data_3SPZ
# 
_entry.id   3SPZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3SPZ         
NDB   NA1204       
RCSB  RCSB066508   
WWPDB D_1000066508 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3SPY 'RB69 DNA Polymerase(L415A/L561A/S565G/Y567A) Ternary Complex with dUpCpp Opposite dA'  unspecified 
PDB 3SQ0 'RB69 DNA Polymerase(L561A/S565G/Y567A) Ternary Complex with dUpNpp Opposite dA (Mn2+)' unspecified 
PDB 3SQ1 'RB69 DNA Polymerase Ternary Complex with dUpCpp Opposite dA'                           unspecified 
PDB 3SQ2 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (AT rich sequence)'         unspecified 
PDB 3SQ4 'RB69 DNA Polymerase Ternary Complex with dTTP Opposite 2AP (GC rich sequence)'         unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3SPZ 
_pdbx_database_status.recvd_initial_deposition_date   2011-07-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xia, S.'          1 
'Konigsberg, W.H.' 2 
'Wang, J.'         3 
# 
_citation.id                        primary 
_citation.title                     
'Structural Insights into Complete Metal Ion Coordination from Ternary Complexes of B Family RB69 DNA Polymerase.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            50 
_citation.page_first                9114 
_citation.page_last                 9124 
_citation.year                      2011 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21923197 
_citation.pdbx_database_id_DOI      10.1021/bi201260h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Xia, S.'          1 
primary 'Wang, M.'         2 
primary 'Blaha, G.'        3 
primary 'Konigsberg, W.H.' 4 
primary 'Wang, J.'         5 
# 
_cell.entry_id           3SPZ 
_cell.length_a           78.168 
_cell.length_b           119.064 
_cell.length_c           130.208 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3SPZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase'                                                                            104448.867 1   
2.7.7.7 'L415A, L561A, S565G, Y567A' ? ?        
2 polymer     syn "5'-D(P*GP*AP*GP*TP*AP*AP*GP*CP*AP*GP*TP*CP*CP*GP*CP*G)-3'"                                 4948.217   1   ? ? ? 
template 
3 polymer     syn "5'-D(*GP*CP*GP*GP*AP*CP*TP*GP*CP*TP*TP*AP*C)-3'"                                           3967.585   1   ? ? ? 
primer   
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]uridine" 466.169    1   ? ? ? 
?        
5 non-polymer syn 'CALCIUM ION'                                                                               40.078     4   ? ? ? 
?        
6 water       nat water                                                                                       18.015     229 ? ? ? 
?        
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Gp43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSAYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFAIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIAVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSAYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
ALINGLAGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
A ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DT)(DA)(DA)(DG)(DC)(DA)(DG)(DT)(DC)(DC)(DG)(DC)(DG)' GAGTAAGCAGTCCGCG T ? 
3 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DG)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DA)(DC)' GCGGACTGCTTAC P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   GLU n 
1 4   PHE n 
1 5   TYR n 
1 6   LEU n 
1 7   THR n 
1 8   VAL n 
1 9   GLU n 
1 10  GLN n 
1 11  ILE n 
1 12  GLY n 
1 13  ASP n 
1 14  SER n 
1 15  ILE n 
1 16  PHE n 
1 17  GLU n 
1 18  ARG n 
1 19  TYR n 
1 20  ILE n 
1 21  ASP n 
1 22  SER n 
1 23  ASN n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  VAL n 
1 32  GLU n 
1 33  TYR n 
1 34  LYS n 
1 35  PRO n 
1 36  SER n 
1 37  LEU n 
1 38  PHE n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  PRO n 
1 43  GLU n 
1 44  SER n 
1 45  GLN n 
1 46  ALA n 
1 47  THR n 
1 48  LYS n 
1 49  TYR n 
1 50  PHE n 
1 51  ASP n 
1 52  ILE n 
1 53  TYR n 
1 54  GLY n 
1 55  LYS n 
1 56  PRO n 
1 57  CYS n 
1 58  THR n 
1 59  ARG n 
1 60  LYS n 
1 61  LEU n 
1 62  PHE n 
1 63  ALA n 
1 64  ASN n 
1 65  MET n 
1 66  ARG n 
1 67  ASP n 
1 68  ALA n 
1 69  SER n 
1 70  GLN n 
1 71  TRP n 
1 72  ILE n 
1 73  LYS n 
1 74  ARG n 
1 75  MET n 
1 76  GLU n 
1 77  ASP n 
1 78  ILE n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  LEU n 
1 84  GLY n 
1 85  MET n 
1 86  ASP n 
1 87  ASP n 
1 88  PHE n 
1 89  LYS n 
1 90  LEU n 
1 91  ALA n 
1 92  TYR n 
1 93  LEU n 
1 94  SER n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLU n 
1 101 ILE n 
1 102 LYS n 
1 103 TYR n 
1 104 ASP n 
1 105 HIS n 
1 106 THR n 
1 107 LYS n 
1 108 ILE n 
1 109 ARG n 
1 110 VAL n 
1 111 ALA n 
1 112 ASN n 
1 113 PHE n 
1 114 ASP n 
1 115 ILE n 
1 116 GLU n 
1 117 VAL n 
1 118 THR n 
1 119 SER n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 PHE n 
1 124 PRO n 
1 125 GLU n 
1 126 PRO n 
1 127 SER n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 HIS n 
1 132 PRO n 
1 133 ILE n 
1 134 ASP n 
1 135 ALA n 
1 136 ILE n 
1 137 THR n 
1 138 HIS n 
1 139 TYR n 
1 140 ASP n 
1 141 SER n 
1 142 ILE n 
1 143 ASP n 
1 144 ASP n 
1 145 ARG n 
1 146 PHE n 
1 147 TYR n 
1 148 VAL n 
1 149 PHE n 
1 150 ASP n 
1 151 LEU n 
1 152 LEU n 
1 153 ASN n 
1 154 SER n 
1 155 PRO n 
1 156 TYR n 
1 157 GLY n 
1 158 ASN n 
1 159 VAL n 
1 160 GLU n 
1 161 GLU n 
1 162 TRP n 
1 163 SER n 
1 164 ILE n 
1 165 GLU n 
1 166 ILE n 
1 167 ALA n 
1 168 ALA n 
1 169 LYS n 
1 170 LEU n 
1 171 GLN n 
1 172 GLU n 
1 173 GLN n 
1 174 GLY n 
1 175 GLY n 
1 176 ASP n 
1 177 GLU n 
1 178 VAL n 
1 179 PRO n 
1 180 SER n 
1 181 GLU n 
1 182 ILE n 
1 183 ILE n 
1 184 ASP n 
1 185 LYS n 
1 186 ILE n 
1 187 ILE n 
1 188 TYR n 
1 189 MET n 
1 190 PRO n 
1 191 PHE n 
1 192 ASP n 
1 193 ASN n 
1 194 GLU n 
1 195 LYS n 
1 196 GLU n 
1 197 LEU n 
1 198 LEU n 
1 199 MET n 
1 200 GLU n 
1 201 TYR n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 TRP n 
1 206 GLN n 
1 207 GLN n 
1 208 LYS n 
1 209 THR n 
1 210 PRO n 
1 211 VAL n 
1 212 ILE n 
1 213 LEU n 
1 214 THR n 
1 215 GLY n 
1 216 TRP n 
1 217 ASN n 
1 218 VAL n 
1 219 GLU n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 ILE n 
1 224 PRO n 
1 225 TYR n 
1 226 VAL n 
1 227 TYR n 
1 228 ASN n 
1 229 ARG n 
1 230 ILE n 
1 231 LYS n 
1 232 ASN n 
1 233 ILE n 
1 234 PHE n 
1 235 GLY n 
1 236 GLU n 
1 237 SER n 
1 238 THR n 
1 239 ALA n 
1 240 LYS n 
1 241 ARG n 
1 242 LEU n 
1 243 SER n 
1 244 PRO n 
1 245 HIS n 
1 246 ARG n 
1 247 LYS n 
1 248 THR n 
1 249 ARG n 
1 250 VAL n 
1 251 LYS n 
1 252 VAL n 
1 253 ILE n 
1 254 GLU n 
1 255 ASN n 
1 256 MET n 
1 257 TYR n 
1 258 GLY n 
1 259 SER n 
1 260 ARG n 
1 261 GLU n 
1 262 ILE n 
1 263 ILE n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 GLY n 
1 268 ILE n 
1 269 SER n 
1 270 VAL n 
1 271 LEU n 
1 272 ASP n 
1 273 TYR n 
1 274 ILE n 
1 275 ASP n 
1 276 LEU n 
1 277 TYR n 
1 278 LYS n 
1 279 LYS n 
1 280 PHE n 
1 281 SER n 
1 282 PHE n 
1 283 THR n 
1 284 ASN n 
1 285 GLN n 
1 286 PRO n 
1 287 SER n 
1 288 TYR n 
1 289 SER n 
1 290 LEU n 
1 291 ASP n 
1 292 TYR n 
1 293 ILE n 
1 294 SER n 
1 295 GLU n 
1 296 PHE n 
1 297 GLU n 
1 298 LEU n 
1 299 ASN n 
1 300 VAL n 
1 301 GLY n 
1 302 LYS n 
1 303 LEU n 
1 304 LYS n 
1 305 TYR n 
1 306 ASP n 
1 307 GLY n 
1 308 PRO n 
1 309 ILE n 
1 310 SER n 
1 311 LYS n 
1 312 LEU n 
1 313 ARG n 
1 314 GLU n 
1 315 SER n 
1 316 ASN n 
1 317 HIS n 
1 318 GLN n 
1 319 ARG n 
1 320 TYR n 
1 321 ILE n 
1 322 SER n 
1 323 TYR n 
1 324 ASN n 
1 325 ILE n 
1 326 ILE n 
1 327 ALA n 
1 328 VAL n 
1 329 TYR n 
1 330 ARG n 
1 331 VAL n 
1 332 LEU n 
1 333 GLN n 
1 334 ILE n 
1 335 ASP n 
1 336 ALA n 
1 337 LYS n 
1 338 ARG n 
1 339 GLN n 
1 340 PHE n 
1 341 ILE n 
1 342 ASN n 
1 343 LEU n 
1 344 SER n 
1 345 LEU n 
1 346 ASP n 
1 347 MET n 
1 348 GLY n 
1 349 TYR n 
1 350 TYR n 
1 351 ALA n 
1 352 LYS n 
1 353 ILE n 
1 354 GLN n 
1 355 ILE n 
1 356 GLN n 
1 357 SER n 
1 358 VAL n 
1 359 PHE n 
1 360 SER n 
1 361 PRO n 
1 362 ILE n 
1 363 LYS n 
1 364 THR n 
1 365 TRP n 
1 366 ASP n 
1 367 ALA n 
1 368 ILE n 
1 369 ILE n 
1 370 PHE n 
1 371 ASN n 
1 372 SER n 
1 373 LEU n 
1 374 LYS n 
1 375 GLU n 
1 376 GLN n 
1 377 ASN n 
1 378 LYS n 
1 379 VAL n 
1 380 ILE n 
1 381 PRO n 
1 382 GLN n 
1 383 GLY n 
1 384 ARG n 
1 385 SER n 
1 386 HIS n 
1 387 PRO n 
1 388 VAL n 
1 389 GLN n 
1 390 PRO n 
1 391 TYR n 
1 392 PRO n 
1 393 GLY n 
1 394 ALA n 
1 395 PHE n 
1 396 VAL n 
1 397 LYS n 
1 398 GLU n 
1 399 PRO n 
1 400 ILE n 
1 401 PRO n 
1 402 ASN n 
1 403 ARG n 
1 404 TYR n 
1 405 LYS n 
1 406 TYR n 
1 407 VAL n 
1 408 MET n 
1 409 SER n 
1 410 PHE n 
1 411 ASP n 
1 412 LEU n 
1 413 THR n 
1 414 SER n 
1 415 ALA n 
1 416 TYR n 
1 417 PRO n 
1 418 SER n 
1 419 ILE n 
1 420 ILE n 
1 421 ARG n 
1 422 GLN n 
1 423 VAL n 
1 424 ASN n 
1 425 ILE n 
1 426 SER n 
1 427 PRO n 
1 428 GLU n 
1 429 THR n 
1 430 ILE n 
1 431 ALA n 
1 432 GLY n 
1 433 THR n 
1 434 PHE n 
1 435 LYS n 
1 436 VAL n 
1 437 ALA n 
1 438 PRO n 
1 439 LEU n 
1 440 HIS n 
1 441 ASP n 
1 442 TYR n 
1 443 ILE n 
1 444 ASN n 
1 445 ALA n 
1 446 VAL n 
1 447 ALA n 
1 448 GLU n 
1 449 ARG n 
1 450 PRO n 
1 451 SER n 
1 452 ASP n 
1 453 VAL n 
1 454 TYR n 
1 455 SER n 
1 456 CYS n 
1 457 SER n 
1 458 PRO n 
1 459 ASN n 
1 460 GLY n 
1 461 MET n 
1 462 MET n 
1 463 TYR n 
1 464 TYR n 
1 465 LYS n 
1 466 ASP n 
1 467 ARG n 
1 468 ASP n 
1 469 GLY n 
1 470 VAL n 
1 471 VAL n 
1 472 PRO n 
1 473 THR n 
1 474 GLU n 
1 475 ILE n 
1 476 THR n 
1 477 LYS n 
1 478 VAL n 
1 479 PHE n 
1 480 ASN n 
1 481 GLN n 
1 482 ARG n 
1 483 LYS n 
1 484 GLU n 
1 485 HIS n 
1 486 LYS n 
1 487 GLY n 
1 488 TYR n 
1 489 MET n 
1 490 LEU n 
1 491 ALA n 
1 492 ALA n 
1 493 GLN n 
1 494 ARG n 
1 495 ASN n 
1 496 GLY n 
1 497 GLU n 
1 498 ILE n 
1 499 ILE n 
1 500 LYS n 
1 501 GLU n 
1 502 ALA n 
1 503 LEU n 
1 504 HIS n 
1 505 ASN n 
1 506 PRO n 
1 507 ASN n 
1 508 LEU n 
1 509 SER n 
1 510 VAL n 
1 511 ASP n 
1 512 GLU n 
1 513 PRO n 
1 514 LEU n 
1 515 ASP n 
1 516 VAL n 
1 517 ASP n 
1 518 TYR n 
1 519 ARG n 
1 520 PHE n 
1 521 ASP n 
1 522 PHE n 
1 523 SER n 
1 524 ASP n 
1 525 GLU n 
1 526 ILE n 
1 527 LYS n 
1 528 GLU n 
1 529 LYS n 
1 530 ILE n 
1 531 LYS n 
1 532 LYS n 
1 533 LEU n 
1 534 SER n 
1 535 ALA n 
1 536 LYS n 
1 537 SER n 
1 538 LEU n 
1 539 ASN n 
1 540 GLU n 
1 541 MET n 
1 542 LEU n 
1 543 PHE n 
1 544 ARG n 
1 545 ALA n 
1 546 GLN n 
1 547 ARG n 
1 548 THR n 
1 549 GLU n 
1 550 VAL n 
1 551 ALA n 
1 552 GLY n 
1 553 MET n 
1 554 THR n 
1 555 ALA n 
1 556 GLN n 
1 557 ILE n 
1 558 ASN n 
1 559 ARG n 
1 560 LYS n 
1 561 ALA n 
1 562 LEU n 
1 563 ILE n 
1 564 ASN n 
1 565 GLY n 
1 566 LEU n 
1 567 ALA n 
1 568 GLY n 
1 569 ALA n 
1 570 LEU n 
1 571 GLY n 
1 572 ASN n 
1 573 VAL n 
1 574 TRP n 
1 575 PHE n 
1 576 ARG n 
1 577 TYR n 
1 578 TYR n 
1 579 ASP n 
1 580 LEU n 
1 581 ARG n 
1 582 ASN n 
1 583 ALA n 
1 584 THR n 
1 585 ALA n 
1 586 ILE n 
1 587 THR n 
1 588 THR n 
1 589 PHE n 
1 590 GLY n 
1 591 GLN n 
1 592 MET n 
1 593 ALA n 
1 594 LEU n 
1 595 GLN n 
1 596 TRP n 
1 597 ILE n 
1 598 GLU n 
1 599 ARG n 
1 600 LYS n 
1 601 VAL n 
1 602 ASN n 
1 603 GLU n 
1 604 TYR n 
1 605 LEU n 
1 606 ASN n 
1 607 GLU n 
1 608 VAL n 
1 609 CYS n 
1 610 GLY n 
1 611 THR n 
1 612 GLU n 
1 613 GLY n 
1 614 GLU n 
1 615 ALA n 
1 616 PHE n 
1 617 VAL n 
1 618 LEU n 
1 619 TYR n 
1 620 GLY n 
1 621 ASP n 
1 622 THR n 
1 623 ASP n 
1 624 SER n 
1 625 ILE n 
1 626 TYR n 
1 627 VAL n 
1 628 SER n 
1 629 ALA n 
1 630 ASP n 
1 631 LYS n 
1 632 ILE n 
1 633 ILE n 
1 634 ASP n 
1 635 LYS n 
1 636 VAL n 
1 637 GLY n 
1 638 GLU n 
1 639 SER n 
1 640 LYS n 
1 641 PHE n 
1 642 ARG n 
1 643 ASP n 
1 644 THR n 
1 645 ASN n 
1 646 HIS n 
1 647 TRP n 
1 648 VAL n 
1 649 ASP n 
1 650 PHE n 
1 651 LEU n 
1 652 ASP n 
1 653 LYS n 
1 654 PHE n 
1 655 ALA n 
1 656 ARG n 
1 657 GLU n 
1 658 ARG n 
1 659 MET n 
1 660 GLU n 
1 661 PRO n 
1 662 ALA n 
1 663 ILE n 
1 664 ASP n 
1 665 ARG n 
1 666 GLY n 
1 667 PHE n 
1 668 ARG n 
1 669 GLU n 
1 670 MET n 
1 671 CYS n 
1 672 GLU n 
1 673 TYR n 
1 674 MET n 
1 675 ASN n 
1 676 ASN n 
1 677 LYS n 
1 678 GLN n 
1 679 HIS n 
1 680 LEU n 
1 681 MET n 
1 682 PHE n 
1 683 MET n 
1 684 ASP n 
1 685 ARG n 
1 686 GLU n 
1 687 ALA n 
1 688 ILE n 
1 689 ALA n 
1 690 GLY n 
1 691 PRO n 
1 692 PRO n 
1 693 LEU n 
1 694 GLY n 
1 695 SER n 
1 696 LYS n 
1 697 GLY n 
1 698 ILE n 
1 699 GLY n 
1 700 GLY n 
1 701 PHE n 
1 702 TRP n 
1 703 THR n 
1 704 GLY n 
1 705 LYS n 
1 706 LYS n 
1 707 ARG n 
1 708 TYR n 
1 709 ALA n 
1 710 LEU n 
1 711 ASN n 
1 712 VAL n 
1 713 TRP n 
1 714 ASP n 
1 715 MET n 
1 716 GLU n 
1 717 GLY n 
1 718 THR n 
1 719 ARG n 
1 720 TYR n 
1 721 ALA n 
1 722 GLU n 
1 723 PRO n 
1 724 LYS n 
1 725 LEU n 
1 726 LYS n 
1 727 ILE n 
1 728 MET n 
1 729 GLY n 
1 730 LEU n 
1 731 GLU n 
1 732 THR n 
1 733 GLN n 
1 734 LYS n 
1 735 SER n 
1 736 SER n 
1 737 THR n 
1 738 PRO n 
1 739 LYS n 
1 740 ALA n 
1 741 VAL n 
1 742 GLN n 
1 743 LYS n 
1 744 ALA n 
1 745 LEU n 
1 746 LYS n 
1 747 GLU n 
1 748 CYS n 
1 749 ILE n 
1 750 ARG n 
1 751 ARG n 
1 752 MET n 
1 753 LEU n 
1 754 GLN n 
1 755 GLU n 
1 756 GLY n 
1 757 GLU n 
1 758 GLU n 
1 759 SER n 
1 760 LEU n 
1 761 GLN n 
1 762 GLU n 
1 763 TYR n 
1 764 PHE n 
1 765 LYS n 
1 766 GLU n 
1 767 PHE n 
1 768 GLU n 
1 769 LYS n 
1 770 GLU n 
1 771 PHE n 
1 772 ARG n 
1 773 GLN n 
1 774 LEU n 
1 775 ASN n 
1 776 TYR n 
1 777 ILE n 
1 778 SER n 
1 779 ILE n 
1 780 ALA n 
1 781 SER n 
1 782 VAL n 
1 783 SER n 
1 784 SER n 
1 785 ALA n 
1 786 ASN n 
1 787 ASN n 
1 788 ILE n 
1 789 ALA n 
1 790 LYS n 
1 791 TYR n 
1 792 ASP n 
1 793 VAL n 
1 794 GLY n 
1 795 GLY n 
1 796 PHE n 
1 797 PRO n 
1 798 GLY n 
1 799 PRO n 
1 800 LYS n 
1 801 CYS n 
1 802 PRO n 
1 803 PHE n 
1 804 HIS n 
1 805 ILE n 
1 806 ARG n 
1 807 GLY n 
1 808 ILE n 
1 809 LEU n 
1 810 THR n 
1 811 TYR n 
1 812 ASN n 
1 813 ARG n 
1 814 ALA n 
1 815 ILE n 
1 816 LYS n 
1 817 GLY n 
1 818 ASN n 
1 819 ILE n 
1 820 ASP n 
1 821 ALA n 
1 822 PRO n 
1 823 GLN n 
1 824 VAL n 
1 825 VAL n 
1 826 GLU n 
1 827 GLY n 
1 828 GLU n 
1 829 LYS n 
1 830 VAL n 
1 831 TYR n 
1 832 VAL n 
1 833 LEU n 
1 834 PRO n 
1 835 LEU n 
1 836 ARG n 
1 837 GLU n 
1 838 GLY n 
1 839 ASN n 
1 840 PRO n 
1 841 PHE n 
1 842 GLY n 
1 843 ASP n 
1 844 LYS n 
1 845 CYS n 
1 846 ILE n 
1 847 ALA n 
1 848 TRP n 
1 849 PRO n 
1 850 SER n 
1 851 GLY n 
1 852 THR n 
1 853 GLU n 
1 854 ILE n 
1 855 THR n 
1 856 ASP n 
1 857 LEU n 
1 858 ILE n 
1 859 LYS n 
1 860 ASP n 
1 861 ASP n 
1 862 VAL n 
1 863 LEU n 
1 864 HIS n 
1 865 TRP n 
1 866 MET n 
1 867 ASP n 
1 868 TYR n 
1 869 THR n 
1 870 VAL n 
1 871 LEU n 
1 872 LEU n 
1 873 GLU n 
1 874 LYS n 
1 875 THR n 
1 876 PHE n 
1 877 ILE n 
1 878 LYS n 
1 879 PRO n 
1 880 LEU n 
1 881 GLU n 
1 882 GLY n 
1 883 PHE n 
1 884 THR n 
1 885 SER n 
1 886 ALA n 
1 887 ALA n 
1 888 LYS n 
1 889 LEU n 
1 890 ASP n 
1 891 TYR n 
1 892 GLU n 
1 893 LYS n 
1 894 LYS n 
1 895 ALA n 
1 896 SER n 
1 897 LEU n 
1 898 PHE n 
1 899 ASP n 
1 900 MET n 
1 901 PHE n 
1 902 ASP n 
1 903 PHE n 
2 1   DG  n 
2 2   DA  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DA  n 
2 7   DG  n 
2 8   DC  n 
2 9   DA  n 
2 10  DG  n 
2 11  DT  n 
2 12  DC  n 
2 13  DC  n 
2 14  DG  n 
2 15  DC  n 
2 16  DG  n 
3 1   DG  n 
3 2   DC  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   DC  n 
3 7   DT  n 
3 8   DG  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 43 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage RB69' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12353 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOL_BPR69 Q38087 1 
;MKEFYLTVEQIGDSIFERYIDSNGRERTREVEYKPSLFAHCPESQATKYFDIYGKPCTRKLFANMRDASQWIKRMEDIGL
EALGMDDFKLAYLSDTYNYEIKYDHTKIRVANFDIEVTSPDGFPEPSQAKHPIDAITHYDSIDDRFYVFDLLNSPYGNVE
EWSIEIAAKLQEQGGDEVPSEIIDKIIYMPFDNEKELLMEYLNFWQQKTPVILTGWNVESFDIPYVYNRIKNIFGESTAK
RLSPHRKTRVKVIENMYGSREIITLFGISVLDYIDLYKKFSFTNQPSYSLDYISEFELNVGKLKYDGPISKLRESNHQRY
ISYNIIDVYRVLQIDAKRQFINLSLDMGYYAKIQIQSVFSPIKTWDAIIFNSLKEQNKVIPQGRSHPVQPYPGAFVKEPI
PNRYKYVMSFDLTSLYPSIIRQVNISPETIAGTFKVAPLHDYINAVAERPSDVYSCSPNGMMYYKDRDGVVPTEITKVFN
QRKEHKGYMLAAQRNGEIIKEALHNPNLSVDEPLDVDYRFDFSDEIKEKIKKLSAKSLNEMLFRAQRTEVAGMTAQINRK
LLINSLYGALGNVWFRYYDLRNATAITTFGQMALQWIERKVNEYLNEVCGTEGEAFVLYGDTDSIYVSADKIIDKVGESK
FRDTNHWVDFLDKFARERMEPAIDRGFREMCEYMNNKQHLMFMDREAIAGPPLGSKGIGGFWTGKKRYALNVWDMEGTRY
AEPKLKIMGLETQKSSTPKAVQKALKECIRRMLQEGEESLQEYFKEFEKEFRQLNYISIASVSSANNIAKYDVGGFPGPK
CPFHIRGILTYNRAIKGNIDAPQVVEGEKVYVLPLREGNPFGDKCIAWPSGTEITDLIKDDVLHWMDYTVLLEKTFIKPL
EGFTSAAKLDYEKKASLFDMFDF
;
1 ? 
2 PDB 3SPZ       3SPZ   2 GAGTAAGCAGTCCGCG ? ? 
3 PDB 3SPZ       3SPZ   3 GCGGACTGCTTAC ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3SPZ A 1 ? 903 ? Q38087 1   ? 903 ? 1   903 
2 2 3SPZ T 1 ? 16  ? 3SPZ   3   ? 18  ? 3   18  
3 3 3SPZ P 1 ? 13  ? 3SPZ   103 ? 115 ? 103 115 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3SPZ ALA A 222 ? UNP Q38087 ASP 222 'ENGINEERED MUTATION' 222 1 
1 3SPZ ALA A 327 ? UNP Q38087 ASP 327 'ENGINEERED MUTATION' 327 2 
1 3SPZ ALA A 415 ? UNP Q38087 LEU 415 'ENGINEERED MUTATION' 415 3 
1 3SPZ ALA A 561 ? UNP Q38087 LEU 561 'ENGINEERED MUTATION' 561 4 
1 3SPZ GLY A 565 ? UNP Q38087 SER 565 'ENGINEERED MUTATION' 565 5 
1 3SPZ ALA A 567 ? UNP Q38087 TYR 567 'ENGINEERED MUTATION' 567 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                               ? 'Ca 2' 
40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                         ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'       181.189 
UPC non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]methyl}phosphoryl]uridine" ? 
'C10 H17 N2 O13 P3' 466.169 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          3SPZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.67 
_exptl_crystal.density_percent_sol   53.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'150 mM calcium chloride, 15% w/v PEG350 MME, 100 mM sodium cacodylate, pH 6.5, VAPOR DIFFUSION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'APEX II CCD' 
_diffrn_detector.pdbx_collection_date   2011-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.entry_id                     3SPZ 
_reflns.observed_criterion_sigma_I   1.1 
_reflns.observed_criterion_sigma_F   2.2 
_reflns.d_resolution_low             87.87 
_reflns.d_resolution_high            2.43 
_reflns.number_obs                   43626 
_reflns.number_all                   46149 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.43 
_reflns_shell.d_res_low              2.52 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3SPZ 
_refine.ls_number_reflns_obs                     43626 
_refine.ls_number_reflns_all                     46149 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             87.87 
_refine.ls_d_res_high                            2.43 
_refine.ls_percent_reflns_obs                    99.18 
_refine.ls_R_factor_obs                          0.20288 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20007 
_refine.ls_R_factor_R_free                       0.25650 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2326 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.911 
_refine.B_iso_mean                               39.841 
_refine.aniso_B[1][1]                            0.51 
_refine.aniso_B[2][2]                            -0.14 
_refine.aniso_B[3][3]                            -0.37 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 
U VALUES      : RESIDUAL ONLY
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.276 
_refine.overall_SU_ML                            0.211 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             20.585 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.434 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7359 
_refine_hist.pdbx_number_atoms_nucleic_acid   595 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             229 
_refine_hist.number_atoms_total               8215 
_refine_hist.d_res_high                       2.43 
_refine_hist.d_res_low                        87.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.022  ? 8234  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.169  2.056  ? 11255 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.355  5.000  ? 902   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       35.399 24.171 ? 374   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       15.733 15.000 ? 1342  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       15.430 15.000 ? 46    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.078  0.200  ? 1191  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.021  ? 6091  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.606  4.000  ? 4505  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.829  6.000  ? 7299  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  3.151  6.000  ? 3729  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 4.689  9.000  ? 3956  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.433 
_refine_ls_shell.d_res_low                        2.496 
_refine_ls_shell.number_reflns_R_work             3102 
_refine_ls_shell.R_factor_R_work                  0.268 
_refine_ls_shell.percent_reflns_obs               96.62 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             159 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3SPZ 
_struct.title                     'DNA Polymerase(L415A/L561A/S565G/Y567A) Ternary Complex with dUpCpp Opposite dA (Ca2+)' 
_struct.pdbx_descriptor           'DNA polymerase (E.C.2.7.7.7)/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3SPZ 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'dUpCpp, Quadruple mutant, Ca2+, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 64  ? GLY A 79  ? ASN A 64  GLY A 79  1 ? 16 
HELX_P HELX_P2  2  ASP A 87  ? TYR A 97  ? ASP A 87  TYR A 97  1 ? 11 
HELX_P HELX_P3  3  ASP A 104 ? ILE A 108 ? ASP A 104 ILE A 108 5 ? 5  
HELX_P HELX_P4  4  SER A 163 ? ALA A 168 ? SER A 163 ALA A 168 1 ? 6  
HELX_P HELX_P5  5  LEU A 170 ? GLY A 174 ? LEU A 170 GLY A 174 5 ? 5  
HELX_P HELX_P6  6  PRO A 179 ? ASP A 184 ? PRO A 179 ASP A 184 1 ? 6  
HELX_P HELX_P7  7  ASN A 193 ? LYS A 208 ? ASN A 193 LYS A 208 1 ? 16 
HELX_P HELX_P8  8  PHE A 221 ? GLY A 235 ? PHE A 221 GLY A 235 1 ? 15 
HELX_P HELX_P9  9  GLY A 235 ? LYS A 240 ? GLY A 235 LYS A 240 1 ? 6  
HELX_P HELX_P10 10 ARG A 241 ? SER A 243 ? ARG A 241 SER A 243 5 ? 3  
HELX_P HELX_P11 11 ASP A 272 ? SER A 281 ? ASP A 272 SER A 281 1 ? 10 
HELX_P HELX_P12 12 SER A 289 ? ASN A 299 ? SER A 289 ASN A 299 1 ? 11 
HELX_P HELX_P13 13 PRO A 308 ? ASN A 316 ? PRO A 308 ASN A 316 1 ? 9  
HELX_P HELX_P14 14 ASN A 316 ? GLN A 339 ? ASN A 316 GLN A 339 1 ? 24 
HELX_P HELX_P15 15 GLN A 339 ? LYS A 352 ? GLN A 339 LYS A 352 1 ? 14 
HELX_P HELX_P16 16 GLN A 354 ? PHE A 359 ? GLN A 354 PHE A 359 5 ? 6  
HELX_P HELX_P17 17 SER A 360 ? GLN A 376 ? SER A 360 GLN A 376 1 ? 17 
HELX_P HELX_P18 18 SER A 414 ? ASN A 424 ? SER A 414 ASN A 424 1 ? 11 
HELX_P HELX_P19 19 PRO A 438 ? ASN A 444 ? PRO A 438 ASN A 444 1 ? 7  
HELX_P HELX_P20 20 GLY A 469 ? LEU A 503 ? GLY A 469 LEU A 503 1 ? 35 
HELX_P HELX_P21 21 SER A 523 ? LYS A 531 ? SER A 523 LYS A 531 1 ? 9  
HELX_P HELX_P22 22 SER A 534 ? LEU A 570 ? SER A 534 LEU A 570 1 ? 37 
HELX_P HELX_P23 23 ASP A 579 ? CYS A 609 ? ASP A 579 CYS A 609 1 ? 31 
HELX_P HELX_P24 24 ALA A 629 ? GLY A 637 ? ALA A 629 GLY A 637 1 ? 9  
HELX_P HELX_P25 25 GLU A 638 ? PHE A 641 ? GLU A 638 PHE A 641 5 ? 4  
HELX_P HELX_P26 26 ASP A 643 ? ARG A 658 ? ASP A 643 ARG A 658 1 ? 16 
HELX_P HELX_P27 27 ARG A 658 ? MET A 674 ? ARG A 658 MET A 674 1 ? 17 
HELX_P HELX_P28 28 LEU A 730 ? LYS A 734 ? LEU A 730 LYS A 734 5 ? 5  
HELX_P HELX_P29 29 PRO A 738 ? GLU A 755 ? PRO A 738 GLU A 755 1 ? 18 
HELX_P HELX_P30 30 GLY A 756 ? PHE A 771 ? GLY A 756 PHE A 771 1 ? 16 
HELX_P HELX_P31 31 ARG A 772 ? LEU A 774 ? ARG A 772 LEU A 774 5 ? 3  
HELX_P HELX_P32 32 ASN A 775 ? ALA A 780 ? ASN A 775 ALA A 780 1 ? 6  
HELX_P HELX_P33 33 ILE A 788 ? LYS A 790 ? ILE A 788 LYS A 790 5 ? 3  
HELX_P HELX_P34 34 PRO A 802 ? ILE A 815 ? PRO A 802 ILE A 815 1 ? 14 
HELX_P HELX_P35 35 THR A 855 ? MET A 866 ? THR A 855 MET A 866 1 ? 12 
HELX_P HELX_P36 36 ASP A 867 ? PHE A 876 ? ASP A 867 PHE A 876 1 ? 10 
HELX_P HELX_P37 37 PHE A 876 ? ALA A 887 ? PHE A 876 ALA A 887 1 ? 12 
HELX_P HELX_P38 38 SER A 896 ? PHE A 901 ? SER A 896 PHE A 901 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D UPC .   O1G   ? ? ? 1_555 E CA  .  CA ? ? A UPC 904 A CA  905 1_555 ? ? ? ? ? ? ?            2.189 ? 
metalc2  metalc ? ? A LYS 531 O     ? ? ? 1_555 G CA  .  CA ? ? A LYS 531 A CA  907 1_555 ? ? ? ? ? ? ?            2.211 ? 
metalc3  metalc ? ? A ASN 507 OD1   ? ? ? 1_555 G CA  .  CA ? ? A ASN 507 A CA  907 1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc4  metalc ? ? A ASP 623 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 623 A CA  905 1_555 ? ? ? ? ? ? ?            2.314 ? 
metalc5  metalc ? ? A ASP 411 OD2   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905 1_555 ? ? ? ? ? ? ?            2.355 ? 
metalc6  metalc ? ? A ASN 505 O     ? ? ? 1_555 G CA  .  CA ? ? A ASN 505 A CA  907 1_555 ? ? ? ? ? ? ?            2.387 ? 
metalc7  metalc ? ? D UPC .   O2B   ? ? ? 1_555 E CA  .  CA ? ? A UPC 904 A CA  905 1_555 ? ? ? ? ? ? ?            2.435 ? 
metalc8  metalc ? ? A LEU 412 O     ? ? ? 1_555 E CA  .  CA ? ? A LEU 412 A CA  905 1_555 ? ? ? ? ? ? ?            2.468 ? 
metalc9  metalc ? ? D UPC .   O2A   ? ? ? 1_555 E CA  .  CA ? ? A UPC 904 A CA  905 1_555 ? ? ? ? ? ? ?            2.584 ? 
metalc10 metalc ? ? A GLU 116 OE2   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116 A CA  908 1_555 ? ? ? ? ? ? ?            2.660 ? 
metalc11 metalc ? ? A GLU 116 OE1   ? ? ? 1_555 H CA  .  CA ? ? A GLU 116 A CA  908 1_555 ? ? ? ? ? ? ?            2.804 ? 
metalc12 metalc ? ? A ASP 411 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 411 A CA  906 1_555 ? ? ? ? ? ? ?            2.808 ? 
metalc13 metalc ? ? D UPC .   O2A   ? ? ? 1_555 F CA  .  CA ? ? A UPC 904 A CA  906 1_555 ? ? ? ? ? ? ?            2.827 ? 
metalc14 metalc ? ? C DC  13  "O3'" ? ? ? 1_555 F CA  .  CA ? ? P DC  115 A CA  906 1_555 ? ? ? ? ? ? ?            2.962 ? 
metalc15 metalc ? ? A ASP 411 OD1   ? ? ? 1_555 E CA  .  CA ? ? A ASP 411 A CA  905 1_555 ? ? ? ? ? ? ?            3.091 ? 
metalc16 metalc ? ? A ASP 623 OD2   ? ? ? 1_555 F CA  .  CA ? ? A ASP 623 A CA  906 1_555 ? ? ? ? ? ? ?            3.195 ? 
metalc17 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 922 1_555 ? ? ? ? ? ? ?            2.004 ? 
metalc18 metalc ? ? G CA  .   CA    ? ? ? 1_555 I HOH .  O  ? ? A CA  907 A HOH 920 1_555 ? ? ? ? ? ? ?            2.306 ? 
hydrog1  hydrog ? ? B DG  3   N1    ? ? ? 1_555 C DC  13 N3 ? ? T DG  5   P DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  3   N2    ? ? ? 1_555 C DC  13 O2 ? ? T DG  5   P DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  3   O6    ? ? ? 1_555 C DC  13 N4 ? ? T DG  5   P DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  12 N1 ? ? T DT  6   P DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  12 N6 ? ? T DT  6   P DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  11 N3 ? ? T DA  7   P DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  11 O4 ? ? T DA  7   P DT  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  10 N3 ? ? T DA  8   P DT  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  10 O4 ? ? T DA  8   P DT  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  9  N3 ? ? T DG  9   P DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  9  O2 ? ? T DG  9   P DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  9  N4 ? ? T DG  9   P DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  8   N3    ? ? ? 1_555 C DG  8  N1 ? ? T DC  10  P DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  8   N4    ? ? ? 1_555 C DG  8  O6 ? ? T DC  10  P DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  8   O2    ? ? ? 1_555 C DG  8  N2 ? ? T DC  10  P DG  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  9   N1    ? ? ? 1_555 C DT  7  N3 ? ? T DA  11  P DT  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  9   N6    ? ? ? 1_555 C DT  7  O4 ? ? T DA  11  P DT  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  6  N3 ? ? T DG  12  P DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  6  O2 ? ? T DG  12  P DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  6  N4 ? ? T DG  12  P DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  11  N3    ? ? ? 1_555 C DA  5  N1 ? ? T DT  13  P DA  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  11  O4    ? ? ? 1_555 C DA  5  N6 ? ? T DT  13  P DA  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  12  N3    ? ? ? 1_555 C DG  4  N1 ? ? T DC  14  P DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  12  N4    ? ? ? 1_555 C DG  4  O6 ? ? T DC  14  P DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  12  O2    ? ? ? 1_555 C DG  4  N2 ? ? T DC  14  P DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DC  13  N3    ? ? ? 1_555 C DG  3  N1 ? ? T DC  15  P DG  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  13  N4    ? ? ? 1_555 C DG  3  O6 ? ? T DC  15  P DG  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  13  O2    ? ? ? 1_555 C DG  3  N2 ? ? T DC  15  P DG  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  14  N1    ? ? ? 1_555 C DC  2  N3 ? ? T DG  16  P DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  14  N2    ? ? ? 1_555 C DC  2  O2 ? ? T DG  16  P DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  14  O6    ? ? ? 1_555 C DC  2  N4 ? ? T DG  16  P DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  15  N3    ? ? ? 1_555 C DG  1  N1 ? ? T DC  17  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  15  N4    ? ? ? 1_555 C DG  1  O6 ? ? T DC  17  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  15  O2    ? ? ? 1_555 C DG  1  N2 ? ? T DC  17  P DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 2 ? 
D ? 6 ? 
E ? 2 ? 
F ? 2 ? 
G ? 7 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 4   ? ILE A 11  ? PHE A 4   ILE A 11  
A 2 SER A 14  ? ILE A 20  ? SER A 14  ILE A 20  
A 3 GLU A 26  ? VAL A 31  ? GLU A 26  VAL A 31  
B 1 SER A 36  ? HIS A 40  ? SER A 36  HIS A 40  
B 2 CYS A 57  ? LEU A 61  ? CYS A 57  LEU A 61  
C 1 PHE A 50  ? ASP A 51  ? PHE A 50  ASP A 51  
C 2 LYS A 378 ? VAL A 379 ? LYS A 378 VAL A 379 
D 1 ILE A 186 ? PHE A 191 ? ILE A 186 PHE A 191 
D 2 ARG A 145 ? LEU A 151 ? ARG A 145 LEU A 151 
D 3 ILE A 133 ? ASP A 140 ? ILE A 133 ASP A 140 
D 4 VAL A 110 ? VAL A 117 ? VAL A 110 VAL A 117 
D 5 ILE A 212 ? THR A 214 ? ILE A 212 THR A 214 
D 6 SER A 269 ? VAL A 270 ? SER A 269 VAL A 270 
E 1 ASN A 153 ? SER A 154 ? ASN A 153 SER A 154 
E 2 GLY A 157 ? ASN A 158 ? GLY A 157 ASN A 158 
F 1 THR A 248 ? VAL A 250 ? THR A 248 VAL A 250 
F 2 ILE A 263 ? LEU A 265 ? ILE A 263 LEU A 265 
G 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
G 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
G 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
G 4 MET A 683 ? ALA A 689 ? MET A 683 ALA A 689 
G 5 VAL A 407 ? LEU A 412 ? VAL A 407 LEU A 412 
G 6 SER A 624 ? SER A 628 ? SER A 624 SER A 628 
G 7 VAL A 617 ? ASP A 621 ? VAL A 617 ASP A 621 
H 1 ASN A 402 ? ARG A 403 ? ASN A 402 ARG A 403 
H 2 GLY A 700 ? GLY A 704 ? GLY A 700 GLY A 704 
H 3 ARG A 707 ? MET A 715 ? ARG A 707 MET A 715 
H 4 THR A 718 ? MET A 728 ? THR A 718 MET A 728 
I 1 ILE A 430 ? THR A 433 ? ILE A 430 THR A 433 
I 2 MET A 461 ? TYR A 463 ? MET A 461 TYR A 463 
I 3 SER A 455 ? CYS A 456 ? SER A 455 CYS A 456 
J 1 SER A 781 ? SER A 784 ? SER A 781 SER A 784 
J 2 LYS A 829 ? PRO A 834 ? LYS A 829 PRO A 834 
J 3 CYS A 845 ? PRO A 849 ? CYS A 845 PRO A 849 
K 1 ASP A 792 ? VAL A 793 ? ASP A 792 VAL A 793 
K 2 PHE A 796 ? PRO A 797 ? PHE A 796 PRO A 797 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 11  ? N ILE A 11  O SER A 14  ? O SER A 14  
A 2 3 N TYR A 19  ? N TYR A 19  O ARG A 27  ? O ARG A 27  
B 1 2 N ALA A 39  ? N ALA A 39  O THR A 58  ? O THR A 58  
C 1 2 N PHE A 50  ? N PHE A 50  O VAL A 379 ? O VAL A 379 
D 1 2 O ILE A 187 ? O ILE A 187 N PHE A 146 ? N PHE A 146 
D 2 3 O TYR A 147 ? O TYR A 147 N HIS A 138 ? N HIS A 138 
D 3 4 O TYR A 139 ? O TYR A 139 N ASN A 112 ? N ASN A 112 
D 4 5 N ALA A 111 ? N ALA A 111 O THR A 214 ? O THR A 214 
D 5 6 N LEU A 213 ? N LEU A 213 O SER A 269 ? O SER A 269 
E 1 2 N SER A 154 ? N SER A 154 O GLY A 157 ? O GLY A 157 
F 1 2 N ARG A 249 ? N ARG A 249 O THR A 264 ? O THR A 264 
G 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
G 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
G 3 4 O TRP A 713 ? O TRP A 713 N ILE A 688 ? N ILE A 688 
G 4 5 O GLU A 686 ? O GLU A 686 N SER A 409 ? N SER A 409 
G 5 6 N PHE A 410 ? N PHE A 410 O ILE A 625 ? O ILE A 625 
G 6 7 O TYR A 626 ? O TYR A 626 N LEU A 618 ? N LEU A 618 
H 1 2 N ASN A 402 ? N ASN A 402 O TRP A 702 ? O TRP A 702 
H 2 3 N THR A 703 ? N THR A 703 O ARG A 707 ? O ARG A 707 
H 3 4 N LEU A 710 ? N LEU A 710 O LYS A 726 ? O LYS A 726 
I 1 2 N ALA A 431 ? N ALA A 431 O MET A 462 ? O MET A 462 
I 2 3 O TYR A 463 ? O TYR A 463 N SER A 455 ? N SER A 455 
J 1 2 N SER A 783 ? N SER A 783 O VAL A 830 ? O VAL A 830 
J 2 3 N TYR A 831 ? N TYR A 831 O TRP A 848 ? O TRP A 848 
K 1 2 N VAL A 793 ? N VAL A 793 O PHE A 796 ? O PHE A 796 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE UPC A 904' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 905'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CA A 906'  
AC4 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 907'  
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A 908'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 18 ASP A 411 ? ASP A 411 . ? 1_555 ? 
2  AC1 18 LEU A 412 ? LEU A 412 . ? 1_555 ? 
3  AC1 18 THR A 413 ? THR A 413 . ? 1_555 ? 
4  AC1 18 SER A 414 ? SER A 414 . ? 1_555 ? 
5  AC1 18 ALA A 415 ? ALA A 415 . ? 1_555 ? 
6  AC1 18 TYR A 416 ? TYR A 416 . ? 1_555 ? 
7  AC1 18 ARG A 482 ? ARG A 482 . ? 1_555 ? 
8  AC1 18 LYS A 486 ? LYS A 486 . ? 1_555 ? 
9  AC1 18 LYS A 560 ? LYS A 560 . ? 1_555 ? 
10 AC1 18 ASN A 564 ? ASN A 564 . ? 1_555 ? 
11 AC1 18 THR A 622 ? THR A 622 . ? 1_555 ? 
12 AC1 18 ASP A 623 ? ASP A 623 . ? 1_555 ? 
13 AC1 18 CA  E .   ? CA  A 905 . ? 1_555 ? 
14 AC1 18 CA  F .   ? CA  A 906 . ? 1_555 ? 
15 AC1 18 HOH I .   ? HOH A 958 . ? 1_555 ? 
16 AC1 18 DC  C 13  ? DC  P 115 . ? 1_555 ? 
17 AC1 18 DA  B 2   ? DA  T 4   . ? 1_555 ? 
18 AC1 18 DG  B 3   ? DG  T 5   . ? 1_555 ? 
19 AC2 4  ASP A 411 ? ASP A 411 . ? 1_555 ? 
20 AC2 4  LEU A 412 ? LEU A 412 . ? 1_555 ? 
21 AC2 4  ASP A 623 ? ASP A 623 . ? 1_555 ? 
22 AC2 4  UPC D .   ? UPC A 904 . ? 1_555 ? 
23 AC3 4  ASP A 411 ? ASP A 411 . ? 1_555 ? 
24 AC3 4  ASP A 623 ? ASP A 623 . ? 1_555 ? 
25 AC3 4  UPC D .   ? UPC A 904 . ? 1_555 ? 
26 AC3 4  DC  C 13  ? DC  P 115 . ? 1_555 ? 
27 AC4 5  ASN A 505 ? ASN A 505 . ? 1_555 ? 
28 AC4 5  ASN A 507 ? ASN A 507 . ? 1_555 ? 
29 AC4 5  LYS A 531 ? LYS A 531 . ? 1_555 ? 
30 AC4 5  HOH I .   ? HOH A 920 . ? 1_555 ? 
31 AC4 5  HOH I .   ? HOH A 922 . ? 1_555 ? 
32 AC5 2  ASP A 114 ? ASP A 114 . ? 1_555 ? 
33 AC5 2  GLU A 116 ? GLU A 116 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3SPZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3SPZ 
_atom_sites.fract_transf_matrix[1][1]   0.012793 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008399 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007680 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -37.986 -20.585 32.865 1.00 64.75  ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -36.686 -20.199 33.482 1.00 63.08  ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -36.491 -18.693 33.372 1.00 60.42  ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -37.241 -18.014 32.665 1.00 61.53  ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -35.527 -20.950 32.818 1.00 64.37  ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -35.189 -20.491 31.393 1.00 70.31  ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -33.887 -21.439 30.557 1.00 77.84  ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -32.496 -21.230 31.678 1.00 76.86  ? 1    MET A CE    1 
ATOM   9    N  N     . LYS A 1 2   ? -35.498 -18.169 34.081 1.00 56.81  ? 2    LYS A N     1 
ATOM   10   C  CA    . LYS A 1 2   ? -35.172 -16.753 33.982 1.00 53.70  ? 2    LYS A CA    1 
ATOM   11   C  C     . LYS A 1 2   ? -34.317 -16.488 32.742 1.00 49.86  ? 2    LYS A C     1 
ATOM   12   O  O     . LYS A 1 2   ? -33.417 -17.268 32.410 1.00 49.21  ? 2    LYS A O     1 
ATOM   13   C  CB    . LYS A 1 2   ? -34.473 -16.253 35.254 1.00 55.09  ? 2    LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 2   ? -35.384 -15.565 36.272 1.00 59.58  ? 2    LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 2   ? -35.947 -14.245 35.730 1.00 66.12  ? 2    LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 2   ? -37.037 -13.653 36.631 1.00 68.58  ? 2    LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 2   ? -36.480 -13.009 37.858 1.00 70.05  ? 2    LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 3   ? -34.615 -15.389 32.058 1.00 46.04  ? 3    GLU A N     1 
ATOM   19   C  CA    . GLU A 1 3   ? -33.891 -14.993 30.858 1.00 42.41  ? 3    GLU A CA    1 
ATOM   20   C  C     . GLU A 1 3   ? -32.517 -14.444 31.189 1.00 38.07  ? 3    GLU A C     1 
ATOM   21   O  O     . GLU A 1 3   ? -32.319 -13.818 32.226 1.00 38.37  ? 3    GLU A O     1 
ATOM   22   C  CB    . GLU A 1 3   ? -34.644 -13.905 30.116 1.00 43.57  ? 3    GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 3   ? -35.943 -14.323 29.480 1.00 50.13  ? 3    GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 3   ? -36.625 -13.150 28.812 1.00 55.24  ? 3    GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 3   ? -36.984 -12.191 29.526 1.00 59.28  ? 3    GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 3   ? -36.795 -13.176 27.578 1.00 61.91  ? 3    GLU A OE2   1 
ATOM   27   N  N     . PHE A 1 4   ? -31.576 -14.663 30.282 1.00 33.29  ? 4    PHE A N     1 
ATOM   28   C  CA    . PHE A 1 4   ? -30.256 -14.080 30.401 1.00 31.39  ? 4    PHE A CA    1 
ATOM   29   C  C     . PHE A 1 4   ? -29.704 -13.723 29.027 1.00 29.39  ? 4    PHE A C     1 
ATOM   30   O  O     . PHE A 1 4   ? -30.011 -14.375 28.035 1.00 28.66  ? 4    PHE A O     1 
ATOM   31   C  CB    . PHE A 1 4   ? -29.302 -15.019 31.161 1.00 31.38  ? 4    PHE A CB    1 
ATOM   32   C  CG    . PHE A 1 4   ? -29.155 -16.389 30.537 1.00 32.22  ? 4    PHE A CG    1 
ATOM   33   C  CD1   . PHE A 1 4   ? -30.104 -17.388 30.775 1.00 28.64  ? 4    PHE A CD1   1 
ATOM   34   C  CD2   . PHE A 1 4   ? -28.064 -16.682 29.726 1.00 29.37  ? 4    PHE A CD2   1 
ATOM   35   C  CE1   . PHE A 1 4   ? -29.978 -18.645 30.208 1.00 29.58  ? 4    PHE A CE1   1 
ATOM   36   C  CE2   . PHE A 1 4   ? -27.926 -17.948 29.156 1.00 32.33  ? 4    PHE A CE2   1 
ATOM   37   C  CZ    . PHE A 1 4   ? -28.886 -18.933 29.401 1.00 30.62  ? 4    PHE A CZ    1 
ATOM   38   N  N     . TYR A 1 5   ? -28.888 -12.678 28.979 1.00 29.10  ? 5    TYR A N     1 
ATOM   39   C  CA    . TYR A 1 5   ? -28.247 -12.272 27.737 1.00 29.75  ? 5    TYR A CA    1 
ATOM   40   C  C     . TYR A 1 5   ? -27.114 -13.203 27.290 1.00 28.79  ? 5    TYR A C     1 
ATOM   41   O  O     . TYR A 1 5   ? -26.472 -13.890 28.105 1.00 27.28  ? 5    TYR A O     1 
ATOM   42   C  CB    . TYR A 1 5   ? -27.719 -10.845 27.847 1.00 29.93  ? 5    TYR A CB    1 
ATOM   43   C  CG    . TYR A 1 5   ? -26.530 -10.664 28.768 1.00 27.06  ? 5    TYR A CG    1 
ATOM   44   C  CD1   . TYR A 1 5   ? -26.716 -10.408 30.128 1.00 25.18  ? 5    TYR A CD1   1 
ATOM   45   C  CD2   . TYR A 1 5   ? -25.221 -10.696 28.278 1.00 27.38  ? 5    TYR A CD2   1 
ATOM   46   C  CE1   . TYR A 1 5   ? -25.647 -10.217 30.971 1.00 22.76  ? 5    TYR A CE1   1 
ATOM   47   C  CE2   . TYR A 1 5   ? -24.124 -10.506 29.136 1.00 22.77  ? 5    TYR A CE2   1 
ATOM   48   C  CZ    . TYR A 1 5   ? -24.360 -10.270 30.482 1.00 20.82  ? 5    TYR A CZ    1 
ATOM   49   O  OH    . TYR A 1 5   ? -23.323 -10.063 31.357 1.00 21.91  ? 5    TYR A OH    1 
ATOM   50   N  N     . LEU A 1 6   ? -26.885 -13.206 25.980 1.00 27.80  ? 6    LEU A N     1 
ATOM   51   C  CA    . LEU A 1 6   ? -25.749 -13.889 25.377 1.00 26.20  ? 6    LEU A CA    1 
ATOM   52   C  C     . LEU A 1 6   ? -24.730 -12.853 24.975 1.00 26.27  ? 6    LEU A C     1 
ATOM   53   O  O     . LEU A 1 6   ? -23.590 -12.911 25.429 1.00 24.99  ? 6    LEU A O     1 
ATOM   54   C  CB    . LEU A 1 6   ? -26.185 -14.717 24.167 1.00 26.10  ? 6    LEU A CB    1 
ATOM   55   C  CG    . LEU A 1 6   ? -27.109 -15.870 24.556 1.00 25.70  ? 6    LEU A CG    1 
ATOM   56   C  CD1   . LEU A 1 6   ? -27.760 -16.463 23.335 1.00 21.29  ? 6    LEU A CD1   1 
ATOM   57   C  CD2   . LEU A 1 6   ? -26.343 -16.923 25.373 1.00 20.34  ? 6    LEU A CD2   1 
ATOM   58   N  N     . THR A 1 7   ? -25.145 -11.902 24.135 1.00 27.72  ? 7    THR A N     1 
ATOM   59   C  CA    . THR A 1 7   ? -24.278 -10.795 23.726 1.00 31.45  ? 7    THR A CA    1 
ATOM   60   C  C     . THR A 1 7   ? -25.059 -9.497  23.625 1.00 35.02  ? 7    THR A C     1 
ATOM   61   O  O     . THR A 1 7   ? -26.279 -9.511  23.419 1.00 38.01  ? 7    THR A O     1 
ATOM   62   C  CB    . THR A 1 7   ? -23.634 -11.007 22.339 1.00 30.78  ? 7    THR A CB    1 
ATOM   63   O  OG1   . THR A 1 7   ? -24.655 -11.007 21.327 1.00 32.99  ? 7    THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 7   ? -22.810 -12.295 22.278 1.00 30.69  ? 7    THR A CG2   1 
ATOM   65   N  N     . VAL A 1 8   ? -24.341 -8.380  23.734 1.00 34.45  ? 8    VAL A N     1 
ATOM   66   C  CA    . VAL A 1 8   ? -24.921 -7.066  23.500 1.00 33.89  ? 8    VAL A CA    1 
ATOM   67   C  C     . VAL A 1 8   ? -23.938 -6.186  22.722 1.00 34.55  ? 8    VAL A C     1 
ATOM   68   O  O     . VAL A 1 8   ? -22.728 -6.245  22.946 1.00 32.23  ? 8    VAL A O     1 
ATOM   69   C  CB    . VAL A 1 8   ? -25.367 -6.395  24.832 1.00 34.81  ? 8    VAL A CB    1 
ATOM   70   C  CG1   . VAL A 1 8   ? -24.160 -6.005  25.700 1.00 30.06  ? 8    VAL A CG1   1 
ATOM   71   C  CG2   . VAL A 1 8   ? -26.280 -5.203  24.564 1.00 32.11  ? 8    VAL A CG2   1 
ATOM   72   N  N     . GLU A 1 9   ? -24.468 -5.386  21.799 1.00 34.70  ? 9    GLU A N     1 
ATOM   73   C  CA    . GLU A 1 9   ? -23.668 -4.428  21.039 1.00 33.64  ? 9    GLU A CA    1 
ATOM   74   C  C     . GLU A 1 9   ? -24.400 -3.104  20.886 1.00 36.29  ? 9    GLU A C     1 
ATOM   75   O  O     . GLU A 1 9   ? -25.639 -3.065  20.857 1.00 38.27  ? 9    GLU A O     1 
ATOM   76   C  CB    . GLU A 1 9   ? -23.337 -4.973  19.642 1.00 34.48  ? 9    GLU A CB    1 
ATOM   77   C  CG    . GLU A 1 9   ? -22.591 -6.303  19.602 1.00 32.30  ? 9    GLU A CG    1 
ATOM   78   C  CD    . GLU A 1 9   ? -21.147 -6.218  20.091 1.00 32.85  ? 9    GLU A CD    1 
ATOM   79   O  OE1   . GLU A 1 9   ? -20.692 -5.121  20.486 1.00 30.49  ? 9    GLU A OE1   1 
ATOM   80   O  OE2   . GLU A 1 9   ? -20.462 -7.263  20.089 1.00 35.15  ? 9    GLU A OE2   1 
ATOM   81   N  N     . GLN A 1 10  ? -23.631 -2.022  20.783 1.00 38.54  ? 10   GLN A N     1 
ATOM   82   C  CA    . GLN A 1 10  ? -24.169 -0.723  20.383 1.00 40.45  ? 10   GLN A CA    1 
ATOM   83   C  C     . GLN A 1 10  ? -23.811 -0.438  18.933 1.00 42.75  ? 10   GLN A C     1 
ATOM   84   O  O     . GLN A 1 10  ? -22.637 -0.428  18.561 1.00 39.21  ? 10   GLN A O     1 
ATOM   85   C  CB    . GLN A 1 10  ? -23.646 0.414   21.264 1.00 41.44  ? 10   GLN A CB    1 
ATOM   86   C  CG    . GLN A 1 10  ? -24.446 1.705   21.087 1.00 40.73  ? 10   GLN A CG    1 
ATOM   87   C  CD    . GLN A 1 10  ? -23.695 2.967   21.485 1.00 43.91  ? 10   GLN A CD    1 
ATOM   88   O  OE1   . GLN A 1 10  ? -22.858 2.964   22.394 1.00 42.61  ? 10   GLN A OE1   1 
ATOM   89   N  NE2   . GLN A 1 10  ? -24.016 4.066   20.807 1.00 41.70  ? 10   GLN A NE2   1 
ATOM   90   N  N     . ILE A 1 11  ? -24.838 -0.205  18.120 1.00 47.61  ? 11   ILE A N     1 
ATOM   91   C  CA    . ILE A 1 11  ? -24.658 0.108   16.703 1.00 50.15  ? 11   ILE A CA    1 
ATOM   92   C  C     . ILE A 1 11  ? -25.530 1.311   16.371 1.00 50.40  ? 11   ILE A C     1 
ATOM   93   O  O     . ILE A 1 11  ? -26.745 1.181   16.209 1.00 52.50  ? 11   ILE A O     1 
ATOM   94   C  CB    . ILE A 1 11  ? -24.988 -1.115  15.792 1.00 51.10  ? 11   ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 11  ? -23.946 -2.225  15.999 1.00 50.88  ? 11   ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 11  ? -25.054 -0.695  14.314 1.00 53.36  ? 11   ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 11  ? -24.323 -3.577  15.417 1.00 52.81  ? 11   ILE A CD1   1 
ATOM   98   N  N     . GLY A 1 12  ? -24.900 2.481   16.291 1.00 50.07  ? 12   GLY A N     1 
ATOM   99   C  CA    . GLY A 1 12  ? -25.619 3.740   16.141 1.00 51.38  ? 12   GLY A CA    1 
ATOM   100  C  C     . GLY A 1 12  ? -26.516 3.992   17.342 1.00 51.67  ? 12   GLY A C     1 
ATOM   101  O  O     . GLY A 1 12  ? -26.046 3.981   18.487 1.00 50.19  ? 12   GLY A O     1 
ATOM   102  N  N     . ASP A 1 13  ? -27.808 4.191   17.064 1.00 51.27  ? 13   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 13  ? -28.838 4.419   18.087 1.00 50.49  ? 13   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 13  ? -29.526 3.126   18.500 1.00 49.21  ? 13   ASP A C     1 
ATOM   105  O  O     . ASP A 1 13  ? -30.570 3.147   19.170 1.00 48.40  ? 13   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 13  ? -29.894 5.408   17.575 1.00 51.61  ? 13   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 13  ? -29.388 6.834   17.529 1.00 54.14  ? 13   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 13  ? -29.853 7.609   16.658 1.00 56.45  ? 13   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 13  ? -28.525 7.182   18.368 1.00 54.95  ? 13   ASP A OD2   1 
ATOM   110  N  N     . SER A 1 14  ? -28.939 2.004   18.096 1.00 48.00  ? 14   SER A N     1 
ATOM   111  C  CA    . SER A 1 14  ? -29.525 0.700   18.370 1.00 47.79  ? 14   SER A CA    1 
ATOM   112  C  C     . SER A 1 14  ? -28.676 -0.159  19.293 1.00 44.51  ? 14   SER A C     1 
ATOM   113  O  O     . SER A 1 14  ? -27.445 -0.180  19.206 1.00 41.40  ? 14   SER A O     1 
ATOM   114  C  CB    . SER A 1 14  ? -29.813 -0.054  17.068 1.00 50.38  ? 14   SER A CB    1 
ATOM   115  O  OG    . SER A 1 14  ? -31.054 0.349   16.507 1.00 55.45  ? 14   SER A OG    1 
ATOM   116  N  N     . ILE A 1 15  ? -29.367 -0.849  20.191 1.00 43.58  ? 15   ILE A N     1 
ATOM   117  C  CA    . ILE A 1 15  ? -28.782 -1.935  20.953 1.00 41.35  ? 15   ILE A CA    1 
ATOM   118  C  C     . ILE A 1 15  ? -29.149 -3.212  20.220 1.00 41.18  ? 15   ILE A C     1 
ATOM   119  O  O     . ILE A 1 15  ? -30.308 -3.409  19.844 1.00 40.46  ? 15   ILE A O     1 
ATOM   120  C  CB    . ILE A 1 15  ? -29.291 -1.955  22.426 1.00 39.15  ? 15   ILE A CB    1 
ATOM   121  C  CG1   . ILE A 1 15  ? -28.664 -0.811  23.244 1.00 37.20  ? 15   ILE A CG1   1 
ATOM   122  C  CG2   . ILE A 1 15  ? -29.035 -3.300  23.084 1.00 37.29  ? 15   ILE A CG2   1 
ATOM   123  C  CD1   . ILE A 1 15  ? -27.124 -0.722  23.221 1.00 30.21  ? 15   ILE A CD1   1 
ATOM   124  N  N     . PHE A 1 16  ? -28.143 -4.047  19.983 1.00 42.33  ? 16   PHE A N     1 
ATOM   125  C  CA    . PHE A 1 16  ? -28.340 -5.360  19.389 1.00 42.94  ? 16   PHE A CA    1 
ATOM   126  C  C     . PHE A 1 16  ? -27.969 -6.409  20.425 1.00 42.08  ? 16   PHE A C     1 
ATOM   127  O  O     . PHE A 1 16  ? -26.809 -6.502  20.861 1.00 41.45  ? 16   PHE A O     1 
ATOM   128  C  CB    . PHE A 1 16  ? -27.488 -5.533  18.134 1.00 43.88  ? 16   PHE A CB    1 
ATOM   129  C  CG    . PHE A 1 16  ? -28.128 -5.003  16.878 1.00 49.62  ? 16   PHE A CG    1 
ATOM   130  C  CD1   . PHE A 1 16  ? -29.092 -5.754  16.195 1.00 52.14  ? 16   PHE A CD1   1 
ATOM   131  C  CD2   . PHE A 1 16  ? -27.749 -3.767  16.356 1.00 50.43  ? 16   PHE A CD2   1 
ATOM   132  C  CE1   . PHE A 1 16  ? -29.674 -5.275  15.024 1.00 52.78  ? 16   PHE A CE1   1 
ATOM   133  C  CE2   . PHE A 1 16  ? -28.331 -3.277  15.179 1.00 54.43  ? 16   PHE A CE2   1 
ATOM   134  C  CZ    . PHE A 1 16  ? -29.294 -4.034  14.515 1.00 53.59  ? 16   PHE A CZ    1 
ATOM   135  N  N     . GLU A 1 17  ? -28.971 -7.184  20.822 1.00 40.58  ? 17   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 17  ? -28.822 -8.171  21.872 1.00 38.78  ? 17   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 17  ? -29.243 -9.546  21.392 1.00 37.87  ? 17   GLU A C     1 
ATOM   138  O  O     . GLU A 1 17  ? -30.329 -9.722  20.831 1.00 37.94  ? 17   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 17  ? -29.651 -7.793  23.105 1.00 39.18  ? 17   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 17  ? -29.430 -8.732  24.292 1.00 40.39  ? 17   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 17  ? -30.574 -8.747  25.290 1.00 41.88  ? 17   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 17  ? -30.470 -9.508  26.275 1.00 41.10  ? 17   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 17  ? -31.569 -8.010  25.101 1.00 41.85  ? 17   GLU A OE2   1 
ATOM   144  N  N     . ARG A 1 18  ? -28.358 -10.511 21.619 1.00 35.31  ? 18   ARG A N     1 
ATOM   145  C  CA    . ARG A 1 18  ? -28.694 -11.914 21.517 1.00 32.67  ? 18   ARG A CA    1 
ATOM   146  C  C     . ARG A 1 18  ? -28.973 -12.361 22.941 1.00 32.37  ? 18   ARG A C     1 
ATOM   147  O  O     . ARG A 1 18  ? -28.244 -11.977 23.866 1.00 30.39  ? 18   ARG A O     1 
ATOM   148  C  CB    . ARG A 1 18  ? -27.541 -12.704 20.895 1.00 31.33  ? 18   ARG A CB    1 
ATOM   149  C  CG    . ARG A 1 18  ? -27.290 -12.357 19.436 1.00 28.95  ? 18   ARG A CG    1 
ATOM   150  C  CD    . ARG A 1 18  ? -25.965 -12.922 18.941 1.00 31.22  ? 18   ARG A CD    1 
ATOM   151  N  NE    . ARG A 1 18  ? -26.021 -14.367 18.718 1.00 29.86  ? 18   ARG A NE    1 
ATOM   152  C  CZ    . ARG A 1 18  ? -24.963 -15.135 18.471 1.00 29.53  ? 18   ARG A CZ    1 
ATOM   153  N  NH1   . ARG A 1 18  ? -23.745 -14.611 18.421 1.00 26.98  ? 18   ARG A NH1   1 
ATOM   154  N  NH2   . ARG A 1 18  ? -25.120 -16.440 18.288 1.00 33.56  ? 18   ARG A NH2   1 
ATOM   155  N  N     . TYR A 1 19  ? -30.048 -13.126 23.128 1.00 31.00  ? 19   TYR A N     1 
ATOM   156  C  CA    . TYR A 1 19  ? -30.414 -13.583 24.465 1.00 30.44  ? 19   TYR A CA    1 
ATOM   157  C  C     . TYR A 1 19  ? -31.071 -14.957 24.470 1.00 32.18  ? 19   TYR A C     1 
ATOM   158  O  O     . TYR A 1 19  ? -31.432 -15.493 23.419 1.00 33.32  ? 19   TYR A O     1 
ATOM   159  C  CB    . TYR A 1 19  ? -31.300 -12.542 25.169 1.00 29.69  ? 19   TYR A CB    1 
ATOM   160  C  CG    . TYR A 1 19  ? -32.684 -12.377 24.562 1.00 37.33  ? 19   TYR A CG    1 
ATOM   161  C  CD1   . TYR A 1 19  ? -32.877 -11.619 23.396 1.00 35.03  ? 19   TYR A CD1   1 
ATOM   162  C  CD2   . TYR A 1 19  ? -33.804 -12.983 25.149 1.00 37.49  ? 19   TYR A CD2   1 
ATOM   163  C  CE1   . TYR A 1 19  ? -34.136 -11.473 22.838 1.00 38.29  ? 19   TYR A CE1   1 
ATOM   164  C  CE2   . TYR A 1 19  ? -35.074 -12.834 24.597 1.00 39.77  ? 19   TYR A CE2   1 
ATOM   165  C  CZ    . TYR A 1 19  ? -35.229 -12.077 23.442 1.00 40.87  ? 19   TYR A CZ    1 
ATOM   166  O  OH    . TYR A 1 19  ? -36.477 -11.929 22.881 1.00 45.61  ? 19   TYR A OH    1 
ATOM   167  N  N     . ILE A 1 20  ? -31.203 -15.528 25.667 1.00 33.33  ? 20   ILE A N     1 
ATOM   168  C  CA    . ILE A 1 20  ? -31.986 -16.738 25.879 1.00 34.48  ? 20   ILE A CA    1 
ATOM   169  C  C     . ILE A 1 20  ? -33.315 -16.350 26.543 1.00 37.83  ? 20   ILE A C     1 
ATOM   170  O  O     . ILE A 1 20  ? -33.322 -15.673 27.579 1.00 37.48  ? 20   ILE A O     1 
ATOM   171  C  CB    . ILE A 1 20  ? -31.205 -17.766 26.725 1.00 31.37  ? 20   ILE A CB    1 
ATOM   172  C  CG1   . ILE A 1 20  ? -29.949 -18.262 25.979 1.00 35.02  ? 20   ILE A CG1   1 
ATOM   173  C  CG2   . ILE A 1 20  ? -32.079 -18.919 27.138 1.00 30.30  ? 20   ILE A CG2   1 
ATOM   174  C  CD1   . ILE A 1 20  ? -30.196 -19.002 24.640 1.00 33.77  ? 20   ILE A CD1   1 
ATOM   175  N  N     . ASP A 1 21  ? -34.430 -16.763 25.939 1.00 38.84  ? 21   ASP A N     1 
ATOM   176  C  CA    . ASP A 1 21  ? -35.757 -16.441 26.481 1.00 43.80  ? 21   ASP A CA    1 
ATOM   177  C  C     . ASP A 1 21  ? -36.220 -17.424 27.571 1.00 45.88  ? 21   ASP A C     1 
ATOM   178  O  O     . ASP A 1 21  ? -35.483 -18.355 27.933 1.00 44.52  ? 21   ASP A O     1 
ATOM   179  C  CB    . ASP A 1 21  ? -36.817 -16.249 25.370 1.00 44.46  ? 21   ASP A CB    1 
ATOM   180  C  CG    . ASP A 1 21  ? -37.187 -17.549 24.645 1.00 49.74  ? 21   ASP A CG    1 
ATOM   181  O  OD1   . ASP A 1 21  ? -37.092 -18.650 25.234 1.00 52.29  ? 21   ASP A OD1   1 
ATOM   182  O  OD2   . ASP A 1 21  ? -37.606 -17.463 23.469 1.00 53.61  ? 21   ASP A OD2   1 
ATOM   183  N  N     . SER A 1 22  ? -37.437 -17.204 28.078 1.00 47.39  ? 22   SER A N     1 
ATOM   184  C  CA    . SER A 1 22  ? -37.994 -17.980 29.195 1.00 49.14  ? 22   SER A CA    1 
ATOM   185  C  C     . SER A 1 22  ? -38.195 -19.458 28.867 1.00 49.67  ? 22   SER A C     1 
ATOM   186  O  O     . SER A 1 22  ? -38.263 -20.298 29.770 1.00 50.74  ? 22   SER A O     1 
ATOM   187  C  CB    . SER A 1 22  ? -39.311 -17.356 29.686 1.00 50.83  ? 22   SER A CB    1 
ATOM   188  O  OG    . SER A 1 22  ? -40.337 -17.451 28.708 1.00 53.05  ? 22   SER A OG    1 
ATOM   189  N  N     . ASN A 1 23  ? -38.299 -19.769 27.578 1.00 48.66  ? 23   ASN A N     1 
ATOM   190  C  CA    . ASN A 1 23  ? -38.390 -21.148 27.127 1.00 48.83  ? 23   ASN A CA    1 
ATOM   191  C  C     . ASN A 1 23  ? -37.002 -21.731 26.855 1.00 48.78  ? 23   ASN A C     1 
ATOM   192  O  O     . ASN A 1 23  ? -36.868 -22.875 26.416 1.00 49.57  ? 23   ASN A O     1 
ATOM   193  C  CB    . ASN A 1 23  ? -39.272 -21.233 25.880 1.00 50.96  ? 23   ASN A CB    1 
ATOM   194  C  CG    . ASN A 1 23  ? -40.729 -20.879 26.166 1.00 51.91  ? 23   ASN A CG    1 
ATOM   195  O  OD1   . ASN A 1 23  ? -41.411 -21.571 26.926 1.00 51.72  ? 23   ASN A OD1   1 
ATOM   196  N  ND2   . ASN A 1 23  ? -41.210 -19.803 25.551 1.00 44.45  ? 23   ASN A ND2   1 
ATOM   197  N  N     . GLY A 1 24  ? -35.971 -20.930 27.117 1.00 46.15  ? 24   GLY A N     1 
ATOM   198  C  CA    . GLY A 1 24  ? -34.601 -21.341 26.888 1.00 43.06  ? 24   GLY A CA    1 
ATOM   199  C  C     . GLY A 1 24  ? -34.242 -21.420 25.419 1.00 42.53  ? 24   GLY A C     1 
ATOM   200  O  O     . GLY A 1 24  ? -33.404 -22.229 25.032 1.00 43.97  ? 24   GLY A O     1 
ATOM   201  N  N     . ARG A 1 25  ? -34.874 -20.584 24.599 1.00 43.78  ? 25   ARG A N     1 
ATOM   202  C  CA    . ARG A 1 25  ? -34.577 -20.520 23.159 1.00 44.22  ? 25   ARG A CA    1 
ATOM   203  C  C     . ARG A 1 25  ? -33.721 -19.297 22.839 1.00 40.61  ? 25   ARG A C     1 
ATOM   204  O  O     . ARG A 1 25  ? -33.882 -18.249 23.471 1.00 41.16  ? 25   ARG A O     1 
ATOM   205  C  CB    . ARG A 1 25  ? -35.879 -20.522 22.339 1.00 47.78  ? 25   ARG A CB    1 
ATOM   206  C  CG    . ARG A 1 25  ? -36.342 -21.919 21.865 1.00 59.21  ? 25   ARG A CG    1 
ATOM   207  C  CD    . ARG A 1 25  ? -36.343 -22.961 23.009 1.00 68.30  ? 25   ARG A CD    1 
ATOM   208  N  NE    . ARG A 1 25  ? -36.455 -24.355 22.564 1.00 72.54  ? 25   ARG A NE    1 
ATOM   209  C  CZ    . ARG A 1 25  ? -37.579 -25.073 22.597 1.00 76.01  ? 25   ARG A CZ    1 
ATOM   210  N  NH1   . ARG A 1 25  ? -38.711 -24.537 23.048 1.00 75.61  ? 25   ARG A NH1   1 
ATOM   211  N  NH2   . ARG A 1 25  ? -37.574 -26.332 22.173 1.00 76.15  ? 25   ARG A NH2   1 
ATOM   212  N  N     . GLU A 1 26  ? -32.793 -19.429 21.889 1.00 38.76  ? 26   GLU A N     1 
ATOM   213  C  CA    . GLU A 1 26  ? -31.972 -18.279 21.464 1.00 36.83  ? 26   GLU A CA    1 
ATOM   214  C  C     . GLU A 1 26  ? -32.743 -17.274 20.599 1.00 37.55  ? 26   GLU A C     1 
ATOM   215  O  O     . GLU A 1 26  ? -33.331 -17.642 19.582 1.00 37.10  ? 26   GLU A O     1 
ATOM   216  C  CB    . GLU A 1 26  ? -30.684 -18.697 20.735 1.00 33.61  ? 26   GLU A CB    1 
ATOM   217  C  CG    . GLU A 1 26  ? -29.833 -17.459 20.398 1.00 35.35  ? 26   GLU A CG    1 
ATOM   218  C  CD    . GLU A 1 26  ? -28.525 -17.736 19.688 1.00 37.67  ? 26   GLU A CD    1 
ATOM   219  O  OE1   . GLU A 1 26  ? -27.933 -18.818 19.883 1.00 38.50  ? 26   GLU A OE1   1 
ATOM   220  O  OE2   . GLU A 1 26  ? -28.076 -16.837 18.942 1.00 38.88  ? 26   GLU A OE2   1 
ATOM   221  N  N     . ARG A 1 27  ? -32.711 -16.007 21.003 1.00 38.48  ? 27   ARG A N     1 
ATOM   222  C  CA    . ARG A 1 27  ? -33.351 -14.938 20.249 1.00 42.55  ? 27   ARG A CA    1 
ATOM   223  C  C     . ARG A 1 27  ? -32.412 -13.754 20.030 1.00 42.45  ? 27   ARG A C     1 
ATOM   224  O  O     . ARG A 1 27  ? -31.414 -13.604 20.728 1.00 42.57  ? 27   ARG A O     1 
ATOM   225  C  CB    . ARG A 1 27  ? -34.613 -14.447 20.970 1.00 46.93  ? 27   ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 27  ? -35.519 -15.513 21.623 1.00 54.71  ? 27   ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 27  ? -36.253 -16.411 20.623 1.00 65.30  ? 27   ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 27  ? -36.627 -15.727 19.384 1.00 75.32  ? 27   ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 27  ? -37.717 -14.977 19.221 1.00 82.56  ? 27   ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 27  ? -38.573 -14.792 20.223 1.00 84.78  ? 27   ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 27  ? -37.948 -14.404 18.045 1.00 84.26  ? 27   ARG A NH2   1 
ATOM   232  N  N     . THR A 1 28  ? -32.746 -12.915 19.051 1.00 45.59  ? 28   THR A N     1 
ATOM   233  C  CA    . THR A 1 28  ? -32.053 -11.648 18.818 1.00 45.70  ? 28   THR A CA    1 
ATOM   234  C  C     . THR A 1 28  ? -33.108 -10.549 18.779 1.00 45.71  ? 28   THR A C     1 
ATOM   235  O  O     . THR A 1 28  ? -34.268 -10.817 18.459 1.00 47.46  ? 28   THR A O     1 
ATOM   236  C  CB    . THR A 1 28  ? -31.261 -11.654 17.480 1.00 47.28  ? 28   THR A CB    1 
ATOM   237  O  OG1   . THR A 1 28  ? -30.445 -12.828 17.409 1.00 53.62  ? 28   THR A OG1   1 
ATOM   238  C  CG2   . THR A 1 28  ? -30.353 -10.415 17.355 1.00 44.56  ? 28   THR A CG2   1 
ATOM   239  N  N     . ARG A 1 29  ? -32.711 -9.322  19.116 1.00 43.82  ? 29   ARG A N     1 
ATOM   240  C  CA    . ARG A 1 29  ? -33.594 -8.157  18.994 1.00 43.97  ? 29   ARG A CA    1 
ATOM   241  C  C     . ARG A 1 29  ? -32.811 -6.852  18.796 1.00 44.64  ? 29   ARG A C     1 
ATOM   242  O  O     . ARG A 1 29  ? -31.727 -6.674  19.371 1.00 41.49  ? 29   ARG A O     1 
ATOM   243  C  CB    . ARG A 1 29  ? -34.538 -8.049  20.207 1.00 42.29  ? 29   ARG A CB    1 
ATOM   244  C  CG    . ARG A 1 29  ? -33.840 -8.019  21.567 1.00 42.14  ? 29   ARG A CG    1 
ATOM   245  C  CD    . ARG A 1 29  ? -34.835 -7.950  22.706 1.00 41.72  ? 29   ARG A CD    1 
ATOM   246  N  NE    . ARG A 1 29  ? -34.207 -8.193  24.008 1.00 40.15  ? 29   ARG A NE    1 
ATOM   247  C  CZ    . ARG A 1 29  ? -34.820 -8.778  25.036 1.00 39.26  ? 29   ARG A CZ    1 
ATOM   248  N  NH1   . ARG A 1 29  ? -36.077 -9.199  24.922 1.00 38.22  ? 29   ARG A NH1   1 
ATOM   249  N  NH2   . ARG A 1 29  ? -34.177 -8.957  26.179 1.00 35.42  ? 29   ARG A NH2   1 
ATOM   250  N  N     . GLU A 1 30  ? -33.353 -5.961  17.965 1.00 45.40  ? 30   GLU A N     1 
ATOM   251  C  CA    . GLU A 1 30  ? -32.851 -4.595  17.864 1.00 46.90  ? 30   GLU A CA    1 
ATOM   252  C  C     . GLU A 1 30  ? -33.695 -3.706  18.779 1.00 46.70  ? 30   GLU A C     1 
ATOM   253  O  O     . GLU A 1 30  ? -34.918 -3.709  18.682 1.00 45.68  ? 30   GLU A O     1 
ATOM   254  C  CB    . GLU A 1 30  ? -32.901 -4.107  16.412 1.00 50.12  ? 30   GLU A CB    1 
ATOM   255  C  CG    . GLU A 1 30  ? -32.296 -2.715  16.181 1.00 54.86  ? 30   GLU A CG    1 
ATOM   256  C  CD    . GLU A 1 30  ? -32.170 -2.331  14.703 1.00 59.83  ? 30   GLU A CD    1 
ATOM   257  O  OE1   . GLU A 1 30  ? -32.748 -3.014  13.829 1.00 63.53  ? 30   GLU A OE1   1 
ATOM   258  O  OE2   . GLU A 1 30  ? -31.482 -1.334  14.408 1.00 61.48  ? 30   GLU A OE2   1 
ATOM   259  N  N     . VAL A 1 31  ? -33.045 -2.974  19.684 1.00 47.28  ? 31   VAL A N     1 
ATOM   260  C  CA    . VAL A 1 31  ? -33.761 -2.075  20.604 1.00 48.48  ? 31   VAL A CA    1 
ATOM   261  C  C     . VAL A 1 31  ? -33.288 -0.625  20.491 1.00 49.11  ? 31   VAL A C     1 
ATOM   262  O  O     . VAL A 1 31  ? -32.102 -0.340  20.646 1.00 48.62  ? 31   VAL A O     1 
ATOM   263  C  CB    . VAL A 1 31  ? -33.699 -2.568  22.079 1.00 47.67  ? 31   VAL A CB    1 
ATOM   264  C  CG1   . VAL A 1 31  ? -34.088 -1.458  23.059 1.00 48.36  ? 31   VAL A CG1   1 
ATOM   265  C  CG2   . VAL A 1 31  ? -34.612 -3.758  22.272 1.00 46.86  ? 31   VAL A CG2   1 
ATOM   266  N  N     . GLU A 1 32  ? -34.234 0.275   20.214 1.00 51.51  ? 32   GLU A N     1 
ATOM   267  C  CA    . GLU A 1 32  ? -33.978 1.719   20.140 1.00 52.51  ? 32   GLU A CA    1 
ATOM   268  C  C     . GLU A 1 32  ? -33.821 2.247   21.562 1.00 48.97  ? 32   GLU A C     1 
ATOM   269  O  O     . GLU A 1 32  ? -34.745 2.847   22.119 1.00 50.33  ? 32   GLU A O     1 
ATOM   270  C  CB    . GLU A 1 32  ? -35.131 2.443   19.411 1.00 55.45  ? 32   GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 32  ? -35.303 2.070   17.925 1.00 62.38  ? 32   GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 32  ? -36.716 2.333   17.371 1.00 69.11  ? 32   GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 32  ? -36.859 2.484   16.132 1.00 69.83  ? 32   GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 32  ? -37.688 2.379   18.160 1.00 70.90  ? 32   GLU A OE2   1 
ATOM   275  N  N     . TYR A 1 33  ? -32.649 2.012   22.147 1.00 44.06  ? 33   TYR A N     1 
ATOM   276  C  CA    . TYR A 1 33  ? -32.450 2.219   23.580 1.00 41.08  ? 33   TYR A CA    1 
ATOM   277  C  C     . TYR A 1 33  ? -32.415 3.678   23.983 1.00 40.47  ? 33   TYR A C     1 
ATOM   278  O  O     . TYR A 1 33  ? -31.683 4.484   23.399 1.00 39.66  ? 33   TYR A O     1 
ATOM   279  C  CB    . TYR A 1 33  ? -31.184 1.516   24.061 1.00 40.32  ? 33   TYR A CB    1 
ATOM   280  C  CG    . TYR A 1 33  ? -30.945 1.619   25.555 1.00 37.50  ? 33   TYR A CG    1 
ATOM   281  C  CD1   . TYR A 1 33  ? -31.862 1.097   26.468 1.00 33.47  ? 33   TYR A CD1   1 
ATOM   282  C  CD2   . TYR A 1 33  ? -29.788 2.220   26.052 1.00 34.30  ? 33   TYR A CD2   1 
ATOM   283  C  CE1   . TYR A 1 33  ? -31.644 1.188   27.834 1.00 32.26  ? 33   TYR A CE1   1 
ATOM   284  C  CE2   . TYR A 1 33  ? -29.563 2.313   27.417 1.00 32.55  ? 33   TYR A CE2   1 
ATOM   285  C  CZ    . TYR A 1 33  ? -30.492 1.796   28.301 1.00 32.16  ? 33   TYR A CZ    1 
ATOM   286  O  OH    . TYR A 1 33  ? -30.261 1.892   29.658 1.00 33.88  ? 33   TYR A OH    1 
ATOM   287  N  N     . LYS A 1 34  ? -33.217 3.999   24.993 1.00 38.83  ? 34   LYS A N     1 
ATOM   288  C  CA    . LYS A 1 34  ? -33.347 5.363   25.478 1.00 38.91  ? 34   LYS A CA    1 
ATOM   289  C  C     . LYS A 1 34  ? -32.586 5.545   26.800 1.00 36.65  ? 34   LYS A C     1 
ATOM   290  O  O     . LYS A 1 34  ? -33.084 5.184   27.873 1.00 35.64  ? 34   LYS A O     1 
ATOM   291  C  CB    . LYS A 1 34  ? -34.832 5.751   25.578 1.00 41.01  ? 34   LYS A CB    1 
ATOM   292  C  CG    . LYS A 1 34  ? -35.452 6.098   24.209 1.00 44.01  ? 34   LYS A CG    1 
ATOM   293  C  CD    . LYS A 1 34  ? -36.955 5.846   24.144 1.00 50.45  ? 34   LYS A CD    1 
ATOM   294  C  CE    . LYS A 1 34  ? -37.284 4.449   23.610 1.00 52.96  ? 34   LYS A CE    1 
ATOM   295  N  NZ    . LYS A 1 34  ? -38.758 4.173   23.607 1.00 52.71  ? 34   LYS A NZ    1 
ATOM   296  N  N     . PRO A 1 35  ? -31.363 6.104   26.720 1.00 35.26  ? 35   PRO A N     1 
ATOM   297  C  CA    . PRO A 1 35  ? -30.446 6.176   27.855 1.00 32.76  ? 35   PRO A CA    1 
ATOM   298  C  C     . PRO A 1 35  ? -30.778 7.329   28.785 1.00 32.02  ? 35   PRO A C     1 
ATOM   299  O  O     . PRO A 1 35  ? -31.559 8.211   28.418 1.00 33.70  ? 35   PRO A O     1 
ATOM   300  C  CB    . PRO A 1 35  ? -29.095 6.424   27.187 1.00 32.66  ? 35   PRO A CB    1 
ATOM   301  C  CG    . PRO A 1 35  ? -29.423 7.157   25.933 1.00 34.64  ? 35   PRO A CG    1 
ATOM   302  C  CD    . PRO A 1 35  ? -30.843 6.839   25.553 1.00 35.80  ? 35   PRO A CD    1 
ATOM   303  N  N     . SER A 1 36  ? -30.198 7.310   29.982 1.00 30.74  ? 36   SER A N     1 
ATOM   304  C  CA    . SER A 1 36  ? -30.296 8.435   30.908 1.00 30.84  ? 36   SER A CA    1 
ATOM   305  C  C     . SER A 1 36  ? -28.917 8.823   31.416 1.00 31.32  ? 36   SER A C     1 
ATOM   306  O  O     . SER A 1 36  ? -28.035 7.978   31.546 1.00 31.78  ? 36   SER A O     1 
ATOM   307  C  CB    . SER A 1 36  ? -31.208 8.111   32.093 1.00 31.09  ? 36   SER A CB    1 
ATOM   308  O  OG    . SER A 1 36  ? -32.563 8.050   31.699 1.00 32.09  ? 36   SER A OG    1 
ATOM   309  N  N     . LEU A 1 37  ? -28.737 10.115  31.667 1.00 30.80  ? 37   LEU A N     1 
ATOM   310  C  CA    . LEU A 1 37  ? -27.576 10.620  32.374 1.00 28.17  ? 37   LEU A CA    1 
ATOM   311  C  C     . LEU A 1 37  ? -28.053 11.699  33.339 1.00 29.18  ? 37   LEU A C     1 
ATOM   312  O  O     . LEU A 1 37  ? -29.233 12.068  33.335 1.00 30.25  ? 37   LEU A O     1 
ATOM   313  C  CB    . LEU A 1 37  ? -26.533 11.170  31.401 1.00 26.96  ? 37   LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 37  ? -25.857 10.206  30.422 1.00 25.45  ? 37   LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 37  ? -25.210 10.980  29.284 1.00 23.83  ? 37   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 37  ? -24.852 9.288   31.124 1.00 20.26  ? 37   LEU A CD2   1 
ATOM   317  N  N     . PHE A 1 38  ? -27.144 12.208  34.162 1.00 27.06  ? 38   PHE A N     1 
ATOM   318  C  CA    . PHE A 1 38  ? -27.540 13.053  35.269 1.00 27.96  ? 38   PHE A CA    1 
ATOM   319  C  C     . PHE A 1 38  ? -26.677 14.290  35.401 1.00 31.28  ? 38   PHE A C     1 
ATOM   320  O  O     . PHE A 1 38  ? -25.487 14.286  35.066 1.00 33.29  ? 38   PHE A O     1 
ATOM   321  C  CB    . PHE A 1 38  ? -27.497 12.257  36.582 1.00 28.56  ? 38   PHE A CB    1 
ATOM   322  C  CG    . PHE A 1 38  ? -28.359 11.020  36.577 1.00 25.44  ? 38   PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1 38  ? -27.920 9.845   35.967 1.00 21.78  ? 38   PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1 38  ? -29.607 11.030  37.193 1.00 21.64  ? 38   PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1 38  ? -28.720 8.701   35.956 1.00 20.27  ? 38   PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1 38  ? -30.413 9.893   37.191 1.00 21.18  ? 38   PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1 38  ? -29.971 8.727   36.569 1.00 22.57  ? 38   PHE A CZ    1 
ATOM   328  N  N     . ALA A 1 39  ? -27.299 15.344  35.912 1.00 33.88  ? 39   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 39  ? -26.637 16.602  36.202 1.00 34.43  ? 39   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 39  ? -27.017 16.979  37.622 1.00 35.82  ? 39   ALA A C     1 
ATOM   331  O  O     . ALA A 1 39  ? -28.156 16.767  38.034 1.00 38.24  ? 39   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 39  ? -27.108 17.677  35.227 1.00 35.02  ? 39   ALA A CB    1 
ATOM   333  N  N     . HIS A 1 40  ? -26.071 17.524  38.376 1.00 37.08  ? 40   HIS A N     1 
ATOM   334  C  CA    . HIS A 1 40  ? -26.389 18.079  39.686 1.00 38.17  ? 40   HIS A CA    1 
ATOM   335  C  C     . HIS A 1 40  ? -27.453 19.163  39.544 1.00 39.35  ? 40   HIS A C     1 
ATOM   336  O  O     . HIS A 1 40  ? -27.420 19.958  38.603 1.00 39.00  ? 40   HIS A O     1 
ATOM   337  C  CB    . HIS A 1 40  ? -25.143 18.659  40.347 1.00 36.59  ? 40   HIS A CB    1 
ATOM   338  C  CG    . HIS A 1 40  ? -24.179 17.625  40.822 1.00 38.57  ? 40   HIS A CG    1 
ATOM   339  N  ND1   . HIS A 1 40  ? -22.875 17.567  40.380 1.00 40.66  ? 40   HIS A ND1   1 
ATOM   340  C  CD2   . HIS A 1 40  ? -24.330 16.595  41.687 1.00 41.09  ? 40   HIS A CD2   1 
ATOM   341  C  CE1   . HIS A 1 40  ? -22.260 16.551  40.961 1.00 39.84  ? 40   HIS A CE1   1 
ATOM   342  N  NE2   . HIS A 1 40  ? -23.120 15.946  41.760 1.00 40.03  ? 40   HIS A NE2   1 
ATOM   343  N  N     . CYS A 1 41  ? -28.397 19.176  40.479 1.00 39.82  ? 41   CYS A N     1 
ATOM   344  C  CA    . CYS A 1 41  ? -29.448 20.179  40.523 1.00 41.93  ? 41   CYS A CA    1 
ATOM   345  C  C     . CYS A 1 41  ? -29.404 20.824  41.899 1.00 45.30  ? 41   CYS A C     1 
ATOM   346  O  O     . CYS A 1 41  ? -28.683 20.341  42.769 1.00 45.76  ? 41   CYS A O     1 
ATOM   347  C  CB    . CYS A 1 41  ? -30.809 19.528  40.276 1.00 40.87  ? 41   CYS A CB    1 
ATOM   348  S  SG    . CYS A 1 41  ? -31.267 18.335  41.547 1.00 42.31  ? 41   CYS A SG    1 
ATOM   349  N  N     . PRO A 1 42  ? -30.162 21.921  42.105 1.00 50.08  ? 42   PRO A N     1 
ATOM   350  C  CA    . PRO A 1 42  ? -30.180 22.544  43.434 1.00 53.52  ? 42   PRO A CA    1 
ATOM   351  C  C     . PRO A 1 42  ? -30.959 21.723  44.461 1.00 56.12  ? 42   PRO A C     1 
ATOM   352  O  O     . PRO A 1 42  ? -31.776 20.875  44.085 1.00 55.54  ? 42   PRO A O     1 
ATOM   353  C  CB    . PRO A 1 42  ? -30.865 23.897  43.186 1.00 54.96  ? 42   PRO A CB    1 
ATOM   354  C  CG    . PRO A 1 42  ? -31.646 23.720  41.933 1.00 52.82  ? 42   PRO A CG    1 
ATOM   355  C  CD    . PRO A 1 42  ? -30.868 22.743  41.102 1.00 51.58  ? 42   PRO A CD    1 
ATOM   356  N  N     . GLU A 1 43  ? -30.701 21.979  45.745 1.00 60.10  ? 43   GLU A N     1 
ATOM   357  C  CA    . GLU A 1 43  ? -31.351 21.242  46.833 1.00 64.38  ? 43   GLU A CA    1 
ATOM   358  C  C     . GLU A 1 43  ? -32.864 21.452  46.817 1.00 66.69  ? 43   GLU A C     1 
ATOM   359  O  O     . GLU A 1 43  ? -33.626 20.557  47.187 1.00 66.34  ? 43   GLU A O     1 
ATOM   360  C  CB    . GLU A 1 43  ? -30.766 21.632  48.194 1.00 65.81  ? 43   GLU A CB    1 
ATOM   361  C  CG    . GLU A 1 43  ? -30.917 20.550  49.270 1.00 71.56  ? 43   GLU A CG    1 
ATOM   362  C  CD    . GLU A 1 43  ? -30.072 19.300  48.986 1.00 75.26  ? 43   GLU A CD    1 
ATOM   363  O  OE1   . GLU A 1 43  ? -30.658 18.246  48.635 1.00 74.76  ? 43   GLU A OE1   1 
ATOM   364  O  OE2   . GLU A 1 43  ? -28.824 19.374  49.103 1.00 74.63  ? 43   GLU A OE2   1 
ATOM   365  N  N     . SER A 1 44  ? -33.277 22.634  46.365 1.00 69.10  ? 44   SER A N     1 
ATOM   366  C  CA    . SER A 1 44  ? -34.687 22.985  46.179 1.00 71.72  ? 44   SER A CA    1 
ATOM   367  C  C     . SER A 1 44  ? -35.467 21.985  45.307 1.00 73.02  ? 44   SER A C     1 
ATOM   368  O  O     . SER A 1 44  ? -36.705 21.948  45.345 1.00 73.89  ? 44   SER A O     1 
ATOM   369  C  CB    . SER A 1 44  ? -34.799 24.398  45.582 1.00 72.23  ? 44   SER A CB    1 
ATOM   370  O  OG    . SER A 1 44  ? -34.147 24.493  44.322 1.00 70.23  ? 44   SER A OG    1 
ATOM   371  N  N     . GLN A 1 45  ? -34.740 21.177  44.533 1.00 72.03  ? 45   GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45  ? -35.350 20.287  43.549 1.00 71.88  ? 45   GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45  ? -35.567 18.873  44.091 1.00 70.85  ? 45   GLN A C     1 
ATOM   374  O  O     . GLN A 1 45  ? -34.603 18.127  44.312 1.00 71.00  ? 45   GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45  ? -34.504 20.254  42.276 1.00 71.31  ? 45   GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45  ? -35.271 19.879  41.019 1.00 73.96  ? 45   GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45  ? -34.584 20.360  39.747 1.00 76.91  ? 45   GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45  ? -34.432 19.601  38.787 1.00 77.53  ? 45   GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45  ? -34.166 21.627  39.736 1.00 76.32  ? 45   GLN A NE2   1 
ATOM   380  N  N     . ALA A 1 46  ? -36.836 18.518  44.302 1.00 68.94  ? 46   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 46  ? -37.216 17.178  44.764 1.00 66.56  ? 46   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 46  ? -36.790 16.089  43.764 1.00 63.70  ? 46   ALA A C     1 
ATOM   383  O  O     . ALA A 1 46  ? -37.092 16.163  42.569 1.00 63.51  ? 46   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 46  ? -38.716 17.109  45.047 1.00 66.41  ? 46   ALA A CB    1 
ATOM   385  N  N     . THR A 1 47  ? -36.075 15.086  44.260 1.00 59.39  ? 47   THR A N     1 
ATOM   386  C  CA    . THR A 1 47  ? -35.521 14.048  43.403 1.00 56.19  ? 47   THR A CA    1 
ATOM   387  C  C     . THR A 1 47  ? -35.334 12.753  44.199 1.00 54.66  ? 47   THR A C     1 
ATOM   388  O  O     . THR A 1 47  ? -35.308 12.765  45.433 1.00 55.80  ? 47   THR A O     1 
ATOM   389  C  CB    . THR A 1 47  ? -34.179 14.531  42.745 1.00 56.13  ? 47   THR A CB    1 
ATOM   390  O  OG1   . THR A 1 47  ? -33.675 13.546  41.836 1.00 52.50  ? 47   THR A OG1   1 
ATOM   391  C  CG2   . THR A 1 47  ? -33.121 14.836  43.798 1.00 56.36  ? 47   THR A CG2   1 
ATOM   392  N  N     . LYS A 1 48  ? -35.234 11.633  43.496 1.00 52.13  ? 48   LYS A N     1 
ATOM   393  C  CA    . LYS A 1 48  ? -34.870 10.373  44.137 1.00 51.68  ? 48   LYS A CA    1 
ATOM   394  C  C     . LYS A 1 48  ? -33.441 9.927   43.750 1.00 49.30  ? 48   LYS A C     1 
ATOM   395  O  O     . LYS A 1 48  ? -32.964 8.884   44.207 1.00 49.80  ? 48   LYS A O     1 
ATOM   396  C  CB    . LYS A 1 48  ? -35.907 9.285   43.826 1.00 52.64  ? 48   LYS A CB    1 
ATOM   397  C  CG    . LYS A 1 48  ? -36.062 8.949   42.340 1.00 53.97  ? 48   LYS A CG    1 
ATOM   398  C  CD    . LYS A 1 48  ? -37.295 8.085   42.124 1.00 61.95  ? 48   LYS A CD    1 
ATOM   399  C  CE    . LYS A 1 48  ? -37.045 6.964   41.115 1.00 63.44  ? 48   LYS A CE    1 
ATOM   400  N  NZ    . LYS A 1 48  ? -35.994 6.017   41.581 1.00 66.01  ? 48   LYS A NZ    1 
ATOM   401  N  N     . TYR A 1 49  ? -32.771 10.727  42.920 1.00 45.11  ? 49   TYR A N     1 
ATOM   402  C  CA    . TYR A 1 49  ? -31.422 10.414  42.455 1.00 43.99  ? 49   TYR A CA    1 
ATOM   403  C  C     . TYR A 1 49  ? -30.394 11.288  43.139 1.00 42.26  ? 49   TYR A C     1 
ATOM   404  O  O     . TYR A 1 49  ? -30.416 12.516  43.016 1.00 42.08  ? 49   TYR A O     1 
ATOM   405  C  CB    . TYR A 1 49  ? -31.295 10.579  40.938 1.00 43.35  ? 49   TYR A CB    1 
ATOM   406  C  CG    . TYR A 1 49  ? -32.364 9.867   40.146 1.00 44.02  ? 49   TYR A CG    1 
ATOM   407  C  CD1   . TYR A 1 49  ? -33.462 10.567  39.641 1.00 44.12  ? 49   TYR A CD1   1 
ATOM   408  C  CD2   . TYR A 1 49  ? -32.283 8.495   39.902 1.00 41.76  ? 49   TYR A CD2   1 
ATOM   409  C  CE1   . TYR A 1 49  ? -34.465 9.922   38.912 1.00 45.48  ? 49   TYR A CE1   1 
ATOM   410  C  CE2   . TYR A 1 49  ? -33.277 7.836   39.172 1.00 45.79  ? 49   TYR A CE2   1 
ATOM   411  C  CZ    . TYR A 1 49  ? -34.368 8.558   38.678 1.00 45.97  ? 49   TYR A CZ    1 
ATOM   412  O  OH    . TYR A 1 49  ? -35.353 7.921   37.951 1.00 45.88  ? 49   TYR A OH    1 
ATOM   413  N  N     . PHE A 1 50  ? -29.489 10.640  43.858 1.00 40.81  ? 50   PHE A N     1 
ATOM   414  C  CA    . PHE A 1 50  ? -28.383 11.327  44.503 1.00 39.19  ? 50   PHE A CA    1 
ATOM   415  C  C     . PHE A 1 50  ? -27.052 10.771  44.004 1.00 36.17  ? 50   PHE A C     1 
