 .   ? -11.411 4.762   57.000  1.00 36.35 ? 1247 HOH A O     1 
HETATM 8382 O  O     . HOH J 6 .   ? -33.603 25.498  33.002  1.00 45.19 ? 1248 HOH A O     1 
HETATM 8383 O  O     . HOH J 6 .   ? -25.262 5.839   17.140  1.00 36.28 ? 1249 HOH A O     1 
HETATM 8384 O  O     . HOH J 6 .   ? -6.887  13.716  6.858   1.00 35.44 ? 1250 HOH A O     1 
HETATM 8385 O  O     . HOH J 6 .   ? -22.189 -10.092 14.804  1.00 26.14 ? 1251 HOH A O     1 
HETATM 8386 O  O     . HOH J 6 .   ? 14.446  19.962  -13.010 1.00 34.46 ? 1252 HOH A O     1 
HETATM 8387 O  O     . HOH J 6 .   ? 14.737  1.180   12.163  1.00 33.49 ? 1253 HOH A O     1 
HETATM 8388 O  O     . HOH J 6 .   ? -25.572 16.944  25.913  1.00 42.26 ? 1254 HOH A O     1 
HETATM 8389 O  O     . HOH J 6 .   ? -36.514 -6.693  19.824  1.00 26.65 ? 1255 HOH A O     1 
HETATM 8390 O  O     . HOH J 6 .   ? -18.374 1.756   6.665   1.00 30.77 ? 1256 HOH A O     1 
HETATM 8391 O  O     . HOH J 6 .   ? -24.858 17.210  61.414  1.00 22.16 ? 1257 HOH A O     1 
HETATM 8392 O  O     . HOH J 6 .   ? -5.431  6.090   -7.631  1.00 31.23 ? 1258 HOH A O     1 
HETATM 8393 O  O     . HOH J 6 .   ? -0.544  -12.599 -5.801  1.00 19.92 ? 1259 HOH A O     1 
HETATM 8394 O  O     . HOH J 6 .   ? 11.130  -8.169  6.666   1.00 29.92 ? 1260 HOH A O     1 
HETATM 8395 O  O     . HOH J 6 .   ? -25.322 34.726  48.541  1.00 34.89 ? 1261 HOH A O     1 
HETATM 8396 O  O     . HOH J 6 .   ? 1.690   3.743   9.648   1.00 25.93 ? 1262 HOH A O     1 
HETATM 8397 O  O     . HOH J 6 .   ? 5.615   36.078  -0.274  1.00 28.10 ? 1263 HOH A O     1 
HETATM 8398 O  O     . HOH J 6 .   ? 17.153  7.751   54.670  1.00 35.04 ? 1264 HOH A O     1 
HETATM 8399 O  O     . HOH J 6 .   ? -3.201  23.023  56.206  1.00 32.90 ? 1265 HOH A O     1 
HETATM 8400 O  O     . HOH J 6 .   ? -40.620 19.113  43.408  1.00 29.89 ? 1266 HOH A O     1 
HETATM 8401 O  O     . HOH J 6 .   ? 2.710   12.338  15.597  1.00 39.47 ? 1267 HOH A O     1 
HETATM 8402 O  O     . HOH J 6 .   ? -17.432 -14.291 13.238  1.00 39.36 ? 1268 HOH A O     1 
HETATM 8403 O  O     . HOH J 6 .   ? -28.831 16.987  48.734  1.00 41.76 ? 1269 HOH A O     1 
HETATM 8404 O  O     . HOH J 6 .   ? -15.136 10.453  8.595   1.00 31.35 ? 1270 HOH A O     1 
HETATM 8405 O  O     . HOH J 6 .   ? -14.093 1.800   61.907  1.00 37.09 ? 1271 HOH A O     1 
HETATM 8406 O  O     . HOH J 6 .   ? -3.729  12.533  44.548  1.00 37.40 ? 1272 HOH A O     1 
HETATM 8407 O  O     . HOH J 6 .   ? 7.615   25.872  31.936  1.00 30.47 ? 1273 HOH A O     1 
HETATM 8408 O  O     . HOH J 6 .   ? -30.661 25.412  35.134  1.00 35.79 ? 1274 HOH A O     1 
HETATM 8409 O  O     . HOH J 6 .   ? -14.545 26.852  36.429  1.00 18.99 ? 1275 HOH A O     1 
HETATM 8410 O  O     . HOH J 6 .   ? -0.890  23.584  13.666  1.00 21.34 ? 1276 HOH A O     1 
HETATM 8411 O  O     . HOH J 6 .   ? 20.636  10.772  19.358  1.00 24.32 ? 1277 HOH A O     1 
HETATM 8412 O  O     . HOH J 6 .   ? -21.186 -6.874  15.034  1.00 20.87 ? 1278 HOH A O     1 
HETATM 8413 O  O     . HOH J 6 .   ? 1.499   13.541  -8.340  1.00 24.70 ? 1279 HOH A O     1 
HETATM 8414 O  O     . HOH J 6 .   ? -4.980  1.406   -7.030  1.00 28.10 ? 1280 HOH A O     1 
HETATM 8415 O  O     . HOH J 6 .   ? -11.555 35.716  5.441   1.00 34.35 ? 1281 HOH A O     1 
HETATM 8416 O  O     . HOH J 6 .   ? -2.544  12.088  41.644  1.00 23.84 ? 1282 HOH A O     1 
HETATM 8417 O  O     . HOH J 6 .   ? -2.791  11.683  1.893   1.00 32.28 ? 1283 HOH A O     1 
HETATM 8418 O  O     . HOH J 6 .   ? 12.339  28.719  31.506  1.00 42.31 ? 1284 HOH A O     1 
HETATM 8419 O  O     . HOH J 6 .   ? -6.013  -11.947 -5.451  1.00 31.02 ? 1285 HOH A O     1 
HETATM 8420 O  O     . HOH J 6 .   ? 9.767   26.877  44.868  1.00 34.31 ? 1286 HOH A O     1 
HETATM 8421 O  O     . HOH J 6 .   ? 0.103   22.353  59.052  1.00 29.63 ? 1287 HOH A O     1 
HETATM 8422 O  O     . HOH J 6 .   ? 21.973  13.827  21.161  1.00 39.57 ? 1288 HOH A O     1 
HETATM 8423 O  O     . HOH J 6 .   ? -28.557 -17.972 40.928  1.00 17.76 ? 1289 HOH A O     1 
HETATM 8424 O  O     . HOH J 6 .   ? 33.478  25.626  27.292  1.00 33.58 ? 1290 HOH A O     1 
HETATM 8425 O  O     . HOH J 6 .   ? -3.494  40.149  55.193  1.00 28.03 ? 1291 HOH A O     1 
HETATM 8426 O  O     . HOH J 6 .   ? -6.413  -17.253 14.262  1.00 27.00 ? 1292 HOH A O     1 
HETATM 8427 O  O     . HOH J 6 .   ? -14.160 2.509   36.154  1.00 37.62 ? 1293 HOH A O     1 
HETATM 8428 O  O     . HOH J 6 .   ? -34.958 8.203   33.949  1.00 30.24 ? 1294 HOH A O     1 
HETATM 8429 O  O     . HOH J 6 .   ? 13.509  29.702  40.101  1.00 30.93 ? 1295 HOH A O     1 
HETATM 8430 O  O     . HOH J 6 .   ? -37.753 8.486   35.922  1.00 31.29 ? 1296 HOH A O     1 
HETATM 8431 O  O     . HOH J 6 .   ? -20.617 -14.066 9.484   1.00 32.76 ? 1297 HOH A O     1 
HETATM 8432 O  O     . HOH J 6 .   ? -16.835 -16.682 37.003  1.00 39.04 ? 1298 HOH A O     1 
HETATM 8433 O  O     . HOH J 6 .   ? 18.354  1.134   56.474  1.00 40.97 ? 1299 HOH A O     1 
HETATM 8434 O  O     . HOH J 6 .   ? -2.783  24.905  27.667  1.00 38.37 ? 1300 HOH A O     1 
HETATM 8435 O  O     . HOH J 6 .   ? -15.568 36.036  67.000  1.00 26.27 ? 1301 HOH A O     1 
HETATM 8436 O  O     . HOH J 6 .   ? 0.108   -15.574 1.488   1.00 13.05 ? 1302 HOH A O     1 
HETATM 8437 O  O     . HOH J 6 .   ? -3.536  9.371   1.176   1.00 34.58 ? 1303 HOH A O     1 
HETATM 8438 O  O     . HOH J 6 .   ? 29.416  26.603  44.847  1.00 32.71 ? 1304 HOH A O     1 
HETATM 8439 O  O     . HOH J 6 .   ? 2.866   45.639  51.511  1.00 32.13 ? 1305 HOH A O     1 
HETATM 8440 O  O     . HOH J 6 .   ? 6.197   10.729  39.831  1.00 33.24 ? 1306 HOH A O     1 
HETATM 8441 O  O     . HOH J 6 .   ? -5.500  -14.651 20.113  1.00 34.15 ? 1307 HOH A O     1 
HETATM 8442 O  O     . HOH J 6 .   ? -31.531 8.955   20.802  1.00 31.41 ? 1308 HOH A O     1 
HETATM 8443 O  O     . HOH J 6 .   ? 12.426  26.431  27.496  1.00 29.17 ? 1309 HOH A O     1 
HETATM 8444 O  O     . HOH J 6 .   ? -21.307 27.750  38.325  1.00 32.84 ? 1310 HOH A O     1 
HETATM 8445 O  O     . HOH J 6 .   ? -17.900 4.203   65.172  1.00 27.87 ? 1311 HOH A O     1 
HETATM 8446 O  O     . HOH J 6 .   ? 0.575   24.445  46.327  1.00 34.28 ? 1312 HOH A O     1 
HETATM 8447 O  O     . HOH J 6 .   ? -8.723  41.662  42.360  1.00 41.81 ? 1313 HOH A O     1 
HETATM 8448 O  O     . HOH J 6 .   ? 1.207   14.399  62.070  1.00 31.26 ? 1314 HOH A O     1 
HETATM 8449 O  O     . HOH J 6 .   ? -23.132 13.622  36.721  1.00 21.50 ? 1315 HOH A O     1 
HETATM 8450 O  O     . HOH J 6 .   ? 10.555  23.918  23.975  1.00 36.01 ? 1316 HOH A O     1 
HETATM 8451 O  O     . HOH J 6 .   ? 22.287  26.224  56.085  1.00 30.03 ? 1317 HOH A O     1 
HETATM 8452 O  O     . HOH J 6 .   ? 14.410  6.795   2.824   1.00 30.84 ? 1318 HOH A O     1 
HETATM 8453 O  O     . HOH J 6 .   ? 1.920   -6.966  26.569  1.00 24.57 ? 1319 HOH A O     1 
HETATM 8454 O  O     . HOH J 6 .   ? 0.395   28.984  0.696   1.00 32.10 ? 1320 HOH A O     1 
HETATM 8455 O  O     . HOH J 6 .   ? 29.075  34.263  10.487  1.00 33.49 ? 1321 HOH A O     1 
HETATM 8456 O  O     . HOH J 6 .   ? -10.098 24.055  71.388  1.00 22.85 ? 1322 HOH A O     1 
HETATM 8457 O  O     . HOH J 6 .   ? -35.348 23.673  34.341  1.00 29.60 ? 1323 HOH A O     1 
HETATM 8458 O  O     . HOH J 6 .   ? -33.942 22.727  37.948  1.00 42.33 ? 1324 HOH A O     1 
HETATM 8459 O  O     . HOH J 6 .   ? -23.604 3.209   59.887  1.00 42.22 ? 1325 HOH A O     1 
HETATM 8460 O  O     . HOH J 6 .   ? 5.501   11.081  36.561  1.00 33.38 ? 1326 HOH A O     1 
HETATM 8461 O  O     . HOH J 6 .   ? 13.563  -1.637  13.040  1.00 25.19 ? 1327 HOH A O     1 
HETATM 8462 O  O     . HOH J 6 .   ? -31.051 23.753  39.947  1.00 41.80 ? 1328 HOH A O     1 
HETATM 8463 O  O     . HOH J 6 .   ? 32.136  15.438  55.880  1.00 29.55 ? 1329 HOH A O     1 
HETATM 8464 O  O     . HOH J 6 .   ? -17.775 24.043  38.365  1.00 26.11 ? 1330 HOH A O     1 
HETATM 8465 O  O     . HOH J 6 .   ? -20.126 23.793  30.797  1.00 39.91 ? 1331 HOH A O     1 
HETATM 8466 O  O     . HOH J 6 .   ? -0.098  9.628   62.091  1.00 41.56 ? 1332 HOH A O     1 
HETATM 8467 O  O     . HOH J 6 .   ? -0.572  12.219  61.506  1.00 34.63 ? 1333 HOH A O     1 
HETATM 8468 O  O     . HOH J 6 .   ? 2.631   0.507   13.491  1.00 12.53 ? 1334 HOH A O     1 
HETATM 8469 O  O     . HOH J 6 .   ? 4.565   1.819   12.419  1.00 15.81 ? 1335 HOH A O     1 
HETATM 8470 O  O     . HOH J 6 .   ? -16.657 33.154  40.218  1.00 26.50 ? 1336 HOH A O     1 
HETATM 8471 O  O     . HOH J 6 .   ? -13.250 31.505  36.478  1.00 32.42 ? 1337 HOH A O     1 
HETATM 8472 O  O     . HOH J 6 .   ? -9.883  -14.722 21.615  1.00 32.21 ? 1338 HOH A O     1 
HETATM 8473 O  O     . HOH J 6 .   ? -12.025 -15.640 21.565  1.00 33.19 ? 1339 HOH A O     1 
HETATM 8474 O  O     . HOH J 6 .   ? 28.872  34.440  38.419  1.00 21.53 ? 1340 HOH A O     1 
HETATM 8475 O  O     . HOH J 6 .   ? 27.114  34.129  40.948  1.00 25.55 ? 1341 HOH A O     1 
HETATM 8476 O  O     . HOH J 6 .   ? 27.172  31.667  41.999  1.00 21.43 ? 1342 HOH A O     1 
HETATM 8477 O  O     . HOH J 6 .   ? -26.125 2.712   21.773  1.00 32.56 ? 1343 HOH A O     1 
HETATM 8478 O  O     . HOH J 6 .   ? -5.183  40.423  60.603  1.00 25.34 ? 1344 HOH A O     1 
HETATM 8479 O  O     . HOH J 6 .   ? -2.832  40.107  57.680  1.00 28.57 ? 1345 HOH A O     1 
HETATM 8480 O  O     . HOH J 6 .   ? -13.229 -2.947  33.586  1.00 28.32 ? 1346 HOH A O     1 
HETATM 8481 O  O     . HOH J 6 .   ? -11.495 -13.364 34.511  1.00 45.59 ? 1347 HOH A O     1 
HETATM 8482 O  O     . HOH J 6 .   ? 7.575   -8.273  20.565  1.00 40.16 ? 1348 HOH A O     1 
HETATM 8483 O  O     . HOH J 6 .   ? 23.189  4.932   16.898  1.00 45.67 ? 1349 HOH A O     1 
HETATM 8484 O  O     . HOH J 6 .   ? 22.668  6.082   10.972  1.00 44.20 ? 1350 HOH A O     1 
HETATM 8485 O  O     . HOH J 6 .   ? 1.444   -6.333  -5.859  1.00 27.46 ? 1351 HOH A O     1 
HETATM 8486 O  O     . HOH J 6 .   ? 2.233   -9.158  -6.168  1.00 39.64 ? 1352 HOH A O     1 
HETATM 8487 O  O     . HOH J 6 .   ? 4.052   -0.863  -5.560  1.00 24.24 ? 1353 HOH A O     1 
HETATM 8488 O  O     . HOH J 6 .   ? 9.658   6.631   59.601  1.00 53.70 ? 1354 HOH A O     1 
HETATM 8489 O  O     . HOH J 6 .   ? 4.404   27.813  29.749  1.00 33.11 ? 1355 HOH A O     1 
HETATM 8490 O  O     . HOH J 6 .   ? 13.450  11.045  22.672  1.00 28.33 ? 1356 HOH A O     1 
HETATM 8491 O  O     . HOH J 6 .   ? 14.254  29.736  33.435  1.00 25.38 ? 1357 HOH A O     1 
HETATM 8492 O  O     . HOH J 6 .   ? 6.435   27.905  39.612  1.00 37.50 ? 1358 HOH A O     1 
HETATM 8493 O  O     . HOH J 6 .   ? -3.408  -17.497 17.035  1.00 24.10 ? 1359 HOH A O     1 
HETATM 8494 O  O     . HOH J 6 .   ? -13.175 9.310   47.155  1.00 26.01 ? 1360 HOH A O     1 
HETATM 8495 O  O     . HOH J 6 .   ? 16.583  15.767  31.270  1.00 26.56 ? 1361 HOH A O     1 
HETATM 8496 O  O     . HOH J 6 .   ? 25.226  19.056  57.201  1.00 35.16 ? 1362 HOH A O     1 
HETATM 8497 O  O     . HOH J 6 .   ? -23.878 38.740  44.289  1.00 33.84 ? 1363 HOH A O     1 
HETATM 8498 O  O     . HOH J 6 .   ? -16.234 30.950  39.767  1.00 27.86 ? 1364 HOH A O     1 
HETATM 8499 O  O     . HOH J 6 .   ? 7.805   17.441  29.829  1.00 33.72 ? 1365 HOH A O     1 
HETATM 8500 O  O     . HOH K 6 .   ? 4.866   1.597   19.171  1.00 17.82 ? 19   HOH T O     1 
HETATM 8501 O  O     . HOH K 6 .   ? 7.589   3.920   18.703  1.00 20.57 ? 20   HOH T O     1 
HETATM 8502 O  O     . HOH K 6 .   ? 11.299  0.365   14.671  1.00 15.87 ? 21   HOH T O     1 
HETATM 8503 O  O     . HOH K 6 .   ? 18.926  6.679   17.382  1.00 18.22 ? 22   HOH T O     1 
HETATM 8504 O  O     . HOH K 6 .   ? 24.544  3.775   29.420  1.00 29.44 ? 189  HOH T O     1 
HETATM 8505 O  O     . HOH K 6 .   ? 5.529   -1.619  26.758  1.00 21.25 ? 198  HOH T O     1 
HETATM 8506 O  O     . HOH K 6 .   ? 39.620  -7.292  32.112  1.00 31.59 ? 204  HOH T O     1 
HETATM 8507 O  O     . HOH K 6 .   ? 5.240   -5.549  24.416  1.00 24.67 ? 245  HOH T O     1 
HETATM 8508 O  O     . HOH K 6 .   ? 19.874  8.113   36.192  1.00 21.46 ? 263  HOH T O     1 
HETATM 8509 O  O     . HOH K 6 .   ? 24.989  6.149   28.154  1.00 34.12 ? 277  HOH T O     1 
HETATM 8510 O  O     . HOH K 6 .   ? 26.465  8.668   33.426  1.00 32.68 ? 297  HOH T O     1 
HETATM 8511 O  O     . HOH K 6 .   ? 22.053  6.628   20.585  1.00 23.54 ? 319  HOH T O     1 
HETATM 8512 O  O     . HOH K 6 .   ? 42.200  -7.803  32.423  1.00 21.79 ? 344  HOH T O     1 
HETATM 8513 O  O     . HOH K 6 .   ? 20.662  8.032   18.707  1.00 23.88 ? 346  HOH T O     1 
HETATM 8514 O  O     . HOH K 6 .   ? 15.461  1.787   24.996  1.00 30.41 ? 370  HOH T O     1 
HETATM 8515 O  O     . HOH K 6 .   ? 22.094  4.287   38.055  1.00 35.60 ? 392  HOH T O     1 
HETATM 8516 O  O     . HOH K 6 .   ? 26.231  12.954  32.023  1.00 33.75 ? 417  HOH T O     1 
HETATM 8517 O  O     . HOH K 6 .   ? 10.000  -3.461  17.319  1.00 28.08 ? 429  HOH T O     1 
HETATM 8518 O  O     . HOH K 6 .   ? -9.459  0.611   36.850  1.00 30.87 ? 472  HOH T O     1 
HETATM 8519 O  O     . HOH K 6 .   ? -3.270  10.193  38.132  1.00 31.19 ? 489  HOH T O     1 
HETATM 8520 O  O     . HOH K 6 .   ? 26.963  4.590   29.835  1.00 44.72 ? 492  HOH T O     1 
HETATM 8521 O  O     . HOH L 6 .   ? 9.949   10.572  16.427  1.00 22.59 ? 13   HOH P O     1 
HETATM 8522 O  O     . HOH L 6 .   ? 4.741   4.230   18.450  1.00 16.52 ? 19   HOH P O     1 
HETATM 8523 O  O     . HOH L 6 .   ? 12.295  8.658   23.345  1.00 23.75 ? 64   HOH P O     1 
HETATM 8524 O  O     . HOH L 6 .   ? 5.988   5.319   29.401  1.00 22.19 ? 131  HOH P O     1 
HETATM 8525 O  O     . HOH L 6 .   ? 17.956  5.953   38.151  1.00 33.25 ? 214  HOH P O     1 
HETATM 8526 O  O     . HOH L 6 .   ? 17.008  7.501   35.928  1.00 27.96 ? 255  HOH P O     1 
HETATM 8527 O  O     . HOH L 6 .   ? 15.691  0.741   29.753  1.00 22.91 ? 267  HOH P O     1 
HETATM 8528 O  O     . HOH L 6 .   ? 7.865   17.697  22.879  1.00 25.29 ? 298  HOH P O     1 
HETATM 8529 O  O     . HOH L 6 .   ? 6.103   11.926  28.645  1.00 36.32 ? 326  HOH P O     1 
HETATM 8530 O  O     . HOH L 6 .   ? 14.617  -0.370  32.154  1.00 27.85 ? 348  HOH P O     1 
HETATM 8531 O  O     . HOH L 6 .   ? 28.280  -6.600  31.959  1.00 34.72 ? 413  HOH P O     1 
HETATM 8532 O  O     . HOH L 6 .   ? 13.425  1.739   41.585  1.00 22.00 ? 420  HOH P O     1 
HETATM 8533 O  O     . HOH L 6 .   ? 38.266  4.205   35.058  1.00 32.46 ? 421  HOH P O     1 
HETATM 8534 O  O     . HOH L 6 .   ? 14.989  10.850  31.844  1.00 43.21 ? 423  HOH P O     1 
HETATM 8535 O  O     . HOH L 6 .   ? 4.295   10.956  13.913  1.00 35.09 ? 493  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.6495 0.6455 0.7305 0.0450  -0.0200 -0.0335 1   MET A N     
2    C CA    . MET A 1   ? 0.6472 0.6379 0.7180 0.0409  -0.0202 -0.0306 1   MET A CA    
3    C C     . MET A 1   ? 0.6159 0.6131 0.6946 0.0369  -0.0170 -0.0300 1   MET A C     
4    O O     . MET A 1   ? 0.5809 0.5861 0.6714 0.0365  -0.0131 -0.0313 1   MET A O     
5    C CB    . MET A 1   ? 0.6790 0.6623 0.7367 0.0394  -0.0172 -0.0276 1   MET A CB    
6    C CG    . MET A 1   ? 0.7438 0.7302 0.8036 0.0379  -0.0101 -0.0266 1   MET A CG    
7    S SD    . MET A 1   ? 0.8440 0.8207 0.8886 0.0373  -0.0082 -0.0238 1   MET A SD    
8    C CE    . MET A 1   ? 0.8194 0.7917 0.8557 0.0326  -0.0094 -0.0210 1   MET A CE    
9    N N     . LYS A 2   ? 0.5826 0.5761 0.6547 0.0340  -0.0185 -0.0283 2   LYS A N     
10   C CA    . LYS A 2   ? 0.5726 0.5705 0.6494 0.0301  -0.0154 -0.0274 2   LYS A CA    
11   C C     . LYS A 2   ? 0.5273 0.5245 0.6001 0.0274  -0.0091 -0.0250 2   LYS A C     
12   O O     . LYS A 2   ? 0.4959 0.4870 0.5584 0.0275  -0.0084 -0.0233 2   LYS A O     
13   C CB    . LYS A 2   ? 0.6102 0.6035 0.6802 0.0283  -0.0191 -0.0264 2   LYS A CB    
14   C CG    . LYS A 2   ? 0.6757 0.6713 0.7524 0.0296  -0.0246 -0.0288 2   LYS A CG    
15   C CD    . LYS A 2   ? 0.7209 0.7252 0.8112 0.0275  -0.0224 -0.0299 2   LYS A CD    
16   C CE    . LYS A 2   ? 0.7697 0.7750 0.8652 0.0280  -0.0284 -0.0320 2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.7666 0.7662 0.8527 0.0258  -0.0300 -0.0305 2   LYS A NZ    
18   N N     . GLU A 3   ? 0.5029 0.5060 0.5836 0.0251  -0.0047 -0.0250 3   GLU A N     
19   C CA    . GLU A 3   ? 0.4968 0.4986 0.5737 0.0228  0.0011  -0.0230 3   GLU A CA    
20   C C     . GLU A 3   ? 0.4524 0.4490 0.5198 0.0198  0.0009  -0.0205 3   GLU A C     
21   O O     . GLU A 3   ? 0.4290 0.4251 0.4956 0.0187  -0.0023 -0.0205 3   GLU A O     
22   C CB    . GLU A 3   ? 0.5110 0.5197 0.5987 0.0211  0.0059  -0.0238 3   GLU A CB    
23   C CG    . GLU A 3   ? 0.6154 0.6311 0.7158 0.0238  0.0059  -0.0267 3   GLU A CG    
24   C CD    . GLU A 3   ? 0.6922 0.7139 0.8022 0.0221  0.0125  -0.0272 3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.7339 0.7594 0.8506 0.0246  0.0151  -0.0290 3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.7102 0.7325 0.8209 0.0183  0.0153  -0.0259 3   GLU A OE2   
27   N N     . PHE A 4   ? 0.3857 0.3782 0.4459 0.0188  0.0042  -0.0187 4   PHE A N     
28   C CA    . PHE A 4   ? 0.3150 0.3036 0.3683 0.0159  0.0044  -0.0166 4   PHE A CA    
29   C C     . PHE A 4   ? 0.3096 0.2959 0.3595 0.0142  0.0088  -0.0151 4   PHE A C     
30   O O     . PHE A 4   ? 0.3046 0.2888 0.3519 0.0157  0.0110  -0.0151 4   PHE A O     
31   C CB    . PHE A 4   ? 0.3203 0.3030 0.3646 0.0164  0.0010  -0.0157 4   PHE A CB    
32   C CG    . PHE A 4   ? 0.3294 0.3071 0.3670 0.0182  0.0011  -0.0151 4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.3273 0.3046 0.3654 0.0216  -0.0009 -0.0165 4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.3189 0.2918 0.3494 0.0167  0.0026  -0.0133 4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.3779 0.3497 0.4090 0.0234  -0.0011 -0.0160 4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.3126 0.2800 0.3363 0.0183  0.0022  -0.0128 4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.3349 0.3017 0.3587 0.0217  0.0005  -0.0141 4   PHE A CZ    
38   N N     . TYR A 5   ? 0.2874 0.2733 0.3365 0.0113  0.0096  -0.0141 5   TYR A N     
39   C CA    . TYR A 5   ? 0.2986 0.2810 0.3433 0.0098  0.0130  -0.0127 5   TYR A CA    
40   C C     . TYR A 5   ? 0.2988 0.2745 0.3341 0.0103  0.0120  -0.0114 5   TYR A C     
41   O O     . TYR A 5   ? 0.2892 0.2631 0.3212 0.0107  0.0088  -0.0111 5   TYR A O     
42   C CB    . TYR A 5   ? 0.2844 0.2674 0.3303 0.0069  0.0133  -0.0121 5   TYR A CB    
43   C CG    . TYR A 5   ? 0.2691 0.2502 0.3113 0.0058  0.0100  -0.0114 5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.2043 0.1884 0.2498 0.0058  0.0073  -0.0122 5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2793 0.2553 0.3147 0.0050  0.0097  -0.0100 5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.2729 0.2552 0.3150 0.0049  0.0052  -0.0116 5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.2962 0.2713 0.3297 0.0040  0.0073  -0.0096 5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.2681 0.2465 0.3048 0.0039  0.0055  -0.0104 5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.3544 0.3319 0.3891 0.0030  0.0039  -0.0101 5   TYR A OH    
50   N N     . LEU A 6   ? 0.3075 0.2789 0.3380 0.0102  0.0148  -0.0106 6   LEU A N     
51   C CA    . LEU A 6   ? 0.2838 0.2481 0.3053 0.0103  0.0136  -0.0093 6   LEU A CA    
52   C C     . LEU A 6   ? 0.3073 0.2686 0.3260 0.0078  0.0136  -0.0082 6   LEU A C     
53   O O     . LEU A 6   ? 0.3047 0.2638 0.3207 0.0068  0.0108  -0.0075 6   LEU A O     
54   C CB    . LEU A 6   ? 0.3080 0.2680 0.3248 0.0124  0.0161  -0.0094 6   LEU A CB    
55   C CG    . LEU A 6   ? 0.2540 0.2161 0.2730 0.0154  0.0154  -0.0106 6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.2092 0.1676 0.2242 0.0177  0.0187  -0.0110 6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.2617 0.2210 0.2765 0.0159  0.0109  -0.0102 6   LEU A CD2   
58   N N     . THR A 7   ? 0.3089 0.2700 0.3284 0.0069  0.0169  -0.0081 7   THR A N     
59   C CA    . THR A 7   ? 0.3160 0.2738 0.3328 0.0048  0.0168  -0.0073 7   THR A CA    
60   C C     . THR A 7   ? 0.3323 0.2936 0.3544 0.0032  0.0198  -0.0077 7   THR A C     
61   O O     . THR A 7   ? 0.3600 0.3248 0.3866 0.0038  0.0230  -0.0084 7   THR A O     
62   C CB    . THR A 7   ? 0.3489 0.2977 0.3562 0.0051  0.0174  -0.0063 7   THR A CB    
63   O OG1   . THR A 7   ? 0.3386 0.2856 0.3441 0.0060  0.0221  -0.0065 7   THR A OG1   
64   C CG2   . THR A 7   ? 0.3034 0.2477 0.3051 0.0065  0.0142  -0.0059 7   THR A CG2   
65   N N     . VAL A 8   ? 0.3198 0.2799 0.3416 0.0013  0.0187  -0.0072 8   VAL A N     
66   C CA    . VAL A 8   ? 0.3258 0.2874 0.3511 -0.0006 0.0212  -0.0074 8   VAL A CA    
67   C C     . VAL A 8   ? 0.3527 0.3071 0.3711 -0.0020 0.0204  -0.0064 8   VAL A C     
68   O O     . VAL A 8   ? 0.3579 0.3098 0.3734 -0.0018 0.0167  -0.0061 8   VAL A O     
69   C CB    . VAL A 8   ? 0.3125 0.2818 0.3468 -0.0015 0.0194  -0.0084 8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.2307 0.1999 0.2640 -0.0017 0.0151  -0.0083 8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.3394 0.3101 0.3777 -0.0037 0.0219  -0.0085 8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3694 0.3201 0.3853 -0.0033 0.0241  -0.0059 9   GLU A N     
73   C CA    . GLU A 9   ? 0.3799 0.3225 0.3884 -0.0046 0.0234  -0.0051 9   GLU A CA    
74   C C     . GLU A 9   ? 0.3875 0.3306 0.3987 -0.0071 0.0265  -0.0050 9   GLU A C     
75   O O     . GLU A 9   ? 0.3941 0.3418 0.4110 -0.0078 0.0307  -0.0054 9   GLU A O     
76   C CB    . GLU A 9   ? 0.3873 0.3198 0.3845 -0.0036 0.0247  -0.0041 9   GLU A CB    
77   C CG    . GLU A 9   ? 0.3660 0.2966 0.3596 -0.0013 0.0217  -0.0041 9   GLU A CG    
78   C CD    . GLU A 9   ? 0.3773 0.3058 0.3694 -0.0011 0.0158  -0.0041 9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.3338 0.2626 0.3278 -0.0024 0.0139  -0.0043 9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.3723 0.2990 0.3618 0.0003  0.0131  -0.0041 9   GLU A OE2   
81   N N     . GLN A 10  ? 0.3934 0.3319 0.4013 -0.0085 0.0243  -0.0046 10  GLN A N     
82   C CA    . GLN A 10  ? 0.3971 0.3323 0.4038 -0.0110 0.0275  -0.0041 10  GLN A CA    
83   C C     . GLN A 10  ? 0.4287 0.3512 0.4223 -0.0113 0.0292  -0.0029 10  GLN A C     
84   O O     . GLN A 10  ? 0.4448 0.3602 0.4309 -0.0102 0.0249  -0.0026 10  GLN A O     
85   C CB    . GLN A 10  ? 0.3946 0.3314 0.4048 -0.0124 0.0240  -0.0046 10  GLN A CB    
86   C CG    . GLN A 10  ? 0.3962 0.3270 0.4030 -0.0152 0.0267  -0.0038 10  GLN A CG    
87   C CD    . GLN A 10  ? 0.4207 0.3511 0.4289 -0.0163 0.0228  -0.0043 10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.3894 0.3248 0.4022 -0.0148 0.0184  -0.0053 10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.4455 0.3692 0.4493 -0.0188 0.0245  -0.0035 10  GLN A NE2   
90   N N     . ILE A 11  ? 0.4206 0.3399 0.4115 -0.0127 0.0354  -0.0022 11  ILE A N     
91   C CA    . ILE A 11  ? 0.4421 0.3478 0.4190 -0.0132 0.0379  -0.0009 11  ILE A CA    
92   C C     . ILE A 11  ? 0.4588 0.3620 0.4358 -0.0167 0.0427  -0.0003 11  ILE A C     
93   O O     . ILE A 11  ? 0.4450 0.3527 0.4275 -0.0182 0.0490  -0.0004 11  ILE A O     
94   C CB    . ILE A 11  ? 0.4542 0.3558 0.4246 -0.0113 0.0417  -0.0006 11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.4664 0.3694 0.4362 -0.0081 0.0364  -0.0012 11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.4807 0.3667 0.4350 -0.0119 0.0449  0.0008  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.5143 0.4143 0.4788 -0.0058 0.0395  -0.0011 11  ILE A CD1   
98   N N     . GLY A 12  ? 0.4738 0.3699 0.4452 -0.0181 0.0394  0.0002  12  GLY A N     
99   C CA    . GLY A 12  ? 0.4984 0.3920 0.4702 -0.0218 0.0429  0.0008  12  GLY A CA    
100  C C     . GLY A 12  ? 0.5026 0.4104 0.4909 -0.0234 0.0440  -0.0003 12  GLY A C     
101  O O     . GLY A 12  ? 0.4893 0.4048 0.4855 -0.0222 0.0386  -0.0014 12  GLY A O     
102  N N     . ASP A 13  ? 0.4978 0.4084 0.4910 -0.0260 0.0509  -0.0001 13  ASP A N     
103  C CA    . ASP A 13  ? 0.4700 0.3935 0.4793 -0.0278 0.0519  -0.0013 13  ASP A CA    
104  C C     . ASP A 13  ? 0.4579 0.3929 0.4781 -0.0257 0.0538  -0.0026 13  ASP A C     
105  O O     . ASP A 13  ? 0.4418 0.3871 0.4756 -0.0270 0.0553  -0.0037 13  ASP A O     
106  C CB    . ASP A 13  ? 0.4753 0.3962 0.4862 -0.0324 0.0578  -0.0005 13  ASP A CB    
107  C CG    . ASP A 13  ? 0.4752 0.3871 0.4787 -0.0346 0.0546  0.0004  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.5625 0.4650 0.5584 -0.0379 0.0594  0.0017  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.4594 0.3732 0.4645 -0.0331 0.0474  -0.0004 13  ASP A OD2   
110  N N     . SER A 14  ? 0.4290 0.3618 0.4432 -0.0223 0.0530  -0.0025 14  SER A N     