ATOM   416  O  O     . PHE A 1 50  ? -26.966 9.591   43.655 1.00 36.51  ? 50   PHE A O     1 
ATOM   417  C  CB    . PHE A 1 50  ? -28.508 11.200  46.024 1.00 40.38  ? 50   PHE A CB    1 
ATOM   418  C  CG    . PHE A 1 50  ? -29.707 11.919  46.594 1.00 42.15  ? 50   PHE A CG    1 
ATOM   419  C  CD1   . PHE A 1 50  ? -30.933 11.271  46.723 1.00 44.74  ? 50   PHE A CD1   1 
ATOM   420  C  CD2   . PHE A 1 50  ? -29.609 13.242  46.999 1.00 42.55  ? 50   PHE A CD2   1 
ATOM   421  C  CE1   . PHE A 1 50  ? -32.044 11.931  47.248 1.00 44.70  ? 50   PHE A CE1   1 
ATOM   422  C  CE2   . PHE A 1 50  ? -30.708 13.911  47.518 1.00 45.70  ? 50   PHE A CE2   1 
ATOM   423  C  CZ    . PHE A 1 50  ? -31.930 13.253  47.645 1.00 46.99  ? 50   PHE A CZ    1 
ATOM   424  N  N     . ASP A 1 51  ? -26.022 11.614  43.941 1.00 32.93  ? 51   ASP A N     1 
ATOM   425  C  CA    . ASP A 1 51  ? -24.697 11.112  43.610 1.00 31.89  ? 51   ASP A CA    1 
ATOM   426  C  C     . ASP A 1 51  ? -24.106 10.441  44.856 1.00 33.67  ? 51   ASP A C     1 
ATOM   427  O  O     . ASP A 1 51  ? -24.751 10.438  45.911 1.00 35.66  ? 51   ASP A O     1 
ATOM   428  C  CB    . ASP A 1 51  ? -23.803 12.206  42.998 1.00 31.36  ? 51   ASP A CB    1 
ATOM   429  C  CG    . ASP A 1 51  ? -23.205 13.169  44.029 1.00 33.25  ? 51   ASP A CG    1 
ATOM   430  O  OD1   . ASP A 1 51  ? -23.303 12.943  45.253 1.00 33.04  ? 51   ASP A OD1   1 
ATOM   431  O  OD2   . ASP A 1 51  ? -22.593 14.168  43.592 1.00 35.56  ? 51   ASP A OD2   1 
ATOM   432  N  N     . ILE A 1 52  ? -22.901 9.883   44.750 1.00 33.09  ? 52   ILE A N     1 
ATOM   433  C  CA    . ILE A 1 52  ? -22.332 9.093   45.860 1.00 33.85  ? 52   ILE A CA    1 
ATOM   434  C  C     . ILE A 1 52  ? -22.018 9.899   47.125 1.00 34.91  ? 52   ILE A C     1 
ATOM   435  O  O     . ILE A 1 52  ? -22.054 9.361   48.237 1.00 36.49  ? 52   ILE A O     1 
ATOM   436  C  CB    . ILE A 1 52  ? -21.124 8.189   45.436 1.00 31.45  ? 52   ILE A CB    1 
ATOM   437  C  CG1   . ILE A 1 52  ? -19.950 9.020   44.919 1.00 30.47  ? 52   ILE A CG1   1 
ATOM   438  C  CG2   . ILE A 1 52  ? -21.570 7.157   44.404 1.00 28.84  ? 52   ILE A CG2   1 
ATOM   439  C  CD1   . ILE A 1 52  ? -18.663 8.223   44.721 1.00 28.41  ? 52   ILE A CD1   1 
ATOM   440  N  N     . TYR A 1 53  ? -21.760 11.190  46.947 1.00 35.30  ? 53   TYR A N     1 
ATOM   441  C  CA    . TYR A 1 53  ? -21.536 12.114  48.068 1.00 38.01  ? 53   TYR A CA    1 
ATOM   442  C  C     . TYR A 1 53  ? -22.837 12.711  48.606 1.00 39.85  ? 53   TYR A C     1 
ATOM   443  O  O     . TYR A 1 53  ? -22.814 13.550  49.510 1.00 40.53  ? 53   TYR A O     1 
ATOM   444  C  CB    . TYR A 1 53  ? -20.571 13.227  47.651 1.00 37.21  ? 53   TYR A CB    1 
ATOM   445  C  CG    . TYR A 1 53  ? -19.364 12.695  46.916 1.00 40.37  ? 53   TYR A CG    1 
ATOM   446  C  CD1   . TYR A 1 53  ? -19.308 12.718  45.521 1.00 35.68  ? 53   TYR A CD1   1 
ATOM   447  C  CD2   . TYR A 1 53  ? -18.281 12.133  47.617 1.00 41.71  ? 53   TYR A CD2   1 
ATOM   448  C  CE1   . TYR A 1 53  ? -18.201 12.215  44.838 1.00 37.84  ? 53   TYR A CE1   1 
ATOM   449  C  CE2   . TYR A 1 53  ? -17.170 11.626  46.941 1.00 40.92  ? 53   TYR A CE2   1 
ATOM   450  C  CZ    . TYR A 1 53  ? -17.137 11.672  45.553 1.00 40.72  ? 53   TYR A CZ    1 
ATOM   451  O  OH    . TYR A 1 53  ? -16.046 11.176  44.875 1.00 42.72  ? 53   TYR A OH    1 
ATOM   452  N  N     . GLY A 1 54  ? -23.963 12.280  48.034 1.00 41.51  ? 54   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 54  ? -25.297 12.656  48.514 1.00 42.76  ? 54   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 54  ? -25.877 13.932  47.938 1.00 43.22  ? 54   GLY A C     1 
ATOM   455  O  O     . GLY A 1 54  ? -26.909 14.410  48.406 1.00 44.15  ? 54   GLY A O     1 
ATOM   456  N  N     . LYS A 1 55  ? -25.214 14.492  46.930 1.00 43.81  ? 55   LYS A N     1 
ATOM   457  C  CA    . LYS A 1 55  ? -25.710 15.683  46.241 1.00 44.79  ? 55   LYS A CA    1 
ATOM   458  C  C     . LYS A 1 55  ? -26.817 15.285  45.270 1.00 42.76  ? 55   LYS A C     1 
ATOM   459  O  O     . LYS A 1 55  ? -26.688 14.289  44.563 1.00 43.34  ? 55   LYS A O     1 
ATOM   460  C  CB    . LYS A 1 55  ? -24.577 16.378  45.479 1.00 46.95  ? 55   LYS A CB    1 
ATOM   461  C  CG    . LYS A 1 55  ? -23.311 16.672  46.292 1.00 52.01  ? 55   LYS A CG    1 
ATOM   462  C  CD    . LYS A 1 55  ? -23.344 18.053  46.950 1.00 58.42  ? 55   LYS A CD    1 
ATOM   463  C  CE    . LYS A 1 55  ? -23.914 18.001  48.371 1.00 63.18  ? 55   LYS A CE    1 
ATOM   464  N  NZ    . LYS A 1 55  ? -23.750 19.304  49.082 1.00 63.11  ? 55   LYS A NZ    1 
ATOM   465  N  N     . PRO A 1 56  ? -27.906 16.068  45.219 1.00 42.21  ? 56   PRO A N     1 
ATOM   466  C  CA    . PRO A 1 56  ? -29.027 15.694  44.360 1.00 40.49  ? 56   PRO A CA    1 
ATOM   467  C  C     . PRO A 1 56  ? -28.724 15.827  42.868 1.00 37.69  ? 56   PRO A C     1 
ATOM   468  O  O     . PRO A 1 56  ? -28.026 16.744  42.446 1.00 36.37  ? 56   PRO A O     1 
ATOM   469  C  CB    . PRO A 1 56  ? -30.129 16.672  44.773 1.00 40.95  ? 56   PRO A CB    1 
ATOM   470  C  CG    . PRO A 1 56  ? -29.417 17.854  45.294 1.00 44.13  ? 56   PRO A CG    1 
ATOM   471  C  CD    . PRO A 1 56  ? -28.168 17.318  45.955 1.00 44.50  ? 56   PRO A CD    1 
ATOM   472  N  N     . CYS A 1 57  ? -29.245 14.902  42.078 1.00 35.93  ? 57   CYS A N     1 
ATOM   473  C  CA    . CYS A 1 57  ? -29.101 15.000  40.643 1.00 35.48  ? 57   CYS A CA    1 
ATOM   474  C  C     . CYS A 1 57  ? -30.441 14.996  39.921 1.00 38.09  ? 57   CYS A C     1 
ATOM   475  O  O     . CYS A 1 57  ? -31.448 14.499  40.431 1.00 40.44  ? 57   CYS A O     1 
ATOM   476  C  CB    . CYS A 1 57  ? -28.208 13.889  40.118 1.00 34.20  ? 57   CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 57  ? -26.541 14.013  40.733 1.00 34.97  ? 57   CYS A SG    1 
ATOM   478  N  N     . THR A 1 58  ? -30.435 15.558  38.722 1.00 37.78  ? 58   THR A N     1 
ATOM   479  C  CA    . THR A 1 58  ? -31.597 15.550  37.866 1.00 37.94  ? 58   THR A CA    1 
ATOM   480  C  C     . THR A 1 58  ? -31.376 14.527  36.731 1.00 35.30  ? 58   THR A C     1 
ATOM   481  O  O     . THR A 1 58  ? -30.297 14.455  36.148 1.00 36.13  ? 58   THR A O     1 
ATOM   482  C  CB    . THR A 1 58  ? -31.914 16.999  37.385 1.00 38.72  ? 58   THR A CB    1 
ATOM   483  O  OG1   . THR A 1 58  ? -33.279 17.089  36.967 1.00 41.55  ? 58   THR A OG1   1 
ATOM   484  C  CG2   . THR A 1 58  ? -30.975 17.468  36.266 1.00 41.04  ? 58   THR A CG2   1 
ATOM   485  N  N     . ARG A 1 59  ? -32.380 13.701  36.466 1.00 34.56  ? 59   ARG A N     1 
ATOM   486  C  CA    . ARG A 1 59  ? -32.305 12.732  35.371 1.00 35.29  ? 59   ARG A CA    1 
ATOM   487  C  C     . ARG A 1 59  ? -32.585 13.404  34.027 1.00 35.54  ? 59   ARG A C     1 
ATOM   488  O  O     . ARG A 1 59  ? -33.580 14.118  33.869 1.00 36.69  ? 59   ARG A O     1 
ATOM   489  C  CB    . ARG A 1 59  ? -33.261 11.536  35.589 1.00 35.00  ? 59   ARG A CB    1 
ATOM   490  C  CG    . ARG A 1 59  ? -33.248 10.538  34.424 1.00 38.47  ? 59   ARG A CG    1 
ATOM   491  C  CD    . ARG A 1 59  ? -33.777 9.169   34.785 1.00 37.61  ? 59   ARG A CD    1 
ATOM   492  N  NE    . ARG A 1 59  ? -35.206 9.054   34.532 1.00 44.12  ? 59   ARG A NE    1 
ATOM   493  C  CZ    . ARG A 1 59  ? -35.763 8.239   33.641 1.00 43.86  ? 59   ARG A CZ    1 
ATOM   494  N  NH1   . ARG A 1 59  ? -35.026 7.429   32.888 1.00 41.22  ? 59   ARG A NH1   1 
ATOM   495  N  NH2   . ARG A 1 59  ? -37.078 8.240   33.510 1.00 46.17  ? 59   ARG A NH2   1 
ATOM   496  N  N     . LYS A 1 60  ? -31.689 13.164  33.077 1.00 35.83  ? 60   LYS A N     1 
ATOM   497  C  CA    . LYS A 1 60  ? -31.826 13.620  31.705 1.00 36.20  ? 60   LYS A CA    1 
ATOM   498  C  C     . LYS A 1 60  ? -32.087 12.391  30.846 1.00 35.30  ? 60   LYS A C     1 
ATOM   499  O  O     . LYS A 1 60  ? -31.190 11.582  30.613 1.00 33.19  ? 60   LYS A O     1 
ATOM   500  C  CB    . LYS A 1 60  ? -30.537 14.319  31.254 1.00 38.27  ? 60   LYS A CB    1 
ATOM   501  C  CG    . LYS A 1 60  ? -30.304 15.717  31.849 1.00 43.98  ? 60   LYS A CG    1 
ATOM   502  C  CD    . LYS A 1 60  ? -30.789 16.815  30.890 1.00 50.46  ? 60   LYS A CD    1 
ATOM   503  C  CE    . LYS A 1 60  ? -30.834 18.194  31.550 1.00 53.15  ? 60   LYS A CE    1 
ATOM   504  N  NZ    . LYS A 1 60  ? -31.968 18.370  32.503 1.00 54.12  ? 60   LYS A NZ    1 
ATOM   505  N  N     . LEU A 1 61  ? -33.330 12.243  30.400 1.00 38.77  ? 61   LEU A N     1 
ATOM   506  C  CA    . LEU A 1 61  ? -33.744 11.113  29.567 1.00 39.22  ? 61   LEU A CA    1 
ATOM   507  C  C     . LEU A 1 61  ? -33.615 11.493  28.093 1.00 39.16  ? 61   LEU A C     1 
ATOM   508  O  O     . LEU A 1 61  ? -34.279 12.424  27.631 1.00 41.22  ? 61   LEU A O     1 
ATOM   509  C  CB    . LEU A 1 61  ? -35.181 10.702  29.927 1.00 39.44  ? 61   LEU A CB    1 
ATOM   510  C  CG    . LEU A 1 61  ? -35.885 9.426   29.415 1.00 42.02  ? 61   LEU A CG    1 
ATOM   511  C  CD1   . LEU A 1 61  ? -36.669 9.677   28.125 1.00 49.22  ? 61   LEU A CD1   1 
ATOM   512  C  CD2   . LEU A 1 61  ? -34.969 8.210   29.268 1.00 38.25  ? 61   LEU A CD2   1 
ATOM   513  N  N     . PHE A 1 62  ? -32.757 10.786  27.362 1.00 37.92  ? 62   PHE A N     1 
ATOM   514  C  CA    . PHE A 1 62  ? -32.489 11.120  25.954 1.00 38.88  ? 62   PHE A CA    1 
ATOM   515  C  C     . PHE A 1 62  ? -33.263 10.255  24.977 1.00 40.96  ? 62   PHE A C     1 
ATOM   516  O  O     . PHE A 1 62  ? -33.476 9.068   25.228 1.00 40.92  ? 62   PHE A O     1 
ATOM   517  C  CB    . PHE A 1 62  ? -31.002 11.020  25.643 1.00 36.47  ? 62   PHE A CB    1 
ATOM   518  C  CG    . PHE A 1 62  ? -30.159 11.938  26.461 1.00 35.81  ? 62   PHE A CG    1 
ATOM   519  C  CD1   . PHE A 1 62  ? -29.542 11.479  27.623 1.00 29.93  ? 62   PHE A CD1   1 
ATOM   520  C  CD2   . PHE A 1 62  ? -29.988 13.265  26.079 1.00 33.51  ? 62   PHE A CD2   1 
ATOM   521  C  CE1   . PHE A 1 62  ? -28.757 12.320  28.383 1.00 31.73  ? 62   PHE A CE1   1 
ATOM   522  C  CE2   . PHE A 1 62  ? -29.208 14.119  26.840 1.00 34.56  ? 62   PHE A CE2   1 
ATOM   523  C  CZ    . PHE A 1 62  ? -28.591 13.645  27.999 1.00 33.22  ? 62   PHE A CZ    1 
ATOM   524  N  N     . ALA A 1 63  ? -33.663 10.861  23.858 1.00 43.96  ? 63   ALA A N     1 
ATOM   525  C  CA    . ALA A 1 63  ? -34.469 10.187  22.837 1.00 47.25  ? 63   ALA A CA    1 
ATOM   526  C  C     . ALA A 1 63  ? -33.699 9.073   22.116 1.00 47.07  ? 63   ALA A C     1 
ATOM   527  O  O     . ALA A 1 63  ? -34.297 8.144   21.559 1.00 48.56  ? 63   ALA A O     1 
ATOM   528  C  CB    . ALA A 1 63  ? -35.031 11.201  21.831 1.00 48.78  ? 63   ALA A CB    1 
ATOM   529  N  N     . ASN A 1 64  ? -32.375 9.181   22.132 1.00 45.77  ? 64   ASN A N     1 
ATOM   530  C  CA    . ASN A 1 64  ? -31.498 8.152   21.582 1.00 46.60  ? 64   ASN A CA    1 
ATOM   531  C  C     . ASN A 1 64  ? -30.112 8.274   22.199 1.00 44.39  ? 64   ASN A C     1 
ATOM   532  O  O     . ASN A 1 64  ? -29.870 9.163   23.015 1.00 42.88  ? 64   ASN A O     1 
ATOM   533  C  CB    . ASN A 1 64  ? -31.437 8.238   20.054 1.00 46.66  ? 64   ASN A CB    1 
ATOM   534  C  CG    . ASN A 1 64  ? -31.082 9.630   19.565 1.00 51.31  ? 64   ASN A CG    1 
ATOM   535  O  OD1   . ASN A 1 64  ? -29.967 10.116  19.791 1.00 51.80  ? 64   ASN A OD1   1 
ATOM   536  N  ND2   . ASN A 1 64  ? -32.033 10.285  18.894 1.00 50.14  ? 64   ASN A ND2   1 
ATOM   537  N  N     . MET A 1 65  ? -29.207 7.387   21.801 1.00 45.74  ? 65   MET A N     1 
ATOM   538  C  CA    . MET A 1 65  ? -27.875 7.331   22.404 1.00 46.22  ? 65   MET A CA    1 
ATOM   539  C  C     . MET A 1 65  ? -26.911 8.393   21.888 1.00 47.43  ? 65   MET A C     1 
ATOM   540  O  O     . MET A 1 65  ? -25.979 8.792   22.597 1.00 47.01  ? 65   MET A O     1 
ATOM   541  C  CB    . MET A 1 65  ? -27.281 5.928   22.273 1.00 44.58  ? 65   MET A CB    1 
ATOM   542  C  CG    . MET A 1 65  ? -27.941 4.927   23.214 1.00 42.75  ? 65   MET A CG    1 
ATOM   543  S  SD    . MET A 1 65  ? -27.347 3.237   23.043 1.00 43.10  ? 65   MET A SD    1 
ATOM   544  C  CE    . MET A 1 65  ? -28.050 2.769   21.463 1.00 44.01  ? 65   MET A CE    1 
ATOM   545  N  N     . ARG A 1 66  ? -27.139 8.855   20.663 1.00 50.11  ? 66   ARG A N     1 
ATOM   546  C  CA    . ARG A 1 66  ? -26.349 9.950   20.118 1.00 53.62  ? 66   ARG A CA    1 
ATOM   547  C  C     . ARG A 1 66  ? -26.631 11.243  20.882 1.00 52.10  ? 66   ARG A C     1 
ATOM   548  O  O     . ARG A 1 66  ? -25.699 11.926  21.298 1.00 50.73  ? 66   ARG A O     1 
ATOM   549  C  CB    . ARG A 1 66  ? -26.602 10.121  18.618 1.00 58.72  ? 66   ARG A CB    1 
ATOM   550  C  CG    . ARG A 1 66  ? -25.916 9.055   17.762 1.00 67.11  ? 66   ARG A CG    1 
ATOM   551  C  CD    . ARG A 1 66  ? -26.238 9.235   16.280 1.00 76.61  ? 66   ARG A CD    1 
ATOM   552  N  NE    . ARG A 1 66  ? -26.041 7.998   15.522 1.00 81.21  ? 66   ARG A NE    1 
ATOM   553  C  CZ    . ARG A 1 66  ? -26.394 7.823   14.250 1.00 85.00  ? 66   ARG A CZ    1 
ATOM   554  N  NH1   . ARG A 1 66  ? -26.969 8.808   13.564 1.00 85.25  ? 66   ARG A NH1   1 
ATOM   555  N  NH2   . ARG A 1 66  ? -26.168 6.653   13.660 1.00 86.44  ? 66   ARG A NH2   1 
ATOM   556  N  N     . ASP A 1 67  ? -27.912 11.553  21.089 1.00 51.52  ? 67   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 67  ? -28.322 12.693  21.916 1.00 50.80  ? 67   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 67  ? -27.560 12.755  23.244 1.00 49.43  ? 67   ASP A C     1 
ATOM   559  O  O     . ASP A 1 67  ? -27.058 13.816  23.634 1.00 49.55  ? 67   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 67  ? -29.829 12.656  22.177 1.00 52.19  ? 67   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 67  ? -30.646 13.142  20.990 1.00 55.41  ? 67   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 67  ? -30.051 13.500  19.949 1.00 55.74  ? 67   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 67  ? -31.892 13.167  21.101 1.00 57.67  ? 67   ASP A OD2   1 
ATOM   564  N  N     . ALA A 1 68  ? -27.465 11.610  23.916 1.00 46.10  ? 68   ALA A N     1 
ATOM   565  C  CA    . ALA A 1 68  ? -26.769 11.501  25.188 1.00 44.62  ? 68   ALA A CA    1 
ATOM   566  C  C     . ALA A 1 68  ? -25.268 11.779  25.074 1.00 44.88  ? 68   ALA A C     1 
ATOM   567  O  O     . ALA A 1 68  ? -24.666 12.340  25.996 1.00 42.13  ? 68   ALA A O     1 
ATOM   568  C  CB    . ALA A 1 68  ? -27.007 10.134  25.788 1.00 44.38  ? 68   ALA A CB    1 
ATOM   569  N  N     . SER A 1 69  ? -24.671 11.376  23.950 1.00 45.77  ? 69   SER A N     1 
ATOM   570  C  CA    . SER A 1 69  ? -23.246 11.607  23.693 1.00 45.85  ? 69   SER A CA    1 
ATOM   571  C  C     . SER A 1 69  ? -22.938 13.078  23.418 1.00 47.03  ? 69   SER A C     1 
ATOM   572  O  O     . SER A 1 69  ? -21.994 13.634  23.979 1.00 46.16  ? 69   SER A O     1 
ATOM   573  C  CB    . SER A 1 69  ? -22.762 10.743  22.533 1.00 46.05  ? 69   SER A CB    1 
ATOM   574  O  OG    . SER A 1 69  ? -22.475 9.436   22.978 1.00 48.03  ? 69   SER A OG    1 
ATOM   575  N  N     . GLN A 1 70  ? -23.740 13.696  22.554 1.00 48.92  ? 70   GLN A N     1 
ATOM   576  C  CA    . GLN A 1 70  ? -23.642 15.125  22.275 1.00 50.70  ? 70   GLN A CA    1 
ATOM   577  C  C     . GLN A 1 70  ? -23.762 15.931  23.563 1.00 49.60  ? 70   GLN A C     1 
ATOM   578  O  O     . GLN A 1 70  ? -23.074 16.939  23.734 1.00 50.06  ? 70   GLN A O     1 
ATOM   579  C  CB    . GLN A 1 70  ? -24.740 15.579  21.302 1.00 54.27  ? 70   GLN A CB    1 
ATOM   580  C  CG    . GLN A 1 70  ? -24.800 14.844  19.955 1.00 60.79  ? 70   GLN A CG    1 
ATOM   581  C  CD    . GLN A 1 70  ? -23.584 15.081  19.057 1.00 67.71  ? 70   GLN A CD    1 
ATOM   582  O  OE1   . GLN A 1 70  ? -23.316 14.288  18.151 1.00 70.83  ? 70   GLN A OE1   1 
ATOM   583  N  NE2   . GLN A 1 70  ? -22.849 16.169  19.301 1.00 68.73  ? 70   GLN A NE2   1 
ATOM   584  N  N     . TRP A 1 71  ? -24.638 15.480  24.461 1.00 45.94  ? 71   TRP A N     1 
ATOM   585  C  CA    . TRP A 1 71  ? -24.881 16.181  25.714 1.00 42.98  ? 71   TRP A CA    1 
ATOM   586  C  C     . TRP A 1 71  ? -23.661 16.138  26.610 1.00 42.82  ? 71   TRP A C     1 
ATOM   587  O  O     . TRP A 1 71  ? -23.375 17.100  27.324 1.00 42.76  ? 71   TRP A O     1 
ATOM   588  C  CB    . TRP A 1 71  ? -26.085 15.599  26.447 1.00 41.37  ? 71   TRP A CB    1 
ATOM   589  C  CG    . TRP A 1 71  ? -26.419 16.354  27.685 1.00 39.06  ? 71   TRP A CG    1 
ATOM   590  C  CD1   . TRP A 1 71  ? -27.040 17.571  27.758 1.00 36.71  ? 71   TRP A CD1   1 
ATOM   591  C  CD2   . TRP A 1 71  ? -26.147 15.959  29.037 1.00 34.26  ? 71   TRP A CD2   1 
ATOM   592  N  NE1   . TRP A 1 71  ? -27.171 17.954  29.068 1.00 36.96  ? 71   TRP A NE1   1 
ATOM   593  C  CE2   . TRP A 1 71  ? -26.634 16.985  29.875 1.00 32.74  ? 71   TRP A CE2   1 
ATOM   594  C  CE3   . TRP A 1 71  ? -25.542 14.841  29.619 1.00 35.10  ? 71   TRP A CE3   1 
ATOM   595  C  CZ2   . TRP A 1 71  ? -26.537 16.927  31.263 1.00 27.42  ? 71   TRP A CZ2   1 
ATOM   596  C  CZ3   . TRP A 1 71  ? -25.440 14.786  31.003 1.00 32.99  ? 71   TRP A CZ3   1 
ATOM   597  C  CH2   . TRP A 1 71  ? -25.942 15.824  31.808 1.00 31.14  ? 71   TRP A CH2   1 
ATOM   598  N  N     . ILE A 1 72  ? -22.947 15.016  26.563 1.00 43.78  ? 72   ILE A N     1 
ATOM   599  C  CA    . ILE A 1 72  ? -21.693 14.863  27.288 1.00 44.06  ? 72   ILE A CA    1 
ATOM   600  C  C     . ILE A 1 72  ? -20.670 15.894  26.799 1.00 44.40  ? 72   ILE A C     1 
ATOM   601  O  O     . ILE A 1 72  ? -19.999 16.541  27.606 1.00 44.83  ? 72   ILE A O     1 
ATOM   602  C  CB    . ILE A 1 72  ? -21.155 13.411  27.187 1.00 43.97  ? 72   ILE A CB    1 
ATOM   603  C  CG1   . ILE A 1 72  ? -22.057 12.467  27.980 1.00 45.86  ? 72   ILE A CG1   1 
ATOM   604  C  CG2   . ILE A 1 72  ? -19.721 13.307  27.715 1.00 42.87  ? 72   ILE A CG2   1 
ATOM   605  C  CD1   . ILE A 1 72  ? -21.920 10.998  27.596 1.00 48.60  ? 72   ILE A CD1   1 
ATOM   606  N  N     . LYS A 1 73  ? -20.582 16.062  25.481 1.00 46.40  ? 73   LYS A N     1 
ATOM   607  C  CA    . LYS A 1 73  ? -19.681 17.044  24.875 1.00 48.58  ? 73   LYS A CA    1 
ATOM   608  C  C     . LYS A 1 73  ? -20.046 18.468  25.295 1.00 47.75  ? 73   LYS A C     1 
ATOM   609  O  O     . LYS A 1 73  ? -19.178 19.248  25.691 1.00 47.49  ? 73   LYS A O     1 
ATOM   610  C  CB    . LYS A 1 73  ? -19.694 16.936  23.349 1.00 51.18  ? 73   LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 73  ? -19.282 15.574  22.791 1.00 58.02  ? 73   LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 73  ? -19.292 15.581  21.247 1.00 64.28  ? 73   LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 73  ? -19.097 14.178  20.646 1.00 65.45  ? 73   LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 73  ? -17.685 13.693  20.704 1.00 60.22  ? 73   LYS A NZ    1 
ATOM   615  N  N     . ARG A 1 74  ? -21.332 18.799  25.219 1.00 47.07  ? 74   ARG A N     1 
ATOM   616  C  CA    . ARG A 1 74  ? -21.799 20.126  25.604 1.00 47.37  ? 74   ARG A CA    1 
ATOM   617  C  C     . ARG A 1 74  ? -21.507 20.426  27.073 1.00 47.85  ? 74   ARG A C     1 
ATOM   618  O  O     . ARG A 1 74  ? -21.066 21.532  27.398 1.00 47.85  ? 74   ARG A O     1 
ATOM   619  C  CB    . ARG A 1 74  ? -23.283 20.312  25.290 1.00 48.51  ? 74   ARG A CB    1 
ATOM   620  C  CG    . ARG A 1 74  ? -23.591 20.482  23.812 1.00 49.09  ? 74   ARG A CG    1 
ATOM   621  C  CD    . ARG A 1 74  ? -24.958 21.148  23.588 1.00 53.63  ? 74   ARG A CD    1 
ATOM   622  N  NE    . ARG A 1 74  ? -26.086 20.315  24.014 1.00 53.99  ? 74   ARG A NE    1 
ATOM   623  C  CZ    . ARG A 1 74  ? -26.573 19.278  23.329 1.00 53.63  ? 74   ARG A CZ    1 
ATOM   624  N  NH1   . ARG A 1 74  ? -26.034 18.914  22.171 1.00 56.46  ? 74   ARG A NH1   1 
ATOM   625  N  NH2   . ARG A 1 74  ? -27.599 18.592  23.810 1.00 50.88  ? 74   ARG A NH2   1 
ATOM   626  N  N     . MET A 1 75  ? -21.732 19.440  27.947 1.00 47.28  ? 75   MET A N     1 
ATOM   627  C  CA    . MET A 1 75  ? -21.399 19.574  29.372 1.00 46.40  ? 75   MET A CA    1 
ATOM   628  C  C     . MET A 1 75  ? -19.908 19.828  29.598 1.00 49.39  ? 75   MET A C     1 
ATOM   629  O  O     . MET A 1 75  ? -19.543 20.618  30.476 1.00 51.82  ? 75   MET A O     1 
ATOM   630  C  CB    . MET A 1 75  ? -21.854 18.352  30.182 1.00 43.87  ? 75   MET A CB    1 
ATOM   631  C  CG    . MET A 1 75  ? -23.366 18.205  30.336 1.00 38.50  ? 75   MET A CG    1 
ATOM   632  S  SD    . MET A 1 75  ? -24.174 19.552  31.233 1.00 38.87  ? 75   MET A SD    1 
ATOM   633  C  CE    . MET A 1 75  ? -23.930 19.060  32.930 1.00 32.48  ? 75   MET A CE    1 
ATOM   634  N  N     . GLU A 1 76  ? -19.055 19.165  28.810 1.00 50.31  ? 76   GLU A N     1 
ATOM   635  C  CA    . GLU A 1 76  ? -17.606 19.403  28.863 1.00 52.16  ? 76   GLU A CA    1 
ATOM   636  C  C     . GLU A 1 76  ? -17.266 20.841  28.444 1.00 51.58  ? 76   GLU A C     1 
ATOM   637  O  O     . GLU A 1 76  ? -16.411 21.486  29.055 1.00 49.47  ? 76   GLU A O     1 
ATOM   638  C  CB    . GLU A 1 76  ? -16.837 18.390  27.995 1.00 54.85  ? 76   GLU A CB    1 
ATOM   639  C  CG    . GLU A 1 76  ? -15.297 18.518  28.099 1.00 62.46  ? 76   GLU A CG    1 
ATOM   640  C  CD    . GLU A 1 76  ? -14.517 17.562  27.192 1.00 64.53  ? 76   GLU A CD    1 
ATOM   641  O  OE1   . GLU A 1 76  ? -13.571 16.912  27.695 1.00 64.31  ? 76   GLU A OE1   1 
ATOM   642  O  OE2   . GLU A 1 76  ? -14.833 17.468  25.985 1.00 65.01  ? 76   GLU A OE2   1 
ATOM   643  N  N     . ASP A 1 77  ? -17.959 21.328  27.412 1.00 51.69  ? 77   ASP A N     1 
ATOM   644  C  CA    . ASP A 1 77  ? -17.776 22.679  26.888 1.00 51.52  ? 77   ASP A CA    1 
ATOM   645  C  C     . ASP A 1 77  ? -18.289 23.750  27.845 1.00 51.53  ? 77   ASP A C     1 
ATOM   646  O  O     . ASP A 1 77  ? -17.905 24.916  27.737 1.00 53.65  ? 77   ASP A O     1 
ATOM   647  C  CB    . ASP A 1 77  ? -18.479 22.832  25.535 1.00 54.21  ? 77   ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 77  ? -17.911 21.908  24.455 1.00 55.22  ? 77   ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 77  ? -16.701 21.579  24.496 1.00 52.64  ? 77   ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 77  ? -18.691 21.523  23.553 1.00 56.09  ? 77   ASP A OD2   1 
ATOM   651  N  N     . ILE A 1 78  ? -19.169 23.363  28.765 1.00 49.08  ? 78   ILE A N     1 
ATOM   652  C  CA    . ILE A 1 78  ? -19.661 24.294  29.775 1.00 46.03  ? 78   ILE A CA    1 
ATOM   653  C  C     . ILE A 1 78  ? -18.742 24.252  30.995 1.00 45.63  ? 78   ILE A C     1 
ATOM   654  O  O     . ILE A 1 78  ? -18.417 25.291  31.570 1.00 46.98  ? 78   ILE A O     1 
ATOM   655  C  CB    . ILE A 1 78  ? -21.141 24.023  30.152 1.00 45.07  ? 78   ILE A CB    1 
ATOM   656  C  CG1   . ILE A 1 78  ? -22.057 24.286  28.947 1.00 45.37  ? 78   ILE A CG1   1 
ATOM   657  C  CG2   . ILE A 1 78  ? -21.572 24.892  31.321 1.00 42.59  ? 78   ILE A CG2   1 
ATOM   658  C  CD1   . ILE A 1 78  ? -23.525 23.881  29.149 1.00 40.73  ? 78   ILE A CD1   1 
ATOM   659  N  N     . GLY A 1 79  ? -18.310 23.049  31.363 1.00 44.09  ? 79   GLY A N     1 
ATOM   660  C  CA    . GLY A 1 79  ? -17.461 22.847  32.532 1.00 42.00  ? 79   GLY A CA    1 
ATOM   661  C  C     . GLY A 1 79  ? -18.204 22.239  33.711 1.00 41.63  ? 79   GLY A C     1 
ATOM   662  O  O     . GLY A 1 79  ? -17.838 22.485  34.860 1.00 42.24  ? 79   GLY A O     1 
ATOM   663  N  N     . LEU A 1 80  ? -19.246 21.448  33.430 1.00 39.88  ? 80   LEU A N     1 
ATOM   664  C  CA    . LEU A 1 80  ? -20.039 20.758  34.475 1.00 37.27  ? 80   LEU A CA    1 
ATOM   665  C  C     . LEU A 1 80  ? -20.055 19.250  34.265 1.00 36.48  ? 80   LEU A C     1 
ATOM   666  O  O     . LEU A 1 80  ? -20.070 18.785  33.130 1.00 37.67  ? 80   LEU A O     1 
ATOM   667  C  CB    . LEU A 1 80  ? -21.483 21.265  34.520 1.00 33.73  ? 80   LEU A CB    1 
ATOM   668  C  CG    . LEU A 1 80  ? -21.727 22.731  34.866 1.00 32.54  ? 80   LEU A CG    1 
ATOM   669  C  CD1   . LEU A 1 80  ? -23.146 23.146  34.475 1.00 32.03  ? 80   LEU A CD1   1 
ATOM   670  C  CD2   . LEU A 1 80  ? -21.463 23.011  36.334 1.00 26.81  ? 80   LEU A CD2   1 
ATOM   671  N  N     . GLU A 1 81  ? -20.068 18.506  35.372 1.00 35.61  ? 81   GLU A N     1 
ATOM   672  C  CA    . GLU A 1 81  ? -20.000 17.046  35.375 1.00 34.35  ? 81   GLU A CA    1 
ATOM   673  C  C     . GLU A 1 81  ? -21.229 16.443  34.731 1.00 35.81  ? 81   GLU A C     1 
ATOM   674  O  O     . GLU A 1 81  ? -22.357 16.903  34.968 1.00 36.27  ? 81   GLU A O     1 
ATOM   675  C  CB    . GLU A 1 81  ? -19.886 16.530  36.814 1.00 34.79  ? 81   GLU A CB    1 
ATOM   676  C  CG    . GLU A 1 81  ? -19.538 15.058  36.942 1.00 34.52  ? 81   GLU A CG    1 
ATOM   677  C  CD    . GLU A 1 81  ? -19.337 14.602  38.384 1.00 36.91  ? 81   GLU A CD    1 
ATOM   678  O  OE1   . GLU A 1 81  ? -19.520 15.409  39.314 1.00 37.39  ? 81   GLU A OE1   1 
ATOM   679  O  OE2   . GLU A 1 81  ? -18.989 13.421  38.595 1.00 41.85  ? 81   GLU A OE2   1 
ATOM   680  N  N     . ALA A 1 82  ? -21.001 15.417  33.913 1.00 35.09  ? 82   ALA A N     1 
ATOM   681  C  CA    . ALA A 1 82  ? -22.078 14.634  33.311 1.00 32.50  ? 82   ALA A CA    1 
ATOM   682  C  C     . ALA A 1 82  ? -22.107 13.235  33.946 1.00 30.90  ? 82   ALA A C     1 
ATOM   683  O  O     . ALA A 1 82  ? -21.310 12.367  33.598 1.00 30.21  ? 82   ALA A O     1 
ATOM   684  C  CB    . ALA A 1 82  ? -21.890 14.556  31.805 1.00 31.82  ? 82   ALA A CB    1 
ATOM   685  N  N     . LEU A 1 83  ? -23.023 13.027  34.888 1.00 30.72  ? 83   LEU A N     1 
ATOM   686  C  CA    . LEU A 1 83  ? -23.027 11.808  35.699 1.00 29.93  ? 83   LEU A CA    1 
ATOM   687  C  C     . LEU A 1 83  ? -23.787 10.668  35.032 1.00 30.29  ? 83   LEU A C     1 
ATOM   688  O  O     . LEU A 1 83  ? -24.582 10.900  34.112 1.00 28.18  ? 83   LEU A O     1 
ATOM   689  C  CB    . LEU A 1 83  ? -23.585 12.087  37.103 1.00 30.60  ? 83   LEU A CB    1 
ATOM   690  C  CG    . LEU A 1 83  ? -22.770 12.999  38.042 1.00 31.97  ? 83   LEU A CG    1 
ATOM   691  C  CD1   . LEU A 1 83  ? -22.945 14.476  37.702 1.00 33.81  ? 83   LEU A CD1   1 
ATOM   692  C  CD2   . LEU A 1 83  ? -23.183 12.770  39.482 1.00 29.19  ? 83   LEU A CD2   1 
ATOM   693  N  N     . GLY A 1 84  ? -23.521 9.441   35.495 1.00 30.79  ? 84   GLY A N     1 
ATOM   694  C  CA    . GLY A 1 84  ? -24.216 8.241   35.016 1.00 31.31  ? 84   GLY A CA    1 
ATOM   695  C  C     . GLY A 1 84  ? -23.349 7.303   34.184 1.00 31.95  ? 84   GLY A C     1 
ATOM   696  O  O     . GLY A 1 84  ? -22.227 7.649   33.801 1.00 30.16  ? 84   GLY A O     1 
ATOM   697  N  N     . MET A 1 85  ? -23.870 6.105   33.912 1.00 31.63  ? 85   MET A N     1 
ATOM   698  C  CA    . MET A 1 85  ? -23.177 5.136   33.059 1.00 30.43  ? 85   MET A CA    1 
ATOM   699  C  C     . MET A 1 85  ? -23.138 5.629   31.617 1.00 32.31  ? 85   MET A C     1 
ATOM   700  O  O     . MET A 1 85  ? -24.174 5.747   30.960 1.00 33.16  ? 85   MET A O     1 
ATOM   701  C  CB    . MET A 1 85  ? -23.842 3.758   33.141 1.00 26.75  ? 85   MET A CB    1 
ATOM   702  C  CG    . MET A 1 85  ? -23.203 2.687   32.263 1.00 24.34  ? 85   MET A CG    1 
ATOM   703  S  SD    . MET A 1 85  ? -21.392 2.536   32.374 1.00 31.56  ? 85   MET A SD    1 
ATOM   704  C  CE    . MET A 1 85  ? -21.169 1.934   34.045 1.00 26.13  ? 85   MET A CE    1 
ATOM   705  N  N     . ASP A 1 86  ? -21.936 5.916   31.137 1.00 33.04  ? 86   ASP A N     1 
ATOM   706  C  CA    . ASP A 1 86  ? -21.731 6.470   29.800 1.00 34.49  ? 86   ASP A CA    1 
ATOM   707  C  C     . ASP A 1 86  ? -21.506 5.375   28.757 1.00 36.16  ? 86   ASP A C     1 
ATOM   708  O  O     . ASP A 1 86  ? -21.568 5.637   27.547 1.00 37.77  ? 86   ASP A O     1 
ATOM   709  C  CB    . ASP A 1 86  ? -20.527 7.398   29.821 1.00 32.16  ? 86   ASP A CB    1 
ATOM   710  C  CG    . ASP A 1 86  ? -19.335 6.755   30.466 1.00 34.56  ? 86   ASP A CG    1 
ATOM   711  O  OD1   . ASP A 1 86  ? -18.403 6.356   29.733 1.00 42.33  ? 86   ASP A OD1   1 
ATOM   712  O  OD2   . ASP A 1 86  ? -19.341 6.618   31.707 1.00 29.23  ? 86   ASP A OD2   1 
ATOM   713  N  N     . ASP A 1 87  ? -21.214 4.163   29.231 1.00 36.28  ? 87   ASP A N     1 
ATOM   714  C  CA    . ASP A 1 87  ? -21.162 2.983   28.372 1.00 35.58  ? 87   ASP A CA    1 
ATOM   715  C  C     . ASP A 1 87  ? -22.557 2.392   28.335 1.00 34.54  ? 87   ASP A C     1 
ATOM   716  O  O     . ASP A 1 87  ? -22.943 1.641   29.227 1.00 35.11  ? 87   ASP A O     1 
ATOM   717  C  CB    . ASP A 1 87  ? -20.157 1.959   28.905 1.00 36.93  ? 87   ASP A CB    1 
ATOM   718  C  CG    . ASP A 1 87  ? -20.034 0.722   28.012 1.00 36.52  ? 87   ASP A CG    1 
ATOM   719  O  OD1   . ASP A 1 87  ? -20.865 0.536   27.101 1.00 31.86  ? 87   ASP A OD1   1 
ATOM   720  O  OD2   . ASP A 1 87  ? -19.089 -0.073  28.228 1.00 39.78  ? 87   ASP A OD2   1 
ATOM   721  N  N     . PHE A 1 88  ? -23.306 2.728   27.290 1.00 33.93  ? 88   PHE A N     1 
ATOM   722  C  CA    . PHE A 1 88  ? -24.739 2.460   27.278 1.00 36.90  ? 88   PHE A CA    1 
ATOM   723  C  C     . PHE A 1 88  ? -25.129 0.989   27.283 1.00 38.68  ? 88   PHE A C     1 
ATOM   724  O  O     . PHE A 1 88  ? -26.177 0.639   27.836 1.00 41.90  ? 88   PHE A O     1 
ATOM   725  C  CB    . PHE A 1 88  ? -25.453 3.222   26.154 1.00 37.65  ? 88   PHE A CB    1 
ATOM   726  C  CG    . PHE A 1 88  ? -25.189 4.696   26.172 1.00 37.40  ? 88   PHE A CG    1 
ATOM   727  C  CD1   . PHE A 1 88  ? -25.596 5.472   27.252 1.00 38.08  ? 88   PHE A CD1   1 
ATOM   728  C  CD2   . PHE A 1 88  ? -24.510 5.302   25.126 1.00 37.38  ? 88   PHE A CD2   1 
ATOM   729  C  CE1   . PHE A 1 88  ? -25.332 6.834   27.286 1.00 42.48  ? 88   PHE A CE1   1 
ATOM   730  C  CE2   . PHE A 1 88  ? -24.244 6.660   25.144 1.00 39.15  ? 88   PHE A CE2   1 
ATOM   731  C  CZ    . PHE A 1 88  ? -24.655 7.432   26.228 1.00 42.03  ? 88   PHE A CZ    1 
ATOM   732  N  N     . LYS A 1 89  ? -24.313 0.117   26.695 1.00 38.01  ? 89   LYS A N     1 
ATOM   733  C  CA    . LYS A 1 89  ? -24.672 -1.301  26.744 1.00 39.34  ? 89   LYS A CA    1 
ATOM   734  C  C     . LYS A 1 89  ? -24.674 -1.840  28.183 1.00 38.42  ? 89   LYS A C     1 
ATOM   735  O  O     . LYS A 1 89  ? -25.419 -2.767  28.506 1.00 37.77  ? 89   LYS A O     1 
ATOM   736  C  CB    . LYS A 1 89  ? -23.860 -2.171  25.774 1.00 38.80  ? 89   LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 89  ? -22.389 -1.952  25.781 1.00 38.91  ? 89   LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 89  ? -21.794 -2.451  24.476 1.00 42.08  ? 89   LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 89  ? -20.281 -2.375  24.502 1.00 41.17  ? 89   LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 89  ? -19.831 -0.965  24.616 1.00 41.78  ? 89   LYS A NZ    1 
ATOM   741  N  N     . LEU A 1 90  ? -23.880 -1.222  29.053 1.00 36.88  ? 90   LEU A N     1 
ATOM   742  C  CA    . LEU A 1 90  ? -23.907 -1.582  30.464 1.00 33.84  ? 90   LEU A CA    1 
ATOM   743  C  C     . LEU A 1 90  ? -25.183 -1.087  31.152 1.00 33.16  ? 90   LEU A C     1 
ATOM   744  O  O     . LEU A 1 90  ? -25.757 -1.790  31.988 1.00 31.49  ? 90   LEU A O     1 
ATOM   745  C  CB    . LEU A 1 90  ? -22.644 -1.112  31.182 1.00 31.94  ? 90   LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 90  ? -21.322 -1.718  30.669 1.00 31.32  ? 90   LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 90  ? -20.191 -1.493  31.658 1.00 32.59  ? 90   LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 90  ? -21.427 -3.200  30.374 1.00 31.69  ? 90   LEU A CD2   1 
ATOM   749  N  N     . ALA A 1 91  ? -25.645 0.103   30.781 1.00 31.19  ? 91   ALA A N     1 
ATOM   750  C  CA    . ALA A 1 91  ? -26.913 0.594   31.311 1.00 29.39  ? 91   ALA A CA    1 
ATOM   751  C  C     . ALA A 1 91  ? -28.039 -0.319  30.834 1.00 29.98  ? 91   ALA A C     1 
ATOM   752  O  O     . ALA A 1 91  ? -28.883 -0.756  31.635 1.00 27.43  ? 91   ALA A O     1 
ATOM   753  C  CB    . ALA A 1 91  ? -27.157 2.034   30.908 1.00 29.23  ? 91   ALA A CB    1 
ATOM   754  N  N     . TYR A 1 92  ? -28.014 -0.641  29.539 1.00 29.07  ? 92   TYR A N     1 
ATOM   755  C  CA    . TYR A 1 92  ? -29.014 -1.515  28.935 1.00 28.29  ? 92   TYR A CA    1 
ATOM   756  C  C     . TYR A 1 92  ? -29.096 -2.842  29.673 1.00 28.59  ? 92   TYR A C     1 
ATOM   757  O  O     . TYR A 1 92  ? -30.176 -3.256  30.100 1.00 30.90  ? 92   TYR A O     1 
ATOM   758  C  CB    . TYR A 1 92  ? -28.728 -1.742  27.438 1.00 30.85  ? 92   TYR A CB    1 
ATOM   759  C  CG    . TYR A 1 92  ? -29.661 -2.759  26.805 1.00 33.00  ? 92   TYR A CG    1 
ATOM   760  C  CD1   . TYR A 1 92  ? -29.276 -4.092  26.654 1.00 32.28  ? 92   TYR A CD1   1 
ATOM   761  C  CD2   . TYR A 1 92  ? -30.941 -2.396  26.403 1.00 31.96  ? 92   TYR A CD2   1 
ATOM   762  C  CE1   . TYR A 1 92  ? -30.142 -5.027  26.104 1.00 34.51  ? 92   TYR A CE1   1 
ATOM   763  C  CE2   . TYR A 1 92  ? -31.811 -3.320  25.861 1.00 33.83  ? 92   TYR A CE2   1 
ATOM   764  C  CZ    . TYR A 1 92  ? -31.412 -4.628  25.707 1.00 34.95  ? 92   TYR A CZ    1 
ATOM   765  O  OH    . TYR A 1 92  ? -32.288 -5.532  25.157 1.00 37.89  ? 92   TYR A OH    1 
ATOM   766  N  N     . LEU A 1 93  ? -27.956 -3.511  29.816 1.00 28.37  ? 93   LEU A N     1 
ATOM   767  C  CA    . LEU A 1 93  ? -27.915 -4.798  30.508 1.00 29.48  ? 93   LEU A CA    1 
ATOM   768  C  C     . LEU A 1 93  ? -28.453 -4.660  31.916 1.00 29.70  ? 93   LEU A C     1 
ATOM   769  O  O     . LEU A 1 93  ? -29.219 -5.515  32.367 1.00 30.91  ? 93   LEU A O     1 
ATOM   770  C  CB    . LEU A 1 93  ? -26.506 -5.413  30.516 1.00 25.44  ? 93   LEU A CB    1 
ATOM   771  C  CG    . LEU A 1 93  ? -26.012 -6.004  29.184 1.00 27.77  ? 93   LEU A CG    1 
ATOM   772  C  CD1   . LEU A 1 93  ? -24.601 -6.590  29.336 1.00 28.02  ? 93   LEU A CD1   1 
ATOM   773  C  CD2   . LEU A 1 93  ? -26.961 -7.047  28.595 1.00 22.52  ? 93   LEU A CD2   1 
ATOM   774  N  N     . SER A 1 94  ? -28.071 -3.571  32.585 1.00 28.55  ? 94   SER A N     1 
ATOM   775  C  CA    . SER A 1 94  ? -28.530 -3.275  33.944 1.00 28.57  ? 94   SER A CA    1 
ATOM   776  C  C     . SER A 1 94  ? -30.043 -3.083  34.027 1.00 31.89  ? 94   SER A C     1 
ATOM   777  O  O     . SER A 1 94  ? -30.681 -3.595  34.949 1.00 34.61  ? 94   SER A O     1 
ATOM   778  C  CB    . SER A 1 94  ? -27.815 -2.044  34.500 1.00 26.99  ? 94   SER A CB    1 
ATOM   779  O  OG    . SER A 1 94  ? -28.189 -1.801  35.843 1.00 28.99  ? 94   SER A OG    1 
ATOM   780  N  N     . ASP A 1 95  ? -30.604 -2.341  33.071 1.00 33.89  ? 95   ASP A N     1 
ATOM   781  C  CA    . ASP A 1 95  ? -32.058 -2.118  32.976 1.00 36.05  ? 95   ASP A CA    1 
ATOM   782  C  C     . ASP A 1 95  ? -32.839 -3.358  32.542 1.00 39.03  ? 95   ASP A C     1 
ATOM   783  O  O     . ASP A 1 95  ? -33.977 -3.558  32.974 1.00 38.14  ? 95   ASP A O     1 
ATOM   784  C  CB    . ASP A 1 95  ? -32.378 -0.981  31.998 1.00 35.17  ? 95   ASP A CB    1 
ATOM   785  C  CG    . ASP A 1 95  ? -32.097 0.398   32.576 1.00 36.34  ? 95   ASP A CG    1 
ATOM   786  O  OD1   . ASP A 1 95  ? -31.858 1.330   31.773 1.00 34.50  ? 95   ASP A OD1   1 
ATOM   787  O  OD2   . ASP A 1 95  ? -32.121 0.552   33.818 1.00 35.13  ? 95   ASP A OD2   1 
ATOM   788  N  N     . THR A 1 96  ? -32.230 -4.174  31.681 1.00 40.68  ? 96   THR A N     1 
ATOM   789  C  CA    . THR A 1 96  ? -32.896 -5.358  31.130 1.00 42.95  ? 96   THR A CA    1 
ATOM   790  C  C     . THR A 1 96  ? -32.837 -6.578  32.054 1.00 42.85  ? 96   THR A C     1 
ATOM   791  O  O     . THR A 1 96  ? -33.732 -7.428  32.024 1.00 44.46  ? 96   THR A O     1 
ATOM   792  C  CB    . THR A 1 96  ? -32.333 -5.720  29.744 1.00 42.55  ? 96   THR A CB    1 
ATOM   793  O  OG1   . THR A 1 96  ? -32.276 -4.535  28.940 1.00 45.25  ? 96   THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 96  ? -33.211 -6.763  29.050 1.00 42.58  ? 96   THR A CG2   1 
ATOM   795  N  N     . TYR A 1 97  ? -31.780 -6.664  32.858 1.00 42.00  ? 97   TYR A N     1 
ATOM   796  C  CA    . TYR A 1 97  ? -31.624 -7.748  33.823 1.00 41.72  ? 97   TYR A CA    1 
ATOM   797  C  C     . TYR A 1 97  ? -31.390 -7.133  35.183 1.00 42.86  ? 97   TYR A C     1 
ATOM   798  O  O     . TYR A 1 97  ? -30.269 -7.111  35.680 1.00 42.58  ? 97   TYR A O     1 
ATOM   799  C  CB    . TYR A 1 97  ? -30.495 -8.711  33.403 1.00 39.77  ? 97   TYR A CB    1 
ATOM   800  C  CG    . TYR A 1 97  ? -30.736 -9.244  32.015 1.00 39.78  ? 97   TYR A CG    1 
ATOM   801  C  CD1   . TYR A 1 97  ? -30.137 -8.647  30.904 1.00 38.13  ? 97   TYR A CD1   1 
ATOM   802  C  CD2   . TYR A 1 97  ? -31.628 -10.297 31.803 1.00 38.08  ? 97   TYR A CD2   1 
ATOM   803  C  CE1   . TYR A 1 97  ? -30.398 -9.104  29.621 1.00 40.21  ? 97   TYR A CE1   1 
ATOM   804  C  CE2   . TYR A 1 97  ? -31.892 -10.763 30.528 1.00 40.61  ? 97   TYR A CE2   1 
ATOM   805  C  CZ    . TYR A 1 97  ? -31.278 -10.163 29.439 1.00 40.57  ? 97   TYR A CZ    1 
ATOM   806  O  OH    . TYR A 1 97  ? -31.545 -10.626 28.174 1.00 37.69  ? 97   TYR A OH    1 
ATOM   807  N  N     . ASN A 1 98  ? -32.465 -6.607  35.763 1.00 44.43  ? 98   ASN A N     1 
ATOM   808  C  CA    . ASN A 1 98  ? -32.425 -6.020  37.089 1.00 47.00  ? 98   ASN A CA    1 
ATOM   809  C  C     . ASN A 1 98  ? -32.747 -7.088  38.131 1.00 47.45  ? 98   ASN A C     1 
ATOM   810  O  O     . ASN A 1 98  ? -33.806 -7.078  38.764 1.00 49.22  ? 98   ASN A O     1 
ATOM   811  C  CB    . ASN A 1 98  ? -33.387 -4.834  37.189 1.00 51.80  ? 98   ASN A CB    1 
ATOM   812  C  CG    . ASN A 1 98  ? -33.125 -3.974  38.414 1.00 56.08  ? 98   ASN A CG    1 
ATOM   813  O  OD1   . ASN A 1 98  ? -32.002 -3.491  38.631 1.00 51.99  ? 98   ASN A OD1   1 
ATOM   814  N  ND2   . ASN A 1 98  ? -34.165 -3.777  39.225 1.00 57.85  ? 98   ASN A ND2   1 
ATOM   815  N  N     . TYR A 1 99  ? -31.807 -8.017  38.262 1.00 45.90  ? 99   TYR A N     1 
ATOM   816  C  CA    . TYR A 1 99  ? -31.863 -9.156  39.156 1.00 46.63  ? 99   TYR A CA    1 
ATOM   817  C  C     . TYR A 1 99  ? -30.562 -9.942  38.961 1.00 47.73  ? 99   TYR A C     1 
ATOM   818  O  O     . TYR A 1 99  ? -29.863 -9.745  37.960 1.00 46.21  ? 99   TYR A O     1 
ATOM   819  C  CB    . TYR A 1 99  ? -33.084 -10.042 38.874 1.00 46.94  ? 99   TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 99  ? -33.242 -10.527 37.435 1.00 48.70  ? 99   TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 99  ? -34.129 -9.894  36.553 1.00 47.77  ? 99   TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 99  ? -32.533 -11.642 36.965 1.00 48.80  ? 99   TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 99  ? -34.292 -10.351 35.238 1.00 45.94  ? 99   TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 99  ? -32.684 -12.101 35.655 1.00 44.93  ? 99   TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 99  ? -33.566 -11.454 34.800 1.00 44.79  ? 99   TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 99  ? -33.721 -11.917 33.514 1.00 40.45  ? 99   TYR A OH    1 
ATOM   827  N  N     . GLU A 1 100 ? -30.239 -10.811 39.920 1.00 48.30  ? 100  GLU A N     1 
ATOM   828  C  CA    . GLU A 1 100 ? -29.039 -11.649 39.867 1.00 48.03  ? 100  GLU A CA    1 
ATOM   829  C  C     . GLU A 1 100 ? -29.187 -12.679 38.748 1.00 46.97  ? 100  GLU A C     1 
ATOM   830  O  O     . GLU A 1 100 ? -30.092 -13.518 38.784 1.00 46.28  ? 100  GLU A O     1 
ATOM   831  C  CB    . GLU A 1 100 ? -28.819 -12.339 41.222 1.00 50.37  ? 100  GLU A CB    1 
ATOM   832  C  CG    . GLU A 1 100 ? -27.521 -13.149 41.361 1.00 54.00  ? 100  GLU A CG    1 
ATOM   833  C  CD    . GLU A 1 100 ? -27.466 -13.982 42.649 1.00 57.77  ? 100  GLU A CD    1 
ATOM   834  O  OE1   . GLU A 1 100 ? -26.760 -15.012 42.660 1.00 60.38  ? 100  GLU A OE1   1 
ATOM   835  O  OE2   . GLU A 1 100 ? -28.126 -13.618 43.649 1.00 58.30  ? 100  GLU A OE2   1 
ATOM   836  N  N     . ILE A 1 101 ? -28.301 -12.604 37.758 1.00 44.93  ? 101  ILE A N     1 
ATOM   837  C  CA    . ILE A 1 101 ? -28.397 -13.456 36.582 1.00 44.68  ? 101  ILE A CA    1 
ATOM   838  C  C     . ILE A 1 101 ? -28.106 -14.911 36.916 1.00 45.05  ? 101  ILE A C     1 
ATOM   839  O  O     . ILE A 1 101 ? -27.021 -15.254 37.376 1.00 45.00  ? 101  ILE A O     1 
ATOM   840  C  CB    . ILE A 1 101 ? -27.508 -12.948 35.398 1.00 44.84  ? 101  ILE A CB    1 
ATOM   841  C  CG1   . ILE A 1 101 ? -28.119 -11.679 34.794 1.00 43.91  ? 101  ILE A CG1   1 
ATOM   842  C  CG2   . ILE A 1 101 ? -27.362 -14.031 34.304 1.00 41.67  ? 101  ILE A CG2   1 
ATOM   843  C  CD1   . ILE A 1 101 ? -27.236 -10.976 33.793 1.00 41.01  ? 101  ILE A CD1   1 
ATOM   844  N  N     . LYS A 1 102 ? -29.112 -15.750 36.703 1.00 46.83  ? 102  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 102 ? -28.964 -17.191 36.777 1.00 48.08  ? 102  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 102 ? -28.932 -17.665 35.332 1.00 46.83  ? 102  LYS A C     1 
ATOM   847  O  O     . LYS A 1 102 ? -29.926 -17.548 34.606 1.00 48.72  ? 102  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 102 ? -30.142 -17.804 37.542 1.00 50.28  ? 102  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 102 ? -30.391 -19.288 37.272 1.00 57.50  ? 102  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 102 ? -29.822 -20.190 38.355 1.00 64.77  ? 102  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 102 ? -30.597 -21.506 38.412 1.00 67.76  ? 102  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 102 ? -30.570 -22.121 39.775 1.00 69.57  ? 102  LYS A NZ    1 
ATOM   853  N  N     . TYR A 1 103 ? -27.778 -18.159 34.904 1.00 43.17  ? 103  TYR A N     1 
ATOM   854  C  CA    . TYR A 1 103 ? -27.596 -18.562 33.518 1.00 39.91  ? 103  TYR A CA    1 
ATOM   855  C  C     . TYR A 1 103 ? -27.468 -20.073 33.416 1.00 40.98  ? 103  TYR A C     1 
ATOM   856  O  O     . TYR A 1 103 ? -27.202 -20.745 34.412 1.00 42.93  ? 103  TYR A O     1 
ATOM   857  C  CB    . TYR A 1 103 ? -26.380 -17.847 32.907 1.00 39.16  ? 103  TYR A CB    1 
ATOM   858  C  CG    . TYR A 1 103 ? -25.029 -18.365 33.360 1.00 33.65  ? 103  TYR A CG    1 
ATOM   859  C  CD1   . TYR A 1 103 ? -24.401 -17.856 34.495 1.00 30.44  ? 103  TYR A CD1   1 
ATOM   860  C  CD2   . TYR A 1 103 ? -24.375 -19.361 32.637 1.00 35.61  ? 103  TYR A CD2   1 
ATOM   861  C  CE1   . TYR A 1 103 ? -23.145 -18.337 34.904 1.00 33.95  ? 103  TYR A CE1   1 
ATOM   862  C  CE2   . TYR A 1 103 ? -23.130 -19.849 33.031 1.00 36.20  ? 103  TYR A CE2   1 
ATOM   863  C  CZ    . TYR A 1 103 ? -22.520 -19.335 34.160 1.00 35.43  ? 103  TYR A CZ    1 
ATOM   864  O  OH    . TYR A 1 103 ? -21.292 -19.835 34.523 1.00 35.89  ? 103  TYR A OH    1 
ATOM   865  N  N     . ASP A 1 104 ? -27.670 -20.600 32.210 1.00 41.36  ? 104  ASP A N     1 
ATOM   866  C  CA    . ASP A 1 104 ? -27.550 -22.034 31.946 1.00 40.87  ? 104  ASP A CA    1 
ATOM   867  C  C     . ASP A 1 104 ? -26.633 -22.265 30.749 1.00 38.79  ? 104  ASP A C     1 
ATOM   868  O  O     . ASP A 1 104 ? -26.989 -21.965 29.600 1.00 38.79  ? 104  ASP A O     1 
ATOM   869  C  CB    . ASP A 1 104 ? -28.933 -22.661 31.719 1.00 41.29  ? 104  ASP A CB    1 
ATOM   870  C  CG    . ASP A 1 104 ? -28.872 -24.154 31.400 1.00 45.34  ? 104  ASP A CG    1 
ATOM   871  O  OD1   . ASP A 1 104 ? -27.767 -24.753 31.356 1.00 47.45  ? 104  ASP A OD1   1 
ATOM   872  O  OD2   . ASP A 1 104 ? -29.954 -24.737 31.183 1.00 49.68  ? 104  ASP A OD2   1 
ATOM   873  N  N     . HIS A 1 105 ? -25.464 -22.822 31.036 1.00 37.05  ? 105  HIS A N     1 
ATOM   874  C  CA    . HIS A 1 105 ? -24.398 -22.976 30.046 1.00 36.94  ? 105  HIS A CA    1 
ATOM   875  C  C     . HIS A 1 105 ? -24.753 -23.904 28.873 1.00 35.19  ? 105  HIS A C     1 
ATOM   876  O  O     . HIS A 1 105 ? -24.222 -23.751 27.782 1.00 32.92  ? 105  HIS A O     1 
ATOM   877  C  CB    . HIS A 1 105 ? -23.108 -23.442 30.727 1.00 38.80  ? 105  HIS A CB    1 
ATOM   878  C  CG    . HIS A 1 105 ? -23.080 -24.909 31.025 1.00 44.64  ? 105  HIS A CG    1 
ATOM   879  N  ND1   . HIS A 1 105 ? -22.560 -25.835 30.145 1.00 46.75  ? 105  HIS A ND1   1 
ATOM   880  C  CD2   . HIS A 1 105 ? -23.520 -25.613 32.095 1.00 47.45  ? 105  HIS A CD2   1 
ATOM   881  C  CE1   . HIS A 1 105 ? -22.674 -27.045 30.664 1.00 48.40  ? 105  HIS A CE1   1 
ATOM   882  N  NE2   . HIS A 1 105 ? -23.255 -26.938 31.846 1.00 49.39  ? 105  HIS A NE2   1 
ATOM   883  N  N     . THR A 1 106 ? -25.656 -24.853 29.099 1.00 35.25  ? 106  THR A N     1 
ATOM   884  C  CA    . THR A 1 106 ? -26.081 -25.775 28.047 1.00 34.14  ? 106  THR A CA    1 
ATOM   885  C  C     . THR A 1 106 ? -26.877 -25.103 26.913 1.00 33.37  ? 106  THR A C     1 
ATOM   886  O  O     . THR A 1 106 ? -27.066 -25.719 25.856 1.00 31.88  ? 106  THR A O     1 
ATOM   887  C  CB    . THR A 1 106 ? -26.907 -26.966 28.611 1.00 35.23  ? 106  THR A CB    1 
ATOM   888  O  OG1   . THR A 1 106 ? -28.163 -26.495 29.111 1.00 35.72  ? 106  THR A OG1   1 
ATOM   889  C  CG2   . THR A 1 106 ? -26.157 -27.682 29.714 1.00 36.54  ? 106  THR A CG2   1 
ATOM   890  N  N     . LYS A 1 107 ? -27.350 -23.869 27.141 1.00 32.42  ? 107  LYS A N     1 
ATOM   891  C  CA    . LYS A 1 107 ? -28.041 -23.064 26.102 1.00 33.10  ? 107  LYS A CA    1 
ATOM   892  C  C     . LYS A 1 107 ? -27.094 -22.108 25.375 1.00 31.03  ? 107  LYS A C     1 
ATOM   893  O  O     . LYS A 1 107 ? -27.447 -21.560 24.331 1.00 31.19  ? 107  LYS A O     1 
ATOM   894  C  CB    . LYS A 1 107 ? -29.198 -22.225 26.683 1.00 35.00  ? 107  LYS A CB    1 
ATOM   895  C  CG    . LYS A 1 107 ? -30.213 -22.964 27.546 1.00 39.32  ? 107  LYS A CG    1 
ATOM   896  C  CD    . LYS A 1 107 ? -31.076 -23.915 26.743 1.00 45.97  ? 107  LYS A CD    1 
ATOM   897  C  CE    . LYS A 1 107 ? -31.948 -24.751 27.661 1.00 49.62  ? 107  LYS A CE    1 
ATOM   898  N  NZ    . LYS A 1 107 ? -32.343 -26.011 26.984 1.00 54.31  ? 107  LYS A NZ    1 
ATOM   899  N  N     . ILE A 1 108 ? -25.903 -21.903 25.936 1.00 30.28  ? 108  ILE A N     1 
ATOM   900  C  CA    . ILE A 1 108 ? -24.916 -20.987 25.367 1.00 27.62  ? 108  ILE A CA    1 
ATOM   901  C  C     . ILE A 1 108 ? -24.034 -21.722 24.374 1.00 29.63  ? 108  ILE A C     1 
ATOM   902  O  O     . ILE A 1 108 ? -23.327 -22.664 24.744 1.00 31.34  ? 108  ILE A O     1 
ATOM   903  C  CB    . ILE A 1 108 ? -23.991 -20.377 26.458 1.00 26.90  ? 108  ILE A CB    1 
ATOM   904  C  CG1   . ILE A 1 108 ? -24.801 -19.687 27.552 1.00 21.85  ? 108  ILE A CG1   1 
ATOM   905  C  CG2   . ILE A 1 108 ? -22.995 -19.401 25.844 1.00 23.06  ? 108  ILE A CG2   1 
ATOM   906  C  CD1   . ILE A 1 108 ? -23.946 -18.985 28.583 1.00 22.24  ? 108  ILE A CD1   1 
ATOM   907  N  N     . ARG A 1 109 ? -24.040 -21.267 23.123 1.00 29.29  ? 109  ARG A N     1 
ATOM   908  C  CA    . ARG A 1 109 ? -23.248 -21.908 22.085 1.00 28.55  ? 109  ARG A CA    1 
ATOM   909  C  C     . ARG A 1 109 ? -21.771 -21.518 22.159 1.00 28.25  ? 109  ARG A C     1 
ATOM   910  O  O     . ARG A 1 109 ? -21.413 -20.375 21.883 1.00 27.76  ? 109  ARG A O     1 
ATOM   911  C  CB    . ARG A 1 109 ? -23.826 -21.597 20.692 1.00 30.06  ? 109  ARG A CB    1 
ATOM   912  C  CG    . ARG A 1 109 ? -23.451 -22.638 19.632 1.00 26.76  ? 109  ARG A CG    1 
ATOM   913  C  CD    . ARG A 1 109 ? -23.935 -22.278 18.238 1.00 29.48  ? 109  ARG A CD    1 
ATOM   914  N  NE    . ARG A 1 109 ? -25.395 -22.240 18.140 1.00 33.53  ? 109  ARG A NE    1 
ATOM   915  C  CZ    . ARG A 1 109 ? -26.182 -23.309 18.023 1.00 33.31  ? 109  ARG A CZ    1 
ATOM   916  N  NH1   . ARG A 1 109 ? -25.672 -24.537 17.989 1.00 28.33  ? 109  ARG A NH1   1 
ATOM   917  N  NH2   . ARG A 1 109 ? -27.496 -23.143 17.945 1.00 34.32  ? 109  ARG A NH2   1 
ATOM   918  N  N     . VAL A 1 110 ? -20.925 -22.485 22.507 1.00 29.44  ? 110  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 110 ? -19.473 -22.284 22.585 1.00 29.50  ? 110  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 110 ? -18.780 -22.979 21.418 1.00 30.28  ? 110  VAL A C     1 
ATOM   921  O  O     . VAL A 1 110 ? -18.937 -24.185 21.210 1.00 31.42  ? 110  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 110 ? -18.882 -22.779 23.932 1.00 29.40  ? 110  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 110 ? -17.390 -22.482 24.010 1.00 31.39  ? 110  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 110 ? -19.580 -22.110 25.098 1.00 33.48  ? 110  VAL A CG2   1 
ATOM   925  N  N     . ALA A 1 111 ? -18.015 -22.204 20.657 1.00 31.41  ? 111  ALA A N     1 
ATOM   926  C  CA    . ALA A 1 111 ? -17.372 -22.699 19.450 1.00 31.58  ? 111  ALA A CA    1 
ATOM   927  C  C     . ALA A 1 111 ? -15.883 -22.747 19.635 1.00 29.74  ? 111  ALA A C     1 
ATOM   928  O  O     . ALA A 1 111 ? -15.266 -21.779 20.063 1.00 31.92  ? 111  ALA A O     1 
ATOM   929  C  CB    . ALA A 1 111 ? -17.725 -21.834 18.237 1.00 29.24  ? 111  ALA A CB    1 
ATOM   930  N  N     . ASN A 1 112 ? -15.315 -23.890 19.303 1.00 30.20  ? 112  ASN A N     1 
ATOM   931  C  CA    . ASN A 1 112 ? -13.881 -24.076 19.352 1.00 33.79  ? 112  ASN A CA    1 
ATOM   932  C  C     . ASN A 1 112 ? -13.459 -24.466 17.941 1.00 34.26  ? 112  ASN A C     1 
ATOM   933  O  O     . ASN A 1 112 ? -13.982 -25.447 17.389 1.00 35.87  ? 112  ASN A O     1 
ATOM   934  C  CB    . ASN A 1 112 ? -13.551 -25.189 20.345 1.00 33.68  ? 112  ASN A CB    1 
ATOM   935  C  CG    . ASN A 1 112 ? -12.128 -25.128 20.849 1.00 41.71  ? 112  ASN A CG    1 
ATOM   936  O  OD1   . ASN A 1 112 ? -11.166 -25.255 20.077 1.00 46.78  ? 112  ASN A OD1   1 
ATOM   937  N  ND2   . ASN A 1 112 ? -11.978 -24.959 22.163 1.00 44.39  ? 112  ASN A ND2   1 
ATOM   938  N  N     . PHE A 1 113 ? -12.555 -23.700 17.338 1.00 30.91  ? 113  PHE A N     1 
ATOM   939  C  CA    . PHE A 1 113 ? -12.142 -24.003 15.973 1.00 33.48  ? 113  PHE A CA    1 
ATOM   940  C  C     . PHE A 1 113 ? -10.677 -23.698 15.671 1.00 34.68  ? 113  PHE A C     1 
ATOM   941  O  O     . PHE A 1 113 ? -10.015 -22.984 16.424 1.00 33.87  ? 113  PHE A O     1 
ATOM   942  C  CB    . PHE A 1 113 ? -13.094 -23.348 14.954 1.00 35.39  ? 113  PHE A CB    1 
ATOM   943  C  CG    . PHE A 1 113 ? -12.697 -21.958 14.531 1.00 35.38  ? 113  PHE A CG    1 
ATOM   944  C  CD1   . PHE A 1 113 ? -12.601 -20.925 15.456 1.00 34.59  ? 113  PHE A CD1   1 
ATOM   945  C  CD2   . PHE A 1 113 ? -12.456 -21.681 13.190 1.00 37.37  ? 113  PHE A CD2   1 
ATOM   946  C  CE1   . PHE A 1 113 ? -12.239 -19.642 15.051 1.00 34.93  ? 113  PHE A CE1   1 
ATOM   947  C  CE2   . PHE A 1 113 ? -12.096 -20.400 12.775 1.00 36.97  ? 113  PHE A CE2   1 
ATOM   948  C  CZ    . PHE A 1 113 ? -11.993 -19.381 13.707 1.00 37.35  ? 113  PHE A CZ    1 
ATOM   949  N  N     . ASP A 1 114 ? -10.186 -24.255 14.567 1.00 35.64  ? 114  ASP A N     1 
ATOM   950  C  CA    . ASP A 1 114 ? -8.797  -24.083 14.132 1.00 39.07  ? 114  ASP A CA    1 
ATOM   951  C  C     . ASP A 1 114 ? -8.788  -24.365 12.639 1.00 37.07  ? 114  ASP A C     1 
ATOM   952  O  O     . ASP A 1 114 ? -9.445  -25.295 12.176 1.00 38.86  ? 114  ASP A O     1 
ATOM   953  C  CB    . ASP A 1 114 ? -7.861  -25.060 14.872 1.00 41.20  ? 114  ASP A CB    1 
ATOM   954  C  CG    . ASP A 1 114 ? -6.368  -24.668 14.779 1.00 48.32  ? 114  ASP A CG    1 
ATOM   955  O  OD1   . ASP A 1 114 ? -5.905  -23.845 15.601 1.00 49.01  ? 114  ASP A OD1   1 
ATOM   956  O  OD2   . ASP A 1 114 ? -5.641  -25.217 13.914 1.00 53.75  ? 114  ASP A OD2   1 
ATOM   957  N  N     . ILE A 1 115 ? -8.065  -23.554 11.882 1.00 35.26  ? 115  ILE A N     1 
ATOM   958  C  CA    . ILE A 1 115 ? -8.005  -23.735 10.437 1.00 33.91  ? 115  ILE A CA    1 
ATOM   959  C  C     . ILE A 1 115 ? -6.600  -24.150 10.021 1.00 35.47  ? 115  ILE A C     1 
ATOM   960  O  O     . ILE A 1 115 ? -5.629  -23.862 10.722 1.00 34.17  ? 115  ILE A O     1 
ATOM   961  C  CB    . ILE A 1 115 ? -8.419  -22.451 9.670  1.00 31.16  ? 115  ILE A CB    1 
ATOM   962  C  CG1   . ILE A 1 115 ? -7.354  -21.362 9.824  1.00 32.20  ? 115  ILE A CG1   1 
ATOM   963  C  CG2   . ILE A 1 115 ? -9.747  -21.950 10.168 1.00 31.72  ? 115  ILE A CG2   1 
ATOM   964  C  CD1   . ILE A 1 115 ? -7.481  -20.215 8.856  1.00 30.98  ? 115  ILE A CD1   1 
ATOM   965  N  N     . GLU A 1 116 ? -6.498  -24.832 8.882  1.00 35.73  ? 116  GLU A N     1 
ATOM   966  C  CA    . GLU A 1 116 ? -5.202  -25.121 8.293  1.00 36.35  ? 116  GLU A CA    1 
ATOM   967  C  C     . GLU A 1 116 ? -5.067  -24.375 6.974  1.00 36.39  ? 116  GLU A C     1 
ATOM   968  O  O     . GLU A 1 116 ? -6.056  -24.230 6.234  1.00 36.98  ? 116  GLU A O     1 
ATOM   969  C  CB    . GLU A 1 116 ? -5.022  -26.622 8.078  1.00 38.16  ? 116  GLU A CB    1 
ATOM   970  C  CG    . GLU A 1 116 ? -5.104  -27.478 9.348  1.00 41.20  ? 116  GLU A CG    1 
ATOM   971  C  CD    . GLU A 1 116 ? -4.100  -27.090 10.415 1.00 45.59  ? 116  GLU A CD    1 
ATOM   972  O  OE1   . GLU A 1 116 ? -3.043  -26.510 10.090 1.00 50.35  ? 116  GLU A OE1   1 
ATOM   973  O  OE2   . GLU A 1 116 ? -4.365  -27.372 11.602 1.00 51.89  ? 116  GLU A OE2   1 
ATOM   974  N  N     . VAL A 1 117 ? -3.855  -23.892 6.692  1.00 32.59  ? 117  VAL A N     1 
ATOM   975  C  CA    . VAL A 1 117 ? -3.552  -23.168 5.448  1.00 32.76  ? 117  VAL A CA    1 
ATOM   976  C  C     . VAL A 1 117 ? -2.139  -23.514 4.943  1.00 35.15  ? 117  VAL A C     1 
ATOM   977  O  O     . VAL A 1 117 ? -1.141  -23.153 5.585  1.00 34.80  ? 117  VAL A O     1 
ATOM   978  C  CB    . VAL A 1 117 ? -3.670  -21.621 5.626  1.00 32.48  ? 117  VAL A CB    1 
ATOM   979  C  CG1   . VAL A 1 117 ? -3.339  -20.896 4.325  1.00 29.71  ? 117  VAL A CG1   1 
ATOM   980  C  CG2   . VAL A 1 117 ? -5.066  -21.203 6.123  1.00 28.62  ? 117  VAL A CG2   1 
ATOM   981  N  N     . THR A 1 118 ? -2.049  -24.217 3.811  1.00 34.69  ? 118  THR A N     1 
ATOM   982  C  CA    . THR A 1 118 ? -0.744  -24.570 3.243  1.00 37.63  ? 118  THR A CA    1 
ATOM   983  C  C     . THR A 1 118 ? -0.088  -23.333 2.643  1.00 39.28  ? 118  THR A C     1 
ATOM   984  O  O     . THR A 1 118 ? -0.751  -22.553 1.948  1.00 40.06  ? 118  THR A O     1 
ATOM   985  C  CB    . THR A 1 118 ? -0.838  -25.712 2.186  1.00 38.37  ? 118  THR A CB    1 
ATOM   986  O  OG1   . THR A 1 118 ? -1.267  -26.926 2.818  1.00 38.41  ? 118  THR A OG1   1 
ATOM   987  C  CG2   . THR A 1 118 ? 0.524   -25.970 1.521  1.00 36.88  ? 118  THR A CG2   1 
ATOM   988  N  N     . SER A 1 119 ? 1.211   -23.164 2.909  1.00 42.00  ? 119  SER A N     1 
ATOM   989  C  CA    . SER A 1 119 ? 1.961   -21.982 2.457  1.00 44.47  ? 119  SER A CA    1 
ATOM   990  C  C     . SER A 1 119 ? 3.403   -22.276 2.029  1.00 47.46  ? 119  SER A C     1 
ATOM   991  O  O     . SER A 1 119 ? 4.293   -22.381 2.878  1.00 46.18  ? 119  SER A O     1 
ATOM   992  C  CB    . SER A 1 119 ? 1.964   -20.908 3.548  1.00 43.93  ? 119  SER A CB    1 
ATOM   993  O  OG    . SER A 1 119 ? 2.728   -19.787 3.144  1.00 47.11  ? 119  SER A OG    1 
ATOM   994  N  N     . PRO A 1 120 ? 3.643   -22.369 0.706  1.00 51.00  ? 120  PRO A N     1 
ATOM   995  C  CA    . PRO A 1 120 ? 4.974   -22.624 0.145  1.00 54.05  ? 120  PRO A CA    1 
ATOM   996  C  C     . PRO A 1 120 ? 5.954   -21.457 0.291  1.00 57.45  ? 120  PRO A C     1 
ATOM   997  O  O     . PRO A 1 120 ? 7.149   -21.627 0.021  1.00 58.59  ? 120  PRO A O     1 
ATOM   998  C  CB    . PRO A 1 120 ? 4.679   -22.845 -1.338 1.00 54.85  ? 120  PRO A CB    1 
ATOM   999  C  CG    . PRO A 1 120 ? 3.469   -22.019 -1.588 1.00 54.33  ? 120  PRO A CG    1 
ATOM   1000 C  CD    . PRO A 1 120 ? 2.635   -22.199 -0.357 1.00 51.46  ? 120  PRO A CD    1 
ATOM   1001 N  N     . ASP A 1 121 ? 5.456   -20.288 0.698  1.00 59.89  ? 121  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1 121 ? 6.286   -19.075 0.765  1.00 62.56  ? 121  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1 121 ? 6.379   -18.453 2.165  1.00 61.09  ? 121  ASP A C     1 
ATOM   1004 O  O     . ASP A 1 121 ? 6.406   -17.229 2.314  1.00 61.21  ? 121  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1 121 ? 5.840   -18.037 -0.285 1.00 64.57  ? 121  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1 121 ? 4.382   -17.597 -0.120 1.00 68.69  ? 121  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1 121 ? 3.874   -16.926 -1.045 1.00 70.83  ? 121  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1 121 ? 3.745   -17.908 0.917  1.00 69.26  ? 121  ASP A OD2   1 
ATOM   1009 N  N     . GLY A 1 122 ? 6.450   -19.304 3.182  1.00 59.37  ? 122  GLY A N     1 
ATOM   1010 C  CA    . GLY A 1 122 ? 6.550   -18.834 4.557  1.00 59.07  ? 122  GLY A CA    1 
ATOM   1011 C  C     . GLY A 1 122 ? 5.196   -18.504 5.157  1.00 57.03  ? 122  GLY A C     1 
ATOM   1012 O  O     . GLY A 1 122 ? 4.162   -18.719 4.529  1.00 57.02  ? 122  GLY A O     1 
ATOM   1013 N  N     . PHE A 1 123 ? 5.208   -17.962 6.371  1.00 55.38  ? 123  PHE A N     1 
ATOM   1014 C  CA    . PHE A 1 123 ? 3.984   -17.754 7.142  1.00 52.65  ? 123  PHE A CA    1 
ATOM   1015 C  C     . PHE A 1 123 ? 2.836   -17.076 6.375  1.00 48.31  ? 123  PHE A C     1 
ATOM   1016 O  O     . PHE A 1 123 ? 3.012   -15.995 5.817  1.00 45.83  ? 123  PHE A O     1 
ATOM   1017 C  CB    . PHE A 1 123 ? 4.275   -16.996 8.439  1.00 53.66  ? 123  PHE A CB    1 
ATOM   1018 C  CG    . PHE A 1 123 ? 3.191   -17.138 9.461  1.00 58.39  ? 123  PHE A CG    1 
ATOM   1019 C  CD1   . PHE A 1 123 ? 3.099   -18.296 10.236 1.00 59.70  ? 123  PHE A CD1   1 
ATOM   1020 C  CD2   . PHE A 1 123 ? 2.243   -16.132 9.634  1.00 58.98  ? 123  PHE A CD2   1 
ATOM   1021 C  CE1   . PHE A 1 123 ? 2.088   -18.441 11.173 1.00 60.53  ? 123  PHE A CE1   1 
ATOM   1022 C  CE2   . PHE A 1 123 ? 1.225   -16.269 10.569 1.00 58.91  ? 123  PHE A CE2   1 
ATOM   1023 C  CZ    . PHE A 1 123 ? 1.148   -17.423 11.341 1.00 60.30  ? 123  PHE A CZ    1 
ATOM   1024 N  N     . PRO A 1 124 ? 1.654   -17.720 6.362  1.00 46.08  ? 124  PRO A N     1 
ATOM   1025 C  CA    . PRO A 1 124 ? 0.458   -17.156 5.720  1.00 45.52  ? 124  PRO A CA    1 
ATOM   1026 C  C     . PRO A 1 124 ? -0.152  -16.005 6.522  1.00 44.74  ? 124  PRO A C     1 
ATOM   1027 O  O     . PRO A 1 124 ? -0.929  -16.244 7.442  1.00 47.16  ? 124  PRO A O     1 
ATOM   1028 C  CB    . PRO A 1 124 ? -0.508  -18.346 5.655  1.00 43.60  ? 124  PRO A CB    1 
ATOM   1029 C  CG    . PRO A 1 124 ? -0.080  -19.249 6.781  1.00 45.38  ? 124  PRO A CG    1 
ATOM   1030 C  CD    . PRO A 1 124 ? 1.410   -19.065 6.922  1.00 45.02  ? 124  PRO A CD    1 
ATOM   1031 N  N     . GLU A 1 125 ? 0.197   -14.768 6.170  1.00 45.09  ? 125  GLU A N     1 
ATOM   1032 C  CA    . GLU A 1 125 ? -0.291  -13.585 6.886  1.00 44.98  ? 125  GLU A CA    1 
ATOM   1033 C  C     . GLU A 1 125 ? -1.801  -13.415 6.714  1.00 42.36  ? 125  GLU A C     1 
ATOM   1034 O  O     . GLU A 1 125 ? -2.292  -13.424 5.590  1.00 40.58  ? 125  GLU A O     1 
ATOM   1035 C  CB    . GLU A 1 125 ? 0.437   -12.317 6.420  1.00 48.87  ? 125  GLU A CB    1 
ATOM   1036 C  CG    . GLU A 1 125 ? 1.976   -12.364 6.502  1.00 56.08  ? 125  GLU A CG    1 
ATOM   1037 C  CD    . GLU A 1 125 ? 2.520   -12.550 7.919  1.00 61.35  ? 125  GLU A CD    1 
ATOM   1038 O  OE1   . GLU A 1 125 ? 1.821   -12.206 8.901  1.00 62.25  ? 125  GLU A OE1   1 
ATOM   1039 O  OE2   . GLU A 1 125 ? 3.665   -13.040 8.046  1.00 65.48  ? 125  GLU A OE2   1 
ATOM   1040 N  N     . PRO A 1 126 ? -2.541  -13.276 7.834  1.00 41.71  ? 126  PRO A N     1 
ATOM   1041 C  CA    . PRO A 1 126 ? -3.999  -13.099 7.786  1.00 40.36  ? 126  PRO A CA    1 
ATOM   1042 C  C     . PRO A 1 126 ? -4.432  -11.862 7.003  1.00 40.88  ? 126  PRO A C     1 
ATOM   1043 O  O     . PRO A 1 126 ? -5.427  -11.916 6.283  1.00 39.37  ? 126  PRO A O     1 
ATOM   1044 C  CB    . PRO A 1 126 ? -4.390  -12.964 9.262  1.00 38.57  ? 126  PRO A CB    1 
ATOM   1045 C  CG    . PRO A 1 126 ? -3.342  -13.702 9.980  1.00 39.91  ? 126  PRO A CG    1 
ATOM   1046 C  CD    . PRO A 1 126 ? -2.066  -13.429 9.222  1.00 41.50  ? 126  PRO A CD    1 
ATOM   1047 N  N     . SER A 1 127 ? -3.681  -10.767 7.121  1.00 42.95  ? 127  SER A N     1 
ATOM   1048 C  CA    . SER A 1 127 ? -4.058  -9.522  6.455  1.00 44.54  ? 127  SER A CA    1 
ATOM   1049 C  C     . SER A 1 127 ? -4.028  -9.640  4.924  1.00 43.90  ? 127  SER A C     1 
ATOM   1050 O  O     . SER A 1 127 ? -4.707  -8.886  4.240  1.00 44.83  ? 127  SER A O     1 
ATOM   1051 C  CB    . SER A 1 127 ? -3.184  -8.363  6.941  1.00 46.81  ? 127  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 127 ? -1.842  -8.531  6.519  1.00 52.04  ? 127  SER A OG    1 
ATOM   1053 N  N     . GLN A 1 128 ? -3.247  -10.590 4.404  1.00 43.97  ? 128  GLN A N     1 
ATOM   1054 C  CA    . GLN A 1 128 ? -3.167  -10.847 2.960  1.00 46.03  ? 128  GLN A CA    1 
ATOM   1055 C  C     . GLN A 1 128 ? -4.053  -12.023 2.541  1.00 45.32  ? 128  GLN A C     1 
ATOM   1056 O  O     . GLN A 1 128 ? -4.727  -11.964 1.510  1.00 45.92  ? 128  GLN A O     1 
ATOM   1057 C  CB    . GLN A 1 128 ? -1.718  -11.087 2.494  1.00 48.28  ? 128  GLN A CB    1 
ATOM   1058 C  CG    . GLN A 1 128 ? -0.690  -10.042 2.945  1.00 54.74  ? 128  GLN A CG    1 
ATOM   1059 C  CD    . GLN A 1 128 ? -1.214  -8.607  2.862  1.00 63.11  ? 128  GLN A CD    1 
ATOM   1060 O  OE1   . GLN A 1 128 ? -1.375  -7.939  3.890  1.00 66.64  ? 128  GLN A OE1   1 
ATOM   1061 N  NE2   . GLN A 1 128 ? -1.498  -8.134  1.642  1.00 61.49  ? 128  GLN A NE2   1 
ATOM   1062 N  N     . ALA A 1 129 ? -4.050  -13.089 3.340  1.00 43.59  ? 129  ALA A N     1 
ATOM   1063 C  CA    . ALA A 1 129 ? -4.905  -14.258 3.093  1.00 41.86  ? 129  ALA A CA    1 
ATOM   1064 C  C     . ALA A 1 129 ? -4.878  -14.665 1.618  1.00 41.24  ? 129  ALA A C     1 
ATOM   1065 O  O     . ALA A 1 129 ? -5.917  -14.811 0.964  1.00 39.53  ? 129  ALA A O     1 
ATOM   1066 C  CB    . ALA A 1 129 ? -6.334  -13.990 3.573  1.00 38.41  ? 129  ALA A CB    1 
ATOM   1067 N  N     . LYS A 1 130 ? -3.671  -14.834 1.095  1.00 41.70  ? 130  LYS A N     1 
ATOM   1068 C  CA    . LYS A 1 130 ? -3.514  -15.106 -0.329 1.00 43.75  ? 130  LYS A CA    1 
ATOM   1069 C  C     . LYS A 1 130 ? -3.433  -16.595 -0.637 1.00 41.40  ? 130  LYS A C     1 
ATOM   1070 O  O     . LYS A 1 130 ? -3.156  -16.978 -1.773 1.00 42.55  ? 130  LYS A O     1 
ATOM   1071 C  CB    . LYS A 1 130 ? -2.318  -14.341 -0.912 1.00 45.05  ? 130  LYS A CB    1 
ATOM   1072 C  CG    . LYS A 1 130 ? -0.962  -14.685 -0.326 1.00 48.60  ? 130  LYS A CG    1 
ATOM   1073 C  CD    . LYS A 1 130 ? 0.134   -14.080 -1.199 1.00 56.63  ? 130  LYS A CD    1 
ATOM   1074 C  CE    . LYS A 1 130 ? 1.529   -14.523 -0.774 1.00 58.85  ? 130  LYS A CE    1 
ATOM   1075 N  NZ    . LYS A 1 130 ? 2.515   -14.292 -1.871 1.00 60.75  ? 130  LYS A NZ    1 
ATOM   1076 N  N     . HIS A 1 131 ? -3.696  -17.416 0.379  1.00 40.41  ? 131  HIS A N     1 
ATOM   1077 C  CA    . HIS A 1 131 ? -3.568  -18.868 0.279  1.00 41.22  ? 131  HIS A CA    1 
ATOM   1078 C  C     . HIS A 1 131 ? -4.854  -19.559 0.659  1.00 40.43  ? 131  HIS A C     1 
ATOM   1079 O  O     . HIS A 1 131 ? -5.575  -19.085 1.541  1.00 41.35  ? 131  HIS A O     1 
ATOM   1080 C  CB    . HIS A 1 131 ? -2.467  -19.390 1.194  1.00 42.25  ? 131  HIS A CB    1 
ATOM   1081 C  CG    . HIS A 1 131 ? -1.084  -19.066 0.732  1.00 44.76  ? 131  HIS A CG    1 
ATOM   1082 N  ND1   . HIS A 1 131 ? -0.258  -18.206 1.420  1.00 45.50  ? 131  HIS A ND1   1 
ATOM   1083 C  CD2   . HIS A 1 131 ? -0.378  -19.493 -0.340 1.00 45.89  ? 131  HIS A CD2   1 
ATOM   1084 C  CE1   . HIS A 1 131 ? 0.900   -18.116 0.790  1.00 48.44  ? 131  HIS A CE1   1 
ATOM   1085 N  NE2   . HIS A 1 131 ? 0.855   -18.889 -0.279 1.00 47.55  ? 131  HIS A NE2   1 
ATOM   1086 N  N     . PRO A 1 132 ? -5.140  -20.696 0.008  1.00 39.56  ? 132  PRO A N     1 
ATOM   1087 C  CA    . PRO A 1 132 ? -6.365  -21.448 0.268  1.00 38.26  ? 132  PRO A CA    1 
ATOM   1088 C  C     . PRO A 1 132 ? -6.472  -21.952 1.703  1.00 36.44  ? 132  PRO A C     1 
ATOM   1089 O  O     . PRO A 1 132 ? -5.509  -22.496 2.241  1.00 38.25  ? 132  PRO A O     1 
ATOM   1090 C  CB    . PRO A 1 132 ? -6.262  -22.636 -0.701 1.00 38.90  ? 132  PRO A CB    1 
ATOM   1091 C  CG    . PRO A 1 132 ? -5.334  -22.172 -1.783 1.00 40.47  ? 132  PRO A CG    1 
ATOM   1092 C  CD    . PRO A 1 132 ? -4.353  -21.280 -1.097 1.00 41.12  ? 132  PRO A CD    1 
ATOM   1093 N  N     . ILE A 1 133 ? -7.637  -21.753 2.314  1.00 35.65  ? 133  ILE A N     1 
ATOM   1094 C  CA    . ILE A 1 133 ? -7.973  -22.420 3.570  1.00 34.22  ? 133  ILE A CA    1 
ATOM   1095 C  C     . ILE A 1 133 ? -8.321  -23.877 3.250  1.00 34.60  ? 133  ILE A C     1 
ATOM   1096 O  O     . ILE A 1 133 ? -9.352  -24.147 2.628  1.00 34.94  ? 133  ILE A O     1 
ATOM   1097 C  CB    . ILE A 1 133 ? -9.153  -21.736 4.288  1.00 32.96  ? 133  ILE A CB    1 
ATOM   1098 C  CG1   . ILE A 1 133 ? -8.793  -20.281 4.637  1.00 32.83  ? 133  ILE A CG1   1 
ATOM   1099 C  CG2   . ILE A 1 133 ? -9.562  -22.548 5.519  1.00 27.09  ? 133  ILE A CG2   1 
ATOM   1100 C  CD1   . ILE A 1 133 ? -9.946  -19.456 5.238  1.00 32.51  ? 133  ILE A CD1   1 
ATOM   1101 N  N     . ASP A 1 134 ? -7.460  -24.811 3.656  1.00 33.78  ? 134  ASP A N     1 
ATOM   1102 C  CA    . ASP A 1 134 ? -7.613  -26.193 3.206  1.00 33.80  ? 134  ASP A CA    1 
ATOM   1103 C  C     . ASP A 1 134 ? -8.139  -27.172 4.254  1.00 33.61  ? 134  ASP A C     1 
ATOM   1104 O  O     . ASP A 1 134 ? -8.352  -28.352 3.953  1.00 36.61  ? 134  ASP A O     1 
ATOM   1105 C  CB    . ASP A 1 134 ? -6.337  -26.701 2.516  1.00 34.69  ? 134  ASP A CB    1 
ATOM   1106 C  CG    . ASP A 1 134 ? -5.107  -26.597 3.392  1.00 33.34  ? 134  ASP A CG    1 
ATOM   1107 O  OD1   . ASP A 1 134 ? -5.240  -26.658 4.617  1.00 38.24  ? 134  ASP A OD1   1 
ATOM   1108 O  OD2   . ASP A 1 134 ? -3.996  -26.464 2.854  1.00 35.84  ? 134  ASP A OD2   1 
ATOM   1109 N  N     . ALA A 1 135 ? -8.366  -26.683 5.470  1.00 30.65  ? 135  ALA A N     1 
ATOM   1110 C  CA    . ALA A 1 135 ? -9.031  -27.468 6.505  1.00 30.72  ? 135  ALA A CA    1 
ATOM   1111 C  C     . ALA A 1 135 ? -9.579  -26.556 7.578  1.00 31.00  ? 135  ALA A C     1 
ATOM   1112 O  O     . ALA A 1 135 ? -8.957  -25.548 7.898  1.00 31.89  ? 135  ALA A O     1 
ATOM   1113 C  CB    . ALA A 1 135 ? -8.076  -28.492 7.120  1.00 30.14  ? 135  ALA A CB    1 
ATOM   1114 N  N     . ILE A 1 136 ? -10.754 -26.905 8.106  1.00 32.76  ? 136  ILE A N     1 
ATOM   1115 C  CA    . ILE A 1 136 ? -11.360 -26.220 9.255  1.00 31.59  ? 136  ILE A CA    1 
ATOM   1116 C  C     . ILE A 1 136 ? -11.994 -27.286 10.136 1.00 33.19  ? 136  ILE A C     1 
ATOM   1117 O  O     . ILE A 1 136 ? -12.863 -28.030 9.670  1.00 37.13  ? 136  ILE A O     1 
ATOM   1118 C  CB    . ILE A 1 136 ? -12.506 -25.256 8.842  1.00 31.54  ? 136  ILE A CB    1 
ATOM   1119 C  CG1   . ILE A 1 136 ? -12.004 -24.102 7.979  1.00 31.06  ? 136  ILE A CG1   1 
ATOM   1120 C  CG2   . ILE A 1 136 ? -13.222 -24.696 10.078 1.00 29.83  ? 136  ILE A CG2   1 
ATOM   1121 C  CD1   . ILE A 1 136 ? -13.139 -23.152 7.518  1.00 34.44  ? 136  ILE A CD1   1 
ATOM   1122 N  N     . THR A 1 137 ? -11.577 -27.372 11.398 1.00 30.91  ? 137  THR A N     1 
ATOM   1123 C  CA    . THR A 1 137 ? -12.372 -28.116 12.379 1.00 29.82  ? 137  THR A CA    1 
ATOM   1124 C  C     . THR A 1 137 ? -13.043 -27.166 13.359 1.00 29.57  ? 137  THR A C     1 
ATOM   1125 O  O     . THR A 1 137 ? -12.386 -26.345 14.000 1.00 29.30  ? 137  THR A O     1 
ATOM   1126 C  CB    . THR A 1 137 ? -11.577 -29.171 13.155 1.00 28.12  ? 137  THR A CB    1 
ATOM   1127 O  OG1   . THR A 1 137 ? -10.961 -30.068 12.236 1.00 28.24  ? 137  THR A OG1   1 
ATOM   1128 C  CG2   . THR A 1 137 ? -12.514 -29.981 14.069 1.00 30.66  ? 137  THR A CG2   1 
ATOM   1129 N  N     . HIS A 1 138 ? -14.355 -27.314 13.472 1.00 28.06  ? 138  HIS A N     1 
ATOM   1130 C  CA    . HIS A 1 138 ? -15.183 -26.431 14.262 1.00 27.55  ? 138  HIS A CA    1 
ATOM   1131 C  C     . HIS A 1 138 ? -15.963 -27.325 15.204 1.00 28.97  ? 138  HIS A C     1 
ATOM   1132 O  O     . HIS A 1 138 ? -16.741 -28.180 14.768 1.00 31.31  ? 138  HIS A O     1 
ATOM   1133 C  CB    . HIS A 1 138 ? -16.122 -25.680 13.320 1.00 26.92  ? 138  HIS A CB    1 
ATOM   1134 C  CG    . HIS A 1 138 ? -16.936 -24.605 13.969 1.00 26.26  ? 138  HIS A CG    1 
ATOM   1135 N  ND1   . HIS A 1 138 ? -16.800 -23.275 13.637 1.00 24.06  ? 138  HIS A ND1   1 
ATOM   1136 C  CD2   . HIS A 1 138 ? -17.937 -24.665 14.881 1.00 28.66  ? 138  HIS A CD2   1 
ATOM   1137 C  CE1   . HIS A 1 138 ? -17.673 -22.560 14.326 1.00 28.94  ? 138  HIS A CE1   1 
ATOM   1138 N  NE2   . HIS A 1 138 ? -18.374 -23.379 15.090 1.00 28.13  ? 138  HIS A NE2   1 
ATOM   1139 N  N     . TYR A 1 139 ? -15.726 -27.152 16.497 1.00 30.50  ? 139  TYR A N     1 
ATOM   1140 C  CA    . TYR A 1 139 ? -16.493 -27.866 17.511 1.00 32.45  ? 139  TYR A CA    1 
ATOM   1141 C  C     . TYR A 1 139 ? -17.591 -26.978 18.095 1.00 32.31  ? 139  TYR A C     1 
ATOM   1142 O  O     . TYR A 1 139 ? -17.329 -25.842 18.521 1.00 31.69  ? 139  TYR A O     1 
ATOM   1143 C  CB    . TYR A 1 139 ? -15.585 -28.396 18.630 1.00 31.86  ? 139  TYR A CB    1 
ATOM   1144 C  CG    . TYR A 1 139 ? -16.374 -28.934 19.793 1.00 32.38  ? 139  TYR A CG    1 
ATOM   1145 C  CD1   . TYR A 1 139 ? -16.766 -28.096 20.837 1.00 33.49  ? 139  TYR A CD1   1 
ATOM   1146 C  CD2   . TYR A 1 139 ? -16.760 -30.273 19.838 1.00 30.59  ? 139  TYR A CD2   1 
ATOM   1147 C  CE1   . TYR A 1 139 ? -17.504 -28.581 21.905 1.00 34.16  ? 139  TYR A CE1   1 
ATOM   1148 C  CE2   . TYR A 1 139 ? -17.502 -30.769 20.906 1.00 31.69  ? 139  TYR A CE2   1 
ATOM   1149 C  CZ    . TYR A 1 139 ? -17.870 -29.915 21.935 1.00 32.97  ? 139  TYR A CZ    1 
ATOM   1150 O  OH    . TYR A 1 139 ? -18.603 -30.387 22.996 1.00 33.15  ? 139  TYR A OH    1 
ATOM   1151 N  N     . ASP A 1 140 ? -18.806 -27.522 18.126 1.00 32.88  ? 140  ASP A N     1 
ATOM   1152 C  CA    . ASP A 1 140 ? -19.985 -26.822 18.630 1.00 32.46  ? 140  ASP A CA    1 
ATOM   1153 C  C     . ASP A 1 140 ? -20.440 -27.479 19.931 1.00 33.89  ? 140  ASP A C     1 
ATOM   1154 O  O     . ASP A 1 140 ? -20.862 -28.635 19.939 1.00 35.91  ? 140  ASP A O     1 
ATOM   1155 C  CB    . ASP A 1 140 ? -21.096 -26.839 17.569 1.00 32.90  ? 140  ASP A CB    1 
ATOM   1156 C  CG    . ASP A 1 140 ? -22.404 -26.203 18.050 1.00 34.76  ? 140  ASP A CG    1 
ATOM   1157 O  OD1   . ASP A 1 140 ? -23.090 -26.787 18.917 1.00 35.73  ? 140  ASP A OD1   1 
ATOM   1158 O  OD2   . ASP A 1 140 ? -22.773 -25.136 17.521 1.00 32.04  ? 140  ASP A OD2   1 
ATOM   1159 N  N     . SER A 1 141 ? -20.367 -26.727 21.025 1.00 33.76  ? 141  SER A N     1 
ATOM   1160 C  CA    . SER A 1 141 ? -20.681 -27.246 22.360 1.00 33.28  ? 141  SER A CA    1 
ATOM   1161 C  C     . SER A 1 141 ? -22.129 -27.701 22.558 1.00 34.12  ? 141  SER A C     1 
ATOM   1162 O  O     . SER A 1 141 ? -22.406 -28.456 23.497 1.00 31.66  ? 141  SER A O     1 
ATOM   1163 C  CB    . SER A 1 141 ? -20.331 -26.212 23.424 1.00 30.25  ? 141  SER A CB    1 
ATOM   1164 O  OG    . SER A 1 141 ? -21.220 -25.119 23.358 1.00 30.17  ? 141  SER A OG    1 
ATOM   1165 N  N     . ILE A 1 142 ? -23.038 -27.243 21.691 1.00 33.97  ? 142  ILE A N     1 
ATOM   1166 C  CA    . ILE A 1 142 ? -24.468 -27.585 21.812 1.00 35.37  ? 142  ILE A CA    1 
ATOM   1167 C  C     . ILE A 1 142 ? -24.838 -28.872 21.048 1.00 36.46  ? 142  ILE A C     1 
ATOM   1168 O  O     . ILE A 1 142 ? -25.664 -29.660 21.511 1.00 38.93  ? 142  ILE A O     1 
ATOM   1169 C  CB    . ILE A 1 142 ? -25.395 -26.391 21.418 1.00 36.07  ? 142  ILE A CB    1 
ATOM   1170 C  CG1   . ILE A 1 142 ? -25.255 -25.245 22.436 1.00 33.24  ? 142  ILE A CG1   1 
ATOM   1171 C  CG2   . ILE A 1 142 ? -26.869 -26.836 21.284 1.00 33.32  ? 142  ILE A CG2   1 
ATOM   1172 C  CD1   . ILE A 1 142 ? -26.179 -24.048 22.172 1.00 28.78  ? 142  ILE A CD1   1 
ATOM   1173 N  N     . ASP A 1 143 ? -24.233 -29.087 19.886 1.00 37.04  ? 143  ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 143 ? -24.359 -30.385 19.209 1.00 36.78  ? 143  ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 143 ? -23.331 -31.372 19.762 1.00 32.41  ? 143  ASP A C     1 
ATOM   1176 O  O     . ASP A 1 143 ? -23.465 -32.575 19.562 1.00 29.81  ? 143  ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 143 ? -24.166 -30.266 17.689 1.00 37.52  ? 143  ASP A CB    1 
ATOM   1178 C  CG    . ASP A 1 143 ? -25.091 -29.256 17.046 1.00 40.23  ? 143  ASP A CG    1 
ATOM   1179 O  OD1   . ASP A 1 143 ? -26.129 -28.893 17.643 1.00 45.11  ? 143  ASP A OD1   1 
ATOM   1180 O  OD2   . ASP A 1 143 ? -24.773 -28.826 15.923 1.00 38.79  ? 143  ASP A OD2   1 
ATOM   1181 N  N     . ASP A 1 144 ? -22.313 -30.856 20.452 1.00 30.95  ? 144  ASP A N     1 
ATOM   1182 C  CA    . ASP A 1 144 ? -21.195 -31.674 20.950 1.00 30.30  ? 144  ASP A CA    1 
ATOM   1183 C  C     . ASP A 1 144 ? -20.621 -32.447 19.760 1.00 28.83  ? 144  ASP A C     1 
ATOM   1184 O  O     . ASP A 1 144 ? -20.519 -33.677 19.781 1.00 28.83  ? 144  ASP A O     1 
ATOM   1185 C  CB    . ASP A 1 144 ? -21.673 -32.604 22.084 1.00 33.85  ? 144  ASP A CB    1 
ATOM   1186 C  CG    . ASP A 1 144 ? -20.542 -33.400 22.739 1.00 38.38  ? 144  ASP A CG    1 
ATOM   1187 O  OD1   . ASP A 1 144 ? -19.376 -32.922 22.781 1.00 37.62  ? 144  ASP A OD1   1 
ATOM   1188 O  OD2   . ASP A 1 144 ? -20.842 -34.517 23.227 1.00 39.76  ? 144  ASP A OD2   1 
ATOM   1189 N  N     . ARG A 1 145 ? -20.297 -31.714 18.699 1.00 25.71  ? 145  ARG A N     1 
ATOM   1190 C  CA    . ARG A 1 145 ? -19.785 -32.330 17.481 1.00 28.80  ? 145  ARG A CA    1 
ATOM   1191 C  C     . ARG A 1 145 ? -18.619 -31.550 16.861 1.00 25.67  ? 145  ARG A C     1 
ATOM   1192 O  O     . ARG A 1 145 ? -18.624 -30.317 16.826 1.00 26.38  ? 145  ARG A O     1 
ATOM   1193 C  CB    . ARG A 1 145 ? -20.900 -32.514 16.439 1.00 28.61  ? 145  ARG A CB    1 
ATOM   1194 C  CG    . ARG A 1 145 ? -22.033 -33.449 16.839 1.00 32.21  ? 145  ARG A CG    1 
ATOM   1195 C  CD    . ARG A 1 145 ? -21.588 -34.906 16.947 1.00 32.89  ? 145  ARG A CD    1 
ATOM   1196 N  NE    . ARG A 1 145 ? -22.736 -35.806 17.045 1.00 36.94  ? 145  ARG A NE    1 
ATOM   1197 C  CZ    . ARG A 1 145 ? -23.202 -36.337 18.177 1.00 41.05  ? 145  ARG A CZ    1 
ATOM   1198 N  NH1   . ARG A 1 145 ? -22.615 -36.084 19.345 1.00 37.84  ? 145  ARG A NH1   1 
ATOM   1199 N  NH2   . ARG A 1 145 ? -24.257 -37.143 18.139 1.00 41.59  ? 145  ARG A NH2   1 
ATOM   1200 N  N     . PHE A 1 146 ? -17.635 -32.291 16.370 1.00 22.09  ? 146  PHE A N     1 
ATOM   1201 C  CA    . PHE A 1 146 ? -16.536 -31.735 15.580 1.00 23.34  ? 146  PHE A CA    1 
ATOM   1202 C  C     . PHE A 1 146 ? -16.898 -31.744 14.101 1.00 23.15  ? 146  PHE A C     1 
ATOM   1203 O  O     . PHE A 1 146 ? -16.940 -32.810 13.484 1.00 25.24  ? 146  PHE A O     1 
ATOM   1204 C  CB    . PHE A 1 146 ? -15.268 -32.568 15.782 1.00 21.38  ? 146  PHE A CB    1 
ATOM   1205 C  CG    . PHE A 1 146 ? -14.804 -32.621 17.200 1.00 21.90  ? 146  PHE A CG    1 
ATOM   1206 C  CD1   . PHE A 1 146 ? -15.359 -33.535 18.092 1.00 21.83  ? 146  PHE A CD1   1 
ATOM   1207 C  CD2   . PHE A 1 146 ? -13.809 -31.764 17.643 1.00 20.86  ? 146  PHE A CD2   1 
ATOM   1208 C  CE1   . PHE A 1 146 ? -14.937 -33.582 19.405 1.00 24.89  ? 146  PHE A CE1   1 
ATOM   1209 C  CE2   . PHE A 1 146 ? -13.368 -31.806 18.955 1.00 22.52  ? 146  PHE A CE2   1 
ATOM   1210 C  CZ    . PHE A 1 146 ? -13.926 -32.713 19.839 1.00 25.68  ? 146  PHE A CZ    1 