111  C CA    . SER A 14  ? 0.4356 0.3780 0.4587 -0.0199 0.0542  -0.0038 14  SER A CA    
112  C C     . SER A 14  ? 0.4054 0.3514 0.4292 -0.0165 0.0475  -0.0045 14  SER A C     
113  O O     . SER A 14  ? 0.3900 0.3286 0.4039 -0.0152 0.0434  -0.0038 14  SER A O     
114  C CB    . SER A 14  ? 0.4389 0.3765 0.4558 -0.0190 0.0609  -0.0033 14  SER A CB    
115  O OG    . SER A 14  ? 0.4502 0.3899 0.4727 -0.0221 0.0685  -0.0033 14  SER A OG    
116  N N     . ILE A 15  ? 0.3839 0.3409 0.4195 -0.0153 0.0461  -0.0060 15  ILE A N     
117  C CA    . ILE A 15  ? 0.3827 0.3430 0.4188 -0.0120 0.0412  -0.0067 15  ILE A CA    
118  C C     . ILE A 15  ? 0.3746 0.3339 0.4079 -0.0095 0.0446  -0.0068 15  ILE A C     
119  O O     . ILE A 15  ? 0.4127 0.3771 0.4530 -0.0096 0.0493  -0.0076 15  ILE A O     
120  C CB    . ILE A 15  ? 0.3525 0.3234 0.4009 -0.0116 0.0375  -0.0082 15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.2976 0.2682 0.3470 -0.0134 0.0335  -0.0082 15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3511 0.3252 0.4000 -0.0082 0.0339  -0.0089 15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.3712 0.3358 0.4118 -0.0124 0.0289  -0.0075 15  ILE A CD1   
124  N N     . PHE A 16  ? 0.3618 0.3149 0.3855 -0.0074 0.0420  -0.0061 16  PHE A N     
125  C CA    . PHE A 16  ? 0.3663 0.3183 0.3868 -0.0045 0.0438  -0.0064 16  PHE A CA    
126  C C     . PHE A 16  ? 0.3680 0.3256 0.3927 -0.0021 0.0385  -0.0073 16  PHE A C     
127  O O     . PHE A 16  ? 0.3295 0.2851 0.3509 -0.0019 0.0334  -0.0068 16  PHE A O     
128  C CB    . PHE A 16  ? 0.3476 0.2871 0.3532 -0.0038 0.0445  -0.0050 16  PHE A CB    
129  C CG    . PHE A 16  ? 0.3955 0.3281 0.3950 -0.0054 0.0513  -0.0043 16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.3911 0.3222 0.3883 -0.0040 0.0572  -0.0046 16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.3977 0.3248 0.3932 -0.0084 0.0520  -0.0033 16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.4606 0.3848 0.4515 -0.0057 0.0644  -0.0038 16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.4241 0.3437 0.4128 -0.0103 0.0587  -0.0024 16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.4204 0.3386 0.4068 -0.0090 0.0652  -0.0026 16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3357 0.3002 0.3680 -0.0003 0.0398  -0.0086 17  GLU A N     
136  C CA    . GLU A 17  ? 0.3404 0.3096 0.3763 0.0019  0.0350  -0.0094 17  GLU A CA    
137  C C     . GLU A 17  ? 0.3586 0.3268 0.3921 0.0051  0.0362  -0.0100 17  GLU A C     
138  O O     . GLU A 17  ? 0.3936 0.3644 0.4312 0.0060  0.0409  -0.0109 17  GLU A O     
139  C CB    . GLU A 17  ? 0.3384 0.3172 0.3867 0.0014  0.0333  -0.0109 17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3917 0.3736 0.4417 0.0035  0.0279  -0.0116 17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3769 0.3673 0.4383 0.0041  0.0263  -0.0134 17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.3693 0.3611 0.4310 0.0058  0.0219  -0.0140 17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3633 0.3584 0.4330 0.0028  0.0292  -0.0143 17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3477 0.3124 0.3751 0.0068  0.0320  -0.0096 18  ARG A N     
145  C CA    . ARG A 18  ? 0.3530 0.3173 0.3788 0.0100  0.0317  -0.0103 18  ARG A CA    
146  C C     . ARG A 18  ? 0.3196 0.2907 0.3529 0.0110  0.0275  -0.0114 18  ARG A C     
147  O O     . ARG A 18  ? 0.2970 0.2692 0.3310 0.0095  0.0237  -0.0109 18  ARG A O     
148  C CB    . ARG A 18  ? 0.3647 0.3197 0.3785 0.0109  0.0295  -0.0090 18  ARG A CB    
149  C CG    . ARG A 18  ? 0.3970 0.3432 0.4014 0.0104  0.0331  -0.0080 18  ARG A CG    
150  C CD    . ARG A 18  ? 0.3554 0.2921 0.3484 0.0111  0.0294  -0.0069 18  ARG A CD    
151  N NE    . ARG A 18  ? 0.3350 0.2691 0.3241 0.0141  0.0288  -0.0074 18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.3606 0.2877 0.3416 0.0150  0.0248  -0.0067 18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.2841 0.2069 0.2611 0.0131  0.0210  -0.0056 18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.2991 0.2235 0.2764 0.0178  0.0243  -0.0072 18  ARG A NH2   
155  N N     . TYR A 19  ? 0.3029 0.2781 0.3413 0.0136  0.0281  -0.0129 19  TYR A N     
156  C CA    . TYR A 19  ? 0.3130 0.2938 0.3580 0.0148  0.0238  -0.0142 19  TYR A CA    
157  C C     . TYR A 19  ? 0.3488 0.3300 0.3943 0.0186  0.0230  -0.0156 19  TYR A C     
158  O O     . TYR A 19  ? 0.3496 0.3286 0.3929 0.0204  0.0268  -0.0160 19  TYR A O     
159  C CB    . TYR A 19  ? 0.3296 0.3183 0.3861 0.0132  0.0241  -0.0154 19  TYR A CB    
160  C CG    . TYR A 19  ? 0.3360 0.3304 0.4019 0.0139  0.0288  -0.0170 19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.3411 0.3336 0.4057 0.0123  0.0350  -0.0163 19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.3709 0.3722 0.4470 0.0162  0.0271  -0.0193 19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3725 0.3706 0.4465 0.0126  0.0402  -0.0179 19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3356 0.3432 0.4223 0.0168  0.0315  -0.0211 19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3690 0.3753 0.4550 0.0149  0.0384  -0.0204 19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.3651 0.3781 0.4624 0.0153  0.0435  -0.0222 19  TYR A OH    
167  N N     . ILE A 20  ? 0.3651 0.3483 0.4128 0.0201  0.0182  -0.0164 20  ILE A N     
168  C CA    . ILE A 20  ? 0.3664 0.3504 0.4158 0.0239  0.0165  -0.0181 20  ILE A CA    
169  C C     . ILE A 20  ? 0.3491 0.3417 0.4116 0.0248  0.0157  -0.0205 20  ILE A C     
170  O O     . ILE A 20  ? 0.3477 0.3432 0.4140 0.0234  0.0124  -0.0206 20  ILE A O     
171  C CB    . ILE A 20  ? 0.3587 0.3372 0.4001 0.0250  0.0110  -0.0174 20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.3494 0.3194 0.3790 0.0242  0.0113  -0.0153 20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.3494 0.3287 0.3931 0.0290  0.0081  -0.0194 20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.3327 0.2986 0.3576 0.0264  0.0147  -0.0155 20  ILE A CD1   
175  N N     . ASP A 21  ? 0.3511 0.3480 0.4209 0.0273  0.0187  -0.0224 21  ASP A N     
176  C CA    . ASP A 21  ? 0.3325 0.3385 0.4167 0.0281  0.0182  -0.0250 21  ASP A CA    
177  C C     . ASP A 21  ? 0.3558 0.3625 0.4422 0.0317  0.0117  -0.0269 21  ASP A C     
178  O O     . ASP A 21  ? 0.3710 0.3707 0.4469 0.0333  0.0081  -0.0260 21  ASP A O     
179  C CB    . ASP A 21  ? 0.3165 0.3278 0.4096 0.0289  0.0249  -0.0265 21  ASP A CB    
180  C CG    . ASP A 21  ? 0.3372 0.3463 0.4276 0.0334  0.0263  -0.0278 21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.3543 0.3593 0.4390 0.0365  0.0210  -0.0282 21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.3753 0.3863 0.4691 0.0340  0.0330  -0.0285 21  ASP A OD2   
183  N N     . SER A 22  ? 0.3656 0.3801 0.4654 0.0329  0.0100  -0.0295 22  SER A N     
184  C CA    . SER A 22  ? 0.3909 0.4057 0.4933 0.0364  0.0029  -0.0316 22  SER A CA    
185  C C     . SER A 22  ? 0.3849 0.3959 0.4828 0.0411  0.0015  -0.0328 22  SER A C     
186  O O     . SER A 22  ? 0.3929 0.4003 0.4874 0.0440  -0.0049 -0.0338 22  SER A O     
187  C CB    . SER A 22  ? 0.3976 0.4216 0.5164 0.0368  0.0009  -0.0345 22  SER A CB    
188  O OG    . SER A 22  ? 0.4732 0.5050 0.6041 0.0365  0.0074  -0.0359 22  SER A OG    
189  N N     . ASN A 23  ? 0.3781 0.3886 0.4744 0.0421  0.0074  -0.0326 23  ASN A N     
190  C CA    . ASN A 23  ? 0.4050 0.4110 0.4960 0.0467  0.0064  -0.0336 23  ASN A CA    
191  C C     . ASN A 23  ? 0.4217 0.4167 0.4953 0.0460  0.0062  -0.0307 23  ASN A C     
192  O O     . ASN A 23  ? 0.4450 0.4346 0.5118 0.0495  0.0053  -0.0312 23  ASN A O     
193  C CB    . ASN A 23  ? 0.4259 0.4379 0.5263 0.0491  0.0128  -0.0358 23  ASN A CB    
194  C CG    . ASN A 23  ? 0.4302 0.4537 0.5497 0.0502  0.0126  -0.0392 23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.4683 0.4937 0.5935 0.0534  0.0060  -0.0416 23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.4600 0.4904 0.5893 0.0473  0.0195  -0.0393 23  ASN A ND2   
197  N N     . GLY A 24  ? 0.4165 0.4083 0.4833 0.0416  0.0067  -0.0279 24  GLY A N     
198  C CA    . GLY A 24  ? 0.4070 0.3890 0.4588 0.0404  0.0059  -0.0252 24  GLY A CA    
199  C C     . GLY A 24  ? 0.4055 0.3839 0.4515 0.0397  0.0117  -0.0239 24  GLY A C     
200  O O     . GLY A 24  ? 0.3999 0.3699 0.4340 0.0398  0.0108  -0.0223 24  GLY A O     
201  N N     . ARG A 25  ? 0.3879 0.3721 0.4418 0.0387  0.0176  -0.0246 25  ARG A N     
202  C CA    . ARG A 25  ? 0.4163 0.3964 0.4640 0.0381  0.0236  -0.0234 25  ARG A CA    
203  C C     . ARG A 25  ? 0.4127 0.3916 0.4577 0.0332  0.0261  -0.0211 25  ARG A C     
204  O O     . ARG A 25  ? 0.3925 0.3773 0.4454 0.0306  0.0257  -0.0211 25  ARG A O     
205  C CB    . ARG A 25  ? 0.4090 0.3950 0.4660 0.0405  0.0295  -0.0258 25  ARG A CB    
206  C CG    . ARG A 25  ? 0.4048 0.3914 0.4643 0.0459  0.0273  -0.0284 25  ARG A CG    
207  C CD    . ARG A 25  ? 0.3901 0.3872 0.4657 0.0478  0.0311  -0.0315 25  ARG A CD    
208  N NE    . ARG A 25  ? 0.4210 0.4177 0.4977 0.0534  0.0315  -0.0340 25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.3725 0.3779 0.4632 0.0562  0.0351  -0.0372 25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.3557 0.3711 0.4609 0.0536  0.0386  -0.0382 25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.3887 0.3929 0.4791 0.0617  0.0352  -0.0396 25  ARG A NH2   
212  N N     . GLU A 26  ? 0.4173 0.3878 0.4507 0.0323  0.0281  -0.0192 26  GLU A N     
213  C CA    . GLU A 26  ? 0.4211 0.3893 0.4510 0.0283  0.0303  -0.0172 26  GLU A CA    
214  C C     . GLU A 26  ? 0.4368 0.4085 0.4722 0.0273  0.0375  -0.0178 26  GLU A C     
215  O O     . GLU A 26  ? 0.4298 0.4004 0.4645 0.0297  0.0422  -0.0188 26  GLU A O     
216  C CB    . GLU A 26  ? 0.4143 0.3715 0.4297 0.0278  0.0291  -0.0151 26  GLU A CB    
217  C CG    . GLU A 26  ? 0.3899 0.3439 0.4012 0.0240  0.0306  -0.0132 26  GLU A CG    
218  C CD    . GLU A 26  ? 0.4614 0.4049 0.4597 0.0234  0.0278  -0.0114 26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.4525 0.3923 0.4459 0.0250  0.0236  -0.0113 26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.3863 0.3251 0.3793 0.0213  0.0296  -0.0102 26  GLU A OE2   
221  N N     . ARG A 27  ? 0.4068 0.3824 0.4476 0.0236  0.0385  -0.0171 27  ARG A N     
222  C CA    . ARG A 27  ? 0.4149 0.3933 0.4607 0.0216  0.0452  -0.0173 27  ARG A CA    
223  C C     . ARG A 27  ? 0.3891 0.3630 0.4289 0.0175  0.0453  -0.0151 27  ARG A C     
224  O O     . ARG A 27  ? 0.3887 0.3598 0.4239 0.0164  0.0400  -0.0139 27  ARG A O     
225  C CB    . ARG A 27  ? 0.4512 0.4413 0.5137 0.0214  0.0460  -0.0195 27  ARG A CB    
226  C CG    . ARG A 27  ? 0.5484 0.5441 0.6185 0.0254  0.0426  -0.0219 27  ARG A CG    
227  C CD    . ARG A 27  ? 0.6447 0.6415 0.7174 0.0289  0.0480  -0.0238 27  ARG A CD    
228  N NE    . ARG A 27  ? 0.7400 0.7442 0.8246 0.0273  0.0549  -0.0251 27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.7631 0.7781 0.8642 0.0268  0.0541  -0.0272 27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.7204 0.7394 0.8271 0.0280  0.0464  -0.0282 27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.7588 0.7800 0.8706 0.0250  0.0611  -0.0282 27  ARG A NH2   
232  N N     . THR A 28  ? 0.3722 0.3452 0.4124 0.0154  0.0516  -0.0147 28  THR A N     
233  C CA    . THR A 28  ? 0.3870 0.3555 0.4222 0.0116  0.0520  -0.0128 28  THR A CA    
234  C C     . THR A 28  ? 0.3940 0.3688 0.4395 0.0089  0.0574  -0.0135 28  THR A C     
235  O O     . THR A 28  ? 0.3960 0.3750 0.4481 0.0100  0.0630  -0.0149 28  THR A O     
236  C CB    . THR A 28  ? 0.4042 0.3601 0.4235 0.0116  0.0544  -0.0111 28  THR A CB    
237  O OG1   . THR A 28  ? 0.4869 0.4371 0.4977 0.0146  0.0505  -0.0109 28  THR A OG1   
238  C CG2   . THR A 28  ? 0.3486 0.2988 0.3616 0.0083  0.0523  -0.0093 28  THR A CG2   
239  N N     . ARG A 29  ? 0.3856 0.3611 0.4329 0.0054  0.0557  -0.0125 29  ARG A N     
240  C CA    . ARG A 29  ? 0.3794 0.3598 0.4358 0.0022  0.0604  -0.0129 29  ARG A CA    
241  C C     . ARG A 29  ? 0.3959 0.3702 0.4457 -0.0015 0.0598  -0.0110 29  ARG A C     
242  O O     . ARG A 29  ? 0.3569 0.3267 0.3997 -0.0016 0.0542  -0.0099 29  ARG A O     
243  C CB    . ARG A 29  ? 0.3760 0.3686 0.4489 0.0022  0.0576  -0.0150 29  ARG A CB    
244  C CG    . ARG A 29  ? 0.4071 0.4013 0.4808 0.0019  0.0496  -0.0147 29  ARG A CG    
245  C CD    . ARG A 29  ? 0.4415 0.4463 0.5301 0.0024  0.0465  -0.0169 29  ARG A CD    
246  N NE    . ARG A 29  ? 0.4173 0.4225 0.5044 0.0037  0.0389  -0.0171 29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.4552 0.4668 0.5510 0.0057  0.0346  -0.0190 29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.4793 0.4984 0.5874 0.0068  0.0366  -0.0212 29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.4727 0.4829 0.5648 0.0066  0.0283  -0.0188 29  ARG A NH2   
250  N N     . GLU A 30  ? 0.4221 0.3962 0.4746 -0.0047 0.0657  -0.0107 30  GLU A N     
251  C CA    . GLU A 30  ? 0.4447 0.4132 0.4920 -0.0083 0.0653  -0.0091 30  GLU A CA    
252  C C     . GLU A 30  ? 0.4444 0.4224 0.5065 -0.0112 0.0654  -0.0102 30  GLU A C     
253  O O     . GLU A 30  ? 0.4517 0.4365 0.5246 -0.0121 0.0707  -0.0114 30  GLU A O     
254  C CB    . GLU A 30  ? 0.4661 0.4239 0.5017 -0.0099 0.0723  -0.0076 30  GLU A CB    
255  C CG    . GLU A 30  ? 0.5181 0.4680 0.5463 -0.0135 0.0718  -0.0059 30  GLU A CG    
256  C CD    . GLU A 30  ? 0.5162 0.4543 0.5319 -0.0153 0.0790  -0.0044 30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.4838 0.4184 0.4941 -0.0131 0.0839  -0.0045 30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.5822 0.5139 0.5927 -0.0186 0.0797  -0.0031 30  GLU A OE2   
259  N N     . VAL A 31  ? 0.4248 0.4034 0.4877 -0.0126 0.0594  -0.0098 31  VAL A N     
260  C CA    . VAL A 31  ? 0.4211 0.4080 0.4973 -0.0151 0.0580  -0.0109 31  VAL A CA    
261  C C     . VAL A 31  ? 0.4314 0.4121 0.5024 -0.0189 0.0577  -0.0094 31  VAL A C     
262  O O     . VAL A 31  ? 0.3939 0.3673 0.4543 -0.0186 0.0537  -0.0082 31  VAL A O     
263  C CB    . VAL A 31  ? 0.4006 0.3945 0.4837 -0.0128 0.0503  -0.0123 31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.4601 0.4618 0.5565 -0.0151 0.0484  -0.0136 31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.4448 0.4434 0.5315 -0.0088 0.0499  -0.0137 31  VAL A CG2   
266  N N     . GLU A 32  ? 0.4309 0.4144 0.5099 -0.0226 0.0621  -0.0096 32  GLU A N     
267  C CA    . GLU A 32  ? 0.4735 0.4514 0.5487 -0.0265 0.0618  -0.0084 32  GLU A CA    
268  C C     . GLU A 32  ? 0.4568 0.4407 0.5403 -0.0268 0.0546  -0.0095 32  GLU A C     
269  O O     . GLU A 32  ? 0.4598 0.4493 0.5543 -0.0297 0.0551  -0.0104 32  GLU A O     
270  C CB    . GLU A 32  ? 0.5147 0.4920 0.5939 -0.0306 0.0701  -0.0080 32  GLU A CB    
271  C CG    . GLU A 32  ? 0.5742 0.5437 0.6430 -0.0302 0.0778  -0.0068 32  GLU A CG    
272  C CD    . GLU A 32  ? 0.6479 0.6177 0.7219 -0.0344 0.0871  -0.0066 32  GLU A CD    
273  O OE1   . GLU A 32  ? 0.6990 0.6588 0.7635 -0.0380 0.0899  -0.0047 32  GLU A OE1   
274  O OE2   . GLU A 32  ? 0.6206 0.6004 0.7083 -0.0342 0.0916  -0.0083 32  GLU A OE2   
275  N N     . TYR A 33  ? 0.4488 0.4313 0.5268 -0.0239 0.0481  -0.0095 33  TYR A N     
276  C CA    . TYR A 33  ? 0.3958 0.3833 0.4796 -0.0233 0.0412  -0.0107 33  TYR A CA    
277  C C     . TYR A 33  ? 0.3723 0.3559 0.4549 -0.0267 0.0395  -0.0101 33  TYR A C     
278  O O     . TYR A 33  ? 0.3683 0.3426 0.4397 -0.0277 0.0399  -0.0085 33  TYR A O     
279  C CB    . TYR A 33  ? 0.3961 0.3812 0.4721 -0.0197 0.0360  -0.0105 33  TYR A CB    
280  C CG    . TYR A 33  ? 0.3697 0.3587 0.4496 -0.0186 0.0294  -0.0116 33  TYR A CG    
281  C CD1   . TYR A 33  ? 0.3822 0.3796 0.4733 -0.0177 0.0270  -0.0135 33  TYR A CD1   
282  C CD2   . TYR A 33  ? 0.3922 0.3760 0.4644 -0.0183 0.0253  -0.0110 33  TYR A CD2   
283  C CE1   . TYR A 33  ? 0.3801 0.3795 0.4729 -0.0166 0.0210  -0.0145 33  TYR A CE1   
284  C CE2   . TYR A 33  ? 0.3395 0.3261 0.4143 -0.0172 0.0199  -0.0121 33  TYR A CE2   
285  C CZ    . TYR A 33  ? 0.3415 0.3355 0.4259 -0.0164 0.0179  -0.0137 33  TYR A CZ    
286  O OH    . TYR A 33  ? 0.3244 0.3197 0.4097 -0.0152 0.0126  -0.0148 33  TYR A OH    
287  N N     . LYS A 34  ? 0.3180 0.3081 0.4118 -0.0282 0.0371  -0.0115 34  LYS A N     
288  C CA    . LYS A 34  ? 0.3503 0.3370 0.4438 -0.0312 0.0348  -0.0112 34  LYS A CA    
289  C C     . LYS A 34  ? 0.3304 0.3174 0.4217 -0.0287 0.0273  -0.0120 34  LYS A C     
290  O O     . LYS A 34  ? 0.2993 0.2933 0.3988 -0.0271 0.0236  -0.0137 34  LYS A O     
291  C CB    . LYS A 34  ? 0.3540 0.3471 0.4613 -0.0346 0.0364  -0.0124 34  LYS A CB    
292  C CG    . LYS A 34  ? 0.4373 0.4342 0.5518 -0.0365 0.0443  -0.0124 34  LYS A CG    
293  C CD    . LYS A 34  ? 0.5102 0.4998 0.6198 -0.0411 0.0504  -0.0106 34  LYS A CD    
294  C CE    . LYS A 34  ? 0.5888 0.5817 0.7096 -0.0457 0.0504  -0.0113 34  LYS A CE    
295  N NZ    . LYS A 34  ? 0.6096 0.6119 0.7461 -0.0478 0.0561  -0.0126 34  LYS A NZ    
296  N N     . PRO A 35  ? 0.3340 0.3132 0.4139 -0.0280 0.0250  -0.0110 35  PRO A N     
297  C CA    . PRO A 35  ? 0.3274 0.3072 0.4055 -0.0255 0.0187  -0.0119 35  PRO A CA    
298  C C     . PRO A 35  ? 0.3228 0.3029 0.4053 -0.0274 0.0151  -0.0128 35  PRO A C     
299  O O     . PRO A 35  ? 0.3112 0.2894 0.3963 -0.0310 0.0174  -0.0124 35  PRO A O     
300  C CB    . PRO A 35  ? 0.3139 0.2855 0.3798 -0.0243 0.0180  -0.0106 35  PRO A CB    
301  C CG    . PRO A 35  ? 0.3393 0.3039 0.4001 -0.0274 0.0220  -0.0092 35  PRO A CG    
302  C CD    . PRO A 35  ? 0.3631 0.3323 0.4315 -0.0293 0.0276  -0.0091 35  PRO A CD    
303  N N     . SER A 36  ? 0.3256 0.3077 0.4086 -0.0251 0.0098  -0.0141 36  SER A N     
304  C CA    . SER A 36  ? 0.3103 0.2910 0.3949 -0.0262 0.0057  -0.0150 36  SER A CA    
305  C C     . SER A 36  ? 0.3106 0.2859 0.3860 -0.0239 0.0023  -0.0150 36  SER A C     
306  O O     . SER A 36  ? 0.3009 0.2768 0.3722 -0.0210 0.0016  -0.0150 36  SER A O     
307  C CB    . SER A 36  ? 0.2932 0.2804 0.3869 -0.0252 0.0021  -0.0169 36  SER A CB    
308  O OG    . SER A 36  ? 0.3283 0.3208 0.4327 -0.0277 0.0046  -0.0174 36  SER A OG    
309  N N     . LEU A 37  ? 0.3367 0.3069 0.4093 -0.0255 0.0001  -0.0151 37  LEU A N     
310  C CA    . LEU A 37  ? 0.3343 0.3003 0.4000 -0.0231 -0.0038 -0.0157 37  LEU A CA    
311  C C     . LEU A 37  ? 0.3367 0.3017 0.4050 -0.0240 -0.0078 -0.0171 37  LEU A C     
312  O O     . LEU A 37  ? 0.3726 0.3402 0.4483 -0.0266 -0.0077 -0.0174 37  LEU A O     
313  C CB    . LEU A 37  ? 0.3308 0.2893 0.3878 -0.0233 -0.0026 -0.0145 37  LEU A CB    
314  C CG    . LEU A 37  ? 0.3734 0.3315 0.4265 -0.0221 0.0005  -0.0133 37  LEU A CG    
315  C CD1   . LEU A 37  ? 0.4043 0.3535 0.4488 -0.0231 0.0014  -0.0120 37  LEU A CD1   
316  C CD2   . LEU A 37  ? 0.3222 0.2837 0.3743 -0.0184 -0.0014 -0.0140 37  LEU A CD2   
317  N N     . PHE A 38  ? 0.3372 0.2984 0.4000 -0.0218 -0.0114 -0.0180 38  PHE A N     
318  C CA    . PHE A 38  ? 0.3246 0.2846 0.3889 -0.0218 -0.0158 -0.0196 38  PHE A CA    
319  C C     . PHE A 38  ? 0.3616 0.3141 0.4190 -0.0214 -0.0184 -0.0200 38  PHE A C     
320  O O     . PHE A 38  ? 0.3872 0.3364 0.4383 -0.0195 -0.0178 -0.0196 38  PHE A O     
321  C CB    . PHE A 38  ? 0.3141 0.2779 0.3792 -0.0184 -0.0185 -0.0212 38  PHE A CB    
322  C CG    . PHE A 38  ? 0.3366 0.3072 0.4080 -0.0182 -0.0169 -0.0211 38  PHE A CG    
323  C CD1   . PHE A 38  ? 0.3084 0.2817 0.3785 -0.0169 -0.0134 -0.0200 38  PHE A CD1   
324  C CD2   . PHE A 38  ? 0.3154 0.2894 0.3940 -0.0189 -0.0194 -0.0223 38  PHE A CD2   
325  C CE1   . PHE A 38  ? 0.3491 0.3281 0.4245 -0.0164 -0.0122 -0.0200 38  PHE A CE1   
326  C CE2   . PHE A 38  ? 0.3476 0.3276 0.4321 -0.0182 -0.0185 -0.0225 38  PHE A CE2   
327  C CZ    . PHE A 38  ? 0.3754 0.3578 0.4580 -0.0169 -0.0147 -0.0213 38  PHE A CZ    
328  N N     . ALA A 39  ? 0.3754 0.3251 0.4344 -0.0231 -0.0216 -0.0209 39  ALA A N     
329  C CA    . ALA A 39  ? 0.3945 0.3367 0.4470 -0.0223 -0.0249 -0.0217 39  ALA A CA    
330  C C     . ALA A 39  ? 0.4069 0.3489 0.4603 -0.0209 -0.0297 -0.0237 39  ALA A C     
331  O O     . ALA A 39  ? 0.4181 0.3639 0.4783 -0.0223 -0.0308 -0.0242 39  ALA A O     
332  C CB    . ALA A 39  ? 0.4040 0.3401 0.4553 -0.0264 -0.0242 -0.0205 39  ALA A CB    
333  N N     . HIS A 40  ? 0.4184 0.3554 0.4650 -0.0178 -0.0326 -0.0251 40  HIS A N     
334  C CA    . HIS A 40  ? 0.4110 0.3455 0.4565 -0.0164 -0.0373 -0.0271 40  HIS A CA    
335  C C     . HIS A 40  ? 0.4193 0.3505 0.4685 -0.0206 -0.0398 -0.0270 40  HIS A C     
336  O O     . HIS A 40  ? 0.4136 0.3413 0.4624 -0.0238 -0.0383 -0.0256 40  HIS A O     
337  C CB    . HIS A 40  ? 0.4210 0.3500 0.4582 -0.0125 -0.0394 -0.0286 40  HIS A CB    
338  C CG    . HIS A 40  ? 0.4125 0.3450 0.4471 -0.0084 -0.0371 -0.0291 40  HIS A CG    
339  N ND1   . HIS A 40  ? 0.4509 0.3827 0.4823 -0.0067 -0.0350 -0.0287 40  HIS A ND1   
340  C CD2   . HIS A 40  ? 0.4336 0.3701 0.4682 -0.0060 -0.0366 -0.0299 40  HIS A CD2   
341  C CE1   . HIS A 40  ? 0.4277 0.3637 0.4584 -0.0036 -0.0330 -0.0293 40  HIS A CE1   
342  N NE2   . HIS A 40  ? 0.4014 0.3398 0.4334 -0.0031 -0.0337 -0.0299 40  HIS A NE2   
343  N N     . CYS A 41  ? 0.4219 0.3537 0.4745 -0.0207 -0.0437 -0.0284 41  CYS A N     
344  C CA    . CYS A 41  ? 0.4455 0.3745 0.5029 -0.0248 -0.0468 -0.0286 41  CYS A CA    
345  C C     . CYS A 41  ? 0.4839 0.4070 0.5370 -0.0227 -0.0532 -0.0310 41  CYS A C     
346  O O     . CYS A 41  ? 0.4903 0.4126 0.5374 -0.0180 -0.0546 -0.0323 41  CYS A O     
347  C CB    . CYS A 41  ? 0.4364 0.3731 0.5055 -0.0280 -0.0453 -0.0281 41  CYS A CB    
348  S SG    . CYS A 41  ? 0.4335 0.3760 0.5061 -0.0245 -0.0481 -0.0299 41  CYS A SG    
349  N N     . PRO A 42  ? 0.5276 0.4460 0.5832 -0.0261 -0.0571 -0.0314 42  PRO A N     
350  C CA    . PRO A 42  ? 0.5626 0.4747 0.6136 -0.0240 -0.0637 -0.0337 42  PRO A CA    
351  C C     . PRO A 42  ? 0.5941 0.5101 0.6482 -0.0216 -0.0667 -0.0353 42  PRO A C     
352  O O     . PRO A 42  ? 0.5678 0.4919 0.6308 -0.0230 -0.0644 -0.0346 42  PRO A O     
353  C CB    . PRO A 42  ? 0.5623 0.4700 0.6181 -0.0292 -0.0669 -0.0335 42  PRO A CB    
354  C CG    . PRO A 42  ? 0.5543 0.4632 0.6126 -0.0333 -0.0612 -0.0310 42  PRO A CG    
355  C CD    . PRO A 42  ? 0.5260 0.4438 0.5877 -0.0320 -0.0554 -0.0298 42  PRO A CD    
356  N N     . GLU A 43  ? 0.6603 0.5699 0.7063 -0.0178 -0.0716 -0.0374 43  GLU A N     
357  C CA    . GLU A 43  ? 0.7268 0.6371 0.7731 -0.0153 -0.0756 -0.0391 43  GLU A CA    
358  C C     . GLU A 43  ? 0.7364 0.6500 0.7948 -0.0193 -0.0795 -0.0395 43  GLU A C     
359  O O     . GLU A 43  ? 0.7376 0.6564 0.8015 -0.0185 -0.0805 -0.0401 43  GLU A O     
360  C CB    . GLU A 43  ? 0.7740 0.6744 0.8080 -0.0109 -0.0806 -0.0414 43  GLU A CB    
361  C CG    . GLU A 43  ? 0.8572 0.7571 0.8814 -0.0053 -0.0778 -0.0421 43  GLU A CG    
362  C CD    . GLU A 43  ? 0.9058 0.8055 0.9240 -0.0033 -0.0723 -0.0413 43  GLU A CD    
363  O OE1   . GLU A 43  ? 0.8819 0.7862 0.8983 -0.0009 -0.0674 -0.0406 43  GLU A OE1   
364  O OE2   . GLU A 43  ? 0.9085 0.8030 0.9238 -0.0040 -0.0733 -0.0414 43  GLU A OE2   
365  N N     . SER A 44  ? 0.7646 0.6752 0.8275 -0.0237 -0.0815 -0.0393 44  SER A N     
366  C CA    . SER A 44  ? 0.7783 0.6919 0.8542 -0.0284 -0.0852 -0.0398 44  SER A CA    
367  C C     . SER A 44  ? 0.7808 0.7060 0.8704 -0.0316 -0.0799 -0.0383 44  SER A C     
368  O O     . SER A 44  ? 0.7969 0.7268 0.8992 -0.0345 -0.0826 -0.0391 44  SER A O     
369  C CB    . SER A 44  ? 0.7862 0.6935 0.8630 -0.0328 -0.0873 -0.0394 44  SER A CB    
370  O OG    . SER A 44  ? 0.7550 0.6648 0.8339 -0.0364 -0.0804 -0.0369 44  SER A OG    
371  N N     . GLN A 45  ? 0.7636 0.6929 0.8509 -0.0310 -0.0725 -0.0363 45  GLN A N     
372  C CA    . GLN A 45  ? 0.7534 0.6927 0.8520 -0.0339 -0.0667 -0.0347 45  GLN A CA    
373  C C     . GLN A 45  ? 0.7367 0.6825 0.8381 -0.0303 -0.0668 -0.0356 45  GLN A C     
374  O O     . GLN A 45  ? 0.7192 0.6645 0.8116 -0.0260 -0.0645 -0.0353 45  GLN A O     
375  C CB    . GLN A 45  ? 0.7595 0.6989 0.8534 -0.0349 -0.0593 -0.0322 45  GLN A CB    
376  C CG    . GLN A 45  ? 0.7917 0.7377 0.8963 -0.0398 -0.0533 -0.0304 45  GLN A CG    
377  C CD    . GLN A 45  ? 0.8449 0.7876 0.9424 -0.0411 -0.0472 -0.0280 45  GLN A CD    
378  O OE1   . GLN A 45  ? 0.8587 0.7933 0.9499 -0.0429 -0.0483 -0.0275 45  GLN A OE1   
379  N NE2   . GLN A 45  ? 0.8599 0.8079 0.9577 -0.0401 -0.0413 -0.0266 45  GLN A NE2   
380  N N     . ALA A 46  ? 0.7293 0.6808 0.8435 -0.0321 -0.0696 -0.0368 46  ALA A N     
381  C CA    . ALA A 46  ? 0.7049 0.6620 0.8228 -0.0288 -0.0709 -0.0379 46  ALA A CA    
382  C C     . ALA A 46  ? 0.6691 0.6332 0.7877 -0.0280 -0.0632 -0.0360 46  ALA A C     
383  O O     . ALA A 46  ? 0.6673 0.6372 0.7944 -0.0317 -0.0576 -0.0345 46  ALA A O     
384  C CB    . ALA A 46  ? 0.7090 0.6714 0.8428 -0.0313 -0.0757 -0.0397 46  ALA A CB    
385  N N     . THR A 47  ? 0.6318 0.5944 0.7406 -0.0231 -0.0628 -0.0361 47  THR A N     
386  C CA    . THR A 47  ? 0.5818 0.5499 0.6898 -0.0219 -0.0562 -0.0344 47  THR A CA    
387  C C     . THR A 47  ? 0.5699 0.5381 0.6724 -0.0171 -0.0582 -0.0354 47  THR A C     
388  O O     . THR A 47  ? 0.5677 0.5296 0.6629 -0.0142 -0.0638 -0.0370 47  THR A O     
389  C CB    . THR A 47  ? 0.5848 0.5496 0.6833 -0.0221 -0.0507 -0.0323 47  THR A CB    
390  O OG1   . THR A 47  ? 0.5104 0.4798 0.6076 -0.0207 -0.0450 -0.0308 47  THR A OG1   
391  C CG2   . THR A 47  ? 0.5916 0.5478 0.6767 -0.0187 -0.0537 -0.0331 47  THR A CG2   
392  N N     . LYS A 48  ? 0.5285 0.5029 0.6340 -0.0164 -0.0536 -0.0343 48  LYS A N     
393  C CA    . LYS A 48  ? 0.5092 0.4828 0.6077 -0.0120 -0.0543 -0.0347 48  LYS A CA    
394  C C     . LYS A 48  ? 0.4901 0.4623 0.5784 -0.0104 -0.0486 -0.0329 48  LYS A C     
395  O O     . LYS A 48  ? 0.4888 0.4600 0.5705 -0.0072 -0.0481 -0.0328 48  LYS A O     
396  C CB    . LYS A 48  ? 0.4961 0.4769 0.6050 -0.0117 -0.0547 -0.0354 48  LYS A CB    
397  C CG    . LYS A 48  ? 0.5084 0.4964 0.6228 -0.0132 -0.0473 -0.0335 48  LYS A CG    
398  C CD    . LYS A 48  ? 0.5041 0.4981 0.6267 -0.0117 -0.0481 -0.0345 48  LYS A CD    
399  C CE    . LYS A 48  ? 0.4931 0.4945 0.6236 -0.0139 -0.0410 -0.0329 48  LYS A CE    
400  N NZ    . LYS A 48  ? 0.4582 0.4670 0.6018 -0.0135 -0.0420 -0.0345 48  LYS A NZ    
401  N N     . TYR A 49  ? 0.4648 0.4364 0.5517 -0.0126 -0.0445 -0.0314 49  TYR A N     
402  C CA    . TYR A 49  ? 0.4276 0.3981 0.5062 -0.0112 -0.0395 -0.0298 49  TYR A CA    
403  C C     . TYR A 49  ? 0.4181 0.3815 0.4864 -0.0096 -0.0409 -0.0302 49  TYR A C     
404  O O     . TYR A 49  ? 0.3958 0.3556 0.4643 -0.0113 -0.0429 -0.0306 49  TYR A O     
405  C CB    . TYR A 49  ? 0.3948 0.3690 0.4779 -0.0142 -0.0339 -0.0278 49  TYR A CB    
406  C CG    . TYR A 49  ? 0.3843 0.3656 0.4781 -0.0159 -0.0318 -0.0275 49  TYR A CG    
407  C CD1   . TYR A 49  ? 0.3601 0.3441 0.4639 -0.0198 -0.0316 -0.0276 49  TYR A CD1   
408  C CD2   . TYR A 49  ? 0.3459 0.3311 0.4400 -0.0138 -0.0299 -0.0272 49  TYR A CD2   
409  C CE1   . TYR A 49  ? 0.3653 0.3563 0.4798 -0.0213 -0.0292 -0.0275 49  TYR A CE1   
410  C CE2   . TYR A 49  ? 0.3911 0.3828 0.4951 -0.0150 -0.0280 -0.0271 49  TYR A CE2   
411  C CZ    . TYR A 49  ? 0.3804 0.3753 0.4949 -0.0187 -0.0274 -0.0274 49  TYR A CZ    
412  O OH    . TYR A 49  ? 0.4696 0.4714 0.5949 -0.0198 -0.0250 -0.0276 49  TYR A OH    
413  N N     . PHE A 50  ? 0.4181 0.3795 0.4779 -0.0063 -0.0394 -0.0302 50  PHE A N     
414  C CA    . PHE A 50  ? 0.4019 0.3572 0.4521 -0.0041 -0.0400 -0.0309 50  PHE A CA    
415  C C     . PHE A 50  ? 0.3924 0.3490 0.4381 -0.0027 -0.0349 -0.0297 50  PHE A C     
416  O O     . PHE A 50  ? 0.3754 0.3359 0.4219 -0.0021 -0.0321 -0.0288 50  PHE A O     
417  C CB    . PHE A 50  ? 0.4063 0.3564 0.4497 -0.0010 -0.0443 -0.0327 50  PHE A CB    
418  C CG    . PHE A 50  ? 0.4714 0.4187 0.5182 -0.0020 -0.0505 -0.0343 50  PHE A CG    
419  C CD1   . PHE A 50  ? 0.4928 0.4433 0.5465 -0.0026 -0.0535 -0.0348 50  PHE A CD1   
420  C CD2   . PHE A 50  ? 0.4764 0.4178 0.5203 -0.0024 -0.0538 -0.0354 50  PHE A CD2   
421  C CE1   . PHE A 50  ? 0.4945 0.4428 0.5529 -0.0036 -0.0598 -0.0365 50  PHE A CE1   
422  C CE2   . PHE A 50  ? 0.5025 0.4411 0.5501 -0.0036 -0.0601 -0.0369 50  PHE A CE2   
423  C CZ    . PHE A 50  ? 0.5333 0.4756 0.5885 -0.0043 -0.0632 -0.0375 50  PHE A CZ    
424  N N     . ASP A 51  ? 0.3797 0.3331 0.4211 -0.0021 -0.0339 -0.0298 51  ASP A N     
425  C CA    . ASP A 51  ? 0.3993 0.3540 0.4373 -0.0006 -0.0297 -0.0291 51  ASP A CA    
426  C C     . ASP A 51  ? 0.4104 0.3633 0.4417 0.0027  -0.0293 -0.0301 51  ASP A C     
427  O O     . ASP A 51  ? 0.4233 0.3730 0.4516 0.0038  -0.0325 -0.0313 51  ASP A O     
428  C CB    . ASP A 51  ? 0.3915 0.3433 0.4277 -0.0008 -0.0293 -0.0292 51  ASP A CB    
429  C CG    . ASP A 51  ? 0.4309 0.3769 0.4605 0.0019  -0.0315 -0.0311 51  ASP A CG    
430  O OD1   . ASP A 51  ? 0.4147 0.3583 0.4398 0.0040  -0.0330 -0.0324 51  ASP A OD1   
431  O OD2   . ASP A 51  ? 0.4284 0.3717 0.4566 0.0021  -0.0317 -0.0315 51  ASP A OD2   
432  N N     . ILE A 52  ? 0.3845 0.3390 0.4133 0.0041  -0.0253 -0.0296 52  ILE A N     
433  C CA    . ILE A 52  ? 0.3910 0.3439 0.4135 0.0067  -0.0239 -0.0303 52  ILE A CA    
434  C C     . ILE A 52  ? 0.3957 0.3420 0.4105 0.0093  -0.0258 -0.0323 52  ILE A C     
435  O O     . ILE A 52  ? 0.3853 0.3282 0.3933 0.0112  -0.0255 -0.0330 52  ILE A O     
436  C CB    . ILE A 52  ? 0.3777 0.3343 0.4004 0.0072  -0.0189 -0.0293 52  ILE A CB    
437  C CG1   . ILE A 52  ? 0.3884 0.3453 0.4119 0.0079  -0.0171 -0.0298 52  ILE A CG1   
438  C CG2   . ILE A 52  ? 0.3831 0.3448 0.4115 0.0052  -0.0175 -0.0274 52  ILE A CG2   
439  C CD1   . ILE A 52  ? 0.3968 0.3577 0.4217 0.0084  -0.0126 -0.0292 52  ILE A CD1   
440  N N     . TYR A 53  ? 0.4053 0.3488 0.4201 0.0093  -0.0278 -0.0333 53  TYR A N     
441  C CA    . TYR A 53  ? 0.4307 0.3673 0.4379 0.0118  -0.0299 -0.0354 53  TYR A CA    
442  C C     . TYR A 53  ? 0.4717 0.4033 0.4774 0.0113  -0.0358 -0.0363 53  TYR A C     
443  O O     . TYR A 53  ? 0.5057 0.4304 0.5047 0.0133  -0.0385 -0.0381 53  TYR A O     
444  C CB    . TYR A 53  ? 0.4294 0.3652 0.4372 0.0125  -0.0292 -0.0361 53  TYR A CB    
445  C CG    . TYR A 53  ? 0.4587 0.3999 0.4700 0.0128  -0.0244 -0.0353 53  TYR A CG    
446  C CD1   . TYR A 53  ? 0.4302 0.3753 0.4481 0.0105  -0.0239 -0.0339 53  TYR A CD1   
447  C CD2   . TYR A 53  ? 0.4425 0.3845 0.4504 0.0153  -0.0202 -0.0360 53  TYR A CD2   
448  C CE1   . TYR A 53  ? 0.4365 0.3860 0.4576 0.0109  -0.0203 -0.0334 53  TYR A CE1   
449  C CE2   . TYR A 53  ? 0.4224 0.3696 0.4347 0.0153  -0.0162 -0.0355 53  TYR A CE2   
450  C CZ    . TYR A 53  ? 0.4524 0.4033 0.4714 0.0133  -0.0167 -0.0342 53  TYR A CZ    
451  O OH    . TYR A 53  ? 0.3978 0.3533 0.4211 0.0136  -0.0134 -0.0339 53  TYR A OH    
452  N N     . GLY A 54  ? 0.4646 0.3996 0.4769 0.0087  -0.0379 -0.0352 54  GLY A N     
453  C CA    . GLY A 54  ? 0.4667 0.3981 0.4800 0.0077  -0.0438 -0.0362 54  GLY A CA    
454  C C     . GLY A 54  ? 0.4790 0.4090 0.4967 0.0054  -0.0469 -0.0364 54  GLY A C     
455  O O     . GLY A 54  ? 0.4924 0.4180 0.5099 0.0049  -0.0523 -0.0376 54  GLY A O     
456  N N     . LYS A 55  ? 0.4742 0.4069 0.4952 0.0039  -0.0439 -0.0354 55  LYS A N     
457  C CA    . LYS A 55  ? 0.4783 0.4092 0.5033 0.0011  -0.0464 -0.0352 55  LYS A CA    
458  C C     . LYS A 55  ? 0.4545 0.3913 0.4897 -0.0030 -0.0461 -0.0337 55  LYS A C     
459  O O     . LYS A 55  ? 0.4360 0.3788 0.4750 -0.0036 -0.0421 -0.0322 55  LYS A O     
460  C CB    . LYS A 55  ? 0.4900 0.4201 0.5132 0.0015  -0.0437 -0.0348 55  LYS A CB    
461  C CG    . LYS A 55  ? 0.5534 0.4797 0.5683 0.0058  -0.0426 -0.0364 55  LYS A CG    
462  C CD    . LYS A 55  ? 0.6331 0.5523 0.6435 0.0068  -0.0457 -0.0379 55  LYS A CD    
463  C CE    . LYS A 55  ? 0.6862 0.5985 0.6919 0.0076  -0.0511 -0.0397 55  LYS A CE    
464  N NZ    . LYS A 55  ? 0.7251 0.6297 0.7251 0.0092  -0.0540 -0.0413 55  LYS A NZ    
465  N N     . PRO A 56  ? 0.4347 0.3696 0.4745 -0.0057 -0.0502 -0.0341 56  PRO A N     
466  C CA    . PRO A 56  ? 0.4152 0.3559 0.4658 -0.0096 -0.0497 -0.0330 56  PRO A CA    
467  C C     . PRO A 56  ? 0.4069 0.3510 0.4616 -0.0126 -0.0448 -0.0309 56  PRO A C     
468  O O     . PRO A 56  ? 0.4062 0.3462 0.4563 -0.0127 -0.0439 -0.0305 56  PRO A O     
469  C CB    . PRO A 56  ? 0.4174 0.3541 0.4713 -0.0118 -0.0555 -0.0342 56  PRO A CB    
470  C CG    . PRO A 56  ? 0.4589 0.3874 0.5037 -0.0102 -0.0577 -0.0352 56  PRO A CG    
471  C CD    . PRO A 56  ? 0.4447 0.3718 0.4802 -0.0055 -0.0553 -0.0357 56  PRO A CD    
472  N N     . CYS A 57  ? 0.3700 0.3209 0.4327 -0.0147 -0.0419 -0.0296 57  CYS A N     
473  C CA    . CYS A 57  ? 0.3858 0.3394 0.4515 -0.0173 -0.0368 -0.0276 57  CYS A CA    
474  C C     . CYS A 57  ? 0.3848 0.3429 0.4612 -0.0215 -0.0358 -0.0269 57  CYS A C     
475  O O     . CYS A 57  ? 0.3459 0.3086 0.4291 -0.0215 -0.0376 -0.0278 57  CYS A O     
476  C CB    . CYS A 57  ? 0.3584 0.3161 0.4221 -0.0151 -0.0325 -0.0265 57  CYS A CB    
477  S SG    . CYS A 57  ? 0.4499 0.4038 0.5032 -0.0111 -0.0316 -0.0269 57  CYS A SG    
478  N N     . THR A 58  ? 0.3930 0.3497 0.4708 -0.0250 -0.0327 -0.0254 58  THR A N     
479  C CA    . THR A 58  ? 0.4225 0.3842 0.5105 -0.0291 -0.0298 -0.0245 58  THR A CA    
480  C C     . THR A 58  ? 0.4017 0.3673 0.4896 -0.0289 -0.0237 -0.0228 58  THR A C     
481  O O     . THR A 58  ? 0.4037 0.3658 0.4834 -0.0275 -0.0215 -0.0217 58  THR A O     
482  C CB    . THR A 58  ? 0.4344 0.3917 0.5249 -0.0339 -0.0299 -0.0239 58  THR A CB    
483  O OG1   . THR A 58  ? 0.5146 0.4772 0.6148 -0.0379 -0.0253 -0.0229 58  THR A OG1   
484  C CG2   . THR A 58  ? 0.4464 0.3956 0.5264 -0.0341 -0.0286 -0.0227 58  THR A CG2   
485  N N     . ARG A 59  ? 0.4253 0.3982 0.5224 -0.0298 -0.0215 -0.0228 59  ARG A N     
486  C CA    . ARG A 59  ? 0.4316 0.4080 0.5292 -0.0298 -0.0157 -0.0213 59  ARG A CA    
487  C C     . ARG A 59  ? 0.4461 0.4206 0.5455 -0.0343 -0.0107 -0.0196 59  ARG A C     
488  O O     . ARG A 59  ? 0.4357 0.4116 0.5434 -0.0381 -0.0105 -0.0199 59  ARG A O     
489  C CB    . ARG A 59  ? 0.4270 0.4115 0.5334 -0.0285 -0.0154 -0.0222 59  ARG A CB    
490  C CG    . ARG A 59  ? 0.4360 0.4239 0.5422 -0.0279 -0.0098 -0.0208 59  ARG A CG    
491  C CD    . ARG A 59  ? 0.4644 0.4587 0.5756 -0.0250 -0.0109 -0.0220 59  ARG A CD    
492  N NE    . ARG A 59  ? 0.4717 0.4722 0.5962 -0.0267 -0.0118 -0.0234 59  ARG A NE    
493  C CZ    . ARG A 59  ? 0.4529 0.4586 0.5859 -0.0287 -0.0068 -0.0230 59  ARG A CZ    
494  N NH1   . ARG A 59  ? 0.4172 0.4217 0.5453 -0.0291 -0.0008 -0.0211 59  ARG A NH1   
495  N NH2   . ARG A 59  ? 0.4746 0.4865 0.6211 -0.0302 -0.0081 -0.0246 59  ARG A NH2   
496  N N     . LYS A 60  ? 0.4498 0.4205 0.5410 -0.0339 -0.0068 -0.0178 60  LYS A N     
497  C CA    . LYS A 60  ? 0.4728 0.4401 0.5630 -0.0377 -0.0015 -0.0160 60  LYS A CA    
498  C C     . LYS A 60  ? 0.4789 0.4507 0.5713 -0.0373 0.0041  -0.0151 60  LYS A C     
499  O O     . LYS A 60  ? 0.4794 0.4502 0.5649 -0.0342 0.0049  -0.0145 60  LYS A O     
500  C CB    . LYS A 60  ? 0.4883 0.4457 0.5662 -0.0377 -0.0019 -0.0148 60  LYS A CB    
501  C CG    . LYS A 60  ? 0.5851 0.5366 0.6614 -0.0395 -0.0061 -0.0155 60  LYS A CG    
502  C CD    . LYS A 60  ? 0.6318 0.5727 0.6966 -0.0402 -0.0058 -0.0142 60  LYS A CD    
503  C CE    . LYS A 60  ? 0.7077 0.6427 0.7733 -0.0452 -0.0059 -0.0137 60  LYS A CE    
504  N NZ    . LYS A 60  ? 0.7177 0.6552 0.7899 -0.0499 0.0003  -0.0123 60  LYS A NZ    
505  N N     . LEU A 61  ? 0.4654 0.4422 0.5678 -0.0404 0.0079  -0.0151 61  LEU A N     
506  C CA    . LEU A 61  ? 0.4552 0.4366 0.5609 -0.0402 0.0137  -0.0144 61  LEU A CA    
507  C C     . LEU A 61  ? 0.4515 0.4257 0.5500 -0.0433 0.0200  -0.0122 61  LEU A C     
508  O O     . LEU A 61  ? 0.4784 0.4494 0.5789 -0.0477 0.0222  -0.0116 61  LEU A O     
509  C CB    . LEU A 61  ? 0.4594 0.4505 0.5808 -0.0416 0.0147  -0.0160 61  LEU A CB    
510  C CG    . LEU A 61  ? 0.4947 0.4930 0.6226 -0.0402 0.0193  -0.0163 61  LEU A CG    
511  C CD1   . LEU A 61  ? 0.4972 0.4975 0.6324 -0.0445 0.0269  -0.0156 61  LEU A CD1   
512  C CD2   . LEU A 61  ? 0.4287 0.4245 0.5460 -0.0362 0.0204  -0.0153 61  LEU A CD2   
513  N N     . PHE A 62  ? 0.4017 0.3726 0.4912 -0.0410 0.0226  -0.0110 62  PHE A N     
514  C CA    . PHE A 62  ? 0.3928 0.3547 0.4724 -0.0432 0.0278  -0.0090 62  PHE A CA    
515  C C     . PHE A 62  ? 0.4141 0.3788 0.4975 -0.0446 0.0355  -0.0083 62  PHE A C     
516  O O     . PHE A 62  ? 0.4141 0.3869 0.5042 -0.0421 0.0364  -0.0092 62  PHE A O     
517  C CB    . PHE A 62  ? 0.3454 0.2996 0.4112 -0.0398 0.0252  -0.0081 62  PHE A CB    
518  C CG    . PHE A 62  ? 0.3311 0.2807 0.3922 -0.0390 0.0190  -0.0087 62  PHE A CG    
519  C CD1   . PHE A 62  ? 0.3380 0.2920 0.4006 -0.0352 0.0135  -0.0102 62  PHE A CD1   
520  C CD2   . PHE A 62  ? 0.3707 0.3111 0.4256 -0.0420 0.0188  -0.0078 62  PHE A CD2   
521  C CE1   . PHE A 62  ? 0.3586 0.3084 0.4170 -0.0342 0.0082  -0.0109 62  PHE A CE1   
522  C CE2   . PHE A 62  ? 0.3729 0.3090 0.4236 -0.0409 0.0128  -0.0085 62  PHE A CE2   
523  C CZ    . PHE A 62  ? 0.3715 0.3125 0.4242 -0.0369 0.0077  -0.0102 62  PHE A CZ    
524  N N     . ALA A 63  ? 0.3957 0.3533 0.4742 -0.0486 0.0411  -0.0066 63  ALA A N     
525  C CA    . ALA A 63  ? 0.4201 0.3788 0.5005 -0.0501 0.0494  -0.0059 63  ALA A CA    
526  C C     . ALA A 63  ? 0.4056 0.3618 0.4767 -0.0460 0.0508  -0.0053 63  ALA A C     
527  O O     . ALA A 63  ? 0.3960 0.3566 0.4712 -0.0453 0.0561  -0.0055 63  ALA A O     
528  C CB    . ALA A 63  ? 0.4279 0.3770 0.5021 -0.0554 0.0553  -0.0040 63  ALA A CB    
529  N N     . ASN A 64  ? 0.4245 0.3737 0.4837 -0.0430 0.0458  -0.0047 64  ASN A N     
530  C CA    . ASN A 64  ? 0.4052 0.3514 0.4554 -0.0391 0.0458  -0.0043 64  ASN A CA    
531  C C     . ASN A 64  ? 0.3990 0.3412 0.4414 -0.0359 0.0386  -0.0044 64  ASN A C     
532  O O     . ASN A 64  ? 0.4473 0.3874 0.4892 -0.0366 0.0341  -0.0047 64  ASN A O     
533  C CB    . ASN A 64  ? 0.4044 0.3399 0.4428 -0.0406 0.0524  -0.0024 64  ASN A CB    
534  C CG    . ASN A 64  ? 0.4370 0.3605 0.4655 -0.0442 0.0530  -0.0009 64  ASN A CG    
535  O OD1   . ASN A 64  ? 0.4363 0.3533 0.4571 -0.0431 0.0471  -0.0007 64  ASN A OD1   
536  N ND2   . ASN A 64  ? 0.4431 0.3634 0.4719 -0.0485 0.0603  0.0001  64  ASN A ND2   
537  N N     . MET A 65  ? 0.4076 0.3488 0.4443 -0.0323 0.0375  -0.0043 65  MET A N     
538  C CA    . MET A 65  ? 0.4033 0.3419 0.4343 -0.0291 0.0310  -0.0047 65  MET A CA    
539  C C     . MET A 65  ? 0.4440 0.3704 0.4630 -0.0298 0.0287  -0.0037 65  MET A C     
540  O O     . MET A 65  ? 0.4339 0.3596 0.4518 -0.0283 0.0231  -0.0044 65  MET A O     
541  C CB    . MET A 65  ? 0.3927 0.3333 0.4213 -0.0255 0.0304  -0.0048 65  MET A CB    
542  C CG    . MET A 65  ? 0.3836 0.3361 0.4238 -0.0239 0.0300  -0.0062 65  MET A CG    
543  S SD    . MET A 65  ? 0.3995 0.3537 0.4367 -0.0199 0.0293  -0.0063 65  MET A SD    
544  C CE    . MET A 65  ? 0.3401 0.2917 0.3748 -0.0207 0.0370  -0.0054 65  MET A CE    
545  N N     . ARG A 66  ? 0.4877 0.4043 0.4974 -0.0320 0.0331  -0.0021 66  ARG A N     
546  C CA    . ARG A 66  ? 0.5197 0.4230 0.5169 -0.0327 0.0307  -0.0012 66  ARG A CA    
547  C C     . ARG A 66  ? 0.4853 0.3879 0.4857 -0.0354 0.0285  -0.0015 66  ARG A C     
548  O O     . ARG A 66  ? 0.4580 0.3541 0.4522 -0.0343 0.0232  -0.0018 66  ARG A O     
549  C CB    . ARG A 66  ? 0.5757 0.4668 0.5603 -0.0344 0.0361  0.0006  66  ARG A CB    
550  C CG    . ARG A 66  ? 0.7202 0.6071 0.6965 -0.0309 0.0356  0.0010  66  ARG A CG    
551  C CD    . ARG A 66  ? 0.8352 0.7131 0.8017 -0.0325 0.0428  0.0025  66  ARG A CD    
552  N NE    . ARG A 66  ? 0.8961 0.7686 0.8535 -0.0290 0.0419  0.0028  66  ARG A NE    
553  C CZ    . ARG A 66  ? 0.9490 0.8128 0.8961 -0.0293 0.0474  0.0040  66  ARG A CZ    
554  N NH1   . ARG A 66  ? 0.9650 0.8247 0.9098 -0.0330 0.0552  0.0051  66  ARG A NH1   
555  N NH2   . ARG A 66  ? 0.9889 0.8477 0.9279 -0.0259 0.0454  0.0040  66  ARG A NH2   
556  N N     . ASP A 67  ? 0.4920 0.4011 0.5024 -0.0387 0.0321  -0.0017 67  ASP A N     
557  C CA    . ASP A 67  ? 0.5053 0.4142 0.5197 -0.0414 0.0295  -0.0022 67  ASP A CA    
558  C C     . ASP A 67  ? 0.4791 0.3941 0.4986 -0.0382 0.0223  -0.0040 67  ASP A C     
559  O O     . ASP A 67  ? 0.4770 0.3865 0.4924 -0.0381 0.0178  -0.0043 67  ASP A O     
560  C CB    . ASP A 67  ? 0.5255 0.4417 0.5518 -0.0455 0.0344  -0.0023 67  ASP A CB    
561  C CG    . ASP A 67  ? 0.5536 0.4618 0.5743 -0.0497 0.0419  -0.0004 67  ASP A CG    
562  O OD1   . ASP A 67  ? 0.5833 0.4786 0.5890 -0.0496 0.0429  0.0011  67  ASP A OD1   
563  O OD2   . ASP A 67  ? 0.5651 0.4797 0.5963 -0.0532 0.0470  -0.0005 67  ASP A OD2   
564  N N     . ALA A 68  ? 0.4333 0.3588 0.4608 -0.0353 0.0214  -0.0051 68  ALA A N     
565  C CA    . ALA A 68  ? 0.4113 0.3428 0.4431 -0.0321 0.0155  -0.0068 68  ALA A CA    
566  C C     . ALA A 68  ? 0.4236 0.3479 0.4458 -0.0291 0.0109  -0.0070 68  ALA A C     
567  O O     . ALA A 68  ? 0.4334 0.3572 0.4559 -0.0280 0.0062  -0.0081 68  ALA A O     
568  C CB    . ALA A 68  ? 0.3975 0.3394 0.4372 -0.0296 0.0161  -0.0077 68  ALA A CB    
569  N N     . SER A 69  ? 0.4063 0.3251 0.4205 -0.0277 0.0121  -0.0060 69  SER A N     
570  C CA    . SER A 69  ? 0.4360 0.3477 0.4417 -0.0249 0.0076  -0.0063 69  SER A CA    
571  C C     . SER A 69  ? 0.4418 0.3427 0.4397 -0.0263 0.0052  -0.0060 69  SER A C     
572  O O     . SER A 69  ? 0.4634 0.3622 0.4596 -0.0241 0.0000  -0.0072 69  SER A O     
573  C CB    . SER A 69  ? 0.4512 0.3579 0.4494 -0.0235 0.0093  -0.0052 69  SER A CB    
574  O OG    . SER A 69  ? 0.5278 0.4436 0.5321 -0.0213 0.0098  -0.0058 69  SER A OG    
575  N N     . GLN A 70  ? 0.4502 0.3439 0.4432 -0.0301 0.0092  -0.0044 70  GLN A N     
576  C CA    . GLN A 70  ? 0.4952 0.3775 0.4799 -0.0319 0.0072  -0.0040 70  GLN A CA    
577  C C     . GLN A 70  ? 0.4652 0.3517 0.4566 -0.0321 0.0033  -0.0055 70  GLN A C     
578  O O     . GLN A 70  ? 0.4787 0.3582 0.4645 -0.0309 -0.0016 -0.0062 70  GLN A O     
579  C CB    . GLN A 70  ? 0.4899 0.3642 0.4688 -0.0365 0.0133  -0.0019 70  GLN A CB    
580  C CG    . GLN A 70  ? 0.5834 0.4477 0.5500 -0.0359 0.0160  -0.0004 70  GLN A CG    
581  C CD    . GLN A 70  ? 0.6558 0.5107 0.6119 -0.0321 0.0095  -0.0010 70  GLN A CD    
582  O OE1   . GLN A 70  ? 0.7025 0.5603 0.6587 -0.0285 0.0073  -0.0016 70  GLN A OE1   
583  N NE2   . GLN A 70  ? 0.6898 0.5333 0.6374 -0.0328 0.0059  -0.0008 70  GLN A NE2   
584  N N     . TRP A 71  ? 0.4577 0.3553 0.4609 -0.0335 0.0051  -0.0061 71  TRP A N     
585  C CA    . TRP A 71  ? 0.4690 0.3708 0.4787 -0.0335 0.0012  -0.0076 71  TRP A CA    
586  C C     . TRP A 71  ? 0.4478 0.3517 0.4572 -0.0287 -0.0045 -0.0095 71  TRP A C     
587  O O     . TRP A 71  ? 0.4738 0.3739 0.4812 -0.0279 -0.0088 -0.0106 71  TRP A O     
588  C CB    . TRP A 71  ? 0.4564 0.3696 0.4787 -0.0353 0.0037  -0.0081 71  TRP A CB    
589  C CG    . TRP A 71  ? 0.4328 0.3495 0.4612 -0.0354 -0.0005 -0.0098 71  TRP A CG    
590  C CD1   . TRP A 71  ? 0.4607 0.3725 0.4891 -0.0388 -0.0015 -0.0097 71  TRP A CD1   
591  C CD2   . TRP A 71  ? 0.4044 0.3289 0.4386 -0.0319 -0.0043 -0.0117 71  TRP A CD2   
592  N NE1   . TRP A 71  ? 0.4276 0.3439 0.4616 -0.0374 -0.0061 -0.0116 71  TRP A NE1   
593  C CE2   . TRP A 71  ? 0.4019 0.3258 0.4391 -0.0332 -0.0077 -0.0128 71  TRP A CE2   
594  C CE3   . TRP A 71  ? 0.3958 0.3272 0.4323 -0.0281 -0.0050 -0.0126 71  TRP A CE3   
595  C CZ2   . TRP A 71  ? 0.3982 0.3274 0.4396 -0.0304 -0.0117 -0.0148 71  TRP A CZ2   
596  C CZ3   . TRP A 71  ? 0.3914 0.3282 0.4323 -0.0256 -0.0086 -0.0144 71  TRP A CZ3   
597  C CH2   . TRP A 71  ? 0.3759 0.3114 0.4189 -0.0266 -0.0119 -0.0155 71  TRP A CH2   
598  N N     . ILE A 72  ? 0.4762 0.3859 0.4876 -0.0256 -0.0044 -0.0099 72  ILE A N     
599  C CA    . ILE A 72  ? 0.4787 0.3907 0.4903 -0.0213 -0.0089 -0.0117 72  ILE A CA    
600  C C     . ILE A 72  ? 0.5057 0.4071 0.5083 -0.0198 -0.0129 -0.0120 72  ILE A C     
601  O O     . ILE A 72  ? 0.4958 0.3969 0.4989 -0.0175 -0.0171 -0.0138 72  ILE A O     
602  C CB    . ILE A 72  ? 0.4635 0.3822 0.4780 -0.0187 -0.0077 -0.0118 72  ILE A CB    
603  C CG1   . ILE A 72  ? 0.4345 0.3641 0.4584 -0.0190 -0.0056 -0.0122 72  ILE A CG1   
604  C CG2   . ILE A 72  ? 0.4527 0.3718 0.4662 -0.0147 -0.0119 -0.0133 72  ILE A CG2   
605  C CD1   . ILE A 72  ? 0.4826 0.4177 0.5085 -0.0175 -0.0034 -0.0117 72  ILE A CD1   
606  N N     . LYS A 73  ? 0.5178 0.4097 0.5116 -0.0210 -0.0116 -0.0104 73  LYS A N     
607  C CA    . LYS A 73  ? 0.5691 0.4490 0.5529 -0.0196 -0.0159 -0.0107 73  LYS A CA    
608  C C     . LYS A 73  ? 0.5602 0.4339 0.5414 -0.0211 -0.0185 -0.0112 73  LYS A C     
609  O O     . LYS A 73  ? 0.5820 0.4519 0.5608 -0.0182 -0.0237 -0.0129 73  LYS A O     
610  C CB    . LYS A 73  ? 0.5934 0.4625 0.5665 -0.0208 -0.0140 -0.0088 73  LYS A CB    
611  C CG    . LYS A 73  ? 0.6745 0.5461 0.6472 -0.0182 -0.0138 -0.0088 73  LYS A CG    
612  C CD    . LYS A 73  ? 0.7644 0.6231 0.7245 -0.0191 -0.0125 -0.0070 73  LYS A CD    
613  C CE    . LYS A 73  ? 0.8087 0.6718 0.7699 -0.0192 -0.0082 -0.0059 73  LYS A CE    
614  N NZ    . LYS A 73  ? 0.8244 0.6972 0.7932 -0.0156 -0.0106 -0.0074 73  LYS A NZ    
615  N N     . ARG A 74  ? 0.5602 0.4328 0.5422 -0.0256 -0.0149 -0.0098 74  ARG A N     
616  C CA    . ARG A 74  ? 0.5516 0.4178 0.5311 -0.0277 -0.0172 -0.0101 74  ARG A CA    
617  C C     . ARG A 74  ? 0.5206 0.3940 0.5075 -0.0253 -0.0211 -0.0125 74  ARG A C     
618  O O     . ARG A 74  ? 0.5175 0.3843 0.5004 -0.0245 -0.0255 -0.0135 74  ARG A O     
619  C CB    . ARG A 74  ? 0.5692 0.4331 0.5491 -0.0335 -0.0120 -0.0081 74  ARG A CB    
620  C CG    . ARG A 74  ? 0.6316 0.4832 0.5998 -0.0360 -0.0086 -0.0058 74  ARG A CG    
621  C CD    . ARG A 74  ? 0.7302 0.5779 0.6981 -0.0421 -0.0034 -0.0039 74  ARG A CD    
622  N NE    . ARG A 74  ? 0.8136 0.6744 0.7943 -0.0444 0.0019  -0.0037 74  ARG A NE    
623  C CZ    . ARG A 74  ? 0.8349 0.6977 0.8162 -0.0463 0.0085  -0.0022 74  ARG A CZ    
624  N NH1   . ARG A 74  ? 0.8447 0.6964 0.8134 -0.0464 0.0109  -0.0006 74  ARG A NH1   
625  N NH2   . ARG A 74  ? 0.8331 0.7084 0.8273 -0.0478 0.0125  -0.0025 74  ARG A NH2   
626  N N     . MET A 75  ? 0.5003 0.3863 0.4970 -0.0239 -0.0197 -0.0133 75  MET A N     
627  C CA    . MET A 75  ? 0.5003 0.3926 0.5029 -0.0212 -0.0231 -0.0156 75  MET A CA    
628  C C     . MET A 75  ? 0.5340 0.4238 0.5331 -0.0163 -0.0276 -0.0175 75  MET A C     
629  O O     . MET A 75  ? 0.5202 0.4089 0.5194 -0.0142 -0.0313 -0.0194 75  MET A O     
630  C CB    . MET A 75  ? 0.4836 0.3886 0.4959 -0.0207 -0.0206 -0.0160 75  MET A CB    
631  C CG    . MET A 75  ? 0.4550 0.3639 0.4733 -0.0250 -0.0174 -0.0150 75  MET A CG    
632  S SD    . MET A 75  ? 0.5040 0.4095 0.5238 -0.0273 -0.0207 -0.0159 75  MET A SD    
633  C CE    . MET A 75  ? 0.4780 0.3916 0.5031 -0.0229 -0.0241 -0.0185 75  MET A CE    
634  N N     . GLU A 76  ? 0.5544 0.4432 0.5508 -0.0143 -0.0273 -0.0172 76  GLU A N     
635  C CA    . GLU A 76  ? 0.5861 0.4716 0.5796 -0.0099 -0.0317 -0.0190 76  GLU A CA    
636  C C     . GLU A 76  ? 0.5827 0.4551 0.5671 -0.0100 -0.0358 -0.0193 76  GLU A C     
637  O O     . GLU A 76  ? 0.5580 0.4285 0.5420 -0.0067 -0.0402 -0.0215 76  GLU A O     
638  C CB    . GLU A 76  ? 0.6116 0.4983 0.6045 -0.0082 -0.0310 -0.0185 76  GLU A CB    
639  C CG    . GLU A 76  ? 0.6970 0.5829 0.6901 -0.0034 -0.0357 -0.0209 76  GLU A CG    
640  C CD    . GLU A 76  ? 0.7655 0.6494 0.7563 -0.0020 -0.0363 -0.0204 76  GLU A CD    
641  O OE1   . GLU A 76  ? 0.8009 0.6809 0.7904 0.0014  -0.0410 -0.0222 76  GLU A OE1   
642  O OE2   . GLU A 76  ? 0.7642 0.6501 0.7548 -0.0042 -0.0324 -0.0185 76  GLU A OE2   
643  N N     . ASP A 77  ? 0.5832 0.4461 0.5598 -0.0137 -0.0342 -0.0170 77  ASP A N     
644  C CA    . ASP A 77  ? 0.5927 0.4414 0.5590 -0.0143 -0.0379 -0.0169 77  ASP A CA    
645  C C     . ASP A 77  ? 0.5983 0.4460 0.5661 -0.0150 -0.0403 -0.0181 77  ASP A C     
646  O O     . ASP A 77  ? 0.6190 0.4577 0.5806 -0.0130 -0.0453 -0.0194 77  ASP A O     
647  C CB    . ASP A 77  ? 0.6293 0.4680 0.5868 -0.0191 -0.0343 -0.0139 77  ASP A CB    
648  C CG    . ASP A 77  ? 0.6241 0.4598 0.5766 -0.0180 -0.0330 -0.0128 77  ASP A CG    
649  O OD1   . ASP A 77  ? 0.6256 0.4641 0.5799 -0.0135 -0.0365 -0.0145 77  ASP A OD1   
650  O OD2   . ASP A 77  ? 0.6363 0.4666 0.5831 -0.0217 -0.0285 -0.0104 77  ASP A OD2   
651  N N     . ILE A 78  ? 0.5510 0.4072 0.5265 -0.0176 -0.0371 -0.0177 78  ILE A N     
652  C CA    . ILE A 78  ? 0.5273 0.3830 0.5047 -0.0183 -0.0395 -0.0189 78  ILE A CA    
653  C C     . ILE A 78  ? 0.5360 0.3980 0.5181 -0.0130 -0.0431 -0.0220 78  ILE A C     
654  O O     . ILE A 78  ? 0.5533 0.4103 0.5327 -0.0115 -0.0472 -0.0237 78  ILE A O     
655  C CB    . ILE A 78  ? 0.5051 0.3669 0.4894 -0.0232 -0.0355 -0.0176 78  ILE A CB    
656  C CG1   . ILE A 78  ? 0.5170 0.3720 0.4968 -0.0287 -0.0314 -0.0147 78  ILE A CG1   
657  C CG2   . ILE A 78  ? 0.4863 0.3469 0.4723 -0.0237 -0.0389 -0.0190 78  ILE A CG2   
658  C CD1   . ILE A 78  ? 0.4482 0.3096 0.4362 -0.0338 -0.0270 -0.0134 78  ILE A CD1   
659  N N     . GLY A 79  ? 0.5241 0.3964 0.5126 -0.0101 -0.0414 -0.0228 79  GLY A N     