ATOM   1211 N  N     . TYR A 1 147 ? -17.168 -30.568 13.541 1.00 23.29  ? 147  TYR A N     1 
ATOM   1212 C  CA    . TYR A 1 147 ? -17.477 -30.445 12.110 1.00 26.46  ? 147  TYR A CA    1 
ATOM   1213 C  C     . TYR A 1 147 ? -16.196 -30.184 11.331 1.00 28.24  ? 147  TYR A C     1 
ATOM   1214 O  O     . TYR A 1 147 ? -15.481 -29.198 11.583 1.00 28.41  ? 147  TYR A O     1 
ATOM   1215 C  CB    . TYR A 1 147 ? -18.495 -29.337 11.852 1.00 24.03  ? 147  TYR A CB    1 
ATOM   1216 C  CG    . TYR A 1 147 ? -19.846 -29.596 12.492 1.00 26.36  ? 147  TYR A CG    1 
ATOM   1217 C  CD1   . TYR A 1 147 ? -20.093 -29.225 13.811 1.00 24.72  ? 147  TYR A CD1   1 
ATOM   1218 C  CD2   . TYR A 1 147 ? -20.876 -30.199 11.773 1.00 25.80  ? 147  TYR A CD2   1 
ATOM   1219 C  CE1   . TYR A 1 147 ? -21.326 -29.454 14.404 1.00 28.62  ? 147  TYR A CE1   1 
ATOM   1220 C  CE2   . TYR A 1 147 ? -22.119 -30.441 12.356 1.00 29.40  ? 147  TYR A CE2   1 
ATOM   1221 C  CZ    . TYR A 1 147 ? -22.339 -30.066 13.676 1.00 31.51  ? 147  TYR A CZ    1 
ATOM   1222 O  OH    . TYR A 1 147 ? -23.563 -30.293 14.273 1.00 26.34  ? 147  TYR A OH    1 
ATOM   1223 N  N     . VAL A 1 148 ? -15.903 -31.081 10.397 1.00 28.46  ? 148  VAL A N     1 
ATOM   1224 C  CA    . VAL A 1 148 ? -14.616 -31.061 9.709  1.00 29.80  ? 148  VAL A CA    1 
ATOM   1225 C  C     . VAL A 1 148 ? -14.790 -30.701 8.231  1.00 29.56  ? 148  VAL A C     1 
ATOM   1226 O  O     . VAL A 1 148 ? -15.462 -31.404 7.491  1.00 31.77  ? 148  VAL A O     1 
ATOM   1227 C  CB    . VAL A 1 148 ? -13.856 -32.399 9.904  1.00 28.97  ? 148  VAL A CB    1 
ATOM   1228 C  CG1   . VAL A 1 148 ? -12.463 -32.324 9.315  1.00 30.47  ? 148  VAL A CG1   1 
ATOM   1229 C  CG2   . VAL A 1 148 ? -13.758 -32.721 11.378 1.00 28.22  ? 148  VAL A CG2   1 
ATOM   1230 N  N     . PHE A 1 149 ? -14.194 -29.579 7.837  1.00 29.76  ? 149  PHE A N     1 
ATOM   1231 C  CA    . PHE A 1 149 ? -14.215 -29.080 6.465  1.00 30.29  ? 149  PHE A CA    1 
ATOM   1232 C  C     . PHE A 1 149 ? -12.847 -29.297 5.817  1.00 32.17  ? 149  PHE A C     1 
ATOM   1233 O  O     . PHE A 1 149 ? -11.840 -28.696 6.231  1.00 32.17  ? 149  PHE A O     1 
ATOM   1234 C  CB    . PHE A 1 149 ? -14.561 -27.596 6.453  1.00 29.58  ? 149  PHE A CB    1 
ATOM   1235 C  CG    . PHE A 1 149 ? -15.890 -27.273 7.084  1.00 32.72  ? 149  PHE A CG    1 
ATOM   1236 C  CD1   . PHE A 1 149 ? -16.008 -27.135 8.470  1.00 32.49  ? 149  PHE A CD1   1 
ATOM   1237 C  CD2   . PHE A 1 149 ? -17.016 -27.086 6.294  1.00 29.05  ? 149  PHE A CD2   1 
ATOM   1238 C  CE1   . PHE A 1 149 ? -17.231 -26.827 9.053  1.00 33.37  ? 149  PHE A CE1   1 
ATOM   1239 C  CE2   . PHE A 1 149 ? -18.247 -26.773 6.869  1.00 35.30  ? 149  PHE A CE2   1 
ATOM   1240 C  CZ    . PHE A 1 149 ? -18.352 -26.643 8.251  1.00 36.13  ? 149  PHE A CZ    1 
ATOM   1241 N  N     . ASP A 1 150 ? -12.826 -30.157 4.799  1.00 33.45  ? 150  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1 150 ? -11.591 -30.724 4.260  1.00 35.02  ? 150  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1 150 ? -11.477 -30.454 2.761  1.00 36.72  ? 150  ASP A C     1 
ATOM   1244 O  O     . ASP A 1 150 ? -12.305 -30.930 1.973  1.00 39.45  ? 150  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1 150 ? -11.566 -32.233 4.553  1.00 34.70  ? 150  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1 150 ? -10.328 -32.924 4.024  1.00 36.87  ? 150  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1 150 ? -9.370  -32.235 3.617  1.00 38.26  ? 150  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1 150 ? -10.314 -34.173 4.018  1.00 35.52  ? 150  ASP A OD2   1 
ATOM   1249 N  N     . LEU A 1 151 ? -10.459 -29.683 2.375  1.00 36.06  ? 151  LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 151 ? -10.240 -29.363 0.967  1.00 36.56  ? 151  LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 151 ? -9.451  -30.461 0.253  1.00 39.79  ? 151  LEU A C     1 
ATOM   1252 O  O     . LEU A 1 151 ? -8.300  -30.756 0.613  1.00 41.08  ? 151  LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 151 ? -9.560  -28.000 0.788  1.00 34.20  ? 151  LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 151 ? -9.462  -27.527 -0.674 1.00 33.54  ? 151  LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 151 ? -10.844 -27.452 -1.331 1.00 31.88  ? 151  LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 151 ? -8.739  -26.205 -0.816 1.00 26.49  ? 151  LEU A CD2   1 
ATOM   1257 N  N     . LEU A 1 152 ? -10.080 -31.056 -0.759 1.00 40.76  ? 152  LEU A N     1 
ATOM   1258 C  CA    . LEU A 1 152 ? -9.480  -32.162 -1.484 1.00 42.63  ? 152  LEU A CA    1 
ATOM   1259 C  C     . LEU A 1 152 ? -8.672  -31.659 -2.663 1.00 44.79  ? 152  LEU A C     1 
ATOM   1260 O  O     . LEU A 1 152 ? -7.590  -32.174 -2.940 1.00 46.67  ? 152  LEU A O     1 
ATOM   1261 C  CB    . LEU A 1 152 ? -10.543 -33.170 -1.934 1.00 43.46  ? 152  LEU A CB    1 
ATOM   1262 C  CG    . LEU A 1 152 ? -11.343 -33.872 -0.823 1.00 44.35  ? 152  LEU A CG    1 
ATOM   1263 C  CD1   . LEU A 1 152 ? -12.319 -34.900 -1.407 1.00 42.93  ? 152  LEU A CD1   1 
ATOM   1264 C  CD2   . LEU A 1 152 ? -10.430 -34.514 0.232  1.00 40.14  ? 152  LEU A CD2   1 
ATOM   1265 N  N     . ASN A 1 153 ? -9.185  -30.636 -3.337 1.00 47.39  ? 153  ASN A N     1 
ATOM   1266 C  CA    . ASN A 1 153 ? -8.494  -30.070 -4.491 1.00 49.28  ? 153  ASN A CA    1 
ATOM   1267 C  C     . ASN A 1 153 ? -8.003  -28.642 -4.281 1.00 49.11  ? 153  ASN A C     1 
ATOM   1268 O  O     . ASN A 1 153 ? -8.775  -27.738 -3.976 1.00 47.20  ? 153  ASN A O     1 
ATOM   1269 C  CB    . ASN A 1 153 ? -9.351  -30.216 -5.746 1.00 50.04  ? 153  ASN A CB    1 
ATOM   1270 C  CG    . ASN A 1 153 ? -9.714  -31.666 -6.021 1.00 51.93  ? 153  ASN A CG    1 
ATOM   1271 O  OD1   . ASN A 1 153 ? -8.854  -32.552 -5.980 1.00 53.51  ? 153  ASN A OD1   1 
ATOM   1272 N  ND2   . ASN A 1 153 ? -10.987 -31.921 -6.279 1.00 51.79  ? 153  ASN A ND2   1 
ATOM   1273 N  N     . SER A 1 154 ? -6.695  -28.470 -4.443 1.00 50.78  ? 154  SER A N     1 
ATOM   1274 C  CA    . SER A 1 154 ? -6.025  -27.207 -4.186 1.00 51.95  ? 154  SER A CA    1 
ATOM   1275 C  C     . SER A 1 154 ? -4.863  -27.043 -5.158 1.00 52.79  ? 154  SER A C     1 
ATOM   1276 O  O     . SER A 1 154 ? -4.272  -28.039 -5.575 1.00 54.84  ? 154  SER A O     1 
ATOM   1277 C  CB    . SER A 1 154 ? -5.508  -27.192 -2.746 1.00 51.61  ? 154  SER A CB    1 
ATOM   1278 O  OG    . SER A 1 154 ? -4.660  -26.091 -2.508 1.00 53.74  ? 154  SER A OG    1 
ATOM   1279 N  N     . PRO A 1 155 ? -4.532  -25.789 -5.530 1.00 53.01  ? 155  PRO A N     1 
ATOM   1280 C  CA    . PRO A 1 155 ? -3.347  -25.504 -6.353 1.00 54.03  ? 155  PRO A CA    1 
ATOM   1281 C  C     . PRO A 1 155 ? -2.061  -26.105 -5.789 1.00 53.40  ? 155  PRO A C     1 
ATOM   1282 O  O     . PRO A 1 155 ? -1.095  -26.286 -6.529 1.00 54.31  ? 155  PRO A O     1 
ATOM   1283 C  CB    . PRO A 1 155 ? -3.256  -23.970 -6.330 1.00 53.57  ? 155  PRO A CB    1 
ATOM   1284 C  CG    . PRO A 1 155 ? -4.257  -23.516 -5.291 1.00 52.47  ? 155  PRO A CG    1 
ATOM   1285 C  CD    . PRO A 1 155 ? -5.314  -24.567 -5.290 1.00 51.83  ? 155  PRO A CD    1 
ATOM   1286 N  N     . TYR A 1 156 ? -2.061  -26.413 -4.495 1.00 52.46  ? 156  TYR A N     1 
ATOM   1287 C  CA    . TYR A 1 156 ? -0.905  -27.034 -3.848 1.00 53.53  ? 156  TYR A CA    1 
ATOM   1288 C  C     . TYR A 1 156 ? -1.052  -28.545 -3.688 1.00 51.74  ? 156  TYR A C     1 
ATOM   1289 O  O     . TYR A 1 156 ? -0.308  -29.174 -2.941 1.00 51.05  ? 156  TYR A O     1 
ATOM   1290 C  CB    . TYR A 1 156 ? -0.594  -26.355 -2.508 1.00 54.53  ? 156  TYR A CB    1 
ATOM   1291 C  CG    . TYR A 1 156 ? -0.332  -24.879 -2.658 1.00 59.81  ? 156  TYR A CG    1 
ATOM   1292 C  CD1   . TYR A 1 156 ? 0.684   -24.416 -3.496 1.00 64.34  ? 156  TYR A CD1   1 
ATOM   1293 C  CD2   . TYR A 1 156 ? -1.106  -23.941 -1.982 1.00 61.24  ? 156  TYR A CD2   1 
ATOM   1294 C  CE1   . TYR A 1 156 ? 0.923   -23.057 -3.655 1.00 65.77  ? 156  TYR A CE1   1 
ATOM   1295 C  CE2   . TYR A 1 156 ? -0.870  -22.574 -2.131 1.00 62.36  ? 156  TYR A CE2   1 
ATOM   1296 C  CZ    . TYR A 1 156 ? 0.144   -22.142 -2.969 1.00 63.52  ? 156  TYR A CZ    1 
ATOM   1297 O  OH    . TYR A 1 156 ? 0.384   -20.794 -3.123 1.00 65.11  ? 156  TYR A OH    1 
ATOM   1298 N  N     . GLY A 1 157 ? -2.012  -29.123 -4.399 1.00 52.43  ? 157  GLY A N     1 
ATOM   1299 C  CA    . GLY A 1 157 ? -2.124  -30.573 -4.474 1.00 52.18  ? 157  GLY A CA    1 
ATOM   1300 C  C     . GLY A 1 157 ? -3.527  -31.109 -4.329 1.00 50.10  ? 157  GLY A C     1 
ATOM   1301 O  O     . GLY A 1 157 ? -4.316  -30.605 -3.529 1.00 49.67  ? 157  GLY A O     1 
ATOM   1302 N  N     . ASN A 1 158 ? -3.832  -32.138 -5.114 1.00 49.25  ? 158  ASN A N     1 
ATOM   1303 C  CA    . ASN A 1 158 ? -5.095  -32.845 -4.992 1.00 47.85  ? 158  ASN A CA    1 
ATOM   1304 C  C     . ASN A 1 158 ? -4.916  -34.119 -4.182 1.00 47.16  ? 158  ASN A C     1 
ATOM   1305 O  O     . ASN A 1 158 ? -3.997  -34.908 -4.433 1.00 48.60  ? 158  ASN A O     1 
ATOM   1306 C  CB    . ASN A 1 158 ? -5.680  -33.134 -6.367 1.00 48.94  ? 158  ASN A CB    1 
ATOM   1307 C  CG    . ASN A 1 158 ? -5.801  -31.878 -7.228 1.00 50.40  ? 158  ASN A CG    1 
ATOM   1308 O  OD1   . ASN A 1 158 ? -5.953  -30.760 -6.720 1.00 47.46  ? 158  ASN A OD1   1 
ATOM   1309 N  ND2   . ASN A 1 158 ? -5.732  -32.063 -8.541 1.00 49.59  ? 158  ASN A ND2   1 
ATOM   1310 N  N     . VAL A 1 159 ? -5.784  -34.300 -3.192 1.00 44.34  ? 159  VAL A N     1 
ATOM   1311 C  CA    . VAL A 1 159 ? -5.640  -35.392 -2.229 1.00 44.35  ? 159  VAL A CA    1 
ATOM   1312 C  C     . VAL A 1 159 ? -6.909  -36.231 -2.112 1.00 44.94  ? 159  VAL A C     1 
ATOM   1313 O  O     . VAL A 1 159 ? -7.995  -35.791 -2.485 1.00 44.68  ? 159  VAL A O     1 
ATOM   1314 C  CB    . VAL A 1 159 ? -5.258  -34.876 -0.811 1.00 42.20  ? 159  VAL A CB    1 
ATOM   1315 C  CG1   . VAL A 1 159 ? -3.882  -34.223 -0.814 1.00 40.80  ? 159  VAL A CG1   1 
ATOM   1316 C  CG2   . VAL A 1 159 ? -6.324  -33.922 -0.274 1.00 41.63  ? 159  VAL A CG2   1 
ATOM   1317 N  N     . GLU A 1 160 ? -6.758  -37.440 -1.581 1.00 45.62  ? 160  GLU A N     1 
ATOM   1318 C  CA    . GLU A 1 160 ? -7.889  -38.321 -1.346 1.00 46.24  ? 160  GLU A CA    1 
ATOM   1319 C  C     . GLU A 1 160 ? -8.561  -37.945 -0.037 1.00 43.85  ? 160  GLU A C     1 
ATOM   1320 O  O     . GLU A 1 160 ? -7.979  -37.245 0.783  1.00 42.49  ? 160  GLU A O     1 
ATOM   1321 C  CB    . GLU A 1 160 ? -7.427  -39.781 -1.320 1.00 48.42  ? 160  GLU A CB    1 
ATOM   1322 C  CG    . GLU A 1 160 ? -6.810  -40.256 -2.631 1.00 54.88  ? 160  GLU A CG    1 
ATOM   1323 C  CD    . GLU A 1 160 ? -7.754  -40.095 -3.813 1.00 60.60  ? 160  GLU A CD    1 
ATOM   1324 O  OE1   . GLU A 1 160 ? -8.880  -40.635 -3.754 1.00 64.56  ? 160  GLU A OE1   1 
ATOM   1325 O  OE2   . GLU A 1 160 ? -7.371  -39.426 -4.797 1.00 61.60  ? 160  GLU A OE2   1 
ATOM   1326 N  N     . GLU A 1 161 ? -9.793  -38.402 0.144  1.00 44.38  ? 161  GLU A N     1 
ATOM   1327 C  CA    . GLU A 1 161 ? -10.527 -38.203 1.392  1.00 43.71  ? 161  GLU A CA    1 
ATOM   1328 C  C     . GLU A 1 161 ? -9.761  -38.709 2.619  1.00 42.07  ? 161  GLU A C     1 
ATOM   1329 O  O     . GLU A 1 161 ? -8.993  -39.667 2.533  1.00 42.05  ? 161  GLU A O     1 
ATOM   1330 C  CB    . GLU A 1 161 ? -11.884 -38.904 1.314  1.00 45.28  ? 161  GLU A CB    1 
ATOM   1331 C  CG    . GLU A 1 161 ? -12.843 -38.309 0.291  1.00 47.19  ? 161  GLU A CG    1 
ATOM   1332 C  CD    . GLU A 1 161 ? -14.267 -38.791 0.483  1.00 51.24  ? 161  GLU A CD    1 
ATOM   1333 O  OE1   . GLU A 1 161 ? -14.670 -39.036 1.640  1.00 53.35  ? 161  GLU A OE1   1 
ATOM   1334 O  OE2   . GLU A 1 161 ? -14.990 -38.923 -0.523 1.00 55.56  ? 161  GLU A OE2   1 
ATOM   1335 N  N     . TRP A 1 162 ? -9.976  -38.043 3.751  1.00 40.71  ? 162  TRP A N     1 
ATOM   1336 C  CA    . TRP A 1 162 ? -9.432  -38.457 5.042  1.00 38.20  ? 162  TRP A CA    1 
ATOM   1337 C  C     . TRP A 1 162 ? -10.217 -39.653 5.569  1.00 39.23  ? 162  TRP A C     1 
ATOM   1338 O  O     . TRP A 1 162 ? -11.443 -39.720 5.413  1.00 37.28  ? 162  TRP A O     1 
ATOM   1339 C  CB    . TRP A 1 162 ? -9.505  -37.293 6.022  1.00 36.31  ? 162  TRP A CB    1 
ATOM   1340 C  CG    . TRP A 1 162 ? -9.286  -37.623 7.477  1.00 37.59  ? 162  TRP A CG    1 
ATOM   1341 C  CD1   . TRP A 1 162 ? -8.084  -37.690 8.133  1.00 36.78  ? 162  TRP A CD1   1 
ATOM   1342 C  CD2   . TRP A 1 162 ? -10.296 -37.878 8.469  1.00 37.14  ? 162  TRP A CD2   1 
ATOM   1343 N  NE1   . TRP A 1 162 ? -8.284  -37.976 9.460  1.00 34.60  ? 162  TRP A NE1   1 
ATOM   1344 C  CE2   . TRP A 1 162 ? -9.629  -38.098 9.696  1.00 36.32  ? 162  TRP A CE2   1 
ATOM   1345 C  CE3   . TRP A 1 162 ? -11.697 -37.946 8.437  1.00 37.76  ? 162  TRP A CE3   1 
ATOM   1346 C  CZ2   . TRP A 1 162 ? -10.316 -38.383 10.887 1.00 34.87  ? 162  TRP A CZ2   1 
ATOM   1347 C  CZ3   . TRP A 1 162 ? -12.380 -38.235 9.622  1.00 39.24  ? 162  TRP A CZ3   1 
ATOM   1348 C  CH2   . TRP A 1 162 ? -11.683 -38.449 10.832 1.00 35.86  ? 162  TRP A CH2   1 
ATOM   1349 N  N     . SER A 1 163 ? -9.498  -40.585 6.191  1.00 39.79  ? 163  SER A N     1 
ATOM   1350 C  CA    . SER A 1 163 ? -10.070 -41.850 6.646  1.00 42.05  ? 163  SER A CA    1 
ATOM   1351 C  C     . SER A 1 163 ? -10.235 -41.906 8.165  1.00 42.85  ? 163  SER A C     1 
ATOM   1352 O  O     . SER A 1 163 ? -9.251  -41.939 8.916  1.00 41.21  ? 163  SER A O     1 
ATOM   1353 C  CB    . SER A 1 163 ? -9.210  -43.017 6.161  1.00 42.84  ? 163  SER A CB    1 
ATOM   1354 O  OG    . SER A 1 163 ? -9.576  -44.228 6.797  1.00 48.70  ? 163  SER A OG    1 
ATOM   1355 N  N     . ILE A 1 164 ? -11.491 -41.932 8.605  1.00 43.47  ? 164  ILE A N     1 
ATOM   1356 C  CA    . ILE A 1 164 ? -11.817 -42.008 10.027 1.00 43.22  ? 164  ILE A CA    1 
ATOM   1357 C  C     . ILE A 1 164 ? -11.360 -43.335 10.632 1.00 43.01  ? 164  ILE A C     1 
ATOM   1358 O  O     . ILE A 1 164 ? -11.035 -43.406 11.817 1.00 42.00  ? 164  ILE A O     1 
ATOM   1359 C  CB    . ILE A 1 164 ? -13.340 -41.753 10.290 1.00 44.51  ? 164  ILE A CB    1 
ATOM   1360 C  CG1   . ILE A 1 164 ? -13.608 -41.509 11.783 1.00 40.14  ? 164  ILE A CG1   1 
ATOM   1361 C  CG2   . ILE A 1 164 ? -14.217 -42.874 9.689  1.00 43.17  ? 164  ILE A CG2   1 
ATOM   1362 C  CD1   . ILE A 1 164 ? -14.909 -40.781 12.064 1.00 38.89  ? 164  ILE A CD1   1 
ATOM   1363 N  N     . GLU A 1 165 ? -11.322 -44.379 9.810  1.00 43.21  ? 165  GLU A N     1 
ATOM   1364 C  CA    . GLU A 1 165 ? -10.881 -45.684 10.277 1.00 45.35  ? 165  GLU A CA    1 
ATOM   1365 C  C     . GLU A 1 165 ? -9.388  -45.658 10.589 1.00 44.64  ? 165  GLU A C     1 
ATOM   1366 O  O     . GLU A 1 165 ? -8.956  -46.196 11.616 1.00 45.93  ? 165  GLU A O     1 
ATOM   1367 C  CB    . GLU A 1 165 ? -11.206 -46.784 9.260  1.00 48.60  ? 165  GLU A CB    1 
ATOM   1368 C  CG    . GLU A 1 165 ? -12.700 -47.072 9.082  1.00 53.55  ? 165  GLU A CG    1 
ATOM   1369 C  CD    . GLU A 1 165 ? -13.388 -46.124 8.099  1.00 58.51  ? 165  GLU A CD    1 
ATOM   1370 O  OE1   . GLU A 1 165 ? -12.683 -45.438 7.322  1.00 59.25  ? 165  GLU A OE1   1 
ATOM   1371 O  OE2   . GLU A 1 165 ? -14.640 -46.066 8.103  1.00 60.83  ? 165  GLU A OE2   1 
ATOM   1372 N  N     . ILE A 1 166 ? -8.612  -45.016 9.713  1.00 41.73  ? 166  ILE A N     1 
ATOM   1373 C  CA    . ILE A 1 166 ? -7.155  -44.924 9.873  1.00 38.59  ? 166  ILE A CA    1 
ATOM   1374 C  C     . ILE A 1 166 ? -6.772  -43.934 10.975 1.00 36.67  ? 166  ILE A C     1 
ATOM   1375 O  O     . ILE A 1 166 ? -5.823  -44.162 11.727 1.00 34.70  ? 166  ILE A O     1 
ATOM   1376 C  CB    . ILE A 1 166 ? -6.463  -44.577 8.527  1.00 39.14  ? 166  ILE A CB    1 
ATOM   1377 C  CG1   . ILE A 1 166 ? -6.505  -45.787 7.584  1.00 40.19  ? 166  ILE A CG1   1 
ATOM   1378 C  CG2   . ILE A 1 166 ? -5.022  -44.106 8.745  1.00 36.45  ? 166  ILE A CG2   1 
ATOM   1379 C  CD1   . ILE A 1 166 ? -6.229  -45.462 6.116  1.00 44.30  ? 166  ILE A CD1   1 
ATOM   1380 N  N     . ALA A 1 167 ? -7.533  -42.849 11.082 1.00 37.35  ? 167  ALA A N     1 
ATOM   1381 C  CA    . ALA A 1 167 ? -7.309  -41.833 12.112 1.00 36.64  ? 167  ALA A CA    1 
ATOM   1382 C  C     . ALA A 1 167 ? -7.437  -42.407 13.520 1.00 38.51  ? 167  ALA A C     1 
ATOM   1383 O  O     . ALA A 1 167 ? -6.738  -41.970 14.437 1.00 40.66  ? 167  ALA A O     1 
ATOM   1384 C  CB    . ALA A 1 167 ? -8.277  -40.694 11.927 1.00 34.83  ? 167  ALA A CB    1 
ATOM   1385 N  N     . ALA A 1 168 ? -8.330  -43.385 13.680 1.00 39.30  ? 168  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 168 ? -8.592  -44.033 14.971 1.00 38.69  ? 168  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 168 ? -7.541  -45.074 15.367 1.00 38.56  ? 168  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 168 ? -7.459  -45.448 16.533 1.00 36.24  ? 168  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 168 ? -9.976  -44.661 14.974 1.00 39.40  ? 168  ALA A CB    1 
ATOM   1390 N  N     . LYS A 1 169 ? -6.747  -45.535 14.401 1.00 39.72  ? 169  LYS A N     1 
ATOM   1391 C  CA    . LYS A 1 169 ? -5.702  -46.541 14.662 1.00 41.49  ? 169  LYS A CA    1 
ATOM   1392 C  C     . LYS A 1 169 ? -4.532  -45.974 15.460 1.00 39.33  ? 169  LYS A C     1 
ATOM   1393 O  O     . LYS A 1 169 ? -4.236  -44.781 15.368 1.00 37.87  ? 169  LYS A O     1 
ATOM   1394 C  CB    . LYS A 1 169 ? -5.176  -47.138 13.357 1.00 41.99  ? 169  LYS A CB    1 
ATOM   1395 C  CG    . LYS A 1 169 ? -6.184  -47.965 12.594 1.00 46.97  ? 169  LYS A CG    1 
ATOM   1396 C  CD    . LYS A 1 169 ? -5.479  -48.880 11.599 1.00 54.89  ? 169  LYS A CD    1 
ATOM   1397 C  CE    . LYS A 1 169 ? -6.464  -49.826 10.934 1.00 58.13  ? 169  LYS A CE    1 
ATOM   1398 N  NZ    . LYS A 1 169 ? -5.911  -51.208 10.861 1.00 61.24  ? 169  LYS A NZ    1 
ATOM   1399 N  N     . LEU A 1 170 ? -3.870  -46.833 16.236 1.00 37.80  ? 170  LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 170 ? -2.671  -46.442 16.973 1.00 37.40  ? 170  LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 170 ? -1.611  -45.904 16.031 1.00 37.73  ? 170  LEU A C     1 
ATOM   1402 O  O     . LEU A 1 170 ? -1.551  -46.316 14.874 1.00 38.95  ? 170  LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 170 ? -2.100  -47.634 17.735 1.00 38.69  ? 170  LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 170 ? -2.934  -48.342 18.807 1.00 38.11  ? 170  LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 170 ? -2.176  -49.569 19.288 1.00 36.87  ? 170  LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 170 ? -3.250  -47.427 19.967 1.00 34.88  ? 170  LEU A CD2   1 
ATOM   1407 N  N     . GLN A 1 171 ? -0.779  -44.986 16.518 1.00 39.57  ? 171  GLN A N     1 
ATOM   1408 C  CA    . GLN A 1 171 ? 0.313   -44.438 15.708 1.00 42.46  ? 171  GLN A CA    1 
ATOM   1409 C  C     . GLN A 1 171 ? 1.287   -45.525 15.290 1.00 45.51  ? 171  GLN A C     1 
ATOM   1410 O  O     . GLN A 1 171 ? 1.667   -45.609 14.125 1.00 47.42  ? 171  GLN A O     1 
ATOM   1411 C  CB    . GLN A 1 171 ? 1.050   -43.313 16.432 1.00 42.85  ? 171  GLN A CB    1 
ATOM   1412 C  CG    . GLN A 1 171 ? 0.210   -42.068 16.612 1.00 46.91  ? 171  GLN A CG    1 
ATOM   1413 C  CD    . GLN A 1 171 ? 0.978   -40.798 16.355 1.00 50.72  ? 171  GLN A CD    1 
ATOM   1414 O  OE1   . GLN A 1 171 ? 1.450   -40.564 15.242 1.00 57.92  ? 171  GLN A OE1   1 
ATOM   1415 N  NE2   . GLN A 1 171 ? 1.098   -39.959 17.377 1.00 48.57  ? 171  GLN A NE2   1 
ATOM   1416 N  N     . GLU A 1 172 ? 1.653   -46.375 16.244 1.00 48.68  ? 172  GLU A N     1 
ATOM   1417 C  CA    . GLU A 1 172 ? 2.532   -47.528 16.013 1.00 51.16  ? 172  GLU A CA    1 
ATOM   1418 C  C     . GLU A 1 172 ? 1.934   -48.557 15.042 1.00 50.90  ? 172  GLU A C     1 
ATOM   1419 O  O     . GLU A 1 172 ? 2.539   -49.601 14.772 1.00 52.21  ? 172  GLU A O     1 
ATOM   1420 C  CB    . GLU A 1 172 ? 2.865   -48.198 17.350 1.00 53.13  ? 172  GLU A CB    1 
ATOM   1421 C  CG    . GLU A 1 172 ? 3.506   -47.263 18.398 1.00 55.67  ? 172  GLU A CG    1 
ATOM   1422 C  CD    . GLU A 1 172 ? 2.496   -46.454 19.201 1.00 55.63  ? 172  GLU A CD    1 
ATOM   1423 O  OE1   . GLU A 1 172 ? 2.927   -45.750 20.140 1.00 59.37  ? 172  GLU A OE1   1 
ATOM   1424 O  OE2   . GLU A 1 172 ? 1.280   -46.516 18.909 1.00 55.28  ? 172  GLU A OE2   1 
ATOM   1425 N  N     . GLN A 1 173 ? 0.751   -48.236 14.523 1.00 47.36  ? 173  GLN A N     1 
ATOM   1426 C  CA    . GLN A 1 173 ? 0.015   -49.070 13.586 1.00 47.40  ? 173  GLN A CA    1 
ATOM   1427 C  C     . GLN A 1 173 ? -0.261  -48.270 12.290 1.00 44.21  ? 173  GLN A C     1 
ATOM   1428 O  O     . GLN A 1 173 ? -1.039  -48.690 11.423 1.00 41.81  ? 173  GLN A O     1 
ATOM   1429 C  CB    . GLN A 1 173 ? -1.275  -49.529 14.268 1.00 50.48  ? 173  GLN A CB    1 
ATOM   1430 C  CG    . GLN A 1 173 ? -2.221  -50.398 13.455 1.00 58.92  ? 173  GLN A CG    1 
ATOM   1431 C  CD    . GLN A 1 173 ? -3.552  -50.669 14.178 1.00 65.83  ? 173  GLN A CD    1 
ATOM   1432 O  OE1   . GLN A 1 173 ? -3.862  -50.065 15.219 1.00 65.58  ? 173  GLN A OE1   1 
ATOM   1433 N  NE2   . GLN A 1 173 ? -4.343  -51.585 13.620 1.00 69.31  ? 173  GLN A NE2   1 
ATOM   1434 N  N     . GLY A 1 174 ? 0.405   -47.124 12.160 1.00 41.33  ? 174  GLY A N     1 
ATOM   1435 C  CA    . GLY A 1 174 ? 0.286   -46.281 10.974 1.00 41.33  ? 174  GLY A CA    1 
ATOM   1436 C  C     . GLY A 1 174 ? -0.887  -45.316 10.988 1.00 40.95  ? 174  GLY A C     1 
ATOM   1437 O  O     . GLY A 1 174 ? -1.081  -44.557 10.033 1.00 42.80  ? 174  GLY A O     1 
ATOM   1438 N  N     . GLY A 1 175 ? -1.668  -45.351 12.068 1.00 39.03  ? 175  GLY A N     1 
ATOM   1439 C  CA    . GLY A 1 175 ? -2.814  -44.476 12.236 1.00 36.73  ? 175  GLY A CA    1 
ATOM   1440 C  C     . GLY A 1 175 ? -2.453  -43.200 12.963 1.00 36.56  ? 175  GLY A C     1 
ATOM   1441 O  O     . GLY A 1 175 ? -1.290  -42.956 13.268 1.00 37.95  ? 175  GLY A O     1 
ATOM   1442 N  N     . ASP A 1 176 ? -3.459  -42.390 13.260 1.00 35.80  ? 176  ASP A N     1 
ATOM   1443 C  CA    . ASP A 1 176 ? -3.220  -41.068 13.829 1.00 36.53  ? 176  ASP A CA    1 
ATOM   1444 C  C     . ASP A 1 176 ? -3.564  -40.957 15.310 1.00 36.51  ? 176  ASP A C     1 
ATOM   1445 O  O     . ASP A 1 176 ? -3.354  -39.909 15.926 1.00 36.73  ? 176  ASP A O     1 
ATOM   1446 C  CB    . ASP A 1 176 ? -3.993  -40.022 13.032 1.00 36.45  ? 176  ASP A CB    1 
ATOM   1447 C  CG    . ASP A 1 176 ? -3.687  -40.077 11.540 1.00 35.94  ? 176  ASP A CG    1 
ATOM   1448 O  OD1   . ASP A 1 176 ? -2.497  -40.106 11.154 1.00 36.04  ? 176  ASP A OD1   1 
ATOM   1449 O  OD2   . ASP A 1 176 ? -4.652  -40.080 10.752 1.00 37.13  ? 176  ASP A OD2   1 
ATOM   1450 N  N     . GLU A 1 177 ? -4.089  -42.044 15.871 1.00 37.87  ? 177  GLU A N     1 
ATOM   1451 C  CA    . GLU A 1 177 ? -4.451  -42.118 17.284 1.00 39.62  ? 177  GLU A CA    1 
ATOM   1452 C  C     . GLU A 1 177 ? -5.367  -40.967 17.699 1.00 36.64  ? 177  GLU A C     1 
ATOM   1453 O  O     . GLU A 1 177 ? -5.212  -40.394 18.772 1.00 36.00  ? 177  GLU A O     1 
ATOM   1454 C  CB    . GLU A 1 177 ? -3.195  -42.196 18.168 1.00 42.88  ? 177  GLU A CB    1 
ATOM   1455 C  CG    . GLU A 1 177 ? -3.331  -43.118 19.386 1.00 51.52  ? 177  GLU A CG    1 
ATOM   1456 C  CD    . GLU A 1 177 ? -1.979  -43.500 19.987 1.00 59.49  ? 177  GLU A CD    1 
ATOM   1457 O  OE1   . GLU A 1 177 ? -1.887  -43.595 21.235 1.00 61.31  ? 177  GLU A OE1   1 
ATOM   1458 O  OE2   . GLU A 1 177 ? -1.008  -43.710 19.214 1.00 61.73  ? 177  GLU A OE2   1 
ATOM   1459 N  N     . VAL A 1 178 ? -6.309  -40.619 16.827 1.00 35.10  ? 178  VAL A N     1 
ATOM   1460 C  CA    . VAL A 1 178 ? -7.407  -39.740 17.207 1.00 34.22  ? 178  VAL A CA    1 
ATOM   1461 C  C     . VAL A 1 178 ? -8.170  -40.386 18.376 1.00 33.15  ? 178  VAL A C     1 
ATOM   1462 O  O     . VAL A 1 178 ? -8.651  -41.508 18.243 1.00 33.35  ? 178  VAL A O     1 
ATOM   1463 C  CB    . VAL A 1 178 ? -8.350  -39.461 16.018 1.00 32.89  ? 178  VAL A CB    1 
ATOM   1464 C  CG1   . VAL A 1 178 ? -9.556  -38.631 16.465 1.00 30.44  ? 178  VAL A CG1   1 
ATOM   1465 C  CG2   . VAL A 1 178 ? -7.597  -38.745 14.928 1.00 29.81  ? 178  VAL A CG2   1 
ATOM   1466 N  N     . PRO A 1 179 ? -8.251  -39.690 19.530 1.00 33.48  ? 179  PRO A N     1 
ATOM   1467 C  CA    . PRO A 1 179 ? -8.848  -40.263 20.747 1.00 32.86  ? 179  PRO A CA    1 
ATOM   1468 C  C     . PRO A 1 179 ? -10.204 -40.908 20.506 1.00 33.42  ? 179  PRO A C     1 
ATOM   1469 O  O     . PRO A 1 179 ? -11.050 -40.327 19.820 1.00 34.81  ? 179  PRO A O     1 
ATOM   1470 C  CB    . PRO A 1 179 ? -8.982  -39.047 21.665 1.00 31.72  ? 179  PRO A CB    1 
ATOM   1471 C  CG    . PRO A 1 179 ? -7.821  -38.207 21.294 1.00 31.68  ? 179  PRO A CG    1 
ATOM   1472 C  CD    . PRO A 1 179 ? -7.714  -38.338 19.786 1.00 32.90  ? 179  PRO A CD    1 
ATOM   1473 N  N     . SER A 1 180 ? -10.397 -42.101 21.066 1.00 34.20  ? 180  SER A N     1 
ATOM   1474 C  CA    . SER A 1 180 ? -11.614 -42.887 20.826 1.00 35.61  ? 180  SER A CA    1 
ATOM   1475 C  C     . SER A 1 180 ? -12.904 -42.180 21.255 1.00 35.34  ? 180  SER A C     1 
ATOM   1476 O  O     . SER A 1 180 ? -13.928 -42.302 20.591 1.00 39.01  ? 180  SER A O     1 
ATOM   1477 C  CB    . SER A 1 180 ? -11.511 -44.269 21.477 1.00 36.09  ? 180  SER A CB    1 
ATOM   1478 O  OG    . SER A 1 180 ? -11.079 -44.178 22.827 1.00 38.89  ? 180  SER A OG    1 
ATOM   1479 N  N     . GLU A 1 181 ? -12.840 -41.413 22.338 1.00 32.91  ? 181  GLU A N     1 
ATOM   1480 C  CA    . GLU A 1 181 ? -14.016 -40.740 22.891 1.00 33.16  ? 181  GLU A CA    1 
ATOM   1481 C  C     . GLU A 1 181 ? -14.608 -39.600 22.029 1.00 32.32  ? 181  GLU A C     1 
ATOM   1482 O  O     . GLU A 1 181 ? -15.628 -39.001 22.403 1.00 34.48  ? 181  GLU A O     1 
ATOM   1483 C  CB    . GLU A 1 181 ? -13.736 -40.275 24.336 1.00 31.50  ? 181  GLU A CB    1 
ATOM   1484 C  CG    . GLU A 1 181 ? -12.764 -39.105 24.480 1.00 37.35  ? 181  GLU A CG    1 
ATOM   1485 C  CD    . GLU A 1 181 ? -11.273 -39.505 24.558 1.00 39.19  ? 181  GLU A CD    1 
ATOM   1486 O  OE1   . GLU A 1 181 ? -10.907 -40.664 24.257 1.00 37.63  ? 181  GLU A OE1   1 
ATOM   1487 O  OE2   . GLU A 1 181 ? -10.457 -38.629 24.916 1.00 37.26  ? 181  GLU A OE2   1 
ATOM   1488 N  N     . ILE A 1 182 ? -13.982 -39.306 20.887 1.00 30.93  ? 182  ILE A N     1 
ATOM   1489 C  CA    . ILE A 1 182 ? -14.475 -38.262 19.965 1.00 30.05  ? 182  ILE A CA    1 
ATOM   1490 C  C     . ILE A 1 182 ? -14.686 -38.774 18.541 1.00 31.40  ? 182  ILE A C     1 
ATOM   1491 O  O     . ILE A 1 182 ? -15.219 -38.060 17.697 1.00 31.82  ? 182  ILE A O     1 
ATOM   1492 C  CB    . ILE A 1 182 ? -13.559 -36.991 19.889 1.00 27.48  ? 182  ILE A CB    1 
ATOM   1493 C  CG1   . ILE A 1 182 ? -12.223 -37.320 19.235 1.00 28.26  ? 182  ILE A CG1   1 
ATOM   1494 C  CG2   . ILE A 1 182 ? -13.360 -36.335 21.253 1.00 22.56  ? 182  ILE A CG2   1 
ATOM   1495 C  CD1   . ILE A 1 182 ? -11.564 -36.128 18.609 1.00 26.71  ? 182  ILE A CD1   1 
ATOM   1496 N  N     . ILE A 1 183 ? -14.253 -40.002 18.277 1.00 34.07  ? 183  ILE A N     1 
ATOM   1497 C  CA    . ILE A 1 183 ? -14.410 -40.620 16.959 1.00 34.72  ? 183  ILE A CA    1 
ATOM   1498 C  C     . ILE A 1 183 ? -15.874 -40.590 16.505 1.00 36.49  ? 183  ILE A C     1 
ATOM   1499 O  O     . ILE A 1 183 ? -16.169 -40.220 15.369 1.00 39.85  ? 183  ILE A O     1 
ATOM   1500 C  CB    . ILE A 1 183 ? -13.788 -42.053 16.932 1.00 34.30  ? 183  ILE A CB    1 
ATOM   1501 C  CG1   . ILE A 1 183 ? -12.267 -41.967 16.767 1.00 34.05  ? 183  ILE A CG1   1 
ATOM   1502 C  CG2   . ILE A 1 183 ? -14.380 -42.929 15.826 1.00 36.30  ? 183  ILE A CG2   1 
ATOM   1503 C  CD1   . ILE A 1 183 ? -11.797 -41.394 15.427 1.00 33.48  ? 183  ILE A CD1   1 
ATOM   1504 N  N     . ASP A 1 184 ? -16.789 -40.937 17.406 1.00 38.51  ? 184  ASP A N     1 
ATOM   1505 C  CA    . ASP A 1 184 ? -18.222 -40.925 17.095 1.00 39.92  ? 184  ASP A CA    1 
ATOM   1506 C  C     . ASP A 1 184 ? -18.813 -39.511 16.970 1.00 38.31  ? 184  ASP A C     1 
ATOM   1507 O  O     . ASP A 1 184 ? -19.957 -39.357 16.556 1.00 39.11  ? 184  ASP A O     1 
ATOM   1508 C  CB    . ASP A 1 184 ? -19.015 -41.758 18.123 1.00 42.74  ? 184  ASP A CB    1 
ATOM   1509 C  CG    . ASP A 1 184 ? -18.808 -43.279 17.966 1.00 47.19  ? 184  ASP A CG    1 
ATOM   1510 O  OD1   . ASP A 1 184 ? -18.396 -43.748 16.877 1.00 49.16  ? 184  ASP A OD1   1 
ATOM   1511 O  OD2   . ASP A 1 184 ? -19.075 -44.014 18.946 1.00 48.63  ? 184  ASP A OD2   1 
ATOM   1512 N  N     . LYS A 1 185 ? -18.035 -38.481 17.307 1.00 37.84  ? 185  LYS A N     1 
ATOM   1513 C  CA    . LYS A 1 185 ? -18.541 -37.096 17.295 1.00 34.99  ? 185  LYS A CA    1 
ATOM   1514 C  C     . LYS A 1 185 ? -18.099 -36.256 16.084 1.00 34.49  ? 185  LYS A C     1 
ATOM   1515 O  O     . LYS A 1 185 ? -18.545 -35.118 15.906 1.00 32.91  ? 185  LYS A O     1 
ATOM   1516 C  CB    . LYS A 1 185 ? -18.206 -36.394 18.606 1.00 34.39  ? 185  LYS A CB    1 
ATOM   1517 C  CG    . LYS A 1 185 ? -18.973 -36.961 19.796 1.00 39.23  ? 185  LYS A CG    1 
ATOM   1518 C  CD    . LYS A 1 185 ? -18.417 -36.449 21.106 1.00 39.74  ? 185  LYS A CD    1 
ATOM   1519 C  CE    . LYS A 1 185 ? -19.065 -37.141 22.277 1.00 39.35  ? 185  LYS A CE    1 
ATOM   1520 N  NZ    . LYS A 1 185 ? -18.711 -36.452 23.545 1.00 39.51  ? 185  LYS A NZ    1 
ATOM   1521 N  N     . ILE A 1 186 ? -17.239 -36.838 15.249 1.00 32.99  ? 186  ILE A N     1 
ATOM   1522 C  CA    . ILE A 1 186 ? -16.746 -36.182 14.039 1.00 31.27  ? 186  ILE A CA    1 
ATOM   1523 C  C     . ILE A 1 186 ? -17.777 -36.274 12.902 1.00 31.72  ? 186  ILE A C     1 
ATOM   1524 O  O     . ILE A 1 186 ? -18.266 -37.357 12.582 1.00 31.55  ? 186  ILE A O     1 
ATOM   1525 C  CB    . ILE A 1 186 ? -15.374 -36.785 13.602 1.00 28.10  ? 186  ILE A CB    1 
ATOM   1526 C  CG1   . ILE A 1 186 ? -14.298 -36.461 14.638 1.00 27.81  ? 186  ILE A CG1   1 
ATOM   1527 C  CG2   . ILE A 1 186 ? -14.945 -36.263 12.243 1.00 29.17  ? 186  ILE A CG2   1 
ATOM   1528 C  CD1   . ILE A 1 186 ? -13.084 -37.418 14.627 1.00 28.21  ? 186  ILE A CD1   1 
ATOM   1529 N  N     . ILE A 1 187 ? -18.113 -35.126 12.319 1.00 32.54  ? 187  ILE A N     1 
ATOM   1530 C  CA    . ILE A 1 187 ? -18.923 -35.069 11.100 1.00 33.62  ? 187  ILE A CA    1 
ATOM   1531 C  C     . ILE A 1 187 ? -18.052 -34.527 9.967  1.00 34.45  ? 187  ILE A C     1 
ATOM   1532 O  O     . ILE A 1 187 ? -17.690 -33.347 9.955  1.00 32.98  ? 187  ILE A O     1 
ATOM   1533 C  CB    . ILE A 1 187 ? -20.198 -34.211 11.279 1.00 34.11  ? 187  ILE A CB    1 
ATOM   1534 C  CG1   . ILE A 1 187 ? -21.178 -34.927 12.218 1.00 34.95  ? 187  ILE A CG1   1 
ATOM   1535 C  CG2   . ILE A 1 187 ? -20.858 -33.916 9.909  1.00 31.25  ? 187  ILE A CG2   1 
ATOM   1536 C  CD1   . ILE A 1 187 ? -22.224 -34.028 12.853 1.00 36.90  ? 187  ILE A CD1   1 
ATOM   1537 N  N     . TYR A 1 188 ? -17.715 -35.407 9.027  1.00 35.50  ? 188  TYR A N     1 
ATOM   1538 C  CA    . TYR A 1 188 ? -16.686 -35.116 8.034  1.00 36.14  ? 188  TYR A CA    1 
ATOM   1539 C  C     . TYR A 1 188 ? -17.310 -34.665 6.718  1.00 37.88  ? 188  TYR A C     1 
ATOM   1540 O  O     . TYR A 1 188 ? -18.175 -35.348 6.157  1.00 38.62  ? 188  TYR A O     1 
ATOM   1541 C  CB    . TYR A 1 188 ? -15.764 -36.337 7.845  1.00 34.91  ? 188  TYR A CB    1 
ATOM   1542 C  CG    . TYR A 1 188 ? -14.763 -36.206 6.713  1.00 36.06  ? 188  TYR A CG    1 
ATOM   1543 C  CD1   . TYR A 1 188 ? -13.578 -35.497 6.878  1.00 33.31  ? 188  TYR A CD1   1 
ATOM   1544 C  CD2   . TYR A 1 188 ? -15.001 -36.801 5.475  1.00 36.75  ? 188  TYR A CD2   1 
ATOM   1545 C  CE1   . TYR A 1 188 ? -12.663 -35.380 5.843  1.00 33.46  ? 188  TYR A CE1   1 
ATOM   1546 C  CE2   . TYR A 1 188 ? -14.084 -36.688 4.435  1.00 37.96  ? 188  TYR A CE2   1 
ATOM   1547 C  CZ    . TYR A 1 188 ? -12.923 -35.971 4.631  1.00 35.30  ? 188  TYR A CZ    1 
ATOM   1548 O  OH    . TYR A 1 188 ? -12.025 -35.857 3.604  1.00 37.84  ? 188  TYR A OH    1 
ATOM   1549 N  N     . MET A 1 189 ? -16.873 -33.507 6.234  1.00 37.83  ? 189  MET A N     1 
ATOM   1550 C  CA    . MET A 1 189 ? -17.388 -32.952 4.987  1.00 38.12  ? 189  MET A CA    1 
ATOM   1551 C  C     . MET A 1 189 ? -16.227 -32.601 4.070  1.00 39.63  ? 189  MET A C     1 
ATOM   1552 O  O     . MET A 1 189 ? -15.552 -31.583 4.290  1.00 38.11  ? 189  MET A O     1 
ATOM   1553 C  CB    . MET A 1 189 ? -18.230 -31.707 5.250  1.00 37.22  ? 189  MET A CB    1 
ATOM   1554 C  CG    . MET A 1 189 ? -19.530 -31.954 5.993  1.00 41.21  ? 189  MET A CG    1 
ATOM   1555 S  SD    . MET A 1 189 ? -20.091 -30.457 6.823  1.00 49.19  ? 189  MET A SD    1 
ATOM   1556 C  CE    . MET A 1 189 ? -18.895 -30.351 8.156  1.00 45.96  ? 189  MET A CE    1 
ATOM   1557 N  N     . PRO A 1 190 ? -15.976 -33.454 3.055  1.00 40.94  ? 190  PRO A N     1 
ATOM   1558 C  CA    . PRO A 1 190 ? -14.984 -33.172 2.019  1.00 42.41  ? 190  PRO A CA    1 
ATOM   1559 C  C     . PRO A 1 190 ? -15.556 -32.227 0.967  1.00 42.55  ? 190  PRO A C     1 
ATOM   1560 O  O     . PRO A 1 190 ? -16.768 -32.215 0.743  1.00 42.42  ? 190  PRO A O     1 
ATOM   1561 C  CB    . PRO A 1 190 ? -14.733 -34.544 1.402  1.00 42.94  ? 190  PRO A CB    1 
ATOM   1562 C  CG    . PRO A 1 190 ? -16.046 -35.237 1.528  1.00 44.77  ? 190  PRO A CG    1 
ATOM   1563 C  CD    . PRO A 1 190 ? -16.635 -34.757 2.837  1.00 43.33  ? 190  PRO A CD    1 
ATOM   1564 N  N     . PHE A 1 191 ? -14.679 -31.436 0.350  1.00 42.95  ? 191  PHE A N     1 
ATOM   1565 C  CA    . PHE A 1 191 ? -15.053 -30.485 -0.701 1.00 42.32  ? 191  PHE A CA    1 
ATOM   1566 C  C     . PHE A 1 191 ? -14.000 -30.490 -1.797 1.00 42.85  ? 191  PHE A C     1 
ATOM   1567 O  O     . PHE A 1 191 ? -12.795 -30.575 -1.520 1.00 42.61  ? 191  PHE A O     1 
ATOM   1568 C  CB    . PHE A 1 191 ? -15.186 -29.058 -0.149 1.00 41.29  ? 191  PHE A CB    1 
ATOM   1569 C  CG    . PHE A 1 191 ? -16.272 -28.891 0.871  1.00 40.41  ? 191  PHE A CG    1 
ATOM   1570 C  CD1   . PHE A 1 191 ? -16.001 -29.057 2.230  1.00 37.46  ? 191  PHE A CD1   1 
ATOM   1571 C  CD2   . PHE A 1 191 ? -17.566 -28.551 0.477  1.00 39.13  ? 191  PHE A CD2   1 
ATOM   1572 C  CE1   . PHE A 1 191 ? -17.007 -28.905 3.180  1.00 36.34  ? 191  PHE A CE1   1 
ATOM   1573 C  CE2   . PHE A 1 191 ? -18.579 -28.393 1.419  1.00 38.85  ? 191  PHE A CE2   1 
ATOM   1574 C  CZ    . PHE A 1 191 ? -18.292 -28.569 2.779  1.00 39.42  ? 191  PHE A CZ    1 
ATOM   1575 N  N     . ASP A 1 192 ? -14.462 -30.377 -3.037 1.00 44.63  ? 192  ASP A N     1 
ATOM   1576 C  CA    . ASP A 1 192 ? -13.579 -30.436 -4.193 1.00 46.83  ? 192  ASP A CA    1 
ATOM   1577 C  C     . ASP A 1 192 ? -13.067 -29.066 -4.646 1.00 45.73  ? 192  ASP A C     1 
ATOM   1578 O  O     . ASP A 1 192 ? -12.213 -28.987 -5.525 1.00 46.95  ? 192  ASP A O     1 
ATOM   1579 C  CB    . ASP A 1 192 ? -14.261 -31.183 -5.345 1.00 50.34  ? 192  ASP A CB    1 
ATOM   1580 C  CG    . ASP A 1 192 ? -14.259 -32.705 -5.153 1.00 56.46  ? 192  ASP A CG    1 
ATOM   1581 O  OD1   . ASP A 1 192 ? -14.106 -33.178 -4.003 1.00 59.45  ? 192  ASP A OD1   1 
ATOM   1582 O  OD2   . ASP A 1 192 ? -14.418 -33.434 -6.163 1.00 62.95  ? 192  ASP A OD2   1 
ATOM   1583 N  N     . ASN A 1 193 ? -13.594 -27.995 -4.056 1.00 43.85  ? 193  ASN A N     1 
ATOM   1584 C  CA    . ASN A 1 193 ? -13.067 -26.644 -4.288 1.00 44.86  ? 193  ASN A CA    1 
ATOM   1585 C  C     . ASN A 1 193 ? -13.261 -25.720 -3.080 1.00 44.25  ? 193  ASN A C     1 
ATOM   1586 O  O     . ASN A 1 193 ? -14.181 -25.907 -2.277 1.00 43.00  ? 193  ASN A O     1 
ATOM   1587 C  CB    . ASN A 1 193 ? -13.626 -26.008 -5.578 1.00 46.32  ? 193  ASN A CB    1 
ATOM   1588 C  CG    . ASN A 1 193 ? -15.117 -25.716 -5.499 1.00 49.65  ? 193  ASN A CG    1 
ATOM   1589 O  OD1   . ASN A 1 193 ? -15.543 -24.742 -4.873 1.00 49.77  ? 193  ASN A OD1   1 
ATOM   1590 N  ND2   . ASN A 1 193 ? -15.919 -26.556 -6.149 1.00 52.53  ? 193  ASN A ND2   1 
ATOM   1591 N  N     . GLU A 1 194 ? -12.379 -24.730 -2.962 1.00 42.65  ? 194  GLU A N     1 
ATOM   1592 C  CA    . GLU A 1 194 ? -12.383 -23.822 -1.825 1.00 41.51  ? 194  GLU A CA    1 
ATOM   1593 C  C     . GLU A 1 194 ? -13.713 -23.086 -1.694 1.00 40.61  ? 194  GLU A C     1 
ATOM   1594 O  O     . GLU A 1 194 ? -14.275 -23.011 -0.602 1.00 40.42  ? 194  GLU A O     1 
ATOM   1595 C  CB    . GLU A 1 194 ? -11.223 -22.828 -1.930 1.00 39.98  ? 194  GLU A CB    1 
ATOM   1596 C  CG    . GLU A 1 194 ? -10.900 -22.120 -0.628 1.00 39.30  ? 194  GLU A CG    1 
ATOM   1597 C  CD    . GLU A 1 194 ? -9.770  -21.104 -0.762 1.00 43.21  ? 194  GLU A CD    1 
ATOM   1598 O  OE1   . GLU A 1 194 ? -9.478  -20.424 0.241  1.00 43.05  ? 194  GLU A OE1   1 
ATOM   1599 O  OE2   . GLU A 1 194 ? -9.177  -20.973 -1.858 1.00 40.86  ? 194  GLU A OE2   1 
ATOM   1600 N  N     . LYS A 1 195 ? -14.216 -22.568 -2.813 1.00 41.07  ? 195  LYS A N     1 
ATOM   1601 C  CA    . LYS A 1 195 ? -15.398 -21.705 -2.809 1.00 42.57  ? 195  LYS A CA    1 
ATOM   1602 C  C     . LYS A 1 195 ? -16.627 -22.369 -2.167 1.00 41.59  ? 195  LYS A C     1 
ATOM   1603 O  O     . LYS A 1 195 ? -17.326 -21.739 -1.379 1.00 40.66  ? 195  LYS A O     1 
ATOM   1604 C  CB    . LYS A 1 195 ? -15.692 -21.173 -4.218 1.00 46.24  ? 195  LYS A CB    1 
ATOM   1605 C  CG    . LYS A 1 195 ? -14.723 -20.079 -4.669 1.00 50.77  ? 195  LYS A CG    1 
ATOM   1606 C  CD    . LYS A 1 195 ? -14.837 -19.756 -6.157 1.00 56.93  ? 195  LYS A CD    1 
ATOM   1607 C  CE    . LYS A 1 195 ? -13.615 -18.955 -6.644 1.00 60.62  ? 195  LYS A CE    1 
ATOM   1608 N  NZ    . LYS A 1 195 ? -13.504 -18.860 -8.136 1.00 60.69  ? 195  LYS A NZ    1 
ATOM   1609 N  N     . GLU A 1 196 ? -16.866 -23.643 -2.468 1.00 41.31  ? 196  GLU A N     1 
ATOM   1610 C  CA    . GLU A 1 196 ? -17.973 -24.351 -1.842 1.00 42.54  ? 196  GLU A CA    1 
ATOM   1611 C  C     . GLU A 1 196 ? -17.706 -24.674 -0.369 1.00 39.64  ? 196  GLU A C     1 
ATOM   1612 O  O     . GLU A 1 196 ? -18.639 -24.646 0.435  1.00 38.32  ? 196  GLU A O     1 
ATOM   1613 C  CB    . GLU A 1 196 ? -18.407 -25.591 -2.640 1.00 46.56  ? 196  GLU A CB    1 
ATOM   1614 C  CG    . GLU A 1 196 ? -17.329 -26.646 -2.846 1.00 57.40  ? 196  GLU A CG    1 
ATOM   1615 C  CD    . GLU A 1 196 ? -17.885 -28.019 -3.222 1.00 67.03  ? 196  GLU A CD    1 
ATOM   1616 O  OE1   . GLU A 1 196 ? -17.071 -28.966 -3.378 1.00 68.55  ? 196  GLU A OE1   1 
ATOM   1617 O  OE2   . GLU A 1 196 ? -19.128 -28.154 -3.349 1.00 70.96  ? 196  GLU A OE2   1 
ATOM   1618 N  N     . LEU A 1 197 ? -16.447 -24.949 -0.012 1.00 36.37  ? 197  LEU A N     1 
ATOM   1619 C  CA    . LEU A 1 197 ? -16.079 -25.148 1.402  1.00 33.63  ? 197  LEU A CA    1 
ATOM   1620 C  C     . LEU A 1 197 ? -16.396 -23.909 2.263  1.00 34.19  ? 197  LEU A C     1 
ATOM   1621 O  O     . LEU A 1 197 ? -17.055 -24.016 3.305  1.00 32.87  ? 197  LEU A O     1 
ATOM   1622 C  CB    . LEU A 1 197 ? -14.603 -25.554 1.546  1.00 33.56  ? 197  LEU A CB    1 
ATOM   1623 C  CG    . LEU A 1 197 ? -14.037 -25.985 2.915  1.00 30.48  ? 197  LEU A CG    1 
ATOM   1624 C  CD1   . LEU A 1 197 ? -12.729 -26.729 2.741  1.00 27.48  ? 197  LEU A CD1   1 
ATOM   1625 C  CD2   . LEU A 1 197 ? -13.834 -24.804 3.868  1.00 24.50  ? 197  LEU A CD2   1 
ATOM   1626 N  N     . LEU A 1 198 ? -15.934 -22.740 1.821  1.00 33.40  ? 198  LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 198 ? -16.178 -21.496 2.542  1.00 32.71  ? 198  LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 198 ? -17.663 -21.136 2.565  1.00 35.97  ? 198  LEU A C     1 
ATOM   1629 O  O     . LEU A 1 198 ? -18.196 -20.782 3.618  1.00 35.02  ? 198  LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 198 ? -15.339 -20.356 1.957  1.00 31.84  ? 198  LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 198 ? -13.812 -20.557 1.990  1.00 31.05  ? 198  LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 198 ? -13.080 -19.440 1.285  1.00 30.75  ? 198  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 198 ? -13.269 -20.721 3.415  1.00 28.80  ? 198  LEU A CD2   1 
ATOM   1634 N  N     . MET A 1 199 ? -18.331 -21.244 1.412  1.00 39.41  ? 199  MET A N     1 
ATOM   1635 C  CA    . MET A 1 199 ? -19.767 -20.961 1.323  1.00 41.72  ? 199  MET A CA    1 
ATOM   1636 C  C     . MET A 1 199 ? -20.516 -21.872 2.288  1.00 39.54  ? 199  MET A C     1 
ATOM   1637 O  O     . MET A 1 199 ? -21.399 -21.432 3.026  1.00 39.01  ? 199  MET A O     1 
ATOM   1638 C  CB    . MET A 1 199 ? -20.295 -21.174 -0.100 1.00 46.48  ? 199  MET A CB    1 
ATOM   1639 C  CG    . MET A 1 199 ? -20.186 -19.980 -1.031 1.00 55.22  ? 199  MET A CG    1 
ATOM   1640 S  SD    . MET A 1 199 ? -21.074 -20.252 -2.606 1.00 74.36  ? 199  MET A SD    1 
ATOM   1641 C  CE    . MET A 1 199 ? -19.935 -21.256 -3.571 1.00 69.72  ? 199  MET A CE    1 
ATOM   1642 N  N     . GLU A 1 200 ? -20.141 -23.145 2.294  1.00 39.22  ? 200  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 200 ? -20.773 -24.100 3.183  1.00 38.71  ? 200  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 200 ? -20.396 -23.800 4.636  1.00 36.16  ? 200  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 200 ? -21.200 -24.031 5.534  1.00 34.39  ? 200  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 200 ? -20.434 -25.536 2.768  1.00 42.03  ? 200  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 200 ? -21.300 -26.631 3.396  1.00 50.59  ? 200  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 200 ? -22.792 -26.356 3.299  1.00 57.93  ? 200  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 200 ? -23.301 -26.151 2.170  1.00 60.84  ? 200  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 200 ? -23.454 -26.349 4.365  1.00 61.28  ? 200  GLU A OE2   1 
ATOM   1651 N  N     . TYR A 1 201 ? -19.202 -23.248 4.866  1.00 34.03  ? 201  TYR A N     1 
ATOM   1652 C  CA    . TYR A 1 201 ? -18.803 -22.876 6.228  1.00 33.50  ? 201  TYR A CA    1 
ATOM   1653 C  C     . TYR A 1 201 ? -19.641 -21.712 6.744  1.00 34.18  ? 201  TYR A C     1 
ATOM   1654 O  O     . TYR A 1 201 ? -20.112 -21.742 7.884  1.00 37.25  ? 201  TYR A O     1 
ATOM   1655 C  CB    . TYR A 1 201 ? -17.296 -22.578 6.356  1.00 30.82  ? 201  TYR A CB    1 
ATOM   1656 C  CG    . TYR A 1 201 ? -16.849 -22.359 7.798  1.00 30.63  ? 201  TYR A CG    1 
ATOM   1657 C  CD1   . TYR A 1 201 ? -16.907 -23.391 8.735  1.00 29.72  ? 201  TYR A CD1   1 
ATOM   1658 C  CD2   . TYR A 1 201 ? -16.371 -21.118 8.228  1.00 31.23  ? 201  TYR A CD2   1 
ATOM   1659 C  CE1   . TYR A 1 201 ? -16.503 -23.197 10.052 1.00 24.06  ? 201  TYR A CE1   1 
ATOM   1660 C  CE2   . TYR A 1 201 ? -15.958 -20.915 9.554  1.00 23.42  ? 201  TYR A CE2   1 
ATOM   1661 C  CZ    . TYR A 1 201 ? -16.032 -21.956 10.454 1.00 25.41  ? 201  TYR A CZ    1 
ATOM   1662 O  OH    . TYR A 1 201 ? -15.640 -21.765 11.766 1.00 24.98  ? 201  TYR A OH    1 
ATOM   1663 N  N     . LEU A 1 202 ? -19.836 -20.702 5.901  1.00 33.24  ? 202  LEU A N     1 
ATOM   1664 C  CA    . LEU A 1 202 ? -20.683 -19.568 6.239  1.00 31.96  ? 202  LEU A CA    1 
ATOM   1665 C  C     . LEU A 1 202 ? -22.119 -19.957 6.490  1.00 34.85  ? 202  LEU A C     1 
ATOM   1666 O  O     . LEU A 1 202 ? -22.734 -19.486 7.445  1.00 36.08  ? 202  LEU A O     1 
ATOM   1667 C  CB    . LEU A 1 202 ? -20.656 -18.540 5.130  1.00 32.23  ? 202  LEU A CB    1 
ATOM   1668 C  CG    . LEU A 1 202 ? -19.486 -17.579 5.200  1.00 34.08  ? 202  LEU A CG    1 
ATOM   1669 C  CD1   . LEU A 1 202 ? -19.407 -16.822 3.896  1.00 34.08  ? 202  LEU A CD1   1 
ATOM   1670 C  CD2   . LEU A 1 202 ? -19.650 -16.635 6.388  1.00 33.10  ? 202  LEU A CD2   1 
ATOM   1671 N  N     . ASN A 1 203 ? -22.661 -20.807 5.624  1.00 38.28  ? 203  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 203 ? -24.041 -21.240 5.761  1.00 40.26  ? 203  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 203 ? -24.248 -21.998 7.074  1.00 39.19  ? 203  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 203 ? -25.243 -21.787 7.779  1.00 38.27  ? 203  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 203 ? -24.467 -22.070 4.551  1.00 44.60  ? 203  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 203 ? -24.857 -21.205 3.346  1.00 50.89  ? 203  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 203 ? -25.793 -21.535 2.620  1.00 55.37  ? 203  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 203 ? -24.137 -20.106 3.127  1.00 52.92  ? 203  ASN A ND2   1 
ATOM   1679 N  N     . PHE A 1 204 ? -23.277 -22.850 7.402  1.00 37.74  ? 204  PHE A N     1 
ATOM   1680 C  CA    . PHE A 1 204 ? -23.226 -23.582 8.675  1.00 34.57  ? 204  PHE A CA    1 
ATOM   1681 C  C     . PHE A 1 204 ? -23.046 -22.626 9.872  1.00 33.33  ? 204  PHE A C     1 
ATOM   1682 O  O     . PHE A 1 204 ? -23.676 -22.802 10.922 1.00 30.91  ? 204  PHE A O     1 
ATOM   1683 C  CB    . PHE A 1 204 ? -22.120 -24.648 8.587  1.00 31.79  ? 204  PHE A CB    1 
ATOM   1684 C  CG    . PHE A 1 204 ? -21.521 -25.055 9.906  1.00 27.34  ? 204  PHE A CG    1 
ATOM   1685 C  CD1   . PHE A 1 204 ? -22.050 -26.125 10.629 1.00 29.41  ? 204  PHE A CD1   1 
ATOM   1686 C  CD2   . PHE A 1 204 ? -20.382 -24.415 10.388 1.00 25.55  ? 204  PHE A CD2   1 
ATOM   1687 C  CE1   . PHE A 1 204 ? -21.467 -26.540 11.840 1.00 31.05  ? 204  PHE A CE1   1 
ATOM   1688 C  CE2   . PHE A 1 204 ? -19.793 -24.800 11.603 1.00 27.49  ? 204  PHE A CE2   1 
ATOM   1689 C  CZ    . PHE A 1 204 ? -20.338 -25.870 12.333 1.00 30.87  ? 204  PHE A CZ    1 
ATOM   1690 N  N     . TRP A 1 205 ? -22.202 -21.611 9.698  1.00 31.59  ? 205  TRP A N     1 
ATOM   1691 C  CA    . TRP A 1 205 ? -22.042 -20.546 10.694 1.00 33.73  ? 205  TRP A CA    1 
ATOM   1692 C  C     . TRP A 1 205 ? -23.365 -19.818 11.029 1.00 35.17  ? 205  TRP A C     1 
ATOM   1693 O  O     . TRP A 1 205 ? -23.639 -19.562 12.202 1.00 34.07  ? 205  TRP A O     1 
ATOM   1694 C  CB    . TRP A 1 205 ? -20.976 -19.554 10.221 1.00 31.91  ? 205  TRP A CB    1 
ATOM   1695 C  CG    . TRP A 1 205 ? -20.602 -18.461 11.187 1.00 31.33  ? 205  TRP A CG    1 
ATOM   1696 C  CD1   . TRP A 1 205 ? -21.335 -17.355 11.493 1.00 31.74  ? 205  TRP A CD1   1 
ATOM   1697 C  CD2   . TRP A 1 205 ? -19.375 -18.342 11.920 1.00 31.95  ? 205  TRP A CD2   1 
ATOM   1698 N  NE1   . TRP A 1 205 ? -20.650 -16.558 12.379 1.00 30.87  ? 205  TRP A NE1   1 
ATOM   1699 C  CE2   . TRP A 1 205 ? -19.446 -17.140 12.660 1.00 30.01  ? 205  TRP A CE2   1 
ATOM   1700 C  CE3   . TRP A 1 205 ? -18.223 -19.137 12.025 1.00 31.52  ? 205  TRP A CE3   1 
ATOM   1701 C  CZ2   . TRP A 1 205 ? -18.417 -16.712 13.498 1.00 27.62  ? 205  TRP A CZ2   1 
ATOM   1702 C  CZ3   . TRP A 1 205 ? -17.196 -18.709 12.857 1.00 31.72  ? 205  TRP A CZ3   1 
ATOM   1703 C  CH2   . TRP A 1 205 ? -17.303 -17.504 13.583 1.00 29.17  ? 205  TRP A CH2   1 
ATOM   1704 N  N     . GLN A 1 206 ? -24.174 -19.487 10.018 1.00 36.21  ? 206  GLN A N     1 
ATOM   1705 C  CA    . GLN A 1 206 ? -25.476 -18.833 10.269 1.00 40.34  ? 206  GLN A CA    1 
ATOM   1706 C  C     . GLN A 1 206 ? -26.410 -19.734 11.091 1.00 38.26  ? 206  GLN A C     1 
ATOM   1707 O  O     . GLN A 1 206 ? -27.066 -19.270 12.028 1.00 37.07  ? 206  GLN A O     1 
ATOM   1708 C  CB    . GLN A 1 206 ? -26.167 -18.396 8.958  1.00 45.02  ? 206  GLN A CB    1 
ATOM   1709 C  CG    . GLN A 1 206 ? -25.932 -16.925 8.536  1.00 52.70  ? 206  GLN A CG    1 
ATOM   1710 C  CD    . GLN A 1 206 ? -26.778 -16.491 7.314  1.00 62.04  ? 206  GLN A CD    1 
ATOM   1711 O  OE1   . GLN A 1 206 ? -26.238 -16.001 6.309  1.00 62.55  ? 206  GLN A OE1   1 
ATOM   1712 N  NE2   . GLN A 1 206 ? -28.105 -16.667 7.404  1.00 59.78  ? 206  GLN A NE2   1 
ATOM   1713 N  N     . GLN A 1 207 ? -26.454 -21.018 10.736 1.00 36.69  ? 207  GLN A N     1 
ATOM   1714 C  CA    . GLN A 1 207 ? -27.239 -22.011 11.469 1.00 37.52  ? 207  GLN A CA    1 
ATOM   1715 C  C     . GLN A 1 207 ? -26.776 -22.207 12.913 1.00 35.88  ? 207  GLN A C     1 
ATOM   1716 O  O     . GLN A 1 207 ? -27.597 -22.329 13.818 1.00 37.42  ? 207  GLN A O     1 
ATOM   1717 C  CB    . GLN A 1 207 ? -27.251 -23.364 10.736 1.00 38.79  ? 207  GLN A CB    1 
ATOM   1718 C  CG    . GLN A 1 207 ? -28.105 -23.410 9.460  1.00 45.00  ? 207  GLN A CG    1 
ATOM   1719 C  CD    . GLN A 1 207 ? -29.592 -23.122 9.711  1.00 54.00  ? 207  GLN A CD    1 
ATOM   1720 O  OE1   . GLN A 1 207 ? -30.252 -23.817 10.490 1.00 57.85  ? 207  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN A 1 207 ? -30.122 -22.098 9.039  1.00 54.34  ? 207  GLN A NE2   1 
ATOM   1722 N  N     . LYS A 1 208 ? -25.465 -22.238 13.122 1.00 35.34  ? 208  LYS A N     1 
ATOM   1723 C  CA    . LYS A 1 208 ? -24.896 -22.501 14.445 1.00 35.60  ? 208  LYS A CA    1 
ATOM   1724 C  C     . LYS A 1 208 ? -23.991 -21.343 14.849 1.00 36.20  ? 208  LYS A C     1 
ATOM   1725 O  O     . LYS A 1 208 ? -22.765 -21.501 14.960 1.00 34.69  ? 208  LYS A O     1 
ATOM   1726 C  CB    . LYS A 1 208 ? -24.104 -23.809 14.438 1.00 34.08  ? 208  LYS A CB    1 
ATOM   1727 C  CG    . LYS A 1 208 ? -24.941 -25.034 14.162 1.00 35.37  ? 208  LYS A CG    1 
ATOM   1728 C  CD    . LYS A 1 208 ? -24.068 -26.229 13.813 1.00 34.50  ? 208  LYS A CD    1 
ATOM   1729 C  CE    . LYS A 1 208 ? -24.884 -27.311 13.115 1.00 33.82  ? 208  LYS A CE    1 
ATOM   1730 N  NZ    . LYS A 1 208 ? -25.989 -27.778 13.992 1.00 31.55  ? 208  LYS A NZ    1 
ATOM   1731 N  N     . THR A 1 209 ? -24.607 -20.180 15.059 1.00 34.90  ? 209  THR A N     1 
ATOM   1732 C  CA    . THR A 1 209 ? -23.861 -18.955 15.280 1.00 33.75  ? 209  THR A CA    1 
ATOM   1733 C  C     . THR A 1 209 ? -23.242 -18.939 16.661 1.00 32.52  ? 209  THR A C     1 
ATOM   1734 O  O     . THR A 1 209 ? -23.949 -19.013 17.674 1.00 35.32  ? 209  THR A O     1 
ATOM   1735 C  CB    . THR A 1 209 ? -24.719 -17.704 15.077 1.00 32.76  ? 209  THR A CB    1 
ATOM   1736 O  OG1   . THR A 1 209 ? -25.579 -17.897 13.953 1.00 39.70  ? 209  THR A OG1   1 
ATOM   1737 C  CG2   . THR A 1 209 ? -23.837 -16.494 14.820 1.00 32.64  ? 209  THR A CG2   1 
ATOM   1738 N  N     . PRO A 1 210 ? -21.910 -18.849 16.702 1.00 30.54  ? 210  PRO A N     1 
ATOM   1739 C  CA    . PRO A 1 210 ? -21.178 -18.835 17.958 1.00 26.93  ? 210  PRO A CA    1 
ATOM   1740 C  C     . PRO A 1 210 ? -21.603 -17.670 18.838 1.00 26.38  ? 210  PRO A C     1 
ATOM   1741 O  O     . PRO A 1 210 ? -21.852 -16.576 18.326 1.00 26.13  ? 210  PRO A O     1 
ATOM   1742 C  CB    . PRO A 1 210 ? -19.724 -18.676 17.505 1.00 25.67  ? 210  PRO A CB    1 
ATOM   1743 C  CG    . PRO A 1 210 ? -19.688 -19.311 16.169 1.00 26.30  ? 210  PRO A CG    1 
ATOM   1744 C  CD    . PRO A 1 210 ? -21.005 -18.917 15.540 1.00 30.00  ? 210  PRO A CD    1 
ATOM   1745 N  N     . VAL A 1 211 ? -21.719 -17.928 20.144 1.00 26.04  ? 211  VAL A N     1 
ATOM   1746 C  CA    . VAL A 1 211 ? -21.865 -16.880 21.149 1.00 24.26  ? 211  VAL A CA    1 
ATOM   1747 C  C     . VAL A 1 211 ? -20.479 -16.592 21.751 1.00 27.44  ? 211  VAL A C     1 
ATOM   1748 O  O     . VAL A 1 211 ? -20.002 -15.453 21.719 1.00 26.39  ? 211  VAL A O     1 
ATOM   1749 C  CB    . VAL A 1 211 ? -22.877 -17.269 22.245 1.00 26.15  ? 211  VAL A CB    1 
ATOM   1750 C  CG1   . VAL A 1 211 ? -22.874 -16.238 23.375 1.00 22.49  ? 211  VAL A CG1   1 
ATOM   1751 C  CG2   . VAL A 1 211 ? -24.288 -17.416 21.657 1.00 23.83  ? 211  VAL A CG2   1 
ATOM   1752 N  N     . ILE A 1 212 ? -19.843 -17.632 22.291 1.00 27.28  ? 212  ILE A N     1 
ATOM   1753 C  CA    . ILE A 1 212 ? -18.436 -17.576 22.692 1.00 29.49  ? 212  ILE A CA    1 
ATOM   1754 C  C     . ILE A 1 212 ? -17.615 -18.253 21.597 1.00 29.03  ? 212  ILE A C     1 
ATOM   1755 O  O     . ILE A 1 212 ? -17.879 -19.403 21.245 1.00 29.98  ? 212  ILE A O     1 
ATOM   1756 C  CB    . ILE A 1 212 ? -18.162 -18.306 24.053 1.00 30.60  ? 212  ILE A CB    1 
ATOM   1757 C  CG1   . ILE A 1 212 ? -19.155 -17.884 25.162 1.00 31.42  ? 212  ILE A CG1   1 
ATOM   1758 C  CG2   . ILE A 1 212 ? -16.705 -18.131 24.483 1.00 27.54  ? 212  ILE A CG2   1 
ATOM   1759 C  CD1   . ILE A 1 212 ? -19.086 -16.417 25.607 1.00 28.97  ? 212  ILE A CD1   1 
ATOM   1760 N  N     . LEU A 1 213 ? -16.642 -17.538 21.041 1.00 26.32  ? 213  LEU A N     1 
ATOM   1761 C  CA    . LEU A 1 213 ? -15.787 -18.113 20.008 1.00 27.11  ? 213  LEU A CA    1 
ATOM   1762 C  C     . LEU A 1 213 ? -14.396 -18.289 20.586 1.00 26.63  ? 213  LEU A C     1 
ATOM   1763 O  O     . LEU A 1 213 ? -13.787 -17.308 21.014 1.00 27.18  ? 213  LEU A O     1 
ATOM   1764 C  CB    . LEU A 1 213 ? -15.759 -17.225 18.757 1.00 24.28  ? 213  LEU A CB    1 
ATOM   1765 C  CG    . LEU A 1 213 ? -15.002 -17.770 17.534 1.00 29.06  ? 213  LEU A CG    1 
ATOM   1766 C  CD1   . LEU A 1 213 ? -15.520 -19.138 17.092 1.00 28.83  ? 213  LEU A CD1   1 
ATOM   1767 C  CD2   . LEU A 1 213 ? -15.040 -16.800 16.356 1.00 24.71  ? 213  LEU A CD2   1 
ATOM   1768 N  N     . THR A 1 214 ? -13.902 -19.527 20.633 1.00 26.69  ? 214  THR A N     1 
ATOM   1769 C  CA    . THR A 1 214 ? -12.574 -19.780 21.218 1.00 28.27  ? 214  THR A CA    1 
ATOM   1770 C  C     . THR A 1 214 ? -11.701 -20.723 20.400 1.00 28.71  ? 214  THR A C     1 
ATOM   1771 O  O     . THR A 1 214 ? -12.091 -21.151 19.316 1.00 32.11  ? 214  THR A O     1 
ATOM   1772 C  CB    . THR A 1 214 ? -12.647 -20.235 22.716 1.00 30.13  ? 214  THR A CB    1 
ATOM   1773 O  OG1   . THR A 1 214 ? -11.330 -20.205 23.299 1.00 32.28  ? 214  THR A OG1   1 
ATOM   1774 C  CG2   . THR A 1 214 ? -13.242 -21.627 22.860 1.00 25.63  ? 214  THR A CG2   1 
ATOM   1775 N  N     . GLY A 1 215 ? -10.525 -21.040 20.940 1.00 28.79  ? 215  GLY A N     1 
ATOM   1776 C  CA    . GLY A 1 215 ? -9.520  -21.857 20.264 1.00 29.42  ? 215  GLY A CA    1 
ATOM   1777 C  C     . GLY A 1 215 ? -8.148  -21.238 20.471 1.00 29.38  ? 215  GLY A C     1 
ATOM   1778 O  O     . GLY A 1 215 ? -8.019  -20.232 21.161 1.00 32.22  ? 215  GLY A O     1 
ATOM   1779 N  N     . TRP A 1 216 ? -7.124  -21.819 19.859 1.00 29.04  ? 216  TRP A N     1 
ATOM   1780 C  CA    . TRP A 1 216 ? -5.747  -21.407 20.120 1.00 29.31  ? 216  TRP A CA    1 
ATOM   1781 C  C     . TRP A 1 216 ? -5.222  -20.415 19.085 1.00 30.94  ? 216  TRP A C     1 
ATOM   1782 O  O     . TRP A 1 216 ? -4.975  -20.782 17.933 1.00 29.32  ? 216  TRP A O     1 
ATOM   1783 C  CB    . TRP A 1 216 ? -4.838  -22.634 20.185 1.00 28.36  ? 216  TRP A CB    1 
ATOM   1784 C  CG    . TRP A 1 216 ? -3.618  -22.377 20.962 1.00 28.28  ? 216  TRP A CG    1 
ATOM   1785 C  CD1   . TRP A 1 216 ? -2.382  -22.083 20.473 1.00 28.25  ? 216  TRP A CD1   1 
ATOM   1786 C  CD2   . TRP A 1 216 ? -3.507  -22.371 22.386 1.00 26.99  ? 216  TRP A CD2   1 
ATOM   1787 N  NE1   . TRP A 1 216 ? -1.501  -21.889 21.507 1.00 29.59  ? 216  TRP A NE1   1 
ATOM   1788 C  CE2   . TRP A 1 216 ? -2.162  -22.061 22.695 1.00 29.09  ? 216  TRP A CE2   1 
ATOM   1789 C  CE3   . TRP A 1 216 ? -4.411  -22.606 23.433 1.00 26.80  ? 216  TRP A CE3   1 
ATOM   1790 C  CZ2   . TRP A 1 216 ? -1.689  -21.980 24.016 1.00 29.96  ? 216  TRP A CZ2   1 
ATOM   1791 C  CZ3   . TRP A 1 216 ? -3.954  -22.515 24.744 1.00 32.20  ? 216  TRP A CZ3   1 
ATOM   1792 C  CH2   . TRP A 1 216 ? -2.593  -22.203 25.024 1.00 34.07  ? 216  TRP A CH2   1 
ATOM   1793 N  N     . ASN A 1 217 ? -5.043  -19.160 19.500 1.00 32.69  ? 217  ASN A N     1 
ATOM   1794 C  CA    . ASN A 1 217 ? -4.634  -18.095 18.583 1.00 34.68  ? 217  ASN A CA    1 
ATOM   1795 C  C     . ASN A 1 217 ? -5.697  -17.664 17.574 1.00 33.72  ? 217  ASN A C     1 
ATOM   1796 O  O     . ASN A 1 217 ? -5.377  -17.039 16.560 1.00 33.55  ? 217  ASN A O     1 
ATOM   1797 C  CB    . ASN A 1 217 ? -3.380  -18.504 17.814 1.00 38.68  ? 217  ASN A CB    1 
ATOM   1798 C  CG    . ASN A 1 217 ? -2.155  -17.836 18.325 1.00 44.96  ? 217  ASN A CG    1 
ATOM   1799 O  OD1   . ASN A 1 217 ? -2.223  -16.921 19.151 1.00 50.28  ? 217  ASN A OD1   1 
ATOM   1800 N  ND2   . ASN A 1 217 ? -1.010  -18.281 17.842 1.00 51.67  ? 217  ASN A ND2   1 
ATOM   1801 N  N     . VAL A 1 218 ? -6.954  -17.993 17.845 1.00 33.13  ? 218  VAL A N     1 
ATOM   1802 C  CA    . VAL A 1 218 ? -8.039  -17.654 16.926 1.00 32.76  ? 218  VAL A CA    1 
ATOM   1803 C  C     . VAL A 1 218 ? -8.071  -16.159 16.604 1.00 35.71  ? 218  VAL A C     1 
ATOM   1804 O  O     . VAL A 1 218 ? -8.265  -15.783 15.453 1.00 36.47  ? 218  VAL A O     1 
ATOM   1805 C  CB    . VAL A 1 218 ? -9.435  -18.142 17.431 1.00 31.80  ? 218  VAL A CB    1 
ATOM   1806 C  CG1   . VAL A 1 218 ? -9.505  -19.648 17.422 1.00 30.23  ? 218  VAL A CG1   1 
ATOM   1807 C  CG2   . VAL A 1 218 ? -9.768  -17.599 18.814 1.00 23.85  ? 218  VAL A CG2   1 
ATOM   1808 N  N     . GLU A 1 219 ? -7.840  -15.319 17.614 1.00 39.32  ? 219  GLU A N     1 
ATOM   1809 C  CA    . GLU A 1 219 ? -7.959  -13.868 17.453 1.00 41.56  ? 219  GLU A CA    1 
ATOM   1810 C  C     . GLU A 1 219 ? -6.899  -13.295 16.531 1.00 39.16  ? 219  GLU A C     1 
ATOM   1811 O  O     . GLU A 1 219 ? -7.187  -12.420 15.720 1.00 39.47  ? 219  GLU A O     1 
ATOM   1812 C  CB    . GLU A 1 219 ? -7.919  -13.136 18.802 1.00 43.51  ? 219  GLU A CB    1 
ATOM   1813 C  CG    . GLU A 1 219 ? -8.437  -11.697 18.712 1.00 48.09  ? 219  GLU A CG    1 
ATOM   1814 C  CD    . GLU A 1 219 ? -8.473  -10.973 20.050 1.00 54.04  ? 219  GLU A CD    1 
ATOM   1815 O  OE1   . GLU A 1 219 ? -9.594  -10.605 20.478 1.00 53.20  ? 219  GLU A OE1   1 
ATOM   1816 O  OE2   . GLU A 1 219 ? -7.392  -10.772 20.666 1.00 51.58  ? 219  GLU A OE2   1 
ATOM   1817 N  N     . SER A 1 220 ? -5.676  -13.784 16.649 1.00 38.23  ? 220  SER A N     1 
ATOM   1818 C  CA    . SER A 1 220 ? -4.600  -13.257 15.812 1.00 37.86  ? 220  SER A CA    1 
ATOM   1819 C  C     . SER A 1 220 ? -4.450  -13.991 14.481 1.00 35.52  ? 220  SER A C     1 
ATOM   1820 O  O     . SER A 1 220 ? -4.022  -13.388 13.499 1.00 38.49  ? 220  SER A O     1 
ATOM   1821 C  CB    . SER A 1 220 ? -3.266  -13.196 16.576 1.00 37.53  ? 220  SER A CB    1 
ATOM   1822 O  OG    . SER A 1 220 ? -2.837  -14.487 16.973 1.00 37.14  ? 220  SER A OG    1 
ATOM   1823 N  N     . PHE A 1 221 ? -4.799  -15.278 14.438 1.00 32.80  ? 221  PHE A N     1 
ATOM   1824 C  CA    . PHE A 1 221 ? -4.663  -16.049 13.184 1.00 33.23  ? 221  PHE A CA    1 
ATOM   1825 C  C     . PHE A 1 221 ? -5.989  -16.486 12.539 1.00 30.15  ? 221  PHE A C     1 
ATOM   1826 O  O     . PHE A 1 221 ? -6.405  -15.909 11.539 1.00 32.10  ? 221  PHE A O     1 
ATOM   1827 C  CB    . PHE A 1 221 ? -3.668  -17.223 13.315 1.00 32.16  ? 221  PHE A CB    1 
ATOM   1828 C  CG    . PHE A 1 221 ? -3.591  -18.100 12.082 1.00 35.82  ? 221  PHE A CG    1 
ATOM   1829 C  CD1   . PHE A 1 221 ? -4.130  -19.392 12.091 1.00 36.99  ? 221  PHE A CD1   1 
ATOM   1830 C  CD2   . PHE A 1 221 ? -2.991  -17.635 10.908 1.00 34.35  ? 221  PHE A CD2   1 
ATOM   1831 C  CE1   . PHE A 1 221 ? -4.067  -20.209 10.951 1.00 36.73  ? 221  PHE A CE1   1 
ATOM   1832 C  CE2   . PHE A 1 221 ? -2.927  -18.440 9.762  1.00 35.37  ? 221  PHE A CE2   1 
ATOM   1833 C  CZ    . PHE A 1 221 ? -3.466  -19.730 9.782  1.00 35.86  ? 221  PHE A CZ    1 
ATOM   1834 N  N     . ALA A 1 222 ? -6.637  -17.496 13.109 1.00 28.04  ? 222  ALA A N     1 
ATOM   1835 C  CA    . ALA A 1 222 ? -7.805  -18.133 12.486 1.00 29.84  ? 222  ALA A CA    1 
ATOM   1836 C  C     . ALA A 1 222 ? -8.939  -17.183 12.083 1.00 30.13  ? 222  ALA A C     1 
ATOM   1837 O  O     . ALA A 1 222 ? -9.406  -17.249 10.946 1.00 30.23  ? 222  ALA A O     1 
ATOM   1838 C  CB    . ALA A 1 222 ? -8.339  -19.247 13.362 1.00 30.06  ? 222  ALA A CB    1 
ATOM   1839 N  N     . ILE A 1 223 ? -9.365  -16.305 12.995 1.00 28.66  ? 223  ILE A N     1 
ATOM   1840 C  CA    . ILE A 1 223 ? -10.483 -15.394 12.720 1.00 29.44  ? 223  ILE A CA    1 
ATOM   1841 C  C     . ILE A 1 223 ? -10.163 -14.389 11.596 1.00 30.77  ? 223  ILE A C     1 
ATOM   1842 O  O     . ILE A 1 223 ? -10.890 -14.349 10.603 1.00 32.81  ? 223  ILE A O     1 
ATOM   1843 C  CB    . ILE A 1 223 ? -11.031 -14.696 14.005 1.00 29.23  ? 223  ILE A CB    1 
ATOM   1844 C  CG1   . ILE A 1 223 ? -11.436 -15.753 15.038 1.00 29.27  ? 223  ILE A CG1   1 
ATOM   1845 C  CG2   . ILE A 1 223 ? -12.186 -13.760 13.663 1.00 26.40  ? 223  ILE A CG2   1 
ATOM   1846 C  CD1   . ILE A 1 223 ? -11.773 -15.216 16.409 1.00 32.02  ? 223  ILE A CD1   1 
ATOM   1847 N  N     . PRO A 1 224 ? -9.075  -13.596 11.729 1.00 31.11  ? 224  PRO A N     1 
ATOM   1848 C  CA    . PRO A 1 224 ? -8.770  -12.683 10.626 1.00 32.27  ? 224  PRO A CA    1 
ATOM   1849 C  C     . PRO A 1 224 ? -8.377  -13.384 9.317  1.00 34.21  ? 224  PRO A C     1 
ATOM   1850 O  O     . PRO A 1 224 ? -8.617  -12.827 8.247  1.00 36.81  ? 224  PRO A O     1 
ATOM   1851 C  CB    . PRO A 1 224 ? -7.606  -11.829 11.159 1.00 32.45  ? 224  PRO A CB    1 
ATOM   1852 C  CG    . PRO A 1 224 ? -7.046  -12.568 12.292 1.00 30.52  ? 224  PRO A CG    1 
ATOM   1853 C  CD    . PRO A 1 224 ? -8.142  -13.424 12.859 1.00 30.77  ? 224  PRO A CD    1 
ATOM   1854 N  N     . TYR A 1 225 ? -7.797  -14.583 9.372  1.00 33.65  ? 225  TYR A N     1 
ATOM   1855 C  CA    . TYR A 1 225 ? -7.518  -15.287 8.115  1.00 33.47  ? 225  TYR A CA    1 
ATOM   1856 C  C     . TYR A 1 225 ? -8.814  -15.654 7.426  1.00 33.25  ? 225  TYR A C     1 
ATOM   1857 O  O     . TYR A 1 225 ? -8.940  -15.500 6.203  1.00 35.65  ? 225  TYR A O     1 
ATOM   1858 C  CB    . TYR A 1 225 ? -6.644  -16.541 8.271  1.00 32.75  ? 225  TYR A CB    1 
ATOM   1859 C  CG    . TYR A 1 225 ? -5.952  -16.900 6.969  1.00 31.13  ? 225  TYR A CG    1 
ATOM   1860 C  CD1   . TYR A 1 225 ? -6.612  -17.628 5.973  1.00 32.78  ? 225  TYR A CD1   1 
ATOM   1861 C  CD2   . TYR A 1 225 ? -4.646  -16.472 6.714  1.00 33.69  ? 225  TYR A CD2   1 
ATOM   1862 C  CE1   . TYR A 1 225 ? -5.980  -17.932 4.755  1.00 32.78  ? 225  TYR A CE1   1 
ATOM   1863 C  CE2   . TYR A 1 225 ? -4.003  -16.771 5.509  1.00 34.16  ? 225  TYR A CE2   1 
ATOM   1864 C  CZ    . TYR A 1 225 ? -4.676  -17.500 4.537  1.00 35.20  ? 225  TYR A CZ    1 
ATOM   1865 O  OH    . TYR A 1 225 ? -4.045  -17.790 3.358  1.00 36.10  ? 225  TYR A OH    1 
ATOM   1866 N  N     . VAL A 1 226 ? -9.780  -16.138 8.203  1.00 31.36  ? 226  VAL A N     1 
ATOM   1867 C  CA    . VAL A 1 226 ? -11.049 -16.561 7.617  1.00 30.94  ? 226  VAL A CA    1 
ATOM   1868 C  C     . VAL A 1 226 ? -11.784 -15.357 7.023  1.00 30.16  ? 226  VAL A C     1 
ATOM   1869 O  O     . VAL A 1 226 ? -12.321 -15.444 5.930  1.00 30.60  ? 226  VAL A O     1 
ATOM   1870 C  CB    . VAL A 1 226 ? -11.916 -17.367 8.611  1.00 29.64  ? 226  VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1 226 ? -13.302 -17.635 8.043  1.00 27.81  ? 226  VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1 226 ? -11.237 -18.693 8.918  1.00 31.06  ? 226  VAL A CG2   1 
ATOM   1873 N  N     . TYR A 1 227 ? -11.763 -14.235 7.738  1.00 32.11  ? 227  TYR A N     1 
ATOM   1874 C  CA    . TYR A 1 227 ? -12.437 -13.012 7.305  1.00 32.73  ? 227  TYR A CA    1 
ATOM   1875 C  C     . TYR A 1 227 ? -11.825 -12.469 6.012  1.00 33.95  ? 227  TYR A C     1 
ATOM   1876 O  O     . TYR A 1 227 ? -12.537 -12.227 5.034  1.00 36.65  ? 227  TYR A O     1 
ATOM   1877 C  CB    . TYR A 1 227 ? -12.390 -11.960 8.421  1.00 32.68  ? 227  TYR A CB    1 
ATOM   1878 C  CG    . TYR A 1 227 ? -13.153 -10.679 8.136  1.00 32.04  ? 227  TYR A CG    1 
ATOM   1879 C  CD1   . TYR A 1 227 ? -14.550 -10.649 8.182  1.00 30.75  ? 227  TYR A CD1   1 
ATOM   1880 C  CD2   . TYR A 1 227 ? -12.479 -9.494  7.850  1.00 31.11  ? 227  TYR A CD2   1 
ATOM   1881 C  CE1   . TYR A 1 227 ? -15.253 -9.480  7.934  1.00 28.41  ? 227  TYR A CE1   1 
ATOM   1882 C  CE2   . TYR A 1 227 ? -13.173 -8.315  7.601  1.00 30.77  ? 227  TYR A CE2   1 
ATOM   1883 C  CZ    . TYR A 1 227 ? -14.562 -8.320  7.643  1.00 30.25  ? 227  TYR A CZ    1 
ATOM   1884 O  OH    . TYR A 1 227 ? -15.256 -7.164  7.396  1.00 29.03  ? 227  TYR A OH    1 
ATOM   1885 N  N     . ASN A 1 228 ? -10.508 -12.305 5.994  1.00 32.02  ? 228  ASN A N     1 
ATOM   1886 C  CA    . ASN A 1 228 ? -9.850  -11.719 4.836  1.00 32.58  ? 228  ASN A CA    1 
ATOM   1887 C  C     . ASN A 1 228 ? -9.924  -12.620 3.616  1.00 34.26  ? 228  ASN A C     1 
ATOM   1888 O  O     . ASN A 1 228 ? -10.120 -12.138 2.492  1.00 35.58  ? 228  ASN A O     1 
ATOM   1889 C  CB    . ASN A 1 228 ? -8.398  -11.353 5.146  1.00 34.03  ? 228  ASN A CB    1 
ATOM   1890 C  CG    . ASN A 1 228 ? -8.278  -10.115 6.018  1.00 32.64  ? 228  ASN A CG    1 
ATOM   1891 O  OD1   . ASN A 1 228 ? -8.807  -9.055  5.695  1.00 37.03  ? 228  ASN A OD1   1 
ATOM   1892 N  ND2   . ASN A 1 228 ? -7.568  -10.245 7.128  1.00 31.91  ? 228  ASN A ND2   1 
ATOM   1893 N  N     . ARG A 1 229 ? -9.778  -13.926 3.838  1.00 32.40  ? 229  ARG A N     1 
ATOM   1894 C  CA    . ARG A 1 229 ? -9.903  -14.895 2.751  1.00 30.76  ? 229  ARG A CA    1 
ATOM   1895 C  C     . ARG A 1 229 ? -11.298 -14.856 2.104  1.00 30.45  ? 229  ARG A C     1 
ATOM   1896 O  O     . ARG A 1 229 ? -11.404 -14.765 0.885  1.00 29.72  ? 229  ARG A O     1 
ATOM   1897 C  CB    . ARG A 1 229 ? -9.549  -16.304 3.230  1.00 29.74  ? 229  ARG A CB    1 
ATOM   1898 C  CG    . ARG A 1 229 ? -9.414  -17.340 2.120  1.00 32.36  ? 229  ARG A CG    1 
ATOM   1899 C  CD    . ARG A 1 229 ? -8.207  -17.096 1.223  1.00 32.84  ? 229  ARG A CD    1 
ATOM   1900 N  NE    . ARG A 1 229 ? -8.130  -18.058 0.118  1.00 33.03  ? 229  ARG A NE    1 
ATOM   1901 C  CZ    . ARG A 1 229 ? -7.343  -17.929 -0.951 1.00 32.53  ? 229  ARG A CZ    1 
ATOM   1902 N  NH1   . ARG A 1 229 ? -6.553  -16.870 -1.093 1.00 28.96  ? 229  ARG A NH1   1 
ATOM   1903 N  NH2   . ARG A 1 229 ? -7.354  -18.862 -1.895 1.00 37.55  ? 229  ARG A NH2   1 
ATOM   1904 N  N     . ILE A 1 230 ? -12.355 -14.907 2.914  1.00 29.80  ? 230  ILE A N     1 
ATOM   1905 C  CA    . ILE A 1 230 ? -13.722 -14.791 2.395  1.00 31.93  ? 230  ILE A CA    1 
ATOM   1906 C  C     . ILE A 1 230 ? -13.921 -13.438 1.716  1.00 34.92  ? 230  ILE A C     1 
ATOM   1907 O  O     . ILE A 1 230 ? -14.548 -13.360 0.651  1.00 37.59  ? 230  ILE A O     1 
ATOM   1908 C  CB    . ILE A 1 230 ? -14.790 -15.012 3.488  1.00 31.14  ? 230  ILE A CB    1 
ATOM   1909 C  CG1   . ILE A 1 230 ? -14.723 -16.454 4.018  1.00 31.46  ? 230  ILE A CG1   1 
ATOM   1910 C  CG2   . ILE A 1 230 ? -16.177 -14.712 2.948  1.00 30.24  ? 230  ILE A CG2   1 
ATOM   1911 C  CD1   . ILE A 1 230 ? -15.801 -16.824 5.071  1.00 26.60  ? 230  ILE A CD1   1 
ATOM   1912 N  N     . LYS A 1 231 ? -13.361 -12.383 2.313  1.00 37.99  ? 231  LYS A N     1 
ATOM   1913 C  CA    . LYS A 1 231 ? -13.396 -11.039 1.709  1.00 40.46  ? 231  LYS A CA    1 
ATOM   1914 C  C     . LYS A 1 231 ? -12.800 -11.020 0.301  1.00 40.69  ? 231  LYS A C     1 
ATOM   1915 O  O     . LYS A 1 231 ? -13.416 -10.501 -0.623 1.00 42.12  ? 231  LYS A O     1 
ATOM   1916 C  CB    . LYS A 1 231 ? -12.710 -9.984  2.598  1.00 38.83  ? 231  LYS A CB    1 
ATOM   1917 C  CG    . LYS A 1 231 ? -12.611 -8.609  1.928  1.00 42.40  ? 231  LYS A CG    1 
ATOM   1918 C  CD    . LYS A 1 231 ? -12.587 -7.442  2.909  1.00 44.88  ? 231  LYS A CD    1 
ATOM   1919 C  CE    . LYS A 1 231 ? -11.180 -7.131  3.417  1.00 51.16  ? 231  LYS A CE    1 
ATOM   1920 N  NZ    . LYS A 1 231 ? -10.352 -6.345  2.449  1.00 55.63  ? 231  LYS A NZ    1 
ATOM   1921 N  N     . ASN A 1 232 ? -11.615 -11.601 0.141  1.00 41.52  ? 232  ASN A N     1 
ATOM   1922 C  CA    . ASN A 1 232 ? -10.920 -11.579 -1.149 1.00 43.69  ? 232  ASN A CA    1 
ATOM   1923 C  C     . ASN A 1 232 ? -11.596 -12.401 -2.235 1.00 43.56  ? 232  ASN A C     1 
ATOM   1924 O  O     . ASN A 1 232 ? -11.442 -12.110 -3.421 1.00 45.12  ? 232  ASN A O     1 
ATOM   1925 C  CB    . ASN A 1 232 ? -9.477  -12.063 -1.003 1.00 45.00  ? 232  ASN A CB    1 
ATOM   1926 C  CG    . ASN A 1 232 ? -8.626  -11.138 -0.157 1.00 47.58  ? 232  ASN A CG    1 
ATOM   1927 O  OD1   . ASN A 1 232 ? -8.929  -9.947  0.003  1.00 47.31  ? 232  ASN A OD1   1 
ATOM   1928 N  ND2   . ASN A 1 232 ? -7.537  -11.686 0.388  1.00 46.17  ? 232  ASN A ND2   1 
ATOM   1929 N  N     . ILE A 1 233 ? -12.324 -13.435 -1.828 1.00 42.02  ? 233  ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 233 ? -12.966 -14.337 -2.775 1.00 40.86  ? 233  ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 233 ? -14.375 -13.871 -3.129 1.00 40.53  ? 233  ILE A C     1 
ATOM   1932 O  O     . ILE A 1 233 ? -14.765 -13.922 -4.300 1.00 38.86  ? 233  ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 233 ? -12.978 -15.797 -2.259 1.00 40.57  ? 233  ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 233 ? -11.549 -16.347 -2.239 1.00 40.38  ? 233  ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 233 ? -13.883 -16.688 -3.130 1.00 41.05  ? 233  ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 233 ? -11.386 -17.615 -1.433 1.00 40.64  ? 233  ILE A CD1   1 
ATOM   1937 N  N     . PHE A 1 234 ? -15.118 -13.408 -2.123 1.00 38.82  ? 234  PHE A N     1 
ATOM   1938 C  CA    . PHE A 1 234 ? -16.531 -13.068 -2.297 1.00 38.64  ? 234  PHE A CA    1 
ATOM   1939 C  C     . PHE A 1 234 ? -16.858 -11.590 -2.126 1.00 38.89  ? 234  PHE A C     1 
ATOM   1940 O  O     . PHE A 1 234 ? -17.894 -11.138 -2.592 1.00 38.59  ? 234  PHE A O     1 
ATOM   1941 C  CB    . PHE A 1 234 ? -17.395 -13.845 -1.310 1.00 38.91  ? 234  PHE A CB    1 
ATOM   1942 C  CG    . PHE A 1 234 ? -17.290 -15.332 -1.431 1.00 39.71  ? 234  PHE A CG    1 
ATOM   1943 C  CD1   . PHE A 1 234 ? -16.546 -16.060 -0.512 1.00 39.69  ? 234  PHE A CD1   1 
ATOM   1944 C  CD2   . PHE A 1 234 ? -17.960 -16.012 -2.444 1.00 40.68  ? 234  PHE A CD2   1 
ATOM   1945 C  CE1   . PHE A 1 234 ? -16.461 -17.444 -0.602 1.00 40.40  ? 234  PHE A CE1   1 
ATOM   1946 C  CE2   . PHE A 1 234 ? -17.877 -17.396 -2.545 1.00 40.30  ? 234  PHE A CE2   1 
ATOM   1947 C  CZ    . PHE A 1 234 ? -17.123 -18.112 -1.623 1.00 41.01  ? 234  PHE A CZ    1 
ATOM   1948 N  N     . GLY A 1 235 ? -15.997 -10.849 -1.438 1.00 40.60  ? 235  GLY A N     1 
ATOM   1949 C  CA    . GLY A 1 235 ? -16.278 -9.451  -1.116 1.00 41.87  ? 235  GLY A CA    1 
ATOM   1950 C  C     . GLY A 1 235 ? -16.500 -9.236  0.364  1.00 42.87  ? 235  GLY A C     1 
ATOM   1951 O  O     . GLY A 1 235 ? -16.790 -10.176 1.102  1.00 44.77  ? 235  GLY A O     1 
ATOM   1952 N  N     . GLU A 1 236 ? -16.373 -7.987  0.791  1.00 45.18  ? 236  GLU A N     1 
ATOM   1953 C  CA    . GLU A 1 236 ? -16.418 -7.628  2.205  1.00 47.47  ? 236  GLU A CA    1 
ATOM   1954 C  C     . GLU A 1 236 ? -17.735 -8.012  2.886  1.00 47.58  ? 236  GLU A C     1 
ATOM   1955 O  O     . GLU A 1 236 ? -17.734 -8.529  4.007  1.00 49.09  ? 236  GLU A O     1 
ATOM   1956 C  CB    . GLU A 1 236 ? -16.164 -6.128  2.368  1.00 50.43  ? 236  GLU A CB    1 
ATOM   1957 C  CG    . GLU A 1 236 ? -15.740 -5.695  3.770  1.00 58.30  ? 236  GLU A CG    1 
ATOM   1958 C  CD    . GLU A 1 236 ? -15.509 -4.187  3.866  1.00 66.75  ? 236  GLU A CD    1 
ATOM   1959 O  OE1   . GLU A 1 236 ? -16.504 -3.427  3.955  1.00 67.13  ? 236  GLU A OE1   1 
ATOM   1960 O  OE2   . GLU A 1 236 ? -14.327 -3.766  3.851  1.00 68.35  ? 236  GLU A OE2   1 
ATOM   1961 N  N     . SER A 1 237 ? -18.853 -7.769  2.213  1.00 44.82  ? 237  SER A N     1 
ATOM   1962 C  CA    . SER A 1 237 ? -20.158 -7.985  2.833  1.00 43.64  ? 237  SER A CA    1 
ATOM   1963 C  C     . SER A 1 237 ? -20.479 -9.465  3.057  1.00 41.62  ? 237  SER A C     1 
ATOM   1964 O  O     . SER A 1 237 ? -21.272 -9.802  3.938  1.00 38.64  ? 237  SER A O     1 
ATOM   1965 C  CB    . SER A 1 237 ? -21.264 -7.269  2.054  1.00 43.19  ? 237  SER A CB    1 
ATOM   1966 O  OG    . SER A 1 237 ? -21.003 -7.314  0.670  1.00 45.70  ? 237  SER A OG    1 
ATOM   1967 N  N     . THR A 1 238 ? -19.853 -10.337 2.266  1.00 40.64  ? 238  THR A N     1 
ATOM   1968 C  CA    . THR A 1 238 ? -19.929 -11.778 2.491  1.00 37.54  ? 238  THR A CA    1 
ATOM   1969 C  C     . THR A 1 238 ? -19.132 -12.153 3.743  1.00 38.19  ? 238  THR A C     1 
ATOM   1970 O  O     . THR A 1 238 ? -19.630 -12.890 4.602  1.00 38.54  ? 238  THR A O     1 
ATOM   1971 C  CB    . THR A 1 238 ? -19.426 -12.572 1.275  1.00 35.96  ? 238  THR A CB    1 
ATOM   1972 O  OG1   . THR A 1 238 ? -20.231 -12.248 0.138  1.00 37.28  ? 238  THR A OG1   1 
ATOM   1973 C  CG2   . THR A 1 238 ? -19.518 -14.073 1.526  1.00 27.62  ? 238  THR A CG2   1 
ATOM   1974 N  N     . ALA A 1 239 ? -17.908 -11.634 3.846  1.00 37.71  ? 239  ALA A N     1 
ATOM   1975 C  CA    . ALA A 1 239 ? -17.075 -11.809 5.040  1.00 38.15  ? 239  ALA A CA    1 
ATOM   1976 C  C     . ALA A 1 239 ? -17.797 -11.310 6.300  1.00 39.80  ? 239  ALA A C     1 
ATOM   1977 O  O     . ALA A 1 239 ? -17.635 -11.874 7.389  1.00 42.66  ? 239  ALA A O     1 
ATOM   1978 C  CB    . ALA A 1 239 ? -15.738 -11.097 4.864  1.00 35.87  ? 239  ALA A CB    1 
ATOM   1979 N  N     . LYS A 1 240 ? -18.607 -10.265 6.134  1.00 39.61  ? 240  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 240 ? -19.400 -9.691  7.224  1.00 39.49  ? 240  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 240 ? -20.497 -10.613 7.790  1.00 38.03  ? 240  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 240 ? -20.981 -10.391 8.901  1.00 38.04  ? 240  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 240 ? -19.979 -8.333  6.810  1.00 39.80  ? 240  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 240 ? -18.941 -7.196  6.792  1.00 42.19  ? 240  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 240 ? -19.613 -5.832  6.660  1.00 46.85  ? 240  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 240 ? -18.650 -4.752  6.172  1.00 48.59  ? 240  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 240 ? -17.799 -4.196  7.253  1.00 51.94  ? 240  LYS A NZ    1 
ATOM   1988 N  N     . ARG A 1 241 ? -20.858 -11.655 7.045  1.00 36.19  ? 241  ARG A N     1 
ATOM   1989 C  CA    . ARG A 1 241 ? -21.801 -12.673 7.522  1.00 35.32  ? 241  ARG A CA    1 
ATOM   1990 C  C     . ARG A 1 241 ? -21.293 -13.430 8.759  1.00 34.28  ? 241  ARG A C     1 
ATOM   1991 O  O     . ARG A 1 241 ? -22.084 -14.071 9.459  1.00 31.35  ? 241  ARG A O     1 
ATOM   1992 C  CB    . ARG A 1 241 ? -22.177 -13.655 6.399  1.00 36.71  ? 241  ARG A CB    1 
ATOM   1993 C  CG    . ARG A 1 241 ? -23.192 -13.097 5.389  1.00 40.64  ? 241  ARG A CG    1 
ATOM   1994 C  CD    . ARG A 1 241 ? -23.430 -14.035 4.213  1.00 44.60  ? 241  ARG A CD    1 
ATOM   1995 N  NE    . ARG A 1 241 ? -24.077 -15.282 4.622  1.00 50.77  ? 241  ARG A NE    1 
ATOM   1996 C  CZ    . ARG A 1 241 ? -23.976 -16.441 3.971  1.00 51.26  ? 241  ARG A CZ    1 
ATOM   1997 N  NH1   . ARG A 1 241 ? -23.255 -16.536 2.861  1.00 54.72  ? 241  ARG A NH1   1 
ATOM   1998 N  NH2   . ARG A 1 241 ? -24.592 -17.515 4.436  1.00 52.59  ? 241  ARG A NH2   1 
ATOM   1999 N  N     . LEU A 1 242 ? -19.988 -13.337 9.042  1.00 32.54  ? 242  LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 242 ? -19.427 -13.910 10.277 1.00 32.32  ? 242  LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 242 ? -19.930 -13.159 11.517 1.00 32.67  ? 242  LEU A C     1 
ATOM   2002 O  O     . LEU A 1 242 ? -19.750 -13.619 12.643 1.00 30.88  ? 242  LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 242 ? -17.890 -13.914 10.259 1.00 31.88  ? 242  LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 242 ? -17.107 -14.808 9.287  1.00 33.34  ? 242  LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 242 ? -15.649 -14.395 9.270  1.00 34.77  ? 242  LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 242 ? -17.214 -16.291 9.622  1.00 32.33  ? 242  LEU A CD2   1 
ATOM   2007 N  N     . SER A 1 243 ? -20.547 -11.999 11.297 1.00 33.37  ? 243  SER A N     1 
ATOM   2008 C  CA    . SER A 1 243 ? -21.179 -11.227 12.360 1.00 33.03  ? 243  SER A CA    1 
ATOM   2009 C  C     . SER A 1 243 ? -22.681 -11.401 12.297 1.00 32.33  ? 243  SER A C     1 
ATOM   2010 O  O     . SER A 1 243 ? -23.287 -11.121 11.263 1.00 32.27  ? 243  SER A O     1 
ATOM   2011 C  CB    . SER A 1 243 ? -20.854 -9.748  12.206 1.00 35.33  ? 243  SER A CB    1 
ATOM   2012 O  OG    . SER A 1 243 ? -21.682 -8.969  13.045 1.00 37.17  ? 243  SER A OG    1 
ATOM   2013 N  N     . PRO A 1 244 ? -23.292 -11.861 13.402 1.00 32.21  ? 244  PRO A N     1 
ATOM   2014 C  CA    . PRO A 1 244 ? -24.745 -11.994 13.476 1.00 32.56  ? 244  PRO A CA    1 
ATOM   2015 C  C     . PRO A 1 244 ? -25.504 -10.702 13.124 1.00 33.43  ? 244  PRO A C     1 
ATOM   2016 O  O     . PRO A 1 244 ? -26.667 -10.768 12.719 1.00 31.61  ? 244  PRO A O     1 
ATOM   2017 C  CB    . PRO A 1 244 ? -25.001 -12.394 14.936 1.00 32.26  ? 244  PRO A CB    1 
ATOM   2018 C  CG    . PRO A 1 244 ? -23.674 -12.473 15.598 1.00 33.33  ? 244  PRO A CG    1 
ATOM   2019 C  CD    . PRO A 1 244 ? -22.625 -12.504 14.546 1.00 32.60  ? 244  PRO A CD    1 
ATOM   2020 N  N     . HIS A 1 245 ? -24.844 -9.551  13.267 1.00 33.19  ? 245  HIS A N     1 
ATOM   2021 C  CA    . HIS A 1 245 ? -25.455 -8.258  12.955 1.00 33.65  ? 245  HIS A CA    1 
ATOM   2022 C  C     . HIS A 1 245 ? -24.814 -7.618  11.720 1.00 34.74  ? 245  HIS A C     1 
ATOM   2023 O  O     . HIS A 1 245 ? -25.022 -6.439  11.437 1.00 31.66  ? 245  HIS A O     1 
ATOM   2024 C  CB    . HIS A 1 245 ? -25.362 -7.320  14.160 1.00 33.17  ? 245  HIS A CB    1 
ATOM   2025 C  CG    . HIS A 1 245 ? -25.783 -7.947  15.453 1.00 34.34  ? 245  HIS A CG    1 
ATOM   2026 N  ND1   . HIS A 1 245 ? -27.054 -8.439  15.667 1.00 37.92  ? 245  HIS A ND1   1 
ATOM   2027 C  CD2   . HIS A 1 245 ? -25.103 -8.149  16.608 1.00 33.19  ? 245  HIS A CD2   1 
ATOM   2028 C  CE1   . HIS A 1 245 ? -27.135 -8.928  16.892 1.00 35.47  ? 245  HIS A CE1   1 
ATOM   2029 N  NE2   . HIS A 1 245 ? -25.965 -8.765  17.484 1.00 35.56  ? 245  HIS A NE2   1 
ATOM   2030 N  N     . ARG A 1 246 ? -24.032 -8.421  10.998 1.00 38.03  ? 246  ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 246 ? -23.334 -8.015  9.770  1.00 40.35  ? 246  ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 246 ? -22.480 -6.752  9.937  1.00 41.34  ? 246  ARG A C     1 
ATOM   2033 O  O     . ARG A 1 246 ? -22.319 -5.976  8.996  1.00 42.46  ? 246  ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 246 ? -24.308 -7.884  8.583  1.00 42.19  ? 246  ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 246 ? -25.262 -9.069  8.386  1.00 43.62  ? 246  ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 246 ? -24.541 -10.316 7.895  1.00 44.82  ? 246  ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 246 ? -25.449 -11.451 7.683  1.00 47.98  ? 246  ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 246 ? -25.775 -12.367 8.602  1.00 46.40  ? 246  ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 246 ? -25.280 -12.312 9.836  1.00 40.15  ? 246  ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 246 ? -26.608 -13.349 8.281  1.00 42.00  ? 246  ARG A NH2   1 
ATOM   2041 N  N     . LYS A 1 247 ? -21.938 -6.557  11.139 1.00 41.45  ? 247  LYS A N     1 
ATOM   2042 C  CA    . LYS A 1 247 ? -21.015 -5.461  11.403 1.00 43.02  ? 247  LYS A CA    1 
ATOM   2043 C  C     . LYS A 1 247 ? -19.676 -5.962  11.931 1.00 42.33  ? 247  LYS A C     1 
ATOM   2044 O  O     . LYS A 1 247 ? -19.614 -6.816  12.821 1.00 40.44  ? 247  LYS A O     1 
ATOM   2045 C  CB    . LYS A 1 247 ? -21.608 -4.433  12.375 1.00 45.79  ? 247  LYS A CB    1 
ATOM   2046 C  CG    . LYS A 1 247 ? -20.780 -3.129  12.437 1.00 48.45  ? 247  LYS A CG    1 
ATOM   2047 C  CD    . LYS A 1 247 ? -21.312 -2.118  13.451 1.00 52.21  ? 247  LYS A CD    1 
ATOM   2048 C  CE    . LYS A 1 247 ? -20.367 -0.919  13.618 1.00 52.15  ? 247  LYS A CE    1 
ATOM   2049 N  NZ    . LYS A 1 247 ? -20.368 -0.034  12.413 1.00 51.72  ? 247  LYS A NZ    1 
ATOM   2050 N  N     . THR A 1 248 ? -18.604 -5.419  11.368 1.00 42.64  ? 248  THR A N     1 
ATOM   2051 C  CA    . THR A 1 248 ? -17.260 -5.726  11.828 1.00 43.94  ? 248  THR A CA    1 
ATOM   2052 C  C     . THR A 1 248 ? -16.408 -4.462  11.930 1.00 47.65  ? 248  THR A C     1 
ATOM   2053 O  O     . THR A 1 248 ? -16.762 -3.416  11.378 1.00 48.51  ? 248  THR A O     1 
ATOM   2054 C  CB    . THR A 1 248 ? -16.550 -6.718  10.894 1.00 42.18  ? 248  THR A CB    1 
ATOM   2055 O  OG1   . THR A 1 248 ? -16.368 -6.116  9.605  1.00 39.51  ? 248  THR A OG1   1 
ATOM   2056 C  CG2   . THR A 1 248 ? -17.344 -8.005  10.766 1.00 38.53  ? 248  THR A CG2   1 
ATOM   2057 N  N     . ARG A 1 249 ? -15.291 -4.576  12.645 1.00 50.58  ? 249  ARG A N     1 
ATOM   2058 C  CA    . ARG A 1 249 ? -14.294 -3.520  12.725 1.00 55.37  ? 249  ARG A CA    1 
ATOM   2059 C  C     . ARG A 1 249 ? -12.915 -4.128  12.488 1.00 57.08  ? 249  ARG A C     1 
ATOM   2060 O  O     . ARG A 1 249 ? -12.562 -5.138  13.099 1.00 54.66  ? 249  ARG A O     1 
ATOM   2061 C  CB    . ARG A 1 249 ? -14.359 -2.821  14.090 1.00 57.00  ? 249  ARG A CB    1 
ATOM   2062 C  CG    . ARG A 1 249 ? -13.380 -1.654  14.275 1.00 62.66  ? 249  ARG A CG    1 
ATOM   2063 C  CD    . ARG A 1 249 ? -13.927 -0.627  15.259 1.00 69.00  ? 249  ARG A CD    1 
ATOM   2064 N  NE    . ARG A 1 249 ? -15.085 0.072   14.694 1.00 75.44  ? 249  ARG A NE    1 
ATOM   2065 C  CZ    . ARG A 1 249 ? -16.028 0.690   15.404 1.00 78.81  ? 249  ARG A CZ    1 
ATOM   2066 N  NH1   . ARG A 1 249 ? -15.976 0.711   16.732 1.00 79.31  ? 249  ARG A NH1   1 
ATOM   2067 N  NH2   . ARG A 1 249 ? -17.037 1.286   14.779 1.00 80.60  ? 249  ARG A NH2   1 
ATOM   2068 N  N     . VAL A 1 250 ? -12.152 -3.523  11.582 1.00 62.47  ? 250  VAL A N     1 
ATOM   2069 C  CA    . VAL A 1 250 ? -10.765 -3.921  11.369 1.00 68.59  ? 250  VAL A CA    1 
ATOM   2070 C  C     . VAL A 1 250 ? -9.908  -3.138  12.363 1.00 74.38  ? 250  VAL A C     1 
ATOM   2071 O  O     . VAL A 1 250 ? -9.397  -2.055  12.066 1.00 74.03  ? 250  VAL A O     1 
ATOM   2072 C  CB    . VAL A 1 250 ? -10.323 -3.730  9.906  1.00 69.04  ? 250  VAL A CB    1 
ATOM   2073 C  CG1   . VAL A 1 250 ? -8.917  -4.277  9.702  1.00 69.59  ? 250  VAL A CG1   1 
ATOM   2074 C  CG2   . VAL A 1 250 ? -11.296 -4.439  8.966  1.00 67.57  ? 250  VAL A CG2   1 
ATOM   2075 N  N     . LYS A 1 251 ? -9.776  -3.722  13.552 1.00 82.79  ? 251  LYS A N     1 
ATOM   2076 C  CA    . LYS A 1 251 ? -9.342  -3.020  14.765 1.00 91.79  ? 251  LYS A CA    1 
ATOM   2077 C  C     . LYS A 1 251 ? -7.836  -2.748  14.826 1.00 97.09  ? 251  LYS A C     1 
ATOM   2078 O  O     . LYS A 1 251 ? -7.074  -3.244  13.996 1.00 97.33  ? 251  LYS A O     1 
ATOM   2079 C  CB    . LYS A 1 251 ? -9.798  -3.805  16.011 1.00 91.53  ? 251  LYS A CB    1 
ATOM   2080 C  CG    . LYS A 1 251 ? -10.105 -2.939  17.240 1.00 93.70  ? 251  LYS A CG    1 
ATOM   2081 C  CD    . LYS A 1 251 ? -10.274 -3.774  18.509 1.00 93.22  ? 251  LYS A CD    1 
ATOM   2082 C  CE    . LYS A 1 251 ? -10.551 -2.885  19.717 1.00 93.72  ? 251  LYS A CE    1 
ATOM   2083 N  NZ    . LYS A 1 251 ? -10.681 -3.665  20.978 1.00 91.27  ? 251  LYS A NZ    1 
ATOM   2084 N  N     . VAL A 1 252 ? -7.434  -1.939  15.809 1.00 103.91 ? 252  VAL A N     1 
ATOM   2085 C  CA    . VAL A 1 252 ? -6.025  -1.649  16.107 1.00 111.19 ? 252  VAL A CA    1 
ATOM   2086 C  C     . VAL A 1 252 ? -5.807  -1.541  17.634 1.00 115.58 ? 252  VAL A C     1 
ATOM   2087 O  O     . VAL A 1 252 ? -6.550  -0.836  18.329 1.00 116.63 ? 252  VAL A O     1 
ATOM   2088 C  CB    . VAL A 1 252 ? -5.498  -0.383  15.324 1.00 112.56 ? 252  VAL A CB    1 
ATOM   2089 C  CG1   . VAL A 1 252 ? -6.334  0.876   15.623 1.00 113.80 ? 252  VAL A CG1   1 
ATOM   2090 C  CG2   . VAL A 1 252 ? -4.003  -0.138  15.583 1.00 112.98 ? 252  VAL A CG2   1 
ATOM   2091 N  N     . ILE A 1 253 ? -4.805  -2.261  18.144 1.00 120.12 ? 253  ILE A N     1 
ATOM   2092 C  CA    . ILE A 1 253 ? -4.486  -2.280  19.583 1.00 124.53 ? 253  ILE A CA    1 
ATOM   2093 C  C     . ILE A 1 253 ? -3.414  -1.229  19.936 1.00 128.33 ? 253  ILE A C     1 
ATOM   2094 O  O     . ILE A 1 253 ? -2.363  -1.163  19.287 1.00 129.15 ? 253  ILE A O     1 
ATOM   2095 C  CB    . ILE A 1 253 ? -4.042  -3.710  20.067 1.00 123.86 ? 253  ILE A CB    1 
ATOM   2096 C  CG1   . ILE A 1 253 ? -5.002  -4.808  19.565 1.00 122.64 ? 253  ILE A CG1   1 
ATOM   2097 C  CG2   . ILE A 1 253 ? -3.868  -3.761  21.595 1.00 124.07 ? 253  ILE A CG2   1 
ATOM   2098 C  CD1   . ILE A 1 253 ? -6.394  -4.821  20.210 1.00 122.17 ? 253  ILE A CD1   1 
ATOM   2099 N  N     . GLU A 1 254 ? -3.691  -0.415  20.960 1.00 131.72 ? 254  GLU A N     1 
ATOM   2100 C  CA    . GLU A 1 254 ? -2.765  0.637   21.414 1.00 135.54 ? 254  GLU A CA    1 
ATOM   2101 C  C     . GLU A 1 254 ? -2.140  0.334   22.785 1.00 137.07 ? 254  GLU A C     1 
ATOM   2102 O  O     . GLU A 1 254 ? -2.831  0.363   23.814 1.00 137.07 ? 254  GLU A O     1 
ATOM   2103 C  CB    . GLU A 1 254 ? -3.459  2.008   21.434 1.00 136.54 ? 254  GLU A CB    1 
ATOM   2104 C  CG    . GLU A 1 254 ? -3.699  2.615   20.052 1.00 137.39 ? 254  GLU A CG    1 
ATOM   2105 C  CD    . GLU A 1 254 ? -4.049  4.097   20.100 1.00 138.95 ? 254  GLU A CD    1 
ATOM   2106 O  OE1   . GLU A 1 254 ? -3.710  4.771   21.099 1.00 139.67 ? 254  GLU A OE1   1 
ATOM   2107 O  OE2   . GLU A 1 254 ? -4.659  4.592   19.128 1.00 139.18 ? 254  GLU A OE2   1 
ATOM   2108 N  N     . ASN A 1 255 ? -0.832  0.058   22.788 1.00 138.68 ? 255  ASN A N     1 
ATOM   2109 C  CA    . ASN A 1 255 ? -0.121  -0.373  24.004 1.00 139.58 ? 255  ASN A CA    1 
ATOM   2110 C  C     . ASN A 1 255 ? 1.308   0.171   24.222 1.00 140.99 ? 255  ASN A C     1 
ATOM   2111 O  O     . ASN A 1 255 ? 1.473   1.238   24.823 1.00 142.32 ? 255  ASN A O     1 
ATOM   2112 C  CB    . ASN A 1 255 ? -0.171  -1.910  24.166 1.00 138.69 ? 255  ASN A CB    1 
ATOM   2113 C  CG    . ASN A 1 255 ? 0.518   -2.661  23.024 1.00 138.25 ? 255  ASN A CG    1 
ATOM   2114 O  OD1   . ASN A 1 255 ? 1.570   -3.273  23.221 1.00 138.21 ? 255  ASN A OD1   1 
ATOM   2115 N  ND2   . ASN A 1 255 ? -0.076  -2.621  21.833 1.00 137.65 ? 255  ASN A ND2   1 
ATOM   2116 N  N     . MET A 1 256 ? 2.326   -0.549  23.738 1.00 140.74 ? 256  MET A N     1 
ATOM   2117 C  CA    . MET A 1 256 ? 3.721   -0.274  24.114 1.00 141.40 ? 256  MET A CA    1 
ATOM   2118 C  C     . MET A 1 256 ? 4.788   -0.717  23.086 1.00 140.86 ? 256  MET A C     1 
ATOM   2119 O  O     . MET A 1 256 ? 5.905   -0.188  23.097 1.00 142.18 ? 256  MET A O     1 
ATOM   2120 C  CB    . MET A 1 256 ? 4.010   -0.897  25.493 1.00 141.59 ? 256  MET A CB    1 
ATOM   2121 C  CG    . MET A 1 256 ? 5.127   -0.235  26.301 1.00 143.25 ? 256  MET A CG    1 
ATOM   2122 S  SD    . MET A 1 256 ? 4.975   -0.472  28.091 1.00 143.15 ? 256  MET A SD    1 
ATOM   2123 C  CE    . MET A 1 256 ? 5.066   -2.255  28.253 1.00 141.40 ? 256  MET A CE    1 
ATOM   2124 N  N     . TYR A 1 257 ? 4.450   -1.663  22.204 1.00 138.43 ? 257  TYR A N     1 
ATOM   2125 C  CA    . TYR A 1 257 ? 5.449   -2.270  21.299 1.00 136.99 ? 257  TYR A CA    1 
ATOM   2126 C  C     . TYR A 1 257 ? 5.177   -2.168  19.785 1.00 134.90 ? 257  TYR A C     1 
ATOM   2127 O  O     . TYR A 1 257 ? 5.996   -1.610  19.054 1.00 134.98 ? 257  TYR A O     1 
ATOM   2128 C  CB    . TYR A 1 257 ? 5.738   -3.730  21.693 1.00 137.03 ? 257  TYR A CB    1 
ATOM   2129 C  CG    . TYR A 1 257 ? 6.194   -3.914  23.130 1.00 138.31 ? 257  TYR A CG    1 
ATOM   2130 C  CD1   . TYR A 1 257 ? 5.329   -4.443  24.092 1.00 137.86 ? 257  TYR A CD1   1 
ATOM   2131 C  CD2   . TYR A 1 257 ? 7.486   -3.559  23.527 1.00 139.38 ? 257  TYR A CD2   1 
ATOM   2132 C  CE1   . TYR A 1 257 ? 5.738   -4.614  25.413 1.00 137.66 ? 257  TYR A CE1   1 
ATOM   2133 C  CE2   . TYR A 1 257 ? 7.904   -3.725  24.847 1.00 139.60 ? 257  TYR A CE2   1 
ATOM   2134 C  CZ    . TYR A 1 257 ? 7.024   -4.254  25.782 1.00 138.72 ? 257  TYR A CZ    1 
ATOM   2135 O  OH    . TYR A 1 257 ? 7.428   -4.422  27.086 1.00 138.44 ? 257  TYR A OH    1 
ATOM   2136 N  N     . GLY A 1 258 ? 4.050   -2.715  19.321 1.00 132.03 ? 258  GLY A N     1 
ATOM   2137 C  CA    . GLY A 1 258 ? 3.783   -2.848  17.877 1.00 129.32 ? 258  GLY A CA    1 
ATOM   2138 C  C     . GLY A 1 258 ? 2.429   -2.382  17.354 1.00 127.01 ? 258  GLY A C     1 
ATOM   2139 O  O     . GLY A 1 258 ? 1.608   -1.854  18.110 1.00 126.81 ? 258  GLY A O     1 
ATOM   2140 N  N     . SER A 1 259 ? 2.203   -2.593  16.052 1.00 124.87 ? 259  SER A N     1 
ATOM   2141 C  CA    . SER A 1 259 ? 0.995   -2.121  15.349 1.00 122.06 ? 259  SER A CA    1 
ATOM   2142 C  C     . SER A 1 259 ? 0.335   -3.197  14.465 1.00 118.64 ? 259  SER A C     1 
ATOM   2143 O  O     . SER A 1 259 ? 0.681   -3.351  13.285 1.00 118.53 ? 259  SER A O     1 
ATOM   2144 C  CB    . SER A 1 259 ? 1.318   -0.870  14.514 1.00 123.56 ? 259  SER A CB    1 
ATOM   2145 O  OG    . SER A 1 259 ? 2.282   -1.148  13.507 1.00 122.83 ? 259  SER A OG    1 
ATOM   2146 N  N     . ARG A 1 260 ? -0.625  -3.922  15.040 1.00 114.22 ? 260  ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 260 ? -1.309  -5.022  14.343 1.00 110.01 ? 260  ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 260 ? -2.763  -4.679  13.956 1.00 105.76 ? 260  ARG A C     1 
ATOM   2149 O  O     . ARG A 1 260 ? -3.216  -3.552  14.187 1.00 106.70 ? 260  ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 260 ? -1.227  -6.322  15.172 1.00 110.48 ? 260  ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 260 ? -1.981  -6.325  16.514 1.00 111.74 ? 260  ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 260 ? -1.503  -7.476  17.403 1.00 113.80 ? 260  ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 260 ? -2.462  -7.840  18.449 1.00 115.33 ? 260  ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 260 ? -3.162  -8.975  18.477 1.00 115.94 ? 260  ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 260 ? -3.022  -9.880  17.514 1.00 115.91 ? 260  ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 260 ? -4.009  -9.212  19.473 1.00 115.16 ? 260  ARG A NH2   1 
ATOM   2157 N  N     . GLU A 1 261 ? -3.472  -5.643  13.353 1.00 98.80  ? 261  GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 261 ? -4.903  -5.493  13.012 1.00 90.61  ? 261  GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 261 ? -5.733  -6.784  13.161 1.00 83.13  ? 261  GLU A C     1 
ATOM   2160 O  O     . GLU A 1 261 ? -5.593  -7.734  12.376 1.00 80.72  ? 261  GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 261 ? -5.089  -4.866  11.617 1.00 92.29  ? 261  GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 261 ? -5.251  -3.341  11.636 1.00 91.77  ? 261  GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 261 ? -5.081  -2.690  10.273 1.00 90.93  ? 261  GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 261 ? -5.906  -2.950  9.374  1.00 90.79  ? 261  GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 261 ? -4.130  -1.899  10.108 1.00 88.48  ? 261  GLU A OE2   1 
ATOM   2166 N  N     . ILE A 1 262 ? -6.589  -6.791  14.185 1.00 74.30  ? 262  ILE A N     1 
ATOM   2167 C  CA    . ILE A 1 262 ? -7.523  -7.889  14.445 1.00 65.91  ? 262  ILE A CA    1 
ATOM   2168 C  C     . ILE A 1 262 ? -8.937  -7.493  14.029 1.00 59.73  ? 262  ILE A C     1 
ATOM   2169 O  O     . ILE A 1 262 ? -9.214  -6.318  13.798 1.00 58.83  ? 262  ILE A O     1 
ATOM   2170 C  CB    . ILE A 1 262 ? -7.541  -8.314  15.940 1.00 65.98  ? 262  ILE A CB    1 
ATOM   2171 C  CG1   . ILE A 1 262 ? -8.261  -7.269  16.804 1.00 67.59  ? 262  ILE A CG1   1 
ATOM   2172 C  CG2   . ILE A 1 262 ? -6.123  -8.592  16.449 1.00 66.78  ? 262  ILE A CG2   1 
ATOM   2173 C  CD1   . ILE A 1 262 ? -9.100  -7.859  17.926 1.00 67.69  ? 262  ILE A CD1   1 
ATOM   2174 N  N     . ILE A 1 263 ? -9.828  -8.476  13.950 1.00 52.78  ? 263  ILE A N     1 
ATOM   2175 C  CA    . ILE A 1 263 ? -11.202 -8.233  13.526 1.00 47.38  ? 263  ILE A CA    1 
ATOM   2176 C  C     . ILE A 1 263 ? -12.160 -8.348  14.693 1.00 44.44  ? 263  ILE A C     1 
ATOM   2177 O  O     . ILE A 1 263 ? -12.170 -9.348  15.411 1.00 44.11  ? 263  ILE A O     1 
ATOM   2178 C  CB    . ILE A 1 263 ? -11.653 -9.214  12.403 1.00 47.05  ? 263  ILE A CB    1 
ATOM   2179 C  CG1   . ILE A 1 263 ? -10.606 -9.298  11.278 1.00 46.08  ? 263  ILE A CG1   1 
ATOM   2180 C  CG2   . ILE A 1 263 ? -13.041 -8.839  11.872 1.00 44.39  ? 263  ILE A CG2   1 
ATOM   2181 C  CD1   . ILE A 1 263 ? -10.345 -7.997  10.542 1.00 45.16  ? 263  ILE A CD1   1 
ATOM   2182 N  N     . THR A 1 264 ? -12.959 -7.309  14.884 1.00 42.37  ? 264  THR A N     1 
ATOM   2183 C  CA    . THR A 1 264 ? -14.043 -7.356  15.841 1.00 41.85  ? 264  THR A CA    1 
ATOM   2184 C  C     . THR A 1 264 ? -15.279 -7.838  15.112 1.00 40.17  ? 264  THR A C     1 
ATOM   2185 O  O     . THR A 1 264 ? -15.764 -7.171  14.202 1.00 41.49  ? 264  THR A O     1 
ATOM   2186 C  CB    . THR A 1 264 ? -14.315 -5.970  16.459 1.00 43.01  ? 264  THR A CB    1 
ATOM   2187 O  OG1   . THR A 1 264 ? -13.102 -5.464  17.021 1.00 47.00  ? 264  THR A OG1   1 
ATOM   2188 C  CG2   . THR A 1 264 ? -15.390 -6.055  17.554 1.00 41.56  ? 264  THR A CG2   1 
ATOM   2189 N  N     . LEU A 1 265 ? -15.768 -9.008  15.497 1.00 38.79  ? 265  LEU A N     1 
ATOM   2190 C  CA    . LEU A 1 265 ? -17.020 -9.538  14.967 1.00 35.82  ? 265  LEU A CA    1 
ATOM   2191 C  C     . LEU A 1 265 ? -18.126 -9.129  15.913 1.00 34.94  ? 265  LEU A C     1 
ATOM   2192 O  O     . LEU A 1 265 ? -18.259 -9.701  16.997 1.00 35.52  ? 265  LEU A O     1 
ATOM   2193 C  CB    . LEU A 1 265 ? -16.965 -11.065 14.875 1.00 34.82  ? 265  LEU A CB    1 
ATOM   2194 C  CG    . LEU A 1 265 ? -15.922 -11.745 13.987 1.00 33.67  ? 265  LEU A CG    1 
ATOM   2195 C  CD1   . LEU A 1 265 ? -16.117 -13.264 14.037 1.00 34.75  ? 265  LEU A CD1   1 
ATOM   2196 C  CD2   . LEU A 1 265 ? -15.999 -11.241 12.555 1.00 31.88  ? 265  LEU A CD2   1 
ATOM   2197 N  N     . PHE A 1 266 ? -18.904 -8.126  15.525 1.00 35.53  ? 266  PHE A N     1 
ATOM   2198 C  CA    . PHE A 1 266 ? -19.966 -7.620  16.395 1.00 36.59  ? 266  PHE A CA    1 
ATOM   2199 C  C     . PHE A 1 266 ? -21.025 -8.688  16.614 1.00 35.90  ? 266  PHE A C     1 
ATOM   2200 O  O     . PHE A 1 266 ? -21.413 -9.392  15.676 1.00 34.42  ? 266  PHE A O     1 
ATOM   2201 C  CB    . PHE A 1 266 ? -20.597 -6.349  15.825 1.00 38.39  ? 266  PHE A CB    1 
ATOM   2202 C  CG    . PHE A 1 266 ? -19.801 -5.108  16.088 1.00 42.39  ? 266  PHE A CG    1 
ATOM   2203 C  CD1   . PHE A 1 266 ? -18.517 -4.953  15.557 1.00 43.50  ? 266  PHE A CD1   1 
ATOM   2204 C  CD2   . PHE A 1 266 ? -20.336 -4.078  16.862 1.00 47.87  ? 266  PHE A CD2   1 
ATOM   2205 C  CE1   . PHE A 1 266 ? -17.765 -3.800  15.801 1.00 42.76  ? 266  PHE A CE1   1 
ATOM   2206 C  CE2   . PHE A 1 266 ? -19.596 -2.912  17.110 1.00 48.45  ? 266  PHE A CE2   1 
ATOM   2207 C  CZ    . PHE A 1 266 ? -18.304 -2.778  16.575 1.00 48.07  ? 266  PHE A CZ    1 
ATOM   2208 N  N     . GLY A 1 267 ? -21.474 -8.813  17.862 1.00 35.03  ? 267  GLY A N     1 
ATOM   2209 C  CA    . GLY A 1 267 ? -22.479 -9.806  18.231 1.00 33.06  ? 267  GLY A CA    1 
ATOM   2210 C  C     . GLY A 1 267 ? -21.862 -11.157 18.529 1.00 33.92  ? 267  GLY A C     1 
ATOM   2211 O  O     . GLY A 1 267 ? -22.585 -12.138 18.706 1.00 32.71  ? 267  GLY A O     1 
ATOM   2212 N  N     . ILE A 1 268 ? -20.526 -11.207 18.579 1.00 31.79  ? 268  ILE A N     1 
ATOM   2213 C  CA    . ILE A 1 268 ? -19.803 -12.398 19.045 1.00 31.57  ? 268  ILE A CA    1 
ATOM   2214 C  C     . ILE A 1 268 ? -18.807 -12.078 20.167 1.00 31.51  ? 268  ILE A C     1 
ATOM   2215 O  O     . ILE A 1 268 ? -18.131 -11.049 20.145 1.00 33.80  ? 268  ILE A O     1 
ATOM   2216 C  CB    . ILE A 1 268 ? -19.082 -13.124 17.897 1.00 29.58  ? 268  ILE A CB    1 
ATOM   2217 C  CG1   . ILE A 1 268 ? -20.111 -13.684 16.913 1.00 32.09  ? 268  ILE A CG1   1 
ATOM   2218 C  CG2   . ILE A 1 268 ? -18.212 -14.262 18.438 1.00 29.62  ? 268  ILE A CG2   1 
ATOM   2219 C  CD1   . ILE A 1 268 ? -19.514 -14.299 15.682 1.00 32.35  ? 268  ILE A CD1   1 
ATOM   2220 N  N     . SER A 1 269 ? -18.727 -12.959 21.153 1.00 28.94  ? 269  SER A N     1 
ATOM   2221 C  CA    . SER A 1 269 ? -17.782 -12.762 22.232 1.00 29.07  ? 269  SER A CA    1 
ATOM   2222 C  C     . SER A 1 269 ? -16.601 -13.698 22.045 1.00 28.92  ? 269  SER A C     1 
ATOM   2223 O  O     . SER A 1 269 ? -16.710 -14.910 22.237 1.00 28.48  ? 269  SER A O     1 
ATOM   2224 C  CB    . SER A 1 269 ? -18.462 -12.930 23.589 1.00 28.73  ? 269  SER A CB    1 
ATOM   2225 O  OG    . SER A 1 269 ? -19.305 -11.819 23.850 1.00 27.89  ? 269  SER A OG    1 
ATOM   2226 N  N     . VAL A 1 270 ? -15.482 -13.115 21.625 1.00 28.44  ? 270  VAL A N     1 
ATOM   2227 C  CA    . VAL A 1 270 ? -14.275 -13.866 21.332 1.00 28.11  ? 270  VAL A CA    1 
ATOM   2228 C  C     . VAL A 1 270 ? -13.373 -13.900 22.552 1.00 28.20  ? 270  VAL A C     1 
ATOM   2229 O  O     . VAL A 1 270 ? -12.993 -12.860 23.092 1.00 29.58  ? 270  VAL A O     1 
ATOM   2230 C  CB    . VAL A 1 270 ? -13.512 -13.280 20.108 1.00 29.65  ? 270  VAL A CB    1 
ATOM   2231 C  CG1   . VAL A 1 270 ? -12.125 -13.892 19.986 1.00 28.02  ? 270  VAL A CG1   1 
ATOM   2232 C  CG2   . VAL A 1 270 ? -14.312 -13.511 18.822 1.00 23.78  ? 270  VAL A CG2   1 
ATOM   2233 N  N     . LEU A 1 271 ? -13.049 -15.116 22.979 1.00 30.22  ? 271  LEU A N     1 
ATOM   2234 C  CA    . LEU A 1 271 ? -12.113 -15.359 24.074 1.00 30.18  ? 271  LEU A CA    1 
ATOM   2235 C  C     . LEU A 1 271 ? -11.057 -16.331 23.582 1.00 31.35  ? 271  LEU A C     1 
ATOM   2236 O  O     . LEU A 1 271 ? -11.167 -17.554 23.772 1.00 31.09  ? 271  LEU A O     1 
ATOM   2237 C  CB    . LEU A 1 271 ? -12.824 -15.951 25.286 1.00 29.56  ? 271  LEU A CB    1 
ATOM   2238 C  CG    . LEU A 1 271 ? -14.082 -15.276 25.835 1.00 32.01  ? 271  LEU A CG    1 
ATOM   2239 C  CD1   . LEU A 1 271 ? -14.744 -16.194 26.848 1.00 31.23  ? 271  LEU A CD1   1 
ATOM   2240 C  CD2   . LEU A 1 271 ? -13.751 -13.947 26.465 1.00 29.96  ? 271  LEU A CD2   1 
ATOM   2241 N  N     . ASP A 1 272 ? -10.052 -15.778 22.916 1.00 30.00  ? 272  ASP A N     1 
ATOM   2242 C  CA    . ASP A 1 272 ? -8.917  -16.545 22.455 1.00 28.37  ? 272  ASP A CA    1 
ATOM   2243 C  C     . ASP A 1 272 ? -8.335  -17.306 23.648 1.00 27.87  ? 272  ASP A C     1 
ATOM   2244 O  O     . ASP A 1 272 ? -7.967  -16.708 24.667 1.00 27.74  ? 272  ASP A O     1 
ATOM   2245 C  CB    . ASP A 1 272 ? -7.897  -15.592 21.847 1.00 29.40  ? 272  ASP A CB    1 
ATOM   2246 C  CG    . ASP A 1 272 ? -6.830  -16.303 21.046 1.00 35.21  ? 272  ASP A CG    1 
ATOM   2247 O  OD1   . ASP A 1 272 ? -6.639  -17.530 21.218 1.00 34.66  ? 272  ASP A OD1   1 
ATOM   2248 O  OD2   . ASP A 1 272 ? -6.162  -15.615 20.248 1.00 40.99  ? 272  ASP A OD2   1 
ATOM   2249 N  N     . TYR A 1 273 ? -8.267  -18.627 23.540 1.00 25.86  ? 273  TYR A N     1 
ATOM   2250 C  CA    . TYR A 1 273 ? -7.853  -19.415 24.694 1.00 25.51  ? 273  TYR A CA    1 
ATOM   2251 C  C     . TYR A 1 273 ? -6.433  -19.130 25.169 1.00 27.04  ? 273  TYR A C     1 
ATOM   2252 O  O     . TYR A 1 273 ? -6.155  -19.245 26.356 1.00 30.02  ? 273  TYR A O     1 
ATOM   2253 C  CB    . TYR A 1 273 ? -8.059  -20.917 24.486 1.00 26.40  ? 273  TYR A CB    1 
ATOM   2254 C  CG    . TYR A 1 273 ? -8.391  -21.587 25.791 1.00 26.23  ? 273  TYR A CG    1 
ATOM   2255 C  CD1   . TYR A 1 273 ? -7.389  -22.104 26.613 1.00 27.47  ? 273  TYR A CD1   1 
ATOM   2256 C  CD2   . TYR A 1 273 ? -9.713  -21.649 26.235 1.00 28.48  ? 273  TYR A CD2   1 
ATOM   2257 C  CE1   . TYR A 1 273 ? -7.701  -22.682 27.846 1.00 33.24  ? 273  TYR A CE1   1 
ATOM   2258 C  CE2   . TYR A 1 273 ? -10.037 -22.228 27.453 1.00 30.96  ? 273  TYR A CE2   1 
ATOM   2259 C  CZ    . TYR A 1 273 ? -9.029  -22.742 28.254 1.00 33.22  ? 273  TYR A CZ    1 
ATOM   2260 O  OH    . TYR A 1 273 ? -9.361  -23.313 29.459 1.00 38.74  ? 273  TYR A OH    1 
ATOM   2261 N  N     . ILE A 1 274 ? -5.541  -18.741 24.263 1.00 25.87  ? 274  ILE A N     1 
ATOM   2262 C  CA    . ILE A 1 274 ? -4.206  -18.338 24.675 1.00 26.75  ? 274  ILE A CA    1 
ATOM   2263 C  C     . ILE A 1 274 ? -4.282  -17.158 25.649 1.00 26.06  ? 274  ILE A C     1 
ATOM   2264 O  O     . ILE A 1 274 ? -3.525  -17.095 26.609 1.00 29.19  ? 274  ILE A O     1 
ATOM   2265 C  CB    . ILE A 1 274 ? -3.255  -18.072 23.458 1.00 28.90  ? 274  ILE A CB    1 
ATOM   2266 C  CG1   . ILE A 1 274 ? -1.831  -17.754 23.928 1.00 27.74  ? 274  ILE A CG1   1 
ATOM   2267 C  CG2   . ILE A 1 274 ? -3.804  -16.978 22.546 1.00 26.97  ? 274  ILE A CG2   1 
ATOM   2268 C  CD1   . ILE A 1 274 ? -0.837  -17.595 22.783 1.00 36.56  ? 274  ILE A CD1   1 
ATOM   2269 N  N     . ASP A 1 275 ? -5.231  -16.254 25.430 1.00 28.34  ? 275  ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 275 ? -5.399  -15.098 26.309 1.00 28.10  ? 275  ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 275 ? -5.971  -15.487 27.656 1.00 28.50  ? 275  ASP A C     1 
ATOM   2272 O  O     . ASP A 1 275 ? -5.481  -15.031 28.689 1.00 29.24  ? 275  ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 275 ? -6.271  -14.048 25.652 1.00 30.90  ? 275  ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 275 ? -5.565  -13.348 24.532 1.00 36.03  ? 275  ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 275 ? -4.358  -13.077 24.706 1.00 41.26  ? 275  ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 275 ? -6.202  -13.086 23.481 1.00 39.29  ? 275  ASP A OD2   1 
ATOM   2277 N  N     . LEU A 1 276 ? -6.994  -16.342 27.639 1.00 27.36  ? 276  LEU A N     1 
ATOM   2278 C  CA    . LEU A 1 276 ? -7.541  -16.920 28.858 1.00 26.65  ? 276  LEU A CA    1 
ATOM   2279 C  C     . LEU A 1 276 ? -6.443  -17.607 29.649 1.00 29.20  ? 276  LEU A C     1 
ATOM   2280 O  O     . LEU A 1 276 ? -6.320  -17.424 30.867 1.00 33.49  ? 276  LEU A O     1 
ATOM   2281 C  CB    . LEU A 1 276 ? -8.626  -17.941 28.535 1.00 25.62  ? 276  LEU A CB    1 
ATOM   2282 C  CG    . LEU A 1 276 ? -9.951  -17.428 27.984 1.00 26.47  ? 276  LEU A CG    1 
ATOM   2283 C  CD1   . LEU A 1 276 ? -10.818 -18.607 27.600 1.00 20.39  ? 276  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU A 1 276 ? -10.664 -16.510 28.990 1.00 26.11  ? 276  LEU A CD2   1 
ATOM   2285 N  N     . TYR A 1 277 ? -5.640  -18.401 28.954 1.00 27.67  ? 277  TYR A N     1 
ATOM   2286 C  CA    . TYR A 1 277 ? -4.562  -19.119 29.606 1.00 26.62  ? 277  TYR A CA    1 
ATOM   2287 C  C     . TYR A 1 277 ? -3.595  -18.165 30.304 1.00 26.87  ? 277  TYR A C     1 
ATOM   2288 O  O     . TYR A 1 277 ? -3.227  -18.392 31.461 1.00 27.81  ? 277  TYR A O     1 
ATOM   2289 C  CB    . TYR A 1 277 ? -3.818  -20.009 28.612 1.00 24.11  ? 277  TYR A CB    1 
ATOM   2290 C  CG    . TYR A 1 277 ? -2.865  -20.969 29.278 1.00 22.19  ? 277  TYR A CG    1 
ATOM   2291 C  CD1   . TYR A 1 277 ? -3.310  -22.205 29.742 1.00 23.60  ? 277  TYR A CD1   1 
ATOM   2292 C  CD2   . TYR A 1 277 ? -1.524  -20.642 29.453 1.00 19.76  ? 277  TYR A CD2   1 
ATOM   2293 C  CE1   . TYR A 1 277 ? -2.446  -23.091 30.363 1.00 24.93  ? 277  TYR A CE1   1 
ATOM   2294 C  CE2   . TYR A 1 277 ? -0.643  -21.533 30.062 1.00 22.83  ? 277  TYR A CE2   1 
ATOM   2295 C  CZ    . TYR A 1 277 ? -1.113  -22.750 30.515 1.00 23.38  ? 277  TYR A CZ    1 
ATOM   2296 O  OH    . TYR A 1 277 ? -0.259  -23.635 31.127 1.00 25.90  ? 277  TYR A OH    1 
ATOM   2297 N  N     . LYS A 1 278 ? -3.201  -17.098 29.609 1.00 25.76  ? 278  LYS A N     1 
ATOM   2298 C  CA    . LYS A 1 278 ? -2.241  -16.139 30.160 1.00 25.63  ? 278  LYS A CA    1 
ATOM   2299 C  C     . LYS A 1 278 ? -2.794  -15.380 31.371 1.00 25.95  ? 278  LYS A C     1 
ATOM   2300 O  O     . LYS A 1 278 ? -2.082  -15.145 32.344 1.00 27.45  ? 278  LYS A O     1 
ATOM   2301 C  CB    . LYS A 1 278 ? -1.764  -15.173 29.077 1.00 26.56  ? 278  LYS A CB    1 
ATOM   2302 C  CG    . LYS A 1 278 ? -1.021  -15.866 27.950 1.00 31.40  ? 278  LYS A CG    1 
ATOM   2303 C  CD    . LYS A 1 278 ? -0.323  -14.877 27.051 1.00 33.51  ? 278  LYS A CD    1 
ATOM   2304 C  CE    . LYS A 1 278 ? 0.577   -15.592 26.072 1.00 33.24  ? 278  LYS A CE    1 
ATOM   2305 N  NZ    . LYS A 1 278 ? 0.886   -14.740 24.891 1.00 32.06  ? 278  LYS A NZ    1 
ATOM   2306 N  N     . LYS A 1 279 ? -4.070  -15.021 31.313 1.00 24.43  ? 279  LYS A N     1 
ATOM   2307 C  CA    . LYS A 1 279 ? -4.701  -14.308 32.405 1.00 25.94  ? 279  LYS A CA    1 
ATOM   2308 C  C     . LYS A 1 279 ? -4.964  -15.194 33.616 1.00 25.27  ? 279  LYS A C     1 
ATOM   2309 O  O     . LYS A 1 279 ? -4.678  -14.799 34.745 1.00 23.36  ? 279  LYS A O     1 
ATOM   2310 C  CB    . LYS A 1 279 ? -6.017  -13.665 31.951 1.00 25.70  ? 279  LYS A CB    1 
ATOM   2311 C  CG    . LYS A 1 279 ? -6.584  -12.708 32.975 1.00 26.77  ? 279  LYS A CG    1 
ATOM   2312 C  CD    . LYS A 1 279 ? -7.919  -12.143 32.554 1.00 25.87  ? 279  LYS A CD    1 
ATOM   2313 C  CE    . LYS A 1 279 ? -8.621  -11.465 33.714 1.00 24.60  ? 279  LYS A CE    1 
ATOM   2314 N  NZ    . LYS A 1 279 ? -7.847  -10.344 34.309 1.00 28.42  ? 279  LYS A NZ    1 
ATOM   2315 N  N     . PHE A 1 280 ? -5.508  -16.384 33.381 1.00 25.77  ? 280  PHE A N     1 
ATOM   2316 C  CA    . PHE A 1 280 ? -6.103  -17.158 34.477 1.00 27.58  ? 280  PHE A CA    1 
ATOM   2317 C  C     . PHE A 1 280 ? -5.248  -18.290 35.046 1.00 27.56  ? 280  PHE A C     1 
ATOM   2318 O  O     . PHE A 1 280 ? -5.550  -18.795 36.135 1.00 28.60  ? 280  PHE A O     1 
ATOM   2319 C  CB    . PHE A 1 280 ? -7.463  -17.721 34.061 1.00 28.41  ? 280  PHE A CB    1 
ATOM   2320 C  CG    . PHE A 1 280 ? -8.499  -16.683 33.767 1.00 27.52  ? 280  PHE A CG    1 
ATOM   2321 C  CD1   . PHE A 1 280 ? -9.394  -16.868 32.726 1.00 26.62  ? 280  PHE A CD1   1 
ATOM   2322 C  CD2   . PHE A 1 280 ? -8.593  -15.530 34.528 1.00 34.15  ? 280  PHE A CD2   1 
ATOM   2323 C  CE1   . PHE A 1 280 ? -10.379 -15.924 32.448 1.00 28.19  ? 280  PHE A CE1   1 
ATOM   2324 C  CE2   . PHE A 1 280 ? -9.568  -14.575 34.255 1.00 36.52  ? 280  PHE A CE2   1 
ATOM   2325 C  CZ    . PHE A 1 280 ? -10.463 -14.776 33.201 1.00 31.50  ? 280  PHE A CZ    1 
ATOM   2326 N  N     . SER A 1 281 ? -4.199  -18.689 34.328 1.00 25.30  ? 281  SER A N     1 
ATOM   2327 C  CA    . SER A 1 281 ? -3.441  -19.885 34.697 1.00 24.83  ? 281  SER A CA    1 
ATOM   2328 C  C     . SER A 1 281 ? -2.349  -19.642 35.724 1.00 26.10  ? 281  SER A C     1 
ATOM   2329 O  O     . SER A 1 281 ? -1.984  -20.555 36.451 1.00 29.49  ? 281  SER A O     1 
ATOM   2330 C  CB    . SER A 1 281 ? -2.848  -20.566 33.465 1.00 24.88  ? 281  SER A CB    1 
ATOM   2331 O  OG    . SER A 1 281 ? -1.649  -19.927 33.065 1.00 25.91  ? 281  SER A OG    1 
ATOM   2332 N  N     . PHE A 1 282 ? -1.831  -18.416 35.780 1.00 28.68  ? 282  PHE A N     1 
ATOM   2333 C  CA    . PHE A 1 282 ? -0.714  -18.056 36.660 1.00 30.20  ? 282  PHE A CA    1 
ATOM   2334 C  C     . PHE A 1 282 ? 0.492   -18.964 36.482 1.00 32.89  ? 282  PHE A C     1 
ATOM   2335 O  O     . PHE A 1 282 ? 1.066   -19.484 37.440 1.00 32.93  ? 282  PHE A O     1 
ATOM   2336 C  CB    . PHE A 1 282 ? -1.159  -17.943 38.119 1.00 31.15  ? 282  PHE A CB    1 
ATOM   2337 C  CG    . PHE A 1 282 ? -2.056  -16.780 38.359 1.00 35.57  ? 282  PHE A CG    1 
ATOM   2338 C  CD1   . PHE A 1 282 ? -1.525  -15.553 38.747 1.00 36.43  ? 282  PHE A CD1   1 
ATOM   2339 C  CD2   . PHE A 1 282 ? -3.435  -16.888 38.135 1.00 30.73  ? 282  PHE A CD2   1 
ATOM   2340 C  CE1   . PHE A 1 282 ? -2.361  -14.461 38.947 1.00 38.07  ? 282  PHE A CE1   1 
ATOM   2341 C  CE2   . PHE A 1 282 ? -4.272  -15.799 38.331 1.00 31.55  ? 282  PHE A CE2   1 
ATOM   2342 C  CZ    . PHE A 1 282 ? -3.741  -14.588 38.735 1.00 33.94  ? 282  PHE A CZ    1 
ATOM   2343 N  N     . THR A 1 283 ? 0.833   -19.160 35.217 1.00 33.76  ? 283  THR A N     1 
ATOM   2344 C  CA    . THR A 1 283 ? 2.086   -19.753 34.812 1.00 37.38  ? 283  THR A CA    1 
ATOM   2345 C  C     . THR A 1 283 ? 2.731   -18.745 33.879 1.00 39.33  ? 283  THR A C     1 
ATOM   2346 O  O     . THR A 1 283 ? 2.021   -17.982 33.199 1.00 39.98  ? 283  THR A O     1 
ATOM   2347 C  CB    . THR A 1 283 ? 1.859   -21.038 33.995 1.00 37.10  ? 283  THR A CB    1 
ATOM   2348 O  OG1   . THR A 1 283 ? 1.245   -20.702 32.738 1.00 37.02  ? 283  THR A OG1   1 
ATOM   2349 C  CG2   . THR A 1 283 ? 0.983   -22.029 34.756 1.00 35.72  ? 283  THR A CG2   1 
ATOM   2350 N  N     . ASN A 1 284 ? 4.059   -18.720 33.844 1.00 39.84  ? 284  ASN A N     1 
ATOM   2351 C  CA    . ASN A 1 284 ? 4.735   -18.130 32.699 1.00 40.62  ? 284  ASN A CA    1 
ATOM   2352 C  C     . ASN A 1 284 ? 5.571   -19.193 32.002 1.00 40.55  ? 284  ASN A C     1 
ATOM   2353 O  O     . ASN A 1 284 ? 6.572   -19.676 32.530 1.00 42.72  ? 284  ASN A O     1 
ATOM   2354 C  CB    . ASN A 1 284 ? 5.545   -16.873 33.041 1.00 42.85  ? 284  ASN A CB    1 
ATOM   2355 C  CG    . ASN A 1 284 ? 6.107   -16.166 31.780 1.00 47.89  ? 284  ASN A CG    1 
ATOM   2356 O  OD1   . ASN A 1 284 ? 5.682   -16.443 30.645 1.00 44.22  ? 284  ASN A OD1   1 
ATOM   2357 N  ND2   . ASN A 1 284 ? 7.072   -15.256 31.986 1.00 46.90  ? 284  ASN A ND2   1 
ATOM   2358 N  N     . GLN A 1 285 ? 5.119   -19.550 30.808 1.00 39.95  ? 285  GLN A N     1 
ATOM   2359 C  CA    . GLN A 1 285 ? 5.693   -20.624 30.021 1.00 36.92  ? 285  GLN A CA    1 
ATOM   2360 C  C     . GLN A 1 285 ? 6.740   -20.093 29.060 1.00 34.95  ? 285  GLN A C     1 
ATOM   2361 O  O     . GLN A 1 285 ? 6.626   -18.964 28.603 1.00 36.58  ? 285  GLN A O     1 
ATOM   2362 C  CB    . GLN A 1 285 ? 4.577   -21.313 29.245 1.00 34.11  ? 285  GLN A CB    1 
ATOM   2363 C  CG    . GLN A 1 285 ? 3.487   -21.843 30.140 1.00 37.32  ? 285  GLN A CG    1 
ATOM   2364 C  CD    . GLN A 1 285 ? 3.845   -23.151 30.827 1.00 38.88  ? 285  GLN A CD    1 
ATOM   2365 O  OE1   . GLN A 1 285 ? 5.016   -23.511 30.974 1.00 41.45  ? 285  GLN A OE1   1 
ATOM   2366 N  NE2   . GLN A 1 285 ? 2.820   -23.877 31.246 1.00 38.20  ? 285  GLN A NE2   1 
ATOM   2367 N  N     . PRO A 1 286 ? 7.764   -20.909 28.744 1.00 34.67  ? 286  PRO A N     1 
ATOM   2368 C  CA    . PRO A 1 286 ? 8.781   -20.492 27.778 1.00 35.14  ? 286  PRO A CA    1 
ATOM   2369 C  C     . PRO A 1 286 ? 8.238   -20.459 26.362 1.00 34.20  ? 286  PRO A C     1 
ATOM   2370 O  O     . PRO A 1 286 ? 8.810   -19.799 25.496 1.00 36.75  ? 286  PRO A O     1 
ATOM   2371 C  CB    . PRO A 1 286 ? 9.855   -21.570 27.910 1.00 36.30  ? 286  PRO A CB    1 
ATOM   2372 C  CG    . PRO A 1 286 ? 9.140   -22.750 28.406 1.00 34.37  ? 286  PRO A CG    1 
ATOM   2373 C  CD    . PRO A 1 286 ? 8.071   -22.231 29.317 1.00 34.31  ? 286  PRO A CD    1 
ATOM   2374 N  N     . SER A 1 287 ? 7.124   -21.147 26.144 1.00 31.82  ? 287  SER A N     1 
ATOM   2375 C  CA    . SER A 1 287 ? 6.481   -21.183 24.854 1.00 29.86  ? 287  SER A CA    1 
ATOM   2376 C  C     . SER A 1 287 ? 4.973   -21.225 25.025 1.00 30.66  ? 287  SER A C     1 
ATOM   2377 O  O     . SER A 1 287 ? 4.469   -21.679 26.047 1.00 30.25  ? 287  SER A O     1 
ATOM   2378 C  CB    . SER A 1 287 ? 6.931   -22.421 24.096 1.00 28.41  ? 287  SER A CB    1 
ATOM   2379 O  OG    . SER A 1 287 ? 6.038   -22.705 23.038 1.00 32.18  ? 287  SER A OG    1 
ATOM   2380 N  N     . TYR A 1 288 ? 4.259   -20.766 24.007 1.00 29.73  ? 288  TYR A N     1 
ATOM   2381 C  CA    . TYR A 1 288 ? 2.820   -20.849 24.009 1.00 31.64  ? 288  TYR A CA    1 
ATOM   2382 C  C     . TYR A 1 288 ? 2.273   -21.555 22.777 1.00 32.13  ? 288  TYR A C     1 
ATOM   2383 O  O     . TYR A 1 288 ? 1.135   -21.321 22.381 1.00 34.16  ? 288  TYR A O     1 
ATOM   2384 C  CB    . TYR A 1 288 ? 2.191   -19.463 24.220 1.00 33.42  ? 288  TYR A CB    1 
ATOM   2385 C  CG    . TYR A 1 288 ? 2.354   -18.995 25.644 1.00 30.11  ? 288  TYR A CG    1 
ATOM   2386 C  CD1   . TYR A 1 288 ? 3.297   -18.035 25.977 1.00 31.65  ? 288  TYR A CD1   1 
ATOM   2387 C  CD2   . TYR A 1 288 ? 1.584   -19.546 26.666 1.00 29.89  ? 288  TYR A CD2   1 
ATOM   2388 C  CE1   . TYR A 1 288 ? 3.465   -17.623 27.297 1.00 35.41  ? 288  TYR A CE1   1 
ATOM   2389 C  CE2   . TYR A 1 288 ? 1.743   -19.147 27.987 1.00 33.00  ? 288  TYR A CE2   1 
ATOM   2390 C  CZ    . TYR A 1 288 ? 2.682   -18.189 28.294 1.00 35.66  ? 288  TYR A CZ    1 
ATOM   2391 O  OH    . TYR A 1 288 ? 2.834   -17.802 29.598 1.00 40.78  ? 288  TYR A OH    1 
ATOM   2392 N  N     . SER A 1 289 ? 3.077   -22.430 22.179 1.00 31.94  ? 289  SER A N     1 
ATOM   2393 C  CA    . SER A 1 289 ? 2.545   -23.335 21.167 1.00 32.47  ? 289  SER A CA    1 
ATOM   2394 C  C     . SER A 1 289 ? 1.614   -24.322 21.858 1.00 31.92  ? 289  SER A C     1 
ATOM   2395 O  O     . SER A 1 289 ? 1.805   -24.653 23.034 1.00 32.77  ? 289  SER A O     1 
ATOM   2396 C  CB    . SER A 1 289 ? 3.654   -24.081 20.423 1.00 33.84  ? 289  SER A CB    1 
ATOM   2397 O  OG    . SER A 1 289 ? 4.038   -25.272 21.091 1.00 38.68  ? 289  SER A OG    1 
ATOM   2398 N  N     . LEU A 1 290 ? 0.611   -24.785 21.127 1.00 30.90  ? 290  LEU A N     1 
ATOM   2399 C  CA    . LEU A 1 290 ? -0.379  -25.689 21.687 1.00 30.51  ? 290  LEU A CA    1 
ATOM   2400 C  C     . LEU A 1 290 ? 0.223   -27.042 22.097 1.00 31.98  ? 290  LEU A C     1 
ATOM   2401 O  O     . LEU A 1 290 ? -0.167  -27.605 23.123 1.00 34.29  ? 290  LEU A O     1 
ATOM   2402 C  CB    . LEU A 1 290 ? -1.561  -25.858 20.730 1.00 25.83  ? 290  LEU A CB    1 
ATOM   2403 C  CG    . LEU A 1 290 ? -2.699  -26.744 21.232 1.00 26.83  ? 290  LEU A CG    1 
ATOM   2404 C  CD1   . LEU A 1 290 ? -3.220  -26.284 22.600 1.00 19.89  ? 290  LEU A CD1   1 
ATOM   2405 C  CD2   . LEU A 1 290 ? -3.823  -26.802 20.188 1.00 26.40  ? 290  LEU A CD2   1 
ATOM   2406 N  N     . ASP A 1 291 ? 1.171   -27.542 21.304 1.00 32.49  ? 291  ASP A N     1 
ATOM   2407 C  CA    . ASP A 1 291 ? 1.959   -28.728 21.649 1.00 36.06  ? 291  ASP A CA    1 
ATOM   2408 C  C     . ASP A 1 291 ? 2.584   -28.635 23.033 1.00 34.42  ? 291  ASP A C     1 
ATOM   2409 O  O     . ASP A 1 291 ? 2.458   -29.558 23.834 1.00 34.98  ? 291  ASP A O     1 
ATOM   2410 C  CB    . ASP A 1 291 ? 3.079   -28.938 20.631 1.00 39.40  ? 291  ASP A CB    1 
ATOM   2411 C  CG    . ASP A 1 291 ? 2.670   -29.830 19.496 1.00 45.83  ? 291  ASP A CG    1 
ATOM   2412 O  OD1   . ASP A 1 291 ? 3.409   -29.845 18.491 1.00 52.66  ? 291  ASP A OD1   1 
ATOM   2413 O  OD2   . ASP A 1 291 ? 1.624   -30.515 19.601 1.00 48.97  ? 291  ASP A OD2   1 
ATOM   2414 N  N     . TYR A 1 292 ? 3.254   -27.514 23.292 1.00 32.48  ? 292  TYR A N     1 
ATOM   2415 C  CA    . TYR A 1 292 ? 3.902   -27.260 24.570 1.00 32.17  ? 292  TYR A CA    1 
ATOM   2416 C  C     . TYR A 1 292 ? 2.908   -27.192 25.733 1.00 30.83  ? 292  TYR A C     1 
ATOM   2417 O  O     . TYR A 1 292 ? 3.090   -27.849 26.775 1.00 32.86  ? 292  TYR A O     1 
ATOM   2418 C  CB    . TYR A 1 292 ? 4.740   -25.969 24.509 1.00 31.91  ? 292  TYR A CB    1 
ATOM   2419 C  CG    . TYR A 1 292 ? 5.667   -25.836 25.684 1.00 34.02  ? 292  TYR A CG    1 
ATOM   2420 C  CD1   . TYR A 1 292 ? 5.190   -25.387 26.921 1.00 35.13  ? 292  TYR A CD1   1 
ATOM   2421 C  CD2   . TYR A 1 292 ? 7.018   -26.186 25.581 1.00 38.27  ? 292  TYR A CD2   1 
ATOM   2422 C  CE1   . TYR A 1 292 ? 6.018   -25.286 28.014 1.00 37.18  ? 292  TYR A CE1   1 
ATOM   2423 C  CE2   . TYR A 1 292 ? 7.870   -26.079 26.686 1.00 37.35  ? 292  TYR A CE2   1 
ATOM   2424 C  CZ    . TYR A 1 292 ? 7.354   -25.630 27.891 1.00 37.56  ? 292  TYR A CZ    1 
ATOM   2425 O  OH    . TYR A 1 292 ? 8.152   -25.522 28.997 1.00 45.75  ? 292  TYR A OH    1 
ATOM   2426 N  N     . ILE A 1 293 ? 1.858   -26.400 25.563 1.00 28.51  ? 293  ILE A N     1 
ATOM   2427 C  CA    . ILE A 1 293 ? 0.908   -26.213 26.647 1.00 28.64  ? 293  ILE A CA    1 
ATOM   2428 C  C     . ILE A 1 293 ? 0.138   -27.505 26.926 1.00 28.36  ? 293  ILE A C     1 
ATOM   2429 O  O     . ILE A 1 293 ? -0.043  -27.879 28.093 1.00 31.10  ? 293  ILE A O     1 
ATOM   2430 C  CB    . ILE A 1 293 ? -0.008  -24.993 26.401 1.00 27.18  ? 293  ILE A CB    1 
ATOM   2431 C  CG1   . ILE A 1 293 ? 0.835   -23.719 26.213 1.00 24.66  ? 293  ILE A CG1   1 
ATOM   2432 C  CG2   . ILE A 1 293 ? -0.997  -24.828 27.533 1.00 27.93  ? 293  ILE A CG2   1 
ATOM   2433 C  CD1   . ILE A 1 293 ? 1.742   -23.356 27.376 1.00 16.99  ? 293  ILE A CD1   1 
ATOM   2434 N  N     . SER A 1 294 ? -0.258  -28.198 25.857 1.00 27.39  ? 294  SER A N     1 
ATOM   2435 C  CA    . SER A 1 294 ? -0.862  -29.531 25.955 1.00 30.79  ? 294  SER A CA    1 
ATOM   2436 C  C     . SER A 1 294 ? 0.005   -30.514 26.746 1.00 32.83  ? 294  SER A C     1 
ATOM   2437 O  O     . SER A 1 294 ? -0.504  -31.204 27.639 1.00 35.17  ? 294  SER A O     1 
ATOM   2438 C  CB    . SER A 1 294 ? -1.147  -30.115 24.567 1.00 30.97  ? 294  SER A CB    1 
ATOM   2439 O  OG    . SER A 1 294 ? -2.204  -29.427 23.928 1.00 36.68  ? 294  SER A OG    1 
ATOM   2440 N  N     . GLU A 1 295 ? 1.297   -30.585 26.411 1.00 32.03  ? 295  GLU A N     1 
ATOM   2441 C  CA    . GLU A 1 295 ? 2.233   -31.454 27.121 1.00 35.64  ? 295  GLU A CA    1 
ATOM   2442 C  C     . GLU A 1 295 ? 2.278   -31.038 28.576 1.00 35.02  ? 295  GLU A C     1 
ATOM   2443 O  O     . GLU A 1 295 ? 2.228   -31.880 29.466 1.00 33.93  ? 295  GLU A O     1 
ATOM   2444 C  CB    . GLU A 1 295 ? 3.630   -31.398 26.493 1.00 38.65  ? 295  GLU A CB    1 
ATOM   2445 C  CG    . GLU A 1 295 ? 4.794   -31.162 27.496 1.00 50.87  ? 295  GLU A CG    1 
ATOM   2446 C  CD    . GLU A 1 295 ? 5.634   -32.404 27.799 1.00 58.35  ? 295  GLU A CD    1 
ATOM   2447 O  OE1   . GLU A 1 295 ? 5.918   -32.658 28.997 1.00 57.75  ? 295  GLU A OE1   1 
ATOM   2448 O  OE2   . GLU A 1 295 ? 6.030   -33.107 26.837 1.00 63.05  ? 295  GLU A OE2   1 
ATOM   2449 N  N     . PHE A 1 296 ? 2.338   -29.731 28.807 1.00 34.47  ? 296  PHE A N     1 
ATOM   2450 C  CA    . PHE A 1 296 ? 2.403   -29.209 30.160 1.00 34.98  ? 296  PHE A CA    1 
ATOM   2451 C  C     . PHE A 1 296 ? 1.161   -29.551 30.962 1.00 34.14  ? 296  PHE A C     1 
ATOM   2452 O  O     . PHE A 1 296 ? 1.270   -30.104 32.055 1.00 33.67  ? 296  PHE A O     1 
ATOM   2453 C  CB    . PHE A 1 296 ? 2.601   -27.690 30.166 1.00 35.65  ? 296  PHE A CB    1 
ATOM   2454 C  CG    . PHE A 1 296 ? 2.860   -27.126 31.535 1.00 36.00  ? 296  PHE A CG    1 
ATOM   2455 C  CD1   . PHE A 1 296 ? 4.167   -27.016 32.016 1.00 32.29  ? 296  PHE A CD1   1 
ATOM   2456 C  CD2   . PHE A 1 296 ? 1.799   -26.721 32.354 1.00 34.35  ? 296  PHE A CD2   1 
ATOM   2457 C  CE1   . PHE A 1 296 ? 4.424   -26.500 33.285 1.00 31.43  ? 296  PHE A CE1   1 
ATOM   2458 C  CE2   . PHE A 1 296 ? 2.041   -26.209 33.628 1.00 37.43  ? 296  PHE A CE2   1 
ATOM   2459 C  CZ    . PHE A 1 296 ? 3.369   -26.097 34.096 1.00 37.16  ? 296  PHE A CZ    1 
ATOM   2460 N  N     . GLU A 1 297 ? -0.005  -29.220 30.420 1.00 31.35  ? 297  GLU A N     1 
ATOM   2461 C  CA    . GLU A 1 297 ? -1.247  -29.316 31.187 1.00 34.16  ? 297  GLU A CA    1 
ATOM   2462 C  C     . GLU A 1 297 ? -1.763  -30.755 31.310 1.00 34.04  ? 297  GLU A C     1 
ATOM   2463 O  O     . GLU A 1 297 ? -2.471  -31.086 32.262 1.00 31.26  ? 297  GLU A O     1 
ATOM   2464 C  CB    . GLU A 1 297 ? -2.353  -28.430 30.562 1.00 33.64  ? 297  GLU A CB    1 
ATOM   2465 C  CG    . GLU A 1 297 ? -2.173  -26.913 30.697 1.00 30.07  ? 297  GLU A CG    1 
ATOM   2466 C  CD    . GLU A 1 297 ? -2.244  -26.419 32.137 1.00 36.35  ? 297  GLU A CD    1 
ATOM   2467 O  OE1   . GLU A 1 297 ? -3.037  -26.979 32.935 1.00 36.55  ? 297  GLU A OE1   1 
ATOM   2468 O  OE2   . GLU A 1 297 ? -1.498  -25.467 32.477 1.00 33.57  ? 297  GLU A OE2   1 
ATOM   2469 N  N     . LEU A 1 298 ? -1.418  -31.598 30.338 1.00 36.33  ? 298  LEU A N     1 
ATOM   2470 C  CA    . LEU A 1 298 ? -2.086  -32.894 30.179 1.00 37.87  ? 298  LEU A CA    1 
ATOM   2471 C  C     . LEU A 1 298 ? -1.167  -34.099 30.063 1.00 39.92  ? 298  LEU A C     1 
ATOM   2472 O  O     . LEU A 1 298 ? -1.644  -35.230 30.121 1.00 39.31  ? 298  LEU A O     1 
ATOM   2473 C  CB    . LEU A 1 298 ? -3.004  -32.872 28.952 1.00 36.88  ? 298  LEU A CB    1 
ATOM   2474 C  CG    . LEU A 1 298 ? -4.035  -31.762 28.761 1.00 34.22  ? 298  LEU A CG    1 
ATOM   2475 C  CD1   . LEU A 1 298 ? -4.396  -31.678 27.284 1.00 32.77  ? 298  LEU A CD1   1 
ATOM   2476 C  CD2   . LEU A 1 298 ? -5.276  -31.992 29.622 1.00 30.29  ? 298  LEU A CD2   1 
ATOM   2477 N  N     . ASN A 1 299 ? 0.133   -33.863 29.887 1.00 43.99  ? 299  ASN A N     1 
ATOM   2478 C  CA    . ASN A 1 299 ? 1.107   -34.941 29.671 1.00 49.67  ? 299  ASN A CA    1 
ATOM   2479 C  C     . ASN A 1 299 ? 0.831   -35.790 28.438 1.00 51.69  ? 299  ASN A C     1 
ATOM   2480 O  O     . ASN A 1 299 ? 1.023   -37.004 28.458 1.00 54.12  ? 299  ASN A O     1 
ATOM   2481 C  CB    . ASN A 1 299 ? 1.222   -35.843 30.898 1.00 53.00  ? 299  ASN A CB    1 
ATOM   2482 C  CG    . ASN A 1 299 ? 2.278   -35.380 31.863 1.00 59.13  ? 299  ASN A CG    1 
ATOM   2483 O  OD1   . ASN A 1 299 ? 3.429   -35.158 31.484 1.00 64.20  ? 299  ASN A OD1   1 
ATOM   2484 N  ND2   . ASN A 1 299 ? 1.896   -35.237 33.129 1.00 63.24  ? 299  ASN A ND2   1 
ATOM   2485 N  N     . VAL A 1 300 ? 0.364   -35.148 27.377 1.00 52.46  ? 300  VAL A N     1 
ATOM   2486 C  CA    . VAL A 1 300 ? 0.224   -35.797 26.087 1.00 54.74  ? 300  VAL A CA    1 
ATOM   2487 C  C     . VAL A 1 300 ? 1.438   -35.433 25.233 1.00 58.75  ? 300  VAL A C     1 
ATOM   2488 O  O     . VAL A 1 300 ? 1.969   -34.324 25.339 1.00 58.80  ? 300  VAL A O     1 
ATOM   2489 C  CB    . VAL A 1 300 ? -1.100  -35.411 25.378 1.00 54.35  ? 300  VAL A CB    1 
ATOM   2490 C  CG1   . VAL A 1 300 ? -2.293  -35.964 26.137 1.00 52.20  ? 300  VAL A CG1   1 
ATOM   2491 C  CG2   . VAL A 1 300 ? -1.227  -33.897 25.212 1.00 53.53  ? 300  VAL A CG2   1 
ATOM   2492 N  N     . GLY A 1 301 ? 1.887   -36.377 24.408 1.00 62.46  ? 301  GLY A N     1 
ATOM   2493 C  CA    . GLY A 1 301 ? 3.067   -36.174 23.570 1.00 65.41  ? 301  GLY A CA    1 
ATOM   2494 C  C     . GLY A 1 301 ? 2.840   -35.178 22.447 1.00 68.39  ? 301  GLY A C     1 
ATOM   2495 O  O     . GLY A 1 301 ? 1.701   -34.968 22.004 1.00 66.75  ? 301  GLY A O     1 
ATOM   2496 N  N     . LYS A 1 302 ? 3.934   -34.560 21.999 1.00 71.21  ? 302  LYS A N     1 
ATOM   2497 C  CA    . LYS A 1 302 ? 3.935   -33.644 20.855 1.00 73.23  ? 302  LYS A CA    1 
ATOM   2498 C  C     . LYS A 1 302 ? 3.400   -34.362 19.613 1.00 72.66  ? 302  LYS A C     1 
ATOM   2499 O  O     . LYS A 1 302 ? 3.773   -35.509 19.360 1.00 73.69  ? 302  LYS A O     1 
ATOM   2500 C  CB    . LYS A 1 302 ? 5.364   -33.145 20.604 1.00 75.44  ? 302  LYS A CB    1 
ATOM   2501 C  CG    . LYS A 1 302 ? 5.476   -31.949 19.667 1.00 79.34  ? 302  LYS A CG    1 
ATOM   2502 C  CD    . LYS A 1 302 ? 6.931   -31.591 19.353 1.00 83.72  ? 302  LYS A CD    1 
ATOM   2503 C  CE    . LYS A 1 302 ? 7.478   -32.404 18.180 1.00 85.88  ? 302  LYS A CE    1 
ATOM   2504 N  NZ    . LYS A 1 302 ? 8.883   -32.028 17.843 1.00 88.01  ? 302  LYS A NZ    1 
ATOM   2505 N  N     . LEU A 1 303 ? 2.518   -33.697 18.859 1.00 71.96  ? 303  LEU A N     1 
ATOM   2506 C  CA    . LEU A 1 303 ? 1.966   -34.263 17.614 1.00 71.26  ? 303  LEU A CA    1 
ATOM   2507 C  C     . LEU A 1 303 ? 3.060   -34.430 16.566 1.00 70.70  ? 303  LEU A C     1 
ATOM   2508 O  O     . LEU A 1 303 ? 3.527   -33.442 15.994 1.00 70.62  ? 303  LEU A O     1 
ATOM   2509 C  CB    . LEU A 1 303 ? 0.844   -33.387 17.035 1.00 70.90  ? 303  LEU A CB    1 
ATOM   2510 C  CG    . LEU A 1 303 ? -0.622  -33.460 17.485 1.00 70.05  ? 303  LEU A CG    1 
ATOM   2511 C  CD1   . LEU A 1 303 ? -0.972  -34.779 18.179 1.00 69.69  ? 303  LEU A CD1   1 
ATOM   2512 C  CD2   . LEU A 1 303 ? -1.012  -32.254 18.333 1.00 70.61  ? 303  LEU A CD2   1 
ATOM   2513 N  N     . LYS A 1 304 ? 3.451   -35.683 16.322 1.00 69.95  ? 304  LYS A N     1 
ATOM   2514 C  CA    . LYS A 1 304 ? 4.600   -36.017 15.464 1.00 70.41  ? 304  LYS A CA    1 
ATOM   2515 C  C     . LYS A 1 304 ? 4.295   -36.105 13.960 1.00 67.61  ? 304  LYS A C     1 
ATOM   2516 O  O     . LYS A 1 304 ? 3.354   -36.789 13.550 1.00 66.31  ? 304  LYS A O     1 
ATOM   2517 C  CB    . LYS A 1 304 ? 5.255   -37.323 15.943 1.00 71.93  ? 304  LYS A CB    1 
ATOM   2518 C  CG    . LYS A 1 304 ? 6.420   -37.140 16.916 1.00 75.86  ? 304  LYS A CG    1 
ATOM   2519 C  CD    . LYS A 1 304 ? 7.768   -37.025 16.180 1.00 81.00  ? 304  LYS A CD    1 
ATOM   2520 C  CE    . LYS A 1 304 ? 8.021   -35.620 15.624 1.00 81.58  ? 304  LYS A CE    1 
ATOM   2521 N  NZ    . LYS A 1 304 ? 8.850   -35.656 14.389 1.00 81.21  ? 304  LYS A NZ    1 
ATOM   2522 N  N     . TYR A 1 305 ? 5.098   -35.411 13.148 1.00 65.93  ? 305  TYR A N     1 
ATOM   2523 C  CA    . TYR A 1 305 ? 5.056   -35.561 11.682 1.00 63.70  ? 305  TYR A CA    1 
ATOM   2524 C  C     . TYR A 1 305 ? 6.419   -35.359 11.027 1.00 62.74  ? 305  TYR A C     1 
ATOM   2525 O  O     . TYR A 1 305 ? 7.311   -34.769 11.627 1.00 63.31  ? 305  TYR A O     1 
ATOM   2526 C  CB    . TYR A 1 305 ? 3.998   -34.655 11.032 1.00 62.61  ? 305  TYR A CB    1 
ATOM   2527 C  CG    . TYR A 1 305 ? 4.169   -33.164 11.254 1.00 62.81  ? 305  TYR A CG    1 
ATOM   2528 C  CD1   . TYR A 1 305 ? 5.009   -32.399 10.437 1.00 63.57  ? 305  TYR A CD1   1 
ATOM   2529 C  CD2   . TYR A 1 305 ? 3.461   -32.511 12.262 1.00 63.98  ? 305  TYR A CD2   1 
ATOM   2530 C  CE1   . TYR A 1 305 ? 5.154   -31.022 10.638 1.00 64.26  ? 305  TYR A CE1   1 
ATOM   2531 C  CE2   . TYR A 1 305 ? 3.593   -31.136 12.469 1.00 64.09  ? 305  TYR A CE2   1 
ATOM   2532 C  CZ    . TYR A 1 305 ? 4.439   -30.399 11.657 1.00 64.28  ? 305  TYR A CZ    1 
ATOM   2533 O  OH    . TYR A 1 305 ? 4.559   -29.043 11.874 1.00 63.49  ? 305  TYR A OH    1 
ATOM   2534 N  N     . ASP A 1 306 ? 6.560   -35.844 9.792  1.00 62.89  ? 306  ASP A N     1 
ATOM   2535 C  CA    . ASP A 1 306 ? 7.810   -35.743 9.032  1.00 63.48  ? 306  ASP A CA    1 
ATOM   2536 C  C     . ASP A 1 306 ? 7.795   -34.560 8.064  1.00 62.43  ? 306  ASP A C     1 
ATOM   2537 O  O     . ASP A 1 306 ? 6.788   -34.305 7.393  1.00 61.17  ? 306  ASP A O     1 
ATOM   2538 C  CB    . ASP A 1 306 ? 8.082   -37.040 8.252  1.00 65.84  ? 306  ASP A CB    1 
ATOM   2539 C  CG    . ASP A 1 306 ? 8.113   -38.286 9.144  1.00 68.59  ? 306  ASP A CG    1 
ATOM   2540 O  OD1   . ASP A 1 306 ? 7.873   -39.394 8.613  1.00 69.89  ? 306  ASP A OD1   1 
ATOM   2541 O  OD2   . ASP A 1 306 ? 8.375   -38.167 10.364 1.00 67.74  ? 306  ASP A OD2   1 
ATOM   2542 N  N     . GLY A 1 307 ? 8.916   -33.846 7.994  1.00 61.97  ? 307  GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 307 ? 9.054   -32.686 7.112  1.00 62.28  ? 307  GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 307 ? 8.288   -31.453 7.577  1.00 60.76  ? 307  GLY A C     1 
ATOM   2545 O  O     . GLY A 1 307 ? 7.690   -31.459 8.655  1.00 59.39  ? 307  GLY A O     1 
ATOM   2546 N  N     . PRO A 1 308 ? 8.287   -30.383 6.757  1.00 60.42  ? 308  PRO A N     1 
ATOM   2547 C  CA    . PRO A 1 308 ? 7.628   -29.135 7.154  1.00 59.31  ? 308  PRO A CA    1 
ATOM   2548 C  C     . PRO A 1 308 ? 6.103   -29.240 7.145  1.00 58.91  ? 308  PRO A C     1 
ATOM   2549 O  O     . PRO A 1 308 ? 5.545   -30.160 6.533  1.00 60.50  ? 308  PRO A O     1 
ATOM   2550 C  CB    . PRO A 1 308 ? 8.090   -28.130 6.087  1.00 58.40  ? 308  PRO A CB    1 
ATOM   2551 C  CG    . PRO A 1 308 ? 9.086   -28.849 5.236  1.00 59.27  ? 308  PRO A CG    1 
ATOM   2552 C  CD    . PRO A 1 308 ? 8.833   -30.300 5.393  1.00 59.69  ? 308  PRO A CD    1 
ATOM   2553 N  N     . ILE A 1 309 ? 5.442   -28.301 7.818  1.00 56.98  ? 309  ILE A N     1 
ATOM   2554 C  CA    . ILE A 1 309 ? 3.986   -28.183 7.753  1.00 55.59  ? 309  ILE A CA    1 
ATOM   2555 C  C     . ILE A 1 309 ? 3.512   -27.775 6.345  1.00 54.97  ? 309  ILE A C     1 
ATOM   2556 O  O     . ILE A 1 309 ? 2.369   -28.044 5.972  1.00 53.73  ? 309  ILE A O     1 
ATOM   2557 C  CB    . ILE A 1 309 ? 3.432   -27.217 8.863  1.00 55.28  ? 309  ILE A CB    1 
ATOM   2558 C  CG1   . ILE A 1 309 ? 1.945   -27.499 9.182  1.00 56.02  ? 309  ILE A CG1   1 
ATOM   2559 C  CG2   . ILE A 1 309 ? 3.752   -25.745 8.552  1.00 54.84  ? 309  ILE A CG2   1 
ATOM   2560 C  CD1   . ILE A 1 309 ? 0.899   -26.805 8.280  1.00 60.42  ? 309  ILE A CD1   1 
ATOM   2561 N  N     . SER A 1 310 ? 4.401   -27.146 5.571  1.00 55.14  ? 310  SER A N     1 
ATOM   2562 C  CA    . SER A 1 310 ? 4.076   -26.662 4.220  1.00 54.35  ? 310  SER A CA    1 
ATOM   2563 C  C     . SER A 1 310 ? 4.053   -27.792 3.188  1.00 53.76  ? 310  SER A C     1 
ATOM   2564 O  O     . SER A 1 310 ? 3.683   -27.590 2.027  1.00 53.78  ? 310  SER A O     1 
ATOM   2565 C  CB    . SER A 1 310 ? 5.071   -25.582 3.782  1.00 55.91  ? 310  SER A CB    1 
ATOM   2566 O  OG    . SER A 1 310 ? 6.372   -26.123 3.599  1.00 57.73  ? 310  SER A OG    1 
ATOM   2567 N  N     . LYS A 1 311 ? 4.466   -28.978 3.620  1.00 51.69  ? 311  LYS A N     1 
ATOM   2568 C  CA    . LYS A 1 311 ? 4.463   -30.147 2.765  1.00 49.81  ? 311  LYS A CA    1 
ATOM   2569 C  C     . LYS A 1 311 ? 3.596   -31.255 3.341  1.00 45.69  ? 311  LYS A C     1 
ATOM   2570 O  O     . LYS A 1 311 ? 3.366   -32.266 2.676  1.00 44.62  ? 311  LYS A O     1 
ATOM   2571 C  CB    . LYS A 1 311 ? 5.898   -30.631 2.527  1.00 51.74  ? 311  LYS A CB    1 
ATOM   2572 C  CG    . LYS A 1 311 ? 6.537   -29.997 1.310  1.00 57.67  ? 311  LYS A CG    1 
ATOM   2573 C  CD    . LYS A 1 311 ? 8.006   -29.637 1.523  1.00 62.73  ? 311  LYS A CD    1 
ATOM   2574 C  CE    . LYS A 1 311 ? 8.434   -28.567 0.500  1.00 66.00  ? 311  LYS A CE    1 
ATOM   2575 N  NZ    . LYS A 1 311 ? 9.889   -28.239 0.528  1.00 65.63  ? 311  LYS A NZ    1 
ATOM   2576 N  N     . LEU A 1 312 ? 3.111   -31.059 4.566  1.00 42.43  ? 312  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1 312 ? 2.345   -32.097 5.263  1.00 41.39  ? 312  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1 312 ? 1.042   -32.478 4.565  1.00 41.16  ? 312  LEU A C     1 
ATOM   2579 O  O     . LEU A 1 312 ? 0.738   -33.663 4.449  1.00 41.03  ? 312  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1 312 ? 2.085   -31.738 6.730  1.00 40.23  ? 312  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1 312 ? 1.334   -32.770 7.593  1.00 40.49  ? 312  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1 312 ? 2.011   -34.143 7.593  1.00 42.36  ? 312  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1 312 ? 1.175   -32.275 9.024  1.00 40.38  ? 312  LEU A CD2   1 
ATOM   2584 N  N     . ARG A 1 313 ? 0.279   -31.494 4.095  1.00 41.65  ? 313  ARG A N     1 
ATOM   2585 C  CA    . ARG A 1 313 ? -0.981  -31.808 3.421  1.00 42.34  ? 313  ARG A CA    1 
ATOM   2586 C  C     . ARG A 1 313 ? -0.758  -32.705 2.203  1.00 46.03  ? 313  ARG A C     1 
ATOM   2587 O  O     . ARG A 1 313 ? -1.531  -33.638 1.968  1.00 47.33  ? 313  ARG A O     1 
ATOM   2588 C  CB    . ARG A 1 313 ? -1.742  -30.550 3.012  1.00 40.78  ? 313  ARG A CB    1 
ATOM   2589 C  CG    . ARG A 1 313 ? -3.089  -30.856 2.364  1.00 38.44  ? 313  ARG A CG    1 
ATOM   2590 C  CD    . ARG A 1 313 ? -3.786  -29.605 1.861  1.00 33.64  ? 313  ARG A CD    1 
ATOM   2591 N  NE    . ARG A 1 313 ? -4.934  -29.966 1.051  1.00 34.95  ? 313  ARG A NE    1 
ATOM   2592 C  CZ    . ARG A 1 313 ? -4.901  -30.077 -0.276 1.00 41.75  ? 313  ARG A CZ    1 
ATOM   2593 N  NH1   . ARG A 1 313 ? -3.771  -29.825 -0.940 1.00 40.82  ? 313  ARG A NH1   1 
ATOM   2594 N  NH2   . ARG A 1 313 ? -5.998  -30.431 -0.943 1.00 34.42  ? 313  ARG A NH2   1 
ATOM   2595 N  N     . GLU A 1 314 ? 0.302   -32.425 1.446  1.00 47.46  ? 314  GLU A N     1 
ATOM   2596 C  CA    . GLU A 1 314 ? 0.585   -33.171 0.218  1.00 50.31  ? 314  GLU A CA    1 
ATOM   2597 C  C     . GLU A 1 314 ? 1.224   -34.539 0.479  1.00 48.09  ? 314  GLU A C     1 
ATOM   2598 O  O     . GLU A 1 314 ? 0.866   -35.521 -0.167 1.00 46.91  ? 314  GLU A O     1 
ATOM   2599 C  CB    . GLU A 1 314 ? 1.424   -32.337 -0.766 1.00 53.67  ? 314  GLU A CB    1 
ATOM   2600 C  CG    . GLU A 1 314 ? 2.909   -32.197 -0.405 1.00 61.79  ? 314  GLU A CG    1 
ATOM   2601 C  CD    . GLU A 1 314 ? 3.651   -31.217 -1.298 1.00 68.59  ? 314  GLU A CD    1 
ATOM   2602 O  OE1   . GLU A 1 314 ? 4.635   -31.641 -1.949 1.00 70.29  ? 314  GLU A OE1   1 
ATOM   2603 O  OE2   . GLU A 1 314 ? 3.249   -30.026 -1.349 1.00 68.96  ? 314  GLU A OE2   1 
ATOM   2604 N  N     . SER A 1 315 ? 2.167   -34.598 1.417  1.00 46.79  ? 315  SER A N     1 
ATOM   2605 C  CA    . SER A 1 315 ? 2.835   -35.854 1.743  1.00 46.24  ? 315  SER A CA    1 
ATOM   2606 C  C     . SER A 1 315 ? 1.952   -36.781 2.575  1.00 45.64  ? 315  SER A C     1 
ATOM   2607 O  O     . SER A 1 315 ? 1.961   -37.995 2.372  1.00 48.76  ? 315  SER A O     1 
ATOM   2608 C  CB    . SER A 1 315 ? 4.180   -35.612 2.443  1.00 47.79  ? 315  SER A CB    1 
ATOM   2609 O  OG    . SER A 1 315 ? 4.086   -34.644 3.476  1.00 46.19  ? 315  SER A OG    1 
ATOM   2610 N  N     . ASN A 1 316 ? 1.188   -36.209 3.502  1.00 42.89  ? 316  ASN A N     1 
ATOM   2611 C  CA    . ASN A 1 316 ? 0.342   -36.998 4.389  1.00 41.17  ? 316  ASN A CA    1 
ATOM   2612 C  C     . ASN A 1 316 ? -0.939  -36.277 4.801  1.00 39.40  ? 316  ASN A C     1 
ATOM   2613 O  O     . ASN A 1 316 ? -1.089  -35.836 5.944  1.00 40.66  ? 316  ASN A O     1 
ATOM   2614 C  CB    . ASN A 1 316 ? 1.138   -37.449 5.621  1.00 40.56  ? 316  ASN A CB    1 
ATOM   2615 C  CG    . ASN A 1 316 ? 0.485   -38.615 6.350  1.00 39.86  ? 316  ASN A CG    1 
ATOM   2616 O  OD1   . ASN A 1 316 ? -0.739  -38.785 6.326  1.00 37.23  ? 316  ASN A OD1   1 
ATOM   2617 N  ND2   . ASN A 1 316 ? 1.304   -39.420 7.013  1.00 39.19  ? 316  ASN A ND2   1 
ATOM   2618 N  N     . HIS A 1 317 ? -1.862  -36.167 3.856  1.00 39.14  ? 317  HIS A N     1 
ATOM   2619 C  CA    . HIS A 1 317 ? -3.163  -35.572 4.109  1.00 37.25  ? 317  HIS A CA    1 
ATOM   2620 C  C     . HIS A 1 317 ? -3.907  -36.270 5.259  1.00 37.50  ? 317  HIS A C     1 
ATOM   2621 O  O     . HIS A 1 317 ? -4.579  -35.620 6.063  1.00 38.04  ? 317  HIS A O     1 
ATOM   2622 C  CB    . HIS A 1 317 ? -3.994  -35.602 2.831  1.00 36.71  ? 317  HIS A CB    1 
ATOM   2623 C  CG    . HIS A 1 317 ? -5.359  -35.013 2.980  1.00 33.96  ? 317  HIS A CG    1 
ATOM   2624 N  ND1   . HIS A 1 317 ? -6.506  -35.770 2.898  1.00 35.62  ? 317  HIS A ND1   1 
ATOM   2625 C  CD2   . HIS A 1 317 ? -5.764  -33.740 3.198  1.00 35.44  ? 317  HIS A CD2   1 
ATOM   2626 C  CE1   . HIS A 1 317 ? -7.561  -34.991 3.056  1.00 35.27  ? 317  HIS A CE1   1 
ATOM   2627 N  NE2   . HIS A 1 317 ? -7.139  -33.754 3.239  1.00 37.63  ? 317  HIS A NE2   1 
ATOM   2628 N  N     . GLN A 1 318 ? -3.771  -37.589 5.338  1.00 37.01  ? 318  GLN A N     1 
ATOM   2629 C  CA    . GLN A 1 318 ? -4.404  -38.360 6.390  1.00 36.92  ? 318  GLN A CA    1 
ATOM   2630 C  C     . GLN A 1 318 ? -4.066  -37.760 7.763  1.00 36.95  ? 318  GLN A C     1 
ATOM   2631 O  O     . GLN A 1 318 ? -4.957  -37.489 8.573  1.00 36.80  ? 318  GLN A O     1 
ATOM   2632 C  CB    . GLN A 1 318 ? -3.977  -39.827 6.295  1.00 35.85  ? 318  GLN A CB    1 
ATOM   2633 C  CG    . GLN A 1 318 ? -4.540  -40.736 7.383  1.00 36.91  ? 318  GLN A CG    1 
ATOM   2634 C  CD    . GLN A 1 318 ? -6.070  -40.776 7.411  1.00 41.51  ? 318  GLN A CD    1 
ATOM   2635 O  OE1   . GLN A 1 318 ? -6.728  -40.936 6.379  1.00 42.99  ? 318  GLN A OE1   1 
ATOM   2636 N  NE2   . GLN A 1 318 ? -6.636  -40.636 8.601  1.00 39.51  ? 318  GLN A NE2   1 
ATOM   2637 N  N     . ARG A 1 319 ? -2.779  -37.528 7.998  1.00 38.42  ? 319  ARG A N     1 
ATOM   2638 C  CA    . ARG A 1 319 ? -2.300  -37.032 9.284  1.00 37.14  ? 319  ARG A CA    1 
ATOM   2639 C  C     . ARG A 1 319 ? -2.643  -35.560 9.464  1.00 34.14  ? 319  ARG A C     1 
ATOM   2640 O  O     . ARG A 1 319 ? -3.062  -35.155 10.548 1.00 33.18  ? 319  ARG A O     1 
ATOM   2641 C  CB    . ARG A 1 319 ? -0.796  -37.279 9.427  1.00 38.44  ? 319  ARG A CB    1 
ATOM   2642 C  CG    . ARG A 1 319 ? -0.265  -37.027 10.807 1.00 38.34  ? 319  ARG A CG    1 
ATOM   2643 C  CD    . ARG A 1 319 ? 0.944   -37.888 11.099 1.00 46.77  ? 319  ARG A CD    1 
ATOM   2644 N  NE    . ARG A 1 319 ? 0.657   -38.981 12.029 1.00 47.08  ? 319  ARG A NE    1 
ATOM   2645 C  CZ    . ARG A 1 319 ? 0.760   -40.275 11.741 1.00 49.43  ? 319  ARG A CZ    1 
ATOM   2646 N  NH1   . ARG A 1 319 ? 1.144   -40.670 10.531 1.00 51.51  ? 319  ARG A NH1   1 
ATOM   2647 N  NH2   . ARG A 1 319 ? 0.479   -41.181 12.671 1.00 46.74  ? 319  ARG A NH2   1 
ATOM   2648 N  N     . TYR A 1 320 ? -2.472  -34.783 8.392  1.00 32.39  ? 320  TYR A N     1 
ATOM   2649 C  CA    . TYR A 1 320 ? -2.864  -33.362 8.333  1.00 31.31  ? 320  TYR A CA    1 
ATOM   2650 C  C     . TYR A 1 320 ? -4.250  -33.074 8.918  1.00 29.45  ? 320  TYR A C     1 
ATOM   2651 O  O     . TYR A 1 320 ? -4.393  -32.202 9.771  1.00 25.14  ? 320  TYR A O     1 
ATOM   2652 C  CB    . TYR A 1 320 ? -2.840  -32.899 6.880  1.00 31.46  ? 320  TYR A CB    1 
ATOM   2653 C  CG    . TYR A 1 320 ? -2.877  -31.404 6.642  1.00 31.79  ? 320  TYR A CG    1 
ATOM   2654 C  CD1   . TYR A 1 320 ? -1.793  -30.588 6.989  1.00 29.87  ? 320  TYR A CD1   1 
ATOM   2655 C  CD2   . TYR A 1 320 ? -3.976  -30.810 6.005  1.00 32.17  ? 320  TYR A CD2   1 
ATOM   2656 C  CE1   . TYR A 1 320 ? -1.810  -29.214 6.730  1.00 29.07  ? 320  TYR A CE1   1 
ATOM   2657 C  CE2   . TYR A 1 320 ? -4.003  -29.443 5.736  1.00 31.58  ? 320  TYR A CE2   1 
ATOM   2658 C  CZ    . TYR A 1 320 ? -2.917  -28.647 6.103  1.00 34.38  ? 320  TYR A CZ    1 
ATOM   2659 O  OH    . TYR A 1 320 ? -2.947  -27.289 5.847  1.00 34.39  ? 320  TYR A OH    1 
ATOM   2660 N  N     . ILE A 1 321 ? -5.261  -33.809 8.459  1.00 29.87  ? 321  ILE A N     1 
ATOM   2661 C  CA    . ILE A 1 321 ? -6.619  -33.610 8.945  1.00 31.26  ? 321  ILE A CA    1 
ATOM   2662 C  C     . ILE A 1 321 ? -6.766  -34.081 10.389 1.00 32.75  ? 321  ILE A C     1 
ATOM   2663 O  O     . ILE A 1 321 ? -7.294  -33.348 11.228 1.00 32.42  ? 321  ILE A O     1 
ATOM   2664 C  CB    . ILE A 1 321 ? -7.673  -34.277 8.033  1.00 31.64  ? 321  ILE A CB    1 
ATOM   2665 C  CG1   . ILE A 1 321 ? -7.582  -33.718 6.608  1.00 34.07  ? 321  ILE A CG1   1 
ATOM   2666 C  CG2   . ILE A 1 321 ? -9.076  -34.079 8.588  1.00 29.82  ? 321  ILE A CG2   1 
ATOM   2667 C  CD1   . ILE A 1 321 ? -7.654  -32.190 6.500  1.00 31.98  ? 321  ILE A CD1   1 
ATOM   2668 N  N     . SER A 1 322 ? -6.285  -35.288 10.678 1.00 33.37  ? 322  SER A N     1 
ATOM   2669 C  CA    . SER A 1 322 ? -6.312  -35.824 12.047 1.00 31.88  ? 322  SER A CA    1 
ATOM   2670 C  C     . SER A 1 322 ? -5.735  -34.846 13.072 1.00 32.46  ? 322  SER A C     1 
ATOM   2671 O  O     . SER A 1 322 ? -6.326  -34.628 14.137 1.00 33.59  ? 322  SER A O     1 
ATOM   2672 C  CB    . SER A 1 322 ? -5.540  -37.136 12.121 1.00 30.74  ? 322  SER A CB    1 
ATOM   2673 O  OG    . SER A 1 322 ? -6.162  -38.146 11.356 1.00 29.85  ? 322  SER A OG    1 
ATOM   2674 N  N     . TYR A 1 323 ? -4.590  -34.251 12.745 1.00 31.49  ? 323  TYR A N     1 
ATOM   2675 C  CA    . TYR A 1 323 ? -3.953  -33.293 13.647 1.00 31.98  ? 323  TYR A CA    1 
ATOM   2676 C  C     . TYR A 1 323 ? -4.748  -32.007 13.775 1.00 30.61  ? 323  TYR A C     1 
ATOM   2677 O  O     . TYR A 1 323 ? -4.746  -31.396 14.841 1.00 29.42  ? 323  TYR A O     1 
ATOM   2678 C  CB    . TYR A 1 323 ? -2.491  -33.033 13.252 1.00 33.74  ? 323  TYR A CB    1 
ATOM   2679 C  CG    . TYR A 1 323 ? -1.572  -34.192 13.617 1.00 38.35  ? 323  TYR A CG    1 
ATOM   2680 C  CD1   . TYR A 1 323 ? -0.201  -34.115 13.401 1.00 42.47  ? 323  TYR A CD1   1 
ATOM   2681 C  CD2   . TYR A 1 323 ? -2.083  -35.366 14.194 1.00 39.36  ? 323  TYR A CD2   1 
ATOM   2682 C  CE1   . TYR A 1 323 ? 0.641   -35.181 13.734 1.00 44.32  ? 323  TYR A CE1   1 
ATOM   2683 C  CE2   . TYR A 1 323 ? -1.256  -36.428 14.532 1.00 43.00  ? 323  TYR A CE2   1 
ATOM   2684 C  CZ    . TYR A 1 323 ? 0.106   -36.329 14.299 1.00 43.14  ? 323  TYR A CZ    1 
ATOM   2685 O  OH    . TYR A 1 323 ? 0.929   -37.380 14.622 1.00 44.59  ? 323  TYR A OH    1 
ATOM   2686 N  N     . ASN A 1 324 ? -5.438  -31.608 12.703 1.00 28.72  ? 324  ASN A N     1 
ATOM   2687 C  CA    . ASN A 1 324 ? -6.318  -30.451 12.772 1.00 26.53  ? 324  ASN A CA    1 
ATOM   2688 C  C     . ASN A 1 324 ? -7.427  -30.719 13.782 1.00 26.18  ? 324  ASN A C     1 
ATOM   2689 O  O     . ASN A 1 324 ? -7.728  -29.876 14.627 1.00 22.18  ? 324  ASN A O     1 
ATOM   2690 C  CB    . ASN A 1 324 ? -6.914  -30.086 11.412 1.00 24.75  ? 324  ASN A CB    1 
ATOM   2691 C  CG    . ASN A 1 324 ? -7.773  -28.829 11.481 1.00 27.79  ? 324  ASN A CG    1 
ATOM   2692 O  OD1   . ASN A 1 324 ? -8.934  -28.834 11.077 1.00 29.07  ? 324  ASN A OD1   1 
ATOM   2693 N  ND2   . ASN A 1 324 ? -7.206  -27.746 12.011 1.00 31.39  ? 324  ASN A ND2   1 
ATOM   2694 N  N     . ILE A 1 325 ? -8.003  -31.914 13.702 1.00 26.63  ? 325  ILE A N     1 
ATOM   2695 C  CA    . ILE A 1 325 ? -9.054  -32.340 14.619 1.00 27.27  ? 325  ILE A CA    1 
ATOM   2696 C  C     . ILE A 1 325 ? -8.547  -32.417 16.062 1.00 27.70  ? 325  ILE A C     1 
ATOM   2697 O  O     . ILE A 1 325 ? -9.181  -31.890 16.974 1.00 27.55  ? 325  ILE A O     1 
ATOM   2698 C  CB    . ILE A 1 325 ? -9.655  -33.698 14.177 1.00 28.90  ? 325  ILE A CB    1 
ATOM   2699 C  CG1   . ILE A 1 325 ? -10.272 -33.568 12.775 1.00 27.53  ? 325  ILE A CG1   1 
ATOM   2700 C  CG2   . ILE A 1 325 ? -10.680 -34.214 15.214 1.00 30.62  ? 325  ILE A CG2   1 
ATOM   2701 C  CD1   . ILE A 1 325 ? -10.718 -34.871 12.161 1.00 26.63  ? 325  ILE A CD1   1 
ATOM   2702 N  N     . ILE A 1 326 ? -7.399  -33.066 16.257 1.00 29.91  ? 326  ILE A N     1 
ATOM   2703 C  CA    . ILE A 1 326 ? -6.839  -33.266 17.595 1.00 28.36  ? 326  ILE A CA    1 
ATOM   2704 C  C     . ILE A 1 326 ? -6.507  -31.943 18.284 1.00 28.85  ? 326  ILE A C     1 
ATOM   2705 O  O     . ILE A 1 326 ? -6.845  -31.748 19.455 1.00 32.54  ? 326  ILE A O     1 
ATOM   2706 C  CB    . ILE A 1 326 ? -5.614  -34.198 17.581 1.00 27.25  ? 326  ILE A CB    1 
ATOM   2707 C  CG1   . ILE A 1 326 ? -6.057  -35.636 17.298 1.00 27.65  ? 326  ILE A CG1   1 
ATOM   2708 C  CG2   . ILE A 1 326 ? -4.863  -34.110 18.912 1.00 26.78  ? 326  ILE A CG2   1 
ATOM   2709 C  CD1   . ILE A 1 326 ? -4.926  -36.615 17.016 1.00 21.66  ? 326  ILE A CD1   1 
ATOM   2710 N  N     . ALA A 1 327 ? -5.882  -31.026 17.555 1.00 27.19  ? 327  ALA A N     1 
ATOM   2711 C  CA    . ALA A 1 327 ? -5.583  -29.695 18.095 1.00 27.82  ? 327  ALA A CA    1 
ATOM   2712 C  C     . ALA A 1 327 ? -6.824  -28.984 18.645 1.00 29.16  ? 327  ALA A C     1 
ATOM   2713 O  O     . ALA A 1 327 ? -6.745  -28.301 19.670 1.00 29.86  ? 327  ALA A O     1 
ATOM   2714 C  CB    . ALA A 1 327 ? -4.892  -28.837 17.063 1.00 23.62  ? 327  ALA A CB    1 
ATOM   2715 N  N     . VAL A 1 328 ? -7.961  -29.145 17.967 1.00 29.49  ? 328  VAL A N     1 
ATOM   2716 C  CA    . VAL A 1 328 ? -9.216  -28.584 18.450 1.00 29.10  ? 328  VAL A CA    1 
ATOM   2717 C  C     . VAL A 1 328 ? -9.596  -29.276 19.755 1.00 30.63  ? 328  VAL A C     1 
ATOM   2718 O  O     . VAL A 1 328 ? -9.879  -28.605 20.749 1.00 33.69  ? 328  VAL A O     1 
ATOM   2719 C  CB    . VAL A 1 328 ? -10.359 -28.680 17.393 1.00 29.66  ? 328  VAL A CB    1 
ATOM   2720 C  CG1   . VAL A 1 328 ? -11.685 -28.198 17.968 1.00 25.01  ? 328  VAL A CG1   1 
ATOM   2721 C  CG2   . VAL A 1 328 ? -10.003 -27.878 16.144 1.00 25.40  ? 328  VAL A CG2   1 
ATOM   2722 N  N     . TYR A 1 329 ? -9.571  -30.608 19.765 1.00 29.04  ? 329  TYR A N     1 
ATOM   2723 C  CA    . TYR A 1 329 ? -9.892  -31.365 20.978 1.00 28.48  ? 329  TYR A CA    1 
ATOM   2724 C  C     . TYR A 1 329 ? -9.005  -30.969 22.169 1.00 28.93  ? 329  TYR A C     1 
ATOM   2725 O  O     . TYR A 1 329 ? -9.487  -30.815 23.296 1.00 31.81  ? 329  TYR A O     1 
ATOM   2726 C  CB    . TYR A 1 329 ? -9.811  -32.873 20.715 1.00 27.90  ? 329  TYR A CB    1 
ATOM   2727 C  CG    . TYR A 1 329 ? -10.241 -33.756 21.878 1.00 29.51  ? 329  TYR A CG    1 
ATOM   2728 C  CD1   . TYR A 1 329 ? -11.354 -33.430 22.668 1.00 29.54  ? 329  TYR A CD1   1 
ATOM   2729 C  CD2   . TYR A 1 329 ? -9.544  -34.938 22.175 1.00 30.16  ? 329  TYR A CD2   1 
ATOM   2730 C  CE1   . TYR A 1 329 ? -11.746 -34.246 23.741 1.00 30.63  ? 329  TYR A CE1   1 
ATOM   2731 C  CE2   . TYR A 1 329 ? -9.934  -35.767 23.238 1.00 28.53  ? 329  TYR A CE2   1 
ATOM   2732 C  CZ    . TYR A 1 329 ? -11.035 -35.415 24.010 1.00 28.79  ? 329  TYR A CZ    1 
ATOM   2733 O  OH    . TYR A 1 329 ? -11.420 -36.222 25.052 1.00 27.86  ? 329  TYR A OH    1 
ATOM   2734 N  N     . ARG A 1 330 ? -7.718  -30.782 21.916 1.00 26.76  ? 330  ARG A N     1 
ATOM   2735 C  CA    . ARG A 1 330 ? -6.785  -30.430 22.981 1.00 25.45  ? 330  ARG A CA    1 
ATOM   2736 C  C     . ARG A 1 330 ? -7.149  -29.159 23.755 1.00 24.44  ? 330  ARG A C     1 
ATOM   2737 O  O     . ARG A 1 330 ? -6.982  -29.109 24.974 1.00 22.87  ? 330  ARG A O     1 
ATOM   2738 C  CB    . ARG A 1 330 ? -5.352  -30.396 22.463 1.00 24.89  ? 330  ARG A CB    1 
ATOM   2739 C  CG    . ARG A 1 330 ? -4.817  -31.779 22.202 1.00 27.45  ? 330  ARG A CG    1 
ATOM   2740 C  CD    . ARG A 1 330 ? -3.405  -31.751 21.722 1.00 32.94  ? 330  ARG A CD    1 
ATOM   2741 N  NE    . ARG A 1 330 ? -2.853  -33.102 21.740 1.00 41.75  ? 330  ARG A NE    1 
ATOM   2742 C  CZ    . ARG A 1 330 ? -1.558  -33.395 21.665 1.00 47.11  ? 330  ARG A CZ    1 
ATOM   2743 N  NH1   . ARG A 1 330 ? -0.640  -32.434 21.568 1.00 46.19  ? 330  ARG A NH1   1 
ATOM   2744 N  NH2   . ARG A 1 330 ? -1.181  -34.665 21.700 1.00 52.92  ? 330  ARG A NH2   1 
ATOM   2745 N  N     . VAL A 1 331 ? -7.669  -28.146 23.075 1.00 23.02  ? 331  VAL A N     1 
ATOM   2746 C  CA    . VAL A 1 331 ? -8.079  -26.952 23.799 1.00 24.71  ? 331  VAL A CA    1 
ATOM   2747 C  C     . VAL A 1 331 ? -9.238  -27.304 24.721 1.00 26.62  ? 331  VAL A C     1 
ATOM   2748 O  O     . VAL A 1 331 ? -9.266  -26.887 25.883 1.00 30.28  ? 331  VAL A O     1 
ATOM   2749 C  CB    . VAL A 1 331 ? -8.425  -25.771 22.874 1.00 26.58  ? 331  VAL A CB    1 
ATOM   2750 C  CG1   . VAL A 1 331 ? -8.720  -24.524 23.698 1.00 22.40  ? 331  VAL A CG1   1 
ATOM   2751 C  CG2   . VAL A 1 331 ? -7.272  -25.492 21.904 1.00 28.49  ? 331  VAL A CG2   1 
ATOM   2752 N  N     . LEU A 1 332 ? -10.167 -28.109 24.217 1.00 25.71  ? 332  LEU A N     1 
ATOM   2753 C  CA    . LEU A 1 332 ? -11.294 -28.589 25.012 1.00 26.98  ? 332  LEU A CA    1 
ATOM   2754 C  C     . LEU A 1 332 ? -10.830 -29.397 26.232 1.00 28.15  ? 332  LEU A C     1 
ATOM   2755 O  O     . LEU A 1 332 ? -11.431 -29.309 27.300 1.00 30.33  ? 332  LEU A O     1 
ATOM   2756 C  CB    . LEU A 1 332 ? -12.243 -29.437 24.146 1.00 25.73  ? 332  LEU A CB    1 
ATOM   2757 C  CG    . LEU A 1 332 ? -12.925 -28.727 22.975 1.00 25.42  ? 332  LEU A CG    1 
ATOM   2758 C  CD1   . LEU A 1 332 ? -13.556 -29.736 22.014 1.00 28.10  ? 332  LEU A CD1   1 
ATOM   2759 C  CD2   . LEU A 1 332 ? -13.978 -27.707 23.467 1.00 22.29  ? 332  LEU A CD2   1 
ATOM   2760 N  N     . GLN A 1 333 ? -9.773  -30.187 26.065 1.00 26.78  ? 333  GLN A N     1 
ATOM   2761 C  CA    . GLN A 1 333 ? -9.219  -30.955 27.175 1.00 27.62  ? 333  GLN A CA    1 
ATOM   2762 C  C     . GLN A 1 333 ? -8.545  -30.082 28.230 1.00 27.19  ? 333  GLN A C     1 
ATOM   2763 O  O     . GLN A 1 333 ? -8.663  -30.356 29.422 1.00 28.00  ? 333  GLN A O     1 
ATOM   2764 C  CB    . GLN A 1 333 ? -8.232  -32.001 26.681 1.00 28.01  ? 333  GLN A CB    1 
ATOM   2765 C  CG    . GLN A 1 333 ? -8.863  -33.191 25.993 1.00 28.60  ? 333  GLN A CG    1 
ATOM   2766 C  CD    . GLN A 1 333 ? -7.814  -34.081 25.351 1.00 30.96  ? 333  GLN A CD    1 
ATOM   2767 O  OE1   . GLN A 1 333 ? -7.639  -35.230 25.749 1.00 36.76  ? 333  GLN A OE1   1 
ATOM   2768 N  NE2   . GLN A 1 333 ? -7.088  -33.544 24.381 1.00 26.57  ? 333  GLN A NE2   1 
ATOM   2769 N  N     . ILE A 1 334 ? -7.839  -29.041 27.790 1.00 25.16  ? 334  ILE A N     1 
ATOM   2770 C  CA    . ILE A 1 334 ? -7.244  -28.088 28.703 1.00 23.39  ? 334  ILE A CA    1 
ATOM   2771 C  C     . ILE A 1 334 ? -8.353  -27.367 29.467 1.00 26.13  ? 334  ILE A C     1 
ATOM   2772 O  O     . ILE A 1 334 ? -8.273  -27.192 30.684 1.00 28.08  ? 334  ILE A O     1 
ATOM   2773 C  CB    . ILE A 1 334 ? -6.370  -27.061 27.972 1.00 23.15  ? 334  ILE A CB    1 
ATOM   2774 C  CG1   . ILE A 1 334 ? -5.139  -27.741 27.365 1.00 21.62  ? 334  ILE A CG1   1 
ATOM   2775 C  CG2   . ILE A 1 334 ? -5.957  -25.937 28.929 1.00 22.22  ? 334  ILE A CG2   1 
ATOM   2776 C  CD1   . ILE A 1 334 ? -4.409  -26.904 26.342 1.00 21.63  ? 334  ILE A CD1   1 
ATOM   2777 N  N     . ASP A 1 335 ? -9.399  -26.963 28.762 1.00 27.40  ? 335  ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 335 ? -10.506 -26.300 29.440 1.00 29.15  ? 335  ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 335 ? -11.297 -27.218 30.350 1.00 30.08  ? 335  ASP A C     1 
ATOM   2780 O  O     . ASP A 1 335 ? -11.860 -26.757 31.345 1.00 33.06  ? 335  ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 335 ? -11.457 -25.593 28.477 1.00 30.51  ? 335  ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 335 ? -12.412 -24.672 29.210 1.00 32.74  ? 335  ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 335 ? -11.934 -23.683 29.805 1.00 36.51  ? 335  ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 335 ? -13.625 -24.958 29.233 1.00 30.15  ? 335  ASP A OD2   1 
ATOM   2785 N  N     . ALA A 1 336 ? -11.353 -28.506 30.023 1.00 29.11  ? 336  ALA A N     1 
ATOM   2786 C  CA    . ALA A 1 336 ? -12.018 -29.467 30.909 1.00 29.75  ? 336  ALA A CA    1 
ATOM   2787 C  C     . ALA A 1 336 ? -11.289 -29.535 32.243 1.00 29.47  ? 336  ALA A C     1 
ATOM   2788 O  O     . ALA A 1 336 ? -11.895 -29.769 33.281 1.00 33.03  ? 336  ALA A O     1 
ATOM   2789 C  CB    . ALA A 1 336 ? -12.106 -30.848 30.266 1.00 29.41  ? 336  ALA A CB    1 
ATOM   2790 N  N     . LYS A 1 337 ? -9.983  -29.297 32.198 1.00 30.76  ? 337  LYS A N     1 
ATOM   2791 C  CA    . LYS A 1 337 ? -9.128  -29.299 33.378 1.00 29.07  ? 337  LYS A CA    1 
ATOM   2792 C  C     . LYS A 1 337 ? -9.194  -27.950 34.097 1.00 27.30  ? 337  LYS A C     1 
ATOM   2793 O  O     . LYS A 1 337 ? -9.573  -27.881 35.263 1.00 28.79  ? 337  LYS A O     1 
ATOM   2794 C  CB    . LYS A 1 337 ? -7.688  -29.601 32.950 1.00 29.63  ? 337  LYS A CB    1 
ATOM   2795 C  CG    . LYS A 1 337 ? -6.673  -29.607 34.081 1.00 33.67  ? 337  LYS A CG    1 
ATOM   2796 C  CD    . LYS A 1 337 ? -5.249  -29.606 33.552 1.00 29.83  ? 337  LYS A CD    1 
ATOM   2797 C  CE    . LYS A 1 337 ? -4.268  -29.673 34.695 1.00 33.99  ? 337  LYS A CE    1 
ATOM   2798 N  NZ    . LYS A 1 337 ? -2.921  -29.252 34.246 1.00 38.44  ? 337  LYS A NZ    1 