660  C CA    . GLY A 79  ? 0.5170 0.3961 0.5103 -0.0053 -0.0433 -0.0256 79  GLY A CA    
661  C C     . GLY A 79  ? 0.5071 0.3959 0.5078 -0.0060 -0.0410 -0.0259 79  GLY A C     
662  O O     . GLY A 79  ? 0.5126 0.4029 0.5145 -0.0034 -0.0431 -0.0281 79  GLY A O     
663  N N     . LEU A 80  ? 0.5014 0.3960 0.5063 -0.0092 -0.0368 -0.0240 80  LEU A N     
664  C CA    . LEU A 80  ? 0.4725 0.3753 0.4839 -0.0101 -0.0351 -0.0242 80  LEU A CA    
665  C C     . LEU A 80  ? 0.4784 0.3905 0.4952 -0.0098 -0.0311 -0.0234 80  LEU A C     
666  O O     . LEU A 80  ? 0.4931 0.4051 0.5093 -0.0114 -0.0286 -0.0216 80  LEU A O     
667  C CB    . LEU A 80  ? 0.4612 0.3612 0.4734 -0.0150 -0.0346 -0.0228 80  LEU A CB    
668  C CG    . LEU A 80  ? 0.4678 0.3600 0.4762 -0.0159 -0.0387 -0.0238 80  LEU A CG    
669  C CD1   . LEU A 80  ? 0.4451 0.3347 0.4552 -0.0217 -0.0372 -0.0219 80  LEU A CD1   
670  C CD2   . LEU A 80  ? 0.3771 0.2729 0.3878 -0.0128 -0.0413 -0.0262 80  LEU A CD2   
671  N N     . GLU A 81  ? 0.4559 0.3752 0.4772 -0.0078 -0.0307 -0.0246 81  GLU A N     
672  C CA    . GLU A 81  ? 0.4504 0.3782 0.4763 -0.0072 -0.0274 -0.0240 81  GLU A CA    
673  C C     . GLU A 81  ? 0.4160 0.3466 0.4454 -0.0112 -0.0244 -0.0220 81  GLU A C     
674  O O     . GLU A 81  ? 0.4060 0.3359 0.4374 -0.0139 -0.0250 -0.0218 81  GLU A O     
675  C CB    . GLU A 81  ? 0.4627 0.3957 0.4909 -0.0044 -0.0278 -0.0258 81  GLU A CB    
676  C CG    . GLU A 81  ? 0.4627 0.4032 0.4943 -0.0032 -0.0247 -0.0255 81  GLU A CG    
677  C CD    . GLU A 81  ? 0.4833 0.4274 0.5157 -0.0008 -0.0247 -0.0270 81  GLU A CD    
678  O OE1   . GLU A 81  ? 0.4749 0.4156 0.5048 0.0005  -0.0273 -0.0287 81  GLU A OE1   
679  O OE2   . GLU A 81  ? 0.4728 0.4224 0.5075 -0.0003 -0.0223 -0.0266 81  GLU A OE2   
680  N N     . ALA A 82  ? 0.4045 0.3382 0.4349 -0.0114 -0.0214 -0.0207 82  ALA A N     
681  C CA    . ALA A 82  ? 0.3622 0.2992 0.3961 -0.0144 -0.0180 -0.0189 82  ALA A CA    
682  C C     . ALA A 82  ? 0.3745 0.3197 0.4127 -0.0126 -0.0162 -0.0192 82  ALA A C     
683  O O     . ALA A 82  ? 0.3419 0.2888 0.3791 -0.0109 -0.0150 -0.0189 82  ALA A O     
684  C CB    . ALA A 82  ? 0.3964 0.3283 0.4259 -0.0160 -0.0159 -0.0171 82  ALA A CB    
685  N N     . LEU A 83  ? 0.3644 0.3140 0.4072 -0.0131 -0.0166 -0.0198 83  LEU A N     
686  C CA    . LEU A 83  ? 0.3670 0.3229 0.4126 -0.0111 -0.0159 -0.0203 83  LEU A CA    
687  C C     . LEU A 83  ? 0.3657 0.3263 0.4155 -0.0126 -0.0128 -0.0190 83  LEU A C     
688  O O     . LEU A 83  ? 0.3687 0.3288 0.4210 -0.0155 -0.0113 -0.0180 83  LEU A O     
689  C CB    . LEU A 83  ? 0.3471 0.3038 0.3940 -0.0102 -0.0188 -0.0220 83  LEU A CB    
690  C CG    . LEU A 83  ? 0.3388 0.2914 0.3813 -0.0078 -0.0217 -0.0237 83  LEU A CG    
691  C CD1   . LEU A 83  ? 0.3483 0.2949 0.3893 -0.0097 -0.0244 -0.0240 83  LEU A CD1   
692  C CD2   . LEU A 83  ? 0.3175 0.2720 0.3597 -0.0057 -0.0232 -0.0252 83  LEU A CD2   
693  N N     . GLY A 84  ? 0.3589 0.3238 0.4093 -0.0106 -0.0117 -0.0190 84  GLY A N     
694  C CA    . GLY A 84  ? 0.3236 0.2930 0.3777 -0.0114 -0.0092 -0.0181 84  GLY A CA    
695  C C     . GLY A 84  ? 0.3301 0.2997 0.3816 -0.0105 -0.0067 -0.0170 84  GLY A C     
696  O O     . GLY A 84  ? 0.2941 0.2604 0.3417 -0.0096 -0.0071 -0.0168 84  GLY A O     
697  N N     . MET A 85  ? 0.3329 0.3062 0.3870 -0.0106 -0.0047 -0.0163 85  MET A N     
698  C CA    . MET A 85  ? 0.3044 0.2777 0.3559 -0.0097 -0.0027 -0.0153 85  MET A CA    
699  C C     . MET A 85  ? 0.3254 0.2943 0.3741 -0.0114 -0.0007 -0.0140 85  MET A C     
700  O O     . MET A 85  ? 0.3686 0.3379 0.4195 -0.0133 0.0017  -0.0132 85  MET A O     
701  C CB    . MET A 85  ? 0.3092 0.2870 0.3635 -0.0089 -0.0014 -0.0151 85  MET A CB    
702  C CG    . MET A 85  ? 0.2842 0.2617 0.3359 -0.0082 0.0006  -0.0140 85  MET A CG    
703  S SD    . MET A 85  ? 0.3132 0.2881 0.3602 -0.0066 -0.0006 -0.0140 85  MET A SD    
704  C CE    . MET A 85  ? 0.3014 0.2800 0.3494 -0.0048 -0.0019 -0.0152 85  MET A CE    
705  N N     . ASP A 86  ? 0.3472 0.3116 0.3911 -0.0106 -0.0018 -0.0138 86  ASP A N     
706  C CA    . ASP A 86  ? 0.3664 0.3242 0.4053 -0.0119 -0.0008 -0.0127 86  ASP A CA    
707  C C     . ASP A 86  ? 0.3720 0.3288 0.4082 -0.0116 0.0015  -0.0115 86  ASP A C     
708  O O     . ASP A 86  ? 0.3634 0.3143 0.3948 -0.0128 0.0031  -0.0103 86  ASP A O     
709  C CB    . ASP A 86  ? 0.3977 0.3503 0.4324 -0.0108 -0.0039 -0.0133 86  ASP A CB    
710  C CG    . ASP A 86  ? 0.4523 0.4076 0.4877 -0.0080 -0.0056 -0.0142 86  ASP A CG    
711  O OD1   . ASP A 86  ? 0.4996 0.4509 0.5315 -0.0071 -0.0069 -0.0141 86  ASP A OD1   
712  O OD2   . ASP A 86  ? 0.5054 0.4664 0.5446 -0.0069 -0.0057 -0.0151 86  ASP A OD2   
713  N N     . ASP A 87  ? 0.3590 0.3206 0.3974 -0.0100 0.0016  -0.0117 87  ASP A N     
714  C CA    . ASP A 87  ? 0.3392 0.3002 0.3754 -0.0096 0.0037  -0.0106 87  ASP A CA    
715  C C     . ASP A 87  ? 0.3521 0.3173 0.3926 -0.0105 0.0067  -0.0104 87  ASP A C     
716  O O     . ASP A 87  ? 0.3432 0.3142 0.3883 -0.0096 0.0063  -0.0111 87  ASP A O     
717  C CB    . ASP A 87  ? 0.3568 0.3202 0.3932 -0.0075 0.0022  -0.0110 87  ASP A CB    
718  C CG    . ASP A 87  ? 0.4234 0.3850 0.4566 -0.0070 0.0036  -0.0100 87  ASP A CG    
719  O OD1   . ASP A 87  ? 0.3816 0.3412 0.4130 -0.0078 0.0063  -0.0091 87  ASP A OD1   
720  O OD2   . ASP A 87  ? 0.4071 0.3691 0.4397 -0.0057 0.0020  -0.0101 87  ASP A OD2   
721  N N     . PHE A 88  ? 0.3406 0.3026 0.3794 -0.0122 0.0097  -0.0095 88  PHE A N     
722  C CA    . PHE A 88  ? 0.3425 0.3090 0.3872 -0.0135 0.0127  -0.0096 88  PHE A CA    
723  C C     . PHE A 88  ? 0.3524 0.3234 0.3997 -0.0119 0.0141  -0.0097 88  PHE A C     
724  O O     . PHE A 88  ? 0.3889 0.3660 0.4434 -0.0118 0.0145  -0.0106 88  PHE A O     
725  C CB    . PHE A 88  ? 0.3505 0.3121 0.3928 -0.0161 0.0163  -0.0086 88  PHE A CB    
726  C CG    . PHE A 88  ? 0.3574 0.3138 0.3969 -0.0179 0.0147  -0.0085 88  PHE A CG    
727  C CD1   . PHE A 88  ? 0.3730 0.3330 0.4177 -0.0183 0.0117  -0.0097 88  PHE A CD1   
728  C CD2   . PHE A 88  ? 0.3720 0.3190 0.4026 -0.0189 0.0157  -0.0073 88  PHE A CD2   
729  C CE1   . PHE A 88  ? 0.3488 0.3035 0.3905 -0.0197 0.0099  -0.0097 88  PHE A CE1   
730  C CE2   . PHE A 88  ? 0.3884 0.3298 0.4157 -0.0204 0.0138  -0.0073 88  PHE A CE2   
731  C CZ    . PHE A 88  ? 0.3630 0.3085 0.3962 -0.0208 0.0109  -0.0085 88  PHE A CZ    
732  N N     . LYS A 89  ? 0.3222 0.2901 0.3639 -0.0103 0.0142  -0.0090 89  LYS A N     
733  C CA    . LYS A 89  ? 0.3584 0.3295 0.4014 -0.0086 0.0151  -0.0091 89  LYS A CA    
734  C C     . LYS A 89  ? 0.3237 0.3003 0.3710 -0.0071 0.0121  -0.0102 89  LYS A C     
735  O O     . LYS A 89  ? 0.2988 0.2792 0.3494 -0.0059 0.0125  -0.0107 89  LYS A O     
736  C CB    . LYS A 89  ? 0.3516 0.3170 0.3868 -0.0074 0.0156  -0.0081 89  LYS A CB    
737  C CG    . LYS A 89  ? 0.3923 0.3539 0.4227 -0.0067 0.0121  -0.0079 89  LYS A CG    
738  C CD    . LYS A 89  ? 0.4293 0.3827 0.4512 -0.0064 0.0129  -0.0068 89  LYS A CD    
739  C CE    . LYS A 89  ? 0.4983 0.4475 0.5161 -0.0056 0.0089  -0.0068 89  LYS A CE    
740  N NZ    . LYS A 89  ? 0.4755 0.4252 0.4955 -0.0062 0.0064  -0.0075 89  LYS A NZ    
741  N N     . LEU A 90  ? 0.3337 0.3103 0.3807 -0.0071 0.0091  -0.0106 90  LEU A N     
742  C CA    . LEU A 90  ? 0.3172 0.2977 0.3668 -0.0058 0.0066  -0.0116 90  LEU A CA    
743  C C     . LEU A 90  ? 0.3148 0.2995 0.3708 -0.0063 0.0060  -0.0127 90  LEU A C     
744  O O     . LEU A 90  ? 0.2854 0.2732 0.3438 -0.0050 0.0046  -0.0135 90  LEU A O     
745  C CB    . LEU A 90  ? 0.3263 0.3053 0.3735 -0.0055 0.0042  -0.0119 90  LEU A CB    
746  C CG    . LEU A 90  ? 0.3191 0.2953 0.3620 -0.0047 0.0037  -0.0113 90  LEU A CG    
747  C CD1   . LEU A 90  ? 0.2892 0.2658 0.3324 -0.0043 0.0017  -0.0122 90  LEU A CD1   
748  C CD2   . LEU A 90  ? 0.3586 0.3359 0.4005 -0.0036 0.0041  -0.0109 90  LEU A CD2   
749  N N     . ALA A 91  ? 0.3086 0.2927 0.3669 -0.0082 0.0066  -0.0128 91  ALA A N     
750  C CA    . ALA A 91  ? 0.3355 0.3236 0.4010 -0.0091 0.0060  -0.0139 91  ALA A CA    
751  C C     . ALA A 91  ? 0.3170 0.3089 0.3878 -0.0088 0.0084  -0.0141 91  ALA A C     
752  O O     . ALA A 91  ? 0.3327 0.3290 0.4096 -0.0081 0.0067  -0.0154 91  ALA A O     
753  C CB    . ALA A 91  ? 0.2686 0.2545 0.3353 -0.0116 0.0063  -0.0139 91  ALA A CB    
754  N N     . TYR A 92  ? 0.3345 0.3243 0.4025 -0.0092 0.0122  -0.0130 92  TYR A N     
755  C CA    . TYR A 92  ? 0.3522 0.3452 0.4246 -0.0086 0.0151  -0.0133 92  TYR A CA    
756  C C     . TYR A 92  ? 0.3485 0.3444 0.4217 -0.0057 0.0129  -0.0141 92  TYR A C     
757  O O     . TYR A 92  ? 0.3226 0.3233 0.4030 -0.0048 0.0126  -0.0154 92  TYR A O     
758  C CB    . TYR A 92  ? 0.3735 0.3618 0.4399 -0.0091 0.0195  -0.0119 92  TYR A CB    
759  C CG    . TYR A 92  ? 0.4013 0.3925 0.4711 -0.0078 0.0228  -0.0123 92  TYR A CG    
760  C CD1   . TYR A 92  ? 0.3704 0.3606 0.4359 -0.0051 0.0222  -0.0121 92  TYR A CD1   
761  C CD2   . TYR A 92  ? 0.3769 0.3719 0.4546 -0.0093 0.0266  -0.0129 92  TYR A CD2   
762  C CE1   . TYR A 92  ? 0.3958 0.3883 0.4642 -0.0035 0.0250  -0.0127 92  TYR A CE1   
763  C CE2   . TYR A 92  ? 0.4016 0.3999 0.4833 -0.0078 0.0299  -0.0136 92  TYR A CE2   
764  C CZ    . TYR A 92  ? 0.3899 0.3866 0.4665 -0.0047 0.0290  -0.0135 92  TYR A CZ    
765  O OH    . TYR A 92  ? 0.4032 0.4028 0.4835 -0.0028 0.0321  -0.0144 92  TYR A OH    
766  N N     . LEU A 93  ? 0.3537 0.3462 0.4196 -0.0043 0.0111  -0.0134 93  LEU A N     
767  C CA    . LEU A 93  ? 0.3570 0.3507 0.4221 -0.0018 0.0089  -0.0139 93  LEU A CA    
768  C C     . LEU A 93  ? 0.3504 0.3472 0.4199 -0.0011 0.0052  -0.0154 93  LEU A C     
769  O O     . LEU A 93  ? 0.3442 0.3433 0.4165 0.0008  0.0036  -0.0165 93  LEU A O     
770  C CB    . LEU A 93  ? 0.3153 0.3046 0.3721 -0.0011 0.0079  -0.0128 93  LEU A CB    
771  C CG    . LEU A 93  ? 0.3330 0.3184 0.3845 -0.0010 0.0104  -0.0116 93  LEU A CG    
772  C CD1   . LEU A 93  ? 0.3159 0.2976 0.3610 -0.0005 0.0086  -0.0108 93  LEU A CD1   
773  C CD2   . LEU A 93  ? 0.2796 0.2662 0.3325 0.0007  0.0122  -0.0119 93  LEU A CD2   
774  N N     . SER A 94  ? 0.3155 0.3117 0.3851 -0.0024 0.0035  -0.0156 94  SER A N     
775  C CA    . SER A 94  ? 0.3399 0.3375 0.4121 -0.0018 -0.0004 -0.0171 94  SER A CA    
776  C C     . SER A 94  ? 0.3572 0.3596 0.4389 -0.0018 -0.0012 -0.0186 94  SER A C     
777  O O     . SER A 94  ? 0.3336 0.3372 0.4174 0.0001  -0.0047 -0.0200 94  SER A O     
778  C CB    . SER A 94  ? 0.3557 0.3511 0.4258 -0.0032 -0.0016 -0.0171 94  SER A CB    
779  O OG    . SER A 94  ? 0.3326 0.3269 0.4005 -0.0018 -0.0053 -0.0181 94  SER A OG    
780  N N     . ASP A 95  ? 0.3576 0.3621 0.4449 -0.0040 0.0019  -0.0184 95  ASP A N     
781  C CA    . ASP A 95  ? 0.3615 0.3714 0.4598 -0.0046 0.0021  -0.0199 95  ASP A CA    
782  C C     . ASP A 95  ? 0.3610 0.3742 0.4630 -0.0023 0.0032  -0.0206 95  ASP A C     
783  O O     . ASP A 95  ? 0.3866 0.4042 0.4970 -0.0011 0.0007  -0.0225 95  ASP A O     
784  C CB    . ASP A 95  ? 0.3556 0.3662 0.4579 -0.0079 0.0063  -0.0192 95  ASP A CB    
785  C CG    . ASP A 95  ? 0.3590 0.3675 0.4610 -0.0102 0.0041  -0.0192 95  ASP A CG    
786  O OD1   . ASP A 95  ? 0.3377 0.3433 0.4373 -0.0127 0.0070  -0.0180 95  ASP A OD1   
787  O OD2   . ASP A 95  ? 0.3661 0.3751 0.4695 -0.0092 -0.0008 -0.0205 95  ASP A OD2   
788  N N     . THR A 96  ? 0.3772 0.3879 0.4731 -0.0016 0.0066  -0.0192 96  THR A N     
789  C CA    . THR A 96  ? 0.3457 0.3588 0.4443 0.0006  0.0085  -0.0198 96  THR A CA    
790  C C     . THR A 96  ? 0.3393 0.3511 0.4342 0.0039  0.0043  -0.0205 96  THR A C     
791  O O     . THR A 96  ? 0.3340 0.3489 0.4339 0.0063  0.0037  -0.0219 96  THR A O     
792  C CB    . THR A 96  ? 0.3659 0.3756 0.4585 -0.0001 0.0139  -0.0181 96  THR A CB    
793  O OG1   . THR A 96  ? 0.3496 0.3589 0.4439 -0.0034 0.0176  -0.0173 96  THR A OG1   
794  C CG2   . THR A 96  ? 0.3375 0.3497 0.4334 0.0021  0.0167  -0.0188 96  THR A CG2   
795  N N     . TYR A 97  ? 0.3291 0.3362 0.4152 0.0041  0.0017  -0.0196 97  TYR A N     
796  C CA    . TYR A 97  ? 0.3457 0.3500 0.4262 0.0068  -0.0021 -0.0199 97  TYR A CA    
797  C C     . TYR A 97  ? 0.3784 0.3806 0.4564 0.0067  -0.0064 -0.0205 97  TYR A C     
798  O O     . TYR A 97  ? 0.3899 0.3877 0.4596 0.0064  -0.0069 -0.0194 97  TYR A O     
799  C CB    . TYR A 97  ? 0.2882 0.2875 0.3589 0.0072  -0.0003 -0.0181 97  TYR A CB    
800  C CG    . TYR A 97  ? 0.3035 0.3036 0.3751 0.0077  0.0037  -0.0176 97  TYR A CG    
801  C CD1   . TYR A 97  ? 0.3216 0.3206 0.3918 0.0055  0.0078  -0.0163 97  TYR A CD1   
802  C CD2   . TYR A 97  ? 0.3495 0.3506 0.4228 0.0104  0.0033  -0.0186 97  TYR A CD2   
803  C CE1   . TYR A 97  ? 0.3247 0.3232 0.3945 0.0060  0.0117  -0.0159 97  TYR A CE1   
804  C CE2   . TYR A 97  ? 0.3115 0.3127 0.3852 0.0111  0.0073  -0.0183 97  TYR A CE2   
805  C CZ    . TYR A 97  ? 0.3265 0.3263 0.3982 0.0088  0.0117  -0.0170 97  TYR A CZ    
806  O OH    . TYR A 97  ? 0.3078 0.3066 0.3784 0.0095  0.0159  -0.0167 97  TYR A OH    
807  N N     . ASN A 98  ? 0.4059 0.4114 0.4917 0.0070  -0.0094 -0.0223 98  ASN A N     
808  C CA    . ASN A 98  ? 0.4491 0.4523 0.5329 0.0070  -0.0139 -0.0232 98  ASN A CA    
809  C C     . ASN A 98  ? 0.4651 0.4644 0.5436 0.0101  -0.0186 -0.0242 98  ASN A C     
810  O O     . ASN A 98  ? 0.5012 0.5006 0.5832 0.0115  -0.0234 -0.0261 98  ASN A O     
811  C CB    . ASN A 98  ? 0.4332 0.4409 0.5277 0.0056  -0.0155 -0.0248 98  ASN A CB    
812  C CG    . ASN A 98  ? 0.4812 0.4854 0.5725 0.0053  -0.0198 -0.0255 98  ASN A CG    
813  O OD1   . ASN A 98  ? 0.4330 0.4317 0.5140 0.0058  -0.0205 -0.0246 98  ASN A OD1   
814  N ND2   . ASN A 98  ? 0.4660 0.4734 0.5663 0.0044  -0.0226 -0.0272 98  ASN A ND2   
815  N N     . TYR A 99  ? 0.4885 0.4837 0.5581 0.0111  -0.0174 -0.0228 99  TYR A N     
816  C CA    . TYR A 99  ? 0.5034 0.4932 0.5656 0.0137  -0.0213 -0.0233 99  TYR A CA    
817  C C     . TYR A 99  ? 0.4994 0.4843 0.5512 0.0133  -0.0186 -0.0212 99  TYR A C     
818  O O     . TYR A 99  ? 0.4628 0.4493 0.5147 0.0114  -0.0143 -0.0197 99  TYR A O     
819  C CB    . TYR A 99  ? 0.5134 0.5056 0.5815 0.0165  -0.0236 -0.0249 99  TYR A CB    
820  C CG    . TYR A 99  ? 0.5658 0.5624 0.6388 0.0163  -0.0189 -0.0243 99  TYR A CG    
821  C CD1   . TYR A 99  ? 0.5670 0.5708 0.6516 0.0150  -0.0162 -0.0251 99  TYR A CD1   
822  C CD2   . TYR A 99  ? 0.5698 0.5628 0.6354 0.0173  -0.0172 -0.0230 99  TYR A CD2   
823  C CE1   . TYR A 99  ? 0.5732 0.5800 0.6610 0.0150  -0.0115 -0.0245 99  TYR A CE1   
824  C CE2   . TYR A 99  ? 0.5275 0.5234 0.5964 0.0174  -0.0131 -0.0225 99  TYR A CE2   
825  C CZ    . TYR A 99  ? 0.5836 0.5862 0.6632 0.0164  -0.0101 -0.0233 99  TYR A CZ    
826  O OH    . TYR A 99  ? 0.6056 0.6101 0.6872 0.0166  -0.0056 -0.0229 99  TYR A OH    
827  N N     . GLU A 100 ? 0.4825 0.4610 0.5252 0.0149  -0.0212 -0.0211 100 GLU A N     
828  C CA    . GLU A 100 ? 0.5248 0.4987 0.5585 0.0142  -0.0186 -0.0192 100 GLU A CA    
829  C C     . GLU A 100 ? 0.4927 0.4681 0.5281 0.0151  -0.0170 -0.0187 100 GLU A C     
830  O O     . GLU A 100 ? 0.5251 0.5000 0.5618 0.0177  -0.0198 -0.0199 100 GLU A O     
831  C CB    . GLU A 100 ? 0.5541 0.5198 0.5768 0.0154  -0.0214 -0.0191 100 GLU A CB    
832  C CG    . GLU A 100 ? 0.6604 0.6217 0.6744 0.0137  -0.0180 -0.0171 100 GLU A CG    
833  C CD    . GLU A 100 ? 0.7543 0.7066 0.7565 0.0146  -0.0199 -0.0168 100 GLU A CD    
834  O OE1   . GLU A 100 ? 0.7722 0.7210 0.7679 0.0127  -0.0167 -0.0152 100 GLU A OE1   
835  O OE2   . GLU A 100 ? 0.7695 0.7178 0.7689 0.0171  -0.0245 -0.0182 100 GLU A OE2   
836  N N     . ILE A 101 ? 0.4663 0.4432 0.5018 0.0133  -0.0128 -0.0171 101 ILE A N     
837  C CA    . ILE A 101 ? 0.4639 0.4415 0.5003 0.0141  -0.0111 -0.0167 101 ILE A CA    
838  C C     . ILE A 101 ? 0.4786 0.4498 0.5063 0.0155  -0.0126 -0.0160 101 ILE A C     
839  O O     . ILE A 101 ? 0.5038 0.4704 0.5240 0.0141  -0.0120 -0.0146 101 ILE A O     
840  C CB    . ILE A 101 ? 0.4392 0.4187 0.4768 0.0119  -0.0068 -0.0152 101 ILE A CB    
841  C CG1   . ILE A 101 ? 0.4484 0.4335 0.4946 0.0107  -0.0052 -0.0159 101 ILE A CG1   
842  C CG2   . ILE A 101 ? 0.3750 0.3528 0.4104 0.0129  -0.0052 -0.0145 101 ILE A CG2   
843  C CD1   . ILE A 101 ? 0.3964 0.3818 0.4422 0.0083  -0.0019 -0.0146 101 ILE A CD1   
844  N N     . LYS A 102 ? 0.5007 0.4717 0.5297 0.0183  -0.0144 -0.0170 102 LYS A N     
845  C CA    . LYS A 102 ? 0.5395 0.5041 0.5603 0.0197  -0.0158 -0.0164 102 LYS A CA    
846  C C     . LYS A 102 ? 0.5326 0.4987 0.5552 0.0202  -0.0131 -0.0159 102 LYS A C     
847  O O     . LYS A 102 ? 0.5674 0.5376 0.5968 0.0224  -0.0129 -0.0174 102 LYS A O     
848  C CB    . LYS A 102 ? 0.5830 0.5447 0.6025 0.0231  -0.0208 -0.0182 102 LYS A CB    
849  C CG    . LYS A 102 ? 0.6566 0.6095 0.6651 0.0244  -0.0229 -0.0174 102 LYS A CG    
850  C CD    . LYS A 102 ? 0.7510 0.6967 0.7492 0.0224  -0.0235 -0.0160 102 LYS A CD    
851  C CE    . LYS A 102 ? 0.8141 0.7508 0.8010 0.0225  -0.0242 -0.0146 102 LYS A CE    
852  N NZ    . LYS A 102 ? 0.8189 0.7485 0.7957 0.0201  -0.0236 -0.0131 102 LYS A NZ    
853  N N     . TYR A 103 ? 0.4969 0.4594 0.5136 0.0183  -0.0109 -0.0140 103 TYR A N     
854  C CA    . TYR A 103 ? 0.4688 0.4315 0.4858 0.0186  -0.0084 -0.0134 103 TYR A CA    
855  C C     . TYR A 103 ? 0.4721 0.4283 0.4816 0.0205  -0.0102 -0.0131 103 TYR A C     
856  O O     . TYR A 103 ? 0.4924 0.4430 0.4951 0.0205  -0.0128 -0.0126 103 TYR A O     
857  C CB    . TYR A 103 ? 0.4403 0.4033 0.4565 0.0154  -0.0053 -0.0117 103 TYR A CB    
858  C CG    . TYR A 103 ? 0.4244 0.3819 0.4331 0.0133  -0.0058 -0.0101 103 TYR A CG    
859  C CD1   . TYR A 103 ? 0.4441 0.4014 0.4516 0.0114  -0.0061 -0.0097 103 TYR A CD1   
860  C CD2   . TYR A 103 ? 0.3737 0.3262 0.3769 0.0133  -0.0058 -0.0090 103 TYR A CD2   
861  C CE1   . TYR A 103 ? 0.4071 0.3600 0.4090 0.0092  -0.0059 -0.0082 103 TYR A CE1   
862  C CE2   . TYR A 103 ? 0.4163 0.3644 0.4140 0.0110  -0.0062 -0.0075 103 TYR A CE2   
863  C CZ    . TYR A 103 ? 0.4056 0.3542 0.4031 0.0089  -0.0059 -0.0072 103 TYR A CZ    
864  O OH    . TYR A 103 ? 0.3725 0.3171 0.3655 0.0064  -0.0056 -0.0058 103 TYR A OH    
865  N N     . ASP A 104 ? 0.4428 0.3989 0.4529 0.0222  -0.0088 -0.0133 104 ASP A N     
866  C CA    . ASP A 104 ? 0.4463 0.3958 0.4491 0.0242  -0.0105 -0.0130 104 ASP A CA    
867  C C     . ASP A 104 ? 0.4343 0.3806 0.4329 0.0225  -0.0081 -0.0114 104 ASP A C     
868  O O     . ASP A 104 ? 0.4377 0.3863 0.4393 0.0232  -0.0054 -0.0118 104 ASP A O     
869  C CB    . ASP A 104 ? 0.4466 0.3979 0.4533 0.0285  -0.0115 -0.0153 104 ASP A CB    
870  C CG    . ASP A 104 ? 0.4692 0.4131 0.4679 0.0311  -0.0134 -0.0152 104 ASP A CG    
871  O OD1   . ASP A 104 ? 0.4516 0.3886 0.4416 0.0292  -0.0140 -0.0133 104 ASP A OD1   
872  O OD2   . ASP A 104 ? 0.5318 0.4769 0.5335 0.0350  -0.0144 -0.0172 104 ASP A OD2   
873  N N     . HIS A 105 ? 0.4371 0.3776 0.4285 0.0202  -0.0092 -0.0097 105 HIS A N     
874  C CA    . HIS A 105 ? 0.4593 0.3965 0.4472 0.0183  -0.0079 -0.0082 105 HIS A CA    
875  C C     . HIS A 105 ? 0.4455 0.3782 0.4292 0.0210  -0.0079 -0.0085 105 HIS A C     
876  O O     . HIS A 105 ? 0.4395 0.3706 0.4217 0.0203  -0.0063 -0.0079 105 HIS A O     
877  C CB    . HIS A 105 ? 0.4440 0.3766 0.4268 0.0150  -0.0091 -0.0065 105 HIS A CB    
878  C CG    . HIS A 105 ? 0.4977 0.4225 0.4723 0.0159  -0.0118 -0.0060 105 HIS A CG    
879  N ND1   . HIS A 105 ? 0.5003 0.4188 0.4692 0.0155  -0.0127 -0.0050 105 HIS A ND1   
880  C CD2   . HIS A 105 ? 0.5343 0.4556 0.5048 0.0172  -0.0142 -0.0064 105 HIS A CD2   
881  C CE1   . HIS A 105 ? 0.5465 0.4581 0.5082 0.0163  -0.0153 -0.0047 105 HIS A CE1   
882  N NE2   . HIS A 105 ? 0.5187 0.4317 0.4810 0.0174  -0.0162 -0.0055 105 HIS A NE2   
883  N N     . THR A 106 ? 0.3588 0.3718 0.4141 0.0173  -0.0065 0.0029  106 THR A N     
884  C CA    . THR A 106 ? 0.3460 0.3607 0.4050 0.0232  -0.0032 0.0038  106 THR A CA    
885  C C     . THR A 106 ? 0.3466 0.3699 0.4150 0.0228  0.0013  0.0037  106 THR A C     
886  O O     . THR A 106 ? 0.3392 0.3621 0.4086 0.0269  0.0057  0.0038  106 THR A O     
887  C CB    . THR A 106 ? 0.3711 0.3896 0.4339 0.0288  -0.0069 0.0057  106 THR A CB    
888  O OG1   . THR A 106 ? 0.3323 0.3644 0.4069 0.0277  -0.0098 0.0068  106 THR A OG1   
889  C CG2   . THR A 106 ? 0.3635 0.3726 0.4158 0.0288  -0.0116 0.0062  106 THR A CG2   
890  N N     . LYS A 107 ? 0.3194 0.3496 0.3934 0.0173  0.0004  0.0035  107 LYS A N     
891  C CA    . LYS A 107 ? 0.3208 0.3590 0.4030 0.0153  0.0047  0.0036  107 LYS A CA    
892  C C     . LYS A 107 ? 0.3216 0.3518 0.3970 0.0113  0.0086  0.0022  107 LYS A C     
893  O O     . LYS A 107 ? 0.3176 0.3516 0.3971 0.0095  0.0128  0.0023  107 LYS A O     
894  C CB    . LYS A 107 ? 0.3111 0.3613 0.4031 0.0106  0.0014  0.0043  107 LYS A CB    
895  C CG    . LYS A 107 ? 0.3604 0.4207 0.4603 0.0135  -0.0038 0.0060  107 LYS A CG    
896  C CD    . LYS A 107 ? 0.3622 0.4299 0.4700 0.0212  -0.0010 0.0073  107 LYS A CD    
897  C CE    . LYS A 107 ? 0.4617 0.5416 0.5793 0.0242  -0.0065 0.0093  107 LYS A CE    
898  N NZ    . LYS A 107 ? 0.4625 0.5441 0.5833 0.0340  -0.0045 0.0104  107 LYS A NZ    
899  N N     . ILE A 108 ? 0.2801 0.2996 0.3453 0.0098  0.0071  0.0011  108 ILE A N     
900  C CA    . ILE A 108 ? 0.2953 0.3072 0.3540 0.0068  0.0101  0.0000  108 ILE A CA    
901  C C     . ILE A 108 ? 0.2831 0.2886 0.3361 0.0106  0.0139  -0.0001 108 ILE A C     
902  O O     . ILE A 108 ? 0.2671 0.2675 0.3146 0.0137  0.0125  -0.0002 108 ILE A O     
903  C CB    . ILE A 108 ? 0.2468 0.2516 0.2980 0.0036  0.0070  -0.0012 108 ILE A CB    
904  C CG1   . ILE A 108 ? 0.2518 0.2614 0.3068 -0.0009 0.0031  -0.0014 108 ILE A CG1   
905  C CG2   . ILE A 108 ? 0.2849 0.2818 0.3296 0.0018  0.0100  -0.0021 108 ILE A CG2   
906  C CD1   . ILE A 108 ? 0.2346 0.2367 0.2813 -0.0035 0.0000  -0.0029 108 ILE A CD1   
907  N N     . ARG A 109 ? 0.2919 0.2970 0.3452 0.0100  0.0184  0.0001  109 ARG A N     
908  C CA    . ARG A 109 ? 0.2812 0.2797 0.3281 0.0129  0.0219  -0.0001 109 ARG A CA    
909  C C     . ARG A 109 ? 0.2654 0.2547 0.3029 0.0113  0.0211  -0.0008 109 ARG A C     
910  O O     . ARG A 109 ? 0.2783 0.2650 0.3139 0.0083  0.0223  -0.0009 109 ARG A O     
911  C CB    . ARG A 109 ? 0.3090 0.3103 0.3588 0.0128  0.0272  0.0004  109 ARG A CB    
912  C CG    . ARG A 109 ? 0.3066 0.3016 0.3497 0.0163  0.0307  0.0002  109 ARG A CG    
913  C CD    . ARG A 109 ? 0.2737 0.2719 0.3193 0.0164  0.0364  0.0006  109 ARG A CD    
914  N NE    . ARG A 109 ? 0.3120 0.3220 0.3689 0.0180  0.0379  0.0012  109 ARG A NE    
915  C CZ    . ARG A 109 ? 0.3189 0.3322 0.3789 0.0238  0.0394  0.0011  109 ARG A CZ    
916  N NH1   . ARG A 109 ? 0.3519 0.3558 0.4032 0.0279  0.0395  0.0003  109 ARG A NH1   
917  N NH2   . ARG A 109 ? 0.3466 0.3726 0.4184 0.0254  0.0406  0.0017  109 ARG A NH2   
918  N N     . VAL A 110 ? 0.2820 0.2665 0.3138 0.0134  0.0192  -0.0011 110 VAL A N     
919  C CA    . VAL A 110 ? 0.2956 0.2735 0.3197 0.0122  0.0185  -0.0016 110 VAL A CA    
920  C C     . VAL A 110 ? 0.3431 0.3158 0.3612 0.0138  0.0210  -0.0014 110 VAL A C     
921  O O     . VAL A 110 ? 0.3800 0.3506 0.3957 0.0164  0.0211  -0.0013 110 VAL A O     
922  C CB    . VAL A 110 ? 0.3396 0.3161 0.3607 0.0119  0.0146  -0.0021 110 VAL A CB    
923  C CG1   . VAL A 110 ? 0.3010 0.2730 0.3157 0.0106  0.0143  -0.0026 110 VAL A CG1   
924  C CG2   . VAL A 110 ? 0.3101 0.2910 0.3360 0.0100  0.0119  -0.0024 110 VAL A CG2   
925  N N     . ALA A 111 ? 0.3009 0.2708 0.3158 0.0124  0.0228  -0.0012 111 ALA A N     
926  C CA    . ALA A 111 ? 0.3163 0.2810 0.3246 0.0132  0.0249  -0.0010 111 ALA A CA    
927  C C     . ALA A 111 ? 0.3001 0.2612 0.3023 0.0121  0.0228  -0.0010 111 ALA A C     
928  O O     . ALA A 111 ? 0.2680 0.2296 0.2706 0.0109  0.0217  -0.0009 111 ALA A O     
929  C CB    . ALA A 111 ? 0.3218 0.2861 0.3303 0.0124  0.0285  -0.0003 111 ALA A CB    
930  N N     . ASN A 112 ? 0.2974 0.2546 0.2936 0.0127  0.0224  -0.0010 112 ASN A N     
931  C CA    . ASN A 112 ? 0.3429 0.2981 0.3337 0.0112  0.0203  -0.0009 112 ASN A CA    
932  C C     . ASN A 112 ? 0.3400 0.2904 0.3241 0.0108  0.0219  -0.0004 112 ASN A C     
933  O O     . ASN A 112 ? 0.3572 0.3034 0.3375 0.0118  0.0234  -0.0007 112 ASN A O     
934  C CB    . ASN A 112 ? 0.3681 0.3224 0.3566 0.0109  0.0181  -0.0012 112 ASN A CB    
935  C CG    . ASN A 112 ? 0.4901 0.4457 0.4757 0.0087  0.0158  -0.0011 112 ASN A CG    
936  O OD1   . ASN A 112 ? 0.5072 0.4611 0.4879 0.0072  0.0154  -0.0006 112 ASN A OD1   