ATOM   2799 N  N     . ARG A 1 338 ? -8.844  -26.886 33.378 1.00 25.10  ? 338  ARG A N     1 
ATOM   2800 C  CA    . ARG A 1 338 ? -8.664  -25.561 33.960 1.00 24.11  ? 338  ARG A CA    1 
ATOM   2801 C  C     . ARG A 1 338 ? -9.956  -24.806 34.224 1.00 25.37  ? 338  ARG A C     1 
ATOM   2802 O  O     . ARG A 1 338 ? -10.042 -24.077 35.211 1.00 27.66  ? 338  ARG A O     1 
ATOM   2803 C  CB    . ARG A 1 338 ? -7.759  -24.713 33.078 1.00 22.62  ? 338  ARG A CB    1 
ATOM   2804 C  CG    . ARG A 1 338 ? -6.302  -25.109 33.126 1.00 25.49  ? 338  ARG A CG    1 
ATOM   2805 C  CD    . ARG A 1 338 ? -5.641  -24.828 34.477 1.00 24.40  ? 338  ARG A CD    1 
ATOM   2806 N  NE    . ARG A 1 338 ? -4.193  -24.814 34.291 1.00 23.79  ? 338  ARG A NE    1 
ATOM   2807 C  CZ    . ARG A 1 338 ? -3.333  -24.109 35.017 1.00 25.47  ? 338  ARG A CZ    1 
ATOM   2808 N  NH1   . ARG A 1 338 ? -3.751  -23.348 36.026 1.00 18.01  ? 338  ARG A NH1   1 
ATOM   2809 N  NH2   . ARG A 1 338 ? -2.036  -24.174 34.727 1.00 28.70  ? 338  ARG A NH2   1 
ATOM   2810 N  N     . GLN A 1 339 ? -10.937 -24.969 33.339 1.00 22.90  ? 339  GLN A N     1 
ATOM   2811 C  CA    . GLN A 1 339 ? -12.289 -24.427 33.517 1.00 27.65  ? 339  GLN A CA    1 
ATOM   2812 C  C     . GLN A 1 339 ? -12.360 -22.899 33.421 1.00 28.39  ? 339  GLN A C     1 
ATOM   2813 O  O     . GLN A 1 339 ? -13.051 -22.242 34.206 1.00 31.49  ? 339  GLN A O     1 
ATOM   2814 C  CB    . GLN A 1 339 ? -12.913 -24.943 34.825 1.00 28.51  ? 339  GLN A CB    1 
ATOM   2815 C  CG    . GLN A 1 339 ? -13.042 -26.470 34.868 1.00 33.44  ? 339  GLN A CG    1 
ATOM   2816 C  CD    . GLN A 1 339 ? -13.829 -26.969 36.067 1.00 39.50  ? 339  GLN A CD    1 
ATOM   2817 O  OE1   . GLN A 1 339 ? -14.141 -28.155 36.171 1.00 38.54  ? 339  GLN A OE1   1 
ATOM   2818 N  NE2   . GLN A 1 339 ? -14.152 -26.063 36.981 1.00 42.90  ? 339  GLN A NE2   1 
ATOM   2819 N  N     . PHE A 1 340 ? -11.641 -22.351 32.448 1.00 29.75  ? 340  PHE A N     1 
ATOM   2820 C  CA    . PHE A 1 340 ? -11.563 -20.912 32.249 1.00 29.18  ? 340  PHE A CA    1 
ATOM   2821 C  C     . PHE A 1 340 ? -12.804 -20.354 31.539 1.00 29.26  ? 340  PHE A C     1 
ATOM   2822 O  O     . PHE A 1 340 ? -13.175 -19.196 31.756 1.00 30.12  ? 340  PHE A O     1 
ATOM   2823 C  CB    . PHE A 1 340 ? -10.287 -20.545 31.467 1.00 28.95  ? 340  PHE A CB    1 
ATOM   2824 C  CG    . PHE A 1 340 ? -8.996  -20.875 32.186 1.00 29.96  ? 340  PHE A CG    1 
ATOM   2825 C  CD1   . PHE A 1 340 ? -8.925  -20.885 33.578 1.00 30.67  ? 340  PHE A CD1   1 
ATOM   2826 C  CD2   . PHE A 1 340 ? -7.836  -21.138 31.460 1.00 29.91  ? 340  PHE A CD2   1 
ATOM   2827 C  CE1   . PHE A 1 340 ? -7.722  -21.188 34.235 1.00 31.41  ? 340  PHE A CE1   1 
ATOM   2828 C  CE2   . PHE A 1 340 ? -6.634  -21.437 32.098 1.00 25.85  ? 340  PHE A CE2   1 
ATOM   2829 C  CZ    . PHE A 1 340 ? -6.575  -21.463 33.490 1.00 29.32  ? 340  PHE A CZ    1 
ATOM   2830 N  N     . ILE A 1 341 ? -13.433 -21.161 30.684 1.00 27.37  ? 341  ILE A N     1 
ATOM   2831 C  CA    . ILE A 1 341 ? -14.679 -20.755 30.037 1.00 27.02  ? 341  ILE A CA    1 
ATOM   2832 C  C     . ILE A 1 341 ? -15.781 -20.632 31.087 1.00 28.98  ? 341  ILE A C     1 
ATOM   2833 O  O     . ILE A 1 341 ? -16.577 -19.689 31.046 1.00 30.36  ? 341  ILE A O     1 
ATOM   2834 C  CB    . ILE A 1 341 ? -15.135 -21.736 28.921 1.00 27.02  ? 341  ILE A CB    1 
ATOM   2835 C  CG1   . ILE A 1 341 ? -14.076 -21.890 27.819 1.00 23.36  ? 341  ILE A CG1   1 
ATOM   2836 C  CG2   . ILE A 1 341 ? -16.471 -21.289 28.322 1.00 26.21  ? 341  ILE A CG2   1 
ATOM   2837 C  CD1   . ILE A 1 341 ? -13.947 -20.712 26.889 1.00 20.17  ? 341  ILE A CD1   1 
ATOM   2838 N  N     . ASN A 1 342 ? -15.830 -21.587 32.019 1.00 29.13  ? 342  ASN A N     1 
ATOM   2839 C  CA    . ASN A 1 342 ? -16.797 -21.546 33.118 1.00 30.23  ? 342  ASN A CA    1 
ATOM   2840 C  C     . ASN A 1 342 ? -16.605 -20.309 34.006 1.00 28.42  ? 342  ASN A C     1 
ATOM   2841 O  O     . ASN A 1 342 ? -17.566 -19.586 34.294 1.00 28.64  ? 342  ASN A O     1 
ATOM   2842 C  CB    . ASN A 1 342 ? -16.735 -22.826 33.960 1.00 32.20  ? 342  ASN A CB    1 
ATOM   2843 C  CG    . ASN A 1 342 ? -17.560 -22.722 35.241 1.00 36.72  ? 342  ASN A CG    1 
ATOM   2844 O  OD1   . ASN A 1 342 ? -18.795 -22.730 35.202 1.00 36.91  ? 342  ASN A OD1   1 
ATOM   2845 N  ND2   . ASN A 1 342 ? -16.876 -22.617 36.387 1.00 35.40  ? 342  ASN A ND2   1 
ATOM   2846 N  N     . LEU A 1 343 ? -15.355 -20.075 34.409 1.00 26.65  ? 343  LEU A N     1 
ATOM   2847 C  CA    . LEU A 1 343 ? -14.955 -18.886 35.159 1.00 24.85  ? 343  LEU A CA    1 
ATOM   2848 C  C     . LEU A 1 343 ? -15.348 -17.593 34.443 1.00 25.30  ? 343  LEU A C     1 
ATOM   2849 O  O     . LEU A 1 343 ? -16.066 -16.776 35.009 1.00 27.84  ? 343  LEU A O     1 
ATOM   2850 C  CB    . LEU A 1 343 ? -13.452 -18.924 35.414 1.00 24.71  ? 343  LEU A CB    1 
ATOM   2851 C  CG    . LEU A 1 343 ? -12.768 -17.662 35.950 1.00 26.42  ? 343  LEU A CG    1 
ATOM   2852 C  CD1   . LEU A 1 343 ? -13.182 -17.353 37.407 1.00 21.32  ? 343  LEU A CD1   1 
ATOM   2853 C  CD2   . LEU A 1 343 ? -11.252 -17.814 35.821 1.00 26.85  ? 343  LEU A CD2   1 
ATOM   2854 N  N     . SER A 1 344 ? -14.894 -17.422 33.197 1.00 25.94  ? 344  SER A N     1 
ATOM   2855 C  CA    . SER A 1 344 ? -15.262 -16.260 32.368 1.00 24.91  ? 344  SER A CA    1 
ATOM   2856 C  C     . SER A 1 344 ? -16.751 -16.008 32.406 1.00 25.52  ? 344  SER A C     1 
ATOM   2857 O  O     . SER A 1 344 ? -17.188 -14.873 32.616 1.00 25.20  ? 344  SER A O     1 
ATOM   2858 C  CB    . SER A 1 344 ? -14.852 -16.453 30.903 1.00 24.07  ? 344  SER A CB    1 
ATOM   2859 O  OG    . SER A 1 344 ? -13.452 -16.539 30.767 1.00 23.81  ? 344  SER A OG    1 
ATOM   2860 N  N     . LEU A 1 345 ? -17.527 -17.069 32.205 1.00 26.46  ? 345  LEU A N     1 
ATOM   2861 C  CA    . LEU A 1 345 ? -18.984 -16.938 32.211 1.00 27.77  ? 345  LEU A CA    1 
ATOM   2862 C  C     . LEU A 1 345 ? -19.504 -16.517 33.599 1.00 28.80  ? 345  LEU A C     1 
ATOM   2863 O  O     . LEU A 1 345 ? -20.301 -15.584 33.695 1.00 29.89  ? 345  LEU A O     1 
ATOM   2864 C  CB    . LEU A 1 345 ? -19.677 -18.216 31.702 1.00 24.95  ? 345  LEU A CB    1 
ATOM   2865 C  CG    . LEU A 1 345 ? -19.608 -18.580 30.208 1.00 25.83  ? 345  LEU A CG    1 
ATOM   2866 C  CD1   . LEU A 1 345 ? -20.084 -20.026 29.993 1.00 21.59  ? 345  LEU A CD1   1 
ATOM   2867 C  CD2   . LEU A 1 345 ? -20.377 -17.602 29.283 1.00 19.82  ? 345  LEU A CD2   1 
ATOM   2868 N  N     . ASP A 1 346 ? -19.048 -17.187 34.658 1.00 30.12  ? 346  ASP A N     1 
ATOM   2869 C  CA    . ASP A 1 346 ? -19.438 -16.826 36.031 1.00 32.40  ? 346  ASP A CA    1 
ATOM   2870 C  C     . ASP A 1 346 ? -19.236 -15.337 36.297 1.00 31.15  ? 346  ASP A C     1 
ATOM   2871 O  O     . ASP A 1 346 ? -20.148 -14.663 36.765 1.00 32.63  ? 346  ASP A O     1 
ATOM   2872 C  CB    . ASP A 1 346 ? -18.643 -17.637 37.070 1.00 36.07  ? 346  ASP A CB    1 
ATOM   2873 C  CG    . ASP A 1 346 ? -19.304 -18.956 37.427 1.00 40.59  ? 346  ASP A CG    1 
ATOM   2874 O  OD1   . ASP A 1 346 ? -20.372 -19.266 36.856 1.00 46.21  ? 346  ASP A OD1   1 
ATOM   2875 O  OD2   . ASP A 1 346 ? -18.757 -19.681 38.289 1.00 40.67  ? 346  ASP A OD2   1 
ATOM   2876 N  N     . MET A 1 347 ? -18.044 -14.837 35.971 1.00 31.62  ? 347  MET A N     1 
ATOM   2877 C  CA    . MET A 1 347 ? -17.662 -13.448 36.240 1.00 33.84  ? 347  MET A CA    1 
ATOM   2878 C  C     . MET A 1 347 ? -18.418 -12.465 35.356 1.00 33.22  ? 347  MET A C     1 
ATOM   2879 O  O     . MET A 1 347 ? -18.861 -11.404 35.819 1.00 33.14  ? 347  MET A O     1 
ATOM   2880 C  CB    . MET A 1 347 ? -16.150 -13.257 36.055 1.00 35.16  ? 347  MET A CB    1 
ATOM   2881 C  CG    . MET A 1 347 ? -15.283 -13.649 37.273 1.00 42.97  ? 347  MET A CG    1 
ATOM   2882 S  SD    . MET A 1 347 ? -13.484 -13.662 36.927 1.00 52.41  ? 347  MET A SD    1 
ATOM   2883 C  CE    . MET A 1 347 ? -13.212 -12.007 36.286 1.00 47.32  ? 347  MET A CE    1 
ATOM   2884 N  N     . GLY A 1 348 ? -18.560 -12.823 34.081 1.00 31.73  ? 348  GLY A N     1 
ATOM   2885 C  CA    . GLY A 1 348 ? -19.242 -11.977 33.114 1.00 28.58  ? 348  GLY A CA    1 
ATOM   2886 C  C     . GLY A 1 348 ? -20.670 -11.654 33.519 1.00 26.85  ? 348  GLY A C     1 
ATOM   2887 O  O     . GLY A 1 348 ? -21.087 -10.496 33.456 1.00 25.93  ? 348  GLY A O     1 
ATOM   2888 N  N     . TYR A 1 349 ? -21.413 -12.679 33.925 1.00 25.28  ? 349  TYR A N     1 
ATOM   2889 C  CA    . TYR A 1 349 ? -22.819 -12.517 34.308 1.00 27.44  ? 349  TYR A CA    1 
ATOM   2890 C  C     . TYR A 1 349 ? -22.958 -11.907 35.692 1.00 29.13  ? 349  TYR A C     1 
ATOM   2891 O  O     . TYR A 1 349 ? -23.906 -11.168 35.951 1.00 32.24  ? 349  TYR A O     1 
ATOM   2892 C  CB    . TYR A 1 349 ? -23.569 -13.847 34.246 1.00 26.33  ? 349  TYR A CB    1 
ATOM   2893 C  CG    . TYR A 1 349 ? -23.818 -14.315 32.842 1.00 27.63  ? 349  TYR A CG    1 
ATOM   2894 C  CD1   . TYR A 1 349 ? -24.711 -13.641 32.014 1.00 29.42  ? 349  TYR A CD1   1 
ATOM   2895 C  CD2   . TYR A 1 349 ? -23.151 -15.416 32.329 1.00 26.79  ? 349  TYR A CD2   1 
ATOM   2896 C  CE1   . TYR A 1 349 ? -24.935 -14.056 30.717 1.00 29.31  ? 349  TYR A CE1   1 
ATOM   2897 C  CE2   . TYR A 1 349 ? -23.370 -15.839 31.026 1.00 29.63  ? 349  TYR A CE2   1 
ATOM   2898 C  CZ    . TYR A 1 349 ? -24.264 -15.154 30.230 1.00 29.21  ? 349  TYR A CZ    1 
ATOM   2899 O  OH    . TYR A 1 349 ? -24.487 -15.565 28.942 1.00 31.94  ? 349  TYR A OH    1 
ATOM   2900 N  N     . TYR A 1 350 ? -22.022 -12.229 36.583 1.00 28.84  ? 350  TYR A N     1 
ATOM   2901 C  CA    . TYR A 1 350 ? -21.980 -11.603 37.896 1.00 27.65  ? 350  TYR A CA    1 
ATOM   2902 C  C     . TYR A 1 350 ? -21.886 -10.077 37.758 1.00 28.26  ? 350  TYR A C     1 
ATOM   2903 O  O     . TYR A 1 350 ? -22.607 -9.341  38.440 1.00 27.76  ? 350  TYR A O     1 
ATOM   2904 C  CB    . TYR A 1 350 ? -20.806 -12.144 38.712 1.00 27.43  ? 350  TYR A CB    1 
ATOM   2905 C  CG    . TYR A 1 350 ? -20.748 -11.589 40.111 1.00 29.07  ? 350  TYR A CG    1 
ATOM   2906 C  CD1   . TYR A 1 350 ? -21.568 -12.111 41.119 1.00 29.45  ? 350  TYR A CD1   1 
ATOM   2907 C  CD2   . TYR A 1 350 ? -19.891 -10.531 40.431 1.00 24.98  ? 350  TYR A CD2   1 
ATOM   2908 C  CE1   . TYR A 1 350 ? -21.535 -11.602 42.419 1.00 29.58  ? 350  TYR A CE1   1 
ATOM   2909 C  CE2   . TYR A 1 350 ? -19.852 -10.005 41.734 1.00 29.59  ? 350  TYR A CE2   1 
ATOM   2910 C  CZ    . TYR A 1 350 ? -20.674 -10.553 42.727 1.00 31.35  ? 350  TYR A CZ    1 
ATOM   2911 O  OH    . TYR A 1 350 ? -20.644 -10.063 44.020 1.00 27.36  ? 350  TYR A OH    1 
ATOM   2912 N  N     . ALA A 1 351 ? -21.010 -9.615  36.863 1.00 27.91  ? 351  ALA A N     1 
ATOM   2913 C  CA    . ALA A 1 351 ? -20.756 -8.182  36.674 1.00 25.43  ? 351  ALA A CA    1 
ATOM   2914 C  C     . ALA A 1 351 ? -21.786 -7.522  35.764 1.00 27.48  ? 351  ALA A C     1 
ATOM   2915 O  O     . ALA A 1 351 ? -21.935 -6.298  35.786 1.00 27.04  ? 351  ALA A O     1 
ATOM   2916 C  CB    . ALA A 1 351 ? -19.368 -7.959  36.119 1.00 21.74  ? 351  ALA A CB    1 
ATOM   2917 N  N     . LYS A 1 352 ? -22.498 -8.332  34.980 1.00 28.23  ? 352  LYS A N     1 
ATOM   2918 C  CA    . LYS A 1 352 ? -23.375 -7.824  33.904 1.00 30.45  ? 352  LYS A CA    1 
ATOM   2919 C  C     . LYS A 1 352 ? -22.567 -7.039  32.861 1.00 30.15  ? 352  LYS A C     1 
ATOM   2920 O  O     . LYS A 1 352 ? -22.889 -5.898  32.525 1.00 30.37  ? 352  LYS A O     1 
ATOM   2921 C  CB    . LYS A 1 352 ? -24.569 -7.021  34.457 1.00 28.49  ? 352  LYS A CB    1 
ATOM   2922 C  CG    . LYS A 1 352 ? -25.575 -7.894  35.192 1.00 32.18  ? 352  LYS A CG    1 
ATOM   2923 C  CD    . LYS A 1 352 ? -26.723 -7.124  35.833 1.00 35.91  ? 352  LYS A CD    1 
ATOM   2924 C  CE    . LYS A 1 352 ? -27.338 -7.978  36.960 1.00 40.15  ? 352  LYS A CE    1 
ATOM   2925 N  NZ    . LYS A 1 352 ? -28.434 -7.348  37.782 1.00 43.26  ? 352  LYS A NZ    1 
ATOM   2926 N  N     . ILE A 1 353 ? -21.498 -7.665  32.371 1.00 28.26  ? 353  ILE A N     1 
ATOM   2927 C  CA    . ILE A 1 353 ? -20.689 -7.096  31.292 1.00 27.06  ? 353  ILE A CA    1 
ATOM   2928 C  C     . ILE A 1 353 ? -20.767 -7.975  30.041 1.00 27.22  ? 353  ILE A C     1 
ATOM   2929 O  O     . ILE A 1 353 ? -21.309 -9.082  30.094 1.00 28.41  ? 353  ILE A O     1 
ATOM   2930 C  CB    . ILE A 1 353 ? -19.211 -6.923  31.719 1.00 25.06  ? 353  ILE A CB    1 
ATOM   2931 C  CG1   . ILE A 1 353 ? -18.629 -8.259  32.199 1.00 24.30  ? 353  ILE A CG1   1 
ATOM   2932 C  CG2   . ILE A 1 353 ? -19.098 -5.851  32.785 1.00 21.98  ? 353  ILE A CG2   1 
ATOM   2933 C  CD1   . ILE A 1 353 ? -17.200 -8.197  32.727 1.00 24.88  ? 353  ILE A CD1   1 
ATOM   2934 N  N     . GLN A 1 354 ? -20.247 -7.478  28.917 1.00 26.30  ? 354  GLN A N     1 
ATOM   2935 C  CA    . GLN A 1 354 ? -19.953 -8.351  27.782 1.00 27.17  ? 354  GLN A CA    1 
ATOM   2936 C  C     . GLN A 1 354 ? -18.925 -9.329  28.287 1.00 26.67  ? 354  GLN A C     1 
ATOM   2937 O  O     . GLN A 1 354 ? -18.002 -8.939  28.998 1.00 29.14  ? 354  GLN A O     1 
ATOM   2938 C  CB    . GLN A 1 354 ? -19.331 -7.598  26.602 1.00 28.15  ? 354  GLN A CB    1 
ATOM   2939 C  CG    . GLN A 1 354 ? -20.132 -6.471  25.993 1.00 30.00  ? 354  GLN A CG    1 
ATOM   2940 C  CD    . GLN A 1 354 ? -19.372 -5.800  24.859 1.00 37.27  ? 354  GLN A CD    1 
ATOM   2941 O  OE1   . GLN A 1 354 ? -19.789 -5.853  23.703 1.00 39.09  ? 354  GLN A OE1   1 
ATOM   2942 N  NE2   . GLN A 1 354 ? -18.234 -5.182  25.185 1.00 40.04  ? 354  GLN A NE2   1 
ATOM   2943 N  N     . ILE A 1 355 ? -19.056 -10.587 27.892 1.00 27.81  ? 355  ILE A N     1 
ATOM   2944 C  CA    . ILE A 1 355 ? -18.199 -11.646 28.412 1.00 26.89  ? 355  ILE A CA    1 
ATOM   2945 C  C     . ILE A 1 355 ? -16.719 -11.397 28.153 1.00 28.58  ? 355  ILE A C     1 
ATOM   2946 O  O     . ILE A 1 355 ? -15.882 -11.747 28.992 1.00 28.01  ? 355  ILE A O     1 
ATOM   2947 C  CB    . ILE A 1 355 ? -18.649 -13.062 27.923 1.00 28.48  ? 355  ILE A CB    1 
ATOM   2948 C  CG1   . ILE A 1 355 ? -20.097 -13.348 28.345 1.00 24.42  ? 355  ILE A CG1   1 
ATOM   2949 C  CG2   . ILE A 1 355 ? -17.746 -14.170 28.478 1.00 27.72  ? 355  ILE A CG2   1 
ATOM   2950 C  CD1   . ILE A 1 355 ? -20.345 -13.154 29.826 1.00 22.85  ? 355  ILE A CD1   1 
ATOM   2951 N  N     . GLN A 1 356 ? -16.394 -10.767 27.023 1.00 27.76  ? 356  GLN A N     1 
ATOM   2952 C  CA    . GLN A 1 356 ? -14.989 -10.520 26.679 1.00 27.32  ? 356  GLN A CA    1 
ATOM   2953 C  C     . GLN A 1 356 ? -14.356 -9.445  27.563 1.00 29.18  ? 356  GLN A C     1 
ATOM   2954 O  O     . GLN A 1 356 ? -13.136 -9.280  27.567 1.00 32.36  ? 356  GLN A O     1 
ATOM   2955 C  CB    . GLN A 1 356 ? -14.800 -10.218 25.185 1.00 26.55  ? 356  GLN A CB    1 
ATOM   2956 C  CG    . GLN A 1 356 ? -15.466 -8.932  24.664 1.00 26.99  ? 356  GLN A CG    1 
ATOM   2957 C  CD    . GLN A 1 356 ? -16.885 -9.134  24.123 1.00 28.51  ? 356  GLN A CD    1 
ATOM   2958 O  OE1   . GLN A 1 356 ? -17.668 -9.957  24.621 1.00 25.50  ? 356  GLN A OE1   1 
ATOM   2959 N  NE2   . GLN A 1 356 ? -17.220 -8.367  23.100 1.00 24.12  ? 356  GLN A NE2   1 
ATOM   2960 N  N     . SER A 1 357 ? -15.191 -8.741  28.325 1.00 29.33  ? 357  SER A N     1 
ATOM   2961 C  CA    . SER A 1 357 ? -14.732 -7.702  29.245 1.00 29.16  ? 357  SER A CA    1 
ATOM   2962 C  C     . SER A 1 357 ? -14.143 -8.269  30.542 1.00 29.86  ? 357  SER A C     1 
ATOM   2963 O  O     . SER A 1 357 ? -13.615 -7.507  31.355 1.00 30.87  ? 357  SER A O     1 
ATOM   2964 C  CB    . SER A 1 357 ? -15.870 -6.727  29.581 1.00 33.16  ? 357  SER A CB    1 
ATOM   2965 O  OG    . SER A 1 357 ? -16.245 -5.922  28.472 1.00 32.42  ? 357  SER A OG    1 
ATOM   2966 N  N     . VAL A 1 358 ? -14.220 -9.591  30.736 1.00 27.59  ? 358  VAL A N     1 
ATOM   2967 C  CA    . VAL A 1 358 ? -13.546 -10.237 31.877 1.00 27.23  ? 358  VAL A CA    1 
ATOM   2968 C  C     . VAL A 1 358 ? -12.025 -10.010 31.878 1.00 30.63  ? 358  VAL A C     1 
ATOM   2969 O  O     . VAL A 1 358 ? -11.389 -10.108 32.931 1.00 34.78  ? 358  VAL A O     1 
ATOM   2970 C  CB    . VAL A 1 358 ? -13.841 -11.776 32.010 1.00 27.88  ? 358  VAL A CB    1 
ATOM   2971 C  CG1   . VAL A 1 358 ? -15.314 -12.061 32.315 1.00 19.12  ? 358  VAL A CG1   1 
ATOM   2972 C  CG2   . VAL A 1 358 ? -13.362 -12.572 30.770 1.00 29.32  ? 358  VAL A CG2   1 
ATOM   2973 N  N     . PHE A 1 359 ? -11.452 -9.704  30.710 1.00 28.40  ? 359  PHE A N     1 
ATOM   2974 C  CA    . PHE A 1 359 ? -10.024 -9.414  30.599 1.00 29.07  ? 359  PHE A CA    1 
ATOM   2975 C  C     . PHE A 1 359 ? -9.672  -8.081  31.244 1.00 31.33  ? 359  PHE A C     1 
ATOM   2976 O  O     . PHE A 1 359 ? -8.494  -7.805  31.508 1.00 32.23  ? 359  PHE A O     1 
ATOM   2977 C  CB    . PHE A 1 359 ? -9.557  -9.421  29.132 1.00 28.95  ? 359  PHE A CB    1 
ATOM   2978 C  CG    . PHE A 1 359 ? -9.575  -10.785 28.495 1.00 25.79  ? 359  PHE A CG    1 
ATOM   2979 C  CD1   . PHE A 1 359 ? -8.679  -11.771 28.905 1.00 25.23  ? 359  PHE A CD1   1 
ATOM   2980 C  CD2   . PHE A 1 359 ? -10.495 -11.087 27.496 1.00 21.79  ? 359  PHE A CD2   1 
ATOM   2981 C  CE1   . PHE A 1 359 ? -8.697  -13.045 28.331 1.00 28.21  ? 359  PHE A CE1   1 
ATOM   2982 C  CE2   . PHE A 1 359 ? -10.521 -12.356 26.912 1.00 23.17  ? 359  PHE A CE2   1 
ATOM   2983 C  CZ    . PHE A 1 359 ? -9.621  -13.340 27.333 1.00 25.61  ? 359  PHE A CZ    1 
ATOM   2984 N  N     . SER A 1 360 ? -10.694 -7.260  31.488 1.00 30.20  ? 360  SER A N     1 
ATOM   2985 C  CA    . SER A 1 360 ? -10.504 -5.965  32.111 1.00 27.92  ? 360  SER A CA    1 
ATOM   2986 C  C     . SER A 1 360 ? -11.157 -5.886  33.493 1.00 27.79  ? 360  SER A C     1 
ATOM   2987 O  O     . SER A 1 360 ? -12.377 -5.731  33.600 1.00 26.34  ? 360  SER A O     1 
ATOM   2988 C  CB    . SER A 1 360 ? -11.038 -4.855  31.215 1.00 27.63  ? 360  SER A CB    1 
ATOM   2989 O  OG    . SER A 1 360 ? -11.200 -3.660  31.966 1.00 31.23  ? 360  SER A OG    1 
ATOM   2990 N  N     . PRO A 1 361 ? -10.335 -5.961  34.552 1.00 26.99  ? 361  PRO A N     1 
ATOM   2991 C  CA    . PRO A 1 361 ? -10.775 -5.796  35.942 1.00 26.03  ? 361  PRO A CA    1 
ATOM   2992 C  C     . PRO A 1 361 ? -11.463 -4.445  36.121 1.00 26.99  ? 361  PRO A C     1 
ATOM   2993 O  O     . PRO A 1 361 ? -12.507 -4.357  36.780 1.00 27.61  ? 361  PRO A O     1 
ATOM   2994 C  CB    . PRO A 1 361 ? -9.462  -5.818  36.733 1.00 26.82  ? 361  PRO A CB    1 
ATOM   2995 C  CG    . PRO A 1 361 ? -8.446  -6.444  35.815 1.00 24.20  ? 361  PRO A CG    1 
ATOM   2996 C  CD    . PRO A 1 361 ? -8.870  -6.090  34.437 1.00 26.34  ? 361  PRO A CD    1 
ATOM   2997 N  N     . ILE A 1 362 ? -10.883 -3.413  35.504 1.00 26.06  ? 362  ILE A N     1 
ATOM   2998 C  CA    . ILE A 1 362 ? -11.442 -2.063  35.490 1.00 23.87  ? 362  ILE A CA    1 
ATOM   2999 C  C     . ILE A 1 362 ? -12.876 -2.032  34.945 1.00 24.39  ? 362  ILE A C     1 
ATOM   3000 O  O     . ILE A 1 362 ? -13.779 -1.491  35.591 1.00 26.46  ? 362  ILE A O     1 
ATOM   3001 C  CB    . ILE A 1 362 ? -10.507 -1.081  34.738 1.00 22.41  ? 362  ILE A CB    1 
ATOM   3002 C  CG1   . ILE A 1 362 ? -9.291  -0.785  35.605 1.00 20.04  ? 362  ILE A CG1   1 
ATOM   3003 C  CG2   . ILE A 1 362 ? -11.208 0.224   34.393 1.00 22.39  ? 362  ILE A CG2   1 
ATOM   3004 C  CD1   . ILE A 1 362 ? -8.376  0.303   35.062 1.00 20.55  ? 362  ILE A CD1   1 
ATOM   3005 N  N     . LYS A 1 363 ? -13.094 -2.634  33.782 1.00 23.44  ? 363  LYS A N     1 
ATOM   3006 C  CA    . LYS A 1 363 ? -14.448 -2.719  33.241 1.00 25.28  ? 363  LYS A CA    1 
ATOM   3007 C  C     . LYS A 1 363 ? -15.357 -3.533  34.152 1.00 24.60  ? 363  LYS A C     1 
ATOM   3008 O  O     . LYS A 1 363 ? -16.495 -3.159  34.408 1.00 26.80  ? 363  LYS A O     1 
ATOM   3009 C  CB    . LYS A 1 363 ? -14.445 -3.325  31.840 1.00 25.16  ? 363  LYS A CB    1 
ATOM   3010 C  CG    . LYS A 1 363 ? -15.821 -3.402  31.198 1.00 29.60  ? 363  LYS A CG    1 
ATOM   3011 C  CD    . LYS A 1 363 ? -16.379 -2.017  30.861 1.00 35.89  ? 363  LYS A CD    1 
ATOM   3012 C  CE    . LYS A 1 363 ? -15.667 -1.389  29.668 1.00 38.36  ? 363  LYS A CE    1 
ATOM   3013 N  NZ    . LYS A 1 363 ? -16.419 -0.199  29.221 1.00 41.70  ? 363  LYS A NZ    1 
ATOM   3014 N  N     . THR A 1 364 ? -14.839 -4.655  34.630 1.00 25.39  ? 364  THR A N     1 
ATOM   3015 C  CA    . THR A 1 364 ? -15.575 -5.548  35.505 1.00 24.83  ? 364  THR A CA    1 
ATOM   3016 C  C     . THR A 1 364 ? -16.051 -4.803  36.748 1.00 25.12  ? 364  THR A C     1 
ATOM   3017 O  O     . THR A 1 364 ? -17.237 -4.794  37.036 1.00 26.15  ? 364  THR A O     1 
ATOM   3018 C  CB    . THR A 1 364 ? -14.705 -6.791  35.855 1.00 24.26  ? 364  THR A CB    1 
ATOM   3019 O  OG1   . THR A 1 364 ? -14.448 -7.511  34.644 1.00 22.96  ? 364  THR A OG1   1 
ATOM   3020 C  CG2   . THR A 1 364 ? -15.412 -7.707  36.824 1.00 23.06  ? 364  THR A CG2   1 
ATOM   3021 N  N     . TRP A 1 365 ? -15.133 -4.145  37.453 1.00 26.01  ? 365  TRP A N     1 
ATOM   3022 C  CA    . TRP A 1 365 ? -15.506 -3.388  38.641 1.00 27.40  ? 365  TRP A CA    1 
ATOM   3023 C  C     . TRP A 1 365 ? -16.384 -2.169  38.384 1.00 28.54  ? 365  TRP A C     1 
ATOM   3024 O  O     . TRP A 1 365 ? -17.260 -1.866  39.204 1.00 30.51  ? 365  TRP A O     1 
ATOM   3025 C  CB    . TRP A 1 365 ? -14.285 -3.003  39.463 1.00 27.35  ? 365  TRP A CB    1 
ATOM   3026 C  CG    . TRP A 1 365 ? -13.694 -4.170  40.192 1.00 25.99  ? 365  TRP A CG    1 
ATOM   3027 C  CD1   . TRP A 1 365 ? -12.498 -4.758  39.948 1.00 22.03  ? 365  TRP A CD1   1 
ATOM   3028 C  CD2   . TRP A 1 365 ? -14.285 -4.894  41.276 1.00 23.94  ? 365  TRP A CD2   1 
ATOM   3029 N  NE1   . TRP A 1 365 ? -12.297 -5.796  40.814 1.00 27.15  ? 365  TRP A NE1   1 
ATOM   3030 C  CE2   . TRP A 1 365 ? -13.385 -5.908  41.635 1.00 24.43  ? 365  TRP A CE2   1 
ATOM   3031 C  CE3   . TRP A 1 365 ? -15.493 -4.784  41.973 1.00 25.35  ? 365  TRP A CE3   1 
ATOM   3032 C  CZ2   . TRP A 1 365 ? -13.640 -6.799  42.671 1.00 25.59  ? 365  TRP A CZ2   1 
ATOM   3033 C  CZ3   . TRP A 1 365 ? -15.748 -5.672  42.995 1.00 21.40  ? 365  TRP A CZ3   1 
ATOM   3034 C  CH2   . TRP A 1 365 ? -14.829 -6.665  43.333 1.00 25.71  ? 365  TRP A CH2   1 
ATOM   3035 N  N     . ASP A 1 366 ? -16.155 -1.466  37.272 1.00 26.81  ? 366  ASP A N     1 
ATOM   3036 C  CA    . ASP A 1 366 ? -17.031 -0.350  36.901 1.00 26.17  ? 366  ASP A CA    1 
ATOM   3037 C  C     . ASP A 1 366 ? -18.491 -0.813  36.817 1.00 26.20  ? 366  ASP A C     1 
ATOM   3038 O  O     . ASP A 1 366 ? -19.389 -0.164  37.364 1.00 29.32  ? 366  ASP A O     1 
ATOM   3039 C  CB    . ASP A 1 366 ? -16.583 0.327   35.596 1.00 26.23  ? 366  ASP A CB    1 
ATOM   3040 C  CG    . ASP A 1 366 ? -17.236 1.697   35.386 1.00 27.71  ? 366  ASP A CG    1 
ATOM   3041 O  OD1   . ASP A 1 366 ? -17.318 2.482   36.354 1.00 26.51  ? 366  ASP A OD1   1 
ATOM   3042 O  OD2   . ASP A 1 366 ? -17.673 1.997   34.249 1.00 32.03  ? 366  ASP A OD2   1 
ATOM   3043 N  N     . ALA A 1 367 ? -18.718 -1.956  36.174 1.00 25.76  ? 367  ALA A N     1 
ATOM   3044 C  CA    . ALA A 1 367 ? -20.055 -2.529  36.082 1.00 24.77  ? 367  ALA A CA    1 
ATOM   3045 C  C     . ALA A 1 367 ? -20.605 -2.984  37.425 1.00 27.04  ? 367  ALA A C     1 
ATOM   3046 O  O     . ALA A 1 367 ? -21.773 -2.714  37.739 1.00 29.47  ? 367  ALA A O     1 
ATOM   3047 C  CB    . ALA A 1 367 ? -20.063 -3.668  35.112 1.00 25.64  ? 367  ALA A CB    1 
ATOM   3048 N  N     . ILE A 1 368 ? -19.785 -3.682  38.215 1.00 27.34  ? 368  ILE A N     1 
ATOM   3049 C  CA    . ILE A 1 368 ? -20.256 -4.190  39.509 1.00 27.16  ? 368  ILE A CA    1 
ATOM   3050 C  C     . ILE A 1 368 ? -20.703 -3.027  40.379 1.00 29.47  ? 368  ILE A C     1 
ATOM   3051 O  O     . ILE A 1 368 ? -21.852 -3.001  40.834 1.00 32.70  ? 368  ILE A O     1 
ATOM   3052 C  CB    . ILE A 1 368 ? -19.216 -5.040  40.256 1.00 26.58  ? 368  ILE A CB    1 
ATOM   3053 C  CG1   . ILE A 1 368 ? -18.883 -6.303  39.462 1.00 25.54  ? 368  ILE A CG1   1 
ATOM   3054 C  CG2   . ILE A 1 368 ? -19.737 -5.409  41.652 1.00 23.67  ? 368  ILE A CG2   1 
ATOM   3055 C  CD1   . ILE A 1 368 ? -17.599 -7.013  39.926 1.00 29.81  ? 368  ILE A CD1   1 
ATOM   3056 N  N     . ILE A 1 369 ? -19.810 -2.055  40.564 1.00 27.30  ? 369  ILE A N     1 
ATOM   3057 C  CA    . ILE A 1 369 ? -20.095 -0.858  41.364 1.00 27.31  ? 369  ILE A CA    1 
ATOM   3058 C  C     . ILE A 1 369 ? -21.294 -0.048  40.824 1.00 28.57  ? 369  ILE A C     1 
ATOM   3059 O  O     . ILE A 1 369 ? -22.142 0.418   41.597 1.00 27.80  ? 369  ILE A O     1 
ATOM   3060 C  CB    . ILE A 1 369 ? -18.829 0.028   41.503 1.00 28.66  ? 369  ILE A CB    1 
ATOM   3061 C  CG1   . ILE A 1 369 ? -17.747 -0.718  42.303 1.00 27.64  ? 369  ILE A CG1   1 
ATOM   3062 C  CG2   . ILE A 1 369 ? -19.162 1.358   42.164 1.00 26.23  ? 369  ILE A CG2   1 
ATOM   3063 C  CD1   . ILE A 1 369 ? -16.344 -0.204  42.081 1.00 24.85  ? 369  ILE A CD1   1 
ATOM   3064 N  N     . PHE A 1 370 ? -21.376 0.106   39.504 1.00 27.34  ? 370  PHE A N     1 
ATOM   3065 C  CA    . PHE A 1 370 ? -22.513 0.804   38.910 1.00 26.41  ? 370  PHE A CA    1 
ATOM   3066 C  C     . PHE A 1 370 ? -23.827 0.107   39.276 1.00 26.77  ? 370  PHE A C     1 
ATOM   3067 O  O     . PHE A 1 370 ? -24.765 0.747   39.768 1.00 26.48  ? 370  PHE A O     1 
ATOM   3068 C  CB    . PHE A 1 370 ? -22.332 0.954   37.388 1.00 26.21  ? 370  PHE A CB    1 
ATOM   3069 C  CG    . PHE A 1 370 ? -23.624 1.122   36.614 1.00 28.22  ? 370  PHE A CG    1 
ATOM   3070 C  CD1   . PHE A 1 370 ? -23.979 0.197   35.628 1.00 28.04  ? 370  PHE A CD1   1 
ATOM   3071 C  CD2   . PHE A 1 370 ? -24.483 2.194   36.864 1.00 25.34  ? 370  PHE A CD2   1 
ATOM   3072 C  CE1   . PHE A 1 370 ? -25.170 0.341   34.896 1.00 27.07  ? 370  PHE A CE1   1 
ATOM   3073 C  CE2   . PHE A 1 370 ? -25.678 2.342   36.146 1.00 25.68  ? 370  PHE A CE2   1 
ATOM   3074 C  CZ    . PHE A 1 370 ? -26.020 1.413   35.162 1.00 26.57  ? 370  PHE A CZ    1 
ATOM   3075 N  N     . ASN A 1 371 ? -23.886 -1.203  39.059 1.00 27.00  ? 371  ASN A N     1 
ATOM   3076 C  CA    . ASN A 1 371 ? -25.107 -1.956  39.339 1.00 27.53  ? 371  ASN A CA    1 
ATOM   3077 C  C     . ASN A 1 371 ? -25.483 -1.918  40.805 1.00 29.48  ? 371  ASN A C     1 
ATOM   3078 O  O     . ASN A 1 371 ? -26.674 -1.959  41.150 1.00 32.76  ? 371  ASN A O     1 
ATOM   3079 C  CB    . ASN A 1 371 ? -24.975 -3.397  38.897 1.00 25.43  ? 371  ASN A CB    1 
ATOM   3080 C  CG    . ASN A 1 371 ? -25.217 -3.563  37.442 1.00 27.30  ? 371  ASN A CG    1 
ATOM   3081 O  OD1   . ASN A 1 371 ? -26.361 -3.566  36.994 1.00 28.02  ? 371  ASN A OD1   1 
ATOM   3082 N  ND2   . ASN A 1 371 ? -24.135 -3.697  36.672 1.00 29.07  ? 371  ASN A ND2   1 
ATOM   3083 N  N     . SER A 1 372 ? -24.468 -1.837  41.660 1.00 26.64  ? 372  SER A N     1 
ATOM   3084 C  CA    . SER A 1 372 ? -24.696 -1.794  43.086 1.00 28.30  ? 372  SER A CA    1 
ATOM   3085 C  C     . SER A 1 372 ? -25.306 -0.456  43.475 1.00 28.00  ? 372  SER A C     1 
ATOM   3086 O  O     . SER A 1 372 ? -26.320 -0.421  44.162 1.00 29.04  ? 372  SER A O     1 
ATOM   3087 C  CB    . SER A 1 372 ? -23.406 -2.050  43.858 1.00 27.10  ? 372  SER A CB    1 
ATOM   3088 O  OG    . SER A 1 372 ? -23.684 -2.190  45.235 1.00 27.58  ? 372  SER A OG    1 
ATOM   3089 N  N     . LEU A 1 373 ? -24.685 0.630   43.020 1.00 28.41  ? 373  LEU A N     1 
ATOM   3090 C  CA    . LEU A 1 373 ? -25.140 1.982   43.319 1.00 29.45  ? 373  LEU A CA    1 
ATOM   3091 C  C     . LEU A 1 373 ? -26.514 2.271   42.729 1.00 32.95  ? 373  LEU A C     1 
ATOM   3092 O  O     . LEU A 1 373 ? -27.344 2.915   43.384 1.00 35.64  ? 373  LEU A O     1 
ATOM   3093 C  CB    . LEU A 1 373 ? -24.120 3.022   42.850 1.00 27.24  ? 373  LEU A CB    1 
ATOM   3094 C  CG    . LEU A 1 373 ? -22.749 2.992   43.541 1.00 24.60  ? 373  LEU A CG    1 
ATOM   3095 C  CD1   . LEU A 1 373 ? -21.753 3.815   42.762 1.00 21.75  ? 373  LEU A CD1   1 
ATOM   3096 C  CD2   . LEU A 1 373 ? -22.824 3.504   44.964 1.00 23.55  ? 373  LEU A CD2   1 
ATOM   3097 N  N     . LYS A 1 374 ? -26.765 1.781   41.515 1.00 32.84  ? 374  LYS A N     1 
ATOM   3098 C  CA    . LYS A 1 374 ? -28.080 1.953   40.883 1.00 35.48  ? 374  LYS A CA    1 
ATOM   3099 C  C     . LYS A 1 374 ? -29.238 1.345   41.696 1.00 36.24  ? 374  LYS A C     1 
ATOM   3100 O  O     . LYS A 1 374 ? -30.339 1.891   41.710 1.00 34.95  ? 374  LYS A O     1 
ATOM   3101 C  CB    . LYS A 1 374 ? -28.082 1.423   39.441 1.00 35.99  ? 374  LYS A CB    1 
ATOM   3102 C  CG    . LYS A 1 374 ? -29.461 1.336   38.818 1.00 36.27  ? 374  LYS A CG    1 
ATOM   3103 C  CD    . LYS A 1 374 ? -29.385 0.986   37.358 1.00 42.65  ? 374  LYS A CD    1 
ATOM   3104 C  CE    . LYS A 1 374 ? -30.688 0.360   36.882 1.00 42.76  ? 374  LYS A CE    1 
ATOM   3105 N  NZ    . LYS A 1 374 ? -30.736 -1.099  37.177 1.00 45.64  ? 374  LYS A NZ    1 
ATOM   3106 N  N     . GLU A 1 375 ? -28.980 0.226   42.373 1.00 38.54  ? 375  GLU A N     1 
ATOM   3107 C  CA    . GLU A 1 375 ? -29.984 -0.423  43.205 1.00 41.70  ? 375  GLU A CA    1 
ATOM   3108 C  C     . GLU A 1 375 ? -30.487 0.509   44.305 1.00 41.53  ? 375  GLU A C     1 
ATOM   3109 O  O     . GLU A 1 375 ? -31.649 0.427   44.709 1.00 41.40  ? 375  GLU A O     1 
ATOM   3110 C  CB    . GLU A 1 375 ? -29.438 -1.718  43.819 1.00 45.37  ? 375  GLU A CB    1 
ATOM   3111 C  CG    . GLU A 1 375 ? -29.548 -2.951  42.917 1.00 54.21  ? 375  GLU A CG    1 
ATOM   3112 C  CD    . GLU A 1 375 ? -30.972 -3.517  42.824 1.00 64.56  ? 375  GLU A CD    1 
ATOM   3113 O  OE1   . GLU A 1 375 ? -31.641 -3.676  43.876 1.00 68.64  ? 375  GLU A OE1   1 
ATOM   3114 O  OE2   . GLU A 1 375 ? -31.418 -3.824  41.692 1.00 67.84  ? 375  GLU A OE2   1 
ATOM   3115 N  N     . GLN A 1 376 ? -29.607 1.388   44.782 1.00 40.06  ? 376  GLN A N     1 
ATOM   3116 C  CA    . GLN A 1 376 ? -29.953 2.371   45.807 1.00 40.34  ? 376  GLN A CA    1 
ATOM   3117 C  C     . GLN A 1 376 ? -30.293 3.737   45.202 1.00 40.31  ? 376  GLN A C     1 
ATOM   3118 O  O     . GLN A 1 376 ? -30.327 4.742   45.914 1.00 41.85  ? 376  GLN A O     1 
ATOM   3119 C  CB    . GLN A 1 376 ? -28.802 2.556   46.790 1.00 40.42  ? 376  GLN A CB    1 
ATOM   3120 C  CG    . GLN A 1 376 ? -28.114 1.294   47.276 1.00 48.29  ? 376  GLN A CG    1 
ATOM   3121 C  CD    . GLN A 1 376 ? -26.796 1.616   47.977 1.00 54.76  ? 376  GLN A CD    1 
ATOM   3122 O  OE1   . GLN A 1 376 ? -25.728 1.185   47.541 1.00 59.30  ? 376  GLN A OE1   1 
ATOM   3123 N  NE2   . GLN A 1 376 ? -26.864 2.407   49.046 1.00 56.03  ? 376  GLN A NE2   1 
ATOM   3124 N  N     . ASN A 1 377 ? -30.533 3.769   43.892 1.00 39.01  ? 377  ASN A N     1 
ATOM   3125 C  CA    . ASN A 1 377 ? -30.847 5.000   43.158 1.00 38.60  ? 377  ASN A CA    1 
ATOM   3126 C  C     . ASN A 1 377 ? -29.714 6.017   43.142 1.00 38.89  ? 377  ASN A C     1 
ATOM   3127 O  O     . ASN A 1 377 ? -29.948 7.213   42.889 1.00 38.98  ? 377  ASN A O     1 
ATOM   3128 C  CB    . ASN A 1 377 ? -32.125 5.667   43.691 1.00 39.24  ? 377  ASN A CB    1 
ATOM   3129 C  CG    . ASN A 1 377 ? -33.380 4.912   43.326 1.00 38.49  ? 377  ASN A CG    1 
ATOM   3130 O  OD1   . ASN A 1 377 ? -33.479 4.317   42.247 1.00 39.24  ? 377  ASN A OD1   1 
ATOM   3131 N  ND2   . ASN A 1 377 ? -34.359 4.942   44.224 1.00 35.03  ? 377  ASN A ND2   1 
ATOM   3132 N  N     . LYS A 1 378 ? -28.496 5.550   43.413 1.00 37.04  ? 378  LYS A N     1 
ATOM   3133 C  CA    . LYS A 1 378 ? -27.338 6.435   43.437 1.00 35.80  ? 378  LYS A CA    1 
ATOM   3134 C  C     . LYS A 1 378 ? -26.804 6.638   42.032 1.00 33.51  ? 378  LYS A C     1 
ATOM   3135 O  O     . LYS A 1 378 ? -26.979 5.786   41.166 1.00 33.35  ? 378  LYS A O     1 
ATOM   3136 C  CB    . LYS A 1 378 ? -26.257 5.899   44.366 1.00 37.26  ? 378  LYS A CB    1 
ATOM   3137 C  CG    . LYS A 1 378 ? -26.778 5.587   45.751 1.00 39.90  ? 378  LYS A CG    1 
ATOM   3138 C  CD    . LYS A 1 378 ? -25.781 5.984   46.814 1.00 43.94  ? 378  LYS A CD    1 
ATOM   3139 C  CE    . LYS A 1 378 ? -26.367 5.791   48.197 1.00 48.97  ? 378  LYS A CE    1 
ATOM   3140 N  NZ    . LYS A 1 378 ? -25.717 6.714   49.161 1.00 52.70  ? 378  LYS A NZ    1 
ATOM   3141 N  N     . VAL A 1 379 ? -26.173 7.786   41.814 1.00 32.44  ? 379  VAL A N     1 
ATOM   3142 C  CA    . VAL A 1 379 ? -25.696 8.193   40.492 1.00 30.44  ? 379  VAL A CA    1 
ATOM   3143 C  C     . VAL A 1 379 ? -24.167 8.258   40.452 1.00 28.34  ? 379  VAL A C     1 
ATOM   3144 O  O     . VAL A 1 379 ? -23.544 8.969   41.240 1.00 29.11  ? 379  VAL A O     1 
ATOM   3145 C  CB    . VAL A 1 379 ? -26.336 9.541   40.083 1.00 29.05  ? 379  VAL A CB    1 
ATOM   3146 C  CG1   . VAL A 1 379 ? -25.691 10.088  38.873 1.00 25.59  ? 379  VAL A CG1   1 
ATOM   3147 C  CG2   . VAL A 1 379 ? -27.820 9.351   39.828 1.00 30.03  ? 379  VAL A CG2   1 
ATOM   3148 N  N     . ILE A 1 380 ? -23.578 7.510   39.521 1.00 27.43  ? 380  ILE A N     1 
ATOM   3149 C  CA    . ILE A 1 380 ? -22.128 7.336   39.448 1.00 27.11  ? 380  ILE A CA    1 
ATOM   3150 C  C     . ILE A 1 380 ? -21.414 8.570   38.872 1.00 28.48  ? 380  ILE A C     1 
ATOM   3151 O  O     . ILE A 1 380 ? -21.974 9.270   38.023 1.00 29.55  ? 380  ILE A O     1 
ATOM   3152 C  CB    . ILE A 1 380 ? -21.725 6.041   38.663 1.00 28.59  ? 380  ILE A CB    1 
ATOM   3153 C  CG1   . ILE A 1 380 ? -22.029 6.168   37.160 1.00 26.90  ? 380  ILE A CG1   1 
ATOM   3154 C  CG2   . ILE A 1 380 ? -22.369 4.797   39.290 1.00 26.38  ? 380  ILE A CG2   1 
ATOM   3155 C  CD1   . ILE A 1 380 ? -21.441 5.059   36.294 1.00 21.42  ? 380  ILE A CD1   1 
ATOM   3156 N  N     . PRO A 1 381 ? -20.176 8.835   39.332 1.00 27.67  ? 381  PRO A N     1 
ATOM   3157 C  CA    . PRO A 1 381 ? -19.439 10.010  38.872 1.00 28.00  ? 381  PRO A CA    1 
ATOM   3158 C  C     . PRO A 1 381 ? -18.971 9.899   37.428 1.00 28.11  ? 381  PRO A C     1 
ATOM   3159 O  O     . PRO A 1 381 ? -18.806 8.796   36.914 1.00 29.00  ? 381  PRO A O     1 
ATOM   3160 C  CB    . PRO A 1 381 ? -18.212 10.063  39.801 1.00 30.00  ? 381  PRO A CB    1 
ATOM   3161 C  CG    . PRO A 1 381 ? -18.276 8.872   40.693 1.00 29.24  ? 381  PRO A CG    1 
ATOM   3162 C  CD    . PRO A 1 381 ? -19.366 7.972   40.211 1.00 28.09  ? 381  PRO A CD    1 
ATOM   3163 N  N     . GLN A 1 382 ? -18.767 11.038  36.779 1.00 29.25  ? 382  GLN A N     1 
ATOM   3164 C  CA    . GLN A 1 382 ? -18.110 11.052  35.484 1.00 32.58  ? 382  GLN A CA    1 
ATOM   3165 C  C     . GLN A 1 382 ? -16.622 10.725  35.656 1.00 33.62  ? 382  GLN A C     1 
ATOM   3166 O  O     . GLN A 1 382 ? -15.952 11.223  36.584 1.00 33.00  ? 382  GLN A O     1 
ATOM   3167 C  CB    . GLN A 1 382 ? -18.283 12.417  34.809 1.00 35.46  ? 382  GLN A CB    1 
ATOM   3168 C  CG    . GLN A 1 382 ? -17.827 12.483  33.333 1.00 38.43  ? 382  GLN A CG    1 
ATOM   3169 C  CD    . GLN A 1 382 ? -18.020 13.869  32.693 1.00 41.09  ? 382  GLN A CD    1 
ATOM   3170 O  OE1   . GLN A 1 382 ? -18.188 14.878  33.384 1.00 39.43  ? 382  GLN A OE1   1 
ATOM   3171 N  NE2   . GLN A 1 382 ? -17.986 13.914  31.362 1.00 42.08  ? 382  GLN A NE2   1 
ATOM   3172 N  N     . GLY A 1 383 ? -16.121 9.868   34.775 1.00 32.64  ? 383  GLY A N     1 
ATOM   3173 C  CA    . GLY A 1 383 ? -14.693 9.601   34.704 1.00 35.53  ? 383  GLY A CA    1 
ATOM   3174 C  C     . GLY A 1 383 ? -13.962 10.890  34.379 1.00 37.88  ? 383  GLY A C     1 
ATOM   3175 O  O     . GLY A 1 383 ? -14.435 11.688  33.563 1.00 36.83  ? 383  GLY A O     1 
ATOM   3176 N  N     . ARG A 1 384 ? -12.830 11.112  35.040 1.00 39.27  ? 384  ARG A N     1 
ATOM   3177 C  CA    . ARG A 1 384 ? -12.043 12.315  34.802 1.00 42.54  ? 384  ARG A CA    1 
ATOM   3178 C  C     . ARG A 1 384 ? -10.676 11.932  34.271 1.00 42.34  ? 384  ARG A C     1 
ATOM   3179 O  O     . ARG A 1 384 ? -10.239 10.789  34.403 1.00 42.03  ? 384  ARG A O     1 
ATOM   3180 C  CB    . ARG A 1 384 ? -11.914 13.190  36.063 1.00 44.71  ? 384  ARG A CB    1 
ATOM   3181 C  CG    . ARG A 1 384 ? -13.190 13.322  36.888 1.00 51.27  ? 384  ARG A CG    1 
ATOM   3182 C  CD    . ARG A 1 384 ? -13.351 14.710  37.484 1.00 61.03  ? 384  ARG A CD    1 
ATOM   3183 N  NE    . ARG A 1 384 ? -14.006 15.634  36.546 1.00 69.41  ? 384  ARG A NE    1 
ATOM   3184 C  CZ    . ARG A 1 384 ? -15.307 15.943  36.542 1.00 69.93  ? 384  ARG A CZ    1 
ATOM   3185 N  NH1   . ARG A 1 384 ? -16.143 15.410  37.428 1.00 67.79  ? 384  ARG A NH1   1 
ATOM   3186 N  NH2   . ARG A 1 384 ? -15.777 16.795  35.638 1.00 70.47  ? 384  ARG A NH2   1 
ATOM   3187 N  N     . SER A 1 385 ? -10.017 12.892  33.642 1.00 43.86  ? 385  SER A N     1 
ATOM   3188 C  CA    . SER A 1 385 ? -8.647  12.706  33.219 1.00 44.79  ? 385  SER A CA    1 
ATOM   3189 C  C     . SER A 1 385 ? -7.749  12.902  34.436 1.00 42.77  ? 385  SER A C     1 
ATOM   3190 O  O     . SER A 1 385 ? -8.045  13.735  35.300 1.00 43.23  ? 385  SER A O     1 
ATOM   3191 C  CB    . SER A 1 385 ? -8.295  13.705  32.116 1.00 45.99  ? 385  SER A CB    1 
ATOM   3192 O  OG    . SER A 1 385 ? -7.271  13.190  31.283 1.00 51.85  ? 385  SER A OG    1 
ATOM   3193 N  N     . HIS A 1 386 ? -6.678  12.112  34.512 1.00 40.72  ? 386  HIS A N     1 
ATOM   3194 C  CA    . HIS A 1 386 ? -5.667  12.240  35.570 1.00 38.02  ? 386  HIS A CA    1 
ATOM   3195 C  C     . HIS A 1 386 ? -4.268  12.022  35.023 1.00 36.14  ? 386  HIS A C     1 
ATOM   3196 O  O     . HIS A 1 386 ? -4.055  11.128  34.201 1.00 34.55  ? 386  HIS A O     1 
ATOM   3197 C  CB    . HIS A 1 386 ? -5.911  11.232  36.696 1.00 37.69  ? 386  HIS A CB    1 
ATOM   3198 C  CG    . HIS A 1 386 ? -7.295  11.280  37.260 1.00 37.72  ? 386  HIS A CG    1 
ATOM   3199 N  ND1   . HIS A 1 386 ? -7.685  12.220  38.190 1.00 36.74  ? 386  HIS A ND1   1 
ATOM   3200 C  CD2   . HIS A 1 386 ? -8.388  10.518  37.009 1.00 33.43  ? 386  HIS A CD2   1 
ATOM   3201 C  CE1   . HIS A 1 386 ? -8.956  12.025  38.499 1.00 37.42  ? 386  HIS A CE1   1 
ATOM   3202 N  NE2   . HIS A 1 386 ? -9.404  10.998  37.798 1.00 37.25  ? 386  HIS A NE2   1 
ATOM   3203 N  N     . PRO A 1 387 ? -3.298  12.829  35.481 1.00 36.80  ? 387  PRO A N     1 
ATOM   3204 C  CA    . PRO A 1 387 ? -1.908  12.523  35.113 1.00 37.60  ? 387  PRO A CA    1 
ATOM   3205 C  C     . PRO A 1 387 ? -1.421  11.300  35.882 1.00 36.74  ? 387  PRO A C     1 
ATOM   3206 O  O     . PRO A 1 387 ? -1.762  11.151  37.051 1.00 35.98  ? 387  PRO A O     1 
ATOM   3207 C  CB    . PRO A 1 387 ? -1.140  13.768  35.567 1.00 36.55  ? 387  PRO A CB    1 
ATOM   3208 C  CG    . PRO A 1 387 ? -1.979  14.361  36.654 1.00 39.29  ? 387  PRO A CG    1 
ATOM   3209 C  CD    . PRO A 1 387 ? -3.409  14.037  36.325 1.00 36.12  ? 387  PRO A CD    1 
ATOM   3210 N  N     . VAL A 1 388 ? -0.646  10.433  35.233 1.00 37.91  ? 388  VAL A N     1 
ATOM   3211 C  CA    . VAL A 1 388 ? -0.045  9.280   35.914 1.00 39.08  ? 388  VAL A CA    1 
ATOM   3212 C  C     . VAL A 1 388 ? 0.998   9.722   36.947 1.00 40.79  ? 388  VAL A C     1 
ATOM   3213 O  O     . VAL A 1 388 ? 1.975   10.401  36.604 1.00 41.15  ? 388  VAL A O     1 
ATOM   3214 C  CB    . VAL A 1 388 ? 0.602   8.275   34.918 1.00 40.79  ? 388  VAL A CB    1 
ATOM   3215 C  CG1   . VAL A 1 388 ? 1.348   7.168   35.671 1.00 39.78  ? 388  VAL A CG1   1 
ATOM   3216 C  CG2   . VAL A 1 388 ? -0.452  7.661   33.995 1.00 38.51  ? 388  VAL A CG2   1 
ATOM   3217 N  N     . GLN A 1 389 ? 0.764   9.351   38.209 1.00 41.10  ? 389  GLN A N     1 
ATOM   3218 C  CA    . GLN A 1 389 ? 1.739   9.563   39.294 1.00 42.83  ? 389  GLN A CA    1 
ATOM   3219 C  C     . GLN A 1 389 ? 2.125   8.236   39.959 1.00 42.08  ? 389  GLN A C     1 
ATOM   3220 O  O     . GLN A 1 389 ? 1.257   7.407   40.266 1.00 40.72  ? 389  GLN A O     1 
ATOM   3221 C  CB    . GLN A 1 389 ? 1.211   10.530  40.366 1.00 42.30  ? 389  GLN A CB    1 
ATOM   3222 C  CG    . GLN A 1 389 ? 0.556   11.798  39.839 1.00 47.30  ? 389  GLN A CG    1 
ATOM   3223 C  CD    . GLN A 1 389 ? 0.150   12.759  40.953 1.00 51.58  ? 389  GLN A CD    1 
ATOM   3224 O  OE1   . GLN A 1 389 ? -1.042  13.050  41.150 1.00 47.69  ? 389  GLN A OE1   1 
ATOM   3225 N  NE2   . GLN A 1 389 ? 1.144   13.253  41.693 1.00 53.68  ? 389  GLN A NE2   1 
ATOM   3226 N  N     . PRO A 1 390 ? 3.434   8.023   40.171 1.00 33.86  ? 390  PRO A N     1 
ATOM   3227 C  CA    . PRO A 1 390 ? 3.908   6.887   40.968 1.00 32.84  ? 390  PRO A CA    1 
ATOM   3228 C  C     . PRO A 1 390 ? 3.447   7.044   42.408 1.00 32.03  ? 390  PRO A C     1 
ATOM   3229 O  O     . PRO A 1 390 ? 3.204   8.166   42.853 1.00 31.19  ? 390  PRO A O     1 
ATOM   3230 C  CB    . PRO A 1 390 ? 5.442   7.021   40.901 1.00 34.78  ? 390  PRO A CB    1 
ATOM   3231 C  CG    . PRO A 1 390 ? 5.703   7.863   39.685 1.00 36.91  ? 390  PRO A CG    1 
ATOM   3232 C  CD    . PRO A 1 390 ? 4.548   8.818   39.621 1.00 34.37  ? 390  PRO A CD    1 
ATOM   3233 N  N     . TYR A 1 391 ? 3.316   5.933   43.126 1.00 31.41  ? 391  TYR A N     1 
ATOM   3234 C  CA    . TYR A 1 391 ? 2.955   5.970   44.544 1.00 29.54  ? 391  TYR A CA    1 
ATOM   3235 C  C     . TYR A 1 391 ? 3.548   4.750   45.246 1.00 28.80  ? 391  TYR A C     1 
ATOM   3236 O  O     . TYR A 1 391 ? 3.913   3.802   44.580 1.00 32.44  ? 391  TYR A O     1 
ATOM   3237 C  CB    . TYR A 1 391 ? 1.432   6.090   44.725 1.00 30.56  ? 391  TYR A CB    1 
ATOM   3238 C  CG    . TYR A 1 391 ? 0.626   4.894   44.281 1.00 29.30  ? 391  TYR A CG    1 
ATOM   3239 C  CD1   . TYR A 1 391 ? 0.284   4.706   42.935 1.00 28.53  ? 391  TYR A CD1   1 
ATOM   3240 C  CD2   . TYR A 1 391 ? 0.184   3.956   45.211 1.00 27.82  ? 391  TYR A CD2   1 
ATOM   3241 C  CE1   . TYR A 1 391 ? -0.467  3.594   42.532 1.00 27.69  ? 391  TYR A CE1   1 
ATOM   3242 C  CE2   . TYR A 1 391 ? -0.559  2.849   44.822 1.00 27.85  ? 391  TYR A CE2   1 
ATOM   3243 C  CZ    . TYR A 1 391 ? -0.884  2.672   43.491 1.00 28.24  ? 391  TYR A CZ    1 
ATOM   3244 O  OH    . TYR A 1 391 ? -1.634  1.576   43.140 1.00 27.17  ? 391  TYR A OH    1 
ATOM   3245 N  N     . PRO A 1 392 ? 3.682   4.779   46.584 1.00 27.72  ? 392  PRO A N     1 
ATOM   3246 C  CA    . PRO A 1 392 ? 4.394   3.670   47.232 1.00 26.14  ? 392  PRO A CA    1 
ATOM   3247 C  C     . PRO A 1 392 ? 3.547   2.414   47.502 1.00 25.87  ? 392  PRO A C     1 
ATOM   3248 O  O     . PRO A 1 392 ? 2.337   2.493   47.736 1.00 23.74  ? 392  PRO A O     1 
ATOM   3249 C  CB    . PRO A 1 392 ? 4.870   4.289   48.554 1.00 26.74  ? 392  PRO A CB    1 
ATOM   3250 C  CG    . PRO A 1 392 ? 3.859   5.319   48.857 1.00 25.77  ? 392  PRO A CG    1 
ATOM   3251 C  CD    . PRO A 1 392 ? 3.364   5.862   47.537 1.00 25.69  ? 392  PRO A CD    1 
ATOM   3252 N  N     . GLY A 1 393 ? 4.215   1.266   47.479 1.00 26.37  ? 393  GLY A N     1 
ATOM   3253 C  CA    . GLY A 1 393 ? 3.572   -0.023  47.642 1.00 26.20  ? 393  GLY A CA    1 
ATOM   3254 C  C     . GLY A 1 393 ? 3.930   -0.678  48.957 1.00 26.22  ? 393  GLY A C     1 
ATOM   3255 O  O     . GLY A 1 393 ? 3.772   -0.080  50.015 1.00 26.91  ? 393  GLY A O     1 
ATOM   3256 N  N     . ALA A 1 394 ? 4.416   -1.911  48.897 1.00 25.39  ? 394  ALA A N     1 
ATOM   3257 C  CA    . ALA A 1 394 ? 4.614   -2.685  50.111 1.00 24.50  ? 394  ALA A CA    1 
ATOM   3258 C  C     . ALA A 1 394 ? 5.992   -2.501  50.741 1.00 25.75  ? 394  ALA A C     1 
ATOM   3259 O  O     . ALA A 1 394 ? 6.907   -1.914  50.138 1.00 23.82  ? 394  ALA A O     1 
ATOM   3260 C  CB    . ALA A 1 394 ? 4.356   -4.127  49.840 1.00 25.16  ? 394  ALA A CB    1 
ATOM   3261 N  N     . PHE A 1 395 ? 6.114   -2.994  51.972 1.00 24.79  ? 395  PHE A N     1 
ATOM   3262 C  CA    . PHE A 1 395 ? 7.385   -3.055  52.657 1.00 22.40  ? 395  PHE A CA    1 
ATOM   3263 C  C     . PHE A 1 395 ? 7.990   -4.419  52.448 1.00 22.95  ? 395  PHE A C     1 
ATOM   3264 O  O     . PHE A 1 395 ? 7.296   -5.435  52.497 1.00 23.43  ? 395  PHE A O     1 
ATOM   3265 C  CB    . PHE A 1 395 ? 7.212   -2.811  54.159 1.00 23.56  ? 395  PHE A CB    1 
ATOM   3266 C  CG    . PHE A 1 395 ? 8.509   -2.884  54.939 1.00 24.99  ? 395  PHE A CG    1 
ATOM   3267 C  CD1   . PHE A 1 395 ? 9.482   -1.906  54.785 1.00 22.43  ? 395  PHE A CD1   1 
ATOM   3268 C  CD2   . PHE A 1 395 ? 8.758   -3.941  55.800 1.00 23.20  ? 395  PHE A CD2   1 
ATOM   3269 C  CE1   . PHE A 1 395 ? 10.673  -1.976  55.483 1.00 24.79  ? 395  PHE A CE1   1 
ATOM   3270 C  CE2   . PHE A 1 395 ? 9.955   -4.015  56.501 1.00 22.69  ? 395  PHE A CE2   1 
ATOM   3271 C  CZ    . PHE A 1 395 ? 10.906  -3.035  56.340 1.00 25.41  ? 395  PHE A CZ    1 
ATOM   3272 N  N     . VAL A 1 396 ? 9.300   -4.437  52.233 1.00 25.45  ? 396  VAL A N     1 
ATOM   3273 C  CA    . VAL A 1 396 ? 10.062  -5.675  52.192 1.00 24.82  ? 396  VAL A CA    1 
ATOM   3274 C  C     . VAL A 1 396 ? 11.283  -5.556  53.079 1.00 25.61  ? 396  VAL A C     1 
ATOM   3275 O  O     . VAL A 1 396 ? 12.134  -4.685  52.864 1.00 26.69  ? 396  VAL A O     1 
ATOM   3276 C  CB    . VAL A 1 396 ? 10.478  -6.033  50.769 1.00 25.04  ? 396  VAL A CB    1 
ATOM   3277 C  CG1   . VAL A 1 396 ? 11.270  -7.317  50.762 1.00 24.72  ? 396  VAL A CG1   1 
ATOM   3278 C  CG2   . VAL A 1 396 ? 9.236   -6.179  49.899 1.00 27.91  ? 396  VAL A CG2   1 
ATOM   3279 N  N     . LYS A 1 397 ? 11.350  -6.431  54.080 1.00 25.74  ? 397  LYS A N     1 
ATOM   3280 C  CA    . LYS A 1 397 ? 12.455  -6.464  55.035 1.00 25.61  ? 397  LYS A CA    1 
ATOM   3281 C  C     . LYS A 1 397 ? 13.683  -6.999  54.344 1.00 26.82  ? 397  LYS A C     1 
ATOM   3282 O  O     . LYS A 1 397 ? 13.603  -7.978  53.605 1.00 26.75  ? 397  LYS A O     1 
ATOM   3283 C  CB    . LYS A 1 397 ? 12.103  -7.369  56.217 1.00 26.66  ? 397  LYS A CB    1 
ATOM   3284 C  CG    . LYS A 1 397 ? 13.161  -7.434  57.288 1.00 26.69  ? 397  LYS A CG    1 
ATOM   3285 C  CD    . LYS A 1 397 ? 12.792  -8.427  58.358 1.00 28.28  ? 397  LYS A CD    1 
ATOM   3286 C  CE    . LYS A 1 397 ? 13.942  -8.622  59.339 1.00 28.47  ? 397  LYS A CE    1 
ATOM   3287 N  NZ    . LYS A 1 397 ? 14.185  -7.391  60.131 1.00 33.80  ? 397  LYS A NZ    1 
ATOM   3288 N  N     . GLU A 1 398 ? 14.819  -6.348  54.571 1.00 27.72  ? 398  GLU A N     1 
ATOM   3289 C  CA    . GLU A 1 398 ? 16.090  -6.860  54.084 1.00 26.75  ? 398  GLU A CA    1 
ATOM   3290 C  C     . GLU A 1 398 ? 16.478  -8.033  54.966 1.00 26.23  ? 398  GLU A C     1 
ATOM   3291 O  O     . GLU A 1 398 ? 16.676  -7.864  56.159 1.00 27.69  ? 398  GLU A O     1 
ATOM   3292 C  CB    . GLU A 1 398 ? 17.179  -5.782  54.145 1.00 27.76  ? 398  GLU A CB    1 
ATOM   3293 C  CG    . GLU A 1 398 ? 18.483  -6.182  53.439 1.00 31.76  ? 398  GLU A CG    1 
ATOM   3294 C  CD    . GLU A 1 398 ? 18.387  -6.053  51.926 1.00 33.28  ? 398  GLU A CD    1 
ATOM   3295 O  OE1   . GLU A 1 398 ? 18.109  -4.927  51.452 1.00 35.54  ? 398  GLU A OE1   1 
ATOM   3296 O  OE2   . GLU A 1 398 ? 18.583  -7.071  51.217 1.00 28.56  ? 398  GLU A OE2   1 
ATOM   3297 N  N     . PRO A 1 399 ? 16.587  -9.230  54.385 1.00 26.68  ? 399  PRO A N     1 
ATOM   3298 C  CA    . PRO A 1 399 ? 16.987  -10.378 55.197 1.00 26.97  ? 399  PRO A CA    1 
ATOM   3299 C  C     . PRO A 1 399 ? 18.507  -10.491 55.282 1.00 27.44  ? 399  PRO A C     1 
ATOM   3300 O  O     . PRO A 1 399 ? 19.203  -10.051 54.365 1.00 28.97  ? 399  PRO A O     1 
ATOM   3301 C  CB    . PRO A 1 399 ? 16.432  -11.562 54.404 1.00 28.04  ? 399  PRO A CB    1 
ATOM   3302 C  CG    . PRO A 1 399 ? 16.477  -11.099 52.954 1.00 27.96  ? 399  PRO A CG    1 
ATOM   3303 C  CD    . PRO A 1 399 ? 16.419  -9.578  52.960 1.00 26.28  ? 399  PRO A CD    1 
ATOM   3304 N  N     . ILE A 1 400 ? 19.017  -11.073 56.364 1.00 27.25  ? 400  ILE A N     1 
ATOM   3305 C  CA    . ILE A 1 400 ? 20.435  -11.420 56.438 1.00 27.53  ? 400  ILE A CA    1 
ATOM   3306 C  C     . ILE A 1 400 ? 20.673  -12.684 55.608 1.00 29.92  ? 400  ILE A C     1 
ATOM   3307 O  O     . ILE A 1 400 ? 20.095  -13.739 55.897 1.00 31.95  ? 400  ILE A O     1 
ATOM   3308 C  CB    . ILE A 1 400 ? 20.918  -11.634 57.892 1.00 28.08  ? 400  ILE A CB    1 
ATOM   3309 C  CG1   . ILE A 1 400 ? 20.731  -10.351 58.716 1.00 27.07  ? 400  ILE A CG1   1 
ATOM   3310 C  CG2   . ILE A 1 400 ? 22.396  -12.073 57.922 1.00 20.62  ? 400  ILE A CG2   1 
ATOM   3311 C  CD1   . ILE A 1 400 ? 20.653  -10.573 60.251 1.00 21.05  ? 400  ILE A CD1   1 
ATOM   3312 N  N     . PRO A 1 401 ? 21.514  -12.588 54.564 1.00 30.14  ? 401  PRO A N     1 
ATOM   3313 C  CA    . PRO A 1 401 ? 21.701  -13.780 53.747 1.00 29.46  ? 401  PRO A CA    1 
ATOM   3314 C  C     . PRO A 1 401 ? 22.319  -14.859 54.611 1.00 29.26  ? 401  PRO A C     1 
ATOM   3315 O  O     . PRO A 1 401 ? 23.305  -14.606 55.303 1.00 32.62  ? 401  PRO A O     1 
ATOM   3316 C  CB    . PRO A 1 401 ? 22.684  -13.329 52.655 1.00 28.60  ? 401  PRO A CB    1 
ATOM   3317 C  CG    . PRO A 1 401 ? 22.668  -11.831 52.690 1.00 32.01  ? 401  PRO A CG    1 
ATOM   3318 C  CD    . PRO A 1 401 ? 22.362  -11.469 54.119 1.00 32.23  ? 401  PRO A CD    1 
ATOM   3319 N  N     . ASN A 1 402 ? 21.722  -16.041 54.591 1.00 25.97  ? 402  ASN A N     1 
ATOM   3320 C  CA    . ASN A 1 402 ? 22.169  -17.127 55.443 1.00 24.49  ? 402  ASN A CA    1 
ATOM   3321 C  C     . ASN A 1 402 ? 21.380  -18.405 55.196 1.00 25.18  ? 402  ASN A C     1 
ATOM   3322 O  O     . ASN A 1 402 ? 20.449  -18.426 54.384 1.00 22.56  ? 402  ASN A O     1 
ATOM   3323 C  CB    . ASN A 1 402 ? 22.026  -16.734 56.908 1.00 22.40  ? 402  ASN A CB    1 
ATOM   3324 C  CG    . ASN A 1 402 ? 23.040  -17.404 57.777 1.00 24.52  ? 402  ASN A CG    1 
ATOM   3325 O  OD1   . ASN A 1 402 ? 23.779  -18.270 57.316 1.00 27.87  ? 402  ASN A OD1   1 
ATOM   3326 N  ND2   . ASN A 1 402 ? 23.101  -17.002 59.043 1.00 20.88  ? 402  ASN A ND2   1 
ATOM   3327 N  N     . ARG A 1 403 ? 21.783  -19.469 55.890 1.00 25.56  ? 403  ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 403 ? 20.944  -20.636 56.058 1.00 25.44  ? 403  ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 403 ? 20.056  -20.420 57.276 1.00 25.38  ? 403  ARG A C     1 
ATOM   3330 O  O     . ARG A 1 403 ? 20.443  -19.752 58.249 1.00 26.85  ? 403  ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 403 ? 21.775  -21.915 56.210 1.00 26.60  ? 403  ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 403 ? 22.518  -22.052 57.541 1.00 27.08  ? 403  ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 403 ? 23.215  -23.390 57.648 1.00 23.31  ? 403  ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 403 ? 24.375  -23.423 56.778 1.00 26.91  ? 403  ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 403 ? 25.265  -24.409 56.732 1.00 29.66  ? 403  ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 403 ? 25.135  -25.471 57.516 1.00 24.80  ? 403  ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 403 ? 26.295  -24.321 55.894 1.00 29.08  ? 403  ARG A NH2   1 
ATOM   3338 N  N     . TYR A 1 404 ? 18.855  -20.974 57.204 1.00 24.45  ? 404  TYR A N     1 
ATOM   3339 C  CA    . TYR A 1 404 ? 17.896  -20.888 58.288 1.00 25.99  ? 404  TYR A CA    1 
ATOM   3340 C  C     . TYR A 1 404 ? 17.238  -22.259 58.499 1.00 27.26  ? 404  TYR A C     1 
ATOM   3341 O  O     . TYR A 1 404 ? 16.389  -22.672 57.702 1.00 27.73  ? 404  TYR A O     1 
ATOM   3342 C  CB    . TYR A 1 404 ? 16.868  -19.798 57.976 1.00 24.72  ? 404  TYR A CB    1 
ATOM   3343 C  CG    . TYR A 1 404 ? 17.437  -18.384 58.002 1.00 25.36  ? 404  TYR A CG    1 
ATOM   3344 C  CD1   . TYR A 1 404 ? 17.511  -17.669 59.202 1.00 23.65  ? 404  TYR A CD1   1 
ATOM   3345 C  CD2   . TYR A 1 404 ? 17.877  -17.757 56.832 1.00 24.61  ? 404  TYR A CD2   1 
ATOM   3346 C  CE1   . TYR A 1 404 ? 18.009  -16.377 59.247 1.00 26.35  ? 404  TYR A CE1   1 
ATOM   3347 C  CE2   . TYR A 1 404 ? 18.392  -16.452 56.866 1.00 27.89  ? 404  TYR A CE2   1 
ATOM   3348 C  CZ    . TYR A 1 404 ? 18.452  -15.771 58.086 1.00 30.33  ? 404  TYR A CZ    1 
ATOM   3349 O  OH    . TYR A 1 404 ? 18.962  -14.488 58.164 1.00 33.15  ? 404  TYR A OH    1 
ATOM   3350 N  N     . LYS A 1 405 ? 17.647  -22.960 59.562 1.00 27.56  ? 405  LYS A N     1 
ATOM   3351 C  CA    . LYS A 1 405 ? 17.244  -24.359 59.809 1.00 26.66  ? 405  LYS A CA    1 
ATOM   3352 C  C     . LYS A 1 405 ? 15.723  -24.607 59.952 1.00 26.84  ? 405  LYS A C     1 
ATOM   3353 O  O     . LYS A 1 405 ? 15.152  -25.388 59.190 1.00 25.96  ? 405  LYS A O     1 
ATOM   3354 C  CB    . LYS A 1 405 ? 17.991  -24.915 61.020 1.00 28.10  ? 405  LYS A CB    1 
ATOM   3355 C  CG    . LYS A 1 405 ? 17.947  -26.422 61.148 1.00 30.67  ? 405  LYS A CG    1 
ATOM   3356 C  CD    . LYS A 1 405 ? 18.729  -26.889 62.364 1.00 35.97  ? 405  LYS A CD    1 
ATOM   3357 C  CE    . LYS A 1 405 ? 19.054  -28.373 62.268 1.00 41.67  ? 405  LYS A CE    1 
ATOM   3358 N  NZ    . LYS A 1 405 ? 19.779  -28.911 63.460 1.00 40.42  ? 405  LYS A NZ    1 
ATOM   3359 N  N     . TYR A 1 406 ? 15.083  -23.961 60.923 1.00 24.06  ? 406  TYR A N     1 
ATOM   3360 C  CA    . TYR A 1 406 ? 13.642  -24.116 61.131 1.00 25.65  ? 406  TYR A CA    1 
ATOM   3361 C  C     . TYR A 1 406 ? 12.925  -22.799 60.879 1.00 26.30  ? 406  TYR A C     1 
ATOM   3362 O  O     . TYR A 1 406 ? 13.343  -21.753 61.374 1.00 26.17  ? 406  TYR A O     1 
ATOM   3363 C  CB    . TYR A 1 406 ? 13.320  -24.607 62.551 1.00 26.70  ? 406  TYR A CB    1 
ATOM   3364 C  CG    . TYR A 1 406 ? 13.806  -26.016 62.867 1.00 26.33  ? 406  TYR A CG    1 
ATOM   3365 C  CD1   . TYR A 1 406 ? 15.019  -26.223 63.532 1.00 27.96  ? 406  TYR A CD1   1 
ATOM   3366 C  CD2   . TYR A 1 406 ? 13.047  -27.136 62.516 1.00 24.89  ? 406  TYR A CD2   1 
ATOM   3367 C  CE1   . TYR A 1 406 ? 15.473  -27.510 63.837 1.00 25.37  ? 406  TYR A CE1   1 
ATOM   3368 C  CE2   . TYR A 1 406 ? 13.496  -28.425 62.811 1.00 29.31  ? 406  TYR A CE2   1 
ATOM   3369 C  CZ    . TYR A 1 406 ? 14.713  -28.598 63.469 1.00 26.91  ? 406  TYR A CZ    1 
ATOM   3370 O  OH    . TYR A 1 406 ? 15.161  -29.858 63.761 1.00 28.54  ? 406  TYR A OH    1 
ATOM   3371 N  N     . VAL A 1 407 ? 11.840  -22.850 60.114 1.00 24.23  ? 407  VAL A N     1 
ATOM   3372 C  CA    . VAL A 1 407 ? 11.123  -21.646 59.772 1.00 25.52  ? 407  VAL A CA    1 
ATOM   3373 C  C     . VAL A 1 407 ? 9.613   -21.883 59.764 1.00 26.72  ? 407  VAL A C     1 
ATOM   3374 O  O     . VAL A 1 407 ? 9.111   -22.884 59.239 1.00 26.57  ? 407  VAL A O     1 
ATOM   3375 C  CB    . VAL A 1 407 ? 11.630  -21.039 58.408 1.00 26.96  ? 407  VAL A CB    1 
ATOM   3376 C  CG1   . VAL A 1 407 ? 10.783  -19.839 57.961 1.00 23.06  ? 407  VAL A CG1   1 
ATOM   3377 C  CG2   . VAL A 1 407 ? 13.086  -20.621 58.506 1.00 23.13  ? 407  VAL A CG2   1 
ATOM   3378 N  N     . MET A 1 408 ? 8.907   -20.937 60.360 1.00 26.87  ? 408  MET A N     1 
ATOM   3379 C  CA    . MET A 1 408 ? 7.464   -20.912 60.362 1.00 29.52  ? 408  MET A CA    1 
ATOM   3380 C  C     . MET A 1 408 ? 7.024   -19.599 59.742 1.00 30.16  ? 408  MET A C     1 
ATOM   3381 O  O     . MET A 1 408 ? 7.374   -18.530 60.248 1.00 33.31  ? 408  MET A O     1 
ATOM   3382 C  CB    . MET A 1 408 ? 6.929   -20.996 61.795 1.00 28.51  ? 408  MET A CB    1 
ATOM   3383 C  CG    . MET A 1 408 ? 6.392   -22.355 62.188 1.00 33.80  ? 408  MET A CG    1 
ATOM   3384 S  SD    . MET A 1 408 ? 5.516   -22.323 63.764 1.00 43.62  ? 408  MET A SD    1 
ATOM   3385 C  CE    . MET A 1 408 ? 6.826   -21.785 64.869 1.00 30.75  ? 408  MET A CE    1 
ATOM   3386 N  N     . SER A 1 409 ? 6.254   -19.669 58.663 1.00 25.98  ? 409  SER A N     1 
ATOM   3387 C  CA    . SER A 1 409 ? 5.755   -18.452 58.035 1.00 26.03  ? 409  SER A CA    1 
ATOM   3388 C  C     . SER A 1 409 ? 4.282   -18.194 58.351 1.00 24.24  ? 409  SER A C     1 
ATOM   3389 O  O     . SER A 1 409 ? 3.517   -19.127 58.580 1.00 25.77  ? 409  SER A O     1 
ATOM   3390 C  CB    . SER A 1 409 ? 5.966   -18.501 56.528 1.00 23.80  ? 409  SER A CB    1 
ATOM   3391 O  OG    . SER A 1 409 ? 5.168   -19.508 55.950 1.00 24.43  ? 409  SER A OG    1 
ATOM   3392 N  N     . PHE A 1 410 ? 3.912   -16.914 58.373 1.00 23.56  ? 410  PHE A N     1 
ATOM   3393 C  CA    . PHE A 1 410 ? 2.540   -16.452 58.641 1.00 22.93  ? 410  PHE A CA    1 
ATOM   3394 C  C     . PHE A 1 410 ? 2.273   -15.309 57.680 1.00 23.69  ? 410  PHE A C     1 
ATOM   3395 O  O     . PHE A 1 410 ? 3.190   -14.543 57.343 1.00 24.75  ? 410  PHE A O     1 
ATOM   3396 C  CB    . PHE A 1 410 ? 2.390   -15.913 60.070 1.00 20.39  ? 410  PHE A CB    1 
ATOM   3397 C  CG    . PHE A 1 410 ? 2.741   -16.903 61.151 1.00 23.60  ? 410  PHE A CG    1 
ATOM   3398 C  CD1   . PHE A 1 410 ? 4.070   -17.195 61.451 1.00 21.38  ? 410  PHE A CD1   1 
ATOM   3399 C  CD2   . PHE A 1 410 ? 1.735   -17.514 61.902 1.00 27.53  ? 410  PHE A CD2   1 
ATOM   3400 C  CE1   . PHE A 1 410 ? 4.392   -18.101 62.443 1.00 23.88  ? 410  PHE A CE1   1 
ATOM   3401 C  CE2   . PHE A 1 410 ? 2.046   -18.423 62.903 1.00 26.54  ? 410  PHE A CE2   1 
ATOM   3402 C  CZ    . PHE A 1 410 ? 3.383   -18.714 63.178 1.00 26.29  ? 410  PHE A CZ    1 
ATOM   3403 N  N     . ASP A 1 411 ? 1.017   -15.164 57.270 1.00 23.62  ? 411  ASP A N     1 
ATOM   3404 C  CA    . ASP A 1 411 ? 0.658   -14.247 56.198 1.00 23.47  ? 411  ASP A CA    1 
ATOM   3405 C  C     . ASP A 1 411 ? -0.836  -13.881 56.363 1.00 24.11  ? 411  ASP A C     1 
ATOM   3406 O  O     . ASP A 1 411 ? -1.625  -14.711 56.809 1.00 24.78  ? 411  ASP A O     1 
ATOM   3407 C  CB    . ASP A 1 411 ? 1.070   -14.924 54.862 1.00 22.80  ? 411  ASP A CB    1 
ATOM   3408 C  CG    . ASP A 1 411 ? 0.038   -14.832 53.775 1.00 27.76  ? 411  ASP A CG    1 
ATOM   3409 O  OD1   . ASP A 1 411 ? -0.986  -15.532 53.820 1.00 35.68  ? 411  ASP A OD1   1 
ATOM   3410 O  OD2   . ASP A 1 411 ? 0.269   -14.079 52.817 1.00 41.14  ? 411  ASP A OD2   1 
ATOM   3411 N  N     . LEU A 1 412 ? -1.211  -12.635 56.061 1.00 25.06  ? 412  LEU A N     1 
ATOM   3412 C  CA    . LEU A 1 412 ? -2.608  -12.175 56.218 1.00 25.40  ? 412  LEU A CA    1 
ATOM   3413 C  C     . LEU A 1 412 ? -3.545  -12.749 55.172 1.00 25.93  ? 412  LEU A C     1 
ATOM   3414 O  O     . LEU A 1 412 ? -3.207  -12.790 53.988 1.00 30.66  ? 412  LEU A O     1 
ATOM   3415 C  CB    . LEU A 1 412 ? -2.704  -10.648 56.121 1.00 24.91  ? 412  LEU A CB    1 
ATOM   3416 C  CG    . LEU A 1 412 ? -2.102  -9.719  57.181 1.00 26.35  ? 412  LEU A CG    1 
ATOM   3417 C  CD1   . LEU A 1 412 ? -2.267  -8.277  56.732 1.00 16.49  ? 412  LEU A CD1   1 
ATOM   3418 C  CD2   . LEU A 1 412 ? -2.744  -9.928  58.541 1.00 25.17  ? 412  LEU A CD2   1 
ATOM   3419 N  N     . THR A 1 413 ? -4.733  -13.157 55.596 1.00 24.53  ? 413  THR A N     1 
ATOM   3420 C  CA    . THR A 1 413 ? -5.767  -13.587 54.652 1.00 26.31  ? 413  THR A CA    1 
ATOM   3421 C  C     . THR A 1 413 ? -6.227  -12.408 53.786 1.00 27.01  ? 413  THR A C     1 
ATOM   3422 O  O     . THR A 1 413 ? -6.680  -11.382 54.305 1.00 27.18  ? 413  THR A O     1 
ATOM   3423 C  CB    . THR A 1 413 ? -6.990  -14.202 55.380 1.00 25.63  ? 413  THR A CB    1 
ATOM   3424 O  OG1   . THR A 1 413 ? -6.587  -15.391 56.062 1.00 22.13  ? 413  THR A OG1   1 
ATOM   3425 C  CG2   . THR A 1 413 ? -8.120  -14.549 54.396 1.00 25.86  ? 413  THR A CG2   1 
ATOM   3426 N  N     . SER A 1 414 ? -6.101  -12.565 52.471 1.00 25.77  ? 414  SER A N     1 
ATOM   3427 C  CA    . SER A 1 414 ? -6.585  -11.572 51.514 1.00 25.41  ? 414  SER A CA    1 
ATOM   3428 C  C     . SER A 1 414 ? -6.280  -10.150 51.992 1.00 23.83  ? 414  SER A C     1 
ATOM   3429 O  O     . SER A 1 414 ? -7.187  -9.391  52.328 1.00 25.64  ? 414  SER A O     1 
ATOM   3430 C  CB    . SER A 1 414 ? -8.082  -11.761 51.289 1.00 23.64  ? 414  SER A CB    1 
ATOM   3431 O  OG    . SER A 1 414 ? -8.526  -10.896 50.266 1.00 27.18  ? 414  SER A OG    1 
ATOM   3432 N  N     . ALA A 1 415 ? -4.995  -9.807  52.015 1.00 21.30  ? 415  ALA A N     1 
ATOM   3433 C  CA    . ALA A 1 415 ? -4.505  -8.647  52.744 1.00 19.80  ? 415  ALA A CA    1 
ATOM   3434 C  C     . ALA A 1 415 ? -5.082  -7.320  52.270 1.00 21.24  ? 415  ALA A C     1 
ATOM   3435 O  O     . ALA A 1 415 ? -5.722  -6.615  53.044 1.00 24.10  ? 415  ALA A O     1 
ATOM   3436 C  CB    . ALA A 1 415 ? -2.999  -8.612  52.717 1.00 16.73  ? 415  ALA A CB    1 
ATOM   3437 N  N     . TYR A 1 416 ? -4.854  -6.964  51.011 1.00 21.13  ? 416  TYR A N     1 
ATOM   3438 C  CA    . TYR A 1 416 ? -5.341  -5.679  50.541 1.00 21.25  ? 416  TYR A CA    1 
ATOM   3439 C  C     . TYR A 1 416 ? -6.877  -5.543  50.665 1.00 21.45  ? 416  TYR A C     1 
ATOM   3440 O  O     . TYR A 1 416 ? -7.340  -4.574  51.274 1.00 22.29  ? 416  TYR A O     1 
ATOM   3441 C  CB    . TYR A 1 416 ? -4.769  -5.314  49.161 1.00 18.69  ? 416  TYR A CB    1 
ATOM   3442 C  CG    . TYR A 1 416 ? -3.321  -4.810  49.211 1.00 20.11  ? 416  TYR A CG    1 
ATOM   3443 C  CD1   . TYR A 1 416 ? -2.510  -5.048  50.326 1.00 19.99  ? 416  TYR A CD1   1 
ATOM   3444 C  CD2   . TYR A 1 416 ? -2.760  -4.116  48.136 1.00 19.93  ? 416  TYR A CD2   1 
ATOM   3445 C  CE1   . TYR A 1 416 ? -1.199  -4.600  50.376 1.00 17.78  ? 416  TYR A CE1   1 
ATOM   3446 C  CE2   . TYR A 1 416 ? -1.438  -3.666  48.173 1.00 18.60  ? 416  TYR A CE2   1 
ATOM   3447 C  CZ    . TYR A 1 416 ? -0.663  -3.925  49.301 1.00 21.09  ? 416  TYR A CZ    1 
ATOM   3448 O  OH    . TYR A 1 416 ? 0.650   -3.499  49.370 1.00 20.84  ? 416  TYR A OH    1 
ATOM   3449 N  N     . PRO A 1 417 ? -7.660  -6.525  50.152 1.00 21.03  ? 417  PRO A N     1 
ATOM   3450 C  CA    . PRO A 1 417 ? -9.124  -6.438  50.327 1.00 23.54  ? 417  PRO A CA    1 
ATOM   3451 C  C     . PRO A 1 417 ? -9.532  -6.342  51.794 1.00 25.63  ? 417  PRO A C     1 
ATOM   3452 O  O     . PRO A 1 417 ? -10.448 -5.586  52.127 1.00 26.78  ? 417  PRO A O     1 
ATOM   3453 C  CB    . PRO A 1 417 ? -9.643  -7.750  49.711 1.00 21.86  ? 417  PRO A CB    1 
ATOM   3454 C  CG    . PRO A 1 417 ? -8.622  -8.112  48.685 1.00 21.81  ? 417  PRO A CG    1 
ATOM   3455 C  CD    . PRO A 1 417 ? -7.292  -7.677  49.304 1.00 21.75  ? 417  PRO A CD    1 
ATOM   3456 N  N     . SER A 1 418 ? -8.841  -7.081  52.662 1.00 26.06  ? 418  SER A N     1 
ATOM   3457 C  CA    . SER A 1 418 ? -9.147  -7.075  54.085 1.00 24.29  ? 418  SER A CA    1 
ATOM   3458 C  C     . SER A 1 418 ? -8.880  -5.704  54.688 1.00 24.93  ? 418  SER A C     1 
ATOM   3459 O  O     . SER A 1 418 ? -9.636  -5.248  55.548 1.00 28.12  ? 418  SER A O     1 
ATOM   3460 C  CB    . SER A 1 418 ? -8.358  -8.157  54.823 1.00 23.47  ? 418  SER A CB    1 
ATOM   3461 O  OG    . SER A 1 418 ? -8.750  -9.444  54.377 1.00 20.37  ? 418  SER A OG    1 
ATOM   3462 N  N     . ILE A 1 419 ? -7.830  -5.041  54.212 1.00 22.01  ? 419  ILE A N     1 
ATOM   3463 C  CA    . ILE A 1 419 ? -7.518  -3.684  54.647 1.00 21.67  ? 419  ILE A CA    1 
ATOM   3464 C  C     . ILE A 1 419 ? -8.633  -2.736  54.237 1.00 22.68  ? 419  ILE A C     1 
ATOM   3465 O  O     . ILE A 1 419 ? -9.091  -1.910  55.040 1.00 22.48  ? 419  ILE A O     1 
ATOM   3466 C  CB    . ILE A 1 419 ? -6.167  -3.198  54.076 1.00 19.68  ? 419  ILE A CB    1 
ATOM   3467 C  CG1   . ILE A 1 419 ? -5.029  -3.973  54.729 1.00 18.07  ? 419  ILE A CG1   1 
ATOM   3468 C  CG2   . ILE A 1 419 ? -5.987  -1.699  54.286 1.00 14.19  ? 419  ILE A CG2   1 
ATOM   3469 C  CD1   . ILE A 1 419 ? -3.659  -3.578  54.260 1.00 19.52  ? 419  ILE A CD1   1 
ATOM   3470 N  N     . ILE A 1 420 ? -9.069  -2.872  52.989 1.00 21.23  ? 420  ILE A N     1 
ATOM   3471 C  CA    . ILE A 1 420 ? -10.183 -2.089  52.468 1.00 22.83  ? 420  ILE A CA    1 
ATOM   3472 C  C     . ILE A 1 420 ? -11.394 -2.205  53.409 1.00 26.60  ? 420  ILE A C     1 
ATOM   3473 O  O     . ILE A 1 420 ? -11.996 -1.198  53.782 1.00 29.64  ? 420  ILE A O     1 
ATOM   3474 C  CB    . ILE A 1 420 ? -10.523 -2.507  51.001 1.00 21.03  ? 420  ILE A CB    1 
ATOM   3475 C  CG1   . ILE A 1 420 ? -9.425  -2.027  50.042 1.00 20.20  ? 420  ILE A CG1   1 
ATOM   3476 C  CG2   . ILE A 1 420 ? -11.895 -2.000  50.558 1.00 18.16  ? 420  ILE A CG2   1 
ATOM   3477 C  CD1   . ILE A 1 420 ? -9.681  -2.330  48.549 1.00 15.80  ? 420  ILE A CD1   1 
ATOM   3478 N  N     . ARG A 1 421 ? -11.707 -3.429  53.825 1.00 27.60  ? 421  ARG A N     1 
ATOM   3479 C  CA    . ARG A 1 421 ? -12.907 -3.709  54.620 1.00 27.81  ? 421  ARG A CA    1 
ATOM   3480 C  C     . ARG A 1 421 ? -12.741 -3.265  56.077 1.00 29.58  ? 421  ARG A C     1 
ATOM   3481 O  O     . ARG A 1 421 ? -13.682 -2.755  56.698 1.00 30.91  ? 421  ARG A O     1 
ATOM   3482 C  CB    . ARG A 1 421 ? -13.242 -5.204  54.553 1.00 27.21  ? 421  ARG A CB    1 
ATOM   3483 C  CG    . ARG A 1 421 ? -13.416 -5.773  53.135 1.00 24.75  ? 421  ARG A CG    1 
ATOM   3484 C  CD    . ARG A 1 421 ? -13.442 -7.293  53.141 1.00 25.33  ? 421  ARG A CD    1 
ATOM   3485 N  NE    . ARG A 1 421 ? -14.423 -7.811  54.098 1.00 26.04  ? 421  ARG A NE    1 
ATOM   3486 C  CZ    . ARG A 1 421 ? -14.294 -8.957  54.759 1.00 26.45  ? 421  ARG A CZ    1 
ATOM   3487 N  NH1   . ARG A 1 421 ? -13.229 -9.726  54.563 1.00 24.08  ? 421  ARG A NH1   1 
ATOM   3488 N  NH2   . ARG A 1 421 ? -15.231 -9.341  55.616 1.00 25.68  ? 421  ARG A NH2   1 
ATOM   3489 N  N     . GLN A 1 422 ? -11.538 -3.461  56.607 1.00 27.73  ? 422  GLN A N     1 
ATOM   3490 C  CA    . GLN A 1 422 ? -11.196 -3.044  57.960 1.00 27.80  ? 422  GLN A CA    1 
ATOM   3491 C  C     . GLN A 1 422 ? -11.308 -1.538  58.123 1.00 27.47  ? 422  GLN A C     1 
ATOM   3492 O  O     . GLN A 1 422 ? -11.881 -1.058  59.088 1.00 30.35  ? 422  GLN A O     1 
ATOM   3493 C  CB    . GLN A 1 422 ? -9.774  -3.516  58.327 1.00 26.97  ? 422  GLN A CB    1 
ATOM   3494 C  CG    . GLN A 1 422 ? -9.185  -2.877  59.583 1.00 26.84  ? 422  GLN A CG    1 
ATOM   3495 C  CD    . GLN A 1 422 ? -8.442  -3.862  60.473 1.00 26.74  ? 422  GLN A CD    1 
ATOM   3496 O  OE1   . GLN A 1 422 ? -8.603  -5.081  60.356 1.00 26.25  ? 422  GLN A OE1   1 
ATOM   3497 N  NE2   . GLN A 1 422 ? -7.637  -3.334  61.382 1.00 21.20  ? 422  GLN A NE2   1 
ATOM   3498 N  N     . VAL A 1 423 ? -10.745 -0.798  57.180 1.00 27.09  ? 423  VAL A N     1 
ATOM   3499 C  CA    . VAL A 1 423 ? -10.691 0.657   57.282 1.00 25.58  ? 423  VAL A CA    1 
ATOM   3500 C  C     . VAL A 1 423 ? -11.950 1.316   56.681 1.00 28.97  ? 423  VAL A C     1 
ATOM   3501 O  O     . VAL A 1 423 ? -12.261 2.470   56.992 1.00 28.82  ? 423  VAL A O     1 
ATOM   3502 C  CB    . VAL A 1 423 ? -9.388  1.207   56.637 1.00 22.70  ? 423  VAL A CB    1 
ATOM   3503 C  CG1   . VAL A 1 423 ? -9.265  2.672   56.865 1.00 22.39  ? 423  VAL A CG1   1 
ATOM   3504 C  CG2   . VAL A 1 423 ? -8.175  0.513   57.235 1.00 19.32  ? 423  VAL A CG2   1 
ATOM   3505 N  N     . ASN A 1 424 ? -12.684 0.565   55.853 1.00 28.33  ? 424  ASN A N     1 
ATOM   3506 C  CA    . ASN A 1 424 ? -13.872 1.078   55.161 1.00 27.76  ? 424  ASN A CA    1 
ATOM   3507 C  C     . ASN A 1 424 ? -13.473 2.077   54.061 1.00 26.97  ? 424  ASN A C     1 
ATOM   3508 O  O     . ASN A 1 424 ? -14.033 3.169   53.953 1.00 23.64  ? 424  ASN A O     1 
ATOM   3509 C  CB    . ASN A 1 424 ? -14.865 1.699   56.159 1.00 29.78  ? 424  ASN A CB    1 
ATOM   3510 C  CG    . ASN A 1 424 ? -16.295 1.688   55.651 1.00 30.47  ? 424  ASN A CG    1 
ATOM   3511 O  OD1   . ASN A 1 424 ? -16.699 0.788   54.911 1.00 36.02  ? 424  ASN A OD1   1 
ATOM   3512 N  ND2   . ASN A 1 424 ? -17.073 2.684   56.057 1.00 30.59  ? 424  ASN A ND2   1 
ATOM   3513 N  N     . ILE A 1 425 ? -12.486 1.683   53.254 1.00 27.88  ? 425  ILE A N     1 
ATOM   3514 C  CA    . ILE A 1 425 ? -11.952 2.518   52.179 1.00 26.26  ? 425  ILE A CA    1 
ATOM   3515 C  C     . ILE A 1 425 ? -12.835 2.461   50.939 1.00 26.15  ? 425  ILE A C     1 
ATOM   3516 O  O     . ILE A 1 425 ? -12.976 1.410   50.320 1.00 26.83  ? 425  ILE A O     1 
ATOM   3517 C  CB    . ILE A 1 425 ? -10.521 2.100   51.809 1.00 24.79  ? 425  ILE A CB    1 
ATOM   3518 C  CG1   . ILE A 1 425 ? -9.600  2.255   53.022 1.00 24.17  ? 425  ILE A CG1   1 
ATOM   3519 C  CG2   . ILE A 1 425 ? -10.028 2.927   50.632 1.00 25.90  ? 425  ILE A CG2   1 
ATOM   3520 C  CD1   . ILE A 1 425 ? -8.235  1.594   52.882 1.00 24.12  ? 425  ILE A CD1   1 
ATOM   3521 N  N     . SER A 1 426 ? -13.421 3.605   50.590 1.00 26.48  ? 426  SER A N     1 
ATOM   3522 C  CA    . SER A 1 426 ? -14.307 3.746   49.436 1.00 25.57  ? 426  SER A CA    1 
ATOM   3523 C  C     . SER A 1 426 ? -14.254 5.220   48.994 1.00 26.77  ? 426  SER A C     1 
ATOM   3524 O  O     . SER A 1 426 ? -13.810 6.074   49.757 1.00 29.75  ? 426  SER A O     1 
ATOM   3525 C  CB    . SER A 1 426 ? -15.721 3.368   49.865 1.00 27.97  ? 426  SER A CB    1 
ATOM   3526 O  OG    . SER A 1 426 ? -16.490 2.828   48.812 1.00 29.13  ? 426  SER A OG    1 
ATOM   3527 N  N     . PRO A 1 427 ? -14.698 5.539   47.769 1.00 28.02  ? 427  PRO A N     1 
ATOM   3528 C  CA    . PRO A 1 427 ? -14.755 6.965   47.416 1.00 29.67  ? 427  PRO A CA    1 
ATOM   3529 C  C     . PRO A 1 427 ? -15.707 7.807   48.278 1.00 32.55  ? 427  PRO A C     1 
ATOM   3530 O  O     . PRO A 1 427 ? -15.394 8.964   48.578 1.00 35.20  ? 427  PRO A O     1 
ATOM   3531 C  CB    . PRO A 1 427 ? -15.245 6.954   45.963 1.00 30.62  ? 427  PRO A CB    1 
ATOM   3532 C  CG    . PRO A 1 427 ? -15.816 5.582   45.742 1.00 28.49  ? 427  PRO A CG    1 
ATOM   3533 C  CD    . PRO A 1 427 ? -15.022 4.679   46.620 1.00 28.30  ? 427  PRO A CD    1 
ATOM   3534 N  N     . GLU A 1 428 ? -16.842 7.235   48.681 1.00 32.13  ? 428  GLU A N     1 
ATOM   3535 C  CA    . GLU A 1 428 ? -17.865 7.986   49.406 1.00 33.51  ? 428  GLU A CA    1 
ATOM   3536 C  C     . GLU A 1 428 ? -17.769 7.909   50.940 1.00 34.34  ? 428  GLU A C     1 
ATOM   3537 O  O     . GLU A 1 428 ? -18.557 8.548   51.638 1.00 35.38  ? 428  GLU A O     1 
ATOM   3538 C  CB    . GLU A 1 428 ? -19.277 7.616   48.907 1.00 34.95  ? 428  GLU A CB    1 
ATOM   3539 C  CG    . GLU A 1 428 ? -19.866 6.290   49.421 1.00 36.12  ? 428  GLU A CG    1 
ATOM   3540 C  CD    . GLU A 1 428 ? -19.185 5.045   48.847 1.00 39.38  ? 428  GLU A CD    1 
ATOM   3541 O  OE1   . GLU A 1 428 ? -17.952 5.067   48.614 1.00 36.25  ? 428  GLU A OE1   1 
ATOM   3542 O  OE2   . GLU A 1 428 ? -19.887 4.030   48.648 1.00 38.87  ? 428  GLU A OE2   1 
ATOM   3543 N  N     . THR A 1 429 ? -16.798 7.160   51.462 1.00 33.42  ? 429  THR A N     1 
ATOM   3544 C  CA    . THR A 1 429 ? -16.649 7.012   52.919 1.00 31.61  ? 429  THR A CA    1 
ATOM   3545 C  C     . THR A 1 429 ? -15.549 7.898   53.492 1.00 34.31  ? 429  THR A C     1 
ATOM   3546 O  O     . THR A 1 429 ? -15.211 7.804   54.683 1.00 35.86  ? 429  THR A O     1 
ATOM   3547 C  CB    . THR A 1 429 ? -16.395 5.545   53.358 1.00 29.34  ? 429  THR A CB    1 
ATOM   3548 O  OG1   . THR A 1 429 ? -15.220 5.039   52.717 1.00 27.94  ? 429  THR A OG1   1 
ATOM   3549 C  CG2   . THR A 1 429 ? -17.575 4.664   53.016 1.00 29.85  ? 429  THR A CG2   1 
ATOM   3550 N  N     . ILE A 1 430 ? -14.997 8.768   52.651 1.00 34.25  ? 430  ILE A N     1 
ATOM   3551 C  CA    . ILE A 1 430 ? -13.955 9.679   53.095 1.00 36.10  ? 430  ILE A CA    1 
ATOM   3552 C  C     . ILE A 1 430 ? -14.548 10.718  54.052 1.00 38.86  ? 430  ILE A C     1 
ATOM   3553 O  O     . ILE A 1 430 ? -15.512 11.401  53.711 1.00 42.00  ? 430  ILE A O     1 
ATOM   3554 C  CB    . ILE A 1 430 ? -13.242 10.331  51.893 1.00 36.09  ? 430  ILE A CB    1 
ATOM   3555 C  CG1   . ILE A 1 430 ? -12.448 9.259   51.132 1.00 33.01  ? 430  ILE A CG1   1 
ATOM   3556 C  CG2   . ILE A 1 430 ? -12.349 11.497  52.352 1.00 36.39  ? 430  ILE A CG2   1 
ATOM   3557 C  CD1   . ILE A 1 430 ? -11.797 9.727   49.859 1.00 35.91  ? 430  ILE A CD1   1 
ATOM   3558 N  N     . ALA A 1 431 ? -13.985 10.812  55.257 1.00 39.79  ? 431  ALA A N     1 
ATOM   3559 C  CA    . ALA A 1 431 ? -14.478 11.747  56.277 1.00 39.97  ? 431  ALA A CA    1 
ATOM   3560 C  C     . ALA A 1 431 ? -13.562 12.956  56.482 1.00 40.01  ? 431  ALA A C     1 
ATOM   3561 O  O     . ALA A 1 431 ? -14.010 14.006  56.960 1.00 42.36  ? 431  ALA A O     1 
ATOM   3562 C  CB    . ALA A 1 431 ? -14.707 11.027  57.600 1.00 40.09  ? 431  ALA A CB    1 
ATOM   3563 N  N     . GLY A 1 432 ? -12.288 12.810  56.127 1.00 37.12  ? 432  GLY A N     1 
ATOM   3564 C  CA    . GLY A 1 432 ? -11.324 13.905  56.258 1.00 37.60  ? 432  GLY A CA    1 
ATOM   3565 C  C     . GLY A 1 432 ? -9.897  13.406  56.377 1.00 36.23  ? 432  GLY A C     1 
ATOM   3566 O  O     . GLY A 1 432 ? -9.582  12.312  55.918 1.00 35.98  ? 432  GLY A O     1 
ATOM   3567 N  N     . THR A 1 433 ? -9.037  14.210  56.997 1.00 35.03  ? 433  THR A N     1 
ATOM   3568 C  CA    . THR A 1 433 ? -7.635  13.851  57.183 1.00 35.28  ? 433  THR A CA    1 
ATOM   3569 C  C     . THR A 1 433 ? -7.163  14.155  58.600 1.00 36.35  ? 433  THR A C     1 
ATOM   3570 O  O     . THR A 1 433 ? -7.818  14.884  59.346 1.00 37.97  ? 433  THR A O     1 
ATOM   3571 C  CB    . THR A 1 433 ? -6.693  14.594  56.186 1.00 34.66  ? 433  THR A CB    1 
ATOM   3572 O  OG1   . THR A 1 433 ? -6.993  15.995  56.196 1.00 34.23  ? 433  THR A OG1   1 
ATOM   3573 C  CG2   . THR A 1 433 ? -6.838  14.055  54.760 1.00 32.52  ? 433  THR A CG2   1 
ATOM   3574 N  N     . PHE A 1 434 ? -6.023  13.584  58.963 1.00 34.56  ? 434  PHE A N     1 
ATOM   3575 C  CA    . PHE A 1 434 ? -5.333  13.953  60.186 1.00 34.50  ? 434  PHE A CA    1 
ATOM   3576 C  C     . PHE A 1 434 ? -3.866  14.213  59.863 1.00 34.16  ? 434  PHE A C     1 
ATOM   3577 O  O     . PHE A 1 434 ? -3.381  13.788  58.815 1.00 34.71  ? 434  PHE A O     1 
ATOM   3578 C  CB    . PHE A 1 434 ? -5.490  12.859  61.243 1.00 32.42  ? 434  PHE A CB    1 
ATOM   3579 C  CG    . PHE A 1 434 ? -4.767  11.584  60.918 1.00 32.51  ? 434  PHE A CG    1 
ATOM   3580 C  CD1   . PHE A 1 434 ? -5.413  10.557  60.220 1.00 31.89  ? 434  PHE A CD1   1 
ATOM   3581 C  CD2   . PHE A 1 434 ? -3.447  11.399  61.317 1.00 27.67  ? 434  PHE A CD2   1 
ATOM   3582 C  CE1   . PHE A 1 434 ? -4.754  9.375   59.924 1.00 30.53  ? 434  PHE A CE1   1 
ATOM   3583 C  CE2   . PHE A 1 434 ? -2.777  10.217  61.023 1.00 30.13  ? 434  PHE A CE2   1 
ATOM   3584 C  CZ    . PHE A 1 434 ? -3.431  9.203   60.327 1.00 31.18  ? 434  PHE A CZ    1 
ATOM   3585 N  N     . LYS A 1 435 ? -3.169  14.911  60.754 1.00 35.32  ? 435  LYS A N     1 
ATOM   3586 C  CA    . LYS A 1 435 ? -1.742  15.202  60.571 1.00 37.50  ? 435  LYS A CA    1 
ATOM   3587 C  C     . LYS A 1 435 ? -0.878  13.961  60.827 1.00 36.92  ? 435  LYS A C     1 
ATOM   3588 O  O     . LYS A 1 435 ? -0.872  13.425  61.938 1.00 38.41  ? 435  LYS A O     1 
ATOM   3589 C  CB    . LYS A 1 435 ? -1.323  16.368  61.475 1.00 39.50  ? 435  LYS A CB    1 
ATOM   3590 C  CG    . LYS A 1 435 ? 0.170   16.705  61.427 1.00 46.17  ? 435  LYS A CG    1 
ATOM   3591 C  CD    . LYS A 1 435 ? 0.442   18.180  61.731 1.00 50.09  ? 435  LYS A CD    1 
ATOM   3592 C  CE    . LYS A 1 435 ? 0.290   18.509  63.208 1.00 49.60  ? 435  LYS A CE    1 
ATOM   3593 N  NZ    . LYS A 1 435 ? 0.242   19.981  63.418 1.00 51.44  ? 435  LYS A NZ    1 
ATOM   3594 N  N     . VAL A 1 436 ? -0.160  13.505  59.799 1.00 35.41  ? 436  VAL A N     1 
ATOM   3595 C  CA    . VAL A 1 436 ? 0.641   12.279  59.905 1.00 37.72  ? 436  VAL A CA    1 
ATOM   3596 C  C     . VAL A 1 436 ? 1.913   12.417  60.740 1.00 38.70  ? 436  VAL A C     1 
ATOM   3597 O  O     . VAL A 1 436 ? 2.591   13.441  60.705 1.00 39.96  ? 436  VAL A O     1 
ATOM   3598 C  CB    . VAL A 1 436 ? 1.036   11.666  58.521 1.00 36.92  ? 436  VAL A CB    1 
ATOM   3599 C  CG1   . VAL A 1 436 ? -0.173  11.186  57.789 1.00 38.88  ? 436  VAL A CG1   1 
ATOM   3600 C  CG2   . VAL A 1 436 ? 1.821   12.659  57.663 1.00 40.54  ? 436  VAL A CG2   1 
ATOM   3601 N  N     . ALA A 1 437 ? 2.211   11.366  61.493 1.00 38.33  ? 437  ALA A N     1 
ATOM   3602 C  CA    . ALA A 1 437 ? 3.499   11.209  62.128 1.00 41.10  ? 437  ALA A CA    1 
ATOM   3603 C  C     . ALA A 1 437 ? 4.355   10.361  61.172 1.00 41.77  ? 437  ALA A C     1 
ATOM   3604 O  O     . ALA A 1 437 ? 3.822   9.777   60.226 1.00 41.15  ? 437  ALA A O     1 
ATOM   3605 C  CB    . ALA A 1 437 ? 3.329   10.518  63.470 1.00 39.97  ? 437  ALA A CB    1 
ATOM   3606 N  N     . PRO A 1 438 ? 5.684   10.297  61.393 1.00 41.11  ? 438  PRO A N     1 
ATOM   3607 C  CA    . PRO A 1 438 ? 6.445   9.365   60.566 1.00 39.90  ? 438  PRO A CA    1 
ATOM   3608 C  C     . PRO A 1 438 ? 5.942   7.947   60.802 1.00 38.96  ? 438  PRO A C     1 
ATOM   3609 O  O     . PRO A 1 438 ? 5.517   7.618   61.914 1.00 36.92  ? 438  PRO A O     1 
ATOM   3610 C  CB    . PRO A 1 438 ? 7.874   9.505   61.100 1.00 41.28  ? 438  PRO A CB    1 
ATOM   3611 C  CG    . PRO A 1 438 ? 7.897   10.819  61.808 1.00 41.54  ? 438  PRO A CG    1 
ATOM   3612 C  CD    . PRO A 1 438 ? 6.535   10.994  62.370 1.00 40.45  ? 438  PRO A CD    1 
ATOM   3613 N  N     . LEU A 1 439 ? 5.991   7.116   59.768 1.00 38.72  ? 439  LEU A N     1 
ATOM   3614 C  CA    . LEU A 1 439 ? 5.416   5.777   59.839 1.00 38.22  ? 439  LEU A CA    1 
ATOM   3615 C  C     . LEU A 1 439 ? 5.920   4.972   61.039 1.00 39.29  ? 439  LEU A C     1 
ATOM   3616 O  O     . LEU A 1 439 ? 5.117   4.368   61.758 1.00 40.40  ? 439  LEU A O     1 
ATOM   3617 C  CB    . LEU A 1 439 ? 5.665   5.018   58.537 1.00 38.74  ? 439  LEU A CB    1 
ATOM   3618 C  CG    . LEU A 1 439 ? 5.002   3.648   58.429 1.00 37.67  ? 439  LEU A CG    1 
ATOM   3619 C  CD1   . LEU A 1 439 ? 3.511   3.790   58.154 1.00 35.79  ? 439  LEU A CD1   1 
ATOM   3620 C  CD2   . LEU A 1 439 ? 5.686   2.854   57.343 1.00 39.32  ? 439  LEU A CD2   1 
ATOM   3621 N  N     . HIS A 1 440 ? 7.237   4.976   61.258 1.00 38.50  ? 440  HIS A N     1 
ATOM   3622 C  CA    . HIS A 1 440 ? 7.850   4.263   62.385 1.00 41.36  ? 440  HIS A CA    1 
ATOM   3623 C  C     . HIS A 1 440 ? 7.140   4.541   63.715 1.00 38.05  ? 440  HIS A C     1 
ATOM   3624 O  O     . HIS A 1 440 ? 7.039   3.653   64.558 1.00 37.21  ? 440  HIS A O     1 
ATOM   3625 C  CB    . HIS A 1 440 ? 9.350   4.592   62.492 1.00 46.09  ? 440  HIS A CB    1 
ATOM   3626 C  CG    . HIS A 1 440 ? 10.215  3.813   61.541 1.00 59.16  ? 440  HIS A CG    1 
ATOM   3627 N  ND1   . HIS A 1 440 ? 9.834   3.518   60.246 1.00 62.73  ? 440  HIS A ND1   1 
ATOM   3628 C  CD2   . HIS A 1 440 ? 11.459  3.290   61.692 1.00 64.89  ? 440  HIS A CD2   1 
ATOM   3629 C  CE1   . HIS A 1 440 ? 10.795  2.834   59.648 1.00 64.57  ? 440  HIS A CE1   1 
ATOM   3630 N  NE2   . HIS A 1 440 ? 11.794  2.687   60.502 1.00 65.48  ? 440  HIS A NE2   1 
ATOM   3631 N  N     . ASP A 1 441 ? 6.640   5.768   63.881 1.00 36.11  ? 441  ASP A N     1 
ATOM   3632 C  CA    . ASP A 1 441 ? 5.954   6.179   65.109 1.00 36.09  ? 441  ASP A CA    1 
ATOM   3633 C  C     . ASP A 1 441 ? 4.652   5.411   65.334 1.00 35.47  ? 441  ASP A C     1 
ATOM   3634 O  O     . ASP A 1 441 ? 4.279   5.123   66.471 1.00 35.34  ? 441  ASP A O     1 
ATOM   3635 C  CB    . ASP A 1 441 ? 5.684   7.688   65.115 1.00 36.95  ? 441  ASP A CB    1 
ATOM   3636 C  CG    . ASP A 1 441 ? 6.933   8.524   65.416 1.00 40.46  ? 441  ASP A CG    1 
ATOM   3637 O  OD1   . ASP A 1 441 ? 7.974   7.966   65.819 1.00 42.39  ? 441  ASP A OD1   1 
ATOM   3638 O  OD2   . ASP A 1 441 ? 6.861   9.762   65.265 1.00 42.24  ? 441  ASP A OD2   1 
ATOM   3639 N  N     . TYR A 1 442 ? 3.964   5.071   64.251 1.00 33.23  ? 442  TYR A N     1 
ATOM   3640 C  CA    . TYR A 1 442 ? 2.782   4.229   64.368 1.00 32.76  ? 442  TYR A CA    1 
ATOM   3641 C  C     . TYR A 1 442 ? 3.203   2.782   64.638 1.00 32.25  ? 442  TYR A C     1 
ATOM   3642 O  O     . TYR A 1 442 ? 2.664   2.121   65.534 1.00 32.13  ? 442  TYR A O     1 
ATOM   3643 C  CB    . TYR A 1 442 ? 1.899   4.349   63.118 1.00 31.54  ? 442  TYR A CB    1 
ATOM   3644 C  CG    . TYR A 1 442 ? 1.409   5.758   62.886 1.00 31.43  ? 442  TYR A CG    1 
ATOM   3645 C  CD1   . TYR A 1 442 ? 0.382   6.305   63.679 1.00 25.16  ? 442  TYR A CD1   1 
ATOM   3646 C  CD2   . TYR A 1 442 ? 1.985   6.561   61.893 1.00 28.59  ? 442  TYR A CD2   1 
ATOM   3647 C  CE1   . TYR A 1 442 ? -0.060  7.588   63.483 1.00 26.03  ? 442  TYR A CE1   1 
ATOM   3648 C  CE2   . TYR A 1 442 ? 1.543   7.862   61.686 1.00 29.97  ? 442  TYR A CE2   1 
ATOM   3649 C  CZ    . TYR A 1 442 ? 0.521   8.369   62.487 1.00 31.91  ? 442  TYR A CZ    1 
ATOM   3650 O  OH    . TYR A 1 442 ? 0.085   9.658   62.294 1.00 34.18  ? 442  TYR A OH    1 
ATOM   3651 N  N     . ILE A 1 443 ? 4.186   2.314   63.869 1.00 32.65  ? 443  ILE A N     1 
ATOM   3652 C  CA    . ILE A 1 443 ? 4.779   0.983   64.036 1.00 29.58  ? 443  ILE A CA    1 
ATOM   3653 C  C     . ILE A 1 443 ? 5.141   0.741   65.504 1.00 31.05  ? 443  ILE A C     1 
ATOM   3654 O  O     . ILE A 1 443 ? 4.845   -0.323  66.054 1.00 30.79  ? 443  ILE A O     1 
ATOM   3655 C  CB    . ILE A 1 443 ? 5.981   0.803   63.079 1.00 27.78  ? 443  ILE A CB    1 
ATOM   3656 C  CG1   . ILE A 1 443 ? 5.463   0.707   61.633 1.00 30.77  ? 443  ILE A CG1   1 
ATOM   3657 C  CG2   . ILE A 1 443 ? 6.837   -0.411  63.454 1.00 24.52  ? 443  ILE A CG2   1 
ATOM   3658 C  CD1   . ILE A 1 443 ? 6.506   1.011   60.559 1.00 28.45  ? 443  ILE A CD1   1 
ATOM   3659 N  N     . ASN A 1 444 ? 5.720   1.755   66.142 1.00 32.26  ? 444  ASN A N     1 
ATOM   3660 C  CA    . ASN A 1 444 ? 6.177   1.655   67.529 1.00 35.12  ? 444  ASN A CA    1 
ATOM   3661 C  C     . ASN A 1 444 ? 5.197   2.188   68.577 1.00 36.91  ? 444  ASN A C     1 
ATOM   3662 O  O     . ASN A 1 444 ? 5.564   2.368   69.735 1.00 39.35  ? 444  ASN A O     1 
ATOM   3663 C  CB    . ASN A 1 444 ? 7.526   2.352   67.671 1.00 35.00  ? 444  ASN A CB    1 
ATOM   3664 C  CG    . ASN A 1 444 ? 8.614   1.665   66.874 1.00 40.99  ? 444  ASN A CG    1 
ATOM   3665 O  OD1   . ASN A 1 444 ? 8.881   0.476   67.065 1.00 40.68  ? 444  ASN A OD1   1 
ATOM   3666 N  ND2   . ASN A 1 444 ? 9.247   2.408   65.969 1.00 42.24  ? 444  ASN A ND2   1 
ATOM   3667 N  N     . ALA A 1 445 ? 3.959   2.447   68.162 1.00 37.57  ? 445  ALA A N     1 
ATOM   3668 C  CA    . ALA A 1 445 ? 2.886   2.928   69.053 1.00 40.21  ? 445  ALA A CA    1 
ATOM   3669 C  C     . ALA A 1 445 ? 3.191   4.204   69.863 1.00 41.73  ? 445  ALA A C     1 
ATOM   3670 O  O     . ALA A 1 445 ? 2.571   4.433   70.903 1.00 42.50  ? 445  ALA A O     1 
ATOM   3671 C  CB    . ALA A 1 445 ? 2.400   1.793   69.980 1.00 39.24  ? 445  ALA A CB    1 
ATOM   3672 N  N     . VAL A 1 446 ? 4.127   5.027   69.384 1.00 42.23  ? 446  VAL A N     1 
ATOM   3673 C  CA    . VAL A 1 446 ? 4.444   6.310   70.037 1.00 44.08  ? 446  VAL A CA    1 
ATOM   3674 C  C     . VAL A 1 446 ? 3.635   7.505   69.499 1.00 44.30  ? 446  VAL A C     1 
ATOM   3675 O  O     . VAL A 1 446 ? 3.399   8.477   70.217 1.00 45.94  ? 446  VAL A O     1 
ATOM   3676 C  CB    . VAL A 1 446 ? 5.973   6.641   70.041 1.00 45.49  ? 446  VAL A CB    1 
ATOM   3677 C  CG1   . VAL A 1 446 ? 6.748   5.678   70.951 1.00 47.73  ? 446  VAL A CG1   1 
ATOM   3678 C  CG2   . VAL A 1 446 ? 6.555   6.642   68.640 1.00 46.02  ? 446  VAL A CG2   1 
ATOM   3679 N  N     . ALA A 1 447 ? 3.206   7.427   68.246 1.00 42.84  ? 447  ALA A N     1 
ATOM   3680 C  CA    . ALA A 1 447 ? 2.425   8.503   67.639 1.00 43.83  ? 447  ALA A CA    1 
ATOM   3681 C  C     . ALA A 1 447 ? 1.067   8.708   68.302 1.00 43.56  ? 447  ALA A C     1 
ATOM   3682 O  O     . ALA A 1 447 ? 0.418   7.758   68.747 1.00 44.58  ? 447  ALA A O     1 
ATOM   3683 C  CB    . ALA A 1 447 ? 2.242   8.252   66.157 1.00 44.09  ? 447  ALA A CB    1 
ATOM   3684 N  N     . GLU A 1 448 ? 0.655   9.967   68.355 1.00 42.95  ? 448  GLU A N     1 
ATOM   3685 C  CA    . GLU A 1 448 ? -0.663  10.358  68.813 1.00 42.81  ? 448  GLU A CA    1 
ATOM   3686 C  C     . GLU A 1 448 ? -1.700  9.536   68.057 1.00 38.79  ? 448  GLU A C     1 
ATOM   3687 O  O     . GLU A 1 448 ? -1.618  9.406   66.838 1.00 38.05  ? 448  GLU A O     1 
ATOM   3688 C  CB    . GLU A 1 448 ? -0.854  11.837  68.501 1.00 45.58  ? 448  GLU A CB    1 
ATOM   3689 C  CG    . GLU A 1 448 ? -1.610  12.628  69.547 1.00 56.04  ? 448  GLU A CG    1 
ATOM   3690 C  CD    . GLU A 1 448 ? -1.910  14.057  69.091 1.00 62.43  ? 448  GLU A CD    1 
ATOM   3691 O  OE1   . GLU A 1 448 ? -2.269  14.888  69.955 1.00 63.83  ? 448  GLU A OE1   1 
ATOM   3692 O  OE2   . GLU A 1 448 ? -1.787  14.348  67.874 1.00 61.99  ? 448  GLU A OE2   1 
ATOM   3693 N  N     . ARG A 1 449 ? -2.657  8.960   68.774 1.00 36.01  ? 449  ARG A N     1 
ATOM   3694 C  CA    . ARG A 1 449 ? -3.761  8.243   68.126 1.00 34.25  ? 449  ARG A CA    1 
ATOM   3695 C  C     . ARG A 1 449 ? -4.478  9.154   67.119 1.00 33.12  ? 449  ARG A C     1 
ATOM   3696 O  O     . ARG A 1 449 ? -4.924  10.244  67.481 1.00 31.57  ? 449  ARG A O     1 
ATOM   3697 C  CB    . ARG A 1 449 ? -4.748  7.728   69.169 1.00 32.92  ? 449  ARG A CB    1 
ATOM   3698 C  CG    . ARG A 1 449 ? -5.813  6.805   68.625 1.00 31.21  ? 449  ARG A CG    1 
ATOM   3699 C  CD    . ARG A 1 449 ? -6.586  6.190   69.777 1.00 32.83  ? 449  ARG A CD    1 
ATOM   3700 N  NE    . ARG A 1 449 ? -7.594  5.233   69.339 1.00 32.40  ? 449  ARG A NE    1 
ATOM   3701 C  CZ    . ARG A 1 449 ? -8.899  5.357   69.567 1.00 34.09  ? 449  ARG A CZ    1 
ATOM   3702 N  NH1   . ARG A 1 449 ? -9.376  6.405   70.229 1.00 31.97  ? 449  ARG A NH1   1 
ATOM   3703 N  NH2   . ARG A 1 449 ? -9.732  4.422   69.141 1.00 32.43  ? 449  ARG A NH2   1 
ATOM   3704 N  N     . PRO A 1 450 ? -4.573  8.715   65.848 1.00 31.71  ? 450  PRO A N     1 
ATOM   3705 C  CA    . PRO A 1 450 ? -5.107  9.555   64.775 1.00 32.88  ? 450  PRO A CA    1 
ATOM   3706 C  C     . PRO A 1 450 ? -6.525  10.098  65.007 1.00 34.07  ? 450  PRO A C     1 
ATOM   3707 O  O     . PRO A 1 450 ? -6.757  11.288  64.774 1.00 35.32  ? 450  PRO A O     1 
ATOM   3708 C  CB    . PRO A 1 450 ? -5.063  8.622   63.555 1.00 32.12  ? 450  PRO A CB    1 
ATOM   3709 C  CG    . PRO A 1 450 ? -3.933  7.712   63.856 1.00 29.30  ? 450  PRO A CG    1 
ATOM   3710 C  CD    . PRO A 1 450 ? -4.055  7.439   65.321 1.00 29.64  ? 450  PRO A CD    1 
ATOM   3711 N  N     . SER A 1 451 ? -7.455  9.248   65.451 1.00 34.53  ? 451  SER A N     1 
ATOM   3712 C  CA    . SER A 1 451 ? -8.836  9.684   65.656 1.00 36.49  ? 451  SER A CA    1 
ATOM   3713 C  C     . SER A 1 451 ? -9.623  8.887   66.687 1.00 38.27  ? 451  SER A C     1 
ATOM   3714 O  O     . SER A 1 451 ? -9.469  7.671   66.801 1.00 38.84  ? 451  SER A O     1 
ATOM   3715 C  CB    . SER A 1 451 ? -9.617  9.701   64.338 1.00 34.64  ? 451  SER A CB    1 
ATOM   3716 O  OG    . SER A 1 451 ? -10.887 10.314  64.517 1.00 36.76  ? 451  SER A OG    1 
ATOM   3717 N  N     . ASP A 1 452 ? -10.475 9.615   67.412 1.00 40.60  ? 452  ASP A N     1 
ATOM   3718 C  CA    . ASP A 1 452 ? -11.456 9.090   68.359 1.00 41.96  ? 452  ASP A CA    1 
ATOM   3719 C  C     . ASP A 1 452 ? -12.741 8.701   67.657 1.00 39.45  ? 452  ASP A C     1 
ATOM   3720 O  O     . ASP A 1 452 ? -13.590 8.020   68.232 1.00 36.24  ? 452  ASP A O     1 
ATOM   3721 C  CB    . ASP A 1 452 ? -11.834 10.194  69.345 1.00 46.22  ? 452  ASP A CB    1 
ATOM   3722 C  CG    . ASP A 1 452 ? -11.103 10.085  70.646 1.00 55.59  ? 452  ASP A CG    1 
ATOM   3723 O  OD1   . ASP A 1 452 ? -10.169 9.256   70.730 1.00 64.47  ? 452  ASP A OD1   1 
ATOM   3724 O  OD2   . ASP A 1 452 ? -11.463 10.826  71.589 1.00 57.80  ? 452  ASP A OD2   1 
ATOM   3725 N  N     . VAL A 1 453 ? -12.886 9.178   66.423 1.00 37.96  ? 453  VAL A N     1 
ATOM   3726 C  CA    . VAL A 1 453 ? -14.184 9.262   65.765 1.00 38.13  ? 453  VAL A CA    1 
ATOM   3727 C  C     . VAL A 1 453 ? -14.249 8.452   64.465 1.00 37.74  ? 453  VAL A C     1 
ATOM   3728 O  O     . VAL A 1 453 ? -15.269 7.811   64.176 1.00 37.40  ? 453  VAL A O     1 
ATOM   3729 C  CB    . VAL A 1 453 ? -14.548 10.744  65.492 1.00 37.17  ? 453  VAL A CB    1 
ATOM   3730 C  CG1   . VAL A 1 453 ? -15.881 10.867  64.793 1.00 37.63  ? 453  VAL A CG1   1 
ATOM   3731 C  CG2   . VAL A 1 453 ? -14.567 11.525  66.784 1.00 38.82  ? 453  VAL A CG2   1 
ATOM   3732 N  N     . TYR A 1 454 ? -13.163 8.480   63.696 1.00 36.88  ? 454  TYR A N     1 
ATOM   3733 C  CA    . TYR A 1 454 ? -13.136 7.878   62.357 1.00 36.90  ? 454  TYR A CA    1 
ATOM   3734 C  C     . TYR A 1 454 ? -12.101 6.768   62.216 1.00 36.23  ? 454  TYR A C     1 
ATOM   3735 O  O     . TYR A 1 454 ? -11.174 6.647   63.021 1.00 36.66  ? 454  TYR A O     1 
ATOM   3736 C  CB    . TYR A 1 454 ? -12.927 8.954   61.271 1.00 35.53  ? 454  TYR A CB    1 
ATOM   3737 C  CG    . TYR A 1 454 ? -13.972 10.058  61.303 1.00 33.71  ? 454  TYR A CG    1 
ATOM   3738 C  CD1   . TYR A 1 454 ? -15.321 9.777   61.054 1.00 34.43  ? 454  TYR A CD1   1 
ATOM   3739 C  CD2   . TYR A 1 454 ? -13.613 11.373  61.588 1.00 33.80  ? 454  TYR A CD2   1 
ATOM   3740 C  CE1   . TYR A 1 454 ? -16.285 10.773  61.084 1.00 34.81  ? 454  TYR A CE1   1 
ATOM   3741 C  CE2   . TYR A 1 454 ? -14.573 12.388  61.624 1.00 39.23  ? 454  TYR A CE2   1 
ATOM   3742 C  CZ    . TYR A 1 454 ? -15.909 12.081  61.371 1.00 38.83  ? 454  TYR A CZ    1 
ATOM   3743 O  OH    . TYR A 1 454 ? -16.867 13.077  61.410 1.00 37.68  ? 454  TYR A OH    1 
ATOM   3744 N  N     . SER A 1 455 ? -12.286 5.963   61.177 1.00 36.03  ? 455  SER A N     1 
ATOM   3745 C  CA    . SER A 1 455 ? -11.407 4.848   60.857 1.00 34.88  ? 455  SER A CA    1 
ATOM   3746 C  C     . SER A 1 455 ? -10.240 5.348   60.020 1.00 32.82  ? 455  SER A C     1 
ATOM   3747 O  O     . SER A 1 455 ? -10.450 6.045   59.032 1.00 32.43  ? 455  SER A O     1 
ATOM   3748 C  CB    . SER A 1 455 ? -12.197 3.789   60.089 1.00 32.60  ? 455  SER A CB    1 
ATOM   3749 O  OG    . SER A 1 455 ? -11.336 2.778   59.627 1.00 34.00  ? 455  SER A OG    1 
ATOM   3750 N  N     . CYS A 1 456 ? -9.020  4.969   60.394 1.00 31.47  ? 456  CYS A N     1 
ATOM   3751 C  CA    . CYS A 1 456 ? -7.833  5.630   59.861 1.00 30.25  ? 456  CYS A CA    1 
ATOM   3752 C  C     . CYS A 1 456 ? -6.768  4.733   59.259 1.00 30.81  ? 456  CYS A C     1 
ATOM   3753 O  O     . CYS A 1 456 ? -6.582  3.591   59.668 1.00 31.83  ? 456  CYS A O     1 
ATOM   3754 C  CB    . CYS A 1 456 ? -7.181  6.490   60.940 1.00 30.91  ? 456  CYS A CB    1 
ATOM   3755 S  SG    . CYS A 1 456 ? -8.289  7.706   61.703 1.00 33.48  ? 456  CYS A SG    1 
ATOM   3756 N  N     . SER A 1 457 ? -6.059  5.291   58.279 1.00 29.83  ? 457  SER A N     1 
ATOM   3757 C  CA    . SER A 1 457 ? -4.843  4.707   57.752 1.00 25.84  ? 457  SER A CA    1 
ATOM   3758 C  C     . SER A 1 457 ? -3.692  5.648   58.080 1.00 25.47  ? 457  SER A C     1 
ATOM   3759 O  O     . SER A 1 457 ? -3.885  6.869   58.097 1.00 25.79  ? 457  SER A O     1 
ATOM   3760 C  CB    . SER A 1 457 ? -4.962  4.530   56.242 1.00 25.65  ? 457  SER A CB    1 
ATOM   3761 O  OG    . SER A 1 457 ? -3.767  3.984   55.722 1.00 25.95  ? 457  SER A OG    1 
ATOM   3762 N  N     . PRO A 1 458 ? -2.484  5.097   58.330 1.00 24.42  ? 458  PRO A N     1 
ATOM   3763 C  CA    . PRO A 1 458 ? -1.349  5.952   58.667 1.00 23.20  ? 458  PRO A CA    1 
ATOM   3764 C  C     . PRO A 1 458 ? -0.864  6.786   57.489 1.00 25.09  ? 458  PRO A C     1 
ATOM   3765 O  O     . PRO A 1 458 ? 0.151   7.464   57.610 1.00 24.45  ? 458  PRO A O     1 
ATOM   3766 C  CB    . PRO A 1 458 ? -0.271  4.954   59.074 1.00 20.18  ? 458  PRO A CB    1 
ATOM   3767 C  CG    . PRO A 1 458 ? -0.602  3.736   58.342 1.00 22.08  ? 458  PRO A CG    1 
ATOM   3768 C  CD    . PRO A 1 458 ? -2.095  3.678   58.304 1.00 23.07  ? 458  PRO A CD    1 
ATOM   3769 N  N     . ASN A 1 459 ? -1.575  6.724   56.360 1.00 27.17  ? 459  ASN A N     1 
ATOM   3770 C  CA    . ASN A 1 459 ? -1.294  7.614   55.236 1.00 27.61  ? 459  ASN A CA    1 
ATOM   3771 C  C     . ASN A 1 459 ? -1.882  9.019   55.440 1.00 28.32  ? 459  ASN A C     1 
ATOM   3772 O  O     . ASN A 1 459 ? -1.528  9.942   54.721 1.00 29.87  ? 459  ASN A O     1 
ATOM   3773 C  CB    . ASN A 1 459 ? -1.770  7.004   53.914 1.00 28.12  ? 459  ASN A CB    1 
ATOM   3774 C  CG    . ASN A 1 459 ? -3.226  7.322   53.596 1.00 30.07  ? 459  ASN A CG    1 
ATOM   3775 O  OD1   . ASN A 1 459 ? -4.080  7.344   54.480 1.00 31.73  ? 459  ASN A OD1   1 
ATOM   3776 N  ND2   . ASN A 1 459 ? -3.514  7.554   52.317 1.00 26.66  ? 459  ASN A ND2   1 
ATOM   3777 N  N     . GLY A 1 460 ? -2.780  9.174   56.415 1.00 27.38  ? 460  GLY A N     1 
ATOM   3778 C  CA    . GLY A 1 460 ? -3.379  10.478  56.715 1.00 24.73  ? 460  GLY A CA    1 
ATOM   3779 C  C     . GLY A 1 460 ? -4.874  10.541  56.503 1.00 25.24  ? 460  GLY A C     1 
ATOM   3780 O  O     . GLY A 1 460 ? -5.488  11.574  56.741 1.00 26.91  ? 460  GLY A O     1 
ATOM   3781 N  N     . MET A 1 461 ? -5.461  9.425   56.079 1.00 25.82  ? 461  MET A N     1 
ATOM   3782 C  CA    . MET A 1 461 ? -6.868  9.372   55.706 1.00 26.54  ? 461  MET A CA    1 
ATOM   3783 C  C     . MET A 1 461 ? -7.805  8.930   56.831 1.00 28.12  ? 461  MET A C     1 
ATOM   3784 O  O     . MET A 1 461 ? -7.427  8.153   57.713 1.00 29.64  ? 461  MET A O     1 
ATOM   3785 C  CB    . MET A 1 461 ? -7.049  8.465   54.489 1.00 28.53  ? 461  MET A CB    1 
ATOM   3786 C  CG    . MET A 1 461 ? -6.451  9.014   53.201 1.00 26.85  ? 461  MET A CG    1 
ATOM   3787 S  SD    . MET A 1 461 ? -7.058  10.656  52.812 1.00 35.38  ? 461  MET A SD    1 
ATOM   3788 C  CE    . MET A 1 461 ? -8.791  10.344  52.469 1.00 26.47  ? 461  MET A CE    1 
ATOM   3789 N  N     . MET A 1 462 ? -9.028  9.448   56.791 1.00 28.96  ? 462  MET A N     1 
ATOM   3790 C  CA    . MET A 1 462 ? -10.068 9.123   57.769 1.00 30.92  ? 462  MET A CA    1 
ATOM   3791 C  C     . MET A 1 462 ? -11.332 8.709   57.043 1.00 29.54  ? 462  MET A C     1 
ATOM   3792 O  O     . MET A 1 462 ? -11.695 9.312   56.033 1.00 31.63  ? 462  MET A O     1 
ATOM   3793 C  CB    . MET A 1 462 ? -10.382 10.324  58.672 1.00 31.40  ? 462  MET A CB    1 
ATOM   3794 C  CG    . MET A 1 462 ? -9.180  10.911  59.391 1.00 34.06  ? 462  MET A CG    1 
ATOM   3795 S  SD    . MET A 1 462 ? -9.583  11.651  60.982 1.00 35.22  ? 462  MET A SD    1 
ATOM   3796 C  CE    . MET A 1 462 ? -10.489 13.133  60.512 1.00 32.10  ? 462  MET A CE    1 
ATOM   3797 N  N     . TYR A 1 463 ? -12.004 7.690   57.563 1.00 29.54  ? 463  TYR A N     1 
ATOM   3798 C  CA    . TYR A 1 463 ? -13.226 7.160   56.941 1.00 31.16  ? 463  TYR A CA    1 
ATOM   3799 C  C     . TYR A 1 463 ? -14.354 6.984   57.948 1.00 33.69  ? 463  TYR A C     1 
ATOM   3800 O  O     . TYR A 1 463 ? -14.101 6.756   59.136 1.00 35.00  ? 463  TYR A O     1 
ATOM   3801 C  CB    . TYR A 1 463 ? -12.923 5.826   56.255 1.00 27.49  ? 463  TYR A CB    1 
ATOM   3802 C  CG    . TYR A 1 463 ? -11.816 5.929   55.234 1.00 26.20  ? 463  TYR A CG    1 
ATOM   3803 C  CD1   . TYR A 1 463 ? -10.470 5.859   55.618 1.00 23.33  ? 463  TYR A CD1   1 
ATOM   3804 C  CD2   . TYR A 1 463 ? -12.116 6.123   53.880 1.00 24.70  ? 463  TYR A CD2   1 
ATOM   3805 C  CE1   . TYR A 1 463 ? -9.446  5.970   54.672 1.00 25.97  ? 463  TYR A CE1   1 
ATOM   3806 C  CE2   . TYR A 1 463 ? -11.113 6.223   52.932 1.00 25.87  ? 463  TYR A CE2   1 
ATOM   3807 C  CZ    . TYR A 1 463 ? -9.781  6.152   53.329 1.00 28.26  ? 463  TYR A CZ    1 
ATOM   3808 O  OH    . TYR A 1 463 ? -8.804  6.262   52.374 1.00 26.71  ? 463  TYR A OH    1 
ATOM   3809 N  N     . TYR A 1 464 ? -15.595 7.097   57.473 1.00 37.08  ? 464  TYR A N     1 
ATOM   3810 C  CA    . TYR A 1 464 ? -16.775 6.853   58.313 1.00 38.93  ? 464  TYR A CA    1 
ATOM   3811 C  C     . TYR A 1 464 ? -16.849 5.400   58.768 1.00 38.08  ? 464  TYR A C     1 
ATOM   3812 O  O     . TYR A 1 464 ? -16.705 4.493   57.964 1.00 38.26  ? 464  TYR A O     1 
ATOM   3813 C  CB    . TYR A 1 464 ? -18.069 7.242   57.585 1.00 39.98  ? 464  TYR A CB    1 
ATOM   3814 C  CG    . TYR A 1 464 ? -18.169 8.712   57.250 1.00 45.32  ? 464  TYR A CG    1 
ATOM   3815 C  CD1   . TYR A 1 464 ? -18.058 9.155   55.931 1.00 48.49  ? 464  TYR A CD1   1 
ATOM   3816 C  CD2   . TYR A 1 464 ? -18.364 9.665   58.252 1.00 47.15  ? 464  TYR A CD2   1 
ATOM   3817 C  CE1   . TYR A 1 464 ? -18.139 10.518  55.619 1.00 48.75  ? 464  TYR A CE1   1 
ATOM   3818 C  CE2   . TYR A 1 464 ? -18.444 11.021  57.953 1.00 48.30  ? 464  TYR A CE2   1 
ATOM   3819 C  CZ    . TYR A 1 464 ? -18.330 11.440  56.637 1.00 48.44  ? 464  TYR A CZ    1 
ATOM   3820 O  OH    . TYR A 1 464 ? -18.412 12.780  56.343 1.00 47.61  ? 464  TYR A OH    1 
ATOM   3821 N  N     . LYS A 1 465 ? -17.052 5.200   60.067 1.00 41.69  ? 465  LYS A N     1 
ATOM   3822 C  CA    . LYS A 1 465 ? -17.232 3.874   60.663 1.00 43.59  ? 465  LYS A CA    1 
ATOM   3823 C  C     . LYS A 1 465 ? -18.679 3.425   60.566 1.00 46.80  ? 465  LYS A C     1 
ATOM   3824 O  O     . LYS A 1 465 ? -18.971 2.233   60.537 1.00 47.53  ? 465  LYS A O     1 
ATOM   3825 C  CB    . LYS A 1 465 ? -16.866 3.908   62.148 1.00 42.89  ? 465  LYS A CB    1 
ATOM   3826 C  CG    . LYS A 1 465 ? -15.423 4.259   62.453 1.00 38.67  ? 465  LYS A CG    1 
ATOM   3827 C  CD    . LYS A 1 465 ? -15.131 4.101   63.931 1.00 34.17  ? 465  LYS A CD    1 
ATOM   3828 C  CE    . LYS A 1 465 ? -15.151 2.644   64.348 1.00 34.13  ? 465  LYS A CE    1 
ATOM   3829 N  NZ    . LYS A 1 465 ? -14.470 2.447   65.653 1.00 33.96  ? 465  LYS A NZ    1 
ATOM   3830 N  N     . ASP A 1 466 ? -19.576 4.400   60.522 1.00 50.81  ? 466  ASP A N     1 
ATOM   3831 C  CA    . ASP A 1 466 ? -20.997 4.189   60.767 1.00 56.52  ? 466  ASP A CA    1 
ATOM   3832 C  C     . ASP A 1 466 ? -21.808 3.779   59.527 1.00 57.27  ? 466  ASP A C     1 
ATOM   3833 O  O     . ASP A 1 466 ? -23.026 3.586   59.621 1.00 58.33  ? 466  ASP A O     1 
ATOM   3834 C  CB    . ASP A 1 466 ? -21.584 5.461   61.402 1.00 58.95  ? 466  ASP A CB    1 
ATOM   3835 C  CG    . ASP A 1 466 ? -21.124 6.735   60.689 1.00 64.55  ? 466  ASP A CG    1 
ATOM   3836 O  OD1   . ASP A 1 466 ? -21.655 7.037   59.596 1.00 67.10  ? 466  ASP A OD1   1 
ATOM   3837 O  OD2   . ASP A 1 466 ? -20.224 7.432   61.216 1.00 67.80  ? 466  ASP A OD2   1 
ATOM   3838 N  N     . ARG A 1 467 ? -21.139 3.647   58.379 1.00 56.38  ? 467  ARG A N     1 
ATOM   3839 C  CA    . ARG A 1 467 ? -21.807 3.361   57.095 1.00 56.08  ? 467  ARG A CA    1 
ATOM   3840 C  C     . ARG A 1 467 ? -20.897 2.637   56.103 1.00 54.12  ? 467  ARG A C     1 
ATOM   3841 O  O     . ARG A 1 467 ? -19.702 2.927   56.020 1.00 52.46  ? 467  ARG A O     1 
ATOM   3842 C  CB    . ARG A 1 467 ? -22.354 4.646   56.457 1.00 58.08  ? 467  ARG A CB    1 
ATOM   3843 C  CG    . ARG A 1 467 ? -21.416 5.853   56.530 1.00 59.98  ? 467  ARG A CG    1 
ATOM   3844 C  CD    . ARG A 1 467 ? -21.931 7.018   55.684 1.00 63.65  ? 467  ARG A CD    1 
ATOM   3845 N  NE    . ARG A 1 467 ? -21.857 8.305   56.387 1.00 66.00  ? 467  ARG A NE    1 
ATOM   3846 C  CZ    . ARG A 1 467 ? -21.831 9.499   55.790 1.00 67.54  ? 467  ARG A CZ    1 
ATOM   3847 N  NH1   . ARG A 1 467 ? -21.856 9.595   54.462 1.00 65.46  ? 467  ARG A NH1   1 
ATOM   3848 N  NH2   . ARG A 1 467 ? -21.768 10.606  56.525 1.00 67.21  ? 467  ARG A NH2   1 
ATOM   3849 N  N     . ASP A 1 468 ? -21.463 1.702   55.345 1.00 52.33  ? 468  ASP A N     1 
ATOM   3850 C  CA    . ASP A 1 468 ? -20.653 0.942   54.398 1.00 50.94  ? 468  ASP A CA    1 
ATOM   3851 C  C     . ASP A 1 468 ? -20.445 1.624   53.053 1.00 46.01  ? 468  ASP A C     1 
ATOM   3852 O  O     . ASP A 1 468 ? -21.357 2.220   52.491 1.00 44.87  ? 468  ASP A O     1 
ATOM   3853 C  CB    . ASP A 1 468 ? -21.184 -0.480  54.208 1.00 54.96  ? 468  ASP A CB    1 
ATOM   3854 C  CG    . ASP A 1 468 ? -20.298 -1.525  54.880 1.00 61.06  ? 468  ASP A CG    1 
ATOM   3855 O  OD1   . ASP A 1 468 ? -19.118 -1.660  54.470 1.00 58.17  ? 468  ASP A OD1   1 
ATOM   3856 O  OD2   . ASP A 1 468 ? -20.786 -2.210  55.812 1.00 66.27  ? 468  ASP A OD2   1 
ATOM   3857 N  N     . GLY A 1 469 ? -19.215 1.535   52.561 1.00 45.96  ? 469  GLY A N     1 
ATOM   3858 C  CA    . GLY A 1 469 ? -18.892 1.973   51.218 1.00 39.21  ? 469  GLY A CA    1 
ATOM   3859 C  C     . GLY A 1 469 ? -19.175 0.884   50.204 1.00 35.82  ? 469  GLY A C     1 
ATOM   3860 O  O     . GLY A 1 469 ? -19.081 -0.316  50.503 1.00 32.54  ? 469  GLY A O     1 
ATOM   3861 N  N     . VAL A 1 470 ? -19.527 1.318   48.998 1.00 34.16  ? 470  VAL A N     1 
ATOM   3862 C  CA    . VAL A 1 470 ? -19.757 0.422   47.875 1.00 30.66  ? 470  VAL A CA    1 
ATOM   3863 C  C     . VAL A 1 470 ? -18.528 -0.434  47.552 1.00 28.22  ? 470  VAL A C     1 
ATOM   3864 O  O     . VAL A 1 470 ? -18.675 -1.598  47.170 1.00 31.09  ? 470  VAL A O     1 
ATOM   3865 C  CB    . VAL A 1 470 ? -20.275 1.191   46.624 1.00 31.07  ? 470  VAL A CB    1 
ATOM   3866 C  CG1   . VAL A 1 470 ? -19.173 2.077   46.012 1.00 27.41  ? 470  VAL A CG1   1 
ATOM   3867 C  CG2   . VAL A 1 470 ? -20.876 0.228   45.598 1.00 26.46  ? 470  VAL A CG2   1 
ATOM   3868 N  N     . VAL A 1 471 ? -17.323 0.116   47.723 1.00 25.97  ? 471  VAL A N     1 
ATOM   3869 C  CA    . VAL A 1 471 ? -16.110 -0.692  47.536 1.00 24.00  ? 471  VAL A CA    1 
ATOM   3870 C  C     . VAL A 1 471 ? -16.017 -1.846  48.580 1.00 25.71  ? 471  VAL A C     1 
ATOM   3871 O  O     . VAL A 1 471 ? -15.983 -3.009  48.192 1.00 29.33  ? 471  VAL A O     1 
ATOM   3872 C  CB    . VAL A 1 471 ? -14.816 0.176   47.389 1.00 23.17  ? 471  VAL A CB    1 
ATOM   3873 C  CG1   . VAL A 1 471 ? -13.535 -0.663  47.496 1.00 13.86  ? 471  VAL A CG1   1 
ATOM   3874 C  CG2   . VAL A 1 471 ? -14.841 0.928   46.068 1.00 21.81  ? 471  VAL A CG2   1 
ATOM   3875 N  N     . PRO A 1 472 ? -16.010 -1.541  49.892 1.00 25.87  ? 472  PRO A N     1 
ATOM   3876 C  CA    . PRO A 1 472 ? -16.017 -2.651  50.855 1.00 26.77  ? 472  PRO A CA    1 
ATOM   3877 C  C     . PRO A 1 472 ? -17.153 -3.660  50.659 1.00 28.44  ? 472  PRO A C     1 
ATOM   3878 O  O     . PRO A 1 472 ? -16.919 -4.872  50.720 1.00 30.12  ? 472  PRO A O     1 
ATOM   3879 C  CB    . PRO A 1 472 ? -16.178 -1.939  52.191 1.00 26.70  ? 472  PRO A CB    1 
ATOM   3880 C  CG    . PRO A 1 472 ? -15.494 -0.642  51.988 1.00 28.68  ? 472  PRO A CG    1 
ATOM   3881 C  CD    . PRO A 1 472 ? -15.752 -0.252  50.559 1.00 27.57  ? 472  PRO A CD    1 
ATOM   3882 N  N     . THR A 1 473 ? -18.363 -3.165  50.424 1.00 27.85  ? 473  THR A N     1 
ATOM   3883 C  CA    . THR A 1 473 ? -19.534 -4.021  50.276 1.00 28.38  ? 473  THR A CA    1 
ATOM   3884 C  C     . THR A 1 473 ? -19.363 -5.032  49.142 1.00 27.06  ? 473  THR A C     1 
ATOM   3885 O  O     . THR A 1 473 ? -19.493 -6.249  49.352 1.00 28.68  ? 473  THR A O     1 
ATOM   3886 C  CB    . THR A 1 473 ? -20.802 -3.172  50.071 1.00 29.41  ? 473  THR A CB    1 
ATOM   3887 O  OG1   . THR A 1 473 ? -21.002 -2.368  51.237 1.00 35.08  ? 473  THR A OG1   1 
ATOM   3888 C  CG2   . THR A 1 473 ? -22.041 -4.042  49.860 1.00 27.81  ? 473  THR A CG2   1 
ATOM   3889 N  N     . GLU A 1 474 ? -19.052 -4.533  47.954 1.00 24.26  ? 474  GLU A N     1 
ATOM   3890 C  CA    . GLU A 1 474 ? -18.927 -5.396  46.780 1.00 23.77  ? 474  GLU A CA    1 
ATOM   3891 C  C     . GLU A 1 474 ? -17.644 -6.250  46.794 1.00 22.54  ? 474  GLU A C     1 
ATOM   3892 O  O     . GLU A 1 474 ? -17.673 -7.401  46.381 1.00 23.56  ? 474  GLU A O     1 
ATOM   3893 C  CB    . GLU A 1 474 ? -19.084 -4.594  45.482 1.00 21.99  ? 474  GLU A CB    1 
ATOM   3894 C  CG    . GLU A 1 474 ? -20.426 -3.860  45.343 1.00 23.73  ? 474  GLU A CG    1 
ATOM   3895 C  CD    . GLU A 1 474 ? -21.636 -4.806  45.288 1.00 29.83  ? 474  GLU A CD    1 
ATOM   3896 O  OE1   . GLU A 1 474 ? -22.680 -4.470  45.878 1.00 28.02  ? 474  GLU A OE1   1 
ATOM   3897 O  OE2   . GLU A 1 474 ? -21.546 -5.888  44.664 1.00 32.72  ? 474  GLU A OE2   1 
ATOM   3898 N  N     . ILE A 1 475 ? -16.538 -5.713  47.302 1.00 22.42  ? 475  ILE A N     1 
ATOM   3899 C  CA    . ILE A 1 475 ? -15.300 -6.501  47.398 1.00 22.61  ? 475  ILE A CA    1 
ATOM   3900 C  C     . ILE A 1 475 ? -15.472 -7.663  48.388 1.00 24.79  ? 475  ILE A C     1 
ATOM   3901 O  O     . ILE A 1 475 ? -14.869 -8.724  48.231 1.00 26.71  ? 475  ILE A O     1 
ATOM   3902 C  CB    . ILE A 1 475 ? -14.101 -5.636  47.809 1.00 20.67  ? 475  ILE A CB    1 
ATOM   3903 C  CG1   . ILE A 1 475 ? -12.828 -6.132  47.130 1.00 22.01  ? 475  ILE A CG1   1 
ATOM   3904 C  CG2   . ILE A 1 475 ? -13.932 -5.617  49.321 1.00 21.31  ? 475  ILE A CG2   1 
ATOM   3905 C  CD1   . ILE A 1 475 ? -11.558 -5.421  47.580 1.00 15.43  ? 475  ILE A CD1   1 
ATOM   3906 N  N     . THR A 1 476 ? -16.304 -7.447  49.403 1.00 26.28  ? 476  THR A N     1 
ATOM   3907 C  CA    . THR A 1 476 ? -16.620 -8.461  50.396 1.00 26.71  ? 476  THR A CA    1 
ATOM   3908 C  C     . THR A 1 476 ? -17.412 -9.624  49.769 1.00 27.77  ? 476  THR A C     1 
ATOM   3909 O  O     . THR A 1 476 ? -17.105 -10.785 50.010 1.00 29.52  ? 476  THR A O     1 
ATOM   3910 C  CB    . THR A 1 476 ? -17.387 -7.822  51.577 1.00 28.82  ? 476  THR A CB    1 
ATOM   3911 O  OG1   . THR A 1 476 ? -16.488 -7.000  52.339 1.00 29.49  ? 476  THR A OG1   1 
ATOM   3912 C  CG2   . THR A 1 476 ? -18.032 -8.881  52.484 1.00 23.35  ? 476  THR A CG2   1 
ATOM   3913 N  N     . LYS A 1 477 ? -18.417 -9.306  48.957 1.00 29.47  ? 477  LYS A N     1 
ATOM   3914 C  CA    . LYS A 1 477 ? -19.192 -10.325 48.249 1.00 29.38  ? 477  LYS A CA    1 
ATOM   3915 C  C     . LYS A 1 477 ? -18.279 -11.276 47.470 1.00 29.25  ? 477  LYS A C     1 
ATOM   3916 O  O     . LYS A 1 477 ? -18.378 -12.498 47.615 1.00 34.34  ? 477  LYS A O     1 
ATOM   3917 C  CB    . LYS A 1 477 ? -20.216 -9.678  47.310 1.00 30.62  ? 477  LYS A CB    1 
ATOM   3918 C  CG    . LYS A 1 477 ? -21.461 -9.123  48.001 1.00 29.12  ? 477  LYS A CG    1 
ATOM   3919 C  CD    . LYS A 1 477 ? -22.405 -8.493  46.988 1.00 32.91  ? 477  LYS A CD    1 
ATOM   3920 C  CE    . LYS A 1 477 ? -23.096 -7.276  47.601 1.00 42.96  ? 477  LYS A CE    1 
ATOM   3921 N  NZ    . LYS A 1 477 ? -24.251 -6.728  46.803 1.00 47.07  ? 477  LYS A NZ    1 
ATOM   3922 N  N     . VAL A 1 478 ? -17.384 -10.717 46.664 1.00 23.03  ? 478  VAL A N     1 
ATOM   3923 C  CA    . VAL A 1 478 ? -16.468 -11.517 45.848 1.00 25.10  ? 478  VAL A CA    1 
ATOM   3924 C  C     . VAL A 1 478 ? -15.437 -12.264 46.695 1.00 24.84  ? 478  VAL A C     1 
ATOM   3925 O  O     . VAL A 1 478 ? -15.128 -13.422 46.404 1.00 23.13  ? 478  VAL A O     1 
ATOM   3926 C  CB    . VAL A 1 478 ? -15.754 -10.670 44.755 1.00 24.66  ? 478  VAL A CB    1 
ATOM   3927 C  CG1   . VAL A 1 478 ? -14.884 -11.547 43.861 1.00 21.59  ? 478  VAL A CG1   1 
ATOM   3928 C  CG2   . VAL A 1 478 ? -16.775 -9.930  43.912 1.00 24.27  ? 478  VAL A CG2   1 
ATOM   3929 N  N     . PHE A 1 479 ? -14.911 -11.603 47.732 1.00 28.08  ? 479  PHE A N     1 
ATOM   3930 C  CA    . PHE A 1 479 ? -14.065 -12.268 48.726 1.00 28.09  ? 479  PHE A CA    1 
ATOM   3931 C  C     . PHE A 1 479 ? -14.707 -13.542 49.295 1.00 30.35  ? 479  PHE A C     1 
ATOM   3932 O  O     . PHE A 1 479 ? -14.067 -14.590 49.356 1.00 30.46  ? 479  PHE A O     1 
ATOM   3933 C  CB    . PHE A 1 479 ? -13.690 -11.348 49.897 1.00 28.56  ? 479  PHE A CB    1 
ATOM   3934 C  CG    . PHE A 1 479 ? -13.040 -12.096 51.032 1.00 30.71  ? 479  PHE A CG    1 
ATOM   3935 C  CD1   . PHE A 1 479 ? -11.763 -12.652 50.870 1.00 25.53  ? 479  PHE A CD1   1 
ATOM   3936 C  CD2   . PHE A 1 479 ? -13.731 -12.325 52.227 1.00 28.62  ? 479  PHE A CD2   1 
ATOM   3937 C  CE1   . PHE A 1 479 ? -11.173 -13.400 51.898 1.00 29.07  ? 479  PHE A CE1   1 
ATOM   3938 C  CE2   . PHE A 1 479 ? -13.148 -13.063 53.266 1.00 26.84  ? 479  PHE A CE2   1 
ATOM   3939 C  CZ    . PHE A 1 479 ? -11.866 -13.604 53.101 1.00 30.10  ? 479  PHE A CZ    1 
ATOM   3940 N  N     . ASN A 1 480 ? -15.959 -13.438 49.735 1.00 32.92  ? 480  ASN A N     1 
ATOM   3941 C  CA    . ASN A 1 480 ? -16.679 -14.592 50.287 1.00 34.18  ? 480  ASN A CA    1 
ATOM   3942 C  C     . ASN A 1 480 ? -16.831 -15.760 49.305 1.00 35.12  ? 480  ASN A C     1 
ATOM   3943 O  O     . ASN A 1 480 ? -16.737 -16.922 49.704 1.00 34.93  ? 480  ASN A O     1 
ATOM   3944 C  CB    . ASN A 1 480 ? -18.033 -14.164 50.854 1.00 33.49  ? 480  ASN A CB    1 
ATOM   3945 C  CG    . ASN A 1 480 ? -17.912 -13.516 52.223 1.00 32.92  ? 480  ASN A CG    1 
ATOM   3946 O  OD1   . ASN A 1 480 ? -16.910 -13.704 52.924 1.00 30.68  ? 480  ASN A OD1   1 
ATOM   3947 N  ND2   . ASN A 1 480 ? -18.938 -12.753 52.618 1.00 25.05  ? 480  ASN A ND2   1 
ATOM   3948 N  N     . GLN A 1 481 ? -17.053 -15.447 48.028 1.00 36.00  ? 481  GLN A N     1 
ATOM   3949 C  CA    . GLN A 1 481 ? -17.046 -16.464 46.973 1.00 35.79  ? 481  GLN A CA    1 
ATOM   3950 C  C     . GLN A 1 481 ? -15.683 -17.105 46.899 1.00 34.90  ? 481  GLN A C     1 
ATOM   3951 O  O     . GLN A 1 481 ? -15.565 -18.323 46.791 1.00 35.66  ? 481  GLN A O     1 
ATOM   3952 C  CB    . GLN A 1 481 ? -17.365 -15.850 45.616 1.00 36.29  ? 481  GLN A CB    1 
ATOM   3953 C  CG    . GLN A 1 481 ? -18.816 -15.458 45.419 1.00 40.98  ? 481  GLN A CG    1 
ATOM   3954 C  CD    . GLN A 1 481 ? -19.070 -14.850 44.049 1.00 46.29  ? 481  GLN A CD    1 
ATOM   3955 O  OE1   . GLN A 1 481 ? -18.133 -14.550 43.292 1.00 43.69  ? 481  GLN A OE1   1 
ATOM   3956 N  NE2   . GLN A 1 481 ? -20.346 -14.667 43.719 1.00 47.80  ? 481  GLN A NE2   1 
ATOM   3957 N  N     . ARG A 1 482 ? -14.651 -16.270 46.955 1.00 34.46  ? 482  ARG A N     1 
ATOM   3958 C  CA    . ARG A 1 482 ? -13.282 -16.736 46.899 1.00 33.32  ? 482  ARG A CA    1 
ATOM   3959 C  C     . ARG A 1 482 ? -12.988 -17.699 48.041 1.00 34.95  ? 482  ARG A C     1 
ATOM   3960 O  O     . ARG A 1 482 ? -12.417 -18.765 47.823 1.00 37.87  ? 482  ARG A O     1 
ATOM   3961 C  CB    . ARG A 1 482 ? -12.331 -15.548 46.964 1.00 34.17  ? 482  ARG A CB    1 
ATOM   3962 C  CG    . ARG A 1 482 ? -10.874 -15.922 46.788 1.00 31.34  ? 482  ARG A CG    1 
ATOM   3963 C  CD    . ARG A 1 482 ? -10.130 -16.060 48.096 1.00 25.65  ? 482  ARG A CD    1 
ATOM   3964 N  NE    . ARG A 1 482 ? -8.831  -16.641 47.800 1.00 24.48  ? 482  ARG A NE    1 
ATOM   3965 C  CZ    . ARG A 1 482 ? -7.753  -16.578 48.571 1.00 25.68  ? 482  ARG A CZ    1 
ATOM   3966 N  NH1   . ARG A 1 482 ? -7.773  -15.943 49.745 1.00 29.15  ? 482  ARG A NH1   1 
ATOM   3967 N  NH2   . ARG A 1 482 ? -6.643  -17.169 48.153 1.00 14.45  ? 482  ARG A NH2   1 
ATOM   3968 N  N     . LYS A 1 483 ? -13.379 -17.312 49.253 1.00 35.08  ? 483  LYS A N     1 
ATOM   3969 C  CA    . LYS A 1 483 ? -13.189 -18.114 50.461 1.00 34.30  ? 483  LYS A CA    1 
ATOM   3970 C  C     . LYS A 1 483 ? -13.739 -19.544 50.329 1.00 34.36  ? 483  LYS A C     1 
ATOM   3971 O  O     . LYS A 1 483 ? -13.056 -20.512 50.680 1.00 37.25  ? 483  LYS A O     1 
ATOM   3972 C  CB    . LYS A 1 483 ? -13.834 -17.388 51.641 1.00 35.37  ? 483  LYS A CB    1 
ATOM   3973 C  CG    . LYS A 1 483 ? -13.657 -18.031 52.993 1.00 37.23  ? 483  LYS A CG    1 
ATOM   3974 C  CD    . LYS A 1 483 ? -14.497 -17.281 54.008 1.00 45.08  ? 483  LYS A CD    1 
ATOM   3975 C  CE    . LYS A 1 483 ? -14.214 -17.725 55.425 1.00 48.45  ? 483  LYS A CE    1 
ATOM   3976 N  NZ    . LYS A 1 483 ? -14.651 -16.655 56.368 1.00 53.14  ? 483  LYS A NZ    1 
ATOM   3977 N  N     . GLU A 1 484 ? -14.963 -19.656 49.813 1.00 31.80  ? 484  GLU A N     1 
ATOM   3978 C  CA    . GLU A 1 484 ? -15.653 -20.931 49.589 1.00 31.91  ? 484  GLU A CA    1 
ATOM   3979 C  C     . GLU A 1 484 ? -14.859 -21.883 48.696 1.00 31.89  ? 484  GLU A C     1 
ATOM   3980 O  O     . GLU A 1 484 ? -14.737 -23.080 48.998 1.00 32.24  ? 484  GLU A O     1 
ATOM   3981 C  CB    . GLU A 1 484 ? -17.040 -20.677 48.960 1.00 33.98  ? 484  GLU A CB    1 
ATOM   3982 C  CG    . GLU A 1 484 ? -17.860 -21.946 48.612 1.00 39.20  ? 484  GLU A CG    1 
ATOM   3983 C  CD    . GLU A 1 484 ? -19.123 -21.673 47.765 1.00 44.83  ? 484  GLU A CD    1 
ATOM   3984 O  OE1   . GLU A 1 484 ? -19.594 -20.514 47.686 1.00 44.23  ? 484  GLU A OE1   1 
ATOM   3985 O  OE2   . GLU A 1 484 ? -19.651 -22.639 47.174 1.00 47.50  ? 484  GLU A OE2   1 
ATOM   3986 N  N     . HIS A 1 485 ? -14.343 -21.350 47.589 1.00 27.98  ? 485  HIS A N     1 
ATOM   3987 C  CA    . HIS A 1 485 ? -13.620 -22.160 46.626 1.00 24.81  ? 485  HIS A CA    1 
ATOM   3988 C  C     . HIS A 1 485 ? -12.265 -22.585 47.152 1.00 24.63  ? 485  HIS A C     1 
ATOM   3989 O  O     . HIS A 1 485 ? -11.867 -23.733 46.950 1.00 26.15  ? 485  HIS A O     1 
ATOM   3990 C  CB    . HIS A 1 485 ? -13.515 -21.455 45.277 1.00 24.40  ? 485  HIS A CB    1 
ATOM   3991 C  CG    . HIS A 1 485 ? -14.831 -21.333 44.575 1.00 26.20  ? 485  HIS A CG    1 
ATOM   3992 N  ND1   . HIS A 1 485 ? -15.428 -22.393 43.926 1.00 28.32  ? 485  HIS A ND1   1 
ATOM   3993 C  CD2   . HIS A 1 485 ? -15.681 -20.289 44.447 1.00 26.37  ? 485  HIS A CD2   1 
ATOM   3994 C  CE1   . HIS A 1 485 ? -16.584 -22.005 43.417 1.00 24.96  ? 485  HIS A CE1   1 
ATOM   3995 N  NE2   . HIS A 1 485 ? -16.760 -20.732 43.718 1.00 30.09  ? 485  HIS A NE2   1 
ATOM   3996 N  N     . LYS A 1 486 ? -11.569 -21.679 47.843 1.00 24.98  ? 486  LYS A N     1 
ATOM   3997 C  CA    . LYS A 1 486 ? -10.283 -22.024 48.432 1.00 25.62  ? 486  LYS A CA    1 
ATOM   3998 C  C     . LYS A 1 486 ? -10.494 -23.175 49.394 1.00 26.14  ? 486  LYS A C     1 
ATOM   3999 O  O     . LYS A 1 486 ? -9.709  -24.111 49.407 1.00 27.80  ? 486  LYS A O     1 
ATOM   4000 C  CB    . LYS A 1 486 ? -9.633  -20.841 49.144 1.00 27.68  ? 486  LYS A CB    1 
ATOM   4001 C  CG    . LYS A 1 486 ? -8.178  -21.127 49.514 1.00 28.10  ? 486  LYS A CG    1 
ATOM   4002 C  CD    . LYS A 1 486 ? -7.542  -20.017 50.302 1.00 32.08  ? 486  LYS A CD    1 
ATOM   4003 C  CE    . LYS A 1 486 ? -6.186  -20.463 50.792 1.00 34.54  ? 486  LYS A CE    1 
ATOM   4004 N  NZ    . LYS A 1 486 ? -5.303  -19.331 51.152 1.00 38.75  ? 486  LYS A NZ    1 
ATOM   4005 N  N     . GLY A 1 487 ? -11.583 -23.107 50.160 1.00 29.25  ? 487  GLY A N     1 
ATOM   4006 C  CA    . GLY A 1 487 ? -12.036 -24.203 51.015 1.00 31.13  ? 487  GLY A CA    1 
ATOM   4007 C  C     . GLY A 1 487 ? -12.129 -25.537 50.290 1.00 31.06  ? 487  GLY A C     1 
ATOM   4008 O  O     . GLY A 1 487 ? -11.667 -26.566 50.804 1.00 33.13  ? 487  GLY A O     1 
ATOM   4009 N  N     . TYR A 1 488 ? -12.702 -25.525 49.088 1.00 30.23  ? 488  TYR A N     1 
ATOM   4010 C  CA    . TYR A 1 488 ? -12.784 -26.743 48.269 1.00 30.94  ? 488  TYR A CA    1 
ATOM   4011 C  C     . TYR A 1 488 ? -11.407 -27.211 47.780 1.00 30.80  ? 488  TYR A C     1 
ATOM   4012 O  O     . TYR A 1 488 ? -11.108 -28.405 47.791 1.00 32.23  ? 488  TYR A O     1 
ATOM   4013 C  CB    . TYR A 1 488 ? -13.719 -26.536 47.076 1.00 31.56  ? 488  TYR A CB    1 
ATOM   4014 C  CG    . TYR A 1 488 ? -15.145 -26.168 47.441 1.00 30.31  ? 488  TYR A CG    1 
ATOM   4015 C  CD1   . TYR A 1 488 ? -15.707 -26.554 48.661 1.00 28.24  ? 488  TYR A CD1   1 
ATOM   4016 C  CD2   . TYR A 1 488 ? -15.942 -25.465 46.544 1.00 29.85  ? 488  TYR A CD2   1 
ATOM   4017 C  CE1   . TYR A 1 488 ? -17.017 -26.217 48.984 1.00 29.93  ? 488  TYR A CE1   1 
ATOM   4018 C  CE2   . TYR A 1 488 ? -17.259 -25.133 46.850 1.00 28.88  ? 488  TYR A CE2   1 
ATOM   4019 C  CZ    . TYR A 1 488 ? -17.787 -25.511 48.063 1.00 29.66  ? 488  TYR A CZ    1 
ATOM   4020 O  OH    . TYR A 1 488 ? -19.085 -25.167 48.351 1.00 33.49  ? 488  TYR A OH    1 
ATOM   4021 N  N     . MET A 1 489 ? -10.566 -26.265 47.368 1.00 28.12  ? 489  MET A N     1 
ATOM   4022 C  CA    . MET A 1 489 ? -9.249  -26.592 46.835 1.00 26.05  ? 489  MET A CA    1 
ATOM   4023 C  C     . MET A 1 489 ? -8.359  -27.217 47.912 1.00 25.14  ? 489  MET A C     1 
ATOM   4024 O  O     . MET A 1 489 ? -7.671  -28.218 47.677 1.00 23.16  ? 489  MET A O     1 
ATOM   4025 C  CB    . MET A 1 489 ? -8.600  -25.342 46.236 1.00 26.39  ? 489  MET A CB    1 
ATOM   4026 C  CG    . MET A 1 489 ? -7.163  -25.520 45.830 1.00 26.86  ? 489  MET A CG    1 
ATOM   4027 S  SD    . MET A 1 489 ? -6.300  -23.961 45.737 1.00 40.51  ? 489  MET A SD    1 
ATOM   4028 C  CE    . MET A 1 489 ? -5.932  -23.632 47.455 1.00 28.72  ? 489  MET A CE    1 
ATOM   4029 N  N     . LEU A 1 490 ? -8.395  -26.638 49.103 1.00 24.88  ? 490  LEU A N     1 
ATOM   4030 C  CA    . LEU A 1 490 ? -7.575  -27.144 50.185 1.00 25.68  ? 490  LEU A CA    1 
ATOM   4031 C  C     . LEU A 1 490 ? -8.051  -28.509 50.677 1.00 26.23  ? 490  LEU A C     1 
ATOM   4032 O  O     . LEU A 1 490 ? -7.234  -29.388 50.937 1.00 28.56  ? 490  LEU A O     1 
ATOM   4033 C  CB    . LEU A 1 490 ? -7.501  -26.128 51.318 1.00 24.01  ? 490  LEU A CB    1 
ATOM   4034 C  CG    . LEU A 1 490 ? -6.575  -24.936 51.052 1.00 22.34  ? 490  LEU A CG    1 
ATOM   4035 C  CD1   . LEU A 1 490 ? -6.580  -24.004 52.247 1.00 18.97  ? 490  LEU A CD1   1 
ATOM   4036 C  CD2   . LEU A 1 490 ? -5.137  -25.375 50.730 1.00 18.76  ? 490  LEU A CD2   1 
ATOM   4037 N  N     . ALA A 1 491 ? -9.364  -28.692 50.789 1.00 25.85  ? 491  ALA A N     1 
ATOM   4038 C  CA    . ALA A 1 491 ? -9.904  -30.001 51.145 1.00 25.77  ? 491  ALA A CA    1 
ATOM   4039 C  C     . ALA A 1 491 ? -9.449  -31.065 50.134 1.00 26.03  ? 491  ALA A C     1 
ATOM   4040 O  O     . ALA A 1 491 ? -8.972  -32.131 50.531 1.00 27.99  ? 491  ALA A O     1 
ATOM   4041 C  CB    . ALA A 1 491 ? -11.427 -29.960 51.257 1.00 22.41  ? 491  ALA A CB    1 
ATOM   4042 N  N     . ALA A 1 492 ? -9.568  -30.764 48.841 1.00 24.80  ? 492  ALA A N     1 
ATOM   4043 C  CA    . ALA A 1 492 ? -9.138  -31.698 47.802 1.00 27.02  ? 492  ALA A CA    1 
ATOM   4044 C  C     . ALA A 1 492 ? -7.643  -31.946 47.889 1.00 27.57  ? 492  ALA A C     1 
ATOM   4045 O  O     . ALA A 1 492 ? -7.186  -33.072 47.734 1.00 24.85  ? 492  ALA A O     1 
ATOM   4046 C  CB    . ALA A 1 492 ? -9.514  -31.193 46.421 1.00 28.20  ? 492  ALA A CB    1 
ATOM   4047 N  N     . GLN A 1 493 ? -6.885  -30.885 48.153 1.00 28.66  ? 493  GLN A N     1 
ATOM   4048 C  CA    . GLN A 1 493 ? -5.441  -31.002 48.326 1.00 28.46  ? 493  GLN A CA    1 
ATOM   4049 C  C     . GLN A 1 493 ? -5.101  -31.933 49.497 1.00 29.64  ? 493  GLN A C     1 
ATOM   4050 O  O     . GLN A 1 493 ? -4.233  -32.801 49.369 1.00 30.01  ? 493  GLN A O     1 
ATOM   4051 C  CB    . GLN A 1 493 ? -4.834  -29.618 48.535 1.00 26.64  ? 493  GLN A CB    1 
ATOM   4052 C  CG    . GLN A 1 493 ? -3.329  -29.584 48.677 1.00 25.68  ? 493  GLN A CG    1 
ATOM   4053 C  CD    . GLN A 1 493 ? -2.838  -28.171 48.787 1.00 25.82  ? 493  GLN A CD    1 
ATOM   4054 O  OE1   . GLN A 1 493 ? -2.558  -27.686 49.883 1.00 22.12  ? 493  GLN A OE1   1 
ATOM   4055 N  NE2   . GLN A 1 493 ? -2.790  -27.472 47.658 1.00 28.83  ? 493  GLN A NE2   1 
ATOM   4056 N  N     . ARG A 1 494 ? -5.795  -31.760 50.626 1.00 28.04  ? 494  ARG A N     1 
ATOM   4057 C  CA    . ARG A 1 494 ? -5.593  -32.639 51.790 1.00 28.65  ? 494  ARG A CA    1 
ATOM   4058 C  C     . ARG A 1 494 ? -5.981  -34.084 51.491 1.00 27.82  ? 494  ARG A C     1 
ATOM   4059 O  O     . ARG A 1 494 ? -5.277  -35.011 51.909 1.00 28.08  ? 494  ARG A O     1 
ATOM   4060 C  CB    . ARG A 1 494 ? -6.334  -32.127 53.031 1.00 26.32  ? 494  ARG A CB    1 
ATOM   4061 C  CG    . ARG A 1 494 ? -5.746  -30.851 53.612 1.00 28.11  ? 494  ARG A CG    1 
ATOM   4062 C  CD    . ARG A 1 494 ? -6.391  -30.441 54.951 1.00 24.13  ? 494  ARG A CD    1 
ATOM   4063 N  NE    . ARG A 1 494 ? -7.820  -30.138 54.862 1.00 26.59  ? 494  ARG A NE    1 
ATOM   4064 C  CZ    . ARG A 1 494 ? -8.347  -28.930 54.651 1.00 29.44  ? 494  ARG A CZ    1 
ATOM   4065 N  NH1   . ARG A 1 494 ? -7.576  -27.862 54.469 1.00 28.24  ? 494  ARG A NH1   1 
ATOM   4066 N  NH2   . ARG A 1 494 ? -9.665  -28.791 54.610 1.00 24.39  ? 494  ARG A NH2   1 
ATOM   4067 N  N     . ASN A 1 495 ? -7.104  -34.259 50.783 1.00 28.10  ? 495  ASN A N     1 
ATOM   4068 C  CA    . ASN A 1 495 ? -7.571  -35.578 50.328 1.00 29.07  ? 495  ASN A CA    1 
ATOM   4069 C  C     . ASN A 1 495 ? -6.550  -36.263 49.412 1.00 30.41  ? 495  ASN A C     1 
ATOM   4070 O  O     . ASN A 1 495 ? -6.314  -37.471 49.526 1.00 31.62  ? 495  ASN A O     1 
ATOM   4071 C  CB    . ASN A 1 495 ? -8.922  -35.478 49.609 1.00 28.21  ? 495  ASN A CB    1 
ATOM   4072 C  CG    . ASN A 1 495 ? -10.087 -35.211 50.553 1.00 29.56  ? 495  ASN A CG    1 
ATOM   4073 O  OD1   . ASN A 1 495 ? -10.100 -35.657 51.699 1.00 31.63  ? 495  ASN A OD1   1 
ATOM   4074 N  ND2   . ASN A 1 495 ? -11.084 -34.484 50.061 1.00 29.55  ? 495  ASN A ND2   1 
ATOM   4075 N  N     . GLY A 1 496 ? -5.945  -35.484 48.512 1.00 29.00  ? 496  GLY A N     1 
ATOM   4076 C  CA    . GLY A 1 496 ? -4.845  -35.960 47.681 1.00 27.88  ? 496  GLY A CA    1 
ATOM   4077 C  C     . GLY A 1 496 ? -3.784  -36.635 48.540 1.00 29.78  ? 496  GLY A C     1 
ATOM   4078 O  O     . GLY A 1 496 ? -3.412  -37.775 48.281 1.00 29.98  ? 496  GLY A O     1 
ATOM   4079 N  N     . GLU A 1 497 ? -3.337  -35.945 49.589 1.00 29.54  ? 497  GLU A N     1 
ATOM   4080 C  CA    . GLU A 1 497 ? -2.261  -36.440 50.449 1.00 29.67  ? 497  GLU A CA    1 
ATOM   4081 C  C     . GLU A 1 497 ? -2.634  -37.710 51.194 1.00 31.27  ? 497  GLU A C     1 
ATOM   4082 O  O     . GLU A 1 497 ? -1.791  -38.578 51.386 1.00 33.92  ? 497  GLU A O     1 
ATOM   4083 C  CB    . GLU A 1 497 ? -1.790  -35.364 51.420 1.00 26.56  ? 497  GLU A CB    1 
ATOM   4084 C  CG    . GLU A 1 497 ? -1.207  -34.122 50.738 1.00 30.42  ? 497  GLU A CG    1 
ATOM   4085 C  CD    . GLU A 1 497 ? 0.030   -34.398 49.877 1.00 34.64  ? 497  GLU A CD    1 
ATOM   4086 O  OE1   . GLU A 1 497 ? 0.889   -35.225 50.266 1.00 36.14  ? 497  GLU A OE1   1 
ATOM   4087 O  OE2   . GLU A 1 497 ? 0.148   -33.769 48.803 1.00 34.73  ? 497  GLU A OE2   1 
ATOM   4088 N  N     . ILE A 1 498 ? -3.900  -37.834 51.585 1.00 32.91  ? 498  ILE A N     1 
ATOM   4089 C  CA    . ILE A 1 498 ? -4.389  -39.065 52.208 1.00 32.01  ? 498  ILE A CA    1 
ATOM   4090 C  C     . ILE A 1 498 ? -4.280  -40.239 51.239 1.00 33.29  ? 498  ILE A C     1 
ATOM   4091 O  O     . ILE A 1 498 ? -4.022  -41.379 51.654 1.00 34.44  ? 498  ILE A O     1 
ATOM   4092 C  CB    . ILE A 1 498 ? -5.855  -38.930 52.687 1.00 32.02  ? 498  ILE A CB    1 
ATOM   4093 C  CG1   . ILE A 1 498 ? -5.938  -38.017 53.911 1.00 33.62  ? 498  ILE A CG1   1 
ATOM   4094 C  CG2   . ILE A 1 498 ? -6.455  -40.301 53.026 1.00 29.66  ? 498  ILE A CG2   1 
ATOM   4095 C  CD1   . ILE A 1 498 ? -7.375  -37.670 54.331 1.00 35.05  ? 498  ILE A CD1   1 
ATOM   4096 N  N     . ILE A 1 499 ? -4.484  -39.950 49.954 1.00 34.12  ? 499  ILE A N     1 
ATOM   4097 C  CA    . ILE A 1 499 ? -4.438  -40.964 48.899 1.00 33.86  ? 499  ILE A CA    1 
ATOM   4098 C  C     . ILE A 1 499 ? -2.996  -41.350 48.557 1.00 34.40  ? 499  ILE A C     1 
ATOM   4099 O  O     . ILE A 1 499 ? -2.692  -42.533 48.361 1.00 35.88  ? 499  ILE A O     1 
ATOM   4100 C  CB    . ILE A 1 499 ? -5.264  -40.528 47.651 1.00 34.17  ? 499  ILE A CB    1 
ATOM   4101 C  CG1   . ILE A 1 499 ? -6.756  -40.466 48.009 1.00 31.62  ? 499  ILE A CG1   1 
ATOM   4102 C  CG2   . ILE A 1 499 ? -5.059  -41.485 46.480 1.00 30.60  ? 499  ILE A CG2   1 
ATOM   4103 C  CD1   . ILE A 1 499 ? -7.625  -39.694 46.996 1.00 33.34  ? 499  ILE A CD1   1 
ATOM   4104 N  N     . LYS A 1 500 ? -2.107  -40.363 48.521 1.00 34.70  ? 500  LYS A N     1 
ATOM   4105 C  CA    . LYS A 1 500 ? -0.670  -40.622 48.313 1.00 36.27  ? 500  LYS A CA    1 
ATOM   4106 C  C     . LYS A 1 500 ? -0.040  -41.466 49.433 1.00 38.81  ? 500  LYS A C     1 
ATOM   4107 O  O     . LYS A 1 500 ? 0.807   -42.314 49.162 1.00 40.97  ? 500  LYS A O     1 
ATOM   4108 C  CB    . LYS A 1 500 ? 0.112   -39.322 48.140 1.00 33.53  ? 500  LYS A CB    1 
ATOM   4109 C  CG    . LYS A 1 500 ? -0.320  -38.462 46.960 1.00 32.46  ? 500  LYS A CG    1 
ATOM   4110 C  CD    . LYS A 1 500 ? 0.721   -37.389 46.682 1.00 30.06  ? 500  LYS A CD    1 
ATOM   4111 C  CE    . LYS A 1 500 ? 0.149   -36.231 45.894 1.00 30.75  ? 500  LYS A CE    1 
ATOM   4112 N  NZ    . LYS A 1 500 ? 1.061   -35.050 45.937 1.00 32.13  ? 500  LYS A NZ    1 
ATOM   4113 N  N     . GLU A 1 501 ? -0.446  -41.227 50.683 1.00 41.79  ? 501  GLU A N     1 
ATOM   4114 C  CA    . GLU A 1 501 ? -0.034  -42.072 51.816 1.00 44.00  ? 501  GLU A CA    1 
ATOM   4115 C  C     . GLU A 1 501 ? -0.545  -43.512 51.676 1.00 42.74  ? 501  GLU A C     1 
ATOM   4116 O  O     . GLU A 1 501 ? 0.126   -44.458 52.067 1.00 42.13  ? 501  GLU A O     1 
ATOM   4117 C  CB    . GLU A 1 501 ? -0.513  -41.479 53.151 1.00 44.92  ? 501  GLU A CB    1 
ATOM   4118 C  CG    . GLU A 1 501 ? 0.454   -40.468 53.812 1.00 55.87  ? 501  GLU A CG    1 
ATOM   4119 C  CD    . GLU A 1 501 ? 1.760   -41.100 54.368 1.00 60.04  ? 501  GLU A CD    1 
ATOM   4120 O  OE1   . GLU A 1 501 ? 1.824   -42.335 54.600 1.00 56.18  ? 501  GLU A OE1   1 
ATOM   4121 O  OE2   . GLU A 1 501 ? 2.731   -40.338 54.580 1.00 62.54  ? 501  GLU A OE2   1 
ATOM   4122 N  N     . ALA A 1 502 ? -1.736  -43.668 51.110 1.00 43.49  ? 502  ALA A N     1 
ATOM   4123 C  CA    . ALA A 1 502 ? -2.340  -44.986 50.948 1.00 46.15  ? 502  ALA A CA    1 
ATOM   4124 C  C     . ALA A 1 502 ? -1.723  -45.780 49.793 1.00 49.12  ? 502  ALA A C     1 
ATOM   4125 O  O     . ALA A 1 502 ? -1.843  -47.008 49.748 1.00 51.31  ? 502  ALA A O     1 
ATOM   4126 C  CB    . ALA A 1 502 ? -3.856  -44.871 50.781 1.00 44.51  ? 502  ALA A CB    1 
ATOM   4127 N  N     . LEU A 1 503 ? -1.060  -45.081 48.872 1.00 50.69  ? 503  LEU A N     1 
ATOM   4128 C  CA    . LEU A 1 503 ? -0.398  -45.725 47.742 1.00 52.37  ? 503  LEU A CA    1 
ATOM   4129 C  C     . LEU A 1 503 ? 0.878   -46.449 48.147 1.00 55.06  ? 503  LEU A C     1 
ATOM   4130 O  O     . LEU A 1 503 ? 1.396   -47.266 47.390 1.00 56.86  ? 503  LEU A O     1 
ATOM   4131 C  CB    . LEU A 1 503 ? -0.104  -44.719 46.628 1.00 51.79  ? 503  LEU A CB    1 
ATOM   4132 C  CG    . LEU A 1 503 ? -1.240  -44.487 45.630 1.00 51.80  ? 503  LEU A CG    1 
ATOM   4133 C  CD1   . LEU A 1 503 ? -1.052  -43.173 44.912 1.00 52.35  ? 503  LEU A CD1   1 
ATOM   4134 C  CD2   . LEU A 1 503 ? -1.330  -45.635 44.635 1.00 51.56  ? 503  LEU A CD2   1 
ATOM   4135 N  N     . HIS A 1 504 ? 1.379   -46.151 49.341 1.00 56.75  ? 504  HIS A N     1 
ATOM   4136 C  CA    . HIS A 1 504 ? 2.563   -46.829 49.863 1.00 59.08  ? 504  HIS A CA    1 
ATOM   4137 C  C     . HIS A 1 504 ? 2.293   -48.306 50.135 1.00 59.74  ? 504  HIS A C     1 
ATOM   4138 O  O     . HIS A 1 504 ? 3.202   -49.131 50.060 1.00 60.94  ? 504  HIS A O     1 
ATOM   4139 C  CB    . HIS A 1 504 ? 3.077   -46.126 51.119 1.00 59.74  ? 504  HIS A CB    1 
ATOM   4140 C  CG    . HIS A 1 504 ? 3.577   -44.739 50.863 1.00 61.89  ? 504  HIS A CG    1 
ATOM   4141 N  ND1   . HIS A 1 504 ? 4.465   -44.445 49.850 1.00 63.56  ? 504  HIS A ND1   1 
ATOM   4142 C  CD2   . HIS A 1 504 ? 3.315   -43.566 51.484 1.00 63.29  ? 504  HIS A CD2   1 
ATOM   4143 C  CE1   . HIS A 1 504 ? 4.726   -43.150 49.857 1.00 65.24  ? 504  HIS A CE1   1 
ATOM   4144 N  NE2   . HIS A 1 504 ? 4.040   -42.593 50.838 1.00 65.13  ? 504  HIS A NE2   1 
ATOM   4145 N  N     . ASN A 1 505 ? 1.035   -48.627 50.431 1.00 59.16  ? 505  ASN A N     1 
ATOM   4146 C  CA    . ASN A 1 505 ? 0.607   -50.006 50.650 1.00 59.01  ? 505  ASN A CA    1 
ATOM   4147 C  C     . ASN A 1 505 ? -0.649  -50.367 49.842 1.00 57.74  ? 505  ASN A C     1 
ATOM   4148 O  O     . ASN A 1 505 ? -1.716  -50.589 50.421 1.00 58.42  ? 505  ASN A O     1 
ATOM   4149 C  CB    . ASN A 1 505 ? 0.381   -50.253 52.147 1.00 59.74  ? 505  ASN A CB    1 
ATOM   4150 C  CG    . ASN A 1 505 ? 1.660   -50.156 52.954 1.00 61.78  ? 505  ASN A CG    1 
ATOM   4151 O  OD1   . ASN A 1 505 ? 1.942   -49.128 53.570 1.00 62.12  ? 505  ASN A OD1   1 
ATOM   4152 N  ND2   . ASN A 1 505 ? 2.451   -51.223 52.941 1.00 64.09  ? 505  ASN A ND2   1 
ATOM   4153 N  N     . PRO A 1 506 ? -0.527  -50.433 48.501 1.00 57.16  ? 506  PRO A N     1 
ATOM   4154 C  CA    . PRO A 1 506 ? -1.699  -50.713 47.685 1.00 57.15  ? 506  PRO A CA    1 
ATOM   4155 C  C     . PRO A 1 506 ? -2.128  -52.165 47.796 1.00 58.53  ? 506  PRO A C     1 
ATOM   4156 O  O     . PRO A 1 506 ? -1.292  -53.066 47.754 1.00 59.85  ? 506  PRO A O     1 
ATOM   4157 C  CB    . PRO A 1 506 ? -1.224  -50.405 46.266 1.00 57.41  ? 506  PRO A CB    1 
ATOM   4158 C  CG    . PRO A 1 506 ? 0.216   -50.615 46.290 1.00 57.90  ? 506  PRO A CG    1 
ATOM   4159 C  CD    . PRO A 1 506 ? 0.696   -50.339 47.684 1.00 58.52  ? 506  PRO A CD    1 
ATOM   4160 N  N     . ASN A 1 507 ? -3.427  -52.384 47.950 1.00 59.08  ? 507  ASN A N     1 
ATOM   4161 C  CA    . ASN A 1 507 ? -3.945  -53.735 48.093 1.00 60.09  ? 507  ASN A CA    1 
ATOM   4162 C  C     . ASN A 1 507 ? -4.013  -54.470 46.764 1.00 61.79  ? 507  ASN A C     1 
ATOM   4163 O  O     . ASN A 1 507 ? -4.012  -53.856 45.695 1.00 62.32  ? 507  ASN A O     1 
ATOM   4164 C  CB    . ASN A 1 507 ? -5.305  -53.733 48.792 1.00 59.02  ? 507  ASN A CB    1 
ATOM   4165 C  CG    . ASN A 1 507 ? -5.200  -53.402 50.268 1.00 58.84  ? 507  ASN A CG    1 
ATOM   4166 O  OD1   . ASN A 1 507 ? -4.420  -52.534 50.675 1.00 60.21  ? 507  ASN A OD1   1 
ATOM   4167 N  ND2   . ASN A 1 507 ? -5.986  -54.091 51.082 1.00 58.39  ? 507  ASN A ND2   1 
ATOM   4168 N  N     . LEU A 1 508 ? -4.047  -55.793 46.849 1.00 63.36  ? 508  LEU A N     1 
ATOM   4169 C  CA    . LEU A 1 508 ? -4.131  -56.635 45.673 1.00 66.37  ? 508  LEU A CA    1 
ATOM   4170 C  C     . LEU A 1 508 ? -5.525  -57.230 45.564 1.00 67.46  ? 508  LEU A C     1 
ATOM   4171 O  O     . LEU A 1 508 ? -5.816  -58.300 46.111 1.00 67.64  ? 508  LEU A O     1 
ATOM   4172 C  CB    . LEU A 1 508 ? -3.048  -57.721 45.701 1.00 67.31  ? 508  LEU A CB    1 
ATOM   4173 C  CG    . LEU A 1 508 ? -1.620  -57.252 45.407 1.00 67.95  ? 508  LEU A CG    1 
ATOM   4174 C  CD1   . LEU A 1 508 ? -0.624  -58.338 45.774 1.00 68.73  ? 508  LEU A CD1   1 
ATOM   4175 C  CD2   . LEU A 1 508 ? -1.461  -56.843 43.942 1.00 66.89  ? 508  LEU A CD2   1 
ATOM   4176 N  N     . SER A 1 509 ? -6.391  -56.494 44.876 1.00 68.40  ? 509  SER A N     1 
ATOM   4177 C  CA    . SER A 1 509 ? -7.743  -56.943 44.567 1.00 70.07  ? 509  SER A CA    1 
ATOM   4178 C  C     . SER A 1 509 ? -8.319  -56.143 43.403 1.00 71.20  ? 509  SER A C     1 
ATOM   4179 O  O     . SER A 1 509 ? -7.746  -55.134 42.977 1.00 71.54  ? 509  SER A O     1 
ATOM   4180 C  CB    . SER A 1 509 ? -8.660  -56.875 45.802 1.00 69.66  ? 509  SER A CB    1 
ATOM   4181 O  OG    . SER A 1 509 ? -8.287  -55.827 46.678 1.00 68.31  ? 509  SER A OG    1 
ATOM   4182 N  N     . VAL A 1 510 ? -9.437  -56.623 42.871 1.00 72.92  ? 510  VAL A N     1 
ATOM   4183 C  CA    . VAL A 1 510 ? -10.176 -55.891 41.858 1.00 73.21  ? 510  VAL A CA    1 
ATOM   4184 C  C     . VAL A 1 510 ? -11.329 -55.171 42.555 1.00 71.89  ? 510  VAL A C     1 
ATOM   4185 O  O     . VAL A 1 510 ? -12.271 -55.802 43.047 1.00 73.59  ? 510  VAL A O     1 
ATOM   4186 C  CB    . VAL A 1 510 ? -10.665 -56.818 40.712 1.00 75.48  ? 510  VAL A CB    1 
ATOM   4187 C  CG1   . VAL A 1 510 ? -11.534 -56.045 39.711 1.00 76.04  ? 510  VAL A CG1   1 
ATOM   4188 C  CG2   . VAL A 1 510 ? -9.472  -57.453 40.001 1.00 75.54  ? 510  VAL A CG2   1 
ATOM   4189 N  N     . ASP A 1 511 ? -11.215 -53.847 42.621 1.00 69.18  ? 511  ASP A N     1 
ATOM   4190 C  CA    . ASP A 1 511 ? -12.233 -52.983 43.211 1.00 65.62  ? 511  ASP A CA    1 
ATOM   4191 C  C     . ASP A 1 511 ? -12.509 -51.801 42.288 1.00 65.14  ? 511  ASP A C     1 
ATOM   4192 O  O     . ASP A 1 511 ? -11.991 -51.741 41.167 1.00 65.16  ? 511  ASP A O     1 
ATOM   4193 C  CB    . ASP A 1 511 ? -11.805 -52.506 44.610 1.00 63.14  ? 511  ASP A CB    1 
ATOM   4194 C  CG    . ASP A 1 511 ? -10.324 -52.144 44.688 1.00 61.70  ? 511  ASP A CG    1 
ATOM   4195 O  OD1   . ASP A 1 511 ? -9.810  -51.502 43.751 1.00 57.80  ? 511  ASP A OD1   1 
ATOM   4196 O  OD2   . ASP A 1 511 ? -9.674  -52.502 45.693 1.00 59.61  ? 511  ASP A OD2   1 
ATOM   4197 N  N     . GLU A 1 512 ? -13.341 -50.877 42.757 1.00 64.38  ? 512  GLU A N     1 
ATOM   4198 C  CA    . GLU A 1 512 ? -13.632 -49.653 42.019 1.00 64.78  ? 512  GLU A CA    1 
ATOM   4199 C  C     . GLU A 1 512 ? -13.345 -48.432 42.890 1.00 62.43  ? 512  GLU A C     1 
ATOM   4200 O  O     . GLU A 1 512 ? -13.474 -48.511 44.116 1.00 62.31  ? 512  GLU A O     1 
ATOM   4201 C  CB    . GLU A 1 512 ? -15.087 -49.645 41.525 1.00 66.96  ? 512  GLU A CB    1 
ATOM   4202 C  CG    . GLU A 1 512 ? -15.411 -50.687 40.439 1.00 72.51  ? 512  GLU A CG    1 
ATOM   4203 C  CD    . GLU A 1 512 ? -14.795 -50.367 39.071 1.00 78.12  ? 512  GLU A CD    1 
ATOM   4204 O  OE1   . GLU A 1 512 ? -15.561 -50.221 38.095 1.00 81.15  ? 512  GLU A OE1   1 
ATOM   4205 O  OE2   . GLU A 1 512 ? -13.552 -50.268 38.961 1.00 79.12  ? 512  GLU A OE2   1 
ATOM   4206 N  N     . PRO A 1 513 ? -12.931 -47.306 42.266 1.00 60.92  ? 513  PRO A N     1 
ATOM   4207 C  CA    . PRO A 1 513 ? -12.769 -46.039 42.980 1.00 57.97  ? 513  PRO A CA    1 
ATOM   4208 C  C     . PRO A 1 513 ? -14.065 -45.622 43.666 1.00 56.73  ? 513  PRO A C     1 
ATOM   4209 O  O     . PRO A 1 513 ? -15.157 -45.844 43.126 1.00 56.72  ? 513  PRO A O     1 
ATOM   4210 C  CB    . PRO A 1 513 ? -12.424 -45.045 41.863 1.00 58.23  ? 513  PRO A CB    1 
ATOM   4211 C  CG    . PRO A 1 513 ? -12.850 -45.722 40.593 1.00 60.24  ? 513  PRO A CG    1 
ATOM   4212 C  CD    . PRO A 1 513 ? -12.574 -47.161 40.844 1.00 61.50  ? 513  PRO A CD    1 
ATOM   4213 N  N     . LEU A 1 514 ? -13.931 -45.030 44.850 1.00 54.34  ? 514  LEU A N     1 
ATOM   4214 C  CA    . LEU A 1 514 ? -15.076 -44.640 45.671 1.00 53.08  ? 514  LEU A CA    1 
ATOM   4215 C  C     . LEU A 1 514 ? -15.796 -43.423 45.114 1.00 53.10  ? 514  LEU A C     1 
ATOM   4216 O  O     . LEU A 1 514 ? -15.158 -42.472 44.650 1.00 52.72  ? 514  LEU A O     1 
ATOM   4217 C  CB    . LEU A 1 514 ? -14.619 -44.352 47.100 1.00 51.55  ? 514  LEU A CB    1 
ATOM   4218 C  CG    . LEU A 1 514 ? -14.546 -45.468 48.145 1.00 49.36  ? 514  LEU A CG    1 
ATOM   4219 C  CD1   . LEU A 1 514 ? -14.613 -46.879 47.556 1.00 49.93  ? 514  LEU A CD1   1 
ATOM   4220 C  CD2   . LEU A 1 514 ? -13.294 -45.278 48.986 1.00 46.43  ? 514  LEU A CD2   1 
ATOM   4221 N  N     . ASP A 1 515 ? -17.126 -43.458 45.159 1.00 53.61  ? 515  ASP A N     1 
ATOM   4222 C  CA    . ASP A 1 515 ? -17.925 -42.309 44.747 1.00 53.84  ? 515  ASP A CA    1 
ATOM   4223 C  C     . ASP A 1 515 ? -17.981 -41.283 45.877 1.00 49.85  ? 515  ASP A C     1 
ATOM   4224 O  O     . ASP A 1 515 ? -18.857 -41.340 46.746 1.00 50.24  ? 515  ASP A O     1 
ATOM   4225 C  CB    . ASP A 1 515 ? -19.334 -42.727 44.304 1.00 58.43  ? 515  ASP A CB    1 
ATOM   4226 C  CG    . ASP A 1 515 ? -20.191 -41.534 43.866 1.00 65.56  ? 515  ASP A CG    1 
ATOM   4227 O  OD1   . ASP A 1 515 ? -21.401 -41.515 44.189 1.00 69.42  ? 515  ASP A OD1   1 
ATOM   4228 O  OD2   . ASP A 1 515 ? -19.656 -40.609 43.208 1.00 68.11  ? 515  ASP A OD2   1 
ATOM   4229 N  N     . VAL A 1 516 ? -17.027 -40.355 45.858 1.00 45.32  ? 516  VAL A N     1 
ATOM   4230 C  CA    . VAL A 1 516 ? -16.947 -39.287 46.856 1.00 41.23  ? 516  VAL A CA    1 
ATOM   4231 C  C     . VAL A 1 516 ? -16.923 -37.894 46.229 1.00 38.60  ? 516  VAL A C     1 
ATOM   4232 O  O     . VAL A 1 516 ? -16.703 -37.739 45.033 1.00 39.99  ? 516  VAL A O     1 
ATOM   4233 C  CB    . VAL A 1 516 ? -15.702 -39.435 47.760 1.00 40.50  ? 516  VAL A CB    1 
ATOM   4234 C  CG1   . VAL A 1 516 ? -15.840 -40.651 48.677 1.00 39.00  ? 516  VAL A CG1   1 
ATOM   4235 C  CG2   . VAL A 1 516 ? -14.425 -39.499 46.911 1.00 38.07  ? 516  VAL A CG2   1 
ATOM   4236 N  N     . ASP A 1 517 ? -17.164 -36.886 47.057 1.00 37.29  ? 517  ASP A N     1 
ATOM   4237 C  CA    . ASP A 1 517 ? -16.984 -35.499 46.671 1.00 35.49  ? 517  ASP A CA    1 
ATOM   4238 C  C     . ASP A 1 517 ? -15.657 -35.048 47.280 1.00 30.71  ? 517  ASP A C     1 
ATOM   4239 O  O     . ASP A 1 517 ? -15.506 -34.974 48.498 1.00 30.36  ? 517  ASP A O     1 
ATOM   4240 C  CB    . ASP A 1 517 ? -18.157 -34.644 47.169 1.00 36.53  ? 517  ASP A CB    1 
ATOM   4241 C  CG    . ASP A 1 517 ? -18.067 -33.193 46.717 1.00 38.71  ? 517  ASP A CG    1 
ATOM   4242 O  OD1   . ASP A 1 517 ? -19.058 -32.457 46.915 1.00 39.98  ? 517  ASP A OD1   1 
ATOM   4243 O  OD2   . ASP A 1 517 ? -17.018 -32.783 46.170 1.00 39.46  ? 517  ASP A OD2   1 
ATOM   4244 N  N     . TYR A 1 518 ? -14.693 -34.771 46.414 1.00 29.12  ? 518  TYR A N     1 
ATOM   4245 C  CA    . TYR A 1 518 ? -13.333 -34.452 46.830 1.00 28.53  ? 518  TYR A CA    1 
ATOM   4246 C  C     . TYR A 1 518 ? -13.189 -33.048 47.423 1.00 25.86  ? 518  TYR A C     1 
ATOM   4247 O  O     . TYR A 1 518 ? -12.129 -32.688 47.924 1.00 25.20  ? 518  TYR A O     1 
ATOM   4248 C  CB    . TYR A 1 518 ? -12.384 -34.639 45.657 1.00 29.16  ? 518  TYR A CB    1 
ATOM   4249 C  CG    . TYR A 1 518 ? -12.280 -36.066 45.182 1.00 30.50  ? 518  TYR A CG    1 
ATOM   4250 C  CD1   . TYR A 1 518 ? -13.100 -36.547 44.160 1.00 31.20  ? 518  TYR A CD1   1 
ATOM   4251 C  CD2   . TYR A 1 518 ? -11.349 -36.939 45.747 1.00 29.59  ? 518  TYR A CD2   1 
ATOM   4252 C  CE1   . TYR A 1 518 ? -12.995 -37.872 43.717 1.00 33.03  ? 518  TYR A CE1   1 
ATOM   4253 C  CE2   . TYR A 1 518 ? -11.230 -38.254 45.310 1.00 28.01  ? 518  TYR A CE2   1 
ATOM   4254 C  CZ    . TYR A 1 518 ? -12.051 -38.717 44.302 1.00 31.39  ? 518  TYR A CZ    1 
ATOM   4255 O  OH    . TYR A 1 518 ? -11.927 -40.026 43.890 1.00 34.76  ? 518  TYR A OH    1 
ATOM   4256 N  N     . ARG A 1 519 ? -14.276 -32.282 47.385 1.00 27.08  ? 519  ARG A N     1 
ATOM   4257 C  CA    . ARG A 1 519 ? -14.308 -30.915 47.882 1.00 25.94  ? 519  ARG A CA    1 
ATOM   4258 C  C     . ARG A 1 519 ? -14.432 -30.846 49.400 1.00 28.14  ? 519  ARG A C     1 
ATOM   4259 O  O     . ARG A 1 519 ? -14.290 -29.775 50.001 1.00 29.81  ? 519  ARG A O     1 
ATOM   4260 C  CB    . ARG A 1 519 ? -15.449 -30.155 47.215 1.00 26.16  ? 519  ARG A CB    1 
ATOM   4261 C  CG    . ARG A 1 519 ? -15.259 -29.946 45.704 1.00 27.03  ? 519  ARG A CG    1 
ATOM   4262 C  CD    . ARG A 1 519 ? -16.447 -29.237 45.072 1.00 25.65  ? 519  ARG A CD    1 
ATOM   4263 N  NE    . ARG A 1 519 ? -17.682 -29.973 45.327 1.00 26.89  ? 519  ARG A NE    1 
ATOM   4264 C  CZ    . ARG A 1 519 ? -18.901 -29.441 45.285 1.00 30.61  ? 519  ARG A CZ    1 
ATOM   4265 N  NH1   . ARG A 1 519 ? -19.069 -28.154 44.988 1.00 27.42  ? 519  ARG A NH1   1 
ATOM   4266 N  NH2   . ARG A 1 519 ? -19.957 -30.201 45.545 1.00 26.71  ? 519  ARG A NH2   1 
ATOM   4267 N  N     . PHE A 1 520 ? -14.683 -31.991 50.021 1.00 27.71  ? 520  PHE A N     1 
ATOM   4268 C  CA    . PHE A 1 520 ? -14.822 -32.042 51.462 1.00 31.27  ? 520  PHE A CA    1 
ATOM   4269 C  C     . PHE A 1 520 ? -13.886 -33.084 52.010 1.00 32.31  ? 520  PHE A C     1 
ATOM   4270 O  O     . PHE A 1 520 ? -13.698 -34.129 51.391 1.00 34.03  ? 520  PHE A O     1 
ATOM   4271 C  CB    . PHE A 1 520 ? -16.278 -32.329 51.851 1.00 31.62  ? 520  PHE A CB    1 
ATOM   4272 C  CG    . PHE A 1 520 ? -17.244 -31.309 51.318 1.00 33.68  ? 520  PHE A CG    1 
ATOM   4273 C  CD1   . PHE A 1 520 ? -17.501 -30.139 52.031 1.00 34.54  ? 520  PHE A CD1   1 
ATOM   4274 C  CD2   . PHE A 1 520 ? -17.864 -31.496 50.079 1.00 35.97  ? 520  PHE A CD2   1 
ATOM   4275 C  CE1   . PHE A 1 520 ? -18.382 -29.178 51.533 1.00 38.70  ? 520  PHE A CE1   1 
ATOM   4276 C  CE2   . PHE A 1 520 ? -18.746 -30.544 49.562 1.00 38.07  ? 520  PHE A CE2   1 
ATOM   4277 C  CZ    . PHE A 1 520 ? -19.013 -29.382 50.294 1.00 40.27  ? 520  PHE A CZ    1 
ATOM   4278 N  N     . ASP A 1 521 ? -13.277 -32.779 53.156 1.00 33.65  ? 521  ASP A N     1 
ATOM   4279 C  CA    . ASP A 1 521 ? -12.358 -33.704 53.816 1.00 33.86  ? 521  ASP A CA    1 
ATOM   4280 C  C     . ASP A 1 521 ? -12.995 -35.083 53.986 1.00 32.30  ? 521  ASP A C     1 
ATOM   4281 O  O     . ASP A 1 521 ? -14.116 -35.191 54.472 1.00 33.01  ? 521  ASP A O     1 
ATOM   4282 C  CB    . ASP A 1 521 ? -11.927 -33.141 55.171 1.00 36.27  ? 521  ASP A CB    1 
ATOM   4283 C  CG    . ASP A 1 521 ? -10.899 -32.016 55.039 1.00 40.22  ? 521  ASP A CG    1 
ATOM   4284 O  OD1   . ASP A 1 521 ? -9.766  -32.295 54.585 1.00 34.34  ? 521  ASP A OD1   1 
ATOM   4285 O  OD2   . ASP A 1 521 ? -11.222 -30.859 55.404 1.00 41.30  ? 521  ASP A OD2   1 
ATOM   4286 N  N     . PHE A 1 522 ? -12.286 -36.123 53.547 1.00 29.92  ? 522  PHE A N     1 
ATOM   4287 C  CA    . PHE A 1 522 ? -12.761 -37.497 53.665 1.00 29.36  ? 522  PHE A CA    1 
ATOM   4288 C  C     . PHE A 1 522 ? -13.166 -37.832 55.099 1.00 29.88  ? 522  PHE A C     1 
ATOM   4289 O  O     . PHE A 1 522 ? -12.484 -37.450 56.059 1.00 27.15  ? 522  PHE A O     1 
ATOM   4290 C  CB    . PHE A 1 522 ? -11.681 -38.500 53.230 1.00 29.87  ? 522  PHE A CB    1 
ATOM   4291 C  CG    . PHE A 1 522 ? -11.371 -38.491 51.753 1.00 29.44  ? 522  PHE A CG    1 
ATOM   4292 C  CD1   . PHE A 1 522 ? -12.308 -38.066 50.817 1.00 33.16  ? 522  PHE A CD1   1 
ATOM   4293 C  CD2   . PHE A 1 522 ? -10.142 -38.949 51.300 1.00 30.85  ? 522  PHE A CD2   1 
ATOM   4294 C  CE1   . PHE A 1 522 ? -12.011 -38.073 49.461 1.00 30.78  ? 522  PHE A CE1   1 
ATOM   4295 C  CE2   . PHE A 1 522 ? -9.834  -38.958 49.940 1.00 31.59  ? 522  PHE A CE2   1 
ATOM   4296 C  CZ    . PHE A 1 522 ? -10.774 -38.528 49.023 1.00 32.98  ? 522  PHE A CZ    1 
ATOM   4297 N  N     . SER A 1 523 ? -14.273 -38.558 55.234 1.00 31.41  ? 523  SER A N     1 
ATOM   4298 C  CA    . SER A 1 523 ? -14.707 -39.051 56.534 1.00 33.55  ? 523  SER A CA    1 
ATOM   4299 C  C     . SER A 1 523 ? -13.777 -40.171 56.995 1.00 34.03  ? 523  SER A C     1 
ATOM   4300 O  O     . SER A 1 523 ? -12.999 -40.716 56.205 1.00 31.90  ? 523  SER A O     1 
ATOM   4301 C  CB    . SER A 1 523 ? -16.151 -39.557 56.464 1.00 33.40  ? 523  SER A CB    1 
ATOM   4302 O  OG    . SER A 1 523 ? -16.257 -40.739 55.673 1.00 39.48  ? 523  SER A OG    1 
ATOM   4303 N  N     . ASP A 1 524 ? -13.869 -40.512 58.274 1.00 36.82  ? 524  ASP A N     1 
ATOM   4304 C  CA    . ASP A 1 524 ? -13.139 -41.653 58.814 1.00 39.33  ? 524  ASP A CA    1 
ATOM   4305 C  C     . ASP A 1 524 ? -13.468 -42.952 58.075 1.00 39.21  ? 524  ASP A C     1 
ATOM   4306 O  O     . ASP A 1 524 ? -12.584 -43.782 57.859 1.00 38.12  ? 524  ASP A O     1 
ATOM   4307 C  CB    . ASP A 1 524 ? -13.418 -41.802 60.313 1.00 40.43  ? 524  ASP A CB    1 
ATOM   4308 C  CG    . ASP A 1 524 ? -12.727 -40.736 61.141 1.00 41.70  ? 524  ASP A CG    1 
ATOM   4309 O  OD1   . ASP A 1 524 ? -11.787 -40.085 60.631 1.00 38.16  ? 524  ASP A OD1   1 
ATOM   4310 O  OD2   . ASP A 1 524 ? -13.121 -40.551 62.312 1.00 45.94  ? 524  ASP A OD2   1 
ATOM   4311 N  N     . GLU A 1 525 ? -14.731 -43.119 57.684 1.00 41.14  ? 525  GLU A N     1 
ATOM   4312 C  CA    . GLU A 1 525 ? -15.161 -44.347 57.013 1.00 43.01  ? 525  GLU A CA    1 
ATOM   4313 C  C     . GLU A 1 525 ? -14.515 -44.425 55.641 1.00 39.18  ? 525  GLU A C     1 
ATOM   4314 O  O     . GLU A 1 525 ? -13.963 -45.464 55.271 1.00 39.65  ? 525  GLU A O     1 
ATOM   4315 C  CB    . GLU A 1 525 ? -16.696 -44.465 56.922 1.00 46.66  ? 525  GLU A CB    1 
ATOM   4316 C  CG    . GLU A 1 525 ? -17.240 -45.801 57.485 1.00 56.09  ? 525  GLU A CG    1 
ATOM   4317 C  CD    . GLU A 1 525 ? -18.268 -46.526 56.579 1.00 64.03  ? 525  GLU A CD    1 
ATOM   4318 O  OE1   . GLU A 1 525 ? -19.029 -45.857 55.830 1.00 64.65  ? 525  GLU A OE1   1 
ATOM   4319 O  OE2   . GLU A 1 525 ? -18.320 -47.783 56.637 1.00 62.72  ? 525  GLU A OE2   1 
ATOM   4320 N  N     . ILE A 1 526 ? -14.557 -43.313 54.907 1.00 36.69  ? 526  ILE A N     1 
ATOM   4321 C  CA    . ILE A 1 526 ? -13.855 -43.211 53.624 1.00 34.29  ? 526  ILE A CA    1 
ATOM   4322 C  C     . ILE A 1 526 ? -12.360 -43.514 53.781 1.00 33.14  ? 526  ILE A C     1 
ATOM   4323 O  O     . ILE A 1 526 ? -11.799 -44.269 52.994 1.00 34.74  ? 526  ILE A O     1 
ATOM   4324 C  CB    . ILE A 1 526 ? -14.058 -41.830 52.945 1.00 33.11  ? 526  ILE A CB    1 
ATOM   4325 C  CG1   . ILE A 1 526 ? -15.509 -41.652 52.482 1.00 32.94  ? 526  ILE A CG1   1 
ATOM   4326 C  CG2   . ILE A 1 526 ? -13.121 -41.667 51.754 1.00 25.98  ? 526  ILE A CG2   1 
ATOM   4327 C  CD1   . ILE A 1 526 ? -15.894 -40.192 52.286 1.00 37.59  ? 526  ILE A CD1   1 
ATOM   4328 N  N     . LYS A 1 527 ? -11.722 -42.935 54.793 1.00 32.57  ? 527  LYS A N     1 
ATOM   4329 C  CA    . LYS A 1 527 ? -10.303 -43.213 55.043 1.00 35.72  ? 527  LYS A CA    1 
ATOM   4330 C  C     . LYS A 1 527 ? -10.030 -44.713 55.197 1.00 37.28  ? 527  LYS A C     1 
ATOM   4331 O  O     . LYS A 1 527 ? -9.042  -45.222 54.674 1.00 35.70  ? 527  LYS A O     1 
ATOM   4332 C  CB    . LYS A 1 527 ? -9.784  -42.432 56.253 1.00 34.15  ? 527  LYS A CB    1 
ATOM   4333 C  CG    . LYS A 1 527 ? -9.690  -40.944 55.980 1.00 35.96  ? 527  LYS A CG    1 
ATOM   4334 C  CD    . LYS A 1 527 ? -8.762  -40.229 56.930 1.00 38.17  ? 527  LYS A CD    1 
ATOM   4335 C  CE    . LYS A 1 527 ? -9.500  -39.687 58.120 1.00 39.85  ? 527  LYS A CE    1 
ATOM   4336 N  NZ    . LYS A 1 527 ? -8.772  -38.518 58.667 1.00 42.39  ? 527  LYS A NZ    1 
ATOM   4337 N  N     . GLU A 1 528 ? -10.934 -45.408 55.884 1.00 40.17  ? 528  GLU A N     1 
ATOM   4338 C  CA    . GLU A 1 528 ? -10.811 -46.835 56.118 1.00 44.55  ? 528  GLU A CA    1 
ATOM   4339 C  C     . GLU A 1 528 ? -10.856 -47.640 54.831 1.00 45.57  ? 528  GLU A C     1 
ATOM   4340 O  O     . GLU A 1 528 ? -10.068 -48.569 54.659 1.00 48.39  ? 528  GLU A O     1 
ATOM   4341 C  CB    . GLU A 1 528 ? -11.894 -47.321 57.089 1.00 48.33  ? 528  GLU A CB    1 
ATOM   4342 C  CG    . GLU A 1 528 ? -11.533 -47.131 58.560 1.00 56.81  ? 528  GLU A CG    1 
ATOM   4343 C  CD    . GLU A 1 528 ? -10.239 -47.845 58.930 1.00 64.19  ? 528  GLU A CD    1 
ATOM   4344 O  OE1   . GLU A 1 528 ? -9.216  -47.152 59.154 1.00 65.96  ? 528  GLU A OE1   1 
ATOM   4345 O  OE2   . GLU A 1 528 ? -10.246 -49.099 58.965 1.00 66.96  ? 528  GLU A OE2   1 
ATOM   4346 N  N     . LYS A 1 529 ? -11.774 -47.287 53.933 1.00 44.58  ? 529  LYS A N     1 
ATOM   4347 C  CA    . LYS A 1 529 ? -11.918 -47.997 52.663 1.00 43.33  ? 529  LYS A CA    1 
ATOM   4348 C  C     . LYS A 1 529 ? -10.707 -47.740 51.788 1.00 41.75  ? 529  LYS A C     1 
ATOM   4349 O  O     . LYS A 1 529 ? -10.176 -48.648 51.146 1.00 41.62  ? 529  LYS A O     1 
ATOM   4350 C  CB    . LYS A 1 529 ? -13.182 -47.556 51.931 1.00 44.15  ? 529  LYS A CB    1 
ATOM   4351 C  CG    . LYS A 1 529 ? -14.439 -47.624 52.771 1.00 45.29  ? 529  LYS A CG    1 
ATOM   4352 C  CD    . LYS A 1 529 ? -15.664 -47.545 51.898 1.00 48.81  ? 529  LYS A CD    1 
ATOM   4353 C  CE    . LYS A 1 529 ? -16.912 -47.464 52.750 1.00 50.98  ? 529  LYS A CE    1 
ATOM   4354 N  NZ    . LYS A 1 529 ? -17.979 -48.329 52.193 1.00 52.67  ? 529  LYS A NZ    1 
ATOM   4355 N  N     . ILE A 1 530 ? -10.265 -46.492 51.783 1.00 40.65  ? 530  ILE A N     1 
ATOM   4356 C  CA    . ILE A 1 530 ? -9.091  -46.099 51.022 1.00 41.02  ? 530  ILE A CA    1 
ATOM   4357 C  C     . ILE A 1 530 ? -7.905  -47.002 51.373 1.00 40.13  ? 530  ILE A C     1 
ATOM   4358 O  O     . ILE A 1 530 ? -7.170  -47.437 50.486 1.00 38.45  ? 530  ILE A O     1 
ATOM   4359 C  CB    . ILE A 1 530 ? -8.790  -44.598 51.216 1.00 40.90  ? 530  ILE A CB    1 
ATOM   4360 C  CG1   . ILE A 1 530 ? -9.823  -43.769 50.448 1.00 41.18  ? 530  ILE A CG1   1 
ATOM   4361 C  CG2   . ILE A 1 530 ? -7.393  -44.251 50.756 1.00 42.36  ? 530  ILE A CG2   1 
ATOM   4362 C  CD1   . ILE A 1 530 ? -9.581  -42.285 50.487 1.00 38.56  ? 530  ILE A CD1   1 
ATOM   4363 N  N     . LYS A 1 531 ? -7.761  -47.330 52.655 1.00 39.74  ? 531  LYS A N     1 
ATOM   4364 C  CA    . LYS A 1 531 ? -6.674  -48.202 53.099 1.00 42.38  ? 531  LYS A CA    1 
ATOM   4365 C  C     . LYS A 1 531 ? -6.746  -49.635 52.549 1.00 43.76  ? 531  LYS A C     1 
ATOM   4366 O  O     . LYS A 1 531 ? -5.753  -50.371 52.602 1.00 41.92  ? 531  LYS A O     1 
ATOM   4367 C  CB    . LYS A 1 531 ? -6.571  -48.210 54.619 1.00 42.39  ? 531  LYS A CB    1 
ATOM   4368 C  CG    . LYS A 1 531 ? -5.953  -46.951 55.202 1.00 46.21  ? 531  LYS A CG    1 
ATOM   4369 C  CD    . LYS A 1 531 ? -6.372  -46.799 56.647 1.00 52.82  ? 531  LYS A CD    1 
ATOM   4370 C  CE    . LYS A 1 531 ? -5.489  -45.830 57.400 1.00 57.53  ? 531  LYS A CE    1 
ATOM   4371 N  NZ    . LYS A 1 531 ? -5.830  -45.857 58.854 1.00 62.07  ? 531  LYS A NZ    1 
ATOM   4372 N  N     . LYS A 1 532 ? -7.899  -50.010 51.994 1.00 45.44  ? 532  LYS A N     1 
ATOM   4373 C  CA    . LYS A 1 532 ? -8.090  -51.349 51.423 1.00 46.91  ? 532  LYS A CA    1 
ATOM   4374 C  C     . LYS A 1 532 ? -8.102  -51.395 49.895 1.00 46.12  ? 532  LYS A C     1 
ATOM   4375 O  O     . LYS A 1 532 ? -8.121  -52.482 49.320 1.00 46.59  ? 532  LYS A O     1 
ATOM   4376 C  CB    . LYS A 1 532 ? -9.365  -51.997 51.977 1.00 48.57  ? 532  LYS A CB    1 
ATOM   4377 C  CG    . LYS A 1 532 ? -9.111  -52.852 53.198 1.00 55.55  ? 532  LYS A CG    1 
ATOM   4378 C  CD    . LYS A 1 532 ? -10.281 -52.839 54.168 1.00 60.16  ? 532  LYS A CD    1 
ATOM   4379 C  CE    . LYS A 1 532 ? -9.837  -53.419 55.517 1.00 63.99  ? 532  LYS A CE    1 
ATOM   4380 N  NZ    . LYS A 1 532 ? -10.785 -53.089 56.614 1.00 65.00  ? 532  LYS A NZ    1 
ATOM   4381 N  N     . LEU A 1 533 ? -8.093  -50.229 49.245 1.00 44.58  ? 533  LEU A N     1 
ATOM   4382 C  CA    . LEU A 1 533 ? -8.205  -50.153 47.780 1.00 44.15  ? 533  LEU A CA    1 
ATOM   4383 C  C     . LEU A 1 533 ? -6.937  -50.549 47.014 1.00 45.83  ? 533  LEU A C     1 
ATOM   4384 O  O     . LEU A 1 533 ? -5.818  -50.490 47.542 1.00 44.27  ? 533  LEU A O     1 
ATOM   4385 C  CB    . LEU A 1 533 ? -8.662  -48.765 47.330 1.00 41.89  ? 533  LEU A CB    1 
ATOM   4386 C  CG    . LEU A 1 533 ? -10.100 -48.335 47.642 1.00 43.35  ? 533  LEU A CG    1 
ATOM   4387 C  CD1   . LEU A 1 533 ? -10.263 -46.872 47.291 1.00 42.24  ? 533  LEU A CD1   1 
ATOM   4388 C  CD2   . LEU A 1 533 ? -11.154 -49.184 46.921 1.00 38.02  ? 533  LEU A CD2   1 
ATOM   4389 N  N     . SER A 1 534 ? -7.139  -50.939 45.757 1.00 46.83  ? 534  SER A N     1 
ATOM   4390 C  CA    . SER A 1 534 ? -6.053  -51.290 44.848 1.00 47.75  ? 534  SER A CA    1 
ATOM   4391 C  C     . SER A 1 534 ? -5.295  -50.046 44.400 1.00 48.35  ? 534  SER A C     1 
ATOM   4392 O  O     . SER A 1 534 ? -5.796  -48.921 44.538 1.00 47.10  ? 534  SER A O     1 
ATOM   4393 C  CB    . SER A 1 534 ? -6.612  -52.014 43.623 1.00 48.81  ? 534  SER A CB    1 
ATOM   4394 O  OG    . SER A 1 534 ? -7.532  -51.190 42.922 1.00 44.95  ? 534  SER A OG    1 
ATOM   4395 N  N     . ALA A 1 535 ? -4.095  -50.256 43.856 1.00 49.14  ? 535  ALA A N     1 