937  N ND2   . ASN A 112 ? 0.4963 0.4552 0.4846 0.0082  0.0141  -0.0015 112 ASN A ND2   
938  N N     . PHE A 113 ? 0.3318 0.2821 0.3137 0.0097  0.0215  0.0004  113 PHE A N     
939  C CA    . PHE A 113 ? 0.3495 0.2948 0.3239 0.0089  0.0225  0.0010  113 PHE A CA    
940  C C     . PHE A 113 ? 0.3369 0.2827 0.3072 0.0072  0.0197  0.0020  113 PHE A C     
941  O O     . PHE A 113 ? 0.3187 0.2694 0.2930 0.0072  0.0176  0.0023  113 PHE A O     
942  C CB    . PHE A 113 ? 0.3382 0.2813 0.3124 0.0096  0.0260  0.0015  113 PHE A CB    
943  C CG    . PHE A 113 ? 0.3305 0.2742 0.3053 0.0090  0.0256  0.0028  113 PHE A CG    
944  C CD1   . PHE A 113 ? 0.4080 0.3554 0.3891 0.0094  0.0246  0.0028  113 PHE A CD1   
945  C CD2   . PHE A 113 ? 0.3793 0.3185 0.3472 0.0082  0.0264  0.0040  113 PHE A CD2   
946  C CE1   . PHE A 113 ? 0.4052 0.3511 0.3856 0.0094  0.0243  0.0040  113 PHE A CE1   
947  C CE2   . PHE A 113 ? 0.3096 0.2480 0.2770 0.0081  0.0258  0.0055  113 PHE A CE2   
948  C CZ    . PHE A 113 ? 0.3554 0.2967 0.3290 0.0088  0.0248  0.0056  113 PHE A CZ    
949  N N     . ASP A 114 ? 0.3520 0.2928 0.3141 0.0057  0.0197  0.0024  114 ASP A N     
950  C CA    . ASP A 114 ? 0.3802 0.3222 0.3382 0.0036  0.0166  0.0036  114 ASP A CA    
951  C C     . ASP A 114 ? 0.3766 0.3118 0.3254 0.0024  0.0175  0.0042  114 ASP A C     
952  O O     . ASP A 114 ? 0.3832 0.3118 0.3265 0.0023  0.0200  0.0032  114 ASP A O     
953  C CB    . ASP A 114 ? 0.3835 0.3273 0.3396 0.0011  0.0138  0.0032  114 ASP A CB    
954  C CG    . ASP A 114 ? 0.4760 0.4241 0.4300 -0.0014 0.0103  0.0046  114 ASP A CG    
955  O OD1   . ASP A 114 ? 0.4252 0.3798 0.3848 0.0003  0.0090  0.0057  114 ASP A OD1   
956  O OD2   . ASP A 114 ? 0.5987 0.5434 0.5450 -0.0050 0.0086  0.0047  114 ASP A OD2   
957  N N     . ILE A 115 ? 0.3631 0.2994 0.3098 0.0019  0.0155  0.0060  115 ILE A N     
958  C CA    . ILE A 115 ? 0.3746 0.3041 0.3112 0.0003  0.0158  0.0068  115 ILE A CA    
959  C C     . ILE A 115 ? 0.3836 0.3142 0.3143 -0.0030 0.0112  0.0080  115 ILE A C     
960  O O     . ILE A 115 ? 0.3736 0.3124 0.3099 -0.0034 0.0078  0.0087  115 ILE A O     
961  C CB    . ILE A 115 ? 0.3717 0.2991 0.3080 0.0019  0.0176  0.0083  115 ILE A CB    
962  C CG1   . ILE A 115 ? 0.3577 0.2903 0.2975 0.0030  0.0138  0.0105  115 ILE A CG1   
963  C CG2   . ILE A 115 ? 0.3603 0.2876 0.3028 0.0040  0.0221  0.0073  115 ILE A CG2   
964  C CD1   . ILE A 115 ? 0.3443 0.2722 0.2803 0.0040  0.0147  0.0125  115 ILE A CD1   
965  N N     . GLU A 116 ? 0.3736 0.2965 0.2929 -0.0056 0.0112  0.0081  116 GLU A N     
966  C CA    . GLU A 116 ? 0.3922 0.3158 0.3046 -0.0093 0.0064  0.0096  116 GLU A CA    
967  C C     . GLU A 116 ? 0.3886 0.3076 0.2936 -0.0094 0.0058  0.0115  116 GLU A C     
968  O O     . GLU A 116 ? 0.3994 0.3104 0.2991 -0.0084 0.0101  0.0109  116 GLU A O     
969  C CB    . GLU A 116 ? 0.3885 0.3053 0.2911 -0.0137 0.0058  0.0080  116 GLU A CB    
970  C CG    . GLU A 116 ? 0.4715 0.3909 0.3791 -0.0143 0.0059  0.0064  116 GLU A CG    
971  C CD    . GLU A 116 ? 0.5204 0.4527 0.4378 -0.0152 0.0020  0.0077  116 GLU A CD    
972  O OE1   . GLU A 116 ? 0.5663 0.5057 0.4851 -0.0165 -0.0020 0.0098  116 GLU A OE1   
973  O OE2   . GLU A 116 ? 0.5778 0.5135 0.5015 -0.0145 0.0029  0.0066  116 GLU A OE2   
974  N N     . VAL A 117 ? 0.3779 0.3026 0.2829 -0.0105 0.0005  0.0140  117 VAL A N     
975  C CA    . VAL A 117 ? 0.4083 0.3291 0.3060 -0.0105 -0.0013 0.0165  117 VAL A CA    
976  C C     . VAL A 117 ? 0.4267 0.3517 0.3193 -0.0146 -0.0079 0.0183  117 VAL A C     
977  O O     . VAL A 117 ? 0.4352 0.3720 0.3368 -0.0141 -0.0121 0.0197  117 VAL A O     
978  C CB    . VAL A 117 ? 0.4228 0.3486 0.3290 -0.0057 -0.0016 0.0187  117 VAL A CB    
979  C CG1   . VAL A 117 ? 0.4040 0.3251 0.3016 -0.0057 -0.0044 0.0218  117 VAL A CG1   
980  C CG2   . VAL A 117 ? 0.3903 0.3130 0.3020 -0.0025 0.0043  0.0171  117 VAL A CG2   
981  N N     . THR A 118 ? 0.4530 0.3687 0.3314 -0.0189 -0.0088 0.0183  118 THR A N     
982  C CA    . THR A 118 ? 0.4690 0.3880 0.3411 -0.0237 -0.0157 0.0202  118 THR A CA    
983  C C     . THR A 118 ? 0.5052 0.4286 0.3784 -0.0211 -0.0199 0.0241  118 THR A C     
984  O O     . THR A 118 ? 0.5128 0.4285 0.3812 -0.0184 -0.0172 0.0251  118 THR A O     
985  C CB    . THR A 118 ? 0.4815 0.3872 0.3359 -0.0295 -0.0153 0.0186  118 THR A CB    
986  O OG1   . THR A 118 ? 0.4440 0.3450 0.2975 -0.0311 -0.0116 0.0151  118 THR A OG1   
987  C CG2   . THR A 118 ? 0.5031 0.4122 0.3502 -0.0355 -0.0231 0.0207  118 THR A CG2   
988  N N     . SER A 119 ? 0.5730 0.5094 0.4529 -0.0217 -0.0265 0.0265  119 SER A N     
989  C CA    . SER A 119 ? 0.6287 0.5710 0.5111 -0.0183 -0.0315 0.0306  119 SER A CA    
990  C C     . SER A 119 ? 0.6491 0.6025 0.5316 -0.0223 -0.0398 0.0332  119 SER A C     
991  O O     . SER A 119 ? 0.6358 0.6036 0.5299 -0.0227 -0.0421 0.0332  119 SER A O     
992  C CB    . SER A 119 ? 0.6078 0.5584 0.5052 -0.0108 -0.0298 0.0313  119 SER A CB    
993  O OG    . SER A 119 ? 0.6508 0.6078 0.5511 -0.0069 -0.0352 0.0353  119 SER A OG    
994  N N     . PRO A 120 ? 0.6940 0.6415 0.5634 -0.0256 -0.0443 0.0355  120 PRO A N     
995  C CA    . PRO A 120 ? 0.7190 0.6774 0.5878 -0.0297 -0.0532 0.0385  120 PRO A CA    
996  C C     . PRO A 120 ? 0.7236 0.6967 0.6047 -0.0232 -0.0586 0.0428  120 PRO A C     
997  O O     . PRO A 120 ? 0.7405 0.7278 0.6263 -0.0256 -0.0658 0.0453  120 PRO A O     
998  C CB    . PRO A 120 ? 0.7347 0.6784 0.5832 -0.0348 -0.0554 0.0393  120 PRO A CB    
999  C CG    . PRO A 120 ? 0.7369 0.6663 0.5794 -0.0300 -0.0489 0.0389  120 PRO A CG    
1000 C CD    . PRO A 120 ? 0.7136 0.6432 0.5669 -0.0263 -0.0411 0.0353  120 PRO A CD    
1001 N N     . ASP A 121 ? 0.6954 0.6654 0.5817 -0.0150 -0.0552 0.0437  121 ASP A N     
1002 C CA    . ASP A 121 ? 0.6887 0.6698 0.5848 -0.0077 -0.0601 0.0478  121 ASP A CA    
1003 C C     . ASP A 121 ? 0.6748 0.6655 0.5881 -0.0002 -0.0564 0.0468  121 ASP A C     
1004 O O     . ASP A 121 ? 0.6840 0.6722 0.6006 0.0076  -0.0557 0.0486  121 ASP A O     
1005 C CB    . ASP A 121 ? 0.7066 0.6746 0.5911 -0.0044 -0.0615 0.0511  121 ASP A CB    
1006 C CG    . ASP A 121 ? 0.7058 0.6556 0.5820 -0.0037 -0.0531 0.0486  121 ASP A CG    
1007 O OD1   . ASP A 121 ? 0.7226 0.6584 0.5840 -0.0052 -0.0531 0.0502  121 ASP A OD1   
1008 O OD2   . ASP A 121 ? 0.6840 0.6340 0.5686 -0.0019 -0.0466 0.0451  121 ASP A OD2   
1009 N N     . GLY A 122 ? 0.6559 0.6564 0.5786 -0.0027 -0.0541 0.0438  122 GLY A N     
1010 C CA    . GLY A 122 ? 0.6370 0.6477 0.5755 0.0037  -0.0509 0.0426  122 GLY A CA    
1011 C C     . GLY A 122 ? 0.6212 0.6209 0.5598 0.0051  -0.0426 0.0387  122 GLY A C     
1012 O O     . GLY A 122 ? 0.6104 0.5960 0.5383 0.0009  -0.0389 0.0367  122 GLY A O     
1013 N N     . PHE A 123 ? 0.5988 0.6056 0.5499 0.0112  -0.0398 0.0377  123 PHE A N     
1014 C CA    . PHE A 123 ? 0.5824 0.5806 0.5351 0.0130  -0.0326 0.0343  123 PHE A CA    
1015 C C     . PHE A 123 ? 0.5482 0.5288 0.4906 0.0145  -0.0297 0.0346  123 PHE A C     
1016 O O     . PHE A 123 ? 0.5546 0.5315 0.4945 0.0191  -0.0321 0.0376  123 PHE A O     
1017 C CB    . PHE A 123 ? 0.5886 0.5966 0.5549 0.0198  -0.0309 0.0336  123 PHE A CB    
1018 C CG    . PHE A 123 ? 0.6257 0.6249 0.5934 0.0217  -0.0243 0.0303  123 PHE A CG    
1019 C CD1   . PHE A 123 ? 0.6449 0.6453 0.6150 0.0174  -0.0206 0.0269  123 PHE A CD1   
1020 C CD2   . PHE A 123 ? 0.6453 0.6348 0.6118 0.0275  -0.0220 0.0308  123 PHE A CD2   
1021 C CE1   . PHE A 123 ? 0.6637 0.6570 0.6354 0.0190  -0.0152 0.0241  123 PHE A CE1   
1022 C CE2   . PHE A 123 ? 0.6565 0.6387 0.6243 0.0284  -0.0165 0.0279  123 PHE A CE2   
1023 C CZ    . PHE A 123 ? 0.6562 0.6409 0.6271 0.0243  -0.0132 0.0246  123 PHE A CZ    
1024 N N     . PRO A 124 ? 0.4977 0.4675 0.4339 0.0105  -0.0246 0.0318  124 PRO A N     
1025 C CA    . PRO A 124 ? 0.4843 0.4389 0.4116 0.0111  -0.0208 0.0318  124 PRO A CA    
1026 C C     . PRO A 124 ? 0.4923 0.4442 0.4262 0.0168  -0.0172 0.0312  124 PRO A C     
1027 O O     . PRO A 124 ? 0.5023 0.4553 0.4424 0.0168  -0.0130 0.0282  124 PRO A O     
1028 C CB    . PRO A 124 ? 0.4753 0.4228 0.3966 0.0054  -0.0164 0.0286  124 PRO A CB    
1029 C CG    . PRO A 124 ? 0.4601 0.4178 0.3900 0.0037  -0.0163 0.0262  124 PRO A CG    
1030 C CD    . PRO A 124 ? 0.4896 0.4616 0.4272 0.0053  -0.0220 0.0284  124 PRO A CD    
1031 N N     . GLU A 125 ? 0.5022 0.4498 0.4340 0.0215  -0.0192 0.0342  125 GLU A N     
1032 C CA    . GLU A 125 ? 0.4934 0.4364 0.4294 0.0269  -0.0164 0.0339  125 GLU A CA    
1033 C C     . GLU A 125 ? 0.4745 0.4053 0.4056 0.0241  -0.0103 0.0319  125 GLU A C     
1034 O O     . GLU A 125 ? 0.4987 0.4193 0.4194 0.0212  -0.0091 0.0332  125 GLU A O     
1035 C CB    . GLU A 125 ? 0.5218 0.4609 0.4544 0.0325  -0.0205 0.0380  125 GLU A CB    
1036 C CG    . GLU A 125 ? 0.5972 0.5508 0.5383 0.0374  -0.0261 0.0399  125 GLU A CG    
1037 C CD    . GLU A 125 ? 0.6563 0.6190 0.6102 0.0422  -0.0240 0.0375  125 GLU A CD    
1038 O OE1   . GLU A 125 ? 0.6333 0.5891 0.5883 0.0425  -0.0188 0.0347  125 GLU A OE1   
1039 O OE2   . GLU A 125 ? 0.7178 0.6952 0.6805 0.0456  -0.0275 0.0383  125 GLU A OE2   
1040 N N     . PRO A 126 ? 0.4821 0.4148 0.4210 0.0249  -0.0063 0.0288  126 PRO A N     
1041 C CA    . PRO A 126 ? 0.4861 0.4097 0.4224 0.0222  -0.0007 0.0269  126 PRO A CA    
1042 C C     . PRO A 126 ? 0.5060 0.4169 0.4349 0.0233  0.0005  0.0292  126 PRO A C     
1043 O O     . PRO A 126 ? 0.5283 0.4314 0.4520 0.0195  0.0047  0.0286  126 PRO A O     
1044 C CB    . PRO A 126 ? 0.4688 0.3981 0.4154 0.0237  0.0016  0.0238  126 PRO A CB    
1045 C CG    . PRO A 126 ? 0.4423 0.3815 0.3959 0.0285  -0.0022 0.0244  126 PRO A CG    
1046 C CD    . PRO A 126 ? 0.4615 0.4058 0.4117 0.0275  -0.0068 0.0269  126 PRO A CD    
1047 N N     . SER A 127 ? 0.4942 0.4028 0.4221 0.0284  -0.0030 0.0318  127 SER A N     
1048 C CA    . SER A 127 ? 0.5342 0.4287 0.4536 0.0293  -0.0021 0.0342  127 SER A CA    
1049 C C     . SER A 127 ? 0.5733 0.4600 0.4803 0.0265  -0.0036 0.0375  127 SER A C     
1050 O O     . SER A 127 ? 0.6106 0.4847 0.5086 0.0250  -0.0017 0.0394  127 SER A O     
1051 C CB    . SER A 127 ? 0.5466 0.4390 0.4682 0.0365  -0.0051 0.0359  127 SER A CB    
1052 O OG    . SER A 127 ? 0.5509 0.4502 0.4730 0.0407  -0.0109 0.0386  127 SER A OG    
1053 N N     . GLN A 128 ? 0.5724 0.4664 0.4781 0.0252  -0.0070 0.0382  128 GLN A N     
1054 C CA    . GLN A 128 ? 0.5756 0.4626 0.4685 0.0218  -0.0087 0.0410  128 GLN A CA    
1055 C C     . GLN A 128 ? 0.5446 0.4302 0.4333 0.0153  -0.0040 0.0384  128 GLN A C     
1056 O O     . GLN A 128 ? 0.5303 0.4055 0.4080 0.0118  -0.0011 0.0395  128 GLN A O     
1057 C CB    . GLN A 128 ? 0.6161 0.5111 0.5086 0.0239  -0.0160 0.0436  128 GLN A CB    
1058 C CG    . GLN A 128 ? 0.6691 0.5657 0.5650 0.0315  -0.0210 0.0467  128 GLN A CG    
1059 C CD    . GLN A 128 ? 0.7529 0.6336 0.6370 0.0332  -0.0216 0.0505  128 GLN A CD    
1060 O OE1   . GLN A 128 ? 0.7903 0.6638 0.6756 0.0371  -0.0199 0.0507  128 GLN A OE1   
1061 N NE2   . GLN A 128 ? 0.7927 0.6666 0.6638 0.0298  -0.0240 0.0534  128 GLN A NE2   
1062 N N     . ALA A 129 ? 0.5168 0.4125 0.4138 0.0140  -0.0030 0.0351  129 ALA A N     
1063 C CA    . ALA A 129 ? 0.4910 0.3860 0.3849 0.0089  0.0012  0.0323  129 ALA A CA    
1064 C C     . ALA A 129 ? 0.4984 0.3860 0.3779 0.0051  0.0003  0.0340  129 ALA A C     
1065 O O     . ALA A 129 ? 0.5077 0.3872 0.3794 0.0018  0.0055  0.0331  129 ALA A O     
1066 C CB    . ALA A 129 ? 0.4616 0.3529 0.3588 0.0077  0.0081  0.0299  129 ALA A CB    
1067 N N     . LYS A 130 ? 0.5121 0.4029 0.3878 0.0054  -0.0063 0.0363  130 LYS A N     
1068 C CA    . LYS A 130 ? 0.5436 0.4266 0.4041 0.0018  -0.0083 0.0384  130 LYS A CA    
1069 C C     . LYS A 130 ? 0.5283 0.4121 0.3834 -0.0032 -0.0075 0.0357  130 LYS A C     
1070 O O     . LYS A 130 ? 0.5402 0.4161 0.3811 -0.0069 -0.0082 0.0367  130 LYS A O     
1071 C CB    . LYS A 130 ? 0.5799 0.4644 0.4370 0.0045  -0.0164 0.0429  130 LYS A CB    
1072 C CG    . LYS A 130 ? 0.6322 0.5315 0.4989 0.0061  -0.0229 0.0432  130 LYS A CG    
1073 C CD    . LYS A 130 ? 0.6838 0.5853 0.5480 0.0096  -0.0309 0.0482  130 LYS A CD    
1074 C CE    . LYS A 130 ? 0.7150 0.6320 0.5864 0.0093  -0.0377 0.0488  130 LYS A CE    
1075 N NZ    . LYS A 130 ? 0.7301 0.6526 0.6030 0.0144  -0.0455 0.0536  130 LYS A NZ    
1076 N N     . HIS A 131 ? 0.4960 0.3881 0.3612 -0.0034 -0.0061 0.0324  131 HIS A N     
1077 C CA    . HIS A 131 ? 0.4810 0.3727 0.3410 -0.0078 -0.0055 0.0297  131 HIS A CA    
1078 C C     . HIS A 131 ? 0.4754 0.3634 0.3372 -0.0085 0.0023  0.0257  131 HIS A C     
1079 O O     . HIS A 131 ? 0.4728 0.3641 0.3452 -0.0055 0.0059  0.0247  131 HIS A O     
1080 C CB    . HIS A 131 ? 0.4820 0.3859 0.3504 -0.0082 -0.0111 0.0294  131 HIS A CB    
1081 C CG    . HIS A 131 ? 0.5078 0.4179 0.3758 -0.0074 -0.0191 0.0333  131 HIS A CG    
1082 N ND1   . HIS A 131 ? 0.5330 0.4536 0.4134 -0.0023 -0.0225 0.0352  131 HIS A ND1   
1083 C CD2   . HIS A 131 ? 0.4993 0.4067 0.3558 -0.0108 -0.0245 0.0357  131 HIS A CD2   
1084 C CE1   . HIS A 131 ? 0.5190 0.4442 0.3967 -0.0021 -0.0297 0.0388  131 HIS A CE1   
1085 N NE2   . HIS A 131 ? 0.5002 0.4177 0.3634 -0.0075 -0.0314 0.0393  131 HIS A NE2   
1086 N N     . PRO A 132 ? 0.4665 0.3474 0.3175 -0.0123 0.0049  0.0236  132 PRO A N     
1087 C CA    . PRO A 132 ? 0.4562 0.3339 0.3089 -0.0121 0.0123  0.0199  132 PRO A CA    
1088 C C     . PRO A 132 ? 0.4452 0.3319 0.3117 -0.0102 0.0126  0.0176  132 PRO A C     
1089 O O     . PRO A 132 ? 0.4286 0.3219 0.2989 -0.0112 0.0074  0.0177  132 PRO A O     
1090 C CB    . PRO A 132 ? 0.5056 0.3737 0.3427 -0.0162 0.0133  0.0182  132 PRO A CB    
1091 C CG    . PRO A 132 ? 0.4923 0.3551 0.3168 -0.0186 0.0087  0.0215  132 PRO A CG    
1092 C CD    . PRO A 132 ? 0.4853 0.3589 0.3202 -0.0166 0.0015  0.0246  132 PRO A CD    
1093 N N     . ILE A 133 ? 0.4060 0.2935 0.2801 -0.0079 0.0184  0.0157  133 ILE A N     
1094 C CA    . ILE A 133 ? 0.4062 0.2996 0.2905 -0.0064 0.0197  0.0131  133 ILE A CA    
1095 C C     . ILE A 133 ? 0.4233 0.3096 0.2984 -0.0084 0.0222  0.0103  133 ILE A C     
1096 O O     . ILE A 133 ? 0.4421 0.3208 0.3099 -0.0084 0.0277  0.0092  133 ILE A O     
1097 C CB    . ILE A 133 ? 0.3788 0.2756 0.2739 -0.0033 0.0245  0.0123  133 ILE A CB    
1098 C CG1   . ILE A 133 ? 0.3737 0.2753 0.2761 -0.0015 0.0217  0.0148  133 ILE A CG1   
1099 C CG2   . ILE A 133 ? 0.3902 0.2921 0.2946 -0.0019 0.0259  0.0097  133 ILE A CG2   
1100 C CD1   . ILE A 133 ? 0.3429 0.2457 0.2530 0.0002  0.0261  0.0145  133 ILE A CD1   
1101 N N     . ASP A 134 ? 0.4230 0.3110 0.2975 -0.0104 0.0184  0.0094  134 ASP A N     
1102 C CA    . ASP A 134 ? 0.4119 0.2905 0.2750 -0.0127 0.0201  0.0069  134 ASP A CA    
1103 C C     . ASP A 134 ? 0.4183 0.2976 0.2872 -0.0110 0.0223  0.0042  134 ASP A C     
1104 O O     . ASP A 134 ? 0.4472 0.3173 0.3065 -0.0120 0.0244  0.0019  134 ASP A O     
1105 C CB    . ASP A 134 ? 0.4195 0.2944 0.2708 -0.0179 0.0143  0.0077  134 ASP A CB    
1106 C CG    . ASP A 134 ? 0.4091 0.2954 0.2689 -0.0196 0.0073  0.0097  134 ASP A CG    
1107 O OD1   . ASP A 134 ? 0.4785 0.3728 0.3503 -0.0178 0.0072  0.0091  134 ASP A OD1   
1108 O OD2   . ASP A 134 ? 0.4629 0.3505 0.3170 -0.0229 0.0019  0.0119  134 ASP A OD2   
1109 N N     . ALA A 135 ? 0.3981 0.2874 0.2816 -0.0083 0.0219  0.0045  135 ALA A N     
1110 C CA    . ALA A 135 ? 0.3850 0.2755 0.2750 -0.0060 0.0241  0.0024  135 ALA A CA    
1111 C C     . ALA A 135 ? 0.3732 0.2736 0.2784 -0.0025 0.0251  0.0030  135 ALA A C     
1112 O O     . ALA A 135 ? 0.3671 0.2749 0.2789 -0.0026 0.0219  0.0049  135 ALA A O     
1113 C CB    . ALA A 135 ? 0.3431 0.2333 0.2304 -0.0092 0.0198  0.0019  135 ALA A CB    
1114 N N     . ILE A 136 ? 0.3795 0.2798 0.2898 0.0007  0.0294  0.0014  136 ILE A N     
1115 C CA    . ILE A 136 ? 0.3568 0.2660 0.2809 0.0034  0.0298  0.0015  136 ILE A CA    
1116 C C     . ILE A 136 ? 0.3781 0.2862 0.3044 0.0053  0.0307  -0.0003 136 ILE A C     
1117 O O     . ILE A 136 ? 0.3668 0.2682 0.2877 0.0070  0.0344  -0.0018 136 ILE A O     
1118 C CB    . ILE A 136 ? 0.3319 0.2438 0.2618 0.0055  0.0341  0.0020  136 ILE A CB    
1119 C CG1   . ILE A 136 ? 0.3094 0.2190 0.2337 0.0036  0.0338  0.0040  136 ILE A CG1   
1120 C CG2   . ILE A 136 ? 0.3156 0.2364 0.2587 0.0070  0.0333  0.0023  136 ILE A CG2   
1121 C CD1   . ILE A 136 ? 0.2993 0.2105 0.2278 0.0044  0.0379  0.0048  136 ILE A CD1   
1122 N N     . THR A 137 ? 0.3474 0.2615 0.2809 0.0051  0.0275  -0.0001 137 THR A N     
1123 C CA    . THR A 137 ? 0.3337 0.2480 0.2714 0.0075  0.0283  -0.0014 137 THR A CA    
1124 C C     . THR A 137 ? 0.3363 0.2599 0.2869 0.0096  0.0285  -0.0010 137 THR A C     
1125 O O     . THR A 137 ? 0.3354 0.2650 0.2911 0.0083  0.0257  0.0000  137 THR A O     
1126 C CB    . THR A 137 ? 0.3269 0.2381 0.2598 0.0051  0.0246  -0.0017 137 THR A CB    
1127 O OG1   . THR A 137 ? 0.3376 0.2387 0.2573 0.0026  0.0245  -0.0023 137 THR A OG1   
1128 C CG2   . THR A 137 ? 0.3218 0.2319 0.2581 0.0080  0.0252  -0.0026 137 THR A CG2   
1129 N N     . HIS A 138 ? 0.3223 0.2469 0.2777 0.0130  0.0317  -0.0017 138 HIS A N     
1130 C CA    . HIS A 138 ? 0.3330 0.2661 0.3000 0.0145  0.0322  -0.0014 138 HIS A CA    
1131 C C     . HIS A 138 ? 0.3676 0.3020 0.3390 0.0174  0.0320  -0.0022 138 HIS A C     
1132 O O     . HIS A 138 ? 0.3697 0.3017 0.3404 0.0207  0.0352  -0.0029 138 HIS A O     
1133 C CB    . HIS A 138 ? 0.3074 0.2424 0.2771 0.0151  0.0365  -0.0011 138 HIS A CB    
1134 C CG    . HIS A 138 ? 0.3335 0.2770 0.3145 0.0155  0.0370  -0.0006 138 HIS A CG    
1135 N ND1   . HIS A 138 ? 0.3155 0.2614 0.2989 0.0133  0.0370  0.0004  138 HIS A ND1   
1136 C CD2   . HIS A 138 ? 0.3032 0.2527 0.2929 0.0176  0.0373  -0.0010 138 HIS A CD2   
1137 C CE1   . HIS A 138 ? 0.3130 0.2657 0.3058 0.0133  0.0374  0.0005  138 HIS A CE1   
1138 N NE2   . HIS A 138 ? 0.3185 0.2743 0.3158 0.0159  0.0375  -0.0003 138 HIS A NE2   
1139 N N     . TYR A 139 ? 0.3645 0.3025 0.3399 0.0166  0.0283  -0.0019 139 TYR A N     
1140 C CA    . TYR A 139 ? 0.3394 0.2790 0.3191 0.0192  0.0272  -0.0022 139 TYR A CA    
1141 C C     . TYR A 139 ? 0.3220 0.2707 0.3130 0.0203  0.0278  -0.0019 139 TYR A C     
1142 O O     . TYR A 139 ? 0.3085 0.2619 0.3037 0.0179  0.0269  -0.0015 139 TYR A O     
1143 C CB    . TYR A 139 ? 0.2942 0.2324 0.2711 0.0171  0.0229  -0.0020 139 TYR A CB    
1144 C CG    . TYR A 139 ? 0.2942 0.2339 0.2751 0.0195  0.0212  -0.0019 139 TYR A CG    
1145 C CD1   . TYR A 139 ? 0.2771 0.2245 0.2661 0.0190  0.0191  -0.0016 139 TYR A CD1   
1146 C CD2   . TYR A 139 ? 0.2992 0.2318 0.2749 0.0224  0.0213  -0.0021 139 TYR A CD2   
1147 C CE1   . TYR A 139 ? 0.2135 0.1622 0.2054 0.0209  0.0169  -0.0013 139 TYR A CE1   
1148 C CE2   . TYR A 139 ? 0.3414 0.2748 0.3201 0.0250  0.0192  -0.0016 139 TYR A CE2   
1149 C CZ    . TYR A 139 ? 0.3363 0.2783 0.3234 0.0242  0.0168  -0.0011 139 TYR A CZ    
1150 O OH    . TYR A 139 ? 0.3703 0.3131 0.3598 0.0266  0.0142  -0.0004 139 TYR A OH    
1151 N N     . ASP A 140 ? 0.3165 0.2676 0.3122 0.0240  0.0294  -0.0021 140 ASP A N     
1152 C CA    . ASP A 140 ? 0.3143 0.2750 0.3213 0.0250  0.0296  -0.0017 140 ASP A CA    
1153 C C     . ASP A 140 ? 0.3241 0.2867 0.3343 0.0269  0.0258  -0.0014 140 ASP A C     
1154 O O     . ASP A 140 ? 0.3085 0.2662 0.3150 0.0307  0.0258  -0.0015 140 ASP A O     
1155 C CB    . ASP A 140 ? 0.3007 0.2646 0.3116 0.0280  0.0345  -0.0018 140 ASP A CB    
1156 C CG    . ASP A 140 ? 0.2870 0.2626 0.3104 0.0282  0.0349  -0.0012 140 ASP A CG    
1157 O OD1   . ASP A 140 ? 0.3056 0.2859 0.3349 0.0310  0.0327  -0.0009 140 ASP A OD1   
1158 O OD2   . ASP A 140 ? 0.2774 0.2571 0.3042 0.0252  0.0372  -0.0009 140 ASP A OD2   
1159 N N     . SER A 141 ? 0.3108 0.2792 0.3265 0.0245  0.0227  -0.0010 141 SER A N     
1160 C CA    . SER A 141 ? 0.3256 0.2954 0.3431 0.0255  0.0185  -0.0006 141 SER A CA    
1161 C C     . SER A 141 ? 0.3465 0.3225 0.3720 0.0299  0.0184  0.0001  141 SER A C     
1162 O O     . SER A 141 ? 0.3532 0.3271 0.3773 0.0326  0.0155  0.0007  141 SER A O     
1163 C CB    . SER A 141 ? 0.3201 0.2942 0.3405 0.0215  0.0154  -0.0007 141 SER A CB    
1164 O OG    . SER A 141 ? 0.3095 0.2918 0.3389 0.0204  0.0162  -0.0005 141 SER A OG    
1165 N N     . ILE A 142 ? 0.3382 0.3223 0.3720 0.0305  0.0216  0.0002  142 ILE A N     
1166 C CA    . ILE A 142 ? 0.3579 0.3505 0.4012 0.0350  0.0221  0.0009  142 ILE A CA    
1167 C C     . ILE A 142 ? 0.3711 0.3580 0.4103 0.0415  0.0250  0.0007  142 ILE A C     
1168 O O     . ILE A 142 ? 0.3810 0.3689 0.4226 0.0465  0.0230  0.0015  142 ILE A O     
1169 C CB    . ILE A 142 ? 0.3612 0.3654 0.4152 0.0328  0.0252  0.0012  142 ILE A CB    
1170 C CG1   . ILE A 142 ? 0.3299 0.3386 0.3873 0.0268  0.0215  0.0014  142 ILE A CG1   
1171 C CG2   . ILE A 142 ? 0.3421 0.3569 0.4068 0.0380  0.0268  0.0020  142 ILE A CG2   
1172 C CD1   . ILE A 142 ? 0.3882 0.4087 0.4565 0.0237  0.0230  0.0019  142 ILE A CD1   
1173 N N     . ASP A 143 ? 0.3552 0.3350 0.3872 0.0415  0.0295  -0.0003 143 ASP A N     
1174 C CA    . ASP A 143 ? 0.3891 0.3604 0.4143 0.0472  0.0325  -0.0010 143 ASP A CA    
1175 C C     . ASP A 143 ? 0.3958 0.3538 0.4090 0.0476  0.0289  -0.0011 143 ASP A C     
1176 O O     . ASP A 143 ? 0.3933 0.3436 0.4011 0.0530  0.0297  -0.0013 143 ASP A O     
1177 C CB    . ASP A 143 ? 0.4121 0.3789 0.4315 0.0463  0.0383  -0.0021 143 ASP A CB    
1178 C CG    . ASP A 143 ? 0.4127 0.3915 0.4427 0.0465  0.0430  -0.0020 143 ASP A CG    
1179 O OD1   . ASP A 143 ? 0.3769 0.3683 0.4196 0.0482  0.0421  -0.0010 143 ASP A OD1   
1180 O OD2   . ASP A 143 ? 0.4462 0.4220 0.4715 0.0445  0.0474  -0.0026 143 ASP A OD2   
1181 N N     . ASP A 144 ? 0.3802 0.3351 0.3887 0.0419  0.0253  -0.0009 144 ASP A N     
1182 C CA    . ASP A 144 ? 0.3848 0.3275 0.3811 0.0404  0.0224  -0.0010 144 ASP A CA    
1183 C C     . ASP A 144 ? 0.3860 0.3170 0.3707 0.0409  0.0259  -0.0021 144 ASP A C     
1184 O O     . ASP A 144 ? 0.4202 0.3395 0.3951 0.0430  0.0251  -0.0023 144 ASP A O     
1185 C CB    . ASP A 144 ? 0.3890 0.3288 0.3846 0.0443  0.0186  0.0001  144 ASP A CB    
1186 C CG    . ASP A 144 ? 0.4231 0.3518 0.4068 0.0407  0.0149  0.0005  144 ASP A CG    
1187 O OD1   . ASP A 144 ? 0.3935 0.3212 0.3731 0.0347  0.0144  0.0001  144 ASP A OD1   
1188 O OD2   . ASP A 144 ? 0.4456 0.3666 0.4239 0.0440  0.0126  0.0013  144 ASP A OD2   
1189 N N     . ARG A 145 ? 0.3509 0.2838 0.3357 0.0386  0.0294  -0.0029 145 ARG A N     
1190 C CA    . ARG A 145 ? 0.3779 0.2999 0.3510 0.0384  0.0326  -0.0041 145 ARG A CA    
1191 C C     . ARG A 145 ? 0.3793 0.3007 0.3481 0.0322  0.0323  -0.0041 145 ARG A C     
1192 O O     . ARG A 145 ? 0.3800 0.3107 0.3567 0.0297  0.0321  -0.0035 145 ARG A O     
1193 C CB    . ARG A 145 ? 0.3869 0.3102 0.3625 0.0437  0.0384  -0.0049 145 ARG A CB    
1194 C CG    . ARG A 145 ? 0.3890 0.3126 0.3687 0.0514  0.0393  -0.0049 145 ARG A CG    
1195 C CD    . ARG A 145 ? 0.4036 0.3107 0.3693 0.0540  0.0383  -0.0056 145 ARG A CD    
1196 N NE    . ARG A 145 ? 0.4465 0.3527 0.4154 0.0625  0.0391  -0.0055 145 ARG A NE    
1197 C CZ    . ARG A 145 ? 0.4439 0.3519 0.4168 0.0650  0.0345  -0.0039 145 ARG A CZ    
1198 N NH1   . ARG A 145 ? 0.4477 0.3582 0.4216 0.0594  0.0291  -0.0027 145 ARG A NH1   
1199 N NH2   . ARG A 145 ? 0.4736 0.3807 0.4493 0.0736  0.0354  -0.0036 145 ARG A NH2   
1200 N N     . PHE A 146 ? 0.3876 0.2978 0.3435 0.0296  0.0319  -0.0047 146 PHE A N     
1201 C CA    . PHE A 146 ? 0.3699 0.2792 0.3207 0.0244  0.0318  -0.0047 146 PHE A CA    
1202 C C     . PHE A 146 ? 0.3760 0.2811 0.3219 0.0259  0.0367  -0.0057 146 PHE A C     
1203 O O     . PHE A 146 ? 0.3697 0.2641 0.3058 0.0281  0.0389  -0.0069 146 PHE A O     
1204 C CB    . PHE A 146 ? 0.3778 0.2782 0.3171 0.0199  0.0283  -0.0047 146 PHE A CB    
1205 C CG    . PHE A 146 ? 0.3643 0.2680 0.3066 0.0176  0.0239  -0.0038 146 PHE A CG    
1206 C CD1   . PHE A 146 ? 0.3405 0.2398 0.2817 0.0204  0.0225  -0.0037 146 PHE A CD1   
1207 C CD2   . PHE A 146 ? 0.3726 0.2835 0.3183 0.0131  0.0212  -0.0029 146 PHE A CD2   
1208 C CE1   . PHE A 146 ? 0.3848 0.2866 0.3275 0.0179  0.0186  -0.0027 146 PHE A CE1   
1209 C CE2   . PHE A 146 ? 0.3546 0.2688 0.3026 0.0110  0.0178  -0.0022 146 PHE A CE2   
1210 C CZ    . PHE A 146 ? 0.3403 0.2498 0.2864 0.0130  0.0165  -0.0021 146 PHE A CZ    
1211 N N     . TYR A 147 ? 0.3739 0.2864 0.3256 0.0247  0.0387  -0.0051 147 TYR A N     
1212 C CA    . TYR A 147 ? 0.3722 0.2811 0.3188 0.0255  0.0436  -0.0058 147 TYR A CA    
1213 C C     . TYR A 147 ? 0.3768 0.2798 0.3130 0.0204  0.0419  -0.0055 147 TYR A C     