ATOM   4396 C  CA    . ALA A 1 535 ? -3.301  -49.171 43.285 1.00 49.76  ? 535  ALA A CA    1 
ATOM   4397 C  C     . ALA A 1 535 ? -4.072  -48.499 42.151 1.00 52.04  ? 535  ALA A C     1 
ATOM   4398 O  O     . ALA A 1 535 ? -4.106  -47.276 42.054 1.00 53.91  ? 535  ALA A O     1 
ATOM   4399 C  CB    . ALA A 1 535 ? -1.967  -49.690 42.791 1.00 49.05  ? 535  ALA A CB    1 
ATOM   4400 N  N     . LYS A 1 536 ? -4.702  -49.313 41.309 1.00 54.82  ? 536  LYS A N     1 
ATOM   4401 C  CA    . LYS A 1 536 ? -5.514  -48.833 40.199 1.00 56.10  ? 536  LYS A CA    1 
ATOM   4402 C  C     . LYS A 1 536 ? -6.578  -47.848 40.699 1.00 53.50  ? 536  LYS A C     1 
ATOM   4403 O  O     . LYS A 1 536 ? -6.606  -46.693 40.269 1.00 54.71  ? 536  LYS A O     1 
ATOM   4404 C  CB    . LYS A 1 536 ? -6.144  -50.031 39.465 1.00 58.83  ? 536  LYS A CB    1 
ATOM   4405 C  CG    . LYS A 1 536 ? -6.957  -49.691 38.219 1.00 63.20  ? 536  LYS A CG    1 
ATOM   4406 C  CD    . LYS A 1 536 ? -7.651  -50.936 37.660 1.00 66.69  ? 536  LYS A CD    1 
ATOM   4407 C  CE    . LYS A 1 536 ? -8.664  -50.588 36.571 1.00 68.41  ? 536  LYS A CE    1 
ATOM   4408 N  NZ    . LYS A 1 536 ? -8.028  -50.067 35.327 1.00 68.94  ? 536  LYS A NZ    1 
ATOM   4409 N  N     . SER A 1 537 ? -7.427  -48.302 41.622 1.00 51.23  ? 537  SER A N     1 
ATOM   4410 C  CA    . SER A 1 537 ? -8.480  -47.466 42.211 1.00 47.20  ? 537  SER A CA    1 
ATOM   4411 C  C     . SER A 1 537 ? -7.927  -46.186 42.836 1.00 44.19  ? 537  SER A C     1 
ATOM   4412 O  O     . SER A 1 537 ? -8.471  -45.107 42.614 1.00 42.83  ? 537  SER A O     1 
ATOM   4413 C  CB    . SER A 1 537 ? -9.279  -48.251 43.255 1.00 46.18  ? 537  SER A CB    1 
ATOM   4414 O  OG    . SER A 1 537 ? -10.204 -49.124 42.637 1.00 46.46  ? 537  SER A OG    1 
ATOM   4415 N  N     . LEU A 1 538 ? -6.842  -46.321 43.604 1.00 42.70  ? 538  LEU A N     1 
ATOM   4416 C  CA    . LEU A 1 538 ? -6.206  -45.192 44.297 1.00 39.62  ? 538  LEU A CA    1 
ATOM   4417 C  C     . LEU A 1 538 ? -5.724  -44.098 43.343 1.00 38.31  ? 538  LEU A C     1 
ATOM   4418 O  O     . LEU A 1 538 ? -5.953  -42.916 43.586 1.00 36.42  ? 538  LEU A O     1 
ATOM   4419 C  CB    . LEU A 1 538 ? -5.045  -45.672 45.177 1.00 39.89  ? 538  LEU A CB    1 
ATOM   4420 C  CG    . LEU A 1 538 ? -5.328  -46.469 46.455 1.00 38.94  ? 538  LEU A CG    1 
ATOM   4421 C  CD1   . LEU A 1 538 ? -4.037  -47.079 46.970 1.00 42.07  ? 538  LEU A CD1   1 
ATOM   4422 C  CD2   . LEU A 1 538 ? -5.962  -45.595 47.528 1.00 39.88  ? 538  LEU A CD2   1 
ATOM   4423 N  N     . ASN A 1 539 ? -5.072  -44.502 42.258 1.00 38.02  ? 539  ASN A N     1 
ATOM   4424 C  CA    . ASN A 1 539 ? -4.552  -43.565 41.275 1.00 39.38  ? 539  ASN A CA    1 
ATOM   4425 C  C     . ASN A 1 539 ? -5.658  -42.861 40.521 1.00 39.63  ? 539  ASN A C     1 
ATOM   4426 O  O     . ASN A 1 539 ? -5.539  -41.683 40.192 1.00 41.04  ? 539  ASN A O     1 
ATOM   4427 C  CB    . ASN A 1 539 ? -3.631  -44.272 40.288 1.00 42.31  ? 539  ASN A CB    1 
ATOM   4428 C  CG    . ASN A 1 539 ? -2.264  -44.560 40.868 1.00 46.23  ? 539  ASN A CG    1 
ATOM   4429 O  OD1   . ASN A 1 539 ? -1.691  -45.623 40.629 1.00 51.24  ? 539  ASN A OD1   1 
ATOM   4430 N  ND2   . ASN A 1 539 ? -1.730  -43.616 41.633 1.00 44.41  ? 539  ASN A ND2   1 
ATOM   4431 N  N     . GLU A 1 540 ? -6.727  -43.588 40.229 1.00 40.44  ? 540  GLU A N     1 
ATOM   4432 C  CA    . GLU A 1 540 ? -7.898  -42.960 39.660 1.00 42.49  ? 540  GLU A CA    1 
ATOM   4433 C  C     . GLU A 1 540 ? -8.463  -41.927 40.638 1.00 41.47  ? 540  GLU A C     1 
ATOM   4434 O  O     . GLU A 1 540 ? -8.852  -40.833 40.221 1.00 42.40  ? 540  GLU A O     1 
ATOM   4435 C  CB    . GLU A 1 540 ? -8.954  -43.994 39.260 1.00 44.88  ? 540  GLU A CB    1 
ATOM   4436 C  CG    . GLU A 1 540 ? -10.155 -43.398 38.478 1.00 51.59  ? 540  GLU A CG    1 
ATOM   4437 C  CD    . GLU A 1 540 ? -9.755  -42.582 37.233 1.00 55.67  ? 540  GLU A CD    1 
ATOM   4438 O  OE1   . GLU A 1 540 ? -8.651  -42.812 36.676 1.00 56.39  ? 540  GLU A OE1   1 
ATOM   4439 O  OE2   . GLU A 1 540 ? -10.556 -41.710 36.811 1.00 55.05  ? 540  GLU A OE2   1 
ATOM   4440 N  N     . MET A 1 541 ? -8.473  -42.260 41.934 1.00 38.98  ? 541  MET A N     1 
ATOM   4441 C  CA    . MET A 1 541 ? -8.972  -41.333 42.954 1.00 35.28  ? 541  MET A CA    1 
ATOM   4442 C  C     . MET A 1 541 ? -8.086  -40.100 43.066 1.00 33.31  ? 541  MET A C     1 
ATOM   4443 O  O     . MET A 1 541 ? -8.592  -38.983 43.190 1.00 30.68  ? 541  MET A O     1 
ATOM   4444 C  CB    . MET A 1 541 ? -9.123  -42.015 44.312 1.00 33.47  ? 541  MET A CB    1 
ATOM   4445 C  CG    . MET A 1 541 ? -10.284 -42.984 44.375 1.00 35.27  ? 541  MET A CG    1 
ATOM   4446 S  SD    . MET A 1 541 ? -10.682 -43.541 46.038 1.00 36.38  ? 541  MET A SD    1 
ATOM   4447 C  CE    . MET A 1 541 ? -11.544 -42.138 46.722 1.00 30.96  ? 541  MET A CE    1 
ATOM   4448 N  N     . LEU A 1 542 ? -6.771  -40.319 43.006 1.00 32.21  ? 542  LEU A N     1 
ATOM   4449 C  CA    . LEU A 1 542 ? -5.782  -39.254 43.103 1.00 31.56  ? 542  LEU A CA    1 
ATOM   4450 C  C     . LEU A 1 542 ? -5.946  -38.299 41.938 1.00 32.96  ? 542  LEU A C     1 
ATOM   4451 O  O     . LEU A 1 542 ? -5.926  -37.083 42.116 1.00 34.36  ? 542  LEU A O     1 
ATOM   4452 C  CB    . LEU A 1 542 ? -4.365  -39.831 43.119 1.00 32.20  ? 542  LEU A CB    1 
ATOM   4453 C  CG    . LEU A 1 542 ? -3.175  -38.880 43.300 1.00 34.16  ? 542  LEU A CG    1 
ATOM   4454 C  CD1   . LEU A 1 542 ? -3.362  -37.961 44.511 1.00 33.58  ? 542  LEU A CD1   1 
ATOM   4455 C  CD2   . LEU A 1 542 ? -1.859  -39.662 43.422 1.00 28.38  ? 542  LEU A CD2   1 
ATOM   4456 N  N     . PHE A 1 543 ? -6.136  -38.859 40.749 1.00 32.98  ? 543  PHE A N     1 
ATOM   4457 C  CA    . PHE A 1 543 ? -6.420  -38.065 39.570 1.00 33.61  ? 543  PHE A CA    1 
ATOM   4458 C  C     . PHE A 1 543 ? -7.652  -37.187 39.811 1.00 30.05  ? 543  PHE A C     1 
ATOM   4459 O  O     . PHE A 1 543 ? -7.626  -35.983 39.583 1.00 30.54  ? 543  PHE A O     1 
ATOM   4460 C  CB    . PHE A 1 543 ? -6.619  -38.980 38.350 1.00 36.04  ? 543  PHE A CB    1 
ATOM   4461 C  CG    . PHE A 1 543 ? -6.921  -38.238 37.069 1.00 38.67  ? 543  PHE A CG    1 
ATOM   4462 C  CD1   . PHE A 1 543 ? -5.887  -37.827 36.226 1.00 40.32  ? 543  PHE A CD1   1 
ATOM   4463 C  CD2   . PHE A 1 543 ? -8.239  -37.947 36.708 1.00 41.90  ? 543  PHE A CD2   1 
ATOM   4464 C  CE1   . PHE A 1 543 ? -6.159  -37.138 35.039 1.00 43.73  ? 543  PHE A CE1   1 
ATOM   4465 C  CE2   . PHE A 1 543 ? -8.527  -37.255 35.524 1.00 45.08  ? 543  PHE A CE2   1 
ATOM   4466 C  CZ    . PHE A 1 543 ? -7.481  -36.851 34.687 1.00 44.90  ? 543  PHE A CZ    1 
ATOM   4467 N  N     . ARG A 1 544 ? -8.726  -37.801 40.283 1.00 29.82  ? 544  ARG A N     1 
ATOM   4468 C  CA    . ARG A 1 544 ? -9.982  -37.095 40.482 1.00 31.17  ? 544  ARG A CA    1 
ATOM   4469 C  C     . ARG A 1 544 ? -9.810  -36.012 41.531 1.00 30.92  ? 544  ARG A C     1 
ATOM   4470 O  O     . ARG A 1 544 ? -10.262 -34.884 41.341 1.00 32.72  ? 544  ARG A O     1 
ATOM   4471 C  CB    . ARG A 1 544 ? -11.095 -38.072 40.875 1.00 31.79  ? 544  ARG A CB    1 
ATOM   4472 C  CG    . ARG A 1 544 ? -11.561 -38.971 39.733 1.00 33.68  ? 544  ARG A CG    1 
ATOM   4473 C  CD    . ARG A 1 544 ? -12.375 -40.142 40.241 1.00 33.69  ? 544  ARG A CD    1 
ATOM   4474 N  NE    . ARG A 1 544 ? -12.734 -41.052 39.157 1.00 38.68  ? 544  ARG A NE    1 
ATOM   4475 C  CZ    . ARG A 1 544 ? -13.730 -41.937 39.202 1.00 39.19  ? 544  ARG A CZ    1 
ATOM   4476 N  NH1   . ARG A 1 544 ? -14.491 -42.047 40.286 1.00 33.53  ? 544  ARG A NH1   1 
ATOM   4477 N  NH2   . ARG A 1 544 ? -13.971 -42.712 38.149 1.00 37.41  ? 544  ARG A NH2   1 
ATOM   4478 N  N     . ALA A 1 545 ? -9.133  -36.356 42.623 1.00 29.59  ? 545  ALA A N     1 
ATOM   4479 C  CA    . ALA A 1 545 ? -8.844  -35.404 43.687 1.00 28.56  ? 545  ALA A CA    1 
ATOM   4480 C  C     . ALA A 1 545 ? -8.073  -34.209 43.139 1.00 27.79  ? 545  ALA A C     1 
ATOM   4481 O  O     . ALA A 1 545 ? -8.430  -33.060 43.404 1.00 29.88  ? 545  ALA A O     1 
ATOM   4482 C  CB    . ALA A 1 545 ? -8.065  -36.078 44.812 1.00 26.86  ? 545  ALA A CB    1 
ATOM   4483 N  N     . GLN A 1 546 ? -7.035  -34.490 42.359 1.00 27.43  ? 546  GLN A N     1 
ATOM   4484 C  CA    . GLN A 1 546 ? -6.174  -33.452 41.796 1.00 29.16  ? 546  GLN A CA    1 
ATOM   4485 C  C     . GLN A 1 546 ? -6.911  -32.586 40.764 1.00 30.09  ? 546  GLN A C     1 
ATOM   4486 O  O     . GLN A 1 546 ? -6.679  -31.372 40.688 1.00 28.65  ? 546  GLN A O     1 
ATOM   4487 C  CB    . GLN A 1 546 ? -4.893  -34.066 41.207 1.00 29.89  ? 546  GLN A CB    1 
ATOM   4488 C  CG    . GLN A 1 546 ? -3.977  -34.698 42.263 1.00 32.04  ? 546  GLN A CG    1 
ATOM   4489 C  CD    . GLN A 1 546 ? -2.662  -35.228 41.703 1.00 37.02  ? 546  GLN A CD    1 
ATOM   4490 O  OE1   . GLN A 1 546 ? -1.640  -35.225 42.395 1.00 37.56  ? 546  GLN A OE1   1 
ATOM   4491 N  NE2   . GLN A 1 546 ? -2.685  -35.703 40.456 1.00 36.67  ? 546  GLN A NE2   1 
ATOM   4492 N  N     . ARG A 1 547 ? -7.809  -33.202 39.992 1.00 29.43  ? 547  ARG A N     1 
ATOM   4493 C  CA    . ARG A 1 547 ? -8.648  -32.441 39.070 1.00 32.62  ? 547  ARG A CA    1 
ATOM   4494 C  C     . ARG A 1 547 ? -9.639  -31.551 39.807 1.00 31.36  ? 547  ARG A C     1 
ATOM   4495 O  O     . ARG A 1 547 ? -10.025 -30.504 39.289 1.00 33.65  ? 547  ARG A O     1 
ATOM   4496 C  CB    . ARG A 1 547 ? -9.377  -33.351 38.068 1.00 35.88  ? 547  ARG A CB    1 
ATOM   4497 C  CG    . ARG A 1 547 ? -8.522  -33.790 36.867 1.00 39.44  ? 547  ARG A CG    1 
ATOM   4498 C  CD    . ARG A 1 547 ? -8.162  -32.610 35.953 1.00 41.75  ? 547  ARG A CD    1 
ATOM   4499 N  NE    . ARG A 1 547 ? -7.227  -32.992 34.896 1.00 43.58  ? 547  ARG A NE    1 
ATOM   4500 C  CZ    . ARG A 1 547 ? -7.582  -33.300 33.652 1.00 48.91  ? 547  ARG A CZ    1 
ATOM   4501 N  NH1   . ARG A 1 547 ? -8.861  -33.271 33.288 1.00 50.05  ? 547  ARG A NH1   1 
ATOM   4502 N  NH2   . ARG A 1 547 ? -6.656  -33.643 32.765 1.00 49.73  ? 547  ARG A NH2   1 
ATOM   4503 N  N     . THR A 1 548 ? -10.039 -31.965 41.011 1.00 30.71  ? 548  THR A N     1 
ATOM   4504 C  CA    . THR A 1 548 ? -10.940 -31.166 41.848 1.00 29.53  ? 548  THR A CA    1 
ATOM   4505 C  C     . THR A 1 548 ? -10.187 -29.976 42.435 1.00 27.31  ? 548  THR A C     1 
ATOM   4506 O  O     . THR A 1 548 ? -10.700 -28.864 42.454 1.00 30.57  ? 548  THR A O     1 
ATOM   4507 C  CB    . THR A 1 548 ? -11.580 -31.990 42.995 1.00 29.98  ? 548  THR A CB    1 
ATOM   4508 O  OG1   . THR A 1 548 ? -12.214 -33.158 42.469 1.00 29.21  ? 548  THR A OG1   1 
ATOM   4509 C  CG2   . THR A 1 548 ? -12.621 -31.159 43.740 1.00 27.77  ? 548  THR A CG2   1 
ATOM   4510 N  N     . GLU A 1 549 ? -8.972  -30.225 42.910 1.00 27.39  ? 549  GLU A N     1 
ATOM   4511 C  CA    . GLU A 1 549 ? -8.083  -29.184 43.439 1.00 26.88  ? 549  GLU A CA    1 
ATOM   4512 C  C     . GLU A 1 549 ? -7.767  -28.117 42.383 1.00 26.40  ? 549  GLU A C     1 
ATOM   4513 O  O     . GLU A 1 549 ? -7.834  -26.919 42.664 1.00 26.48  ? 549  GLU A O     1 
ATOM   4514 C  CB    . GLU A 1 549 ? -6.782  -29.816 43.952 1.00 27.34  ? 549  GLU A CB    1 
ATOM   4515 C  CG    . GLU A 1 549 ? -5.870  -28.844 44.708 1.00 28.43  ? 549  GLU A CG    1 
ATOM   4516 C  CD    . GLU A 1 549 ? -4.429  -29.341 44.832 1.00 33.74  ? 549  GLU A CD    1 
ATOM   4517 O  OE1   . GLU A 1 549 ? -4.187  -30.566 44.716 1.00 33.00  ? 549  GLU A OE1   1 
ATOM   4518 O  OE2   . GLU A 1 549 ? -3.530  -28.497 45.048 1.00 34.80  ? 549  GLU A OE2   1 
ATOM   4519 N  N     . VAL A 1 550 ? -7.434  -28.549 41.167 1.00 25.49  ? 550  VAL A N     1 
ATOM   4520 C  CA    . VAL A 1 550 ? -7.248  -27.611 40.045 1.00 25.21  ? 550  VAL A CA    1 
ATOM   4521 C  C     . VAL A 1 550 ? -8.473  -26.709 39.841 1.00 27.05  ? 550  VAL A C     1 
ATOM   4522 O  O     . VAL A 1 550 ? -8.334  -25.491 39.697 1.00 30.13  ? 550  VAL A O     1 
ATOM   4523 C  CB    . VAL A 1 550 ? -6.865  -28.344 38.728 1.00 25.17  ? 550  VAL A CB    1 
ATOM   4524 C  CG1   . VAL A 1 550 ? -6.942  -27.412 37.535 1.00 20.56  ? 550  VAL A CG1   1 
ATOM   4525 C  CG2   . VAL A 1 550 ? -5.464  -28.949 38.846 1.00 25.27  ? 550  VAL A CG2   1 
ATOM   4526 N  N     . ALA A 1 551 ? -9.666  -27.303 39.854 1.00 26.75  ? 551  ALA A N     1 
ATOM   4527 C  CA    . ALA A 1 551 ? -10.891 -26.542 39.647 1.00 26.22  ? 551  ALA A CA    1 
ATOM   4528 C  C     . ALA A 1 551 ? -11.101 -25.503 40.743 1.00 25.92  ? 551  ALA A C     1 
ATOM   4529 O  O     . ALA A 1 551 ? -11.469 -24.369 40.450 1.00 29.24  ? 551  ALA A O     1 
ATOM   4530 C  CB    . ALA A 1 551 ? -12.092 -27.469 39.550 1.00 27.12  ? 551  ALA A CB    1 
ATOM   4531 N  N     . GLY A 1 552 ? -10.873 -25.887 41.998 1.00 21.85  ? 552  GLY A N     1 
ATOM   4532 C  CA    . GLY A 1 552 ? -10.959 -24.947 43.109 1.00 19.53  ? 552  GLY A CA    1 
ATOM   4533 C  C     . GLY A 1 552 ? -9.893  -23.872 43.001 1.00 21.22  ? 552  GLY A C     1 
ATOM   4534 O  O     . GLY A 1 552 ? -10.114 -22.720 43.383 1.00 22.51  ? 552  GLY A O     1 
ATOM   4535 N  N     . MET A 1 553 ? -8.736  -24.249 42.467 1.00 22.06  ? 553  MET A N     1 
ATOM   4536 C  CA    . MET A 1 553 ? -7.633  -23.320 42.273 1.00 24.28  ? 553  MET A CA    1 
ATOM   4537 C  C     . MET A 1 553 ? -8.043  -22.231 41.284 1.00 24.27  ? 553  MET A C     1 
ATOM   4538 O  O     . MET A 1 553 ? -7.936  -21.042 41.583 1.00 24.02  ? 553  MET A O     1 
ATOM   4539 C  CB    . MET A 1 553 ? -6.371  -24.068 41.815 1.00 24.23  ? 553  MET A CB    1 
ATOM   4540 C  CG    . MET A 1 553 ? -5.203  -23.195 41.379 1.00 28.66  ? 553  MET A CG    1 
ATOM   4541 S  SD    . MET A 1 553 ? -4.655  -22.015 42.626 1.00 43.31  ? 553  MET A SD    1 
ATOM   4542 C  CE    . MET A 1 553 ? -3.398  -22.933 43.514 1.00 37.33  ? 553  MET A CE    1 
ATOM   4543 N  N     . THR A 1 554 ? -8.537  -22.643 40.120 1.00 26.43  ? 554  THR A N     1 
ATOM   4544 C  CA    . THR A 1 554 ? -8.996  -21.702 39.107 1.00 24.63  ? 554  THR A CA    1 
ATOM   4545 C  C     . THR A 1 554 ? -9.994  -20.713 39.693 1.00 26.72  ? 554  THR A C     1 
ATOM   4546 O  O     . THR A 1 554 ? -9.847  -19.489 39.521 1.00 27.84  ? 554  THR A O     1 
ATOM   4547 C  CB    . THR A 1 554 ? -9.604  -22.439 37.919 1.00 24.60  ? 554  THR A CB    1 
ATOM   4548 O  OG1   . THR A 1 554 ? -8.554  -23.118 37.210 1.00 29.50  ? 554  THR A OG1   1 
ATOM   4549 C  CG2   . THR A 1 554 ? -10.317 -21.471 36.972 1.00 18.74  ? 554  THR A CG2   1 
ATOM   4550 N  N     . ALA A 1 555 ? -10.976 -21.251 40.413 1.00 24.50  ? 555  ALA A N     1 
ATOM   4551 C  CA    . ALA A 1 555 ? -12.112 -20.477 40.912 1.00 26.98  ? 555  ALA A CA    1 
ATOM   4552 C  C     . ALA A 1 555 ? -11.732 -19.541 42.053 1.00 26.50  ? 555  ALA A C     1 
ATOM   4553 O  O     . ALA A 1 555 ? -12.234 -18.417 42.136 1.00 26.87  ? 555  ALA A O     1 
ATOM   4554 C  CB    . ALA A 1 555 ? -13.268 -21.428 41.342 1.00 26.54  ? 555  ALA A CB    1 
ATOM   4555 N  N     . GLN A 1 556 ? -10.848 -20.005 42.930 1.00 26.47  ? 556  GLN A N     1 
ATOM   4556 C  CA    . GLN A 1 556 ? -10.400 -19.170 44.047 1.00 25.70  ? 556  GLN A CA    1 
ATOM   4557 C  C     . GLN A 1 556 ? -9.358  -18.139 43.628 1.00 25.02  ? 556  GLN A C     1 
ATOM   4558 O  O     . GLN A 1 556 ? -9.478  -16.975 44.014 1.00 26.41  ? 556  GLN A O     1 
ATOM   4559 C  CB    . GLN A 1 556 ? -9.933  -20.005 45.266 1.00 21.23  ? 556  GLN A CB    1 
ATOM   4560 C  CG    . GLN A 1 556 ? -8.539  -20.629 45.174 1.00 26.90  ? 556  GLN A CG    1 
ATOM   4561 C  CD    . GLN A 1 556 ? -7.424  -19.689 45.631 1.00 26.26  ? 556  GLN A CD    1 
ATOM   4562 O  OE1   . GLN A 1 556 ? -7.664  -18.737 46.369 1.00 23.44  ? 556  GLN A OE1   1 
ATOM   4563 N  NE2   . GLN A 1 556 ? -6.202  -19.958 45.186 1.00 25.35  ? 556  GLN A NE2   1 
ATOM   4564 N  N     . ILE A 1 557 ? -8.359  -18.543 42.832 1.00 24.81  ? 557  ILE A N     1 
ATOM   4565 C  CA    . ILE A 1 557 ? -7.229  -17.648 42.581 1.00 24.82  ? 557  ILE A CA    1 
ATOM   4566 C  C     . ILE A 1 557 ? -7.610  -16.459 41.721 1.00 25.82  ? 557  ILE A C     1 
ATOM   4567 O  O     . ILE A 1 557 ? -7.052  -15.376 41.870 1.00 28.31  ? 557  ILE A O     1 
ATOM   4568 C  CB    . ILE A 1 557 ? -5.918  -18.356 42.076 1.00 29.75  ? 557  ILE A CB    1 
ATOM   4569 C  CG1   . ILE A 1 557 ? -4.691  -17.533 42.530 1.00 28.08  ? 557  ILE A CG1   1 
ATOM   4570 C  CG2   . ILE A 1 557 ? -5.931  -18.625 40.541 1.00 23.98  ? 557  ILE A CG2   1 
ATOM   4571 C  CD1   . ILE A 1 557 ? -3.357  -18.061 42.104 1.00 25.62  ? 557  ILE A CD1   1 
ATOM   4572 N  N     . ASN A 1 558 ? -8.587  -16.650 40.842 1.00 27.54  ? 558  ASN A N     1 
ATOM   4573 C  CA    . ASN A 1 558 ? -8.998  -15.576 39.952 1.00 25.27  ? 558  ASN A CA    1 
ATOM   4574 C  C     . ASN A 1 558 ? -10.056 -14.669 40.553 1.00 24.61  ? 558  ASN A C     1 
ATOM   4575 O  O     . ASN A 1 558 ? -10.258 -13.566 40.080 1.00 26.28  ? 558  ASN A O     1 
ATOM   4576 C  CB    . ASN A 1 558 ? -9.421  -16.133 38.602 1.00 24.01  ? 558  ASN A CB    1 
ATOM   4577 C  CG    . ASN A 1 558 ? -8.251  -16.676 37.826 1.00 25.02  ? 558  ASN A CG    1 
ATOM   4578 O  OD1   . ASN A 1 558 ? -7.430  -15.909 37.316 1.00 22.12  ? 558  ASN A OD1   1 
ATOM   4579 N  ND2   . ASN A 1 558 ? -8.158  -18.010 37.728 1.00 19.73  ? 558  ASN A ND2   1 
ATOM   4580 N  N     . ARG A 1 559 ? -10.724 -15.123 41.603 1.00 24.48  ? 559  ARG A N     1 
ATOM   4581 C  CA    . ARG A 1 559 ? -11.594 -14.220 42.343 1.00 24.26  ? 559  ARG A CA    1 
ATOM   4582 C  C     . ARG A 1 559 ? -10.706 -13.363 43.251 1.00 23.90  ? 559  ARG A C     1 
ATOM   4583 O  O     . ARG A 1 559 ? -10.942 -12.175 43.412 1.00 26.92  ? 559  ARG A O     1 
ATOM   4584 C  CB    . ARG A 1 559 ? -12.696 -14.985 43.095 1.00 23.85  ? 559  ARG A CB    1 
ATOM   4585 C  CG    . ARG A 1 559 ? -13.851 -15.474 42.177 1.00 24.74  ? 559  ARG A CG    1 
ATOM   4586 C  CD    . ARG A 1 559 ? -14.824 -16.463 42.868 1.00 20.00  ? 559  ARG A CD    1 
ATOM   4587 N  NE    . ARG A 1 559 ? -15.955 -16.826 42.009 1.00 23.33  ? 559  ARG A NE    1 
ATOM   4588 C  CZ    . ARG A 1 559 ? -15.938 -17.772 41.063 1.00 28.32  ? 559  ARG A CZ    1 
ATOM   4589 N  NH1   . ARG A 1 559 ? -14.838 -18.479 40.822 1.00 29.77  ? 559  ARG A NH1   1 
ATOM   4590 N  NH2   . ARG A 1 559 ? -17.023 -18.008 40.334 1.00 22.96  ? 559  ARG A NH2   1 
ATOM   4591 N  N     . LYS A 1 560 ? -9.655  -13.968 43.796 1.00 24.49  ? 560  LYS A N     1 
ATOM   4592 C  CA    . LYS A 1 560 ? -8.605  -13.238 44.506 1.00 25.83  ? 560  LYS A CA    1 
ATOM   4593 C  C     . LYS A 1 560 ? -7.982  -12.146 43.616 1.00 26.15  ? 560  LYS A C     1 
ATOM   4594 O  O     . LYS A 1 560 ? -7.892  -10.974 44.021 1.00 24.79  ? 560  LYS A O     1 
ATOM   4595 C  CB    . LYS A 1 560 ? -7.534  -14.215 45.025 1.00 25.02  ? 560  LYS A CB    1 
ATOM   4596 C  CG    . LYS A 1 560 ? -6.274  -13.540 45.560 1.00 28.67  ? 560  LYS A CG    1 
ATOM   4597 C  CD    . LYS A 1 560 ? -5.398  -14.465 46.397 1.00 31.06  ? 560  LYS A CD    1 
ATOM   4598 C  CE    . LYS A 1 560 ? -4.634  -15.436 45.538 1.00 38.09  ? 560  LYS A CE    1 
ATOM   4599 N  NZ    . LYS A 1 560 ? -3.620  -16.205 46.326 1.00 40.75  ? 560  LYS A NZ    1 
ATOM   4600 N  N     . ALA A 1 561 ? -7.575  -12.538 42.406 1.00 25.77  ? 561  ALA A N     1 
ATOM   4601 C  CA    . ALA A 1 561 ? -7.060  -11.608 41.383 1.00 27.37  ? 561  ALA A CA    1 
ATOM   4602 C  C     . ALA A 1 561 ? -8.004  -10.439 41.096 1.00 26.91  ? 561  ALA A C     1 
ATOM   4603 O  O     . ALA A 1 561 ? -7.547  -9.296  40.951 1.00 29.61  ? 561  ALA A O     1 
ATOM   4604 C  CB    . ALA A 1 561 ? -6.760  -12.358 40.083 1.00 28.28  ? 561  ALA A CB    1 
ATOM   4605 N  N     . LEU A 1 562 ? -9.304  -10.730 40.998 1.00 20.50  ? 562  LEU A N     1 
ATOM   4606 C  CA    . LEU A 1 562 ? -10.333 -9.699  40.787 1.00 20.60  ? 562  LEU A CA    1 
ATOM   4607 C  C     . LEU A 1 562 ? -10.399 -8.679  41.929 1.00 20.20  ? 562  LEU A C     1 
ATOM   4608 O  O     . LEU A 1 562 ? -10.390 -7.464  41.689 1.00 23.31  ? 562  LEU A O     1 
ATOM   4609 C  CB    . LEU A 1 562 ? -11.725 -10.327 40.563 1.00 21.08  ? 562  LEU A CB    1 
ATOM   4610 C  CG    . LEU A 1 562 ? -12.843 -9.384  40.076 1.00 23.92  ? 562  LEU A CG    1 
ATOM   4611 C  CD1   . LEU A 1 562 ? -12.473 -8.734  38.738 1.00 14.58  ? 562  LEU A CD1   1 
ATOM   4612 C  CD2   . LEU A 1 562 ? -14.202 -10.105 39.971 1.00 23.40  ? 562  LEU A CD2   1 
ATOM   4613 N  N     . ILE A 1 563 ? -10.470 -9.164  43.166 1.00 19.49  ? 563  ILE A N     1 
ATOM   4614 C  CA    . ILE A 1 563 ? -10.490 -8.262  44.335 1.00 21.20  ? 563  ILE A CA    1 
ATOM   4615 C  C     . ILE A 1 563 ? -9.170  -7.533  44.564 1.00 21.01  ? 563  ILE A C     1 
ATOM   4616 O  O     . ILE A 1 563 ? -9.184  -6.349  44.902 1.00 22.22  ? 563  ILE A O     1 
ATOM   4617 C  CB    . ILE A 1 563 ? -11.006 -8.937  45.652 1.00 21.17  ? 563  ILE A CB    1 
ATOM   4618 C  CG1   . ILE A 1 563 ? -10.208 -10.190 46.008 1.00 20.50  ? 563  ILE A CG1   1 
ATOM   4619 C  CG2   . ILE A 1 563 ? -12.467 -9.290  45.514 1.00 20.20  ? 563  ILE A CG2   1 
ATOM   4620 C  CD1   . ILE A 1 563 ? -10.646 -10.843 47.313 1.00 22.50  ? 563  ILE A CD1   1 
ATOM   4621 N  N     . ASN A 1 564 ? -8.041  -8.218  44.358 1.00 21.46  ? 564  ASN A N     1 
ATOM   4622 C  CA    . ASN A 1 564 ? -6.746  -7.538  44.416 1.00 23.87  ? 564  ASN A CA    1 
ATOM   4623 C  C     . ASN A 1 564 ? -6.653  -6.504  43.299 1.00 25.34  ? 564  ASN A C     1 
ATOM   4624 O  O     . ASN A 1 564 ? -6.110  -5.407  43.497 1.00 24.74  ? 564  ASN A O     1 
ATOM   4625 C  CB    . ASN A 1 564 ? -5.578  -8.527  44.373 1.00 23.80  ? 564  ASN A CB    1 
ATOM   4626 C  CG    . ASN A 1 564 ? -5.438  -9.317  45.670 1.00 27.51  ? 564  ASN A CG    1 
ATOM   4627 O  OD1   . ASN A 1 564 ? -6.156  -9.072  46.635 1.00 28.05  ? 564  ASN A OD1   1 
ATOM   4628 N  ND2   . ASN A 1 564 ? -4.513  -10.267 45.695 1.00 28.66  ? 564  ASN A ND2   1 
ATOM   4629 N  N     . GLY A 1 565 ? -7.220  -6.861  42.144 1.00 25.32  ? 565  GLY A N     1 
ATOM   4630 C  CA    . GLY A 1 565 ? -7.402  -5.938  41.027 1.00 26.85  ? 565  GLY A CA    1 
ATOM   4631 C  C     . GLY A 1 565 ? -8.142  -4.662  41.411 1.00 26.81  ? 565  GLY A C     1 
ATOM   4632 O  O     . GLY A 1 565 ? -7.754  -3.574  40.985 1.00 26.87  ? 565  GLY A O     1 
ATOM   4633 N  N     . LEU A 1 566 ? -9.188  -4.782  42.229 1.00 25.80  ? 566  LEU A N     1 
ATOM   4634 C  CA    . LEU A 1 566 ? -9.904  -3.593  42.734 1.00 26.38  ? 566  LEU A CA    1 
ATOM   4635 C  C     . LEU A 1 566 ? -9.001  -2.646  43.528 1.00 24.80  ? 566  LEU A C     1 
ATOM   4636 O  O     . LEU A 1 566 ? -9.070  -1.432  43.366 1.00 28.08  ? 566  LEU A O     1 
ATOM   4637 C  CB    . LEU A 1 566 ? -11.146 -3.978  43.554 1.00 23.37  ? 566  LEU A CB    1 
ATOM   4638 C  CG    . LEU A 1 566 ? -12.042 -2.865  44.122 1.00 23.97  ? 566  LEU A CG    1 
ATOM   4639 C  CD1   . LEU A 1 566 ? -12.345 -1.765  43.094 1.00 17.48  ? 566  LEU A CD1   1 
ATOM   4640 C  CD2   . LEU A 1 566 ? -13.345 -3.476  44.654 1.00 21.76  ? 566  LEU A CD2   1 
ATOM   4641 N  N     . ALA A 1 567 ? -8.144  -3.201  44.370 1.00 24.86  ? 567  ALA A N     1 
ATOM   4642 C  CA    . ALA A 1 567 ? -7.192  -2.389  45.118 1.00 23.45  ? 567  ALA A CA    1 
ATOM   4643 C  C     . ALA A 1 567 ? -6.172  -1.682  44.212 1.00 23.96  ? 567  ALA A C     1 
ATOM   4644 O  O     . ALA A 1 567 ? -5.838  -0.523  44.451 1.00 24.34  ? 567  ALA A O     1 
ATOM   4645 C  CB    . ALA A 1 567 ? -6.492  -3.229  46.170 1.00 22.24  ? 567  ALA A CB    1 
ATOM   4646 N  N     . GLY A 1 568 ? -5.681  -2.370  43.180 1.00 22.80  ? 568  GLY A N     1 
ATOM   4647 C  CA    . GLY A 1 568 ? -4.706  -1.769  42.263 1.00 22.94  ? 568  GLY A CA    1 
ATOM   4648 C  C     . GLY A 1 568 ? -5.342  -0.730  41.344 1.00 26.16  ? 568  GLY A C     1 
ATOM   4649 O  O     . GLY A 1 568 ? -4.718  0.278   40.994 1.00 26.72  ? 568  GLY A O     1 
ATOM   4650 N  N     . ALA A 1 569 ? -6.598  -0.977  40.970 1.00 24.51  ? 569  ALA A N     1 
ATOM   4651 C  CA    . ALA A 1 569 ? -7.340  -0.133  40.041 1.00 24.98  ? 569  ALA A CA    1 
ATOM   4652 C  C     . ALA A 1 569 ? -7.553  1.276   40.572 1.00 26.64  ? 569  ALA A C     1 
ATOM   4653 O  O     . ALA A 1 569 ? -7.616  2.229   39.788 1.00 27.72  ? 569  ALA A O     1 
ATOM   4654 C  CB    . ALA A 1 569 ? -8.679  -0.771  39.702 1.00 25.49  ? 569  ALA A CB    1 
ATOM   4655 N  N     . LEU A 1 570 ? -7.678  1.396   41.895 1.00 26.43  ? 570  LEU A N     1 
ATOM   4656 C  CA    . LEU A 1 570 ? -7.721  2.689   42.574 1.00 26.81  ? 570  LEU A CA    1 
ATOM   4657 C  C     . LEU A 1 570 ? -6.493  3.544   42.249 1.00 28.01  ? 570  LEU A C     1 
ATOM   4658 O  O     . LEU A 1 570 ? -6.517  4.760   42.440 1.00 29.36  ? 570  LEU A O     1 
ATOM   4659 C  CB    . LEU A 1 570 ? -7.843  2.504   44.094 1.00 26.85  ? 570  LEU A CB    1 
ATOM   4660 C  CG    . LEU A 1 570 ? -9.181  1.982   44.645 1.00 27.73  ? 570  LEU A CG    1 
ATOM   4661 C  CD1   . LEU A 1 570 ? -9.015  1.448   46.055 1.00 24.56  ? 570  LEU A CD1   1 
ATOM   4662 C  CD2   . LEU A 1 570 ? -10.289 3.030   44.613 1.00 23.25  ? 570  LEU A CD2   1 
ATOM   4663 N  N     . GLY A 1 571 ? -5.428  2.908   41.760 1.00 27.60  ? 571  GLY A N     1 
ATOM   4664 C  CA    . GLY A 1 571 ? -4.225  3.626   41.330 1.00 27.59  ? 571  GLY A CA    1 
ATOM   4665 C  C     . GLY A 1 571 ? -4.031  3.631   39.821 1.00 26.98  ? 571  GLY A C     1 
ATOM   4666 O  O     . GLY A 1 571 ? -2.926  3.866   39.324 1.00 26.45  ? 571  GLY A O     1 
ATOM   4667 N  N     . ASN A 1 572 ? -5.103  3.346   39.090 1.00 26.38  ? 572  ASN A N     1 
ATOM   4668 C  CA    . ASN A 1 572 ? -5.084  3.434   37.638 1.00 25.26  ? 572  ASN A CA    1 
ATOM   4669 C  C     . ASN A 1 572 ? -5.959  4.591   37.196 1.00 24.06  ? 572  ASN A C     1 
ATOM   4670 O  O     . ASN A 1 572 ? -7.119  4.681   37.576 1.00 24.67  ? 572  ASN A O     1 
ATOM   4671 C  CB    . ASN A 1 572 ? -5.521  2.124   36.992 1.00 23.18  ? 572  ASN A CB    1 
ATOM   4672 C  CG    . ASN A 1 572 ? -5.505  2.188   35.485 1.00 27.97  ? 572  ASN A CG    1 
ATOM   4673 O  OD1   . ASN A 1 572 ? -6.308  2.898   34.873 1.00 28.51  ? 572  ASN A OD1   1 
ATOM   4674 N  ND2   . ASN A 1 572 ? -4.590  1.437   34.869 1.00 28.64  ? 572  ASN A ND2   1 
ATOM   4675 N  N     . VAL A 1 573 ? -5.386  5.473   36.387 1.00 26.28  ? 573  VAL A N     1 
ATOM   4676 C  CA    . VAL A 1 573 ? -6.019  6.749   36.051 1.00 26.21  ? 573  VAL A CA    1 
ATOM   4677 C  C     . VAL A 1 573 ? -7.292  6.605   35.234 1.00 26.69  ? 573  VAL A C     1 
ATOM   4678 O  O     . VAL A 1 573 ? -8.051  7.558   35.118 1.00 29.01  ? 573  VAL A O     1 
ATOM   4679 C  CB    . VAL A 1 573 ? -5.039  7.736   35.350 1.00 26.53  ? 573  VAL A CB    1 
ATOM   4680 C  CG1   . VAL A 1 573 ? -3.895  8.107   36.283 1.00 25.92  ? 573  VAL A CG1   1 
ATOM   4681 C  CG2   . VAL A 1 573 ? -4.510  7.169   34.031 1.00 24.99  ? 573  VAL A CG2   1 
ATOM   4682 N  N     . TRP A 1 574 ? -7.519  5.412   34.688 1.00 27.29  ? 574  TRP A N     1 
ATOM   4683 C  CA    . TRP A 1 574 ? -8.649  5.158   33.799 1.00 28.62  ? 574  TRP A CA    1 
ATOM   4684 C  C     . TRP A 1 574 ? -9.865  4.630   34.543 1.00 30.28  ? 574  TRP A C     1 
ATOM   4685 O  O     . TRP A 1 574 ? -10.955 4.509   33.971 1.00 31.51  ? 574  TRP A O     1 
ATOM   4686 C  CB    . TRP A 1 574 ? -8.236  4.191   32.693 1.00 28.30  ? 574  TRP A CB    1 
ATOM   4687 C  CG    . TRP A 1 574 ? -7.213  4.790   31.790 1.00 33.05  ? 574  TRP A CG    1 
ATOM   4688 C  CD1   . TRP A 1 574 ? -5.896  4.451   31.707 1.00 31.81  ? 574  TRP A CD1   1 
ATOM   4689 C  CD2   . TRP A 1 574 ? -7.413  5.861   30.862 1.00 34.37  ? 574  TRP A CD2   1 
ATOM   4690 N  NE1   . TRP A 1 574 ? -5.263  5.233   30.774 1.00 36.60  ? 574  TRP A NE1   1 
ATOM   4691 C  CE2   . TRP A 1 574 ? -6.170  6.113   30.243 1.00 37.26  ? 574  TRP A CE2   1 
ATOM   4692 C  CE3   . TRP A 1 574 ? -8.523  6.637   30.495 1.00 38.34  ? 574  TRP A CE3   1 
ATOM   4693 C  CZ2   . TRP A 1 574 ? -6.004  7.104   29.271 1.00 38.78  ? 574  TRP A CZ2   1 
ATOM   4694 C  CZ3   . TRP A 1 574 ? -8.358  7.623   29.529 1.00 39.03  ? 574  TRP A CZ3   1 
ATOM   4695 C  CH2   . TRP A 1 574 ? -7.108  7.844   28.926 1.00 41.84  ? 574  TRP A CH2   1 
ATOM   4696 N  N     . PHE A 1 575 ? -9.656  4.310   35.816 1.00 28.48  ? 575  PHE A N     1 
ATOM   4697 C  CA    . PHE A 1 575 ? -10.706 3.835   36.692 1.00 26.96  ? 575  PHE A CA    1 
ATOM   4698 C  C     . PHE A 1 575 ? -11.535 5.008   37.161 1.00 27.23  ? 575  PHE A C     1 
ATOM   4699 O  O     . PHE A 1 575 ? -10.994 6.001   37.648 1.00 26.56  ? 575  PHE A O     1 
ATOM   4700 C  CB    . PHE A 1 575 ? -10.070 3.168   37.898 1.00 27.82  ? 575  PHE A CB    1 
ATOM   4701 C  CG    . PHE A 1 575 ? -11.021 2.382   38.738 1.00 26.24  ? 575  PHE A CG    1 
ATOM   4702 C  CD1   . PHE A 1 575 ? -11.910 1.478   38.158 1.00 28.66  ? 575  PHE A CD1   1 
ATOM   4703 C  CD2   . PHE A 1 575 ? -10.990 2.501   40.123 1.00 26.59  ? 575  PHE A CD2   1 
ATOM   4704 C  CE1   . PHE A 1 575 ? -12.786 0.726   38.954 1.00 29.27  ? 575  PHE A CE1   1 
ATOM   4705 C  CE2   . PHE A 1 575 ? -11.846 1.754   40.928 1.00 27.28  ? 575  PHE A CE2   1 
ATOM   4706 C  CZ    . PHE A 1 575 ? -12.751 0.866   40.346 1.00 29.31  ? 575  PHE A CZ    1 
ATOM   4707 N  N     . ARG A 1 576 ? -12.852 4.883   37.027 1.00 27.56  ? 576  ARG A N     1 
ATOM   4708 C  CA    . ARG A 1 576 ? -13.785 5.913   37.470 1.00 26.70  ? 576  ARG A CA    1 
ATOM   4709 C  C     . ARG A 1 576 ? -13.553 6.342   38.928 1.00 27.53  ? 576  ARG A C     1 
ATOM   4710 O  O     . ARG A 1 576 ? -13.711 7.520   39.257 1.00 27.06  ? 576  ARG A O     1 
ATOM   4711 C  CB    . ARG A 1 576 ? -15.226 5.431   37.281 1.00 27.59  ? 576  ARG A CB    1 
ATOM   4712 C  CG    . ARG A 1 576 ? -16.287 6.523   37.424 1.00 27.22  ? 576  ARG A CG    1 
ATOM   4713 C  CD    . ARG A 1 576 ? -17.673 5.928   37.384 1.00 27.55  ? 576  ARG A CD    1 
ATOM   4714 N  NE    . ARG A 1 576 ? -17.849 5.088   36.209 1.00 24.80  ? 576  ARG A NE    1 
ATOM   4715 C  CZ    . ARG A 1 576 ? -18.204 5.539   35.010 1.00 27.22  ? 576  ARG A CZ    1 
ATOM   4716 N  NH1   . ARG A 1 576 ? -18.428 6.836   34.820 1.00 24.08  ? 576  ARG A NH1   1 
ATOM   4717 N  NH2   . ARG A 1 576 ? -18.333 4.687   33.999 1.00 19.12  ? 576  ARG A NH2   1 
ATOM   4718 N  N     . TYR A 1 577 ? -13.172 5.391   39.788 1.00 25.78  ? 577  TYR A N     1 
ATOM   4719 C  CA    . TYR A 1 577 ? -12.929 5.682   41.206 1.00 22.80  ? 577  TYR A CA    1 
ATOM   4720 C  C     . TYR A 1 577 ? -11.429 5.803   41.536 1.00 23.69  ? 577  TYR A C     1 
ATOM   4721 O  O     . TYR A 1 577 ? -11.006 5.628   42.683 1.00 24.19  ? 577  TYR A O     1 
ATOM   4722 C  CB    . TYR A 1 577 ? -13.677 4.678   42.091 1.00 19.55  ? 577  TYR A CB    1 
ATOM   4723 C  CG    . TYR A 1 577 ? -15.105 4.529   41.621 1.00 25.17  ? 577  TYR A CG    1 
ATOM   4724 C  CD1   . TYR A 1 577 ? -15.461 3.520   40.729 1.00 25.03  ? 577  TYR A CD1   1 
ATOM   4725 C  CD2   . TYR A 1 577 ? -16.089 5.443   42.004 1.00 23.51  ? 577  TYR A CD2   1 
ATOM   4726 C  CE1   . TYR A 1 577 ? -16.760 3.403   40.253 1.00 24.67  ? 577  TYR A CE1   1 
ATOM   4727 C  CE2   . TYR A 1 577 ? -17.382 5.336   41.536 1.00 25.16  ? 577  TYR A CE2   1 
ATOM   4728 C  CZ    . TYR A 1 577 ? -17.719 4.314   40.656 1.00 28.32  ? 577  TYR A CZ    1 
ATOM   4729 O  OH    . TYR A 1 577 ? -19.016 4.197   40.172 1.00 26.60  ? 577  TYR A OH    1 
ATOM   4730 N  N     . TYR A 1 578 ? -10.632 6.144   40.530 1.00 21.29  ? 578  TYR A N     1 
ATOM   4731 C  CA    . TYR A 1 578 ? -9.215  6.457   40.767 1.00 24.79  ? 578  TYR A CA    1 
ATOM   4732 C  C     . TYR A 1 578 ? -9.027  7.490   41.874 1.00 24.22  ? 578  TYR A C     1 
ATOM   4733 O  O     . TYR A 1 578 ? -9.653  8.546   41.836 1.00 29.17  ? 578  TYR A O     1 
ATOM   4734 C  CB    . TYR A 1 578 ? -8.584  6.995   39.495 1.00 22.42  ? 578  TYR A CB    1 
ATOM   4735 C  CG    . TYR A 1 578 ? -7.178  7.486   39.665 1.00 22.66  ? 578  TYR A CG    1 
ATOM   4736 C  CD1   . TYR A 1 578 ? -6.899  8.847   39.675 1.00 26.66  ? 578  TYR A CD1   1 
ATOM   4737 C  CD2   . TYR A 1 578 ? -6.123  6.598   39.784 1.00 25.99  ? 578  TYR A CD2   1 
ATOM   4738 C  CE1   . TYR A 1 578 ? -5.616  9.314   39.808 1.00 27.23  ? 578  TYR A CE1   1 
ATOM   4739 C  CE2   . TYR A 1 578 ? -4.821  7.053   39.916 1.00 30.63  ? 578  TYR A CE2   1 
ATOM   4740 C  CZ    . TYR A 1 578 ? -4.578  8.414   39.930 1.00 28.08  ? 578  TYR A CZ    1 
ATOM   4741 O  OH    . TYR A 1 578 ? -3.302  8.879   40.052 1.00 26.11  ? 578  TYR A OH    1 
ATOM   4742 N  N     . ASP A 1 579 ? -8.168  7.187   42.845 1.00 23.28  ? 579  ASP A N     1 
ATOM   4743 C  CA    . ASP A 1 579 ? -7.874  8.101   43.952 1.00 24.93  ? 579  ASP A CA    1 
ATOM   4744 C  C     . ASP A 1 579 ? -6.644  7.640   44.728 1.00 26.45  ? 579  ASP A C     1 
ATOM   4745 O  O     . ASP A 1 579 ? -6.687  6.648   45.457 1.00 25.50  ? 579  ASP A O     1 
ATOM   4746 C  CB    . ASP A 1 579 ? -9.082  8.225   44.892 1.00 26.77  ? 579  ASP A CB    1 
ATOM   4747 C  CG    . ASP A 1 579 ? -8.988  9.421   45.816 1.00 32.51  ? 579  ASP A CG    1 
ATOM   4748 O  OD1   . ASP A 1 579 ? -10.052 9.866   46.289 1.00 33.14  ? 579  ASP A OD1   1 
ATOM   4749 O  OD2   . ASP A 1 579 ? -7.863  9.925   46.071 1.00 36.57  ? 579  ASP A OD2   1 
ATOM   4750 N  N     . LEU A 1 580 ? -5.547  8.377   44.569 1.00 29.45  ? 580  LEU A N     1 
ATOM   4751 C  CA    . LEU A 1 580 ? -4.278  8.049   45.211 1.00 28.92  ? 580  LEU A CA    1 
ATOM   4752 C  C     . LEU A 1 580 ? -4.342  8.041   46.741 1.00 30.25  ? 580  LEU A C     1 
ATOM   4753 O  O     . LEU A 1 580 ? -3.557  7.350   47.376 1.00 32.84  ? 580  LEU A O     1 
ATOM   4754 C  CB    . LEU A 1 580 ? -3.180  8.985   44.725 1.00 29.77  ? 580  LEU A CB    1 
ATOM   4755 C  CG    . LEU A 1 580 ? -2.188  8.482   43.663 1.00 32.69  ? 580  LEU A CG    1 
ATOM   4756 C  CD1   . LEU A 1 580 ? -2.686  7.293   42.841 1.00 29.25  ? 580  LEU A CD1   1 
ATOM   4757 C  CD2   . LEU A 1 580 ? -1.766  9.636   42.762 1.00 35.02  ? 580  LEU A CD2   1 
ATOM   4758 N  N     . ARG A 1 581 ? -5.275  8.798   47.316 1.00 28.47  ? 581  ARG A N     1 
ATOM   4759 C  CA    . ARG A 1 581 ? -5.531  8.781   48.756 1.00 28.14  ? 581  ARG A CA    1 
ATOM   4760 C  C     . ARG A 1 581 ? -6.045  7.415   49.214 1.00 28.80  ? 581  ARG A C     1 
ATOM   4761 O  O     . ARG A 1 581 ? -5.683  6.931   50.289 1.00 29.69  ? 581  ARG A O     1 
ATOM   4762 C  CB    . ARG A 1 581 ? -6.562  9.850   49.147 1.00 29.37  ? 581  ARG A CB    1 
ATOM   4763 C  CG    . ARG A 1 581 ? -6.157  11.283  48.844 1.00 25.91  ? 581  ARG A CG    1 
ATOM   4764 C  CD    . ARG A 1 581 ? -7.291  12.257  49.121 1.00 31.60  ? 581  ARG A CD    1 
ATOM   4765 N  NE    . ARG A 1 581 ? -8.483  11.976  48.315 1.00 33.05  ? 581  ARG A NE    1 
ATOM   4766 C  CZ    . ARG A 1 581 ? -9.648  12.608  48.444 1.00 37.91  ? 581  ARG A CZ    1 
ATOM   4767 N  NH1   . ARG A 1 581 ? -9.801  13.571  49.349 1.00 36.09  ? 581  ARG A NH1   1 
ATOM   4768 N  NH2   . ARG A 1 581 ? -10.669 12.274  47.665 1.00 42.63  ? 581  ARG A NH2   1 
ATOM   4769 N  N     . ASN A 1 582 ? -6.905  6.803   48.408 1.00 27.92  ? 582  ASN A N     1 
ATOM   4770 C  CA    . ASN A 1 582 ? -7.426  5.487   48.742 1.00 25.61  ? 582  ASN A CA    1 
ATOM   4771 C  C     . ASN A 1 582 ? -6.426  4.384   48.433 1.00 25.89  ? 582  ASN A C     1 
ATOM   4772 O  O     . ASN A 1 582 ? -6.267  3.443   49.221 1.00 25.28  ? 582  ASN A O     1 
ATOM   4773 C  CB    . ASN A 1 582 ? -8.775  5.244   48.066 1.00 22.98  ? 582  ASN A CB    1 
ATOM   4774 C  CG    . ASN A 1 582 ? -9.921  5.997   48.762 1.00 27.41  ? 582  ASN A CG    1 
ATOM   4775 O  OD1   . ASN A 1 582 ? -9.783  6.451   49.907 1.00 26.32  ? 582  ASN A OD1   1 
ATOM   4776 N  ND2   . ASN A 1 582 ? -11.057 6.121   48.074 1.00 24.48  ? 582  ASN A ND2   1 
ATOM   4777 N  N     . ALA A 1 583 ? -5.739  4.513   47.296 1.00 26.77  ? 583  ALA A N     1 
ATOM   4778 C  CA    . ALA A 1 583 ? -4.710  3.553   46.912 1.00 27.53  ? 583  ALA A CA    1 
ATOM   4779 C  C     . ALA A 1 583 ? -3.620  3.535   47.984 1.00 29.68  ? 583  ALA A C     1 
ATOM   4780 O  O     . ALA A 1 583 ? -3.225  2.473   48.480 1.00 31.16  ? 583  ALA A O     1 
ATOM   4781 C  CB    . ALA A 1 583 ? -4.139  3.897   45.557 1.00 26.44  ? 583  ALA A CB    1 
ATOM   4782 N  N     . THR A 1 584 ? -3.190  4.730   48.372 1.00 29.36  ? 584  THR A N     1 
ATOM   4783 C  CA    . THR A 1 584 ? -2.156  4.918   49.380 1.00 28.47  ? 584  THR A CA    1 
ATOM   4784 C  C     . THR A 1 584 ? -2.628  4.530   50.782 1.00 25.37  ? 584  THR A C     1 
ATOM   4785 O  O     . THR A 1 584 ? -1.837  4.077   51.601 1.00 23.83  ? 584  THR A O     1 
ATOM   4786 C  CB    . THR A 1 584 ? -1.657  6.371   49.329 1.00 29.11  ? 584  THR A CB    1 
ATOM   4787 O  OG1   . THR A 1 584 ? -0.964  6.555   48.089 1.00 29.72  ? 584  THR A OG1   1 
ATOM   4788 C  CG2   . THR A 1 584 ? -0.713  6.681   50.466 1.00 34.67  ? 584  THR A CG2   1 
ATOM   4789 N  N     . ALA A 1 585 ? -3.917  4.691   51.053 1.00 24.56  ? 585  ALA A N     1 
ATOM   4790 C  CA    . ALA A 1 585 ? -4.466  4.263   52.340 1.00 23.16  ? 585  ALA A CA    1 
ATOM   4791 C  C     . ALA A 1 585 ? -4.224  2.764   52.562 1.00 21.28  ? 585  ALA A C     1 
ATOM   4792 O  O     . ALA A 1 585 ? -3.822  2.351   53.646 1.00 21.16  ? 585  ALA A O     1 
ATOM   4793 C  CB    . ALA A 1 585 ? -5.933  4.601   52.438 1.00 21.32  ? 585  ALA A CB    1 
ATOM   4794 N  N     . ILE A 1 586 ? -4.423  1.971   51.511 1.00 19.73  ? 586  ILE A N     1 
ATOM   4795 C  CA    . ILE A 1 586 ? -4.204  0.531   51.552 1.00 19.29  ? 586  ILE A CA    1 
ATOM   4796 C  C     . ILE A 1 586 ? -2.720  0.195   51.741 1.00 21.17  ? 586  ILE A C     1 
ATOM   4797 O  O     . ILE A 1 586 ? -2.339  -0.455  52.717 1.00 23.22  ? 586  ILE A O     1 
ATOM   4798 C  CB    . ILE A 1 586 ? -4.743  -0.153  50.266 1.00 19.23  ? 586  ILE A CB    1 
ATOM   4799 C  CG1   . ILE A 1 586 ? -6.257  0.090   50.117 1.00 23.12  ? 586  ILE A CG1   1 
ATOM   4800 C  CG2   . ILE A 1 586 ? -4.438  -1.657  50.260 1.00 13.27  ? 586  ILE A CG2   1 
ATOM   4801 C  CD1   . ILE A 1 586 ? -6.772  -0.078  48.665 1.00 19.59  ? 586  ILE A CD1   1 
ATOM   4802 N  N     . THR A 1 587 ? -1.879  0.641   50.820 1.00 21.23  ? 587  THR A N     1 
ATOM   4803 C  CA    . THR A 1 587 ? -0.487  0.224   50.846 1.00 22.85  ? 587  THR A CA    1 
ATOM   4804 C  C     . THR A 1 587 ? 0.209   0.663   52.144 1.00 25.54  ? 587  THR A C     1 
ATOM   4805 O  O     . THR A 1 587 ? 0.991   -0.112  52.731 1.00 22.68  ? 587  THR A O     1 
ATOM   4806 C  CB    . THR A 1 587 ? 0.274   0.706   49.595 1.00 22.79  ? 587  THR A CB    1 
ATOM   4807 O  OG1   . THR A 1 587 ? 0.288   2.133   49.567 1.00 21.94  ? 587  THR A OG1   1 
ATOM   4808 C  CG2   . THR A 1 587 ? -0.398  0.183   48.313 1.00 21.66  ? 587  THR A CG2   1 
ATOM   4809 N  N     . THR A 1 588 ? -0.098  1.881   52.607 1.00 24.06  ? 588  THR A N     1 
ATOM   4810 C  CA    . THR A 1 588 ? 0.580   2.421   53.788 1.00 25.53  ? 588  THR A CA    1 
ATOM   4811 C  C     . THR A 1 588 ? 0.149   1.685   55.060 1.00 25.17  ? 588  THR A C     1 
ATOM   4812 O  O     . THR A 1 588 ? 0.971   1.374   55.919 1.00 24.44  ? 588  THR A O     1 
ATOM   4813 C  CB    . THR A 1 588 ? 0.418   3.968   53.929 1.00 27.50  ? 588  THR A CB    1 
ATOM   4814 O  OG1   . THR A 1 588 ? 0.541   4.600   52.647 1.00 23.56  ? 588  THR A OG1   1 
ATOM   4815 C  CG2   . THR A 1 588 ? 1.496   4.533   54.824 1.00 26.64  ? 588  THR A CG2   1 
ATOM   4816 N  N     . PHE A 1 589 ? -1.139  1.379   55.156 1.00 24.87  ? 589  PHE A N     1 
ATOM   4817 C  CA    . PHE A 1 589 ? -1.657  0.554   56.240 1.00 24.99  ? 589  PHE A CA    1 
ATOM   4818 C  C     . PHE A 1 589 ? -1.001  -0.823  56.218 1.00 27.59  ? 589  PHE A C     1 
ATOM   4819 O  O     . PHE A 1 589 ? -0.764  -1.427  57.275 1.00 28.37  ? 589  PHE A O     1 
ATOM   4820 C  CB    . PHE A 1 589 ? -3.164  0.395   56.086 1.00 26.32  ? 589  PHE A CB    1 
ATOM   4821 C  CG    . PHE A 1 589 ? -3.836  -0.257  57.259 1.00 27.28  ? 589  PHE A CG    1 
ATOM   4822 C  CD1   . PHE A 1 589 ? -3.990  -1.638  57.311 1.00 25.96  ? 589  PHE A CD1   1 
ATOM   4823 C  CD2   . PHE A 1 589 ? -4.342  0.516   58.302 1.00 27.23  ? 589  PHE A CD2   1 
ATOM   4824 C  CE1   . PHE A 1 589 ? -4.634  -2.238  58.387 1.00 26.77  ? 589  PHE A CE1   1 
ATOM   4825 C  CE2   . PHE A 1 589 ? -4.984  -0.074  59.380 1.00 26.31  ? 589  PHE A CE2   1 
ATOM   4826 C  CZ    . PHE A 1 589 ? -5.137  -1.454  59.418 1.00 27.28  ? 589  PHE A CZ    1 
ATOM   4827 N  N     . GLY A 1 590 ? -0.721  -1.313  55.007 1.00 26.19  ? 590  GLY A N     1 
ATOM   4828 C  CA    . GLY A 1 590 ? -0.076  -2.609  54.816 1.00 24.60  ? 590  GLY A CA    1 
ATOM   4829 C  C     . GLY A 1 590 ? 1.331   -2.580  55.369 1.00 25.40  ? 590  GLY A C     1 
ATOM   4830 O  O     . GLY A 1 590 ? 1.736   -3.486  56.090 1.00 27.69  ? 590  GLY A O     1 
ATOM   4831 N  N     . GLN A 1 591 ? 2.066   -1.524  55.046 1.00 26.39  ? 591  GLN A N     1 
ATOM   4832 C  CA    . GLN A 1 591 ? 3.416   -1.332  55.557 1.00 27.13  ? 591  GLN A CA    1 
ATOM   4833 C  C     . GLN A 1 591 ? 3.437   -1.262  57.072 1.00 31.22  ? 591  GLN A C     1 
ATOM   4834 O  O     . GLN A 1 591 ? 4.297   -1.879  57.706 1.00 34.11  ? 591  GLN A O     1 
ATOM   4835 C  CB    . GLN A 1 591 ? 4.031   -0.065  54.988 1.00 25.66  ? 591  GLN A CB    1 
ATOM   4836 C  CG    . GLN A 1 591 ? 4.595   -0.226  53.601 1.00 29.49  ? 591  GLN A CG    1 
ATOM   4837 C  CD    . GLN A 1 591 ? 5.678   0.789   53.292 1.00 32.17  ? 591  GLN A CD    1 
ATOM   4838 O  OE1   . GLN A 1 591 ? 6.455   1.187   54.168 1.00 34.22  ? 591  GLN A OE1   1 
ATOM   4839 N  NE2   . GLN A 1 591 ? 5.746   1.204   52.032 1.00 35.66  ? 591  GLN A NE2   1 
ATOM   4840 N  N     . MET A 1 592 ? 2.501   -0.509  57.655 1.00 31.95  ? 592  MET A N     1 
ATOM   4841 C  CA    . MET A 1 592 ? 2.413   -0.428  59.108 1.00 33.16  ? 592  MET A CA    1 
ATOM   4842 C  C     . MET A 1 592 ? 2.124   -1.814  59.677 1.00 33.44  ? 592  MET A C     1 
ATOM   4843 O  O     . MET A 1 592 ? 2.855   -2.292  60.539 1.00 33.30  ? 592  MET A O     1 
ATOM   4844 C  CB    . MET A 1 592 ? 1.339   0.569   59.557 1.00 35.02  ? 592  MET A CB    1 
ATOM   4845 C  CG    . MET A 1 592 ? 1.095   0.567   61.065 1.00 33.49  ? 592  MET A CG    1 
ATOM   4846 S  SD    . MET A 1 592 ? -0.191  1.710   61.580 1.00 32.81  ? 592  MET A SD    1 
ATOM   4847 C  CE    . MET A 1 592 ? -1.623  0.982   60.790 1.00 37.50  ? 592  MET A CE    1 
ATOM   4848 N  N     . ALA A 1 593 ? 1.068   -2.451  59.169 1.00 31.60  ? 593  ALA A N     1 
ATOM   4849 C  CA    . ALA A 1 593 ? 0.647   -3.768  59.626 1.00 29.77  ? 593  ALA A CA    1 
ATOM   4850 C  C     . ALA A 1 593 ? 1.818   -4.753  59.746 1.00 30.24  ? 593  ALA A C     1 
ATOM   4851 O  O     . ALA A 1 593 ? 2.045   -5.327  60.811 1.00 30.85  ? 593  ALA A O     1 
ATOM   4852 C  CB    . ALA A 1 593 ? -0.430  -4.318  58.706 1.00 28.43  ? 593  ALA A CB    1 
ATOM   4853 N  N     . LEU A 1 594 ? 2.568   -4.914  58.659 1.00 30.02  ? 594  LEU A N     1 
ATOM   4854 C  CA    . LEU A 1 594 ? 3.693   -5.852  58.593 1.00 30.25  ? 594  LEU A CA    1 
ATOM   4855 C  C     . LEU A 1 594 ? 4.760   -5.553  59.633 1.00 30.40  ? 594  LEU A C     1 
ATOM   4856 O  O     . LEU A 1 594 ? 5.236   -6.448  60.324 1.00 29.29  ? 594  LEU A O     1 
ATOM   4857 C  CB    . LEU A 1 594 ? 4.314   -5.826  57.195 1.00 29.94  ? 594  LEU A CB    1 
ATOM   4858 C  CG    . LEU A 1 594 ? 5.562   -6.649  56.895 1.00 33.21  ? 594  LEU A CG    1 
ATOM   4859 C  CD1   . LEU A 1 594 ? 5.357   -8.088  57.293 1.00 35.46  ? 594  LEU A CD1   1 
ATOM   4860 C  CD2   . LEU A 1 594 ? 5.875   -6.547  55.411 1.00 31.56  ? 594  LEU A CD2   1 
ATOM   4861 N  N     . GLN A 1 595 ? 5.126   -4.287  59.745 1.00 30.19  ? 595  GLN A N     1 
ATOM   4862 C  CA    . GLN A 1 595 ? 6.170   -3.907  60.672 1.00 30.93  ? 595  GLN A CA    1 
ATOM   4863 C  C     . GLN A 1 595 ? 5.684   -3.884  62.123 1.00 31.40  ? 595  GLN A C     1 
ATOM   4864 O  O     . GLN A 1 595 ? 6.442   -4.200  63.045 1.00 31.83  ? 595  GLN A O     1 
ATOM   4865 C  CB    . GLN A 1 595 ? 6.817   -2.598  60.229 1.00 30.60  ? 595  GLN A CB    1 
ATOM   4866 C  CG    . GLN A 1 595 ? 7.865   -2.844  59.147 1.00 29.24  ? 595  GLN A CG    1 
ATOM   4867 C  CD    . GLN A 1 595 ? 8.243   -1.608  58.354 1.00 31.94  ? 595  GLN A CD    1 
ATOM   4868 O  OE1   . GLN A 1 595 ? 9.380   -1.142  58.429 1.00 33.66  ? 595  GLN A OE1   1 
ATOM   4869 N  NE2   . GLN A 1 595 ? 7.295   -1.079  57.574 1.00 31.70  ? 595  GLN A NE2   1 
ATOM   4870 N  N     . TRP A 1 596 ? 4.410   -3.551  62.311 1.00 30.93  ? 596  TRP A N     1 
ATOM   4871 C  CA    . TRP A 1 596 ? 3.772   -3.597  63.630 1.00 29.46  ? 596  TRP A CA    1 
ATOM   4872 C  C     . TRP A 1 596 ? 3.854   -5.020  64.166 1.00 29.28  ? 596  TRP A C     1 
ATOM   4873 O  O     . TRP A 1 596 ? 4.332   -5.253  65.280 1.00 31.27  ? 596  TRP A O     1 
ATOM   4874 C  CB    . TRP A 1 596 ? 2.309   -3.143  63.521 1.00 27.03  ? 596  TRP A CB    1 
ATOM   4875 C  CG    . TRP A 1 596 ? 1.461   -3.298  64.750 1.00 25.10  ? 596  TRP A CG    1 
ATOM   4876 C  CD1   . TRP A 1 596 ? 0.827   -4.427  65.161 1.00 23.46  ? 596  TRP A CD1   1 
ATOM   4877 C  CD2   . TRP A 1 596 ? 1.127   -2.275  65.709 1.00 24.97  ? 596  TRP A CD2   1 
ATOM   4878 N  NE1   . TRP A 1 596 ? 0.128   -4.183  66.321 1.00 27.15  ? 596  TRP A NE1   1 
ATOM   4879 C  CE2   . TRP A 1 596 ? 0.296   -2.872  66.681 1.00 24.71  ? 596  TRP A CE2   1 
ATOM   4880 C  CE3   . TRP A 1 596 ? 1.457   -0.918  65.841 1.00 26.18  ? 596  TRP A CE3   1 
ATOM   4881 C  CZ2   . TRP A 1 596 ? -0.225  -2.160  67.768 1.00 25.08  ? 596  TRP A CZ2   1 
ATOM   4882 C  CZ3   . TRP A 1 596 ? 0.942   -0.207  66.920 1.00 28.04  ? 596  TRP A CZ3   1 
ATOM   4883 C  CH2   . TRP A 1 596 ? 0.106   -0.834  67.873 1.00 28.85  ? 596  TRP A CH2   1 
ATOM   4884 N  N     . ILE A 1 597 ? 3.410   -5.970  63.352 1.00 26.56  ? 597  ILE A N     1 
ATOM   4885 C  CA    . ILE A 1 597 ? 3.274   -7.334  63.809 1.00 27.80  ? 597  ILE A CA    1 
ATOM   4886 C  C     . ILE A 1 597 ? 4.639   -8.048  63.913 1.00 32.12  ? 597  ILE A C     1 
ATOM   4887 O  O     . ILE A 1 597 ? 4.768   -9.054  64.620 1.00 35.09  ? 597  ILE A O     1 
ATOM   4888 C  CB    . ILE A 1 597 ? 2.260   -8.105  62.945 1.00 26.32  ? 597  ILE A CB    1 
ATOM   4889 C  CG1   . ILE A 1 597 ? 1.657   -9.270  63.726 1.00 25.45  ? 597  ILE A CG1   1 
ATOM   4890 C  CG2   . ILE A 1 597 ? 2.876   -8.545  61.615 1.00 29.04  ? 597  ILE A CG2   1 
ATOM   4891 C  CD1   . ILE A 1 597 ? 0.769   -8.822  64.868 1.00 31.89  ? 597  ILE A CD1   1 
ATOM   4892 N  N     . GLU A 1 598 ? 5.651   -7.515  63.227 1.00 32.14  ? 598  GLU A N     1 
ATOM   4893 C  CA    . GLU A 1 598 ? 7.024   -7.983  63.407 1.00 33.00  ? 598  GLU A CA    1 
ATOM   4894 C  C     . GLU A 1 598 ? 7.486   -7.700  64.843 1.00 33.31  ? 598  GLU A C     1 
ATOM   4895 O  O     . GLU A 1 598 ? 8.037   -8.575  65.526 1.00 33.17  ? 598  GLU A O     1 
ATOM   4896 C  CB    . GLU A 1 598 ? 7.967   -7.316  62.401 1.00 30.80  ? 598  GLU A CB    1 
ATOM   4897 C  CG    . GLU A 1 598 ? 9.430   -7.722  62.577 1.00 35.45  ? 598  GLU A CG    1 
ATOM   4898 C  CD    . GLU A 1 598 ? 10.399  -6.872  61.774 1.00 38.07  ? 598  GLU A CD    1 
ATOM   4899 O  OE1   . GLU A 1 598 ? 9.943   -5.944  61.064 1.00 39.77  ? 598  GLU A OE1   1 
ATOM   4900 O  OE2   . GLU A 1 598 ? 11.624  -7.131  61.862 1.00 42.46  ? 598  GLU A OE2   1 
ATOM   4901 N  N     . ARG A 1 599 ? 7.246   -6.470  65.287 1.00 32.46  ? 599  ARG A N     1 
ATOM   4902 C  CA    . ARG A 1 599 ? 7.601   -6.059  66.628 1.00 32.47  ? 599  ARG A CA    1 
ATOM   4903 C  C     . ARG A 1 599 ? 6.862   -6.933  67.641 1.00 31.73  ? 599  ARG A C     1 
ATOM   4904 O  O     . ARG A 1 599 ? 7.477   -7.478  68.560 1.00 30.71  ? 599  ARG A O     1 
ATOM   4905 C  CB    . ARG A 1 599 ? 7.301   -4.565  66.834 1.00 33.01  ? 599  ARG A CB    1 
ATOM   4906 C  CG    . ARG A 1 599 ? 7.518   -4.058  68.259 1.00 33.76  ? 599  ARG A CG    1 
ATOM   4907 C  CD    . ARG A 1 599 ? 7.185   -2.563  68.423 1.00 34.82  ? 599  ARG A CD    1 
ATOM   4908 N  NE    . ARG A 1 599 ? 5.806   -2.217  68.056 1.00 35.76  ? 599  ARG A NE    1 
ATOM   4909 C  CZ    . ARG A 1 599 ? 4.748   -2.288  68.868 1.00 38.33  ? 599  ARG A CZ    1 
ATOM   4910 N  NH1   . ARG A 1 599 ? 4.876   -2.706  70.125 1.00 40.61  ? 599  ARG A NH1   1 
ATOM   4911 N  NH2   . ARG A 1 599 ? 3.548   -1.940  68.421 1.00 33.85  ? 599  ARG A NH2   1 
ATOM   4912 N  N     . LYS A 1 600 ? 5.555   -7.100  67.445 1.00 29.86  ? 600  LYS A N     1 
ATOM   4913 C  CA    . LYS A 1 600 ? 4.757   -7.847  68.407 1.00 29.78  ? 600  LYS A CA    1 
ATOM   4914 C  C     . LYS A 1 600 ? 5.209   -9.290  68.517 1.00 29.11  ? 600  LYS A C     1 
ATOM   4915 O  O     . LYS A 1 600 ? 5.231   -9.847  69.610 1.00 31.76  ? 600  LYS A O     1 
ATOM   4916 C  CB    . LYS A 1 600 ? 3.262   -7.780  68.091 1.00 30.34  ? 600  LYS A CB    1 
ATOM   4917 C  CG    . LYS A 1 600 ? 2.624   -6.426  68.319 1.00 32.04  ? 600  LYS A CG    1 
ATOM   4918 C  CD    . LYS A 1 600 ? 2.571   -6.043  69.786 1.00 33.03  ? 600  LYS A CD    1 
ATOM   4919 C  CE    . LYS A 1 600 ? 1.528   -4.950  69.995 1.00 34.16  ? 600  LYS A CE    1 
ATOM   4920 N  NZ    . LYS A 1 600 ? 1.116   -4.854  71.416 1.00 34.23  ? 600  LYS A NZ    1 
ATOM   4921 N  N     . VAL A 1 601 ? 5.575   -9.889  67.389 1.00 27.49  ? 601  VAL A N     1 
ATOM   4922 C  CA    . VAL A 1 601 ? 6.043   -11.267 67.376 1.00 26.70  ? 601  VAL A CA    1 
ATOM   4923 C  C     . VAL A 1 601 ? 7.420   -11.443 68.042 1.00 28.56  ? 601  VAL A C     1 
ATOM   4924 O  O     . VAL A 1 601 ? 7.605   -12.382 68.820 1.00 31.84  ? 601  VAL A O     1 
ATOM   4925 C  CB    . VAL A 1 601 ? 6.006   -11.856 65.962 1.00 24.70  ? 601  VAL A CB    1 
ATOM   4926 C  CG1   . VAL A 1 601 ? 6.885   -13.101 65.859 1.00 25.19  ? 601  VAL A CG1   1 
ATOM   4927 C  CG2   . VAL A 1 601 ? 4.578   -12.186 65.590 1.00 24.94  ? 601  VAL A CG2   1 
ATOM   4928 N  N     . ASN A 1 602 ? 8.375   -10.562 67.756 1.00 27.19  ? 602  ASN A N     1 
ATOM   4929 C  CA    . ASN A 1 602 ? 9.659   -10.632 68.474 1.00 30.82  ? 602  ASN A CA    1 
ATOM   4930 C  C     . ASN A 1 602 ? 9.437   -10.436 69.965 1.00 32.96  ? 602  ASN A C     1 
ATOM   4931 O  O     . ASN A 1 602 ? 10.009  -11.154 70.774 1.00 37.63  ? 602  ASN A O     1 
ATOM   4932 C  CB    . ASN A 1 602 ? 10.671  -9.608  67.961 1.00 28.54  ? 602  ASN A CB    1 
ATOM   4933 C  CG    . ASN A 1 602 ? 11.162  -9.914  66.554 1.00 29.42  ? 602  ASN A CG    1 
ATOM   4934 O  OD1   . ASN A 1 602 ? 11.503  -11.059 66.217 1.00 25.29  ? 602  ASN A OD1   1 
ATOM   4935 N  ND2   . ASN A 1 602 ? 11.211  -8.881  65.726 1.00 26.95  ? 602  ASN A ND2   1 
ATOM   4936 N  N     . GLU A 1 603 ? 8.591   -9.475  70.329 1.00 33.68  ? 603  GLU A N     1 
ATOM   4937 C  CA    . GLU A 1 603 ? 8.263   -9.260  71.738 1.00 35.71  ? 603  GLU A CA    1 
ATOM   4938 C  C     . GLU A 1 603 ? 7.760   -10.551 72.372 1.00 34.94  ? 603  GLU A C     1 
ATOM   4939 O  O     . GLU A 1 603 ? 8.370   -11.046 73.315 1.00 35.62  ? 603  GLU A O     1 
ATOM   4940 C  CB    . GLU A 1 603 ? 7.252   -8.122  71.917 1.00 34.75  ? 603  GLU A CB    1 
ATOM   4941 C  CG    . GLU A 1 603 ? 7.887   -6.744  71.812 1.00 37.54  ? 603  GLU A CG    1 
ATOM   4942 C  CD    . GLU A 1 603 ? 6.879   -5.610  71.749 1.00 41.28  ? 603  GLU A CD    1 
ATOM   4943 O  OE1   . GLU A 1 603 ? 5.675   -5.849  71.999 1.00 42.17  ? 603  GLU A OE1   1 
ATOM   4944 O  OE2   . GLU A 1 603 ? 7.303   -4.469  71.454 1.00 41.61  ? 603  GLU A OE2   1 
ATOM   4945 N  N     . TYR A 1 604 ? 6.687   -11.112 71.815 1.00 32.55  ? 604  TYR A N     1 
ATOM   4946 C  CA    . TYR A 1 604 ? 6.071   -12.319 72.354 1.00 33.69  ? 604  TYR A CA    1 
ATOM   4947 C  C     . TYR A 1 604 ? 7.045   -13.499 72.489 1.00 35.57  ? 604  TYR A C     1 
ATOM   4948 O  O     . TYR A 1 604 ? 7.108   -14.138 73.548 1.00 35.61  ? 604  TYR A O     1 
ATOM   4949 C  CB    . TYR A 1 604 ? 4.847   -12.724 71.526 1.00 33.77  ? 604  TYR A CB    1 
ATOM   4950 C  CG    . TYR A 1 604 ? 4.238   -14.037 71.966 1.00 34.22  ? 604  TYR A CG    1 
ATOM   4951 C  CD1   . TYR A 1 604 ? 4.573   -15.229 71.322 1.00 30.40  ? 604  TYR A CD1   1 
ATOM   4952 C  CD2   . TYR A 1 604 ? 3.342   -14.092 73.040 1.00 35.65  ? 604  TYR A CD2   1 
ATOM   4953 C  CE1   . TYR A 1 604 ? 4.031   -16.438 71.725 1.00 33.40  ? 604  TYR A CE1   1 
ATOM   4954 C  CE2   . TYR A 1 604 ? 2.787   -15.302 73.448 1.00 35.46  ? 604  TYR A CE2   1 
ATOM   4955 C  CZ    . TYR A 1 604 ? 3.142   -16.471 72.785 1.00 36.44  ? 604  TYR A CZ    1 
ATOM   4956 O  OH    . TYR A 1 604 ? 2.619   -17.679 73.183 1.00 39.44  ? 604  TYR A OH    1 
ATOM   4957 N  N     . LEU A 1 605 ? 7.796   -13.790 71.428 1.00 33.94  ? 605  LEU A N     1 
ATOM   4958 C  CA    . LEU A 1 605 ? 8.663   -14.967 71.427 1.00 35.07  ? 605  LEU A CA    1 
ATOM   4959 C  C     . LEU A 1 605 ? 9.850   -14.834 72.393 1.00 38.07  ? 605  LEU A C     1 
ATOM   4960 O  O     . LEU A 1 605 ? 10.239  -15.810 73.044 1.00 39.30  ? 605  LEU A O     1 
ATOM   4961 C  CB    . LEU A 1 605 ? 9.124   -15.308 70.012 1.00 34.70  ? 605  LEU A CB    1 
ATOM   4962 C  CG    . LEU A 1 605 ? 8.039   -15.801 69.050 1.00 31.16  ? 605  LEU A CG    1 
ATOM   4963 C  CD1   . LEU A 1 605 ? 8.611   -15.915 67.662 1.00 25.79  ? 605  LEU A CD1   1 
ATOM   4964 C  CD2   . LEU A 1 605 ? 7.426   -17.133 69.500 1.00 25.51  ? 605  LEU A CD2   1 
ATOM   4965 N  N     . ASN A 1 606 ? 10.400  -13.628 72.500 1.00 38.16  ? 606  ASN A N     1 
ATOM   4966 C  CA    . ASN A 1 606 ? 11.400  -13.328 73.520 1.00 41.16  ? 606  ASN A CA    1 
ATOM   4967 C  C     . ASN A 1 606 ? 10.852  -13.596 74.917 1.00 43.64  ? 606  ASN A C     1 
ATOM   4968 O  O     . ASN A 1 606 ? 11.542  -14.155 75.777 1.00 45.49  ? 606  ASN A O     1 
ATOM   4969 C  CB    . ASN A 1 606 ? 11.856  -11.875 73.408 1.00 39.85  ? 606  ASN A CB    1 
ATOM   4970 C  CG    . ASN A 1 606 ? 13.003  -11.706 72.448 1.00 40.33  ? 606  ASN A CG    1 
ATOM   4971 O  OD1   . ASN A 1 606 ? 14.112  -12.163 72.718 1.00 44.27  ? 606  ASN A OD1   1 
ATOM   4972 N  ND2   . ASN A 1 606 ? 12.755  -11.035 71.323 1.00 35.33  ? 606  ASN A ND2   1 
ATOM   4973 N  N     . GLU A 1 607 ? 9.595   -13.218 75.127 1.00 44.07  ? 607  GLU A N     1 
ATOM   4974 C  CA    . GLU A 1 607 ? 8.963   -13.408 76.415 1.00 46.48  ? 607  GLU A CA    1 
ATOM   4975 C  C     . GLU A 1 607 ? 8.789   -14.891 76.726 1.00 45.94  ? 607  GLU A C     1 
ATOM   4976 O  O     . GLU A 1 607 ? 9.190   -15.342 77.804 1.00 46.79  ? 607  GLU A O     1 
ATOM   4977 C  CB    . GLU A 1 607 ? 7.631   -12.661 76.494 1.00 48.16  ? 607  GLU A CB    1 
ATOM   4978 C  CG    . GLU A 1 607 ? 7.185   -12.351 77.923 1.00 58.69  ? 607  GLU A CG    1 
ATOM   4979 C  CD    . GLU A 1 607 ? 5.732   -11.899 78.014 1.00 64.82  ? 607  GLU A CD    1 
ATOM   4980 O  OE1   . GLU A 1 607 ? 5.225   -11.275 77.052 1.00 67.07  ? 607  GLU A OE1   1 
ATOM   4981 O  OE2   . GLU A 1 607 ? 5.098   -12.168 79.061 1.00 68.97  ? 607  GLU A OE2   1 
ATOM   4982 N  N     . VAL A 1 608 ? 8.221   -15.655 75.789 1.00 42.54  ? 608  VAL A N     1 
ATOM   4983 C  CA    . VAL A 1 608 ? 7.969   -17.077 76.055 1.00 41.41  ? 608  VAL A CA    1 
ATOM   4984 C  C     . VAL A 1 608 ? 9.263   -17.879 76.152 1.00 40.65  ? 608  VAL A C     1 
ATOM   4985 O  O     . VAL A 1 608 ? 9.335   -18.858 76.887 1.00 40.24  ? 608  VAL A O     1 
ATOM   4986 C  CB    . VAL A 1 608 ? 6.966   -17.737 75.065 1.00 41.72  ? 608  VAL A CB    1 
ATOM   4987 C  CG1   . VAL A 1 608 ? 5.595   -17.042 75.136 1.00 43.03  ? 608  VAL A CG1   1 
ATOM   4988 C  CG2   . VAL A 1 608 ? 7.503   -17.758 73.634 1.00 40.71  ? 608  VAL A CG2   1 
ATOM   4989 N  N     . CYS A 1 609 ? 10.290  -17.444 75.430 1.00 42.18  ? 609  CYS A N     1 
ATOM   4990 C  CA    . CYS A 1 609 ? 11.594  -18.092 75.498 1.00 42.56  ? 609  CYS A CA    1 
ATOM   4991 C  C     . CYS A 1 609 ? 12.461  -17.561 76.632 1.00 44.90  ? 609  CYS A C     1 
ATOM   4992 O  O     . CYS A 1 609 ? 13.573  -18.051 76.833 1.00 46.41  ? 609  CYS A O     1 
ATOM   4993 C  CB    . CYS A 1 609 ? 12.319  -17.967 74.171 1.00 40.71  ? 609  CYS A CB    1 
ATOM   4994 S  SG    . CYS A 1 609 ? 11.475  -18.854 72.880 1.00 40.65  ? 609  CYS A SG    1 
ATOM   4995 N  N     . GLY A 1 610 ? 11.952  -16.560 77.355 1.00 44.80  ? 610  GLY A N     1 
ATOM   4996 C  CA    . GLY A 1 610 ? 12.618  -16.016 78.543 1.00 46.06  ? 610  GLY A CA    1 
ATOM   4997 C  C     . GLY A 1 610 ? 13.881  -15.213 78.286 1.00 47.27  ? 610  GLY A C     1 
ATOM   4998 O  O     . GLY A 1 610 ? 14.718  -15.048 79.182 1.00 48.60  ? 610  GLY A O     1 
ATOM   4999 N  N     . THR A 1 611 ? 14.014  -14.717 77.060 1.00 47.96  ? 611  THR A N     1 
ATOM   5000 C  CA    . THR A 1 611 ? 15.167  -13.922 76.632 1.00 47.73  ? 611  THR A CA    1 
ATOM   5001 C  C     . THR A 1 611 ? 14.716  -12.504 76.268 1.00 49.36  ? 611  THR A C     1 
ATOM   5002 O  O     . THR A 1 611 ? 13.559  -12.144 76.496 1.00 49.99  ? 611  THR A O     1 
ATOM   5003 C  CB    . THR A 1 611 ? 15.864  -14.572 75.433 1.00 46.44  ? 611  THR A CB    1 
ATOM   5004 O  OG1   . THR A 1 611 ? 14.962  -14.599 74.314 1.00 41.76  ? 611  THR A OG1   1 
ATOM   5005 C  CG2   . THR A 1 611 ? 16.313  -15.992 75.784 1.00 42.43  ? 611  THR A CG2   1 
ATOM   5006 N  N     . GLU A 1 612 ? 15.617  -11.698 75.713 1.00 50.41  ? 612  GLU A N     1 
ATOM   5007 C  CA    . GLU A 1 612 ? 15.285  -10.306 75.419 1.00 52.05  ? 612  GLU A CA    1 
ATOM   5008 C  C     . GLU A 1 612 ? 16.028  -9.789  74.190 1.00 51.35  ? 612  GLU A C     1 
ATOM   5009 O  O     . GLU A 1 612 ? 17.242  -9.965  74.066 1.00 48.39  ? 612  GLU A O     1 
ATOM   5010 C  CB    . GLU A 1 612 ? 15.590  -9.433  76.637 1.00 55.59  ? 612  GLU A CB    1 
ATOM   5011 C  CG    . GLU A 1 612 ? 14.534  -8.373  76.959 1.00 61.71  ? 612  GLU A CG    1 
ATOM   5012 C  CD    . GLU A 1 612 ? 14.597  -7.881  78.418 1.00 67.54  ? 612  GLU A CD    1 
ATOM   5013 O  OE1   . GLU A 1 612 ? 15.613  -8.120  79.114 1.00 67.56  ? 612  GLU A OE1   1 
ATOM   5014 O  OE2   . GLU A 1 612 ? 13.619  -7.247  78.873 1.00 69.74  ? 612  GLU A OE2   1 
ATOM   5015 N  N     . GLY A 1 613 ? 15.282  -9.177  73.271 1.00 50.21  ? 613  GLY A N     1 
ATOM   5016 C  CA    . GLY A 1 613 ? 15.874  -8.503  72.115 1.00 50.18  ? 613  GLY A CA    1 
ATOM   5017 C  C     . GLY A 1 613 ? 16.433  -9.374  71.003 1.00 49.49  ? 613  GLY A C     1 
ATOM   5018 O  O     . GLY A 1 613 ? 16.984  -8.858  70.024 1.00 49.89  ? 613  GLY A O     1 
ATOM   5019 N  N     . GLU A 1 614 ? 16.302  -10.689 71.149 1.00 48.02  ? 614  GLU A N     1 
ATOM   5020 C  CA    . GLU A 1 614 ? 16.663  -11.614 70.084 1.00 46.19  ? 614  GLU A CA    1 
ATOM   5021 C  C     . GLU A 1 614 ? 15.730  -11.420 68.894 1.00 43.41  ? 614  GLU A C     1 
ATOM   5022 O  O     . GLU A 1 614 ? 14.546  -11.112 69.064 1.00 42.23  ? 614  GLU A O     1 
ATOM   5023 C  CB    . GLU A 1 614 ? 16.582  -13.062 70.566 1.00 48.26  ? 614  GLU A CB    1 
ATOM   5024 C  CG    . GLU A 1 614 ? 17.761  -13.540 71.421 1.00 52.54  ? 614  GLU A CG    1 
ATOM   5025 C  CD    . GLU A 1 614 ? 17.587  -14.985 71.901 1.00 55.62  ? 614  GLU A CD    1 
ATOM   5026 O  OE1   . GLU A 1 614 ? 18.224  -15.374 72.907 1.00 54.65  ? 614  GLU A OE1   1 
ATOM   5027 O  OE2   . GLU A 1 614 ? 16.806  -15.734 71.272 1.00 57.14  ? 614  GLU A OE2   1 
ATOM   5028 N  N     . ALA A 1 615 ? 16.272  -11.594 67.693 1.00 41.44  ? 615  ALA A N     1 
ATOM   5029 C  CA    . ALA A 1 615 ? 15.511  -11.399 66.469 1.00 39.13  ? 615  ALA A CA    1 
ATOM   5030 C  C     . ALA A 1 615 ? 14.948  -12.732 65.991 1.00 37.83  ? 615  ALA A C     1 
ATOM   5031 O  O     . ALA A 1 615 ? 15.699  -13.613 65.557 1.00 40.20  ? 615  ALA A O     1 
ATOM   5032 C  CB    . ALA A 1 615 ? 16.377  -10.755 65.400 1.00 38.27  ? 615  ALA A CB    1 
ATOM   5033 N  N     . PHE A 1 616 ? 13.632  -12.884 66.107 1.00 32.21  ? 616  PHE A N     1 
ATOM   5034 C  CA    . PHE A 1 616 ? 12.964  -14.087 65.641 1.00 28.60  ? 616  PHE A CA    1 
ATOM   5035 C  C     . PHE A 1 616 ? 12.445  -13.908 64.219 1.00 27.98  ? 616  PHE A C     1 
ATOM   5036 O  O     . PHE A 1 616 ? 12.412  -14.867 63.446 1.00 28.32  ? 616  PHE A O     1 
ATOM   5037 C  CB    . PHE A 1 616 ? 11.804  -14.475 66.561 1.00 27.78  ? 616  PHE A CB    1 
ATOM   5038 C  CG    . PHE A 1 616 ? 12.229  -15.020 67.903 1.00 29.00  ? 616  PHE A CG    1 
ATOM   5039 C  CD1   . PHE A 1 616 ? 12.501  -16.383 68.063 1.00 27.56  ? 616  PHE A CD1   1 
ATOM   5040 C  CD2   . PHE A 1 616 ? 12.325  -14.173 69.020 1.00 23.27  ? 616  PHE A CD2   1 
ATOM   5041 C  CE1   . PHE A 1 616 ? 12.887  -16.897 69.311 1.00 28.49  ? 616  PHE A CE1   1 
ATOM   5042 C  CE2   . PHE A 1 616 ? 12.705  -14.668 70.267 1.00 26.65  ? 616  PHE A CE2   1 
ATOM   5043 C  CZ    . PHE A 1 616 ? 12.985  -16.037 70.419 1.00 29.69  ? 616  PHE A CZ    1 
ATOM   5044 N  N     . VAL A 1 617 ? 12.013  -12.695 63.874 1.00 25.61  ? 617  VAL A N     1 
ATOM   5045 C  CA    . VAL A 1 617 ? 11.508  -12.456 62.527 1.00 25.38  ? 617  VAL A CA    1 
ATOM   5046 C  C     . VAL A 1 617 ? 12.706  -12.208 61.627 1.00 25.51  ? 617  VAL A C     1 
ATOM   5047 O  O     . VAL A 1 617 ? 13.433  -11.236 61.803 1.00 28.89  ? 617  VAL A O     1 
ATOM   5048 C  CB    . VAL A 1 617 ? 10.473  -11.298 62.468 1.00 25.59  ? 617  VAL A CB    1 
ATOM   5049 C  CG1   . VAL A 1 617 ? 9.973   -11.088 61.042 1.00 22.37  ? 617  VAL A CG1   1 
ATOM   5050 C  CG2   . VAL A 1 617 ? 9.309   -11.588 63.387 1.00 20.48  ? 617  VAL A CG2   1 
ATOM   5051 N  N     . LEU A 1 618 ? 12.928  -13.117 60.688 1.00 25.85  ? 618  LEU A N     1 
ATOM   5052 C  CA    . LEU A 1 618 ? 14.127  -13.064 59.866 1.00 25.59  ? 618  LEU A CA    1 
ATOM   5053 C  C     . LEU A 1 618 ? 13.868  -12.324 58.565 1.00 25.20  ? 618  LEU A C     1 
ATOM   5054 O  O     . LEU A 1 618 ? 14.804  -11.820 57.941 1.00 25.54  ? 618  LEU A O     1 
ATOM   5055 C  CB    . LEU A 1 618 ? 14.648  -14.474 59.594 1.00 25.96  ? 618  LEU A CB    1 
ATOM   5056 C  CG    . LEU A 1 618 ? 13.881  -15.343 58.596 1.00 24.73  ? 618  LEU A CG    1 
ATOM   5057 C  CD1   . LEU A 1 618 ? 14.567  -15.284 57.251 1.00 26.66  ? 618  LEU A CD1   1 
ATOM   5058 C  CD2   . LEU A 1 618 ? 13.789  -16.777 59.051 1.00 22.07  ? 618  LEU A CD2   1 
ATOM   5059 N  N     . TYR A 1 619 ? 12.597  -12.250 58.170 1.00 22.71  ? 619  TYR A N     1 
ATOM   5060 C  CA    . TYR A 1 619 ? 12.219  -11.711 56.852 1.00 23.30  ? 619  TYR A CA    1 
ATOM   5061 C  C     . TYR A 1 619 ? 10.723  -11.403 56.750 1.00 23.00  ? 619  TYR A C     1 
ATOM   5062 O  O     . TYR A 1 619 ? 9.894   -11.980 57.468 1.00 20.61  ? 619  TYR A O     1 
ATOM   5063 C  CB    . TYR A 1 619 ? 12.627  -12.705 55.750 1.00 21.55  ? 619  TYR A CB    1 
ATOM   5064 C  CG    . TYR A 1 619 ? 12.259  -12.309 54.351 1.00 21.58  ? 619  TYR A CG    1 
ATOM   5065 C  CD1   . TYR A 1 619 ? 11.358  -13.073 53.604 1.00 22.11  ? 619  TYR A CD1   1 
ATOM   5066 C  CD2   . TYR A 1 619 ? 12.818  -11.174 53.757 1.00 26.11  ? 619  TYR A CD2   1 
ATOM   5067 C  CE1   . TYR A 1 619 ? 11.020  -12.711 52.296 1.00 23.60  ? 619  TYR A CE1   1 
ATOM   5068 C  CE2   . TYR A 1 619 ? 12.482  -10.801 52.448 1.00 24.06  ? 619  TYR A CE2   1 
ATOM   5069 C  CZ    . TYR A 1 619 ? 11.585  -11.568 51.726 1.00 22.86  ? 619  TYR A CZ    1 
ATOM   5070 O  OH    . TYR A 1 619 ? 11.265  -11.198 50.436 1.00 21.53  ? 619  TYR A OH    1 
ATOM   5071 N  N     . GLY A 1 620 ? 10.382  -10.489 55.850 1.00 24.61  ? 620  GLY A N     1 
ATOM   5072 C  CA    . GLY A 1 620 ? 8.985   -10.138 55.620 1.00 26.01  ? 620  GLY A CA    1 
ATOM   5073 C  C     . GLY A 1 620 ? 8.806   -9.426  54.302 1.00 26.40  ? 620  GLY A C     1 
ATOM   5074 O  O     . GLY A 1 620 ? 9.707   -8.707  53.855 1.00 26.83  ? 620  GLY A O     1 
ATOM   5075 N  N     . ASP A 1 621 ? 7.647   -9.635  53.682 1.00 24.84  ? 621  ASP A N     1 
ATOM   5076 C  CA    . ASP A 1 621 ? 7.328   -9.045  52.388 1.00 26.13  ? 621  ASP A CA    1 
ATOM   5077 C  C     . ASP A 1 621 ? 5.821   -8.824  52.299 1.00 26.94  ? 621  ASP A C     1 
ATOM   5078 O  O     . ASP A 1 621 ? 5.041   -9.770  52.350 1.00 27.79  ? 621  ASP A O     1 
ATOM   5079 C  CB    . ASP A 1 621 ? 7.819   -9.946  51.248 1.00 26.18  ? 621  ASP A CB    1 
ATOM   5080 C  CG    . ASP A 1 621 ? 7.632   -9.321  49.859 1.00 33.62  ? 621  ASP A CG    1 
ATOM   5081 O  OD1   . ASP A 1 621 ? 6.860   -8.352  49.700 1.00 33.11  ? 621  ASP A OD1   1 
ATOM   5082 O  OD2   . ASP A 1 621 ? 8.255   -9.827  48.897 1.00 40.77  ? 621  ASP A OD2   1 
ATOM   5083 N  N     . THR A 1 622 ? 5.429   -7.557  52.197 1.00 27.53  ? 622  THR A N     1 
ATOM   5084 C  CA    . THR A 1 622 ? 4.035   -7.149  52.005 1.00 27.47  ? 622  THR A CA    1 
ATOM   5085 C  C     . THR A 1 622 ? 3.133   -7.470  53.192 1.00 25.46  ? 622  THR A C     1 
ATOM   5086 O  O     . THR A 1 622 ? 2.810   -6.577  53.961 1.00 26.41  ? 622  THR A O     1 
ATOM   5087 C  CB    . THR A 1 622 ? 3.437   -7.720  50.702 1.00 28.68  ? 622  THR A CB    1 
ATOM   5088 O  OG1   . THR A 1 622 ? 4.370   -7.519  49.633 1.00 32.66  ? 622  THR A OG1   1 
ATOM   5089 C  CG2   . THR A 1 622 ? 2.130   -7.041  50.377 1.00 27.11  ? 622  THR A CG2   1 
ATOM   5090 N  N     . ASP A 1 623 ? 2.728   -8.729  53.337 1.00 25.70  ? 623  ASP A N     1 
ATOM   5091 C  CA    . ASP A 1 623 ? 1.836   -9.125  54.434 1.00 25.09  ? 623  ASP A CA    1 
ATOM   5092 C  C     . ASP A 1 623 ? 2.326   -10.370 55.171 1.00 24.74  ? 623  ASP A C     1 
ATOM   5093 O  O     . ASP A 1 623 ? 1.556   -11.031 55.869 1.00 28.43  ? 623  ASP A O     1 
ATOM   5094 C  CB    . ASP A 1 623 ? 0.430   -9.399  53.885 1.00 22.35  ? 623  ASP A CB    1 
ATOM   5095 C  CG    . ASP A 1 623 ? 0.355   -10.715 53.154 1.00 20.06  ? 623  ASP A CG    1 
ATOM   5096 O  OD1   . ASP A 1 623 ? -0.759  -11.245 52.968 1.00 20.91  ? 623  ASP A OD1   1 
ATOM   5097 O  OD2   . ASP A 1 623 ? 1.426   -11.237 52.783 1.00 21.49  ? 623  ASP A OD2   1 
ATOM   5098 N  N     . SER A 1 624 ? 3.592   -10.713 54.996 1.00 25.48  ? 624  SER A N     1 
ATOM   5099 C  CA    . SER A 1 624 ? 4.064   -11.976 55.513 1.00 25.84  ? 624  SER A CA    1 
ATOM   5100 C  C     . SER A 1 624 ? 5.280   -11.825 56.406 1.00 27.18  ? 624  SER A C     1 
ATOM   5101 O  O     . SER A 1 624 ? 6.101   -10.940 56.197 1.00 28.99  ? 624  SER A O     1 
ATOM   5102 C  CB    . SER A 1 624 ? 4.374   -12.915 54.356 1.00 24.40  ? 624  SER A CB    1 
ATOM   5103 O  OG    . SER A 1 624 ? 5.447   -12.417 53.588 1.00 24.39  ? 624  SER A OG    1 
ATOM   5104 N  N     . ILE A 1 625 ? 5.384   -12.702 57.398 1.00 26.02  ? 625  ILE A N     1 
ATOM   5105 C  CA    . ILE A 1 625 ? 6.568   -12.773 58.238 1.00 25.72  ? 625  ILE A CA    1 
ATOM   5106 C  C     . ILE A 1 625 ? 7.097   -14.197 58.253 1.00 26.77  ? 625  ILE A C     1 
ATOM   5107 O  O     . ILE A 1 625 ? 6.309   -15.161 58.205 1.00 25.71  ? 625  ILE A O     1 
ATOM   5108 C  CB    . ILE A 1 625 ? 6.301   -12.319 59.687 1.00 26.37  ? 625  ILE A CB    1 
ATOM   5109 C  CG1   . ILE A 1 625 ? 5.104   -13.087 60.281 1.00 27.22  ? 625  ILE A CG1   1 
ATOM   5110 C  CG2   . ILE A 1 625 ? 6.080   -10.801 59.731 1.00 27.10  ? 625  ILE A CG2   1 
ATOM   5111 C  CD1   . ILE A 1 625 ? 4.980   -13.013 61.788 1.00 27.19  ? 625  ILE A CD1   1 
ATOM   5112 N  N     . TYR A 1 626 ? 8.427   -14.302 58.332 1.00 23.97  ? 626  TYR A N     1 
ATOM   5113 C  CA    . TYR A 1 626 ? 9.137   -15.565 58.420 1.00 23.78  ? 626  TYR A CA    1 
ATOM   5114 C  C     . TYR A 1 626 ? 9.885   -15.624 59.735 1.00 24.64  ? 626  TYR A C     1 
ATOM   5115 O  O     . TYR A 1 626 ? 10.706  -14.758 60.036 1.00 29.16  ? 626  TYR A O     1 
ATOM   5116 C  CB    . TYR A 1 626 ? 10.067  -15.746 57.208 1.00 22.67  ? 626  TYR A CB    1 
ATOM   5117 C  CG    . TYR A 1 626 ? 9.262   -15.965 55.952 1.00 22.69  ? 626  TYR A CG    1 
ATOM   5118 C  CD1   . TYR A 1 626 ? 8.681   -14.893 55.275 1.00 24.26  ? 626  TYR A CD1   1 
ATOM   5119 C  CD2   . TYR A 1 626 ? 9.030   -17.242 55.472 1.00 21.69  ? 626  TYR A CD2   1 
ATOM   5120 C  CE1   . TYR A 1 626 ? 7.899   -15.094 54.138 1.00 24.62  ? 626  TYR A CE1   1 
ATOM   5121 C  CE2   . TYR A 1 626 ? 8.266   -17.452 54.346 1.00 22.08  ? 626  TYR A CE2   1 
ATOM   5122 C  CZ    . TYR A 1 626 ? 7.689   -16.376 53.682 1.00 25.47  ? 626  TYR A CZ    1 
ATOM   5123 O  OH    . TYR A 1 626 ? 6.909   -16.595 52.549 1.00 24.30  ? 626  TYR A OH    1 
ATOM   5124 N  N     . VAL A 1 627 ? 9.591   -16.656 60.514 1.00 22.78  ? 627  VAL A N     1 
ATOM   5125 C  CA    . VAL A 1 627 ? 10.021  -16.731 61.900 1.00 25.40  ? 627  VAL A CA    1 
ATOM   5126 C  C     . VAL A 1 627 ? 11.008  -17.872 62.044 1.00 27.20  ? 627  VAL A C     1 
ATOM   5127 O  O     . VAL A 1 627 ? 10.716  -19.009 61.667 1.00 28.98  ? 627  VAL A O     1 
ATOM   5128 C  CB    . VAL A 1 627 ? 8.813   -16.973 62.858 1.00 26.31  ? 627  VAL A CB    1 
ATOM   5129 C  CG1   . VAL A 1 627 ? 9.243   -16.902 64.300 1.00 27.39  ? 627  VAL A CG1   1 
ATOM   5130 C  CG2   . VAL A 1 627 ? 7.691   -15.964 62.601 1.00 25.39  ? 627  VAL A CG2   1 
ATOM   5131 N  N     . SER A 1 628 ? 12.182  -17.557 62.577 1.00 27.28  ? 628  SER A N     1 
ATOM   5132 C  CA    . SER A 1 628 ? 13.162  -18.562 62.926 1.00 27.34  ? 628  SER A CA    1 
ATOM   5133 C  C     . SER A 1 628 ? 12.668  -19.319 64.140 1.00 29.48  ? 628  SER A C     1 
ATOM   5134 O  O     . SER A 1 628 ? 12.459  -18.735 65.207 1.00 32.27  ? 628  SER A O     1 
ATOM   5135 C  CB    . SER A 1 628 ? 14.494  -17.905 63.246 1.00 25.57  ? 628  SER A CB    1 
ATOM   5136 O  OG    . SER A 1 628 ? 15.498  -18.892 63.356 1.00 30.00  ? 628  SER A OG    1 
ATOM   5137 N  N     . ALA A 1 629 ? 12.464  -20.620 63.983 1.00 29.73  ? 629  ALA A N     1 
ATOM   5138 C  CA    . ALA A 1 629 ? 11.943  -21.427 65.082 1.00 27.90  ? 629  ALA A CA    1 
ATOM   5139 C  C     . ALA A 1 629 ? 13.054  -22.212 65.793 1.00 28.46  ? 629  ALA A C     1 
ATOM   5140 O  O     . ALA A 1 629 ? 12.771  -23.053 66.647 1.00 29.55  ? 629  ALA A O     1 
ATOM   5141 C  CB    . ALA A 1 629 ? 10.827  -22.349 64.593 1.00 23.52  ? 629  ALA A CB    1 
ATOM   5142 N  N     . ASP A 1 630 ? 14.308  -21.907 65.457 1.00 28.02  ? 630  ASP A N     1 
ATOM   5143 C  CA    . ASP A 1 630 ? 15.477  -22.583 66.047 1.00 31.12  ? 630  ASP A CA    1 
ATOM   5144 C  C     . ASP A 1 630 ? 15.422  -22.608 67.562 1.00 32.17  ? 630  ASP A C     1 
ATOM   5145 O  O     . ASP A 1 630 ? 15.582  -23.669 68.179 1.00 33.39  ? 630  ASP A O     1 
ATOM   5146 C  CB    . ASP A 1 630 ? 16.788  -21.915 65.608 1.00 31.23  ? 630  ASP A CB    1 
ATOM   5147 C  CG    . ASP A 1 630 ? 17.125  -22.161 64.135 1.00 34.05  ? 630  ASP A CG    1 
ATOM   5148 O  OD1   . ASP A 1 630 ? 16.216  -22.504 63.345 1.00 30.80  ? 630  ASP A OD1   1 
ATOM   5149 O  OD2   . ASP A 1 630 ? 18.316  -21.998 63.768 1.00 38.26  ? 630  ASP A OD2   1 
ATOM   5150 N  N     . LYS A 1 631 ? 15.175  -21.438 68.151 1.00 33.04  ? 631  LYS A N     1 
ATOM   5151 C  CA    . LYS A 1 631 ? 15.122  -21.285 69.606 1.00 34.70  ? 631  LYS A CA    1 
ATOM   5152 C  C     . LYS A 1 631 ? 13.908  -21.980 70.229 1.00 35.55  ? 631  LYS A C     1 
ATOM   5153 O  O     . LYS A 1 631 ? 13.991  -22.468 71.361 1.00 33.79  ? 631  LYS A O     1 
ATOM   5154 C  CB    . LYS A 1 631 ? 15.141  -19.806 70.010 1.00 34.41  ? 631  LYS A CB    1 
ATOM   5155 C  CG    . LYS A 1 631 ? 16.357  -19.032 69.536 1.00 36.52  ? 631  LYS A CG    1 
ATOM   5156 C  CD    . LYS A 1 631 ? 17.571  -19.258 70.406 1.00 43.90  ? 631  LYS A CD    1 
ATOM   5157 C  CE    . LYS A 1 631 ? 18.795  -18.515 69.856 1.00 52.38  ? 631  LYS A CE    1 
ATOM   5158 N  NZ    . LYS A 1 631 ? 18.540  -17.069 69.503 1.00 55.42  ? 631  LYS A NZ    1 
ATOM   5159 N  N     . ILE A 1 632 ? 12.786  -22.013 69.503 1.00 34.59  ? 632  ILE A N     1 
ATOM   5160 C  CA    . ILE A 1 632 ? 11.612  -22.746 69.972 1.00 33.56  ? 632  ILE A CA    1 
ATOM   5161 C  C     . ILE A 1 632 ? 12.005  -24.212 70.107 1.00 33.59  ? 632  ILE A C     1 
ATOM   5162 O  O     . ILE A 1 632 ? 11.729  -24.832 71.132 1.00 32.10  ? 632  ILE A O     1 
ATOM   5163 C  CB    . ILE A 1 632 ? 10.374  -22.586 69.043 1.00 34.55  ? 632  ILE A CB    1 
ATOM   5164 C  CG1   . ILE A 1 632 ? 9.795   -21.170 69.114 1.00 38.20  ? 632  ILE A CG1   1 
ATOM   5165 C  CG2   . ILE A 1 632 ? 9.259   -23.539 69.443 1.00 30.71  ? 632  ILE A CG2   1 
ATOM   5166 C  CD1   . ILE A 1 632 ? 10.496  -20.145 68.267 1.00 36.73  ? 632  ILE A CD1   1 
ATOM   5167 N  N     . ILE A 1 633 ? 12.679  -24.739 69.082 1.00 34.85  ? 633  ILE A N     1 
ATOM   5168 C  CA    . ILE A 1 633 ? 13.148  -26.128 69.066 1.00 36.59  ? 633  ILE A CA    1 
ATOM   5169 C  C     . ILE A 1 633 ? 14.234  -26.407 70.125 1.00 39.35  ? 633  ILE A C     1 
ATOM   5170 O  O     . ILE A 1 633 ? 14.100  -27.359 70.898 1.00 40.60  ? 633  ILE A O     1 
ATOM   5171 C  CB    . ILE A 1 633 ? 13.631  -26.570 67.645 1.00 36.49  ? 633  ILE A CB    1 
ATOM   5172 C  CG1   . ILE A 1 633 ? 12.496  -26.492 66.607 1.00 37.01  ? 633  ILE A CG1   1 
ATOM   5173 C  CG2   . ILE A 1 633 ? 14.223  -27.977 67.672 1.00 35.90  ? 633  ILE A CG2   1 
ATOM   5174 C  CD1   . ILE A 1 633 ? 11.404  -27.567 66.733 1.00 35.63  ? 633  ILE A CD1   1 
ATOM   5175 N  N     . ASP A 1 634 ? 15.294  -25.593 70.163 1.00 39.98  ? 634  ASP A N     1 
ATOM   5176 C  CA    . ASP A 1 634 ? 16.348  -25.748 71.184 1.00 42.99  ? 634  ASP A CA    1 
ATOM   5177 C  C     . ASP A 1 634 ? 15.792  -25.672 72.611 1.00 43.41  ? 634  ASP A C     1 
ATOM   5178 O  O     . ASP A 1 634 ? 16.322  -26.304 73.523 1.00 45.15  ? 634  ASP A O     1 
ATOM   5179 C  CB    . ASP A 1 634 ? 17.453  -24.684 71.043 1.00 44.81  ? 634  ASP A CB    1 
ATOM   5180 C  CG    . ASP A 1 634 ? 18.213  -24.770 69.726 1.00 47.64  ? 634  ASP A CG    1 
ATOM   5181 O  OD1   . ASP A 1 634 ? 18.436  -25.886 69.198 1.00 47.38  ? 634  ASP A OD1   1 
ATOM   5182 O  OD2   . ASP A 1 634 ? 18.602  -23.694 69.225 1.00 49.72  ? 634  ASP A OD2   1 
ATOM   5183 N  N     . LYS A 1 635 ? 14.740  -24.880 72.795 1.00 43.01  ? 635  LYS A N     1 
ATOM   5184 C  CA    . LYS A 1 635 ? 14.127  -24.689 74.098 1.00 45.00  ? 635  LYS A CA    1 
ATOM   5185 C  C     . LYS A 1 635 ? 13.693  -26.022 74.669 1.00 45.72  ? 635  LYS A C     1 
ATOM   5186 O  O     . LYS A 1 635 ? 13.897  -26.283 75.851 1.00 46.63  ? 635  LYS A O     1 
ATOM   5187 C  CB    . LYS A 1 635 ? 12.909  -23.767 74.001 1.00 46.22  ? 635  LYS A CB    1 
ATOM   5188 C  CG    . LYS A 1 635 ? 12.897  -22.638 75.021 1.00 48.85  ? 635  LYS A CG    1 
ATOM   5189 C  CD    . LYS A 1 635 ? 12.766  -23.126 76.451 1.00 47.57  ? 635  LYS A CD    1 
ATOM   5190 C  CE    . LYS A 1 635 ? 13.592  -22.273 77.393 1.00 51.00  ? 635  LYS A CE    1 
ATOM   5191 N  NZ    . LYS A 1 635 ? 13.615  -20.838 76.998 1.00 50.57  ? 635  LYS A NZ    1 
ATOM   5192 N  N     . VAL A 1 636 ? 13.099  -26.863 73.827 1.00 44.81  ? 636  VAL A N     1 
ATOM   5193 C  CA    . VAL A 1 636 ? 12.666  -28.182 74.270 1.00 46.84  ? 636  VAL A CA    1 
ATOM   5194 C  C     . VAL A 1 636 ? 13.739  -29.240 74.053 1.00 48.32  ? 636  VAL A C     1 