1214 O O     . TYR A 147 ? 0.3677 0.2764 0.3076 0.0169  0.0389  -0.0041 147 TYR A O     
1215 C CB    . TYR A 147 ? 0.3695 0.2892 0.3275 0.0267  0.0470  -0.0052 147 TYR A CB    
1216 C CG    . TYR A 147 ? 0.4080 0.3347 0.3764 0.0319  0.0492  -0.0054 147 TYR A CG    
1217 C CD1   . TYR A 147 ? 0.3801 0.3162 0.3599 0.0321  0.0457  -0.0045 147 TYR A CD1   
1218 C CD2   . TYR A 147 ? 0.3670 0.2914 0.3338 0.0369  0.0546  -0.0067 147 TYR A CD2   
1219 C CE1   . TYR A 147 ? 0.3948 0.3383 0.3845 0.0367  0.0469  -0.0045 147 TYR A CE1   
1220 C CE2   . TYR A 147 ? 0.4083 0.3409 0.3860 0.0423  0.0564  -0.0067 147 TYR A CE2   
1221 C CZ    . TYR A 147 ? 0.4073 0.3497 0.3966 0.0420  0.0522  -0.0054 147 TYR A CZ    
1222 O OH    . TYR A 147 ? 0.4022 0.3537 0.4026 0.0473  0.0533  -0.0052 147 TYR A OH    
1223 N N     . VAL A 148 ? 0.3736 0.2650 0.2965 0.0202  0.0437  -0.0067 148 VAL A N     
1224 C CA    . VAL A 148 ? 0.3961 0.2809 0.3075 0.0149  0.0413  -0.0064 148 VAL A CA    
1225 C C     . VAL A 148 ? 0.4150 0.2953 0.3189 0.0146  0.0456  -0.0068 148 VAL A C     
1226 O O     . VAL A 148 ? 0.4657 0.3381 0.3623 0.0177  0.0504  -0.0086 148 VAL A O     
1227 C CB    . VAL A 148 ? 0.3857 0.2588 0.2847 0.0128  0.0385  -0.0074 148 VAL A CB    
1228 C CG1   . VAL A 148 ? 0.4024 0.2703 0.2901 0.0066  0.0353  -0.0069 148 VAL A CG1   
1229 C CG2   . VAL A 148 ? 0.3628 0.2399 0.2682 0.0125  0.0343  -0.0068 148 VAL A CG2   
1230 N N     . PHE A 149 ? 0.4110 0.2957 0.3159 0.0112  0.0441  -0.0051 149 PHE A N     
1231 C CA    . PHE A 149 ? 0.4220 0.3026 0.3191 0.0100  0.0475  -0.0049 149 PHE A CA    
1232 C C     . PHE A 149 ? 0.4162 0.2895 0.3005 0.0049  0.0431  -0.0043 149 PHE A C     
1233 O O     . PHE A 149 ? 0.4458 0.3247 0.3335 0.0019  0.0378  -0.0024 149 PHE A O     
1234 C CB    . PHE A 149 ? 0.3936 0.2839 0.3009 0.0099  0.0486  -0.0030 149 PHE A CB    
1235 C CG    . PHE A 149 ? 0.4164 0.3158 0.3376 0.0137  0.0519  -0.0033 149 PHE A CG    
1236 C CD1   . PHE A 149 ? 0.4140 0.3208 0.3462 0.0148  0.0484  -0.0030 149 PHE A CD1   
1237 C CD2   . PHE A 149 ? 0.4328 0.3339 0.3560 0.0158  0.0585  -0.0037 149 PHE A CD2   
1238 C CE1   . PHE A 149 ? 0.4038 0.3193 0.3486 0.0178  0.0507  -0.0032 149 PHE A CE1   
1239 C CE2   . PHE A 149 ? 0.4542 0.3654 0.3912 0.0189  0.0611  -0.0038 149 PHE A CE2   
1240 C CZ    . PHE A 149 ? 0.3969 0.3152 0.3446 0.0198  0.0568  -0.0035 149 PHE A CZ    
1241 N N     . ASP A 150 ? 0.4350 0.2960 0.3043 0.0041  0.0453  -0.0060 150 ASP A N     
1242 C CA    . ASP A 150 ? 0.4836 0.3363 0.3390 -0.0012 0.0407  -0.0058 150 ASP A CA    
1243 C C     . ASP A 150 ? 0.4843 0.3299 0.3271 -0.0035 0.0428  -0.0055 150 ASP A C     
1244 O O     . ASP A 150 ? 0.5183 0.3561 0.3536 -0.0010 0.0491  -0.0074 150 ASP A O     
1245 C CB    . ASP A 150 ? 0.5014 0.3427 0.3470 -0.0012 0.0406  -0.0082 150 ASP A CB    
1246 C CG    . ASP A 150 ? 0.5212 0.3539 0.3523 -0.0080 0.0352  -0.0081 150 ASP A CG    
1247 O OD1   . ASP A 150 ? 0.4794 0.3174 0.3104 -0.0123 0.0308  -0.0059 150 ASP A OD1   
1248 O OD2   . ASP A 150 ? 0.5208 0.3412 0.3405 -0.0090 0.0352  -0.0102 150 ASP A OD2   
1249 N N     . LEU A 151 ? 0.4648 0.3133 0.3053 -0.0078 0.0378  -0.0030 151 LEU A N     
1250 C CA    . LEU A 151 ? 0.4711 0.3125 0.2987 -0.0103 0.0389  -0.0023 151 LEU A CA    
1251 C C     . LEU A 151 ? 0.4919 0.3205 0.3009 -0.0151 0.0361  -0.0035 151 LEU A C     
1252 O O     . LEU A 151 ? 0.4885 0.3192 0.2961 -0.0195 0.0290  -0.0023 151 LEU A O     
1253 C CB    . LEU A 151 ? 0.4615 0.3114 0.2948 -0.0121 0.0347  0.0014  151 LEU A CB    
1254 C CG    . LEU A 151 ? 0.4577 0.3003 0.2772 -0.0149 0.0351  0.0028  151 LEU A CG    
1255 C CD1   . LEU A 151 ? 0.4417 0.2782 0.2565 -0.0122 0.0440  0.0011  151 LEU A CD1   
1256 C CD2   . LEU A 151 ? 0.4519 0.3024 0.2775 -0.0157 0.0304  0.0067  151 LEU A CD2   
1257 N N     . LEU A 152 ? 0.5015 0.3172 0.2964 -0.0143 0.0418  -0.0060 152 LEU A N     
1258 C CA    . LEU A 152 ? 0.5879 0.3885 0.3624 -0.0190 0.0399  -0.0078 152 LEU A CA    
1259 C C     . LEU A 152 ? 0.5682 0.3643 0.3294 -0.0245 0.0363  -0.0059 152 LEU A C     
1260 O O     . LEU A 152 ? 0.5896 0.3779 0.3373 -0.0304 0.0309  -0.0061 152 LEU A O     
1261 C CB    . LEU A 152 ? 0.5978 0.3843 0.3609 -0.0153 0.0478  -0.0119 152 LEU A CB    
1262 C CG    . LEU A 152 ? 0.5912 0.3784 0.3634 -0.0094 0.0513  -0.0141 152 LEU A CG    
1263 C CD1   . LEU A 152 ? 0.6238 0.3933 0.3794 -0.0067 0.0575  -0.0181 152 LEU A CD1   
1264 C CD2   . LEU A 152 ? 0.5876 0.3795 0.3669 -0.0119 0.0443  -0.0132 152 LEU A CD2   
1265 N N     . ASN A 153 ? 0.5644 0.3649 0.3286 -0.0230 0.0389  -0.0039 153 ASN A N     
1266 C CA    . ASN A 153 ? 0.5914 0.3869 0.3422 -0.0277 0.0357  -0.0017 153 ASN A CA    
1267 C C     . ASN A 153 ? 0.5980 0.4065 0.3610 -0.0277 0.0310  0.0027  153 ASN A C     
1268 O O     . ASN A 153 ? 0.5820 0.3986 0.3583 -0.0235 0.0349  0.0037  153 ASN A O     
1269 C CB    . ASN A 153 ? 0.6104 0.3936 0.3460 -0.0269 0.0438  -0.0036 153 ASN A CB    
1270 C CG    . ASN A 153 ? 0.6704 0.4389 0.3921 -0.0261 0.0487  -0.0082 153 ASN A CG    
1271 O OD1   . ASN A 153 ? 0.7026 0.4634 0.4145 -0.0301 0.0438  -0.0096 153 ASN A OD1   
1272 N ND2   . ASN A 153 ? 0.7134 0.4779 0.4341 -0.0210 0.0585  -0.0107 153 ASN A ND2   
1273 N N     . SER A 154 ? 0.5985 0.4085 0.3565 -0.0325 0.0225  0.0053  154 SER A N     
1274 C CA    . SER A 154 ? 0.6026 0.4245 0.3715 -0.0320 0.0169  0.0096  154 SER A CA    
1275 C C     . SER A 154 ? 0.6165 0.4341 0.3713 -0.0373 0.0098  0.0124  154 SER A C     
1276 O O     . SER A 154 ? 0.6257 0.4342 0.3654 -0.0423 0.0074  0.0108  154 SER A O     
1277 C CB    . SER A 154 ? 0.5618 0.3975 0.3484 -0.0308 0.0121  0.0102  154 SER A CB    
1278 O OG    . SER A 154 ? 0.5800 0.4257 0.3730 -0.0316 0.0046  0.0142  154 SER A OG    
1279 N N     . PRO A 155 ? 0.6362 0.4596 0.3950 -0.0363 0.0063  0.0166  155 PRO A N     
1280 C CA    . PRO A 155 ? 0.6407 0.4634 0.3892 -0.0407 -0.0024 0.0200  155 PRO A CA    
1281 C C     . PRO A 155 ? 0.6372 0.4688 0.3904 -0.0443 -0.0110 0.0205  155 PRO A C     
1282 O O     . PRO A 155 ? 0.6587 0.4876 0.4000 -0.0496 -0.0178 0.0222  155 PRO A O     
1283 C CB    . PRO A 155 ? 0.6363 0.4658 0.3932 -0.0369 -0.0044 0.0244  155 PRO A CB    
1284 C CG    . PRO A 155 ? 0.6224 0.4582 0.3961 -0.0313 0.0020  0.0232  155 PRO A CG    
1285 C CD    . PRO A 155 ? 0.6236 0.4524 0.3940 -0.0312 0.0102  0.0184  155 PRO A CD    
1286 N N     . TYR A 156 ? 0.6045 0.4465 0.3741 -0.0420 -0.0106 0.0191  156 TYR A N     
1287 C CA    . TYR A 156 ? 0.6154 0.4668 0.3901 -0.0460 -0.0180 0.0195  156 TYR A CA    
1288 C C     . TYR A 156 ? 0.6405 0.4829 0.4058 -0.0508 -0.0165 0.0155  156 TYR A C     
1289 O O     . TYR A 156 ? 0.6670 0.5164 0.4365 -0.0547 -0.0216 0.0154  156 TYR A O     
1290 C CB    . TYR A 156 ? 0.5940 0.4627 0.3912 -0.0415 -0.0197 0.0209  156 TYR A CB    
1291 C CG    . TYR A 156 ? 0.6549 0.5313 0.4606 -0.0366 -0.0219 0.0249  156 TYR A CG    
1292 C CD1   . TYR A 156 ? 0.6844 0.5636 0.4844 -0.0386 -0.0295 0.0289  156 TYR A CD1   
1293 C CD2   . TYR A 156 ? 0.6323 0.5123 0.4507 -0.0302 -0.0167 0.0248  156 TYR A CD2   
1294 C CE1   . TYR A 156 ? 0.7217 0.6061 0.5283 -0.0335 -0.0316 0.0327  156 TYR A CE1   
1295 C CE2   . TYR A 156 ? 0.6852 0.5699 0.5096 -0.0258 -0.0186 0.0284  156 TYR A CE2   
1296 C CZ    . TYR A 156 ? 0.6878 0.5742 0.5061 -0.0271 -0.0259 0.0323  156 TYR A CZ    
1297 O OH    . TYR A 156 ? 0.7434 0.6328 0.5668 -0.0221 -0.0279 0.0360  156 TYR A OH    
1298 N N     . GLY A 157 ? 0.6427 0.4695 0.3950 -0.0503 -0.0092 0.0122  157 GLY A N     
1299 C CA    . GLY A 157 ? 0.6794 0.4937 0.4188 -0.0545 -0.0076 0.0083  157 GLY A CA    
1300 C C     . GLY A 157 ? 0.6930 0.4965 0.4297 -0.0496 0.0026  0.0043  157 GLY A C     
1301 O O     . GLY A 157 ? 0.6929 0.5039 0.4450 -0.0432 0.0076  0.0041  157 GLY A O     
1302 N N     . ASN A 158 ? 0.6925 0.4785 0.4092 -0.0527 0.0055  0.0010  158 ASN A N     
1303 C CA    . ASN A 158 ? 0.6713 0.4463 0.3842 -0.0481 0.0147  -0.0032 158 ASN A CA    
1304 C C     . ASN A 158 ? 0.6920 0.4630 0.4044 -0.0501 0.0131  -0.0057 158 ASN A C     
1305 O O     . ASN A 158 ? 0.7058 0.4721 0.4076 -0.0576 0.0066  -0.0056 158 ASN A O     
1306 C CB    . ASN A 158 ? 0.6970 0.4538 0.3874 -0.0492 0.0199  -0.0055 158 ASN A CB    
1307 C CG    . ASN A 158 ? 0.6923 0.4522 0.3825 -0.0473 0.0222  -0.0029 158 ASN A CG    
1308 O OD1   . ASN A 158 ? 0.6918 0.4662 0.3995 -0.0439 0.0214  0.0002  158 ASN A OD1   
1309 N ND2   . ASN A 158 ? 0.7006 0.4456 0.3698 -0.0498 0.0252  -0.0042 158 ASN A ND2   
1310 N N     . VAL A 159 ? 0.6683 0.4417 0.3923 -0.0437 0.0187  -0.0076 159 VAL A N     
1311 C CA    . VAL A 159 ? 0.6570 0.4273 0.3825 -0.0448 0.0173  -0.0094 159 VAL A CA    
1312 C C     . VAL A 159 ? 0.6579 0.4148 0.3776 -0.0389 0.0257  -0.0135 159 VAL A C     
1313 O O     . VAL A 159 ? 0.6382 0.3926 0.3578 -0.0330 0.0331  -0.0147 159 VAL A O     
1314 C CB    . VAL A 159 ? 0.6394 0.4288 0.3878 -0.0430 0.0138  -0.0070 159 VAL A CB    
1315 C CG1   . VAL A 159 ? 0.6204 0.4233 0.3744 -0.0487 0.0052  -0.0031 159 VAL A CG1   
1316 C CG2   . VAL A 159 ? 0.6124 0.4120 0.3781 -0.0344 0.0198  -0.0065 159 VAL A CG2   
1317 N N     . GLU A 160 ? 0.6581 0.4068 0.3732 -0.0405 0.0244  -0.0154 160 GLU A N     
1318 C CA    . GLU A 160 ? 0.6708 0.4069 0.3813 -0.0340 0.0315  -0.0190 160 GLU A CA    
1319 C C     . GLU A 160 ? 0.6313 0.3812 0.3641 -0.0267 0.0338  -0.0182 160 GLU A C     
1320 O O     . GLU A 160 ? 0.5827 0.3493 0.3318 -0.0281 0.0291  -0.0152 160 GLU A O     
1321 C CB    . GLU A 160 ? 0.7083 0.4258 0.4003 -0.0395 0.0287  -0.0214 160 GLU A CB    
1322 C CG    . GLU A 160 ? 0.7892 0.4904 0.4567 -0.0473 0.0263  -0.0228 160 GLU A CG    
1323 C CD    . GLU A 160 ? 0.8997 0.5867 0.5530 -0.0422 0.0347  -0.0259 160 GLU A CD    
1324 O OE1   . GLU A 160 ? 0.9146 0.5930 0.5670 -0.0340 0.0423  -0.0289 160 GLU A OE1   
1325 O OE2   . GLU A 160 ? 0.9586 0.6433 0.6016 -0.0461 0.0339  -0.0254 160 GLU A OE2   
1326 N N     . GLU A 161 ? 0.6355 0.3784 0.3685 -0.0188 0.0410  -0.0208 161 GLU A N     
1327 C CA    . GLU A 161 ? 0.6185 0.3736 0.3715 -0.0118 0.0429  -0.0201 161 GLU A CA    
1328 C C     . GLU A 161 ? 0.5944 0.3523 0.3524 -0.0155 0.0366  -0.0189 161 GLU A C     
1329 O O     . GLU A 161 ? 0.6090 0.3544 0.3523 -0.0218 0.0326  -0.0197 161 GLU A O     
1330 C CB    . GLU A 161 ? 0.6269 0.3733 0.3780 -0.0026 0.0513  -0.0231 161 GLU A CB    
1331 C CG    . GLU A 161 ? 0.6728 0.4262 0.4301 0.0030  0.0586  -0.0233 161 GLU A CG    
1332 C CD    . GLU A 161 ? 0.7102 0.4581 0.4682 0.0129  0.0670  -0.0261 161 GLU A CD    
1333 O OE1   . GLU A 161 ? 0.7073 0.4535 0.4703 0.0173  0.0667  -0.0267 161 GLU A OE1   
1334 O OE2   . GLU A 161 ? 0.7546 0.5005 0.5084 0.0163  0.0742  -0.0276 161 GLU A OE2   
1335 N N     . TRP A 162 ? 0.5726 0.3467 0.3505 -0.0121 0.0357  -0.0169 162 TRP A N     
1336 C CA    . TRP A 162 ? 0.5745 0.3523 0.3582 -0.0149 0.0306  -0.0157 162 TRP A CA    
1337 C C     . TRP A 162 ? 0.5964 0.3601 0.3735 -0.0100 0.0336  -0.0180 162 TRP A C     
1338 O O     . TRP A 162 ? 0.6092 0.3701 0.3886 -0.0016 0.0399  -0.0196 162 TRP A O     
1339 C CB    . TRP A 162 ? 0.5355 0.3346 0.3416 -0.0127 0.0291  -0.0130 162 TRP A CB    
1340 C CG    . TRP A 162 ? 0.5155 0.3199 0.3305 -0.0129 0.0259  -0.0120 162 TRP A CG    
1341 C CD1   . TRP A 162 ? 0.4799 0.2895 0.2961 -0.0199 0.0198  -0.0103 162 TRP A CD1   
1342 C CD2   . TRP A 162 ? 0.4987 0.3048 0.3229 -0.0058 0.0286  -0.0125 162 TRP A CD2   
1343 N NE1   . TRP A 162 ? 0.5176 0.3310 0.3422 -0.0178 0.0189  -0.0098 162 TRP A NE1   
1344 C CE2   . TRP A 162 ? 0.4712 0.2822 0.3005 -0.0092 0.0239  -0.0110 162 TRP A CE2   
1345 C CE3   . TRP A 162 ? 0.4839 0.2887 0.3127 0.0030  0.0346  -0.0138 162 TRP A CE3   
1346 C CZ2   . TRP A 162 ? 0.5031 0.3161 0.3406 -0.0041 0.0246  -0.0108 162 TRP A CZ2   
1347 C CZ3   . TRP A 162 ? 0.5091 0.3173 0.3474 0.0083  0.0349  -0.0135 162 TRP A CZ3   
1348 C CH2   . TRP A 162 ? 0.4910 0.3027 0.3331 0.0047  0.0297  -0.0120 162 TRP A CH2   
1349 N N     . SER A 163 ? 0.5844 0.3392 0.3530 -0.0153 0.0291  -0.0180 163 SER A N     
1350 C CA    . SER A 163 ? 0.6363 0.3750 0.3962 -0.0112 0.0310  -0.0198 163 SER A CA    
1351 C C     . SER A 163 ? 0.6455 0.3933 0.4189 -0.0095 0.0284  -0.0179 163 SER A C     
1352 O O     . SER A 163 ? 0.6684 0.4219 0.4439 -0.0170 0.0227  -0.0159 163 SER A O     
1353 C CB    . SER A 163 ? 0.6468 0.3640 0.3831 -0.0188 0.0282  -0.0214 163 SER A CB    
1354 O OG    . SER A 163 ? 0.6629 0.3652 0.3916 -0.0160 0.0286  -0.0224 163 SER A OG    
1355 N N     . ILE A 164 ? 0.6334 0.3827 0.4154 0.0002  0.0325  -0.0184 164 ILE A N     
1356 C CA    . ILE A 164 ? 0.6333 0.3900 0.4270 0.0026  0.0301  -0.0166 164 ILE A CA    
1357 C C     . ILE A 164 ? 0.6531 0.3925 0.4320 -0.0017 0.0266  -0.0167 164 ILE A C     
1358 O O     . ILE A 164 ? 0.6452 0.3909 0.4303 -0.0051 0.0225  -0.0146 164 ILE A O     
1359 C CB    . ILE A 164 ? 0.6234 0.3869 0.4305 0.0140  0.0349  -0.0169 164 ILE A CB    
1360 C CG1   . ILE A 164 ? 0.6001 0.3765 0.4224 0.0153  0.0316  -0.0144 164 ILE A CG1   
1361 C CG2   . ILE A 164 ? 0.6428 0.3868 0.4367 0.0216  0.0395  -0.0195 164 ILE A CG2   
1362 C CD1   . ILE A 164 ? 0.5899 0.3821 0.4311 0.0237  0.0348  -0.0138 164 ILE A CD1   
1363 N N     . GLU A 165 ? 0.6569 0.3738 0.4152 -0.0021 0.0283  -0.0192 165 GLU A N     
1364 C CA    . GLU A 165 ? 0.6828 0.3797 0.4240 -0.0066 0.0252  -0.0194 165 GLU A CA    
1365 C C     . GLU A 165 ? 0.6589 0.3593 0.3959 -0.0201 0.0188  -0.0177 165 GLU A C     
1366 O O     . GLU A 165 ? 0.6524 0.3496 0.3870 -0.0249 0.0149  -0.0161 165 GLU A O     
1367 C CB    . GLU A 165 ? 0.7313 0.4014 0.4497 -0.0040 0.0287  -0.0228 165 GLU A CB    
1368 C CG    . GLU A 165 ? 0.7925 0.4579 0.5139 0.0101  0.0356  -0.0248 165 GLU A CG    
1369 C CD    . GLU A 165 ? 0.8792 0.5559 0.6084 0.0146  0.0410  -0.0261 165 GLU A CD    
1370 O OE1   . GLU A 165 ? 0.8999 0.5886 0.6332 0.0074  0.0391  -0.0253 165 GLU A OE1   
1371 O OE2   . GLU A 165 ? 0.9393 0.6133 0.6706 0.0255  0.0473  -0.0279 165 GLU A OE2   
1372 N N     . ILE A 166 ? 0.6199 0.3274 0.3561 -0.0263 0.0177  -0.0177 166 ILE A N     
1373 C CA    . ILE A 166 ? 0.6196 0.3346 0.3547 -0.0387 0.0115  -0.0158 166 ILE A CA    
1374 C C     . ILE A 166 ? 0.5812 0.3210 0.3385 -0.0389 0.0091  -0.0128 166 ILE A C     
1375 O O     . ILE A 166 ? 0.5454 0.2901 0.3036 -0.0469 0.0046  -0.0109 166 ILE A O     
1376 C CB    . ILE A 166 ? 0.6307 0.3465 0.3582 -0.0451 0.0102  -0.0164 166 ILE A CB    
1377 C CG1   . ILE A 166 ? 0.6486 0.3371 0.3506 -0.0468 0.0120  -0.0196 166 ILE A CG1   
1378 C CG2   . ILE A 166 ? 0.5861 0.3152 0.3172 -0.0571 0.0035  -0.0138 166 ILE A CG2   
1379 C CD1   . ILE A 166 ? 0.6231 0.3097 0.3157 -0.0511 0.0118  -0.0208 166 ILE A CD1   
1380 N N     . ALA A 167 ? 0.5501 0.3049 0.3247 -0.0304 0.0124  -0.0124 167 ALA A N     
1381 C CA    . ALA A 167 ? 0.5399 0.3169 0.3349 -0.0296 0.0107  -0.0100 167 ALA A CA    
1382 C C     . ALA A 167 ? 0.5628 0.3377 0.3594 -0.0299 0.0089  -0.0088 167 ALA A C     
1383 O O     . ALA A 167 ? 0.5567 0.3446 0.3618 -0.0351 0.0055  -0.0067 167 ALA A O     
1384 C CB    . ALA A 167 ? 0.5080 0.2971 0.3184 -0.0201 0.0149  -0.0102 167 ALA A CB    
1385 N N     . ALA A 168 ? 0.5947 0.3529 0.3826 -0.0240 0.0111  -0.0100 168 ALA A N     
1386 C CA    . ALA A 168 ? 0.5978 0.3515 0.3856 -0.0232 0.0094  -0.0087 168 ALA A CA    
1387 C C     . ALA A 168 ? 0.6326 0.3743 0.4052 -0.0340 0.0052  -0.0079 168 ALA A C     
1388 O O     . ALA A 168 ? 0.6460 0.3897 0.4207 -0.0368 0.0028  -0.0060 168 ALA A O     
1389 C CB    . ALA A 168 ? 0.5982 0.3377 0.3814 -0.0126 0.0129  -0.0101 168 ALA A CB    
1390 N N     . LYS A 169 ? 0.6650 0.3939 0.4216 -0.0407 0.0043  -0.0093 169 LYS A N     
1391 C CA    . LYS A 169 ? 0.6837 0.3992 0.4237 -0.0522 0.0003  -0.0086 169 LYS A CA    
1392 C C     . LYS A 169 ? 0.6730 0.4080 0.4232 -0.0620 -0.0039 -0.0059 169 LYS A C     
1393 O O     . LYS A 169 ? 0.6332 0.3908 0.4007 -0.0611 -0.0039 -0.0050 169 LYS A O     
1394 C CB    . LYS A 169 ? 0.7249 0.4231 0.4454 -0.0575 0.0001  -0.0109 169 LYS A CB    
1395 C CG    . LYS A 169 ? 0.7805 0.4521 0.4839 -0.0501 0.0038  -0.0136 169 LYS A CG    
1396 C CD    . LYS A 169 ? 0.8855 0.5403 0.5696 -0.0548 0.0042  -0.0163 169 LYS A CD    
1397 C CE    . LYS A 169 ? 0.9706 0.5973 0.6364 -0.0467 0.0084  -0.0193 169 LYS A CE    
1398 N NZ    . LYS A 169 ? 1.0443 0.6575 0.6945 -0.0478 0.0107  -0.0225 169 LYS A NZ    
1399 N N     . LEU A 170 ? 0.6731 0.3986 0.4119 -0.0712 -0.0071 -0.0047 170 LEU A N     
1400 C CA    . LEU A 170 ? 0.6532 0.3960 0.3997 -0.0817 -0.0107 -0.0022 170 LEU A CA    
1401 C C     . LEU A 170 ? 0.6474 0.4016 0.3953 -0.0897 -0.0131 -0.0021 170 LEU A C     
1402 O O     . LEU A 170 ? 0.6444 0.3849 0.3786 -0.0916 -0.0133 -0.0040 170 LEU A O     
1403 C CB    . LEU A 170 ? 0.6800 0.4071 0.4107 -0.0910 -0.0133 -0.0010 170 LEU A CB    
1404 C CG    . LEU A 170 ? 0.7176 0.4306 0.4436 -0.0845 -0.0120 -0.0004 170 LEU A CG    
1405 C CD1   . LEU A 170 ? 0.7852 0.4740 0.4883 -0.0942 -0.0145 0.0002  170 LEU A CD1   
1406 C CD2   . LEU A 170 ? 0.6845 0.4183 0.4295 -0.0812 -0.0117 0.0017  170 LEU A CD2   
1407 N N     . GLN A 171 ? 0.6253 0.4042 0.3889 -0.0943 -0.0151 0.0000  171 GLN A N     
1408 C CA    . GLN A 171 ? 0.6664 0.4582 0.4325 -0.1020 -0.0182 0.0006  171 GLN A CA    
1409 C C     . GLN A 171 ? 0.6899 0.4668 0.4362 -0.1152 -0.0220 0.0006  171 GLN A C     
1410 O O     . GLN A 171 ? 0.7014 0.4787 0.4419 -0.1210 -0.0246 0.0002  171 GLN A O     
1411 C CB    . GLN A 171 ? 0.6842 0.5054 0.4711 -0.1038 -0.0195 0.0029  171 GLN A CB    
1412 C CG    . GLN A 171 ? 0.7674 0.6029 0.5732 -0.0915 -0.0161 0.0028  171 GLN A CG    
1413 C CD    . GLN A 171 ? 0.8373 0.6945 0.6582 -0.0895 -0.0169 0.0036  171 GLN A CD    
1414 O OE1   . GLN A 171 ? 0.8736 0.7431 0.6968 -0.0977 -0.0205 0.0051  171 GLN A OE1   
1415 N NE2   . GLN A 171 ? 0.8197 0.6817 0.6510 -0.0788 -0.0138 0.0028  171 GLN A NE2   
1416 N N     . GLU A 172 ? 0.7030 0.4652 0.4377 -0.1201 -0.0225 0.0011  172 GLU A N     
1417 C CA    . GLU A 172 ? 0.7331 0.4772 0.4465 -0.1332 -0.0259 0.0010  172 GLU A CA    
1418 C C     . GLU A 172 ? 0.7553 0.4692 0.4466 -0.1304 -0.0246 -0.0020 172 GLU A C     
1419 O O     . GLU A 172 ? 0.7922 0.4866 0.4626 -0.1407 -0.0273 -0.0026 172 GLU A O     
1420 C CB    . GLU A 172 ? 0.7670 0.5056 0.4753 -0.1397 -0.0266 0.0029  172 GLU A CB    
1421 C CG    . GLU A 172 ? 0.7699 0.5380 0.4986 -0.1433 -0.0274 0.0058  172 GLU A CG    
1422 C CD    . GLU A 172 ? 0.7992 0.5804 0.5464 -0.1302 -0.0236 0.0061  172 GLU A CD    
1423 O OE1   . GLU A 172 ? 0.8212 0.6254 0.5845 -0.1318 -0.0236 0.0080  172 GLU A OE1   
1424 O OE2   . GLU A 172 ? 0.8184 0.5871 0.5638 -0.1185 -0.0207 0.0043  172 GLU A OE2   
1425 N N     . GLN A 173 ? 0.7598 0.4695 0.4552 -0.1166 -0.0204 -0.0040 173 GLN A N     
1426 C CA    . GLN A 173 ? 0.7938 0.4777 0.4705 -0.1121 -0.0181 -0.0073 173 GLN A CA    
1427 C C     . GLN A 173 ? 0.7650 0.4586 0.4474 -0.1086 -0.0172 -0.0086 173 GLN A C     
1428 O O     . GLN A 173 ? 0.8001 0.4764 0.4705 -0.1027 -0.0142 -0.0114 173 GLN A O     
1429 C CB    . GLN A 173 ? 0.8160 0.4864 0.4922 -0.0982 -0.0132 -0.0086 173 GLN A CB    
1430 C CG    . GLN A 173 ? 0.8762 0.5226 0.5355 -0.1002 -0.0137 -0.0084 173 GLN A CG    
1431 C CD    . GLN A 173 ? 0.8788 0.5180 0.5427 -0.0853 -0.0094 -0.0091 173 GLN A CD    
1432 O OE1   . GLN A 173 ? 0.8656 0.5248 0.5500 -0.0785 -0.0082 -0.0075 173 GLN A OE1   
1433 N NE2   . GLN A 173 ? 0.9253 0.5360 0.5700 -0.0799 -0.0072 -0.0114 173 GLN A NE2   
1434 N N     . GLY A 174 ? 0.7341 0.4552 0.4346 -0.1116 -0.0196 -0.0065 174 GLY A N     
1435 C CA    . GLY A 174 ? 0.6966 0.4291 0.4044 -0.1078 -0.0190 -0.0071 174 GLY A CA    
1436 C C     . GLY A 174 ? 0.6920 0.4341 0.4162 -0.0931 -0.0138 -0.0076 174 GLY A C     
1437 O O     . GLY A 174 ? 0.6565 0.4027 0.3839 -0.0881 -0.0120 -0.0085 174 GLY A O     
1438 N N     . GLY A 175 ? 0.6548 0.4005 0.3890 -0.0869 -0.0116 -0.0068 175 GLY A N     
1439 C CA    . GLY A 175 ? 0.6075 0.3621 0.3573 -0.0737 -0.0070 -0.0072 175 GLY A CA    
1440 C C     . GLY A 175 ? 0.5845 0.3673 0.3575 -0.0723 -0.0079 -0.0049 175 GLY A C     
1441 O O     . GLY A 175 ? 0.5850 0.3816 0.3630 -0.0807 -0.0119 -0.0029 175 GLY A O     
1442 N N     . ASP A 176 ? 0.5849 0.3763 0.3721 -0.0616 -0.0042 -0.0051 176 ASP A N     
1443 C CA    . ASP A 176 ? 0.5697 0.3857 0.3778 -0.0593 -0.0047 -0.0032 176 ASP A CA    
1444 C C     . ASP A 176 ? 0.5765 0.3994 0.3948 -0.0564 -0.0041 -0.0021 176 ASP A C     
1445 O O     . ASP A 176 ? 0.5537 0.3959 0.3880 -0.0553 -0.0046 -0.0006 176 ASP A O     
1446 C CB    . ASP A 176 ? 0.5634 0.3866 0.3809 -0.0507 -0.0014 -0.0039 176 ASP A CB    
1447 C CG    . ASP A 176 ? 0.5490 0.3646 0.3553 -0.0532 -0.0016 -0.0050 176 ASP A CG    
1448 O OD1   . ASP A 176 ? 0.5369 0.3551 0.3376 -0.0623 -0.0059 -0.0040 176 ASP A OD1   
1449 O OD2   . ASP A 176 ? 0.5108 0.3188 0.3142 -0.0463 0.0025  -0.0067 176 ASP A OD2   
1450 N N     . GLU A 177 ? 0.5864 0.3926 0.3947 -0.0550 -0.0032 -0.0027 177 GLU A N     
1451 C CA    . GLU A 177 ? 0.6273 0.4373 0.4430 -0.0518 -0.0028 -0.0016 177 GLU A CA    
1452 C C     . GLU A 177 ? 0.5804 0.4062 0.4147 -0.0427 -0.0004 -0.0015 177 GLU A C     
1453 O O     . GLU A 177 ? 0.5735 0.4140 0.4196 -0.0432 -0.0012 -0.0001 177 GLU A O     
1454 C CB    . GLU A 177 ? 0.6591 0.4780 0.4762 -0.0614 -0.0062 0.0005  177 GLU A CB    
1455 C CG    . GLU A 177 ? 0.7598 0.5603 0.5601 -0.0679 -0.0080 0.0009  177 GLU A CG    
1456 C CD    . GLU A 177 ? 0.8394 0.6493 0.6394 -0.0799 -0.0112 0.0029  177 GLU A CD    
1457 O OE1   . GLU A 177 ? 0.8324 0.6603 0.6463 -0.0799 -0.0112 0.0044  177 GLU A OE1   
1458 O OE2   . GLU A 177 ? 0.8851 0.6846 0.6708 -0.0895 -0.0136 0.0030  177 GLU A OE2   
1459 N N     . VAL A 178 ? 0.5681 0.3912 0.4045 -0.0348 0.0029  -0.0030 178 VAL A N     
1460 C CA    . VAL A 178 ? 0.5172 0.3512 0.3688 -0.0260 0.0054  -0.0029 178 VAL A CA    
1461 C C     . VAL A 178 ? 0.5253 0.3519 0.3753 -0.0227 0.0052  -0.0024 178 VAL A C     
1462 O O     . VAL A 178 ? 0.5312 0.3396 0.3679 -0.0214 0.0057  -0.0032 178 VAL A O     
1463 C CB    . VAL A 178 ? 0.5128 0.3441 0.3657 -0.0187 0.0093  -0.0045 178 VAL A CB    
1464 C CG1   . VAL A 178 ? 0.4317 0.2729 0.2994 -0.0102 0.0118  -0.0044 178 VAL A CG1   
1465 C CG2   . VAL A 178 ? 0.4581 0.2971 0.3124 -0.0222 0.0090  -0.0045 178 VAL A CG2   
1466 N N     . PRO A 179 ? 0.5113 0.3510 0.3737 -0.0214 0.0044  -0.0011 179 PRO A N     
1467 C CA    . PRO A 179 ? 0.5101 0.3438 0.3707 -0.0191 0.0034  -0.0003 179 PRO A CA    
1468 C C     . PRO A 179 ? 0.5332 0.3546 0.3902 -0.0102 0.0056  -0.0012 179 PRO A C     
1469 O O     . PRO A 179 ? 0.5417 0.3692 0.4074 -0.0034 0.0085  -0.0022 179 PRO A O     
1470 C CB    . PRO A 179 ? 0.4864 0.3382 0.3631 -0.0171 0.0031  0.0007  179 PRO A CB    
1471 C CG    . PRO A 179 ? 0.4963 0.3621 0.3798 -0.0219 0.0028  0.0008  179 PRO A CG    
1472 C CD    . PRO A 179 ? 0.4799 0.3398 0.3574 -0.0222 0.0041  -0.0004 179 PRO A CD    
1473 N N     . SER A 180 ? 0.5465 0.3510 0.3906 -0.0102 0.0044  -0.0008 180 SER A N     
1474 C CA    . SER A 180 ? 0.5685 0.3593 0.4073 -0.0012 0.0063  -0.0017 180 SER A CA    
1475 C C     . SER A 180 ? 0.5632 0.3650 0.4170 0.0082  0.0074  -0.0012 180 SER A C     
1476 O O     . SER A 180 ? 0.5879 0.3851 0.4428 0.0168  0.0101  -0.0022 180 SER A O     
1477 C CB    . SER A 180 ? 0.6032 0.3728 0.4245 -0.0032 0.0041  -0.0009 180 SER A CB    
1478 O OG    . SER A 180 ? 0.6272 0.4014 0.4503 -0.0079 0.0008  0.0014  180 SER A OG    
1479 N N     . GLU A 181 ? 0.5139 0.3305 0.3792 0.0064  0.0054  0.0003  181 GLU A N     
1480 C CA    . GLU A 181 ? 0.5157 0.3432 0.3951 0.0140  0.0057  0.0009  181 GLU A CA    
1481 C C     . GLU A 181 ? 0.5103 0.3516 0.4033 0.0184  0.0092  -0.0004 181 GLU A C     
1482 O O     . GLU A 181 ? 0.5472 0.3972 0.4516 0.0248  0.0098  -0.0002 181 GLU A O     
1483 C CB    . GLU A 181 ? 0.5146 0.3519 0.4002 0.0105  0.0025  0.0026  181 GLU A CB    
1484 C CG    . GLU A 181 ? 0.4764 0.3297 0.3709 0.0045  0.0026  0.0024  181 GLU A CG    
1485 C CD    . GLU A 181 ? 0.5300 0.3801 0.4153 -0.0051 0.0010  0.0029  181 GLU A CD    
1486 O OE1   . GLU A 181 ? 0.5066 0.3413 0.3774 -0.0083 0.0003  0.0031  181 GLU A OE1   
1487 O OE2   . GLU A 181 ? 0.5662 0.4298 0.4589 -0.0096 0.0006  0.0032  181 GLU A OE2   
1488 N N     . ILE A 182 ? 0.4766 0.3199 0.3680 0.0145  0.0111  -0.0017 182 ILE A N     
1489 C CA    . ILE A 182 ? 0.4631 0.3169 0.3648 0.0180  0.0145  -0.0027 182 ILE A CA    
1490 C C     . ILE A 182 ? 0.4599 0.3032 0.3531 0.0208  0.0183  -0.0045 182 ILE A C     
1491 O O     . ILE A 182 ? 0.4592 0.3097 0.3595 0.0239  0.0218  -0.0054 182 ILE A O     
1492 C CB    . ILE A 182 ? 0.4483 0.3164 0.3582 0.0124  0.0140  -0.0025 182 ILE A CB    
1493 C CG1   . ILE A 182 ? 0.4524 0.3149 0.3518 0.0051  0.0131  -0.0028 182 ILE A CG1   
1494 C CG2   . ILE A 182 ? 0.4316 0.3104 0.3500 0.0103  0.0111  -0.0012 182 ILE A CG2   
1495 C CD1   . ILE A 182 ? 0.4411 0.3166 0.3482 0.0017  0.0132  -0.0026 182 ILE A CD1   
1496 N N     . ILE A 183 ? 0.4836 0.3091 0.3606 0.0192  0.0178  -0.0051 183 ILE A N     
1497 C CA    . ILE A 183 ? 0.4927 0.3055 0.3586 0.0214  0.0214  -0.0072 183 ILE A CA    
1498 C C     . ILE A 183 ? 0.4957 0.3103 0.3684 0.0316  0.0261  -0.0082 183 ILE A C     
1499 O O     . ILE A 183 ? 0.5222 0.3383 0.3952 0.0334  0.0302  -0.0097 183 ILE A O     
1500 C CB    . ILE A 183 ? 0.5603 0.3509 0.4061 0.0184  0.0198  -0.0077 183 ILE A CB    
1501 C CG1   . ILE A 183 ? 0.5516 0.3411 0.3897 0.0068  0.0162  -0.0071 183 ILE A CG1   
1502 C CG2   . ILE A 183 ? 0.5517 0.3265 0.3855 0.0236  0.0243  -0.0102 183 ILE A CG2   
1503 C CD1   . ILE A 183 ? 0.5594 0.3556 0.3982 0.0023  0.0173  -0.0080 183 ILE A CD1   
1504 N N     . ASP A 184 ? 0.5017 0.3169 0.3799 0.0383  0.0254  -0.0073 184 ASP A N     
1505 C CA    . ASP A 184 ? 0.5077 0.3269 0.3942 0.0485  0.0295  -0.0080 184 ASP A CA    
1506 C C     . ASP A 184 ? 0.4768 0.3176 0.3821 0.0495  0.0313  -0.0075 184 ASP A C     
1507 O O     . ASP A 184 ? 0.4725 0.3205 0.3870 0.0568  0.0351  -0.0079 184 ASP A O     
1508 C CB    . ASP A 184 ? 0.5617 0.3758 0.4487 0.0554  0.0273  -0.0067 184 ASP A CB    
1509 C CG    . ASP A 184 ? 0.6581 0.4482 0.5250 0.0550  0.0257  -0.0070 184 ASP A CG    
1510 O OD1   . ASP A 184 ? 0.7269 0.5027 0.5798 0.0538  0.0285  -0.0091 184 ASP A OD1   
1511 O OD2   . ASP A 184 ? 0.7311 0.5157 0.5951 0.0556  0.0215  -0.0051 184 ASP A OD2   
1512 N N     . LYS A 185 ? 0.4347 0.2858 0.3455 0.0421  0.0287  -0.0066 185 LYS A N     
1513 C CA    . LYS A 185 ? 0.4191 0.2889 0.3464 0.0422  0.0296  -0.0059 185 LYS A CA    
1514 C C     . LYS A 185 ? 0.4242 0.2974 0.3509 0.0384  0.0326  -0.0069 185 LYS A C     
1515 O O     . LYS A 185 ? 0.4301 0.3167 0.3682 0.0373  0.0334  -0.0063 185 LYS A O     
1516 C CB    . LYS A 185 ? 0.4050 0.2839 0.3395 0.0378  0.0246  -0.0042 185 LYS A CB    
1517 C CG    . LYS A 185 ? 0.3955 0.2729 0.3319 0.0416  0.0212  -0.0028 185 LYS A CG    
1518 C CD    . LYS A 185 ? 0.4003 0.2884 0.3446 0.0373  0.0170  -0.0014 185 LYS A CD    
1519 C CE    . LYS A 185 ? 0.4290 0.3144 0.3731 0.0402  0.0131  0.0002  185 LYS A CE    
1520 N NZ    . LYS A 185 ? 0.4035 0.2992 0.3546 0.0359  0.0094  0.0014  185 LYS A NZ    
1521 N N     . ILE A 186 ? 0.4566 0.3165 0.3688 0.0361  0.0341  -0.0082 186 ILE A N     
1522 C CA    . ILE A 186 ? 0.4496 0.3107 0.3587 0.0324  0.0365  -0.0090 186 ILE A CA    
1523 C C     . ILE A 186 ? 0.4668 0.3259 0.3752 0.0382  0.0429  -0.0105 186 ILE A C     
1524 O O     . ILE A 186 ? 0.4399 0.2868 0.3392 0.0430  0.0456  -0.0121 186 ILE A O     
1525 C CB    . ILE A 186 ? 0.4814 0.3304 0.3748 0.0253  0.0339  -0.0094 186 ILE A CB    
1526 C CG1   . ILE A 186 ? 0.4470 0.3017 0.3433 0.0190  0.0282  -0.0077 186 ILE A CG1   
1527 C CG2   . ILE A 186 ? 0.4643 0.3135 0.3533 0.0220  0.0362  -0.0100 186 ILE A CG2   
1528 C CD1   . ILE A 186 ? 0.4534 0.2962 0.3348 0.0122  0.0250  -0.0078 186 ILE A CD1   
1529 N N     . ILE A 187 ? 0.4603 0.3312 0.3780 0.0377  0.0456  -0.0102 187 ILE A N     
1530 C CA    . ILE A 187 ? 0.4542 0.3245 0.3708 0.0418  0.0523  -0.0116 187 ILE A CA    
1531 C C     . ILE A 187 ? 0.4607 0.3275 0.3686 0.0357  0.0530  -0.0118 187 ILE A C     
1532 O O     . ILE A 187 ? 0.4304 0.3071 0.3454 0.0315  0.0512  -0.0103 187 ILE A O     
1533 C CB    . ILE A 187 ? 0.4530 0.3397 0.3872 0.0461  0.0553  -0.0107 187 ILE A CB    
1534 C CG1   . ILE A 187 ? 0.4472 0.3362 0.3886 0.0529  0.0544  -0.0105 187 ILE A CG1   
1535 C CG2   . ILE A 187 ? 0.4146 0.3027 0.3481 0.0485  0.0626  -0.0119 187 ILE A CG2   
1536 C CD1   . ILE A 187 ? 0.4860 0.3931 0.4463 0.0561  0.0556  -0.0093 187 ILE A CD1   
1537 N N     . TYR A 188 ? 0.4428 0.2944 0.3343 0.0354  0.0551  -0.0136 188 TYR A N     
1538 C CA    . TYR A 188 ? 0.4508 0.2960 0.3304 0.0289  0.0543  -0.0138 188 TYR A CA    
1539 C C     . TYR A 188 ? 0.4703 0.3152 0.3467 0.0305  0.0608  -0.0147 188 TYR A C     
1540 O O     . TYR A 188 ? 0.4836 0.3217 0.3549 0.0361  0.0665  -0.0168 188 TYR A O     
1541 C CB    . TYR A 188 ? 0.4843 0.3118 0.3456 0.0257  0.0515  -0.0151 188 TYR A CB    
1542 C CG    . TYR A 188 ? 0.4786 0.2980 0.3256 0.0192  0.0507  -0.0155 188 TYR A CG    
1543 C CD1   . TYR A 188 ? 0.4293 0.2571 0.2796 0.0124  0.0457  -0.0133 188 TYR A CD1   
1544 C CD2   . TYR A 188 ? 0.5004 0.3037 0.3301 0.0200  0.0546  -0.0180 188 TYR A CD2   
1545 C CE1   . TYR A 188 ? 0.4127 0.2341 0.2504 0.0066  0.0442  -0.0133 188 TYR A CE1   
1546 C CE2   . TYR A 188 ? 0.4796 0.2752 0.2951 0.0134  0.0533  -0.0182 188 TYR A CE2   
1547 C CZ    . TYR A 188 ? 0.4608 0.2661 0.2808 0.0067  0.0478  -0.0157 188 TYR A CZ    
1548 O OH    . TYR A 188 ? 0.4691 0.2677 0.2756 0.0004  0.0457  -0.0156 188 TYR A OH    
1549 N N     . MET A 189 ? 0.4564 0.3080 0.3350 0.0257  0.0600  -0.0132 189 MET A N     
1550 C CA    . MET A 189 ? 0.4811 0.3325 0.3559 0.0260  0.0659  -0.0137 189 MET A CA    
1551 C C     . MET A 189 ? 0.4978 0.3423 0.3594 0.0192  0.0633  -0.0130 189 MET A C     
1552 O O     . MET A 189 ? 0.4766 0.3291 0.3439 0.0149  0.0591  -0.0106 189 MET A O     
1553 C CB    . MET A 189 ? 0.4844 0.3521 0.3763 0.0276  0.0685  -0.0120 189 MET A CB    
1554 C CG    . MET A 189 ? 0.5317 0.4082 0.4376 0.0342  0.0709  -0.0124 189 MET A CG    
1555 S SD    . MET A 189 ? 0.5687 0.4650 0.4957 0.0333  0.0700  -0.0099 189 MET A SD    
1556 C CE    . MET A 189 ? 0.5001 0.3984 0.4307 0.0292  0.0607  -0.0083 189 MET A CE    
1557 N N     . PRO A 190 ? 0.5029 0.3319 0.3461 0.0182  0.0654  -0.0151 190 PRO A N     
1558 C CA    . PRO A 190 ? 0.5245 0.3468 0.3542 0.0118  0.0630  -0.0144 190 PRO A CA    
1559 C C     . PRO A 190 ? 0.5347 0.3597 0.3634 0.0120  0.0686  -0.0138 190 PRO A C     
1560 O O     . PRO A 190 ? 0.5364 0.3631 0.3686 0.0172  0.0761  -0.0152 190 PRO A O     
1561 C CB    . PRO A 190 ? 0.5268 0.3302 0.3363 0.0107  0.0633  -0.0171 190 PRO A CB    
1562 C CG    . PRO A 190 ? 0.5534 0.3525 0.3647 0.0185  0.0692  -0.0197 190 PRO A CG    
1563 C CD    . PRO A 190 ? 0.5370 0.3532 0.3704 0.0233  0.0698  -0.0182 190 PRO A CD    
1564 N N     . PHE A 191 ? 0.5279 0.3542 0.3525 0.0064  0.0650  -0.0115 191 PHE A N     
1565 C CA    . PHE A 191 ? 0.5375 0.3653 0.3597 0.0056  0.0696  -0.0105 191 PHE A CA    
1566 C C     . PHE A 191 ? 0.5772 0.3931 0.3799 0.0000  0.0672  -0.0101 191 PHE A C     
1567 O O     . PHE A 191 ? 0.5647 0.3781 0.3623 -0.0046 0.0595  -0.0090 191 PHE A O     
1568 C CB    . PHE A 191 ? 0.5237 0.3662 0.3621 0.0049  0.0677  -0.0072 191 PHE A CB    
1569 C CG    . PHE A 191 ? 0.4861 0.3406 0.3428 0.0098  0.0709  -0.0075 191 PHE A CG    
1570 C CD1   . PHE A 191 ? 0.4349 0.2963 0.3034 0.0111  0.0659  -0.0072 191 PHE A CD1   
1571 C CD2   . PHE A 191 ? 0.4756 0.3348 0.3374 0.0129  0.0788  -0.0080 191 PHE A CD2   
1572 C CE1   . PHE A 191 ? 0.4342 0.3064 0.3188 0.0154  0.0682  -0.0074 191 PHE A CE1   
1573 C CE2   . PHE A 191 ? 0.4969 0.3684 0.3762 0.0171  0.0813  -0.0081 191 PHE A CE2   
1574 C CZ    . PHE A 191 ? 0.4638 0.3415 0.3543 0.0184  0.0756  -0.0078 191 PHE A CZ    
1575 N N     . ASP A 192 ? 0.6045 0.4138 0.3964 0.0001  0.0737  -0.0109 192 ASP A N     
1576 C CA    . ASP A 192 ? 0.6478 0.4445 0.4193 -0.0053 0.0717  -0.0107 192 ASP A CA    
1577 C C     . ASP A 192 ? 0.6151 0.4172 0.3876 -0.0098 0.0670  -0.0066 192 ASP A C     
1578 O O     . ASP A 192 ? 0.6315 0.4256 0.3893 -0.0149 0.0621  -0.0054 192 ASP A O     
1579 C CB    . ASP A 192 ? 0.7097 0.4940 0.4656 -0.0033 0.0808  -0.0139 192 ASP A CB    
1580 C CG    . ASP A 192 ? 0.8163 0.5887 0.5632 -0.0003 0.0827  -0.0180 192 ASP A CG    
1581 O OD1   . ASP A 192 ? 0.8640 0.6409 0.6215 0.0020  0.0792  -0.0184 192 ASP A OD1   
1582 O OD2   . ASP A 192 ? 0.8844 0.6419 0.6125 -0.0002 0.0878  -0.0209 192 ASP A OD2   
1583 N N     . ASN A 193 ? 0.5680 0.3832 0.3573 -0.0079 0.0678  -0.0042 193 ASN A N     
1584 C CA    . ASN A 193 ? 0.5593 0.3795 0.3510 -0.0113 0.0628  -0.0001 193 ASN A CA    
1585 C C     . ASN A 193 ? 0.5099 0.3447 0.3228 -0.0091 0.0607  0.0019  193 ASN A C     
1586 O O     . ASN A 193 ? 0.4945 0.3363 0.3202 -0.0051 0.0645  0.0003  193 ASN A O     
1587 C CB    . ASN A 193 ? 0.5905 0.4042 0.3702 -0.0134 0.0680  0.0011  193 ASN A CB    
1588 C CG    . ASN A 193 ? 0.6134 0.4322 0.4010 -0.0100 0.0780  0.0000  193 ASN A CG    
1589 O OD1   . ASN A 193 ? 0.5914 0.4212 0.3945 -0.0089 0.0787  0.0019  193 ASN A OD1   
1590 N ND2   . ASN A 193 ? 0.6188 0.4296 0.3956 -0.0085 0.0858  -0.0031 193 ASN A ND2   
1591 N N     . GLU A 194 ? 0.4978 0.3366 0.3136 -0.0114 0.0542  0.0054  194 GLU A N     
1592 C CA    . GLU A 194 ? 0.5099 0.3608 0.3437 -0.0095 0.0514  0.0072  194 GLU A CA    
1593 C C     . GLU A 194 ? 0.4966 0.3530 0.3399 -0.0077 0.0580  0.0077  194 GLU A C     
1594 O O     . GLU A 194 ? 0.4794 0.3453 0.3382 -0.0053 0.0582  0.0074  194 GLU A O     
1595 C CB    . GLU A 194 ? 0.4957 0.3484 0.3288 -0.0117 0.0433  0.0109  194 GLU A CB    
1596 C CG    . GLU A 194 ? 0.4915 0.3552 0.3416 -0.0094 0.0399  0.0123  194 GLU A CG    
1597 C CD    . GLU A 194 ? 0.5696 0.4345 0.4188 -0.0104 0.0333  0.0161  194 GLU A CD    
1598 O OE1   . GLU A 194 ? 0.5077 0.3809 0.3691 -0.0083 0.0295  0.0171  194 GLU A OE1   
1599 O OE2   . GLU A 194 ? 0.5973 0.4545 0.4332 -0.0128 0.0320  0.0182  194 GLU A OE2   
1600 N N     . LYS A 195 ? 0.5297 0.3802 0.3633 -0.0095 0.0633  0.0084  195 LYS A N     
1601 C CA    . LYS A 195 ? 0.5286 0.3847 0.3707 -0.0090 0.0697  0.0091  195 LYS A CA    
1602 C C     . LYS A 195 ? 0.5215 0.3849 0.3750 -0.0053 0.0758  0.0060  195 LYS A C     
1603 O O     . LYS A 195 ? 0.5242 0.3976 0.3927 -0.0040 0.0770  0.0064  195 LYS A O     
1604 C CB    . LYS A 195 ? 0.5460 0.3939 0.3741 -0.0123 0.0747  0.0106  195 LYS A CB    
1605 C CG    . LYS A 195 ? 0.5760 0.4185 0.3964 -0.0156 0.0689  0.0147  195 LYS A CG    
1606 C CD    . LYS A 195 ? 0.6699 0.5022 0.4731 -0.0191 0.0736  0.0161  195 LYS A CD    
1607 C CE    . LYS A 195 ? 0.7121 0.5381 0.5069 -0.0220 0.0674  0.0207  195 LYS A CE    
1608 N NZ    . LYS A 195 ? 0.7829 0.5969 0.5575 -0.0258 0.0707  0.0221  195 LYS A NZ    
1609 N N     . GLU A 196 ? 0.5289 0.3868 0.3746 -0.0033 0.0794  0.0029  196 GLU A N     
1610 C CA    . GLU A 196 ? 0.5476 0.4118 0.4036 0.0014  0.0845  -0.0001 196 GLU A CA    
1611 C C     . GLU A 196 ? 0.4951 0.3678 0.3659 0.0038  0.0788  -0.0003 196 GLU A C     
1612 O O     . GLU A 196 ? 0.4820 0.3652 0.3677 0.0065  0.0813  -0.0007 196 GLU A O     
1613 C CB    . GLU A 196 ? 0.6030 0.4572 0.4459 0.0037  0.0890  -0.0034 196 GLU A CB    
1614 C CG    . GLU A 196 ? 0.7063 0.5596 0.5446 0.0046  0.0993  -0.0045 196 GLU A CG    
1615 C CD    . GLU A 196 ? 0.8044 0.6424 0.6212 0.0041  0.1028  -0.0068 196 GLU A CD    
1616 O OE1   . GLU A 196 ? 0.8481 0.6787 0.6588 0.0069  0.1020  -0.0097 196 GLU A OE1   
1617 O OE2   . GLU A 196 ? 0.8495 0.6817 0.6544 0.0005  0.1063  -0.0056 196 GLU A OE2   
1618 N N     . LEU A 197 ? 0.4504 0.3191 0.3170 0.0025  0.0712  0.0001  197 LEU A N     
1619 C CA    . LEU A 197 ? 0.4298 0.3059 0.3089 0.0041  0.0656  0.0000  197 LEU A CA    
1620 C C     . LEU A 197 ? 0.4039 0.2911 0.2982 0.0039  0.0646  0.0021  197 LEU A C     
1621 O O     . LEU A 197 ? 0.3749 0.2706 0.2823 0.0065  0.0652  0.0013  197 LEU A O     
1622 C CB    . LEU A 197 ? 0.4182 0.2895 0.2901 0.0014  0.0577  0.0008  197 LEU A CB    
1623 C CG    . LEU A 197 ? 0.3858 0.2633 0.2676 0.0024  0.0520  0.0006  197 LEU A CG    
1624 C CD1   . LEU A 197 ? 0.3975 0.2687 0.2690 -0.0005 0.0461  0.0004  197 LEU A CD1   
1625 C CD2   . LEU A 197 ? 0.3663 0.2537 0.2608 0.0021  0.0485  0.0029  197 LEU A CD2   
1626 N N     . LEU A 198 ? 0.4218 0.3078 0.3130 0.0008  0.0630  0.0048  198 LEU A N     
1627 C CA    . LEU A 198 ? 0.4300 0.3237 0.3329 0.0001  0.0616  0.0068  198 LEU A CA    
1628 C C     . LEU A 198 ? 0.4480 0.3483 0.3597 0.0005  0.0684  0.0064  198 LEU A C     
1629 O O     . LEU A 198 ? 0.4380 0.3469 0.3628 0.0010  0.0674  0.0066  198 LEU A O     
1630 C CB    . LEU A 198 ? 0.4435 0.3323 0.3394 -0.0029 0.0577  0.0099  198 LEU A CB    
1631 C CG    . LEU A 198 ? 0.4630 0.3493 0.3546 -0.0030 0.0499  0.0107  198 LEU A CG    
1632 C CD1   . LEU A 198 ? 0.3988 0.2796 0.2820 -0.0052 0.0465  0.0140  198 LEU A CD1   
1633 C CD2   . LEU A 198 ? 0.4280 0.3228 0.3327 -0.0010 0.0456  0.0102  198 LEU A CD2   
1634 N N     . MET A 199 ? 0.4517 0.3486 0.3562 -0.0001 0.0752  0.0059  199 MET A N     
1635 C CA    . MET A 199 ? 0.4687 0.3739 0.3824 0.0000  0.0823  0.0056  199 MET A CA    
1636 C C     . MET A 199 ? 0.4571 0.3717 0.3835 0.0046  0.0839  0.0031  199 MET A C     
1637 O O     . MET A 199 ? 0.4410 0.3665 0.3812 0.0048  0.0853  0.0034  199 MET A O     
1638 C CB    . MET A 199 ? 0.5107 0.4106 0.4132 -0.0014 0.0901  0.0054  199 MET A CB    
1639 C CG    . MET A 199 ? 0.5134 0.4058 0.4050 -0.0067 0.0899  0.0085  199 MET A CG    
1640 S SD    . MET A 199 ? 0.5772 0.4638 0.4553 -0.0089 0.0999  0.0083  199 MET A SD    
1641 C CE    . MET A 199 ? 0.5351 0.4107 0.3981 -0.0057 0.1000  0.0052  199 MET A CE    
1642 N N     . GLU A 200 ? 0.4599 0.3695 0.3810 0.0082  0.0830  0.0009  200 GLU A N     
1643 C CA    . GLU A 200 ? 0.4732 0.3893 0.4044 0.0132  0.0836  -0.0012 200 GLU A CA    
1644 C C     . GLU A 200 ? 0.4510 0.3737 0.3938 0.0133  0.0765  -0.0005 200 GLU A C     
1645 O O     . GLU A 200 ? 0.4391 0.3718 0.3951 0.0159  0.0770  -0.0010 200 GLU A O     
1646 C CB    . GLU A 200 ? 0.5128 0.4190 0.4327 0.0166  0.0845  -0.0037 200 GLU A CB    
1647 C CG    . GLU A 200 ? 0.6185 0.5289 0.5466 0.0226  0.0852  -0.0058 200 GLU A CG    
1648 C CD    . GLU A 200 ? 0.7003 0.6230 0.6415 0.0262  0.0918  -0.0063 200 GLU A CD    
1649 O OE1   . GLU A 200 ? 0.6789 0.6021 0.6167 0.0258  0.0990  -0.0065 200 GLU A OE1   
1650 O OE2   . GLU A 200 ? 0.7369 0.6693 0.6919 0.0292  0.0897  -0.0063 200 GLU A OE2   
1651 N N     . TYR A 201 ? 0.4037 0.3215 0.3415 0.0106  0.0701  0.0008  201 TYR A N     
1652 C CA    . TYR A 201 ? 0.3867 0.3105 0.3345 0.0104  0.0640  0.0015  201 TYR A CA    
1653 C C     . TYR A 201 ? 0.3736 0.3064 0.3331 0.0086  0.0650  0.0028  201 TYR A C     
1654 O O     . TYR A 201 ? 0.3824 0.3231 0.3532 0.0099  0.0629  0.0024  201 TYR A O     
1655 C CB    . TYR A 201 ? 0.3810 0.2988 0.3216 0.0080  0.0576  0.0027  201 TYR A CB    
1656 C CG    . TYR A 201 ? 0.3971 0.3205 0.3468 0.0084  0.0519  0.0030  201 TYR A CG    
1657 C CD1   . TYR A 201 ? 0.3875 0.3133 0.3414 0.0108  0.0498  0.0014  201 TYR A CD1   
1658 C CD2   . TYR A 201 ? 0.4320 0.3571 0.3847 0.0063  0.0486  0.0048  201 TYR A CD2   
1659 C CE1   . TYR A 201 ? 0.3884 0.3190 0.3494 0.0109  0.0450  0.0016  201 TYR A CE1   
1660 C CE2   . TYR A 201 ? 0.3480 0.2778 0.3080 0.0069  0.0439  0.0047  201 TYR A CE2   
1661 C CZ    . TYR A 201 ? 0.3851 0.3180 0.3493 0.0089  0.0422  0.0031  201 TYR A CZ    
1662 O OH    . TYR A 201 ? 0.3509 0.2881 0.3213 0.0092  0.0380  0.0030  201 TYR A OH    
1663 N N     . LEU A 202 ? 0.3512 0.2823 0.3070 0.0052  0.0680  0.0044  202 LEU A N     
1664 C CA    . LEU A 202 ? 0.3587 0.2969 0.3238 0.0024  0.0693  0.0057  202 LEU A CA    
1665 C C     . LEU A 202 ? 0.3618 0.3111 0.3383 0.0039  0.0745  0.0047  202 LEU A C     
1666 O O     . LEU A 202 ? 0.3661 0.3244 0.3542 0.0025  0.0734  0.0051  202 LEU A O     
1667 C CB    . LEU A 202 ? 0.3669 0.2987 0.3235 -0.0021 0.0713  0.0080  202 LEU A CB    
1668 C CG    . LEU A 202 ? 0.4297 0.3524 0.3776 -0.0037 0.0655  0.0099  202 LEU A CG    
1669 C CD1   . LEU A 202 ? 0.4103 0.3254 0.3476 -0.0074 0.0684  0.0121  202 LEU A CD1   
1670 C CD2   . LEU A 202 ? 0.4118 0.3376 0.3678 -0.0043 0.0605  0.0105  202 LEU A CD2   
1671 N N     . ASN A 203 ? 0.3575 0.3067 0.3308 0.0067  0.0802  0.0033  203 ASN A N     
1672 C CA    . ASN A 203 ? 0.3675 0.3287 0.3527 0.0096  0.0851  0.0023  203 ASN A CA    
1673 C C     . ASN A 203 ? 0.3560 0.3234 0.3513 0.0138  0.0807  0.0011  203 ASN A C     
1674 O O     . ASN A 203 ? 0.3425 0.3223 0.3516 0.0142  0.0809  0.0014  203 ASN A O     
1675 C CB    . ASN A 203 ? 0.3668 0.3255 0.3453 0.0127  0.0926  0.0008  203 ASN A CB    
1676 C CG    . ASN A 203 ? 0.3770 0.3335 0.3487 0.0080  0.0986  0.0022  203 ASN A CG    
1677 O OD1   . ASN A 203 ? 0.4469 0.3954 0.4065 0.0090  0.1032  0.0013  203 ASN A OD1   
1678 N ND2   . ASN A 203 ? 0.3813 0.3436 0.3593 0.0026  0.0984  0.0043  203 ASN A ND2   
1679 N N     . PHE A 204 ? 0.3675 0.3263 0.3554 0.0163  0.0763  0.0001  204 PHE A N     
1680 C CA    . PHE A 204 ? 0.3711 0.3328 0.3654 0.0197  0.0713  -0.0007 204 PHE A CA    
1681 C C     . PHE A 204 ? 0.3594 0.3274 0.3628 0.0163  0.0661  0.0006  204 PHE A C     
1682 O O     . PHE A 204 ? 0.3921 0.3694 0.4068 0.0178  0.0645  0.0005  204 PHE A O     
1683 C CB    . PHE A 204 ? 0.3514 0.3008 0.3333 0.0211  0.0678  -0.0017 204 PHE A CB    
1684 C CG    . PHE A 204 ? 0.3599 0.3096 0.3451 0.0221  0.0613  -0.0019 204 PHE A CG    
1685 C CD1   . PHE A 204 ? 0.3613 0.3121 0.3497 0.0270  0.0607  -0.0031 204 PHE A CD1   
1686 C CD2   . PHE A 204 ? 0.3559 0.3041 0.3401 0.0185  0.0558  -0.0008 204 PHE A CD2   
1687 C CE1   . PHE A 204 ? 0.3841 0.3342 0.3741 0.0274  0.0548  -0.0031 204 PHE A CE1   
1688 C CE2   . PHE A 204 ? 0.3429 0.2916 0.3296 0.0192  0.0504  -0.0011 204 PHE A CE2   
1689 C CZ    . PHE A 204 ? 0.3359 0.2854 0.3251 0.0232  0.0499  -0.0021 204 PHE A CZ    
1690 N N     . TRP A 205 ? 0.3580 0.3204 0.3557 0.0120  0.0635  0.0018  205 TRP A N     
1691 C CA    . TRP A 205 ? 0.3432 0.3088 0.3468 0.0088  0.0588  0.0028  205 TRP A CA    
1692 C C     . TRP A 205 ? 0.3631 0.3394 0.3782 0.0064  0.0611  0.0034  205 TRP A C     
1693 O O     . TRP A 205 ? 0.3204 0.3024 0.3435 0.0053  0.0573  0.0034  205 TRP A O     
1694 C CB    . TRP A 205 ? 0.3382 0.2948 0.3323 0.0055  0.0569  0.0041  205 TRP A CB    
1695 C CG    . TRP A 205 ? 0.3420 0.2982 0.3388 0.0030  0.0520  0.0048  205 TRP A CG    
1696 C CD1   . TRP A 205 ? 0.3429 0.3019 0.3445 -0.0008 0.0523  0.0058  205 TRP A CD1   
1697 C CD2   . TRP A 205 ? 0.3259 0.2778 0.3193 0.0040  0.0466  0.0046  205 TRP A CD2   
1698 N NE1   . TRP A 205 ? 0.3113 0.2668 0.3120 -0.0016 0.0475  0.0060  205 TRP A NE1   
1699 C CE2   . TRP A 205 ? 0.3190 0.2709 0.3153 0.0016  0.0441  0.0053  205 TRP A CE2   
1700 C CE3   . TRP A 205 ? 0.3402 0.2884 0.3282 0.0064  0.0438  0.0040  205 TRP A CE3   
1701 C CZ2   . TRP A 205 ? 0.3271 0.2761 0.3216 0.0024  0.0394  0.0051  205 TRP A CZ2   
1702 C CZ3   . TRP A 205 ? 0.3232 0.2699 0.3104 0.0066  0.0390  0.0041  205 TRP A CZ3   
1703 C CH2   . TRP A 205 ? 0.3648 0.3121 0.3555 0.0050  0.0371  0.0046  205 TRP A CH2   
1704 N N     . GLN A 206 ? 0.3894 0.3687 0.4047 0.0050  0.0672  0.0039  206 GLN A N     
1705 C CA    . GLN A 206 ? 0.4216 0.4128 0.4483 0.0021  0.0702  0.0047  206 GLN A CA    
1706 C C     . GLN A 206 ? 0.4046 0.4083 0.4442 0.0064  0.0699  0.0037  206 GLN A C     
1707 O O     . GLN A 206 ? 0.3986 0.4123 0.4490 0.0039  0.0680  0.0043  206 GLN A O     
1708 C CB    . GLN A 206 ? 0.4650 0.4568 0.4884 -0.0004 0.0776  0.0055  206 GLN A CB    
1709 C CG    . GLN A 206 ? 0.5815 0.5851 0.6155 -0.0056 0.0806  0.0068  206 GLN A CG    
1710 C CD    . GLN A 206 ? 0.6976 0.6963 0.7238 -0.0114 0.0857  0.0085  206 GLN A CD    
1711 O OE1   . GLN A 206 ? 0.7688 0.7536 0.7812 -0.0124 0.0850  0.0091  206 GLN A OE1   
1712 N NE2   . GLN A 206 ? 0.7107 0.7210 0.7456 -0.0155 0.0906  0.0094  206 GLN A NE2   
1713 N N     . GLN A 207 ? 0.3988 0.4010 0.4363 0.0128  0.0715  0.0024  207 GLN A N     
1714 C CA    . GLN A 207 ? 0.4167 0.4293 0.4653 0.0180  0.0709  0.0017  207 GLN A CA    
1715 C C     . GLN A 207 ? 0.4041 0.4155 0.4548 0.0189  0.0632  0.0015  207 GLN A C     
1716 O O     . GLN A 207 ? 0.4250 0.4468 0.4868 0.0207  0.0609  0.0017  207 GLN A O     
1717 C CB    . GLN A 207 ? 0.4439 0.4530 0.4878 0.0250  0.0752  0.0002  207 GLN A CB    
1718 C CG    . GLN A 207 ? 0.5559 0.5694 0.6002 0.0254  0.0839  0.0001  207 GLN A CG    
1719 C CD    . GLN A 207 ? 0.6448 0.6771 0.7059 0.0243  0.0869  0.0011  207 GLN A CD    
1720 O OE1   . GLN A 207 ? 0.6504 0.6936 0.7230 0.0294  0.0859  0.0009  207 GLN A OE1   
1721 N NE2   . GLN A 207 ? 0.6415 0.6778 0.7036 0.0176  0.0906  0.0024  207 GLN A NE2   
1722 N N     . LYS A 208 ? 0.3836 0.3831 0.4239 0.0176  0.0592  0.0012  208 LYS A N     
1723 C CA    . LYS A 208 ? 0.3537 0.3511 0.3943 0.0183  0.0525  0.0009  208 LYS A CA    
1724 C C     . LYS A 208 ? 0.3258 0.3175 0.3617 0.0131  0.0489  0.0014  208 LYS A C     
1725 O O     . LYS A 208 ? 0.3834 0.3662 0.4108 0.0135  0.0461  0.0010  208 LYS A O     
1726 C CB    . LYS A 208 ? 0.3286 0.3172 0.3609 0.0231  0.0514  -0.0002 208 LYS A CB    
1727 C CG    . LYS A 208 ? 0.3234 0.3150 0.3585 0.0292  0.0552  -0.0009 208 LYS A CG    
1728 C CD    . LYS A 208 ? 0.3639 0.3439 0.3883 0.0332  0.0541  -0.0020 208 LYS A CD    
1729 C CE    . LYS A 208 ? 0.4084 0.3883 0.4324 0.0395  0.0595  -0.0030 208 LYS A CE    
1730 N NZ    . LYS A 208 ? 0.4501 0.4420 0.4874 0.0442  0.0592  -0.0026 208 LYS A NZ    
1731 N N     . THR A 209 ? 0.3216 0.3184 0.3629 0.0084  0.0490  0.0023  209 THR A N     
1732 C CA    . THR A 209 ? 0.3350 0.3250 0.3710 0.0039  0.0463  0.0028  209 THR A CA    
1733 C C     . THR A 209 ? 0.3214 0.3098 0.3577 0.0043  0.0404  0.0020  209 THR A C     
1734 O O     . THR A 209 ? 0.3098 0.3056 0.3539 0.0040  0.0379  0.0018  209 THR A O     
1735 C CB    . THR A 209 ? 0.3614 0.3556 0.4020 -0.0019 0.0481  0.0039  209 THR A CB    
1736 O OG1   . THR A 209 ? 0.3716 0.3693 0.4131 -0.0024 0.0543  0.0046  209 THR A OG1   
1737 C CG2   . THR A 209 ? 0.3214 0.3052 0.3536 -0.0056 0.0462  0.0045  209 THR A CG2   
1738 N N     . PRO A 210 ? 0.3422 0.3218 0.3699 0.0050  0.0381  0.0018  210 PRO A N     
1739 C CA    . PRO A 210 ? 0.3237 0.3021 0.3512 0.0053  0.0332  0.0010  210 PRO A CA    
1740 C C     . PRO A 210 ? 0.3031 0.2838 0.3348 0.0014  0.0311  0.0009  210 PRO A C     
1741 O O     . PRO A 210 ? 0.3264 0.3057 0.3577 -0.0021 0.0329  0.0017  210 PRO A O     
1742 C CB    . PRO A 210 ? 0.2889 0.2585 0.3070 0.0058  0.0321  0.0010  210 PRO A CB    
1743 C CG    . PRO A 210 ? 0.3556 0.3224 0.3690 0.0074  0.0357  0.0015  210 PRO A CG    
1744 C CD    . PRO A 210 ? 0.3369 0.3081 0.3549 0.0057  0.0398  0.0021  210 PRO A CD    
1745 N N     . VAL A 211 ? 0.2959 0.2793 0.3305 0.0017  0.0272  0.0001  211 VAL A N     
1746 C CA    . VAL A 211 ? 0.2720 0.2552 0.3079 -0.0021 0.0246  -0.0004 211 VAL A CA    
1747 C C     . VAL A 211 ? 0.2835 0.2588 0.3119 -0.0011 0.0224  -0.0013 211 VAL A C     
1748 O O     . VAL A 211 ? 0.2548 0.2236 0.2785 -0.0029 0.0225  -0.0014 211 VAL A O     
1749 C CB    . VAL A 211 ? 0.2685 0.2600 0.3119 -0.0027 0.0216  -0.0007 211 VAL A CB    
1750 C CG1   . VAL A 211 ? 0.2370 0.2257 0.2787 -0.0067 0.0181  -0.0017 211 VAL A CG1   
1751 C CG2   . VAL A 211 ? 0.1557 0.1572 0.2083 -0.0038 0.0239  0.0004  211 VAL A CG2   
1752 N N     . ILE A 212 ? 0.2772 0.2529 0.3041 0.0020  0.0206  -0.0018 212 ILE A N     
1753 C CA    . ILE A 212 ? 0.2674 0.2378 0.2880 0.0034  0.0190  -0.0026 212 ILE A CA    
1754 C C     . ILE A 212 ? 0.2997 0.2675 0.3161 0.0059  0.0209  -0.0018 212 ILE A C     
1755 O O     . ILE A 212 ? 0.3114 0.2813 0.3287 0.0076  0.0218  -0.0015 212 ILE A O     
1756 C CB    . ILE A 212 ? 0.2572 0.2298 0.2781 0.0043  0.0159  -0.0035 212 ILE A CB    
1757 C CG1   . ILE A 212 ? 0.2647 0.2401 0.2893 0.0016  0.0136  -0.0042 212 ILE A CG1   
1758 C CG2   . ILE A 212 ? 0.2548 0.2235 0.2698 0.0056  0.0150  -0.0042 212 ILE A CG2   
1759 C CD1   . ILE A 212 ? 0.2383 0.2082 0.2592 -0.0010 0.0130  -0.0053 212 ILE A CD1   
1760 N N     . LEU A 213 ? 0.2581 0.2209 0.2695 0.0061  0.0213  -0.0015 213 LEU A N     
1761 C CA    . LEU A 213 ? 0.2862 0.2466 0.2930 0.0077  0.0223  -0.0007 213 LEU A CA    
1762 C C     . LEU A 213 ? 0.2672 0.2268 0.2707 0.0090  0.0201  -0.0011 213 LEU A C     
1763 O O     . LEU A 213 ? 0.2840 0.2418 0.2866 0.0093  0.0192  -0.0015 213 LEU A O     
1764 C CB    . LEU A 213 ? 0.2798 0.2360 0.2838 0.0069  0.0246  0.0006  213 LEU A CB    
1765 C CG    . LEU A 213 ? 0.3611 0.3142 0.3593 0.0079  0.0257  0.0017  213 LEU A CG    
1766 C CD1   . LEU A 213 ? 0.2763 0.2313 0.2745 0.0087  0.0271  0.0015  213 LEU A CD1   
1767 C CD2   . LEU A 213 ? 0.2627 0.2107 0.2571 0.0067  0.0278  0.0033  213 LEU A CD2   
1768 N N     . THR A 214 ? 0.2822 0.2429 0.2835 0.0098  0.0194  -0.0010 214 THR A N     
1769 C CA    . THR A 214 ? 0.2753 0.2372 0.2744 0.0104  0.0175  -0.0013 214 THR A CA    
1770 C C     . THR A 214 ? 0.2773 0.2384 0.2719 0.0103  0.0173  -0.0004 214 THR A C     
1771 O O     . THR A 214 ? 0.2904 0.2487 0.2827 0.0101  0.0189  0.0003  214 THR A O     
1772 C CB    . THR A 214 ? 0.3101 0.2749 0.3109 0.0099  0.0158  -0.0025 214 THR A CB    
1773 O OG1   . THR A 214 ? 0.2630 0.2299 0.2620 0.0102  0.0146  -0.0028 214 THR A OG1   
1774 C CG2   . THR A 214 ? 0.2495 0.2144 0.2498 0.0096  0.0155  -0.0024 214 THR A CG2   
1775 N N     . GLY A 215 ? 0.2963 0.2601 0.2894 0.0099  0.0156  -0.0004 215 GLY A N     
1776 C CA    . GLY A 215 ? 0.3208 0.2843 0.3092 0.0089  0.0147  0.0005  215 GLY A CA    
1777 C C     . GLY A 215 ? 0.3420 0.3107 0.3314 0.0092  0.0131  0.0009  215 GLY A C     
1778 O O     . GLY A 215 ? 0.3366 0.3082 0.3295 0.0105  0.0130  0.0001  215 GLY A O     
1779 N N     . TRP A 216 ? 0.3299 0.3001 0.3162 0.0082  0.0117  0.0021  216 TRP A N     
1780 C CA    . TRP A 216 ? 0.3338 0.3113 0.3224 0.0088  0.0101  0.0027  216 TRP A CA    
1781 C C     . TRP A 216 ? 0.3199 0.2976 0.3083 0.0112  0.0093  0.0042  216 TRP A C     
1782 O O     . TRP A 216 ? 0.3421 0.3171 0.3261 0.0099  0.0084  0.0056  216 TRP A O     
1783 C CB    . TRP A 216 ? 0.3249 0.3064 0.3110 0.0051  0.0084  0.0030  216 TRP A CB    
1784 C CG    . TRP A 216 ? 0.3234 0.3149 0.3138 0.0053  0.0074  0.0032  216 TRP A CG    
1785 C CD1   . TRP A 216 ? 0.3229 0.3221 0.3152 0.0055  0.0056  0.0047  216 TRP A CD1   
1786 C CD2   . TRP A 216 ? 0.3167 0.3125 0.3103 0.0053  0.0084  0.0018  216 TRP A CD2   
1787 N NE1   . TRP A 216 ? 0.3389 0.3479 0.3363 0.0061  0.0058  0.0042  216 TRP A NE1   
1788 C CE2   . TRP A 216 ? 0.3178 0.3242 0.3154 0.0058  0.0078  0.0024  216 TRP A CE2   
1789 C CE3   . TRP A 216 ? 0.2756 0.2675 0.2689 0.0050  0.0097  0.0003  216 TRP A CE3   
1790 C CZ2   . TRP A 216 ? 0.3274 0.3403 0.3282 0.0059  0.0091  0.0012  216 TRP A CZ2   
1791 C CZ3   . TRP A 216 ? 0.2895 0.2869 0.2849 0.0048  0.0104  -0.0008 216 TRP A CZ3   
1792 C CH2   . TRP A 216 ? 0.3151 0.3226 0.3140 0.0052  0.0105  -0.0004 216 TRP A CH2   
1793 N N     . ASN A 217 ? 0.3048 0.2845 0.2970 0.0148  0.0096  0.0041  217 ASN A N     
1794 C CA    . ASN A 217 ? 0.3216 0.2989 0.3129 0.0179  0.0090  0.0057  217 ASN A CA    
1795 C C     . ASN A 217 ? 0.3237 0.2915 0.3106 0.0173  0.0103  0.0064  217 ASN A C     
1796 O O     . ASN A 217 ? 0.3519 0.3167 0.3351 0.0181  0.0093  0.0083  217 ASN A O     
1797 C CB    . ASN A 217 ? 0.3174 0.3010 0.3083 0.0181  0.0061  0.0078  217 ASN A CB    
1798 C CG    . ASN A 217 ? 0.3793 0.3733 0.3760 0.0207  0.0052  0.0077  217 ASN A CG    
1799 O OD1   . ASN A 217 ? 0.4505 0.4443 0.4502 0.0251  0.0063  0.0070  217 ASN A OD1   
1800 N ND2   . ASN A 217 ? 0.3601 0.3631 0.3583 0.0178  0.0033  0.0083  217 ASN A ND2   
1801 N N     . VAL A 218 ? 0.3074 0.2711 0.2945 0.0157  0.0125  0.0050  218 VAL A N     
1802 C CA    . VAL A 218 ? 0.3218 0.2782 0.3057 0.0148  0.0144  0.0055  218 VAL A CA    
1803 C C     . VAL A 218 ? 0.3234 0.2747 0.3066 0.0169  0.0150  0.0064  218 VAL A C     
1804 O O     . VAL A 218 ? 0.3452 0.2908 0.3240 0.0162  0.0158  0.0079  218 VAL A O     
1805 C CB    . VAL A 218 ? 0.3082 0.2633 0.2939 0.0128  0.0167  0.0040  218 VAL A CB    
1806 C CG1   . VAL A 218 ? 0.3631 0.3197 0.3467 0.0109  0.0163  0.0036  218 VAL A CG1   
1807 C CG2   . VAL A 218 ? 0.3230 0.2801 0.3137 0.0134  0.0168  0.0023  218 VAL A CG2   
1808 N N     . GLU A 219 ? 0.3360 0.2883 0.3223 0.0193  0.0146  0.0055  219 GLU A N     
1809 C CA    . GLU A 219 ? 0.3679 0.3130 0.3521 0.0213  0.0151  0.0061  219 GLU A CA    
1810 C C     . GLU A 219 ? 0.3917 0.3353 0.3726 0.0246  0.0130  0.0085  219 GLU A C     
1811 O O     . GLU A 219 ? 0.4077 0.3430 0.3838 0.0252  0.0133  0.0102  219 GLU A O     
1812 C CB    . GLU A 219 ? 0.3500 0.2947 0.3370 0.0228  0.0155  0.0040  219 GLU A CB    
1813 C CG    . GLU A 219 ? 0.3768 0.3117 0.3602 0.0245  0.0161  0.0044  219 GLU A CG    
1814 C CD    . GLU A 219 ? 0.3954 0.3278 0.3797 0.0254  0.0166  0.0020  219 GLU A CD    
1815 O OE1   . GLU A 219 ? 0.4524 0.3803 0.4362 0.0219  0.0178  0.0009  219 GLU A OE1   
1816 O OE2   . GLU A 219 ? 0.4234 0.3588 0.4089 0.0296  0.0160  0.0011  219 GLU A OE2   
1817 N N     . SER A 220 ? 0.3743 0.3260 0.3575 0.0265  0.0108  0.0090  220 SER A N     
1818 C CA    . SER A 220 ? 0.4071 0.3595 0.3884 0.0302  0.0082  0.0115  220 SER A CA    
1819 C C     . SER A 220 ? 0.3922 0.3445 0.3687 0.0277  0.0065  0.0138  220 SER A C     
1820 O O     . SER A 220 ? 0.4541 0.4038 0.4269 0.0301  0.0042  0.0164  220 SER A O     
1821 C CB    . SER A 220 ? 0.3861 0.3492 0.3733 0.0339  0.0065  0.0111  220 SER A CB    
1822 O OG    . SER A 220 ? 0.4552 0.4276 0.4453 0.0303  0.0060  0.0104  220 SER A OG    
1823 N N     . PHE A 221 ? 0.3467 0.3009 0.3225 0.0232  0.0074  0.0129  221 PHE A N     
1824 C CA    . PHE A 221 ? 0.3512 0.3041 0.3210 0.0203  0.0061  0.0145  221 PHE A CA    
1825 C C     . PHE A 221 ? 0.3690 0.3144 0.3337 0.0165  0.0092  0.0139  221 PHE A C     
1826 O O     . PHE A 221 ? 0.4101 0.3481 0.3684 0.0160  0.0099  0.0155  221 PHE A O     
1827 C CB    . PHE A 221 ? 0.3349 0.2971 0.3064 0.0184  0.0034  0.0145  221 PHE A CB    
1828 C CG    . PHE A 221 ? 0.3665 0.3261 0.3304 0.0149  0.0017  0.0159  221 PHE A CG    
1829 C CD1   . PHE A 221 ? 0.3283 0.2852 0.2884 0.0106  0.0034  0.0144  221 PHE A CD1   
1830 C CD2   . PHE A 221 ? 0.3508 0.3095 0.3102 0.0161  -0.0016 0.0188  221 PHE A CD2   
1831 C CE1   . PHE A 221 ? 0.3621 0.3147 0.3133 0.0073  0.0021  0.0153  221 PHE A CE1   
1832 C CE2   . PHE A 221 ? 0.3703 0.3256 0.3211 0.0124  -0.0033 0.0201  221 PHE A CE2   
1833 C CZ    . PHE A 221 ? 0.3732 0.3250 0.3194 0.0078  -0.0012 0.0181  221 PHE A CZ    
1834 N N     . ALA A 222 ? 0.3208 0.2682 0.2880 0.0142  0.0113  0.0116  222 ALA A N     
1835 C CA    . ALA A 222 ? 0.3060 0.2479 0.2689 0.0114  0.0144  0.0109  222 ALA A CA    
1836 C C     . ALA A 222 ? 0.3326 0.2680 0.2943 0.0113  0.0177  0.0113  222 ALA A C     
1837 O O     . ALA A 222 ? 0.3310 0.2608 0.2863 0.0097  0.0195  0.0122  222 ALA A O     
1838 C CB    . ALA A 222 ? 0.2833 0.2283 0.2497 0.0100  0.0157  0.0086  222 ALA A CB    
1839 N N     . ILE A 223 ? 0.3300 0.2658 0.2971 0.0126  0.0185  0.0105  223 ILE A N     
1840 C CA    . ILE A 223 ? 0.3491 0.2791 0.3153 0.0113  0.0215  0.0109  223 ILE A CA    
1841 C C     . ILE A 223 ? 0.3534 0.2758 0.3122 0.0117  0.0210  0.0136  223 ILE A C     
1842 O O     . ILE A 223 ? 0.3519 0.2691 0.3056 0.0093  0.0237  0.0146  223 ILE A O     
1843 C CB    . ILE A 223 ? 0.3719 0.3032 0.3445 0.0117  0.0222  0.0093  223 ILE A CB    
1844 C CG1   . ILE A 223 ? 0.3650 0.3029 0.3437 0.0109  0.0227  0.0070  223 ILE A CG1   
1845 C CG2   . ILE A 223 ? 0.3427 0.2677 0.3137 0.0094  0.0249  0.0100  223 ILE A CG2   
1846 C CD1   . ILE A 223 ? 0.3198 0.2602 0.3042 0.0115  0.0220  0.0053  223 ILE A CD1   
1847 N N     . PRO A 224 ? 0.3700 0.2916 0.3278 0.0150  0.0176  0.0150  224 PRO A N     
1848 C CA    . PRO A 224 ? 0.3798 0.2934 0.3295 0.0157  0.0164  0.0180  224 PRO A CA    
1849 C C     . PRO A 224 ? 0.3780 0.2903 0.3202 0.0139  0.0157  0.0197  224 PRO A C     
1850 O O     . PRO A 224 ? 0.3876 0.2916 0.3216 0.0125  0.0167  0.0218  224 PRO A O     
1851 C CB    . PRO A 224 ? 0.3797 0.2947 0.3313 0.0208  0.0126  0.0190  224 PRO A CB    
1852 C CG    . PRO A 224 ? 0.3855 0.3110 0.3458 0.0221  0.0117  0.0165  224 PRO A CG    
1853 C CD    . PRO A 224 ? 0.3375 0.2650 0.3014 0.0184  0.0151  0.0139  224 PRO A CD    
1854 N N     . TYR A 225 ? 0.3339 0.2531 0.2777 0.0135  0.0141  0.0187  225 TYR A N     
1855 C CA    . TYR A 225 ? 0.3587 0.2754 0.2941 0.0110  0.0135  0.0198  225 TYR A CA    
1856 C C     . TYR A 225 ? 0.3580 0.2689 0.2886 0.0076  0.0187  0.0190  225 TYR A C     
1857 O O     . TYR A 225 ? 0.3788 0.2824 0.2999 0.0060  0.0196  0.0208  225 TYR A O     
1858 C CB    . TYR A 225 ? 0.3251 0.2491 0.2618 0.0101  0.0108  0.0187  225 TYR A CB    
1859 C CG    . TYR A 225 ? 0.3558 0.2764 0.2824 0.0082  0.0081  0.0208  225 TYR A CG    
1860 C CD1   . TYR A 225 ? 0.3165 0.2303 0.2339 0.0047  0.0110  0.0202  225 TYR A CD1   
1861 C CD2   . TYR A 225 ? 0.3223 0.2464 0.2480 0.0100  0.0026  0.0234  225 TYR A CD2   
1862 C CE1   . TYR A 225 ? 0.3468 0.2562 0.2532 0.0026  0.0083  0.0221  225 TYR A CE1   
1863 C CE2   . TYR A 225 ? 0.3609 0.2819 0.2769 0.0080  -0.0006 0.0255  225 TYR A CE2   
1864 C CZ    . TYR A 225 ? 0.4031 0.3163 0.3089 0.0039  0.0021  0.0248  225 TYR A CZ    
1865 O OH    . TYR A 225 ? 0.4127 0.3220 0.3074 0.0015  -0.0014 0.0269  225 TYR A OH    
1866 N N     . VAL A 226 ? 0.3805 0.2949 0.3174 0.0068  0.0221  0.0163  226 VAL A N     
1867 C CA    . VAL A 226 ? 0.3712 0.2824 0.3055 0.0044  0.0275  0.0153  226 VAL A CA    
1868 C C     . VAL A 226 ? 0.3656 0.2707 0.2968 0.0031  0.0304  0.0170  226 VAL A C     
1869 O O     . VAL A 226 ? 0.3739 0.2734 0.2971 0.0008  0.0335  0.0180  226 VAL A O     
1870 C CB    . VAL A 226 ? 0.3883 0.3057 0.3316 0.0046  0.0301  0.0124  226 VAL A CB    
1871 C CG1   . VAL A 226 ? 0.3674 0.2832 0.3100 0.0030  0.0360  0.0117  226 VAL A CG1   
1872 C CG2   . VAL A 226 ? 0.3457 0.2666 0.2892 0.0051  0.0279  0.0109  226 VAL A CG2   
1873 N N     . TYR A 227 ? 0.3599 0.2651 0.2963 0.0041  0.0294  0.0175  227 TYR A N     
1874 C CA    . TYR A 227 ? 0.3777 0.2760 0.3108 0.0021  0.0319  0.0192  227 TYR A CA    
1875 C C     . TYR A 227 ? 0.4080 0.2970 0.3290 0.0016  0.0306  0.0224  227 TYR A C     
1876 O O     . TYR A 227 ? 0.4107 0.2939 0.3250 -0.0017 0.0344  0.0236  227 TYR A O     
1877 C CB    . TYR A 227 ? 0.3529 0.2510 0.2919 0.0034  0.0301  0.0190  227 TYR A CB    
1878 C CG    . TYR A 227 ? 0.3651 0.2547 0.2997 0.0006  0.0323  0.0207  227 TYR A CG    
1879 C CD1   . TYR A 227 ? 0.3226 0.2140 0.2615 -0.0034 0.0367  0.0197  227 TYR A CD1   
1880 C CD2   . TYR A 227 ? 0.3936 0.2731 0.3196 0.0019  0.0298  0.0236  227 TYR A CD2   
1881 C CE1   . TYR A 227 ? 0.3925 0.2759 0.3269 -0.0071 0.0387  0.0214  227 TYR A CE1   
1882 C CE2   . TYR A 227 ? 0.4290 0.2987 0.3494 -0.0011 0.0317  0.0254  227 TYR A CE2   
1883 C CZ    . TYR A 227 ? 0.4458 0.3174 0.3703 -0.0061 0.0362  0.0242  227 TYR A CZ    
1884 O OH    . TYR A 227 ? 0.4929 0.3544 0.4111 -0.0102 0.0381  0.0262  227 TYR A OH    
1885 N N     . ASN A 228 ? 0.4144 0.3028 0.3329 0.0048  0.0252  0.0239  228 ASN A N     
1886 C CA    . ASN A 228 ? 0.4266 0.3065 0.3336 0.0049  0.0227  0.0274  228 ASN A CA    
1887 C C     . ASN A 228 ? 0.4376 0.3153 0.3353 0.0023  0.0237  0.0279  228 ASN A C     
1888 O O     . ASN A 228 ? 0.4587 0.3273 0.3451 0.0005  0.0242  0.0306  228 ASN A O     
1889 C CB    . ASN A 228 ? 0.4105 0.2918 0.3187 0.0098  0.0164  0.0291  228 ASN A CB    
1890 C CG    . ASN A 228 ? 0.4574 0.3356 0.3698 0.0126  0.0157  0.0294  228 ASN A CG    
1891 O OD1   . ASN A 228 ? 0.4771 0.3471 0.3861 0.0103  0.0188  0.0300  228 ASN A OD1   
1892 N ND2   . ASN A 228 ? 0.4627 0.3471 0.3820 0.0174  0.0119  0.0288  228 ASN A ND2   
1893 N N     . ARG A 229 ? 0.4224 0.3069 0.3234 0.0020  0.0240  0.0254  229 ARG A N     
1894 C CA    . ARG A 229 ? 0.4132 0.2944 0.3043 -0.0007 0.0257  0.0252  229 ARG A CA    
1895 C C     . ARG A 229 ? 0.4328 0.3090 0.3196 -0.0039 0.0328  0.0247  229 ARG A C     
1896 O O     . ARG A 229 ? 0.4352 0.3035 0.3098 -0.0063 0.0344  0.0263  229 ARG A O     
1897 C CB    . ARG A 229 ? 0.4198 0.3077 0.3148 -0.0006 0.0250  0.0223  229 ARG A CB    
1898 C CG    . ARG A 229 ? 0.4682 0.3508 0.3511 -0.0033 0.0261  0.0218  229 ARG A CG    
1899 C CD    . ARG A 229 ? 0.4550 0.3340 0.3281 -0.0040 0.0199  0.0247  229 ARG A CD    
1900 N NE    . ARG A 229 ? 0.4866 0.3586 0.3457 -0.0073 0.0209  0.0243  229 ARG A NE    
1901 C CZ    . ARG A 229 ? 0.5033 0.3694 0.3501 -0.0090 0.0168  0.0271  229 ARG A CZ    
1902 N NH1   . ARG A 229 ? 0.4424 0.3091 0.2897 -0.0071 0.0113  0.0307  229 ARG A NH1   
1903 N NH2   . ARG A 229 ? 0.4746 0.3333 0.3078 -0.0124 0.0182  0.0262  229 ARG A NH2   
1904 N N     . ILE A 230 ? 0.4080 0.2894 0.3050 -0.0040 0.0371  0.0225  230 ILE A N     
1905 C CA    . ILE A 230 ? 0.4345 0.3141 0.3302 -0.0070 0.0443  0.0220  230 ILE A CA    
1906 C C     . ILE A 230 ? 0.4286 0.2996 0.3168 -0.0095 0.0452  0.0253  230 ILE A C     
1907 O O     . ILE A 230 ? 0.4526 0.3175 0.3310 -0.0126 0.0495  0.0264  230 ILE A O     
1908 C CB    . ILE A 230 ? 0.3894 0.2783 0.2990 -0.0066 0.0477  0.0193  230 ILE A CB    
1909 C CG1   . ILE A 230 ? 0.4043 0.2991 0.3179 -0.0045 0.0482  0.0162  230 ILE A CG1   
1910 C CG2   . ILE A 230 ? 0.4027 0.2914 0.3128 -0.0100 0.0546  0.0195  230 ILE A CG2   
1911 C CD1   . ILE A 230 ? 0.3406 0.2449 0.2684 -0.0030 0.0491  0.0139  230 ILE A CD1   
1912 N N     . LYS A 231 ? 0.4357 0.3051 0.3274 -0.0081 0.0413  0.0269  231 LYS A N     
1913 C CA    . LYS A 231 ? 0.4335 0.2923 0.3165 -0.0101 0.0411  0.0303  231 LYS A CA    
1914 C C     . LYS A 231 ? 0.4610 0.3104 0.3284 -0.0109 0.0393  0.0333  231 LYS A C     
1915 O O     . LYS A 231 ? 0.4459 0.2868 0.3031 -0.0147 0.0429  0.0354  231 LYS A O     
1916 C CB    . LYS A 231 ? 0.4329 0.2900 0.3208 -0.0071 0.0363  0.0313  231 LYS A CB    
1917 C CG    . LYS A 231 ? 0.4747 0.3184 0.3520 -0.0085 0.0354  0.0352  231 LYS A CG    
1918 C CD    . LYS A 231 ? 0.5648 0.4054 0.4468 -0.0058 0.0322  0.0355  231 LYS A CD    
1919 C CE    . LYS A 231 ? 0.6075 0.4516 0.4930 0.0010  0.0256  0.0356  231 LYS A CE    
1920 N NZ    . LYS A 231 ? 0.6779 0.5142 0.5521 0.0036  0.0209  0.0394  231 LYS A NZ    
1921 N N     . ASN A 232 ? 0.4699 0.3211 0.3352 -0.0078 0.0337  0.0335  232 ASN A N     
1922 C CA    . ASN A 232 ? 0.4982 0.3415 0.3487 -0.0087 0.0310  0.0363  232 ASN A CA    
1923 C C     . ASN A 232 ? 0.5266 0.3664 0.3675 -0.0129 0.0370  0.0352  232 ASN A C     
1924 O O     . ASN A 232 ? 0.5362 0.3660 0.3630 -0.0157 0.0380  0.0380  232 ASN A O     
1925 C CB    . ASN A 232 ? 0.5321 0.3808 0.3839 -0.0054 0.0238  0.0362  232 ASN A CB    
1926 C CG    . ASN A 232 ? 0.5255 0.3765 0.3838 -0.0006 0.0175  0.0381  232 ASN A CG    
1927 O OD1   . ASN A 232 ? 0.5283 0.3735 0.3867 0.0004  0.0178  0.0399  232 ASN A OD1   
1928 N ND2   . ASN A 232 ? 0.5255 0.3847 0.3888 0.0023  0.0120  0.0376  232 ASN A ND2   
1929 N N     . ILE A 233 ? 0.5134 0.3609 0.3614 -0.0131 0.0412  0.0313  233 ILE A N     
1930 C CA    . ILE A 233 ? 0.5086 0.3531 0.3476 -0.0160 0.0472  0.0298  233 ILE A CA    
1931 C C     . ILE A 233 ? 0.5056 0.3483 0.3441 -0.0194 0.0557  0.0298  233 ILE A C     
1932 O O     . ILE A 233 ? 0.5219 0.3574 0.3475 -0.0226 0.0600  0.0307  233 ILE A O     
1933 C CB    . ILE A 233 ? 0.4762 0.3280 0.3212 -0.0142 0.0482  0.0256  233 ILE A CB    
1934 C CG1   . ILE A 233 ? 0.4898 0.3419 0.3316 -0.0126 0.0403  0.0260  233 ILE A CG1   
1935 C CG2   . ILE A 233 ? 0.4924 0.3405 0.3285 -0.0163 0.0556  0.0236  233 ILE A CG2   
1936 C CD1   . ILE A 233 ? 0.4748 0.3334 0.3229 -0.0111 0.0400  0.0223  233 ILE A CD1   
1937 N N     . PHE A 234 ? 0.4519 0.3017 0.3040 -0.0192 0.0579  0.0289  234 PHE A N     
1938 C CA    . PHE A 234 ? 0.4537 0.3052 0.3082 -0.0229 0.0660  0.0286  234 PHE A CA    
1939 C C     . PHE A 234 ? 0.4541 0.3012 0.3091 -0.0259 0.0658  0.0316  234 PHE A C     
1940 O O     . PHE A 234 ? 0.4311 0.2781 0.2854 -0.0304 0.0722  0.0323  234 PHE A O     
1941 C CB    . PHE A 234 ? 0.4394 0.3041 0.3098 -0.0211 0.0699  0.0248  234 PHE A CB    
1942 C CG    . PHE A 234 ? 0.3941 0.2621 0.2641 -0.0180 0.0707  0.0216  234 PHE A CG    
1943 C CD1   . PHE A 234 ? 0.3976 0.2705 0.2750 -0.0141 0.0651  0.0199  234 PHE A CD1   
1944 C CD2   . PHE A 234 ? 0.4712 0.3367 0.3327 -0.0191 0.0775  0.0203  234 PHE A CD2   
1945 C CE1   . PHE A 234 ? 0.4216 0.2957 0.2973 -0.0117 0.0658  0.0170  234 PHE A CE1   
1946 C CE2   . PHE A 234 ? 0.4254 0.2919 0.2852 -0.0160 0.0784  0.0171  234 PHE A CE2   
1947 C CZ    . PHE A 234 ? 0.4194 0.2897 0.2860 -0.0126 0.0723  0.0155  234 PHE A CZ    
1948 N N     . GLY A 235 ? 0.4729 0.3166 0.3294 -0.0235 0.0586  0.0334  235 GLY A N     
1949 C CA    . GLY A 235 ? 0.5157 0.3544 0.3735 -0.0257 0.0580  0.0356  235 GLY A CA    
1950 C C     . GLY A 235 ? 0.5275 0.3756 0.4017 -0.0242 0.0570  0.0332  235 GLY A C     
1951 O O     . GLY A 235 ? 0.5185 0.3779 0.4038 -0.0215 0.0573  0.0299  235 GLY A O     
1952 N N     . GLU A 236 ? 0.5469 0.3888 0.4210 -0.0261 0.0557  0.0350  236 GLU A N     
1953 C CA    . GLU A 236 ? 0.5759 0.4235 0.4626 -0.0251 0.0539  0.0331  236 GLU A CA    
1954 C C     . GLU A 236 ? 0.5690 0.4297 0.4687 -0.0281 0.0591  0.0302  236 GLU A C     
1955 O O     . GLU A 236 ? 0.5600 0.4303 0.4718 -0.0252 0.0572  0.0274  236 GLU A O     
1956 C CB    . GLU A 236 ? 0.6272 0.4623 0.5076 -0.0278 0.0523  0.0358  236 GLU A CB    
1957 C CG    . GLU A 236 ? 0.7183 0.5440 0.5930 -0.0222 0.0452  0.0375  236 GLU A CG    
1958 C CD    . GLU A 236 ? 0.7900 0.6055 0.6629 -0.0234 0.0435  0.0386  236 GLU A CD    
1959 O OE1   . GLU A 236 ? 0.7930 0.6035 0.6628 -0.0304 0.0476  0.0396  236 GLU A OE1   
1960 O OE2   . GLU A 236 ? 0.8132 0.6257 0.6875 -0.0176 0.0382  0.0384  236 GLU A OE2   
1961 N N     . SER A 237 ? 0.5465 0.4078 0.4439 -0.0340 0.0657  0.0310  237 SER A N     
1962 C CA    . SER A 237 ? 0.5103 0.3847 0.4207 -0.0373 0.0706  0.0289  237 SER A CA    
1963 C C     . SER A 237 ? 0.4812 0.3690 0.4020 -0.0326 0.0717  0.0255  237 SER A C     
1964 O O     . SER A 237 ? 0.4383 0.3380 0.3727 -0.0324 0.0726  0.0233  237 SER A O     
1965 C CB    . SER A 237 ? 0.5345 0.4079 0.4401 -0.0446 0.0780  0.0307  237 SER A CB    
1966 O OG    . SER A 237 ? 0.5560 0.4307 0.4554 -0.0439 0.0828  0.0306  237 SER A OG    
1967 N N     . THR A 238 ? 0.4690 0.3539 0.3824 -0.0288 0.0711  0.0252  238 THR A N     
1968 C CA    . THR A 238 ? 0.4388 0.3332 0.3592 -0.0243 0.0718  0.0221  238 THR A CA    
1969 C C     . THR A 238 ? 0.4278 0.3249 0.3551 -0.0196 0.0649  0.0206  238 THR A C     
1970 O O     . THR A 238 ? 0.4412 0.3484 0.3797 -0.0171 0.0649  0.0181  238 THR A O     
1971 C CB    . THR A 238 ? 0.4466 0.3357 0.3551 -0.0230 0.0741  0.0221  238 THR A CB    
1972 O OG1   . THR A 238 ? 0.4414 0.3286 0.3436 -0.0276 0.0813  0.0234  238 THR A OG1   
1973 C CG2   . THR A 238 ? 0.4122 0.3093 0.3266 -0.0184 0.0750  0.0188  238 THR A CG2   
1974 N N     . ALA A 239 ? 0.4186 0.3069 0.3393 -0.0181 0.0592  0.0223  239 ALA A N     
1975 C CA    . ALA A 239 ? 0.4333 0.3244 0.3601 -0.0137 0.0530  0.0211  239 ALA A CA    
1976 C C     . ALA A 239 ? 0.4124 0.3099 0.3510 -0.0146 0.0525  0.0197  239 ALA A C     
1977 O O     . ALA A 239 ? 0.3924 0.2972 0.3397 -0.0115 0.0500  0.0174  239 ALA A O     
1978 C CB    . ALA A 239 ? 0.4222 0.3036 0.3402 -0.0116 0.0474  0.0235  239 ALA A CB    
1979 N N     . LYS A 240 ? 0.3970 0.2912 0.3350 -0.0194 0.0549  0.0210  240 LYS A N     
1980 C CA    . LYS A 240 ? 0.4239 0.3231 0.3717 -0.0216 0.0544  0.0198  240 LYS A CA    
1981 C C     . LYS A 240 ? 0.4008 0.3146 0.3613 -0.0222 0.0577  0.0175  240 LYS A C     
1982 O O     . LYS A 240 ? 0.3855 0.3051 0.3550 -0.0238 0.0566  0.0163  240 LYS A O     
1983 C CB    . LYS A 240 ? 0.4549 0.3454 0.3972 -0.0276 0.0559  0.0221  240 LYS A CB    
1984 C CG    . LYS A 240 ? 0.4791 0.3544 0.4099 -0.0260 0.0516  0.0244  240 LYS A CG    
1985 C CD    . LYS A 240 ? 0.5934 0.4578 0.5159 -0.0326 0.0540  0.0270  240 LYS A CD    
1986 C CE    . LYS A 240 ? 0.6338 0.4813 0.5439 -0.0306 0.0497  0.0295  240 LYS A CE    
1987 N NZ    . LYS A 240 ? 0.6811 0.5252 0.5945 -0.0283 0.0455  0.0281  240 LYS A NZ    
1988 N N     . ARG A 241 ? 0.3901 0.3091 0.3509 -0.0204 0.0613  0.0167  241 ARG A N     
1989 C CA    . ARG A 241 ? 0.3709 0.3033 0.3435 -0.0191 0.0639  0.0145  241 ARG A CA    
1990 C C     . ARG A 241 ? 0.3909 0.3284 0.3706 -0.0143 0.0591  0.0123  241 ARG A C     
1991 O O     . ARG A 241 ? 0.4004 0.3484 0.3904 -0.0128 0.0599  0.0106  241 ARG A O     
1992 C CB    . ARG A 241 ? 0.3840 0.3188 0.3535 -0.0179 0.0696  0.0141  241 ARG A CB    
1993 C CG    . ARG A 241 ? 0.3548 0.2883 0.3200 -0.0235 0.0760  0.0160  241 ARG A CG    
1994 C CD    . ARG A 241 ? 0.3665 0.3009 0.3265 -0.0219 0.0820  0.0154  241 ARG A CD    
1995 N NE    . ARG A 241 ? 0.3773 0.3236 0.3481 -0.0175 0.0844  0.0128  241 ARG A NE    
1996 C CZ    . ARG A 241 ? 0.4319 0.3775 0.3983 -0.0132 0.0874  0.0112  241 ARG A CZ    
1997 N NH1   . ARG A 241 ? 0.4529 0.3869 0.4042 -0.0133 0.0883  0.0118  241 ARG A NH1   
1998 N NH2   . ARG A 241 ? 0.4009 0.3564 0.3771 -0.0087 0.0892  0.0090  241 ARG A NH2   
1999 N N     . LEU A 242 ? 0.3997 0.3299 0.3739 -0.0118 0.0540  0.0125  242 LEU A N     
2000 C CA    . LEU A 242 ? 0.3841 0.3183 0.3640 -0.0081 0.0494  0.0107  242 LEU A CA    
2001 C C     . LEU A 242 ? 0.3760 0.3142 0.3640 -0.0102 0.0474  0.0100  242 LEU A C     
2002 O O     . LEU A 242 ? 0.3560 0.2999 0.3506 -0.0080 0.0447  0.0083  242 LEU A O     
2003 C CB    . LEU A 242 ? 0.3828 0.3098 0.3553 -0.0051 0.0449  0.0112  242 LEU A CB    
2004 C CG    . LEU A 242 ? 0.3524 0.2758 0.3166 -0.0032 0.0454  0.0117  242 LEU A CG    
2005 C CD1   . LEU A 242 ? 0.3908 0.3076 0.3481 -0.0014 0.0407  0.0130  242 LEU A CD1   
2006 C CD2   . LEU A 242 ? 0.3342 0.2639 0.3025 -0.0004 0.0456  0.0095  242 LEU A CD2   
2007 N N     . SER A 243 ? 0.3535 0.2875 0.3396 -0.0149 0.0486  0.0113  243 SER A N     
2008 C CA    . SER A 243 ? 0.3675 0.3047 0.3602 -0.0183 0.0472  0.0107  243 SER A CA    
2009 C C     . SER A 243 ? 0.3677 0.3154 0.3689 -0.0224 0.0513  0.0107  243 SER A C     
2010 O O     . SER A 243 ? 0.4051 0.3522 0.4034 -0.0254 0.0559  0.0122  243 SER A O     
2011 C CB    . SER A 243 ? 0.3672 0.2922 0.3518 -0.0216 0.0458  0.0121  243 SER A CB    
2012 O OG    . SER A 243 ? 0.3479 0.2752 0.3373 -0.0273 0.0460  0.0119  243 SER A OG    
2013 N N     . PRO A 244 ? 0.3610 0.3189 0.3728 -0.0227 0.0496  0.0093  244 PRO A N     
2014 C CA    . PRO A 244 ? 0.3775 0.3479 0.3994 -0.0263 0.0532  0.0095  244 PRO A CA    
2015 C C     . PRO A 244 ? 0.3780 0.3462 0.3987 -0.0344 0.0550  0.0111  244 PRO A C     
2016 O O     . PRO A 244 ? 0.3939 0.3723 0.4216 -0.0382 0.0592  0.0118  244 PRO A O     
2017 C CB    . PRO A 244 ? 0.3635 0.3437 0.3957 -0.0246 0.0493  0.0078  244 PRO A CB    
2018 C CG    . PRO A 244 ? 0.4050 0.3755 0.4311 -0.0230 0.0440  0.0068  244 PRO A CG    
2019 C CD    . PRO A 244 ? 0.3791 0.3388 0.3945 -0.0194 0.0446  0.0074  244 PRO A CD    
2020 N N     . HIS A 245 ? 0.3758 0.3307 0.3875 -0.0371 0.0522  0.0116  245 HIS A N     
2021 C CA    . HIS A 245 ? 0.3958 0.3453 0.4036 -0.0453 0.0539  0.0133  245 HIS A CA    
2022 C C     . HIS A 245 ? 0.3991 0.3349 0.3937 -0.0460 0.0565  0.0155  245 HIS A C     
2023 O O     . HIS A 245 ? 0.4033 0.3298 0.3908 -0.0524 0.0574  0.0173  245 HIS A O     
2024 C CB    . HIS A 245 ? 0.3742 0.3167 0.3801 -0.0486 0.0490  0.0124  245 HIS A CB    
2025 C CG    . HIS A 245 ? 0.3625 0.3153 0.3783 -0.0462 0.0451  0.0101  245 HIS A CG    
2026 N ND1   . HIS A 245 ? 0.3742 0.3440 0.4032 -0.0483 0.0460  0.0098  245 HIS A ND1   
2027 C CD2   . HIS A 245 ? 0.3359 0.2848 0.3502 -0.0416 0.0404  0.0082  245 HIS A CD2   
2028 C CE1   . HIS A 245 ? 0.3949 0.3697 0.4293 -0.0453 0.0415  0.0079  245 HIS A CE1   
2029 N NE2   . HIS A 245 ? 0.3681 0.3301 0.3934 -0.0415 0.0384  0.0068  245 HIS A NE2   
2030 N N     . ARG A 246 ? 0.3789 0.3129 0.3694 -0.0397 0.0573  0.0155  246 ARG A N     
2031 C CA    . ARG A 246 ? 0.4431 0.3648 0.4206 -0.0394 0.0592  0.0177  246 ARG A CA    
2032 C C     . ARG A 246 ? 0.4391 0.3438 0.4052 -0.0399 0.0553  0.0189  246 ARG A C     
2033 O O     . ARG A 246 ? 0.4336 0.3266 0.3883 -0.0420 0.0566  0.0214  246 ARG A O     
2034 C CB    . ARG A 246 ? 0.4757 0.4003 0.4520 -0.0456 0.0657  0.0196  246 ARG A CB    
2035 C CG    . ARG A 246 ? 0.5193 0.4613 0.5072 -0.0447 0.0707  0.0185  246 ARG A CG    
2036 C CD    . ARG A 246 ? 0.5451 0.4887 0.5317 -0.0367 0.0709  0.0171  246 ARG A CD    
2037 N NE    . ARG A 246 ? 0.5498 0.5078 0.5457 -0.0352 0.0762  0.0160  246 ARG A NE    
2038 C CZ    . ARG A 246 ? 0.5708 0.5400 0.5776 -0.0302 0.0749  0.0139  246 ARG A CZ    
2039 N NH1   . ARG A 246 ? 0.5197 0.4877 0.5291 -0.0269 0.0686  0.0125  246 ARG A NH1   
2040 N NH2   . ARG A 246 ? 0.5904 0.5716 0.6049 -0.0284 0.0801  0.0131  246 ARG A NH2   
2041 N N     . LYS A 247 ? 0.4466 0.3495 0.4151 -0.0376 0.0505  0.0172  247 LYS A N     
2042 C CA    . LYS A 247 ? 0.4844 0.3713 0.4425 -0.0364 0.0468  0.0180  247 LYS A CA    
2043 C C     . LYS A 247 ? 0.4884 0.3742 0.4460 -0.0279 0.0427  0.0166  247 LYS A C