ATOM   5195 O  O     . VAL A 1 636 ? 13.709  -30.291 74.692 1.00 52.53  ? 636  VAL A O     1 
ATOM   5196 C  CB    . VAL A 1 636 ? 11.330  -28.625 73.618 1.00 45.81  ? 636  VAL A CB    1 
ATOM   5197 C  CG1   . VAL A 1 636 ? 10.317  -27.484 73.627 1.00 45.37  ? 636  VAL A CG1   1 
ATOM   5198 C  CG2   . VAL A 1 636 ? 11.547  -29.143 72.224 1.00 44.12  ? 636  VAL A CG2   1 
ATOM   5199 N  N     . GLY A 1 637 ? 14.683  -28.954 73.160 1.00 47.41  ? 637  GLY A N     1 
ATOM   5200 C  CA    . GLY A 1 637 ? 15.754  -29.889 72.840 1.00 48.27  ? 637  GLY A CA    1 
ATOM   5201 C  C     . GLY A 1 637 ? 15.369  -30.832 71.714 1.00 48.00  ? 637  GLY A C     1 
ATOM   5202 O  O     . GLY A 1 637 ? 14.317  -31.474 71.765 1.00 45.96  ? 637  GLY A O     1 
ATOM   5203 N  N     . GLU A 1 638 ? 16.233  -30.915 70.702 1.00 47.20  ? 638  GLU A N     1 
ATOM   5204 C  CA    . GLU A 1 638 ? 16.013  -31.780 69.543 1.00 47.61  ? 638  GLU A CA    1 
ATOM   5205 C  C     . GLU A 1 638 ? 15.931  -33.270 69.877 1.00 48.73  ? 638  GLU A C     1 
ATOM   5206 O  O     . GLU A 1 638 ? 15.308  -34.038 69.143 1.00 50.14  ? 638  GLU A O     1 
ATOM   5207 C  CB    . GLU A 1 638 ? 17.100  -31.547 68.491 1.00 47.39  ? 638  GLU A CB    1 
ATOM   5208 C  CG    . GLU A 1 638 ? 16.642  -30.753 67.274 1.00 46.31  ? 638  GLU A CG    1 
ATOM   5209 C  CD    . GLU A 1 638 ? 17.520  -30.975 66.052 1.00 46.65  ? 638  GLU A CD    1 
ATOM   5210 O  OE1   . GLU A 1 638 ? 17.416  -30.183 65.095 1.00 49.61  ? 638  GLU A OE1   1 
ATOM   5211 O  OE2   . GLU A 1 638 ? 18.317  -31.937 66.036 1.00 47.66  ? 638  GLU A OE2   1 
ATOM   5212 N  N     . SER A 1 639 ? 16.575  -33.672 70.971 1.00 49.15  ? 639  SER A N     1 
ATOM   5213 C  CA    . SER A 1 639 ? 16.571  -35.063 71.434 1.00 48.80  ? 639  SER A CA    1 
ATOM   5214 C  C     . SER A 1 639 ? 15.186  -35.610 71.727 1.00 46.28  ? 639  SER A C     1 
ATOM   5215 O  O     . SER A 1 639 ? 14.950  -36.808 71.590 1.00 44.07  ? 639  SER A O     1 
ATOM   5216 C  CB    . SER A 1 639 ? 17.412  -35.209 72.701 1.00 50.55  ? 639  SER A CB    1 
ATOM   5217 O  OG    . SER A 1 639 ? 18.648  -35.825 72.410 1.00 58.18  ? 639  SER A OG    1 
ATOM   5218 N  N     . LYS A 1 640 ? 14.281  -34.730 72.140 1.00 45.67  ? 640  LYS A N     1 
ATOM   5219 C  CA    . LYS A 1 640 ? 12.959  -35.140 72.611 1.00 47.09  ? 640  LYS A CA    1 
ATOM   5220 C  C     . LYS A 1 640 ? 12.032  -35.631 71.486 1.00 45.12  ? 640  LYS A C     1 
ATOM   5221 O  O     . LYS A 1 640 ? 10.980  -36.217 71.757 1.00 45.06  ? 640  LYS A O     1 
ATOM   5222 C  CB    . LYS A 1 640 ? 12.310  -34.007 73.426 1.00 48.88  ? 640  LYS A CB    1 
ATOM   5223 C  CG    . LYS A 1 640 ? 12.971  -33.741 74.796 1.00 54.46  ? 640  LYS A CG    1 
ATOM   5224 C  CD    . LYS A 1 640 ? 12.064  -34.078 75.994 1.00 62.44  ? 640  LYS A CD    1 
ATOM   5225 C  CE    . LYS A 1 640 ? 11.636  -35.564 76.069 1.00 66.51  ? 640  LYS A CE    1 
ATOM   5226 N  NZ    . LYS A 1 640 ? 12.640  -36.467 76.708 1.00 65.65  ? 640  LYS A NZ    1 
ATOM   5227 N  N     . PHE A 1 641 ? 12.439  -35.422 70.233 1.00 42.28  ? 641  PHE A N     1 
ATOM   5228 C  CA    . PHE A 1 641 ? 11.578  -35.735 69.094 1.00 40.40  ? 641  PHE A CA    1 
ATOM   5229 C  C     . PHE A 1 641 ? 11.810  -37.128 68.494 1.00 41.84  ? 641  PHE A C     1 
ATOM   5230 O  O     . PHE A 1 641 ? 12.956  -37.562 68.295 1.00 39.40  ? 641  PHE A O     1 
ATOM   5231 C  CB    . PHE A 1 641 ? 11.653  -34.634 68.036 1.00 38.33  ? 641  PHE A CB    1 
ATOM   5232 C  CG    . PHE A 1 641 ? 11.105  -33.305 68.505 1.00 33.86  ? 641  PHE A CG    1 
ATOM   5233 C  CD1   . PHE A 1 641 ? 11.955  -32.228 68.728 1.00 29.28  ? 641  PHE A CD1   1 
ATOM   5234 C  CD2   . PHE A 1 641 ? 9.738   -33.140 68.729 1.00 32.98  ? 641  PHE A CD2   1 
ATOM   5235 C  CE1   . PHE A 1 641 ? 11.459  -31.003 69.156 1.00 29.17  ? 641  PHE A CE1   1 
ATOM   5236 C  CE2   . PHE A 1 641 ? 9.218   -31.908 69.159 1.00 30.32  ? 641  PHE A CE2   1 
ATOM   5237 C  CZ    . PHE A 1 641 ? 10.079  -30.837 69.371 1.00 28.46  ? 641  PHE A CZ    1 
ATOM   5238 N  N     . ARG A 1 642 ? 10.696  -37.813 68.233 1.00 42.45  ? 642  ARG A N     1 
ATOM   5239 C  CA    . ARG A 1 642 ? 10.675  -39.201 67.772 1.00 44.19  ? 642  ARG A CA    1 
ATOM   5240 C  C     . ARG A 1 642 ? 11.123  -39.324 66.319 1.00 42.11  ? 642  ARG A C     1 
ATOM   5241 O  O     . ARG A 1 642 ? 11.942  -40.178 65.976 1.00 41.40  ? 642  ARG A O     1 
ATOM   5242 C  CB    . ARG A 1 642 ? 9.261   -39.788 67.933 1.00 45.04  ? 642  ARG A CB    1 
ATOM   5243 C  CG    . ARG A 1 642 ? 8.881   -40.129 69.376 1.00 49.96  ? 642  ARG A CG    1 
ATOM   5244 C  CD    . ARG A 1 642 ? 7.454   -40.702 69.484 1.00 51.89  ? 642  ARG A CD    1 
ATOM   5245 N  NE    . ARG A 1 642 ? 6.443   -39.671 69.726 1.00 51.36  ? 642  ARG A NE    1 
ATOM   5246 C  CZ    . ARG A 1 642 ? 5.678   -39.113 68.785 1.00 53.32  ? 642  ARG A CZ    1 
ATOM   5247 N  NH1   . ARG A 1 642 ? 5.787   -39.472 67.504 1.00 52.07  ? 642  ARG A NH1   1 
ATOM   5248 N  NH2   . ARG A 1 642 ? 4.793   -38.186 69.128 1.00 48.87  ? 642  ARG A NH2   1 
ATOM   5249 N  N     . ASP A 1 643 ? 10.558  -38.465 65.475 1.00 40.18  ? 643  ASP A N     1 
ATOM   5250 C  CA    . ASP A 1 643 ? 10.845  -38.431 64.052 1.00 37.70  ? 643  ASP A CA    1 
ATOM   5251 C  C     . ASP A 1 643 ? 10.584  -37.012 63.566 1.00 35.31  ? 643  ASP A C     1 
ATOM   5252 O  O     . ASP A 1 643 ? 10.259  -36.135 64.368 1.00 34.88  ? 643  ASP A O     1 
ATOM   5253 C  CB    . ASP A 1 643 ? 9.958   -39.434 63.312 1.00 39.34  ? 643  ASP A CB    1 
ATOM   5254 C  CG    . ASP A 1 643 ? 8.501   -39.387 63.766 1.00 44.72  ? 643  ASP A CG    1 
ATOM   5255 O  OD1   . ASP A 1 643 ? 7.989   -38.292 64.112 1.00 46.79  ? 643  ASP A OD1   1 
ATOM   5256 O  OD2   . ASP A 1 643 ? 7.857   -40.458 63.764 1.00 48.62  ? 643  ASP A OD2   1 
ATOM   5257 N  N     . THR A 1 644 ? 10.721  -36.781 62.263 1.00 32.32  ? 644  THR A N     1 
ATOM   5258 C  CA    . THR A 1 644 ? 10.451  -35.465 61.700 1.00 31.72  ? 644  THR A CA    1 
ATOM   5259 C  C     . THR A 1 644 ? 9.018   -34.991 61.979 1.00 30.81  ? 644  THR A C     1 
ATOM   5260 O  O     . THR A 1 644 ? 8.813   -33.857 62.386 1.00 30.34  ? 644  THR A O     1 
ATOM   5261 C  CB    . THR A 1 644 ? 10.693  -35.424 60.179 1.00 31.49  ? 644  THR A CB    1 
ATOM   5262 O  OG1   . THR A 1 644 ? 11.989  -35.958 59.873 1.00 36.56  ? 644  THR A OG1   1 
ATOM   5263 C  CG2   . THR A 1 644 ? 10.596  -33.987 59.676 1.00 31.27  ? 644  THR A CG2   1 
ATOM   5264 N  N     . ASN A 1 645 ? 8.041   -35.864 61.750 1.00 31.77  ? 645  ASN A N     1 
ATOM   5265 C  CA    . ASN A 1 645 ? 6.639   -35.513 61.910 1.00 34.23  ? 645  ASN A CA    1 
ATOM   5266 C  C     . ASN A 1 645 ? 6.291   -35.063 63.337 1.00 34.74  ? 645  ASN A C     1 
ATOM   5267 O  O     . ASN A 1 645 ? 5.390   -34.243 63.532 1.00 33.27  ? 645  ASN A O     1 
ATOM   5268 C  CB    . ASN A 1 645 ? 5.741   -36.672 61.473 1.00 35.24  ? 645  ASN A CB    1 
ATOM   5269 C  CG    . ASN A 1 645 ? 4.314   -36.230 61.203 1.00 40.39  ? 645  ASN A CG    1 
ATOM   5270 O  OD1   . ASN A 1 645 ? 4.061   -35.406 60.320 1.00 42.08  ? 645  ASN A OD1   1 
ATOM   5271 N  ND2   . ASN A 1 645 ? 3.372   -36.771 61.970 1.00 42.02  ? 645  ASN A ND2   1 
ATOM   5272 N  N     . HIS A 1 646 ? 7.027   -35.584 64.316 1.00 34.58  ? 646  HIS A N     1 
ATOM   5273 C  CA    . HIS A 1 646 ? 6.840   -35.212 65.718 1.00 36.46  ? 646  HIS A CA    1 
ATOM   5274 C  C     . HIS A 1 646 ? 7.081   -33.720 65.934 1.00 35.25  ? 646  HIS A C     1 
ATOM   5275 O  O     . HIS A 1 646 ? 6.249   -33.048 66.540 1.00 34.76  ? 646  HIS A O     1 
ATOM   5276 C  CB    . HIS A 1 646 ? 7.748   -36.060 66.634 1.00 37.65  ? 646  HIS A CB    1 
ATOM   5277 C  CG    . HIS A 1 646 ? 7.460   -35.917 68.100 1.00 40.94  ? 646  HIS A CG    1 
ATOM   5278 N  ND1   . HIS A 1 646 ? 8.335   -36.353 69.073 1.00 46.45  ? 646  HIS A ND1   1 
ATOM   5279 C  CD2   . HIS A 1 646 ? 6.402   -35.387 68.762 1.00 42.04  ? 646  HIS A CD2   1 
ATOM   5280 C  CE1   . HIS A 1 646 ? 7.827   -36.107 70.268 1.00 44.73  ? 646  HIS A CE1   1 
ATOM   5281 N  NE2   . HIS A 1 646 ? 6.655   -35.521 70.107 1.00 44.50  ? 646  HIS A NE2   1 
ATOM   5282 N  N     . TRP A 1 647 ? 8.206   -33.199 65.439 1.00 34.51  ? 647  TRP A N     1 
ATOM   5283 C  CA    . TRP A 1 647 ? 8.499   -31.778 65.627 1.00 33.04  ? 647  TRP A CA    1 
ATOM   5284 C  C     . TRP A 1 647 ? 7.655   -30.878 64.739 1.00 33.21  ? 647  TRP A C     1 
ATOM   5285 O  O     . TRP A 1 647 ? 7.332   -29.754 65.121 1.00 39.04  ? 647  TRP A O     1 
ATOM   5286 C  CB    . TRP A 1 647 ? 9.997   -31.449 65.530 1.00 31.93  ? 647  TRP A CB    1 
ATOM   5287 C  CG    . TRP A 1 647 ? 10.652  -31.553 64.176 1.00 29.40  ? 647  TRP A CG    1 
ATOM   5288 C  CD1   . TRP A 1 647 ? 11.550  -32.507 63.778 1.00 32.92  ? 647  TRP A CD1   1 
ATOM   5289 C  CD2   . TRP A 1 647 ? 10.519  -30.645 63.068 1.00 27.07  ? 647  TRP A CD2   1 
ATOM   5290 N  NE1   . TRP A 1 647 ? 11.967  -32.264 62.492 1.00 32.75  ? 647  TRP A NE1   1 
ATOM   5291 C  CE2   . TRP A 1 647 ? 11.350  -31.132 62.028 1.00 26.97  ? 647  TRP A CE2   1 
ATOM   5292 C  CE3   . TRP A 1 647 ? 9.773   -29.473 62.848 1.00 29.57  ? 647  TRP A CE3   1 
ATOM   5293 C  CZ2   . TRP A 1 647 ? 11.464  -30.489 60.786 1.00 24.21  ? 647  TRP A CZ2   1 
ATOM   5294 C  CZ3   . TRP A 1 647 ? 9.879   -28.830 61.598 1.00 27.24  ? 647  TRP A CZ3   1 
ATOM   5295 C  CH2   . TRP A 1 647 ? 10.726  -29.347 60.588 1.00 25.49  ? 647  TRP A CH2   1 
ATOM   5296 N  N     . VAL A 1 648 ? 7.290   -31.368 63.564 1.00 30.87  ? 648  VAL A N     1 
ATOM   5297 C  CA    . VAL A 1 648 ? 6.330   -30.657 62.728 1.00 30.80  ? 648  VAL A CA    1 
ATOM   5298 C  C     . VAL A 1 648 ? 5.005   -30.478 63.491 1.00 31.48  ? 648  VAL A C     1 
ATOM   5299 O  O     . VAL A 1 648 ? 4.442   -29.377 63.499 1.00 30.20  ? 648  VAL A O     1 
ATOM   5300 C  CB    . VAL A 1 648 ? 6.132   -31.357 61.368 1.00 30.43  ? 648  VAL A CB    1 
ATOM   5301 C  CG1   . VAL A 1 648 ? 5.042   -30.695 60.578 1.00 26.01  ? 648  VAL A CG1   1 
ATOM   5302 C  CG2   . VAL A 1 648 ? 7.434   -31.339 60.579 1.00 29.95  ? 648  VAL A CG2   1 
ATOM   5303 N  N     . ASP A 1 649 ? 4.548   -31.546 64.158 1.00 31.37  ? 649  ASP A N     1 
ATOM   5304 C  CA    . ASP A 1 649 ? 3.369   -31.493 65.032 1.00 32.07  ? 649  ASP A CA    1 
ATOM   5305 C  C     . ASP A 1 649 ? 3.533   -30.490 66.172 1.00 31.63  ? 649  ASP A C     1 
ATOM   5306 O  O     . ASP A 1 649 ? 2.591   -29.772 66.524 1.00 30.41  ? 649  ASP A O     1 
ATOM   5307 C  CB    . ASP A 1 649 ? 3.047   -32.873 65.612 1.00 33.78  ? 649  ASP A CB    1 
ATOM   5308 C  CG    . ASP A 1 649 ? 2.193   -33.713 64.689 1.00 40.72  ? 649  ASP A CG    1 
ATOM   5309 O  OD1   . ASP A 1 649 ? 1.510   -33.153 63.803 1.00 43.80  ? 649  ASP A OD1   1 
ATOM   5310 O  OD2   . ASP A 1 649 ? 2.192   -34.949 64.853 1.00 47.64  ? 649  ASP A OD2   1 
ATOM   5311 N  N     . PHE A 1 650 ? 4.734   -30.442 66.740 1.00 32.34  ? 650  PHE A N     1 
ATOM   5312 C  CA    . PHE A 1 650 ? 5.017   -29.517 67.816 1.00 31.52  ? 650  PHE A CA    1 
ATOM   5313 C  C     . PHE A 1 650 ? 4.887   -28.071 67.372 1.00 30.00  ? 650  PHE A C     1 
ATOM   5314 O  O     . PHE A 1 650 ? 4.160   -27.296 67.989 1.00 27.80  ? 650  PHE A O     1 
ATOM   5315 C  CB    . PHE A 1 650 ? 6.399   -29.762 68.406 1.00 33.37  ? 650  PHE A CB    1 
ATOM   5316 C  CG    . PHE A 1 650 ? 6.770   -28.769 69.466 1.00 35.10  ? 650  PHE A CG    1 
ATOM   5317 C  CD1   . PHE A 1 650 ? 6.043   -28.702 70.654 1.00 39.24  ? 650  PHE A CD1   1 
ATOM   5318 C  CD2   . PHE A 1 650 ? 7.814   -27.881 69.267 1.00 31.53  ? 650  PHE A CD2   1 
ATOM   5319 C  CE1   . PHE A 1 650 ? 6.363   -27.768 71.637 1.00 40.83  ? 650  PHE A CE1   1 
ATOM   5320 C  CE2   . PHE A 1 650 ? 8.138   -26.944 70.241 1.00 37.36  ? 650  PHE A CE2   1 
ATOM   5321 C  CZ    . PHE A 1 650 ? 7.414   -26.892 71.429 1.00 39.15  ? 650  PHE A CZ    1 
ATOM   5322 N  N     . LEU A 1 651 ? 5.596   -27.711 66.305 1.00 29.29  ? 651  LEU A N     1 
ATOM   5323 C  CA    . LEU A 1 651 ? 5.566   -26.337 65.808 1.00 29.84  ? 651  LEU A CA    1 
ATOM   5324 C  C     . LEU A 1 651 ? 4.196   -25.959 65.266 1.00 28.37  ? 651  LEU A C     1 
ATOM   5325 O  O     . LEU A 1 651 ? 3.783   -24.810 65.379 1.00 28.59  ? 651  LEU A O     1 
ATOM   5326 C  CB    . LEU A 1 651 ? 6.637   -26.092 64.740 1.00 28.35  ? 651  LEU A CB    1 
ATOM   5327 C  CG    . LEU A 1 651 ? 8.112   -26.142 65.136 1.00 32.09  ? 651  LEU A CG    1 
ATOM   5328 C  CD1   . LEU A 1 651 ? 8.968   -26.087 63.887 1.00 28.79  ? 651  LEU A CD1   1 
ATOM   5329 C  CD2   . LEU A 1 651 ? 8.477   -25.006 66.082 1.00 32.99  ? 651  LEU A CD2   1 
ATOM   5330 N  N     . ASP A 1 652 ? 3.503   -26.919 64.664 1.00 29.61  ? 652  ASP A N     1 
ATOM   5331 C  CA    . ASP A 1 652 ? 2.159   -26.661 64.173 1.00 31.83  ? 652  ASP A CA    1 
ATOM   5332 C  C     . ASP A 1 652 ? 1.290   -26.247 65.349 1.00 33.24  ? 652  ASP A C     1 
ATOM   5333 O  O     . ASP A 1 652 ? 0.633   -25.204 65.306 1.00 32.78  ? 652  ASP A O     1 
ATOM   5334 C  CB    . ASP A 1 652 ? 1.573   -27.890 63.464 1.00 32.03  ? 652  ASP A CB    1 
ATOM   5335 C  CG    . ASP A 1 652 ? 0.133   -27.675 62.994 1.00 36.52  ? 652  ASP A CG    1 
ATOM   5336 O  OD1   . ASP A 1 652 ? -0.280  -26.515 62.734 1.00 36.30  ? 652  ASP A OD1   1 
ATOM   5337 O  OD2   . ASP A 1 652 ? -0.595  -28.679 62.878 1.00 39.45  ? 652  ASP A OD2   1 
ATOM   5338 N  N     . LYS A 1 653 ? 1.318   -27.054 66.405 1.00 33.95  ? 653  LYS A N     1 
ATOM   5339 C  CA    . LYS A 1 653 ? 0.519   -26.794 67.595 1.00 35.48  ? 653  LYS A CA    1 
ATOM   5340 C  C     . LYS A 1 653 ? 0.947   -25.476 68.260 1.00 35.68  ? 653  LYS A C     1 
ATOM   5341 O  O     . LYS A 1 653 ? 0.099   -24.698 68.723 1.00 35.26  ? 653  LYS A O     1 
ATOM   5342 C  CB    . LYS A 1 653 ? 0.617   -27.984 68.546 1.00 37.59  ? 653  LYS A CB    1 
ATOM   5343 C  CG    . LYS A 1 653 ? -0.410  -28.020 69.655 1.00 44.43  ? 653  LYS A CG    1 
ATOM   5344 C  CD    . LYS A 1 653 ? -0.476  -29.403 70.319 1.00 50.78  ? 653  LYS A CD    1 
ATOM   5345 C  CE    . LYS A 1 653 ? -1.120  -29.308 71.706 1.00 55.69  ? 653  LYS A CE    1 
ATOM   5346 N  NZ    . LYS A 1 653 ? -1.690  -30.597 72.192 1.00 57.77  ? 653  LYS A NZ    1 
ATOM   5347 N  N     . PHE A 1 654 ? 2.254   -25.211 68.260 1.00 32.46  ? 654  PHE A N     1 
ATOM   5348 C  CA    . PHE A 1 654 ? 2.806   -23.972 68.818 1.00 33.14  ? 654  PHE A CA    1 
ATOM   5349 C  C     . PHE A 1 654 ? 2.284   -22.740 68.079 1.00 33.57  ? 654  PHE A C     1 
ATOM   5350 O  O     . PHE A 1 654 ? 1.923   -21.749 68.713 1.00 35.45  ? 654  PHE A O     1 
ATOM   5351 C  CB    . PHE A 1 654 ? 4.344   -24.006 68.784 1.00 32.20  ? 654  PHE A CB    1 
ATOM   5352 C  CG    . PHE A 1 654 ? 5.012   -22.879 69.537 1.00 32.12  ? 654  PHE A CG    1 
ATOM   5353 C  CD1   . PHE A 1 654 ? 5.299   -21.669 68.908 1.00 33.66  ? 654  PHE A CD1   1 
ATOM   5354 C  CD2   . PHE A 1 654 ? 5.392   -23.041 70.866 1.00 30.92  ? 654  PHE A CD2   1 
ATOM   5355 C  CE1   . PHE A 1 654 ? 5.937   -20.629 69.598 1.00 32.13  ? 654  PHE A CE1   1 
ATOM   5356 C  CE2   . PHE A 1 654 ? 6.027   -22.008 71.561 1.00 30.10  ? 654  PHE A CE2   1 
ATOM   5357 C  CZ    . PHE A 1 654 ? 6.300   -20.801 70.926 1.00 29.33  ? 654  PHE A CZ    1 
ATOM   5358 N  N     . ALA A 1 655 ? 2.246   -22.803 66.744 1.00 32.74  ? 655  ALA A N     1 
ATOM   5359 C  CA    . ALA A 1 655 ? 1.777   -21.679 65.926 1.00 31.24  ? 655  ALA A CA    1 
ATOM   5360 C  C     . ALA A 1 655 ? 0.296   -21.448 66.151 1.00 33.39  ? 655  ALA A C     1 
ATOM   5361 O  O     . ALA A 1 655 ? -0.137  -20.323 66.390 1.00 35.48  ? 655  ALA A O     1 
ATOM   5362 C  CB    . ALA A 1 655 ? 2.066   -21.912 64.444 1.00 30.11  ? 655  ALA A CB    1 
ATOM   5363 N  N     . ARG A 1 656 ? -0.471  -22.527 66.108 1.00 34.96  ? 656  ARG A N     1 
ATOM   5364 C  CA    . ARG A 1 656 ? -1.921  -22.439 66.214 1.00 40.40  ? 656  ARG A CA    1 
ATOM   5365 C  C     . ARG A 1 656 ? -2.403  -22.044 67.618 1.00 38.82  ? 656  ARG A C     1 
ATOM   5366 O  O     . ARG A 1 656 ? -3.330  -21.259 67.747 1.00 39.58  ? 656  ARG A O     1 
ATOM   5367 C  CB    . ARG A 1 656 ? -2.566  -23.755 65.750 1.00 41.61  ? 656  ARG A CB    1 
ATOM   5368 C  CG    . ARG A 1 656 ? -4.079  -23.720 65.611 1.00 48.86  ? 656  ARG A CG    1 
ATOM   5369 C  CD    . ARG A 1 656 ? -4.641  -25.081 65.196 1.00 58.10  ? 656  ARG A CD    1 
ATOM   5370 N  NE    . ARG A 1 656 ? -4.253  -26.156 66.118 1.00 61.72  ? 656  ARG A NE    1 
ATOM   5371 C  CZ    . ARG A 1 656 ? -3.284  -27.038 65.881 1.00 62.27  ? 656  ARG A CZ    1 
ATOM   5372 N  NH1   . ARG A 1 656 ? -2.591  -26.985 64.745 1.00 61.11  ? 656  ARG A NH1   1 
ATOM   5373 N  NH2   . ARG A 1 656 ? -3.004  -27.972 66.782 1.00 59.86  ? 656  ARG A NH2   1 
ATOM   5374 N  N     . GLU A 1 657 ? -1.763  -22.575 68.656 1.00 38.99  ? 657  GLU A N     1 
ATOM   5375 C  CA    . GLU A 1 657 ? -2.262  -22.422 70.027 1.00 37.54  ? 657  GLU A CA    1 
ATOM   5376 C  C     . GLU A 1 657 ? -1.606  -21.293 70.812 1.00 36.03  ? 657  GLU A C     1 
ATOM   5377 O  O     . GLU A 1 657 ? -2.186  -20.794 71.784 1.00 33.38  ? 657  GLU A O     1 
ATOM   5378 C  CB    . GLU A 1 657 ? -2.091  -23.730 70.801 1.00 39.71  ? 657  GLU A CB    1 
ATOM   5379 C  CG    . GLU A 1 657 ? -3.070  -24.833 70.399 1.00 46.64  ? 657  GLU A CG    1 
ATOM   5380 C  CD    . GLU A 1 657 ? -2.830  -26.128 71.156 1.00 52.49  ? 657  GLU A CD    1 
ATOM   5381 O  OE1   . GLU A 1 657 ? -1.962  -26.138 72.059 1.00 54.63  ? 657  GLU A OE1   1 
ATOM   5382 O  OE2   . GLU A 1 657 ? -3.501  -27.138 70.847 1.00 54.47  ? 657  GLU A OE2   1 
ATOM   5383 N  N     . ARG A 1 658 ? -0.399  -20.906 70.397 1.00 33.32  ? 658  ARG A N     1 
ATOM   5384 C  CA    . ARG A 1 658 ? 0.363   -19.874 71.093 1.00 33.37  ? 658  ARG A CA    1 
ATOM   5385 C  C     . ARG A 1 658 ? 0.547   -18.611 70.279 1.00 33.10  ? 658  ARG A C     1 
ATOM   5386 O  O     . ARG A 1 658 ? 0.203   -17.525 70.742 1.00 33.85  ? 658  ARG A O     1 
ATOM   5387 C  CB    . ARG A 1 658 ? 1.734   -20.395 71.517 1.00 33.87  ? 658  ARG A CB    1 
ATOM   5388 C  CG    . ARG A 1 658 ? 1.681   -21.630 72.391 1.00 38.57  ? 658  ARG A CG    1 
ATOM   5389 C  CD    . ARG A 1 658 ? 0.857   -21.396 73.636 1.00 40.11  ? 658  ARG A CD    1 
ATOM   5390 N  NE    . ARG A 1 658 ? 0.727   -22.629 74.402 1.00 46.59  ? 658  ARG A NE    1 
ATOM   5391 C  CZ    . ARG A 1 658 ? 0.263   -22.697 75.647 1.00 53.52  ? 658  ARG A CZ    1 
ATOM   5392 N  NH1   . ARG A 1 658 ? -0.125  -21.596 76.297 1.00 52.68  ? 658  ARG A NH1   1 
ATOM   5393 N  NH2   . ARG A 1 658 ? 0.190   -23.878 76.246 1.00 57.28  ? 658  ARG A NH2   1 
ATOM   5394 N  N     . MET A 1 659 ? 1.089   -18.754 69.071 1.00 33.90  ? 659  MET A N     1 
ATOM   5395 C  CA    . MET A 1 659 ? 1.480   -17.593 68.273 1.00 33.27  ? 659  MET A CA    1 
ATOM   5396 C  C     . MET A 1 659 ? 0.308   -16.837 67.658 1.00 32.77  ? 659  MET A C     1 
ATOM   5397 O  O     . MET A 1 659 ? 0.201   -15.627 67.827 1.00 34.32  ? 659  MET A O     1 
ATOM   5398 C  CB    . MET A 1 659 ? 2.498   -17.977 67.208 1.00 32.22  ? 659  MET A CB    1 
ATOM   5399 C  CG    . MET A 1 659 ? 3.841   -18.354 67.790 1.00 32.69  ? 659  MET A CG    1 
ATOM   5400 S  SD    . MET A 1 659 ? 5.058   -18.679 66.506 1.00 35.05  ? 659  MET A SD    1 
ATOM   5401 C  CE    . MET A 1 659 ? 5.477   -17.019 65.991 1.00 29.96  ? 659  MET A CE    1 
ATOM   5402 N  N     . GLU A 1 660 ? -0.556  -17.548 66.944 1.00 32.05  ? 660  GLU A N     1 
ATOM   5403 C  CA    . GLU A 1 660 ? -1.735  -16.936 66.330 1.00 32.16  ? 660  GLU A CA    1 
ATOM   5404 C  C     . GLU A 1 660 ? -2.591  -16.102 67.306 1.00 31.41  ? 660  GLU A C     1 
ATOM   5405 O  O     . GLU A 1 660 ? -2.927  -14.963 66.987 1.00 32.16  ? 660  GLU A O     1 
ATOM   5406 C  CB    . GLU A 1 660 ? -2.569  -17.979 65.577 1.00 32.73  ? 660  GLU A CB    1 
ATOM   5407 C  CG    . GLU A 1 660 ? -1.933  -18.431 64.262 1.00 34.22  ? 660  GLU A CG    1 
ATOM   5408 C  CD    . GLU A 1 660 ? -2.753  -19.477 63.535 1.00 40.07  ? 660  GLU A CD    1 
ATOM   5409 O  OE1   . GLU A 1 660 ? -3.965  -19.622 63.833 1.00 43.62  ? 660  GLU A OE1   1 
ATOM   5410 O  OE2   . GLU A 1 660 ? -2.186  -20.152 62.649 1.00 42.40  ? 660  GLU A OE2   1 
ATOM   5411 N  N     . PRO A 1 661 ? -2.931  -16.650 68.494 1.00 30.56  ? 661  PRO A N     1 
ATOM   5412 C  CA    . PRO A 1 661 ? -3.574  -15.797 69.499 1.00 31.49  ? 661  PRO A CA    1 
ATOM   5413 C  C     . PRO A 1 661 ? -2.786  -14.520 69.828 1.00 31.62  ? 661  PRO A C     1 
ATOM   5414 O  O     . PRO A 1 661 ? -3.372  -13.429 69.859 1.00 32.93  ? 661  PRO A O     1 
ATOM   5415 C  CB    . PRO A 1 661 ? -3.662  -16.713 70.726 1.00 29.17  ? 661  PRO A CB    1 
ATOM   5416 C  CG    . PRO A 1 661 ? -3.848  -18.053 70.141 1.00 29.58  ? 661  PRO A CG    1 
ATOM   5417 C  CD    . PRO A 1 661 ? -2.939  -18.064 68.918 1.00 29.28  ? 661  PRO A CD    1 
ATOM   5418 N  N     . ALA A 1 662 ? -1.483  -14.657 70.063 1.00 29.11  ? 662  ALA A N     1 
ATOM   5419 C  CA    . ALA A 1 662 ? -0.625  -13.500 70.337 1.00 30.19  ? 662  ALA A CA    1 
ATOM   5420 C  C     . ALA A 1 662 ? -0.600  -12.545 69.144 1.00 30.49  ? 662  ALA A C     1 
ATOM   5421 O  O     . ALA A 1 662 ? -0.553  -11.315 69.304 1.00 31.11  ? 662  ALA A O     1 
ATOM   5422 C  CB    . ALA A 1 662 ? 0.771   -13.941 70.700 1.00 25.93  ? 662  ALA A CB    1 
ATOM   5423 N  N     . ILE A 1 663 ? -0.651  -13.118 67.948 1.00 30.14  ? 663  ILE A N     1 
ATOM   5424 C  CA    . ILE A 1 663 ? -0.763  -12.319 66.741 1.00 29.90  ? 663  ILE A CA    1 
ATOM   5425 C  C     . ILE A 1 663 ? -2.117  -11.611 66.699 1.00 32.29  ? 663  ILE A C     1 
ATOM   5426 O  O     . ILE A 1 663 ? -2.173  -10.399 66.468 1.00 32.61  ? 663  ILE A O     1 
ATOM   5427 C  CB    . ILE A 1 663 ? -0.494  -13.148 65.474 1.00 27.84  ? 663  ILE A CB    1 
ATOM   5428 C  CG1   . ILE A 1 663 ? 1.013   -13.429 65.369 1.00 23.21  ? 663  ILE A CG1   1 
ATOM   5429 C  CG2   . ILE A 1 663 ? -1.010  -12.415 64.231 1.00 19.30  ? 663  ILE A CG2   1 
ATOM   5430 C  CD1   . ILE A 1 663 ? 1.413   -14.387 64.258 1.00 23.42  ? 663  ILE A CD1   1 
ATOM   5431 N  N     . ASP A 1 664 ? -3.189  -12.362 66.956 1.00 34.15  ? 664  ASP A N     1 
ATOM   5432 C  CA    . ASP A 1 664 ? -4.532  -11.802 66.999 1.00 36.50  ? 664  ASP A CA    1 
ATOM   5433 C  C     . ASP A 1 664 ? -4.589  -10.648 67.988 1.00 36.15  ? 664  ASP A C     1 
ATOM   5434 O  O     . ASP A 1 664 ? -5.072  -9.575  67.648 1.00 37.71  ? 664  ASP A O     1 
ATOM   5435 C  CB    . ASP A 1 664 ? -5.584  -12.870 67.362 1.00 42.19  ? 664  ASP A CB    1 
ATOM   5436 C  CG    . ASP A 1 664 ? -5.856  -13.871 66.219 1.00 50.88  ? 664  ASP A CG    1 
ATOM   5437 O  OD1   . ASP A 1 664 ? -6.050  -15.076 66.512 1.00 58.48  ? 664  ASP A OD1   1 
ATOM   5438 O  OD2   . ASP A 1 664 ? -5.893  -13.473 65.032 1.00 56.47  ? 664  ASP A OD2   1 
ATOM   5439 N  N     . ARG A 1 665 ? -4.080  -10.859 69.201 1.00 35.05  ? 665  ARG A N     1 
ATOM   5440 C  CA    . ARG A 1 665 ? -4.100  -9.815  70.226 1.00 36.57  ? 665  ARG A CA    1 
ATOM   5441 C  C     . ARG A 1 665 ? -3.388  -8.568  69.748 1.00 36.22  ? 665  ARG A C     1 
ATOM   5442 O  O     . ARG A 1 665 ? -3.859  -7.454  69.965 1.00 34.53  ? 665  ARG A O     1 
ATOM   5443 C  CB    . ARG A 1 665 ? -3.462  -10.295 71.529 1.00 37.00  ? 665  ARG A CB    1 
ATOM   5444 C  CG    . ARG A 1 665 ? -4.365  -11.182 72.357 1.00 37.31  ? 665  ARG A CG    1 
ATOM   5445 C  CD    . ARG A 1 665 ? -3.838  -11.359 73.773 1.00 41.54  ? 665  ARG A CD    1 
ATOM   5446 N  NE    . ARG A 1 665 ? -2.466  -11.862 73.806 1.00 44.37  ? 665  ARG A NE    1 
ATOM   5447 C  CZ    . ARG A 1 665 ? -2.132  -13.149 73.735 1.00 45.62  ? 665  ARG A CZ    1 
ATOM   5448 N  NH1   . ARG A 1 665 ? -3.071  -14.082 73.620 1.00 46.60  ? 665  ARG A NH1   1 
ATOM   5449 N  NH2   . ARG A 1 665 ? -0.855  -13.502 73.776 1.00 42.88  ? 665  ARG A NH2   1 
ATOM   5450 N  N     . GLY A 1 666 ? -2.252  -8.779  69.089 1.00 37.14  ? 666  GLY A N     1 
ATOM   5451 C  CA    . GLY A 1 666 ? -1.450  -7.698  68.527 1.00 36.98  ? 666  GLY A CA    1 
ATOM   5452 C  C     . GLY A 1 666 ? -2.189  -6.868  67.497 1.00 34.99  ? 666  GLY A C     1 
ATOM   5453 O  O     . GLY A 1 666 ? -2.088  -5.644  67.508 1.00 35.91  ? 666  GLY A O     1 
ATOM   5454 N  N     . PHE A 1 667 ? -2.933  -7.532  66.611 1.00 34.66  ? 667  PHE A N     1 
ATOM   5455 C  CA    . PHE A 1 667 ? -3.686  -6.830  65.560 1.00 34.36  ? 667  PHE A CA    1 
ATOM   5456 C  C     . PHE A 1 667 ? -4.946  -6.138  66.076 1.00 33.20  ? 667  PHE A C     1 
ATOM   5457 O  O     . PHE A 1 667 ? -5.312  -5.070  65.590 1.00 33.25  ? 667  PHE A O     1 
ATOM   5458 C  CB    . PHE A 1 667 ? -4.011  -7.746  64.372 1.00 32.63  ? 667  PHE A CB    1 
ATOM   5459 C  CG    . PHE A 1 667 ? -2.889  -7.855  63.362 1.00 33.27  ? 667  PHE A CG    1 
ATOM   5460 C  CD1   . PHE A 1 667 ? -2.308  -6.710  62.815 1.00 32.20  ? 667  PHE A CD1   1 
ATOM   5461 C  CD2   . PHE A 1 667 ? -2.429  -9.101  62.943 1.00 31.65  ? 667  PHE A CD2   1 
ATOM   5462 C  CE1   . PHE A 1 667 ? -1.272  -6.805  61.880 1.00 31.54  ? 667  PHE A CE1   1 
ATOM   5463 C  CE2   . PHE A 1 667 ? -1.397  -9.210  62.007 1.00 30.48  ? 667  PHE A CE2   1 
ATOM   5464 C  CZ    . PHE A 1 667 ? -0.819  -8.057  61.474 1.00 32.21  ? 667  PHE A CZ    1 
ATOM   5465 N  N     . ARG A 1 668 ? -5.603  -6.739  67.060 1.00 33.84  ? 668  ARG A N     1 
ATOM   5466 C  CA    . ARG A 1 668 ? -6.793  -6.122  67.645 1.00 35.04  ? 668  ARG A CA    1 
ATOM   5467 C  C     . ARG A 1 668 ? -6.437  -4.793  68.287 1.00 35.12  ? 668  ARG A C     1 
ATOM   5468 O  O     . ARG A 1 668 ? -7.254  -3.867  68.299 1.00 34.87  ? 668  ARG A O     1 
ATOM   5469 C  CB    . ARG A 1 668 ? -7.463  -7.048  68.659 1.00 36.13  ? 668  ARG A CB    1 
ATOM   5470 C  CG    . ARG A 1 668 ? -8.192  -8.224  68.018 1.00 40.43  ? 668  ARG A CG    1 
ATOM   5471 C  CD    . ARG A 1 668 ? -9.124  -8.905  68.992 1.00 45.36  ? 668  ARG A CD    1 
ATOM   5472 N  NE    . ARG A 1 668 ? -8.418  -9.701  69.999 1.00 55.19  ? 668  ARG A NE    1 
ATOM   5473 C  CZ    . ARG A 1 668 ? -8.084  -10.985 69.863 1.00 56.10  ? 668  ARG A CZ    1 
ATOM   5474 N  NH1   . ARG A 1 668 ? -8.378  -11.643 68.743 1.00 58.31  ? 668  ARG A NH1   1 
ATOM   5475 N  NH2   . ARG A 1 668 ? -7.449  -11.608 70.850 1.00 51.01  ? 668  ARG A NH2   1 
ATOM   5476 N  N     . GLU A 1 669 ? -5.207  -4.708  68.799 1.00 35.58  ? 669  GLU A N     1 
ATOM   5477 C  CA    . GLU A 1 669 ? -4.685  -3.484  69.400 1.00 37.10  ? 669  GLU A CA    1 
ATOM   5478 C  C     . GLU A 1 669 ? -4.450  -2.420  68.330 1.00 35.24  ? 669  GLU A C     1 
ATOM   5479 O  O     . GLU A 1 669 ? -4.755  -1.237  68.536 1.00 34.24  ? 669  GLU A O     1 
ATOM   5480 C  CB    . GLU A 1 669 ? -3.388  -3.762  70.174 1.00 38.60  ? 669  GLU A CB    1 
ATOM   5481 C  CG    . GLU A 1 669 ? -2.804  -2.529  70.860 1.00 42.40  ? 669  GLU A CG    1 
ATOM   5482 C  CD    . GLU A 1 669 ? -1.568  -2.830  71.674 1.00 45.46  ? 669  GLU A CD    1 
ATOM   5483 O  OE1   . GLU A 1 669 ? -1.665  -3.605  72.644 1.00 50.49  ? 669  GLU A OE1   1 
ATOM   5484 O  OE2   . GLU A 1 669 ? -0.499  -2.281  71.357 1.00 45.83  ? 669  GLU A OE2   1 
ATOM   5485 N  N     . MET A 1 670 ? -3.905  -2.852  67.192 1.00 32.39  ? 670  MET A N     1 
ATOM   5486 C  CA    . MET A 1 670 ? -3.636  -1.951  66.076 1.00 30.74  ? 670  MET A CA    1 
ATOM   5487 C  C     . MET A 1 670 ? -4.956  -1.428  65.511 1.00 28.80  ? 670  MET A C     1 
ATOM   5488 O  O     . MET A 1 670 ? -5.052  -0.273  65.113 1.00 28.69  ? 670  MET A O     1 
ATOM   5489 C  CB    . MET A 1 670 ? -2.820  -2.663  64.995 1.00 28.79  ? 670  MET A CB    1 
ATOM   5490 C  CG    . MET A 1 670 ? -2.109  -1.728  64.029 1.00 31.12  ? 670  MET A CG    1 
ATOM   5491 S  SD    . MET A 1 670 ? -1.402  -2.541  62.573 1.00 30.57  ? 670  MET A SD    1 
ATOM   5492 C  CE    . MET A 1 670 ? -2.858  -2.881  61.593 1.00 32.20  ? 670  MET A CE    1 
ATOM   5493 N  N     . CYS A 1 671 ? -5.971  -2.285  65.502 1.00 27.65  ? 671  CYS A N     1 
ATOM   5494 C  CA    . CYS A 1 671 ? -7.308  -1.912  65.068 1.00 30.30  ? 671  CYS A CA    1 
ATOM   5495 C  C     . CYS A 1 671 ? -7.840  -0.781  65.930 1.00 31.37  ? 671  CYS A C     1 
ATOM   5496 O  O     . CYS A 1 671 ? -8.289  0.239   65.410 1.00 30.46  ? 671  CYS A O     1 
ATOM   5497 C  CB    . CYS A 1 671 ? -8.245  -3.119  65.145 1.00 31.09  ? 671  CYS A CB    1 
ATOM   5498 S  SG    . CYS A 1 671 ? -9.898  -2.836  64.483 1.00 39.18  ? 671  CYS A SG    1 
ATOM   5499 N  N     . GLU A 1 672 ? -7.776  -0.972  67.247 1.00 32.89  ? 672  GLU A N     1 
ATOM   5500 C  CA    . GLU A 1 672 ? -8.169  0.049   68.212 1.00 36.78  ? 672  GLU A CA    1 
ATOM   5501 C  C     . GLU A 1 672 ? -7.338  1.314   68.036 1.00 34.40  ? 672  GLU A C     1 
ATOM   5502 O  O     . GLU A 1 672 ? -7.876  2.428   68.087 1.00 34.64  ? 672  GLU A O     1 
ATOM   5503 C  CB    . GLU A 1 672 ? -8.053  -0.482  69.645 1.00 41.97  ? 672  GLU A CB    1 
ATOM   5504 C  CG    . GLU A 1 672 ? -9.292  -1.277  70.120 1.00 54.12  ? 672  GLU A CG    1 
ATOM   5505 C  CD    . GLU A 1 672 ? -9.056  -2.043  71.430 1.00 63.72  ? 672  GLU A CD    1 
ATOM   5506 O  OE1   . GLU A 1 672 ? -9.096  -3.296  71.397 1.00 66.74  ? 672  GLU A OE1   1 
ATOM   5507 O  OE2   . GLU A 1 672 ? -8.821  -1.399  72.486 1.00 65.18  ? 672  GLU A OE2   1 
ATOM   5508 N  N     . TYR A 1 673 ? -6.037  1.132   67.810 1.00 29.33  ? 673  TYR A N     1 
ATOM   5509 C  CA    . TYR A 1 673 ? -5.118  2.232   67.562 1.00 27.21  ? 673  TYR A CA    1 
ATOM   5510 C  C     . TYR A 1 673 ? -5.583  3.082   66.384 1.00 28.74  ? 673  TYR A C     1 
ATOM   5511 O  O     . TYR A 1 673 ? -5.542  4.308   66.456 1.00 29.20  ? 673  TYR A O     1 
ATOM   5512 C  CB    . TYR A 1 673 ? -3.702  1.691   67.333 1.00 27.64  ? 673  TYR A CB    1 
ATOM   5513 C  CG    . TYR A 1 673 ? -2.597  2.726   67.307 1.00 27.10  ? 673  TYR A CG    1 
ATOM   5514 C  CD1   . TYR A 1 673 ? -2.704  3.921   68.005 1.00 30.22  ? 673  TYR A CD1   1 
ATOM   5515 C  CD2   . TYR A 1 673 ? -1.421  2.485   66.613 1.00 31.43  ? 673  TYR A CD2   1 
ATOM   5516 C  CE1   . TYR A 1 673 ? -1.683  4.868   67.978 1.00 30.39  ? 673  TYR A CE1   1 
ATOM   5517 C  CE2   . TYR A 1 673 ? -0.384  3.420   66.589 1.00 31.55  ? 673  TYR A CE2   1 
ATOM   5518 C  CZ    . TYR A 1 673 ? -0.523  4.609   67.270 1.00 33.14  ? 673  TYR A CZ    1 
ATOM   5519 O  OH    . TYR A 1 673 ? 0.504   5.534   67.250 1.00 35.47  ? 673  TYR A OH    1 
ATOM   5520 N  N     . MET A 1 674 ? -6.042  2.434   65.310 1.00 29.22  ? 674  MET A N     1 
ATOM   5521 C  CA    . MET A 1 674 ? -6.479  3.149   64.105 1.00 29.78  ? 674  MET A CA    1 
ATOM   5522 C  C     . MET A 1 674 ? -7.995  3.336   64.092 1.00 31.07  ? 674  MET A C     1 
ATOM   5523 O  O     . MET A 1 674 ? -8.562  3.859   63.133 1.00 33.22  ? 674  MET A O     1 
ATOM   5524 C  CB    . MET A 1 674 ? -6.018  2.429   62.831 1.00 29.36  ? 674  MET A CB    1 
ATOM   5525 C  CG    . MET A 1 674 ? -4.512  2.384   62.656 1.00 27.24  ? 674  MET A CG    1 
ATOM   5526 S  SD    . MET A 1 674 ? -3.814  3.945   62.103 1.00 31.86  ? 674  MET A SD    1 
ATOM   5527 C  CE    . MET A 1 674 ? -2.485  4.138   63.282 1.00 27.58  ? 674  MET A CE    1 
ATOM   5528 N  N     . ASN A 1 675 ? -8.644  2.912   65.168 1.00 29.99  ? 675  ASN A N     1 
ATOM   5529 C  CA    . ASN A 1 675 ? -10.082 3.055   65.316 1.00 29.77  ? 675  ASN A CA    1 
ATOM   5530 C  C     . ASN A 1 675 ? -10.882 2.546   64.111 1.00 28.51  ? 675  ASN A C     1 
ATOM   5531 O  O     . ASN A 1 675 ? -11.842 3.186   63.675 1.00 26.60  ? 675  ASN A O     1 
ATOM   5532 C  CB    . ASN A 1 675 ? -10.437 4.512   65.637 1.00 30.72  ? 675  ASN A CB    1 
ATOM   5533 C  CG    . ASN A 1 675 ? -11.804 4.642   66.267 1.00 32.99  ? 675  ASN A CG    1 
ATOM   5534 O  OD1   . ASN A 1 675 ? -12.297 3.703   66.900 1.00 32.59  ? 675  ASN A OD1   1 
ATOM   5535 N  ND2   . ASN A 1 675 ? -12.430 5.798   66.095 1.00 32.48  ? 675  ASN A ND2   1 
ATOM   5536 N  N     . ASN A 1 676 ? -10.481 1.387   63.586 1.00 29.37  ? 676  ASN A N     1 
ATOM   5537 C  CA    . ASN A 1 676 ? -11.081 0.820   62.372 1.00 28.33  ? 676  ASN A CA    1 
ATOM   5538 C  C     . ASN A 1 676 ? -12.496 0.268   62.563 1.00 31.70  ? 676  ASN A C     1 
ATOM   5539 O  O     . ASN A 1 676 ? -12.908 -0.065  63.687 1.00 30.97  ? 676  ASN A O     1 
ATOM   5540 C  CB    . ASN A 1 676 ? -10.186 -0.269  61.789 1.00 27.88  ? 676  ASN A CB    1 
ATOM   5541 C  CG    . ASN A 1 676 ? -8.814  0.239   61.374 1.00 26.56  ? 676  ASN A CG    1 
ATOM   5542 O  OD1   . ASN A 1 676 ? -7.807  -0.456  61.559 1.00 27.19  ? 676  ASN A OD1   1 
ATOM   5543 N  ND2   . ASN A 1 676 ? -8.762  1.439   60.803 1.00 22.58  ? 676  ASN A ND2   1 
ATOM   5544 N  N     . LYS A 1 677 ? -13.227 0.174   61.450 1.00 31.69  ? 677  LYS A N     1 
ATOM   5545 C  CA    . LYS A 1 677 ? -14.605 -0.312  61.436 1.00 33.76  ? 677  LYS A CA    1 
ATOM   5546 C  C     . LYS A 1 677 ? -14.698 -1.745  61.954 1.00 34.65  ? 677  LYS A C     1 
ATOM   5547 O  O     . LYS A 1 677 ? -15.510 -2.047  62.825 1.00 35.51  ? 677  LYS A O     1 
ATOM   5548 C  CB    . LYS A 1 677 ? -15.186 -0.215  60.019 1.00 33.44  ? 677  LYS A CB    1 
ATOM   5549 C  CG    . LYS A 1 677 ? -16.683 -0.450  59.922 1.00 33.99  ? 677  LYS A CG    1 
ATOM   5550 C  CD    . LYS A 1 677 ? -17.223 0.104   58.601 1.00 37.88  ? 677  LYS A CD    1 
ATOM   5551 C  CE    . LYS A 1 677 ? -18.729 -0.063  58.469 1.00 37.29  ? 677  LYS A CE    1 
ATOM   5552 N  NZ    . LYS A 1 677 ? -19.089 -1.464  58.152 1.00 38.84  ? 677  LYS A NZ    1 
ATOM   5553 N  N     . GLN A 1 678 ? -13.849 -2.618  61.422 1.00 34.91  ? 678  GLN A N     1 
ATOM   5554 C  CA    . GLN A 1 678 ? -13.885 -4.027  61.762 1.00 34.17  ? 678  GLN A CA    1 
ATOM   5555 C  C     . GLN A 1 678 ? -12.477 -4.609  61.747 1.00 35.15  ? 678  GLN A C     1 
ATOM   5556 O  O     . GLN A 1 678 ? -11.676 -4.342  60.842 1.00 34.97  ? 678  GLN A O     1 
ATOM   5557 C  CB    . GLN A 1 678 ? -14.791 -4.778  60.772 1.00 35.39  ? 678  GLN A CB    1 
ATOM   5558 C  CG    . GLN A 1 678 ? -15.236 -6.178  61.226 1.00 35.47  ? 678  GLN A CG    1 
ATOM   5559 C  CD    . GLN A 1 678 ? -16.046 -6.926  60.163 1.00 36.63  ? 678  GLN A CD    1 
ATOM   5560 O  OE1   . GLN A 1 678 ? -16.393 -6.373  59.123 1.00 33.88  ? 678  GLN A OE1   1 
ATOM   5561 N  NE2   . GLN A 1 678 ? -16.342 -8.192  60.429 1.00 39.81  ? 678  GLN A NE2   1 
ATOM   5562 N  N     . HIS A 1 679 ? -12.181 -5.403  62.766 1.00 35.08  ? 679  HIS A N     1 
ATOM   5563 C  CA    . HIS A 1 679 ? -10.944 -6.144  62.822 1.00 32.50  ? 679  HIS A CA    1 
ATOM   5564 C  C     . HIS A 1 679 ? -10.977 -7.297  61.812 1.00 32.91  ? 679  HIS A C     1 
ATOM   5565 O  O     . HIS A 1 679 ? -11.742 -8.251  61.977 1.00 35.27  ? 679  HIS A O     1 
ATOM   5566 C  CB    . HIS A 1 679 ? -10.729 -6.680  64.235 1.00 31.04  ? 679  HIS A CB    1 
ATOM   5567 C  CG    . HIS A 1 679 ? -9.669  -7.732  64.318 1.00 35.48  ? 679  HIS A CG    1 
ATOM   5568 N  ND1   . HIS A 1 679 ? -8.393  -7.544  63.820 1.00 29.32  ? 679  HIS A ND1   1 
ATOM   5569 C  CD2   . HIS A 1 679 ? -9.699  -8.990  64.822 1.00 33.48  ? 679  HIS A CD2   1 
ATOM   5570 C  CE1   . HIS A 1 679 ? -7.681  -8.638  64.025 1.00 31.01  ? 679  HIS A CE1   1 
ATOM   5571 N  NE2   . HIS A 1 679 ? -8.450  -9.533  64.623 1.00 35.15  ? 679  HIS A NE2   1 
ATOM   5572 N  N     . LEU A 1 680 ? -10.149 -7.215  60.771 1.00 31.29  ? 680  LEU A N     1 
ATOM   5573 C  CA    . LEU A 1 680 ? -10.102 -8.268  59.752 1.00 27.45  ? 680  LEU A CA    1 
ATOM   5574 C  C     . LEU A 1 680 ? -8.670  -8.720  59.403 1.00 28.08  ? 680  LEU A C     1 
ATOM   5575 O  O     . LEU A 1 680 ? -8.459  -9.438  58.426 1.00 27.06  ? 680  LEU A O     1 
ATOM   5576 C  CB    . LEU A 1 680 ? -10.891 -7.851  58.504 1.00 26.24  ? 680  LEU A CB    1 
ATOM   5577 C  CG    . LEU A 1 680 ? -12.421 -7.766  58.659 1.00 31.01  ? 680  LEU A CG    1 
ATOM   5578 C  CD1   . LEU A 1 680 ? -13.092 -7.005  57.516 1.00 26.24  ? 680  LEU A CD1   1 
ATOM   5579 C  CD2   . LEU A 1 680 ? -13.070 -9.156  58.845 1.00 32.96  ? 680  LEU A CD2   1 
ATOM   5580 N  N     . MET A 1 681 ? -7.699  -8.314  60.221 1.00 27.70  ? 681  MET A N     1 
ATOM   5581 C  CA    . MET A 1 681 ? -6.301  -8.731  60.051 1.00 27.58  ? 681  MET A CA    1 
ATOM   5582 C  C     . MET A 1 681 ? -6.086  -10.123 60.632 1.00 27.97  ? 681  MET A C     1 
ATOM   5583 O  O     . MET A 1 681 ? -5.767  -10.277 61.822 1.00 27.72  ? 681  MET A O     1 
ATOM   5584 C  CB    . MET A 1 681 ? -5.339  -7.734  60.706 1.00 27.01  ? 681  MET A CB    1 
ATOM   5585 C  CG    . MET A 1 681 ? -5.381  -6.336  60.133 1.00 24.71  ? 681  MET A CG    1 
ATOM   5586 S  SD    . MET A 1 681 ? -4.910  -6.313  58.395 1.00 30.88  ? 681  MET A SD    1 
ATOM   5587 C  CE    . MET A 1 681 ? -6.472  -5.984  57.581 1.00 24.99  ? 681  MET A CE    1 
ATOM   5588 N  N     . PHE A 1 682 ? -6.270  -11.131 59.781 1.00 25.77  ? 682  PHE A N     1 
ATOM   5589 C  CA    . PHE A 1 682 ? -6.164  -12.517 60.189 1.00 25.28  ? 682  PHE A CA    1 
ATOM   5590 C  C     . PHE A 1 682 ? -4.901  -13.086 59.584 1.00 25.05  ? 682  PHE A C     1 
ATOM   5591 O  O     . PHE A 1 682 ? -4.819  -13.299 58.371 1.00 24.61  ? 682  PHE A O     1 
ATOM   5592 C  CB    . PHE A 1 682 ? -7.407  -13.337 59.767 1.00 23.13  ? 682  PHE A CB    1 
ATOM   5593 C  CG    . PHE A 1 682 ? -8.729  -12.743 60.211 1.00 23.96  ? 682  PHE A CG    1 
ATOM   5594 C  CD1   . PHE A 1 682 ? -8.850  -12.079 61.437 1.00 25.81  ? 682  PHE A CD1   1 
ATOM   5595 C  CD2   . PHE A 1 682 ? -9.871  -12.881 59.415 1.00 27.32  ? 682  PHE A CD2   1 
ATOM   5596 C  CE1   . PHE A 1 682 ? -10.069 -11.542 61.850 1.00 23.17  ? 682  PHE A CE1   1 
ATOM   5597 C  CE2   . PHE A 1 682 ? -11.112 -12.352 59.822 1.00 25.52  ? 682  PHE A CE2   1 
ATOM   5598 C  CZ    . PHE A 1 682 ? -11.207 -11.679 61.042 1.00 26.18  ? 682  PHE A CZ    1 
ATOM   5599 N  N     . MET A 1 683 ? -3.917  -13.322 60.442 1.00 27.23  ? 683  MET A N     1 
ATOM   5600 C  CA    . MET A 1 683 ? -2.599  -13.767 60.006 1.00 29.37  ? 683  MET A CA    1 
ATOM   5601 C  C     . MET A 1 683 ? -2.386  -15.218 60.427 1.00 31.89  ? 683  MET A C     1 
ATOM   5602 O  O     . MET A 1 683 ? -1.957  -15.494 61.548 1.00 33.50  ? 683  MET A O     1 
ATOM   5603 C  CB    . MET A 1 683 ? -1.505  -12.852 60.572 1.00 27.23  ? 683  MET A CB    1 
ATOM   5604 C  CG    . MET A 1 683 ? -0.095  -13.228 60.149 1.00 28.17  ? 683  MET A CG    1 
ATOM   5605 S  SD    . MET A 1 683 ? 1.194   -12.075 60.660 1.00 29.51  ? 683  MET A SD    1 
ATOM   5606 C  CE    . MET A 1 683 ? 1.463   -11.158 59.134 1.00 23.48  ? 683  MET A CE    1 
ATOM   5607 N  N     . ASP A 1 684 ? -2.712  -16.132 59.513 1.00 32.72  ? 684  ASP A N     1 
ATOM   5608 C  CA    . ASP A 1 684 ? -2.645  -17.571 59.765 1.00 32.44  ? 684  ASP A CA    1 
ATOM   5609 C  C     . ASP A 1 684 ? -1.286  -18.147 59.372 1.00 30.91  ? 684  ASP A C     1 
ATOM   5610 O  O     . ASP A 1 684 ? -0.619  -17.638 58.466 1.00 29.55  ? 684  ASP A O     1 
ATOM   5611 C  CB    . ASP A 1 684 ? -3.761  -18.306 59.006 1.00 33.25  ? 684  ASP A CB    1 
ATOM   5612 C  CG    . ASP A 1 684 ? -5.156  -17.943 59.502 1.00 39.67  ? 684  ASP A CG    1 
ATOM   5613 O  OD1   . ASP A 1 684 ? -5.296  -17.459 60.652 1.00 43.25  ? 684  ASP A OD1   1 
ATOM   5614 O  OD2   . ASP A 1 684 ? -6.125  -18.156 58.734 1.00 42.93  ? 684  ASP A OD2   1 
ATOM   5615 N  N     . ARG A 1 685 ? -0.890  -19.214 60.056 1.00 28.44  ? 685  ARG A N     1 
ATOM   5616 C  CA    . ARG A 1 685 ? 0.343   -19.896 59.740 1.00 27.81  ? 685  ARG A CA    1 
ATOM   5617 C  C     . ARG A 1 685 ? 0.269   -20.465 58.320 1.00 28.28  ? 685  ARG A C     1 
ATOM   5618 O  O     . ARG A 1 685 ? -0.738  -21.081 57.932 1.00 27.17  ? 685  ARG A O     1 
ATOM   5619 C  CB    . ARG A 1 685 ? 0.616   -20.999 60.762 1.00 26.52  ? 685  ARG A CB    1 
ATOM   5620 C  CG    . ARG A 1 685 ? 2.001   -21.612 60.653 1.00 23.06  ? 685  ARG A CG    1 
ATOM   5621 C  CD    . ARG A 1 685 ? 2.032   -22.793 59.691 1.00 24.12  ? 685  ARG A CD    1 
ATOM   5622 N  NE    . ARG A 1 685 ? 1.289   -23.954 60.193 1.00 24.92  ? 685  ARG A NE    1 
ATOM   5623 C  CZ    . ARG A 1 685 ? 0.986   -25.031 59.467 1.00 27.72  ? 685  ARG A CZ    1 
ATOM   5624 N  NH1   . ARG A 1 685 ? 1.342   -25.111 58.188 1.00 26.17  ? 685  ARG A NH1   1 
ATOM   5625 N  NH2   . ARG A 1 685 ? 0.314   -26.032 60.017 1.00 28.72  ? 685  ARG A NH2   1 
ATOM   5626 N  N     . GLU A 1 686 ? 1.334   -20.232 57.559 1.00 26.96  ? 686  GLU A N     1 
ATOM   5627 C  CA    . GLU A 1 686 ? 1.453   -20.719 56.197 1.00 29.39  ? 686  GLU A CA    1 
ATOM   5628 C  C     . GLU A 1 686 ? 2.337   -21.964 56.191 1.00 29.00  ? 686  GLU A C     1 
ATOM   5629 O  O     . GLU A 1 686 ? 1.824   -23.080 56.130 1.00 28.89  ? 686  GLU A O     1 
ATOM   5630 C  CB    . GLU A 1 686 ? 2.008   -19.626 55.263 1.00 29.73  ? 686  GLU A CB    1 
ATOM   5631 C  CG    . GLU A 1 686 ? 2.135   -20.036 53.781 1.00 36.96  ? 686  GLU A CG    1 
ATOM   5632 C  CD    . GLU A 1 686 ? 3.134   -19.169 52.974 1.00 45.35  ? 686  GLU A CD    1 
ATOM   5633 O  OE1   . GLU A 1 686 ? 2.671   -18.192 52.336 1.00 52.67  ? 686  GLU A OE1   1 
ATOM   5634 O  OE2   . GLU A 1 686 ? 4.364   -19.453 52.974 1.00 33.10  ? 686  GLU A OE2   1 
ATOM   5635 N  N     . ALA A 1 687 ? 3.653   -21.773 56.283 1.00 26.84  ? 687  ALA A N     1 
ATOM   5636 C  CA    . ALA A 1 687 ? 4.604   -22.882 56.117 1.00 27.82  ? 687  ALA A CA    1 
ATOM   5637 C  C     . ALA A 1 687 ? 5.334   -23.304 57.401 1.00 27.67  ? 687  ALA A C     1 
ATOM   5638 O  O     . ALA A 1 687 ? 5.631   -22.468 58.274 1.00 26.60  ? 687  ALA A O     1 
ATOM   5639 C  CB    . ALA A 1 687 ? 5.617   -22.560 55.011 1.00 25.06  ? 687  ALA A CB    1 
ATOM   5640 N  N     . ILE A 1 688 ? 5.611   -24.606 57.498 1.00 25.50  ? 688  ILE A N     1 
ATOM   5641 C  CA    . ILE A 1 688 ? 6.469   -25.161 58.544 1.00 26.06  ? 688  ILE A CA    1 
ATOM   5642 C  C     . ILE A 1 688 ? 7.641   -25.873 57.872 1.00 24.74  ? 688  ILE A C     1 
ATOM   5643 O  O     . ILE A 1 688 ? 7.457   -26.850 57.157 1.00 24.53  ? 688  ILE A O     1 
ATOM   5644 C  CB    . ILE A 1 688 ? 5.702   -26.109 59.502 1.00 26.26  ? 688  ILE A CB    1 
ATOM   5645 C  CG1   . ILE A 1 688 ? 4.707   -25.307 60.348 1.00 27.16  ? 688  ILE A CG1   1 
ATOM   5646 C  CG2   . ILE A 1 688 ? 6.665   -26.864 60.434 1.00 25.99  ? 688  ILE A CG2   1 
ATOM   5647 C  CD1   . ILE A 1 688 ? 3.687   -26.147 61.018 1.00 21.54  ? 688  ILE A CD1   1 
ATOM   5648 N  N     . ALA A 1 689 ? 8.846   -25.375 58.115 1.00 24.28  ? 689  ALA A N     1 
ATOM   5649 C  CA    . ALA A 1 689 ? 9.987   -25.788 57.326 1.00 25.53  ? 689  ALA A CA    1 
ATOM   5650 C  C     . ALA A 1 689 ? 11.199  -26.137 58.171 1.00 26.20  ? 689  ALA A C     1 
ATOM   5651 O  O     . ALA A 1 689 ? 11.468  -25.510 59.197 1.00 27.60  ? 689  ALA A O     1 
ATOM   5652 C  CB    . ALA A 1 689 ? 10.333  -24.716 56.307 1.00 25.04  ? 689  ALA A CB    1 
ATOM   5653 N  N     . GLY A 1 690 ? 11.926  -27.149 57.718 1.00 24.54  ? 690  GLY A N     1 
ATOM   5654 C  CA    . GLY A 1 690 ? 13.094  -27.632 58.414 1.00 25.18  ? 690  GLY A CA    1 
ATOM   5655 C  C     . GLY A 1 690 ? 13.648  -28.824 57.670 1.00 26.16  ? 690  GLY A C     1 
ATOM   5656 O  O     . GLY A 1 690 ? 12.981  -29.356 56.780 1.00 25.43  ? 690  GLY A O     1 
ATOM   5657 N  N     . PRO A 1 691 ? 14.866  -29.251 58.039 1.00 27.04  ? 691  PRO A N     1 
ATOM   5658 C  CA    . PRO A 1 691 ? 15.523  -30.422 57.473 1.00 28.22  ? 691  PRO A CA    1 
ATOM   5659 C  C     . PRO A 1 691 ? 14.925  -31.697 58.064 1.00 28.44  ? 691  PRO A C     1 
ATOM   5660 O  O     . PRO A 1 691 ? 14.341  -31.636 59.149 1.00 28.72  ? 691  PRO A O     1 
ATOM   5661 C  CB    . PRO A 1 691 ? 16.979  -30.261 57.936 1.00 28.36  ? 691  PRO A CB    1 
ATOM   5662 C  CG    . PRO A 1 691 ? 16.913  -29.491 59.185 1.00 29.74  ? 691  PRO A CG    1 
ATOM   5663 C  CD    . PRO A 1 691 ? 15.619  -28.691 59.177 1.00 28.93  ? 691  PRO A CD    1 
ATOM   5664 N  N     . PRO A 1 692 ? 15.057  -32.844 57.365 1.00 29.36  ? 692  PRO A N     1 
ATOM   5665 C  CA    . PRO A 1 692 ? 14.591  -34.083 57.994 1.00 29.77  ? 692  PRO A CA    1 
ATOM   5666 C  C     . PRO A 1 692 ? 15.351  -34.293 59.290 1.00 32.97  ? 692  PRO A C     1 
ATOM   5667 O  O     . PRO A 1 692 ? 16.553  -34.005 59.359 1.00 32.12  ? 692  PRO A O     1 
ATOM   5668 C  CB    . PRO A 1 692 ? 14.964  -35.166 56.979 1.00 27.97  ? 692  PRO A CB    1 
ATOM   5669 C  CG    . PRO A 1 692 ? 15.046  -34.454 55.676 1.00 26.22  ? 692  PRO A CG    1 
ATOM   5670 C  CD    . PRO A 1 692 ? 15.575  -33.079 56.004 1.00 27.39  ? 692  PRO A CD    1 
ATOM   5671 N  N     . LEU A 1 693 ? 14.648  -34.758 60.318 1.00 37.07  ? 693  LEU A N     1 
ATOM   5672 C  CA    . LEU A 1 693 ? 15.273  -34.995 61.620 1.00 40.07  ? 693  LEU A CA    1 
ATOM   5673 C  C     . LEU A 1 693 ? 16.388  -36.034 61.485 1.00 42.05  ? 693  LEU A C     1 
ATOM   5674 O  O     . LEU A 1 693 ? 16.183  -37.099 60.891 1.00 44.05  ? 693  LEU A O     1 
ATOM   5675 C  CB    . LEU A 1 693 ? 14.220  -35.418 62.645 1.00 39.43  ? 693  LEU A CB    1 
ATOM   5676 C  CG    . LEU A 1 693 ? 14.454  -35.265 64.159 1.00 41.03  ? 693  LEU A CG    1 
ATOM   5677 C  CD1   . LEU A 1 693 ? 14.850  -36.590 64.789 1.00 45.73  ? 693  LEU A CD1   1 
ATOM   5678 C  CD2   . LEU A 1 693 ? 15.437  -34.163 64.525 1.00 36.46  ? 693  LEU A CD2   1 
ATOM   5679 N  N     . GLY A 1 694 ? 17.573  -35.695 61.995 1.00 41.72  ? 694  GLY A N     1 
ATOM   5680 C  CA    . GLY A 1 694 ? 18.735  -36.574 61.916 1.00 40.68  ? 694  GLY A CA    1 
ATOM   5681 C  C     . GLY A 1 694 ? 19.605  -36.370 60.689 1.00 41.23  ? 694  GLY A C     1 
ATOM   5682 O  O     . GLY A 1 694 ? 20.623  -37.052 60.529 1.00 41.51  ? 694  GLY A O     1 
ATOM   5683 N  N     . SER A 1 695 ? 19.214  -35.433 59.825 1.00 39.55  ? 695  SER A N     1 
ATOM   5684 C  CA    . SER A 1 695 ? 19.923  -35.194 58.564 1.00 39.23  ? 695  SER A CA    1 
ATOM   5685 C  C     . SER A 1 695 ? 20.931  -34.034 58.632 1.00 38.85  ? 695  SER A C     1 
ATOM   5686 O  O     . SER A 1 695 ? 20.879  -33.191 59.532 1.00 36.56  ? 695  SER A O     1 
ATOM   5687 C  CB    . SER A 1 695 ? 18.918  -34.930 57.443 1.00 38.85  ? 695  SER A CB    1 
ATOM   5688 O  OG    . SER A 1 695 ? 18.450  -33.592 57.499 1.00 35.81  ? 695  SER A OG    1 
ATOM   5689 N  N     . LYS A 1 696 ? 21.834  -33.992 57.658 1.00 37.72  ? 696  LYS A N     1 
ATOM   5690 C  CA    . LYS A 1 696 ? 22.735  -32.848 57.512 1.00 39.50  ? 696  LYS A CA    1 
ATOM   5691 C  C     . LYS A 1 696 ? 22.095  -31.693 56.721 1.00 37.23  ? 696  LYS A C     1 
ATOM   5692 O  O     . LYS A 1 696 ? 22.747  -30.678 56.450 1.00 36.78  ? 696  LYS A O     1 
ATOM   5693 C  CB    . LYS A 1 696 ? 24.071  -33.272 56.903 1.00 39.04  ? 696  LYS A CB    1 
ATOM   5694 C  CG    . LYS A 1 696 ? 24.907  -34.154 57.820 1.00 44.77  ? 696  LYS A CG    1 
ATOM   5695 C  CD    . LYS A 1 696 ? 26.247  -34.493 57.185 1.00 50.74  ? 696  LYS A CD    1 
ATOM   5696 C  CE    . LYS A 1 696 ? 27.271  -34.890 58.239 1.00 58.51  ? 696  LYS A CE    1 
ATOM   5697 N  NZ    . LYS A 1 696 ? 28.627  -35.167 57.648 1.00 62.83  ? 696  LYS A NZ    1 
ATOM   5698 N  N     . GLY A 1 697 ? 20.814  -31.848 56.387 1.00 34.76  ? 697  GLY A N     1 
ATOM   5699 C  CA    . GLY A 1 697 ? 20.057  -30.830 55.656 1.00 31.38  ? 697  GLY A CA    1 
ATOM   5700 C  C     . GLY A 1 697 ? 20.064  -29.486 56.362 1.00 28.49  ? 697  GLY A C     1 
ATOM   5701 O  O     . GLY A 1 697 ? 20.084  -29.413 57.595 1.00 28.12  ? 697  GLY A O     1 
ATOM   5702 N  N     . ILE A 1 698 ? 20.052  -28.417 55.581 1.00 25.98  ? 698  ILE A N     1 
ATOM   5703 C  CA    . ILE A 1 698 ? 20.148  -27.077 56.154 1.00 25.92  ? 698  ILE A CA    1 
ATOM   5704 C  C     . ILE A 1 698 ? 18.772  -26.417 56.342 1.00 24.77  ? 698  ILE A C     1 
ATOM   5705 O  O     . ILE A 1 698 ? 18.672  -25.345 56.932 1.00 24.59  ? 698  ILE A O     1 
ATOM   5706 C  CB    . ILE A 1 698 ? 21.127  -26.174 55.362 1.00 25.60  ? 698  ILE A CB    1 
ATOM   5707 C  CG1   . ILE A 1 698 ? 20.526  -25.773 54.009 1.00 25.79  ? 698  ILE A CG1   1 
ATOM   5708 C  CG2   . ILE A 1 698 ? 22.441  -26.898 55.164 1.00 24.19  ? 698  ILE A CG2   1 
ATOM   5709 C  CD1   . ILE A 1 698 ? 21.103  -24.507 53.433 1.00 27.65  ? 698  ILE A CD1   1 
ATOM   5710 N  N     . GLY A 1 699 ? 17.719  -27.078 55.860 1.00 24.45  ? 699  GLY A N     1 
ATOM   5711 C  CA    . GLY A 1 699 ? 16.346  -26.625 56.098 1.00 23.38  ? 699  GLY A CA    1 
ATOM   5712 C  C     . GLY A 1 699 ? 15.862  -25.549 55.142 1.00 23.91  ? 699  GLY A C     1 
ATOM   5713 O  O     . GLY A 1 699 ? 14.799  -25.685 54.527 1.00 25.25  ? 699  GLY A O     1 
ATOM   5714 N  N     . GLY A 1 700 ? 16.643  -24.478 55.011 1.00 24.66  ? 700  GLY A N     1 
ATOM   5715 C  CA    . GLY A 1 700 ? 16.262  -23.333 54.189 1.00 22.44  ? 700  GLY A CA    1 
ATOM   5716 C  C     . GLY A 1 700 ? 17.407  -22.361 54.016 1.00 22.93  ? 700  GLY A C     1 
ATOM   5717 O  O     . GLY A 1 700 ? 18.410  -22.460 54.713 1.00 19.16  ? 700  GLY A O     1 
ATOM   5718 N  N     . PHE A 1 701 ? 17.262  -21.432 53.068 1.00 24.36  ? 701  PHE A N     1 
ATOM   5719 C  CA    . PHE A 1 701 ? 18.195  -20.312 52.942 1.00 24.41  ? 701  PHE A CA    1 
ATOM   5720 C  C     . PHE A 1 701 ? 17.576  -19.103 52.258 1.00 26.49  ? 701  PHE A C     1 
ATOM   5721 O  O     . PHE A 1 701 ? 16.632  -19.232 51.480 1.00 28.14  ? 701  PHE A O     1 
ATOM   5722 C  CB    . PHE A 1 701 ? 19.489  -20.724 52.232 1.00 25.09  ? 701  PHE A CB    1 
ATOM   5723 C  CG    . PHE A 1 701 ? 19.322  -21.062 50.768 1.00 22.55  ? 701  PHE A CG    1 
ATOM   5724 C  CD1   . PHE A 1 701 ? 19.102  -22.377 50.368 1.00 19.52  ? 701  PHE A CD1   1 
ATOM   5725 C  CD2   . PHE A 1 701 ? 19.427  -20.070 49.790 1.00 21.66  ? 701  PHE A CD2   1 
ATOM   5726 C  CE1   . PHE A 1 701 ? 18.976  -22.701 49.022 1.00 18.08  ? 701  PHE A CE1   1 
ATOM   5727 C  CE2   . PHE A 1 701 ? 19.295  -20.380 48.442 1.00 20.80  ? 701  PHE A CE2   1 
ATOM   5728 C  CZ    . PHE A 1 701 ? 19.072  -21.701 48.054 1.00 21.25  ? 701  PHE A CZ    1 
ATOM   5729 N  N     . TRP A 1 702 ? 18.124  -17.929 52.571 1.00 27.46  ? 702  TRP A N     1 
ATOM   5730 C  CA    . TRP A 1 702 ? 17.759  -16.674 51.934 1.00 25.52  ? 702  TRP A CA    1 
ATOM   5731 C  C     . TRP A 1 702 ? 18.989  -16.099 51.258 1.00 26.25  ? 702  TRP A C     1 
ATOM   5732 O  O     . TRP A 1 702 ? 20.065  -16.112 51.839 1.00 27.75  ? 702  TRP A O     1 
ATOM   5733 C  CB    . TRP A 1 702 ? 17.254  -15.676 52.981 1.00 23.24  ? 702  TRP A CB    1 
ATOM   5734 C  CG    . TRP A 1 702 ? 15.770  -15.574 53.035 1.00 21.42  ? 702  TRP A CG    1 
ATOM   5735 C  CD1   . TRP A 1 702 ? 14.997  -14.623 52.438 1.00 21.59  ? 702  TRP A CD1   1 
ATOM   5736 C  CD2   . TRP A 1 702 ? 14.870  -16.458 53.716 1.00 16.48  ? 702  TRP A CD2   1 
ATOM   5737 N  NE1   . TRP A 1 702 ? 13.670  -14.862 52.692 1.00 21.41  ? 702  TRP A NE1   1 
ATOM   5738 C  CE2   . TRP A 1 702 ? 13.561  -15.987 53.470 1.00 19.40  ? 702  TRP A CE2   1 
ATOM   5739 C  CE3   . TRP A 1 702 ? 15.043  -17.615 54.489 1.00 15.97  ? 702  TRP A CE3   1 
ATOM   5740 C  CZ2   . TRP A 1 702 ? 12.419  -16.623 53.988 1.00 15.35  ? 702  TRP A CZ2   1 
ATOM   5741 C  CZ3   . TRP A 1 702 ? 13.922  -18.247 55.009 1.00 19.28  ? 702  TRP A CZ3   1 
ATOM   5742 C  CH2   . TRP A 1 702 ? 12.614  -17.745 54.748 1.00 21.92  ? 702  TRP A CH2   1 
ATOM   5743 N  N     . THR A 1 703 ? 18.842  -15.579 50.046 1.00 25.68  ? 703  THR A N     1 
ATOM   5744 C  CA    . THR A 1 703 ? 19.959  -14.839 49.426 1.00 27.84  ? 703  THR A CA    1 
ATOM   5745 C  C     . THR A 1 703 ? 19.747  -13.322 49.426 1.00 25.41  ? 703  THR A C     1 
ATOM   5746 O  O     . THR A 1 703 ? 20.694  -12.573 49.279 1.00 26.08  ? 703  THR A O     1 
ATOM   5747 C  CB    . THR A 1 703 ? 20.262  -15.309 47.963 1.00 26.91  ? 703  THR A CB    1 
ATOM   5748 O  OG1   . THR A 1 703 ? 19.260  -14.801 47.078 1.00 27.71  ? 703  THR A OG1   1 
ATOM   5749 C  CG2   . THR A 1 703 ? 20.304  -16.837 47.862 1.00 26.13  ? 703  THR A CG2   1 
ATOM   5750 N  N     . GLY A 1 704 ? 18.494  -12.888 49.575 1.00 26.32  ? 704  GLY A N     1 
ATOM   5751 C  CA    . GLY A 1 704 ? 18.119  -11.469 49.511 1.00 22.88  ? 704  GLY A CA    1 
ATOM   5752 C  C     . GLY A 1 704 ? 16.602  -11.317 49.502 1.00 22.74  ? 704  GLY A C     1 
ATOM   5753 O  O     . GLY A 1 704 ? 15.870  -12.279 49.751 1.00 17.90  ? 704  GLY A O     1 
ATOM   5754 N  N     . LYS A 1 705 ? 16.117  -10.109 49.234 1.00 20.82  ? 705  LYS A N     1 
ATOM   5755 C  CA    . LYS A 1 705 ? 14.684  -9.912  49.159 1.00 24.67  ? 705  LYS A CA    1 
ATOM   5756 C  C     . LYS A 1 705 ? 14.133  -10.763 48.017 1.00 25.74  ? 705  LYS A C     1 
ATOM   5757 O  O     . LYS A 1 705 ? 14.775  -10.900 46.963 1.00 27.13  ? 705  LYS A O     1 
ATOM   5758 C  CB    . LYS A 1 705 ? 14.326  -8.438  48.966 1.00 23.33  ? 705  LYS A CB    1 
ATOM   5759 C  CG    . LYS A 1 705 ? 14.716  -7.549  50.121 1.00 22.00  ? 705  LYS A CG    1 
ATOM   5760 C  CD    . LYS A 1 705 ? 14.649  -6.093  49.710 1.00 22.75  ? 705  LYS A CD    1 
ATOM   5761 C  CE    . LYS A 1 705 ? 14.773  -5.179  50.906 1.00 21.91  ? 705  LYS A CE    1 
ATOM   5762 N  NZ    . LYS A 1 705 ? 14.515  -3.752  50.556 1.00 23.76  ? 705  LYS A NZ    1 
ATOM   5763 N  N     . LYS A 1 706 ? 12.962  -11.354 48.259 1.00 24.44  ? 706  LYS A N     1 
ATOM   5764 C  CA    . LYS A 1 706 ? 12.215  -12.110 47.252 1.00 22.84  ? 706  LYS A CA    1 
ATOM   5765 C  C     . LYS A 1 706 ? 12.984  -13.317 46.690 1.00 22.69  ? 706  LYS A C     1 
ATOM   5766 O  O     . LYS A 1 706 ? 12.654  -13.820 45.620 1.00 24.63  ? 706  LYS A O     1 
ATOM   5767 C  CB    . LYS A 1 706 ? 11.728  -11.177 46.134 1.00 17.53  ? 706  LYS A CB    1 
ATOM   5768 C  CG    . LYS A 1 706 ? 10.754  -10.109 46.635 1.00 23.14  ? 706  LYS A CG    1 
ATOM   5769 C  CD    . LYS A 1 706 ? 10.297  -9.175  45.529 1.00 23.21  ? 706  LYS A CD    1 
ATOM   5770 C  CE    . LYS A 1 706 ? 9.612   -7.941  46.089 1.00 25.09  ? 706  LYS A CE    1 
ATOM   5771 N  NZ    . LYS A 1 706 ? 8.237   -8.194  46.615 1.00 25.09  ? 706  LYS A NZ    1 
ATOM   5772 N  N     . ARG A 1 707 ? 13.996  -13.785 47.414 1.00 27.02  ? 707  ARG A N     1 
ATOM   5773 C  CA    . ARG A 1 707 ? 14.845  -14.868 46.918 1.00 27.40  ? 707  ARG A CA    1 
ATOM   5774 C  C     . ARG A 1 707 ? 15.227  -15.869 48.016 1.00 26.82  ? 707  ARG A C     1 
ATOM   5775 O  O     . ARG A 1 707 ? 16.179  -15.654 48.770 1.00 29.58  ? 707  ARG A O     1 
ATOM   5776 C  CB    . ARG A 1 707 ? 16.092  -14.295 46.225 1.00 28.04  ? 707  ARG A CB    1 
ATOM   5777 C  CG    . ARG A 1 707 ? 15.870  -13.909 44.761 1.00 32.95  ? 707  ARG A CG    1 
ATOM   5778 C  CD    . ARG A 1 707 ? 17.153  -13.431 44.097 1.00 42.36  ? 707  ARG A CD    1 
ATOM   5779 N  NE    . ARG A 1 707 ? 18.099  -14.526 43.852 1.00 48.44  ? 707  ARG A NE    1 
ATOM   5780 C  CZ    . ARG A 1 707 ? 18.252  -15.160 42.688 1.00 45.82  ? 707  ARG A CZ    1 
ATOM   5781 N  NH1   . ARG A 1 707 ? 17.538  -14.816 41.619 1.00 46.00  ? 707  ARG A NH1   1 
ATOM   5782 N  NH2   . ARG A 1 707 ? 19.128  -16.145 42.594 1.00 42.14  ? 707  ARG A NH2   1 
ATOM   5783 N  N     . TYR A 1 708 ? 14.488  -16.972 48.090 1.00 25.37  ? 708  TYR A N     1 
ATOM   5784 C  CA    . TYR A 1 708 ? 14.675  -17.937 49.165 1.00 23.43  ? 708  TYR A CA    1 
ATOM   5785 C  C     . TYR A 1 708 ? 14.124  -19.329 48.850 1.00 24.33  ? 708  TYR A C     1 
ATOM   5786 O  O     . TYR A 1 708 ? 13.372  -19.523 47.881 1.00 21.48  ? 708  TYR A O     1 
ATOM   5787 C  CB    . TYR A 1 708 ? 14.028  -17.417 50.439 1.00 24.42  ? 708  TYR A CB    1 
ATOM   5788 C  CG    . TYR A 1 708 ? 12.519  -17.237 50.362 1.00 23.37  ? 708  TYR A CG    1 
ATOM   5789 C  CD1   . TYR A 1 708 ? 11.956  -15.993 50.078 1.00 22.31  ? 708  TYR A CD1   1 
ATOM   5790 C  CD2   . TYR A 1 708 ? 11.653  -18.305 50.598 1.00 22.40  ? 708  TYR A CD2   1 
ATOM   5791 C  CE1   . TYR A 1 708 ? 10.566  -15.817 50.024 1.00 19.99  ? 708  TYR A CE1   1 
ATOM   5792 C  CE2   . TYR A 1 708 ? 10.265  -18.133 50.551 1.00 25.20  ? 708  TYR A CE2   1 
ATOM   5793 C  CZ    . TYR A 1 708 ? 9.734   -16.884 50.265 1.00 25.27  ? 708  TYR A CZ    1 
ATOM   5794 O  OH    . TYR A 1 708 ? 8.361   -16.715 50.202 1.00 29.63  ? 708  TYR A OH    1 
ATOM   5795 N  N     . ALA A 1 709 ? 14.496  -20.285 49.703 1.00 23.35  ? 709  ALA A N     1 
ATOM   5796 C  CA    . ALA A 1 709 ? 14.199  -21.702 49.503 1.00 22.14  ? 709  ALA A CA    1 
ATOM   5797 C  C     . ALA A 1 709 ? 13.877  -22.329 50.848 1.00 22.19  ? 709  ALA A C     1 
ATOM   5798 O  O     . ALA A 1 709 ? 14.586  -22.092 51.819 1.00 24.97  ? 709  ALA A O     1 
ATOM   5799 C  CB    . ALA A 1 709 ? 15.395  -22.404 48.863 1.00 19.88  ? 709  ALA A CB    1 
ATOM   5800 N  N     . LEU A 1 710 ? 12.812  -23.123 50.903 1.00 22.57  ? 710  LEU A N     1 
ATOM   5801 C  CA    . LEU A 1 710 ? 12.385  -23.789 52.136 1.00 25.16  ? 710  LEU A CA    1 
ATOM   5802 C  C     . LEU A 1 710 ? 11.954  -25.230 51.890 1.00 25.28  ? 710  LEU A C     1 
ATOM   5803 O  O     . LEU A 1 710 ? 11.174  -25.499 50.969 1.00 27.81  ? 710  LEU A O     1 
ATOM   5804 C  CB    . LEU A 1 710 ? 11.208  -23.034 52.770 1.00 24.71  ? 710  LEU A CB    1 
ATOM   5805 C  CG    . LEU A 1 710 ? 11.515  -21.680 53.406 1.00 25.44  ? 710  LEU A CG    1 
ATOM   5806 C  CD1   . LEU A 1 710 ? 10.230  -21.001 53.867 1.00 22.39  ? 710  LEU A CD1   1 
ATOM   5807 C  CD2   . LEU A 1 710 ? 12.519  -21.828 54.554 1.00 20.52  ? 710  LEU A CD2   1 
ATOM   5808 N  N     . ASN A 1 711 ? 12.446  -26.144 52.721 1.00 25.13  ? 711  ASN A N     1 
ATOM   5809 C  CA    . ASN A 1 711 ? 11.969  -27.532 52.720 1.00 24.18  ? 711  ASN A CA    1 
ATOM   5810 C  C     . ASN A 1 711 ? 10.717  -27.645 53.575 1.00 23.58  ? 711  ASN A C     1 
ATOM   5811 O  O     . ASN A 1 711 ? 10.805  -27.685 54.803 1.00 24.25  ? 711  ASN A O     1 
ATOM   5812 C  CB    . ASN A 1 711 ? 13.042  -28.466 53.264 1.00 25.00  ? 711  ASN A CB    1 
ATOM   5813 C  CG    . ASN A 1 711 ? 12.620  -29.927 53.231 1.00 27.14  ? 711  ASN A CG    1 
ATOM   5814 O  OD1   . ASN A 1 711 ? 12.429  -30.512 52.156 1.00 28.36  ? 711  ASN A OD1   1 
ATOM   5815 N  ND2   . ASN A 1 711 ? 12.495  -30.531 54.409 1.00 21.19  ? 711  ASN A ND2   1 
ATOM   5816 N  N     . VAL A 1 712 ? 9.556   -27.695 52.934 1.00 19.93  ? 712  VAL A N     1 
ATOM   5817 C  CA    . VAL A 1 712 ? 8.291   -27.561 53.652 1.00 22.74  ? 712  VAL A CA    1 
ATOM   5818 C  C     . VAL A 1 712 ? 7.622   -28.912 53.937 1.00 25.19  ? 712  VAL A C     1 
ATOM   5819 O  O     . VAL A 1 712 ? 7.560   -29.772 53.058 1.00 22.71  ? 712  VAL A O     1 
ATOM   5820 C  CB    . VAL A 1 712 ? 7.323   -26.602 52.895 1.00 22.46  ? 712  VAL A CB    1 
ATOM   5821 C  CG1   . VAL A 1 712 ? 5.942   -26.548 53.560 1.00 22.12  ? 712  VAL A CG1   1 
ATOM   5822 C  CG2   . VAL A 1 712 ? 7.930   -25.212 52.803 1.00 18.06  ? 712  VAL A CG2   1 
ATOM   5823 N  N     . TRP A 1 713 ? 7.129   -29.071 55.172 1.00 26.88  ? 713  TRP A N     1 
ATOM   5824 C  CA    . TRP A 1 713 ? 6.432   -30.283 55.630 1.00 28.08  ? 713  TRP A CA    1 
ATOM   5825 C  C     . TRP A 1 713 ? 4.924   -30.108 55.791 1.00 29.81  ? 713  TRP A C     1 
ATOM   5826 O  O     . TRP A 1 713 ? 4.170   -31.083 55.701 1.00 30.74  ? 713  TRP A O     1 
ATOM   5827 C  CB    . TRP A 1 713 ? 7.005   -30.745 56.962 1.00 29.82  ? 713  TRP A CB    1 
ATOM   5828 C  CG    . TRP A 1 713 ? 8.437   -31.048 56.892 1.00 27.70  ? 713  TRP A CG    1 
ATOM   5829 C  CD1   . TRP A 1 713 ? 9.469   -30.189 57.133 1.00 29.70  ? 713  TRP A CD1   1 
ATOM   5830 C  CD2   . TRP A 1 713 ? 9.021   -32.297 56.534 1.00 28.44  ? 713  TRP A CD2   1 
ATOM   5831 N  NE1   . TRP A 1 713 ? 10.672  -30.832 56.955 1.00 28.65  ? 713  TRP A NE1   1 
ATOM   5832 C  CE2   . TRP A 1 713 ? 10.428  -32.130 56.587 1.00 29.37  ? 713  TRP A CE2   1 
ATOM   5833 C  CE3   . TRP A 1 713 ? 8.497   -33.551 56.183 1.00 27.07  ? 713  TRP A CE3   1 
ATOM   5834 C  CZ2   . TRP A 1 713 ? 11.321  -33.171 56.301 1.00 28.66  ? 713  TRP A CZ2   1 
ATOM   5835 C  CZ3   . TRP A 1 713 ? 9.381   -34.585 55.892 1.00 29.61  ? 713  TRP A CZ3   1 
ATOM   5836 C  CH2   . TRP A 1 713 ? 10.784  -34.385 55.950 1.00 31.13  ? 713  TRP A CH2   1 
ATOM   5837 N  N     . ASP A 1 714 ? 4.493   -28.872 56.049 1.00 30.29  ? 714  ASP A N     1 
ATOM   5838 C  CA    . ASP A 1 714 ? 3.075   -28.547 56.188 1.00 29.18  ? 714  ASP A CA    1 
ATOM   5839 C  C     . ASP A 1 714 ? 2.790   -27.153 55.644 1.00 28.06  ? 714  ASP A C     1 
ATOM   5840 O  O     . ASP A 1 714 ? 3.469   -26.189 55.998 1.00 28.55  ? 714  ASP A O     1 
ATOM   5841 C  CB    . ASP A 1 714 ? 2.636   -28.639 57.652 1.00 29.29  ? 714  ASP A CB    1 
ATOM   5842 C  CG    . ASP A 1 714 ? 1.116   -28.639 57.814 1.00 34.09  ? 714  ASP A CG    1 
ATOM   5843 O  OD1   . ASP A 1 714 ? 0.442   -27.643 57.455 1.00 31.63  ? 714  ASP A OD1   1 
ATOM   5844 O  OD2   . ASP A 1 714 ? 0.590   -29.653 58.305 1.00 38.83  ? 714  ASP A OD2   1 
ATOM   5845 N  N     . MET A 1 715 ? 1.780   -27.054 54.789 1.00 27.42  ? 715  MET A N     1 
ATOM   5846 C  CA    . MET A 1 715 ? 1.435   -25.794 54.129 1.00 29.55  ? 715  MET A CA    1 
ATOM   5847 C  C     . MET A 1 715 ? -0.054  -25.506 54.250 1.00 30.27  ? 715  MET A C     1 
ATOM   5848 O  O     . MET A 1 715 ? -0.861  -26.215 53.651 1.00 32.54  ? 715  MET A O     1 
ATOM   5849 C  CB    . MET A 1 715 ? 1.822   -25.860 52.656 1.00 29.71  ? 715  MET A CB    1 
ATOM   5850 C  CG    . MET A 1 715 ? 1.567   -24.597 51.863 1.00 34.30  ? 715  MET A CG    1 
ATOM   5851 S  SD    . MET A 1 715 ? 2.713   -23.284 52.305 1.00 43.11  ? 715  MET A SD    1 
ATOM   5852 C  CE    . MET A 1 715 ? 2.629   -22.274 50.817 1.00 50.21  ? 715  MET A CE    1 
ATOM   5853 N  N     . GLU A 1 716 ? -0.399  -24.467 55.018 1.00 29.79  ? 716  GLU A N     1 
ATOM   5854 C  CA    . GLU A 1 716 ? -1.801  -24.057 55.303 1.00 30.45  ? 716  GLU A CA    1 
ATOM   5855 C  C     . GLU A 1 716 ? -2.706  -25.197 55.787 1.00 30.32  ? 716  GLU A C     1 
ATOM   5856 O  O     . GLU A 1 716 ? -3.901  -25.206 55.503 1.00 32.01  ? 716  GLU A O     1 
ATOM   5857 C  CB    . GLU A 1 716 ? -2.453  -23.342 54.106 1.00 27.44  ? 716  GLU A CB    1 
ATOM   5858 C  CG    . GLU A 1 716 ? -1.802  -22.022 53.728 1.00 36.45  ? 716  GLU A CG    1 
ATOM   5859 C  CD    . GLU A 1 716 ? -2.575  -21.273 52.662 1.00 41.12  ? 716  GLU A CD    1 
ATOM   5860 O  OE1   . GLU A 1 716 ? -3.152  -20.215 52.982 1.00 45.98  ? 716  GLU A OE1   1 
ATOM   5861 O  OE2   . GLU A 1 716 ? -2.622  -21.749 51.508 1.00 44.86  ? 716  GLU A OE2   1 
ATOM   5862 N  N     . GLY A 1 717 ? -2.137  -26.153 56.511 1.00 30.59  ? 717  GLY A N     1 
ATOM   5863 C  CA    . GLY A 1 717 ? -2.912  -27.269 57.027 1.00 28.78  ? 717  GLY A CA    1 
ATOM   5864 C  C     . GLY A 1 717 ? -2.765  -28.549 56.224 1.00 28.94  ? 717  GLY A C     1 
ATOM   5865 O  O     . GLY A 1 717 ? -3.233  -29.600 56.650 1.00 29.77  ? 717  GLY A O     1 
ATOM   5866 N  N     . THR A 1 718 ? -2.115  -28.477 55.067 1.00 27.09  ? 718  THR A N     1 
ATOM   5867 C  CA    . THR A 1 718 ? -1.841  -29.683 54.296 1.00 27.85  ? 718  THR A CA    1 
ATOM   5868 C  C     . THR A 1 718 ? -0.540  -30.323 54.772 1.00 29.19  ? 718  THR A C     1 
ATOM   5869 O  O     . THR A 1 718 ? 0.537   -29.779 54.546 1.00 29.06  ? 718  THR A O     1 
ATOM   5870 C  CB    . THR A 1 718 ? -1.777  -29.386 52.777 1.00 26.88  ? 718  THR A CB    1 
ATOM   5871 O  OG1   . THR A 1 718 ? -3.043  -28.887 52.330 1.00 29.83  ? 718  THR A OG1   1 
ATOM   5872 C  CG2   . THR A 1 718 ? -1.430  -30.636 51.986 1.00 25.44  ? 718  THR A CG2   1 
ATOM   5873 N  N     . ARG A 1 719 ? -0.643  -31.467 55.446 1.00 32.39  ? 719  ARG A N     1 
ATOM   5874 C  CA    . ARG A 1 719 ? 0.547   -32.232 55.833 1.00 31.98  ? 719  ARG A CA    1 
ATOM   5875 C  C     . ARG A 1 719 ? 0.947   -33.142 54.679 1.00 30.99  ? 719  ARG A C     1 
ATOM   5876 O  O     . ARG A 1 719 ? 0.265   -34.131 54.393 1.00 32.23  ? 719  ARG A O     1 
ATOM   5877 C  CB    . ARG A 1 719 ? 0.296   -33.050 57.112 1.00 33.07  ? 719  ARG A CB    1 
ATOM   5878 C  CG    . ARG A 1 719 ? 1.535   -33.814 57.654 1.00 33.52  ? 719  ARG A CG    1 
ATOM   5879 C  CD    . ARG A 1 719 ? 2.526   -32.895 58.360 1.00 30.21  ? 719  ARG A CD    1 
ATOM   5880 N  NE    . ARG A 1 719 ? 1.849   -32.067 59.360 1.00 34.03  ? 719  ARG A NE    1 
ATOM   5881 C  CZ    . ARG A 1 719 ? 1.760   -32.347 60.657 1.00 33.96  ? 719  ARG A CZ    1 
ATOM   5882 N  NH1   . ARG A 1 719 ? 2.324   -33.440 61.162 1.00 36.77  ? 719  ARG A NH1   1 
ATOM   5883 N  NH2   . ARG A 1 719 ? 1.110   -31.516 61.458 1.00 34.13  ? 719  ARG A NH2   1 
ATOM   5884 N  N     . TYR A 1 720 ? 2.043   -32.799 54.013 1.00 29.85  ? 720  TYR A N     1 
ATOM   5885 C  CA    . TYR A 1 720 ? 2.495   -33.548 52.844 1.00 31.68  ? 720  TYR A CA    1 
ATOM   5886 C  C     . TYR A 1 720 ? 2.935   -34.948 53.214 1.00 33.67  ? 720  TYR A C     1 
ATOM   5887 O  O     . TYR A 1 720 ? 3.521   -35.157 54.278 1.00 32.68  ? 720  TYR A O     1 
ATOM   5888 C  CB    . TYR A 1 720 ? 3.676   -32.861 52.166 1.00 31.41  ? 720  TYR A CB    1 
ATOM   5889 C  CG    . TYR A 1 720 ? 3.428   -31.464 51.653 1.00 33.41  ? 720  TYR A CG    1 
ATOM   5890 C  CD1   . TYR A 1 720 ? 2.352   -31.178 50.806 1.00 34.34  ? 720  TYR A CD1   1 
ATOM   5891 C  CD2   . TYR A 1 720 ? 4.313   -30.432 51.971 1.00 33.58  ? 720  TYR A CD2   1 
ATOM   5892 C  CE1   . TYR A 1 720 ? 2.141   -29.879 50.328 1.00 39.69  ? 720  TYR A CE1   1 
ATOM   5893 C  CE2   . TYR A 1 720 ? 4.116   -29.142 51.500 1.00 37.07  ? 720  TYR A CE2   1 
ATOM   5894 C  CZ    . TYR A 1 720 ? 3.036   -28.871 50.684 1.00 39.75  ? 720  TYR A CZ    1 
ATOM   5895 O  OH    . TYR A 1 720 ? 2.868   -27.593 50.221 1.00 44.24  ? 720  TYR A OH    1 
ATOM   5896 N  N     . ALA A 1 721 ? 2.650   -35.897 52.321 1.00 36.20  ? 721  ALA A N     1 
ATOM   5897 C  CA    . ALA A 1 721 ? 3.209   -37.248 52.403 1.00 36.26  ? 721  ALA A CA    1 
ATOM   5898 C  C     . ALA A 1 721 ? 4.729   -37.178 52.274 1.00 36.73  ? 721  ALA A C     1 
ATOM   5899 O  O     . ALA A 1 721 ? 5.446   -37.835 53.026 1.00 37.38  ? 721  ALA A O     1 
ATOM   5900 C  CB    . ALA A 1 721 ? 2.610   -38.144 51.323 1.00 34.82  ? 721  ALA A CB    1 
ATOM   5901 N  N     . GLU A 1 722 ? 5.203   -36.361 51.330 1.00 38.12  ? 722  GLU A N     1 
ATOM   5902 C  CA    . GLU A 1 722 ? 6.636   -36.107 51.134 1.00 40.16  ? 722  GLU A CA    1 
ATOM   5903 C  C     . GLU A 1 722 ? 6.958   -34.612 51.217 1.00 36.82  ? 722  GLU A C     1 
ATOM   5904 O  O     . GLU A 1 722 ? 6.179   -33.786 50.731 1.00 36.37  ? 722  GLU A O     1 
ATOM   5905 C  CB    . GLU A 1 722 ? 7.106   -36.656 49.774 1.00 42.45  ? 722  GLU A CB    1 
ATOM   5906 C  CG    . GLU A 1 722 ? 6.925   -38.167 49.594 1.00 49.96  ? 722  GLU A CG    1 
ATOM   5907 C  CD    . GLU A 1 722 ? 7.910   -39.006 50.410 1.00 54.55  ? 722  GLU A CD    1 
ATOM   5908 O  OE1   . GLU A 1 722 ? 9.116   -38.665 50.463 1.00 58.31  ? 722  GLU A OE1   1 
ATOM   5909 O  OE2   . GLU A 1 722 ? 7.474   -40.022 50.987 1.00 55.51  ? 722  GLU A OE2   1 
ATOM   5910 N  N     . PRO A 1 723 ? 8.118   -34.252 51.804 1.00 35.71  ? 723  PRO A N     1 
ATOM   5911 C  CA    . PRO A 1 723 ? 8.443   -32.821 51.882 1.00 33.66  ? 723  PRO A CA    1 
ATOM   5912 C  C     . PRO A 1 723 ? 8.391   -32.179 50.498 1.00 33.33  ? 723  PRO A C     1 
ATOM   5913 O  O     . PRO A 1 723 ? 8.719   -32.834 49.504 1.00 33.47  ? 723  PRO A O     1 
ATOM   5914 C  CB    . PRO A 1 723 ? 9.876   -32.808 52.429 1.00 32.65  ? 723  PRO A CB    1 
ATOM   5915 C  CG    . PRO A 1 723 ? 10.410  -34.187 52.178 1.00 33.21  ? 723  PRO A CG    1 
ATOM   5916 C  CD    . PRO A 1 723 ? 9.227   -35.094 52.296 1.00 35.54  ? 723  PRO A CD    1 
ATOM   5917 N  N     . LYS A 1 724 ? 7.965   -30.922 50.433 1.00 32.36  ? 724  LYS A N     1 
ATOM   5918 C  CA    . LYS A 1 724 ? 7.894   -30.199 49.161 1.00 33.89  ? 724  LYS A CA    1 
ATOM   5919 C  C     . LYS A 1 724 ? 8.707   -28.908 49.238 1.00 32.16  ? 724  LYS A C     1 
ATOM   5920 O  O     . LYS A 1 724 ? 8.649   -28.191 50.229 1.00 33.55  ? 724  LYS A O     1 
ATOM   5921 C  CB    . LYS A 1 724 ? 6.435   -29.917 48.797 1.00 35.05  ? 724  LYS A CB    1 
ATOM   5922 C  CG    . LYS A 1 724 ? 6.199   -29.239 47.445 1.00 40.34  ? 724  LYS A CG    1 
ATOM   5923 C  CD    . LYS A 1 724 ? 4.702   -28.972 47.250 1.00 48.52  ? 724  LYS A CD    1 
ATOM   5924 C  CE    . LYS A 1 724 ? 4.429   -27.929 46.180 1.00 52.71  ? 724  LYS A CE    1 
ATOM   5925 N  NZ    . LYS A 1 724 ? 4.505   -28.505 44.813 1.00 58.08  ? 724  LYS A NZ    1 
ATOM   5926 N  N     . LEU A 1 725 ? 9.473   -28.611 48.198 1.00 30.27  ? 725  LEU A N     1 
ATOM   5927 C  CA    . LEU A 1 725 ? 10.306  -27.418 48.237 1.00 30.30  ? 725  LEU A CA    1 
ATOM   5928 C  C     . LEU A 1 725 ? 9.476   -26.170 47.972 1.00 28.19  ? 725  LEU A C     1 
ATOM   5929 O  O     . LEU A 1 725 ? 8.672   -26.152 47.043 1.00 27.31  ? 725  LEU A O     1 
ATOM   5930 C  CB    . LEU A 1 725 ? 11.458  -27.522 47.232 1.00 28.42  ? 725  LEU A CB    1 
ATOM   5931 C  CG    . LEU A 1 725 ? 12.451  -28.664 47.450 1.00 30.19  ? 725  LEU A CG    1 
ATOM   5932 C  CD1   . LEU A 1 725 ? 13.560  -28.577 46.424 1.00 31.94  ? 725  LEU A CD1   1 
ATOM   5933 C  CD2   . LEU A 1 725 ? 13.033  -28.664 48.855 1.00 26.18  ? 725  LEU A CD2   1 
ATOM   5934 N  N     . LYS A 1 726 ? 9.640   -25.150 48.814 1.00 25.62  ? 726  LYS A N     1 
ATOM   5935 C  CA    . LYS A 1 726 ? 9.077   -23.838 48.508 1.00 25.52  ? 726  LYS A CA    1 
ATOM   5936 C  C     . LYS A 1 726 ? 10.207  -22.901 48.084 1.00 25.10  ? 726  LYS A C     1 
ATOM   5937 O  O     . LYS A 1 726 ? 10.958  -22.392 48.917 1.00 23.18  ? 726  LYS A O     1 
ATOM   5938 C  CB    . LYS A 1 726 ? 8.287   -23.240 49.678 1.00 22.87  ? 726  LYS A CB    1 
ATOM   5939 C  CG    . LYS A 1 726 ? 7.416   -22.073 49.234 1.00 26.15  ? 726  LYS A CG    1 
ATOM   5940 C  CD    . LYS A 1 726 ? 7.077   -21.060 50.331 1.00 27.55  ? 726  LYS A CD    1 
ATOM   5941 C  CE    . LYS A 1 726 ? 6.166   -19.948 49.757 1.00 30.97  ? 726  LYS A CE    1 
ATOM   5942 N  NZ    . LYS A 1 726 ? 5.929   -18.783 50.679 1.00 31.84  ? 726  LYS A NZ    1 
ATOM   5943 N  N     . ILE A 1 727 ? 10.324  -22.702 46.779 1.00 23.60  ? 727  ILE A N     1 
ATOM   5944 C  CA    . ILE A 1 727 ? 11.334  -21.826 46.217 1.00 23.96  ? 727  ILE A CA    1 
ATOM   5945 C  C     . ILE A 1 727 ? 10.678  -20.589 45.622 1.00 23.92  ? 727  ILE A C     1 
ATOM   5946 O  O     . ILE A 1 727 ? 9.795   -20.702 44.776 1.00 21.75  ? 727  ILE A O     1 
ATOM   5947 C  CB    . ILE A 1 727 ? 12.121  -22.515 45.089 1.00 23.83  ? 727  ILE A CB    1 
ATOM   5948 C  CG1   . ILE A 1 727 ? 12.807  -23.795 45.580 1.00 23.99  ? 727  ILE A CG1   1 
ATOM   5949 C  CG2   . ILE A 1 727 ? 13.143  -21.556 44.515 1.00 24.79  ? 727  ILE A CG2   1 
ATOM   5950 C  CD1   . ILE A 1 727 ? 13.410  -24.626 44.450 1.00 18.53  ? 727  ILE A CD1   1 
ATOM   5951 N  N     . MET A 1 728 ? 11.130  -19.412 46.045 1.00 23.11  ? 728  MET A N     1 
ATOM   5952 C  CA    . MET A 1 728 ? 10.654  -18.171 45.455 1.00 23.13  ? 728  MET A CA    1 
ATOM   5953 C  C     . MET A 1 728 ? 11.792  -17.358 44.859 1.00 22.55  ? 728  MET A C     1 
ATOM   5954 O  O     . MET A 1 728 ? 12.815  -17.137 45.505 1.00 22.38  ? 728  MET A O     1 
ATOM   5955 C  CB    . MET A 1 728 ? 9.886   -17.333 46.483 1.00 25.93  ? 728  MET A CB    1 
ATOM   5956 C  CG    . MET A 1 728 ? 8.643   -18.000 47.107 1.00 29.29  ? 728  MET A CG    1 
ATOM   5957 S  SD    . MET A 1 728 ? 7.483   -18.778 45.956 1.00 35.73  ? 728  MET A SD    1 
ATOM   5958 C  CE    . MET A 1 728 ? 6.562   -17.408 45.292 1.00 33.13  ? 728  MET A CE    1 
ATOM   5959 N  N     . GLY A 1 729 ? 11.616  -16.923 43.616 1.00 23.53  ? 729  GLY A N     1 
ATOM   5960 C  CA    . GLY A 1 729 ? 12.544  -15.978 42.997 1.00 22.03  ? 729  GLY A CA    1 
ATOM   5961 C  C     . GLY A 1 729 ? 13.801  -16.561 42.390 1.00 21.46  ? 729  GLY A C     1 
ATOM   5962 O  O     . GLY A 1 729 ? 14.353  -15.997 41.459 1.00 23.45  ? 729  GLY A O     1 
ATOM   5963 N  N     . LEU A 1 730 ? 14.262  -17.691 42.907 1.00 22.12  ? 730  LEU A N     1 
ATOM   5964 C  CA    . LEU A 1 730 ? 15.497  -18.302 42.415 1.00 22.92  ? 730  LEU A CA    1 
ATOM   5965 C  C     . LEU A 1 730 ? 15.306  -18.849 41.015 1.00 24.21  ? 730  LEU A C     1 
ATOM   5966 O  O     . LEU A 1 730 ? 14.175  -19.151 40.603 1.00 24.18  ? 730  LEU A O     1 
ATOM   5967 C  CB    . LEU A 1 730 ? 15.982  -19.403 43.359 1.00 20.39  ? 730  LEU A CB    1 
ATOM   5968 C  CG    . LEU A 1 730 ? 15.978  -19.047 44.847 1.00 20.88  ? 730  LEU A CG    1 
ATOM   5969 C  CD1   . LEU A 1 730 ? 16.491  -20.213 45.657 1.00 18.89  ? 730  LEU A CD1   1 
ATOM   5970 C  CD2   . LEU A 1 730 ? 16.785  -17.780 45.134 1.00 19.24  ? 730  LEU A CD2   1 
ATOM   5971 N  N     . GLU A 1 731 ? 16.416  -18.993 40.295 1.00 23.86  ? 731  GLU A N     1 
ATOM   5972 C  CA    . GLU A 1 731 ? 16.394  -19.319 38.863 1.00 24.80  ? 731  GLU A CA    1 
ATOM   5973 C  C     . GLU A 1 731 ? 15.483  -20.479 38.475 1.00 27.02  ? 731  GLU A C     1 
ATOM   5974 O  O     . GLU A 1 731 ? 14.944  -20.487 37.374 1.00 29.48  ? 731  GLU A O     1 
ATOM   5975 C  CB    . GLU A 1 731 ? 17.815  -19.517 38.333 1.00 25.95  ? 731  GLU A CB    1 
ATOM   5976 C  CG    . GLU A 1 731 ? 18.593  -18.191 38.079 1.00 28.47  ? 731  GLU A CG    1 
ATOM   5977 C  CD    . GLU A 1 731 ? 18.996  -17.430 39.361 1.00 30.55  ? 731  GLU A CD    1 
ATOM   5978 O  OE1   . GLU A 1 731 ? 18.799  -17.944 40.487 1.00 33.26  ? 731  GLU A OE1   1 
ATOM   5979 O  OE2   . GLU A 1 731 ? 19.522  -16.305 39.237 1.00 35.69  ? 731  GLU A OE2   1 
ATOM   5980 N  N     . THR A 1 732 ? 15.287  -21.437 39.383 1.00 27.11  ? 732  THR A N     1 
ATOM   5981 C  CA    . THR A 1 732 ? 14.370  -22.559 39.151 1.00 27.53  ? 732  THR A CA    1 
ATOM   5982 C  C     . THR A 1 732 ? 12.921  -22.121 38.920 1.00 27.52  ? 732  THR A C     1 
ATOM   5983 O  O     . THR A 1 732 ? 12.092  -22.909 38.461 1.00 26.25  ? 732  THR A O     1 
ATOM   5984 C  CB    . THR A 1 732 ? 14.352  -23.548 40.340 1.00 30.04  ? 732  THR A CB    1 
ATOM   5985 O  OG1   . THR A 1 732 ? 13.974  -22.864 41.546 1.00 31.89  ? 732  THR A OG1   1 
ATOM   5986 C  CG2   . THR A 1 732 ? 15.690  -24.216 40.530 1.00 26.20  ? 732  THR A CG2   1 
ATOM   5987 N  N     . GLN A 1 733 ? 12.615  -20.874 39.261 1.00 28.73  ? 733  GLN A N     1 
ATOM   5988 C  CA    . GLN A 1 733 ? 11.242  -20.352 39.157 1.00 28.35  ? 733  GLN A CA    1 
ATOM   5989 C  C     . GLN A 1 733 ? 11.054  -19.444 37.952 1.00 29.84  ? 733  GLN A C     1 
ATOM   5990 O  O     . GLN A 1 733 ? 9.933   -19.049 37.652 1.00 32.08  ? 733  GLN A O     1 
ATOM   5991 C  CB    . GLN A 1 733 ? 10.858  -19.579 40.424 1.00 24.71  ? 733  GLN A CB    1 
ATOM   5992 C  CG    . GLN A 1 733 ? 11.101  -20.333 41.724 1.00 27.82  ? 733  GLN A CG    1 
ATOM   5993 C  CD    . GLN A 1 733 ? 10.488  -21.726 41.720 1.00 30.60  ? 733  GLN A CD    1 
ATOM   5994 O  OE1   . GLN A 1 733 ? 11.197  -22.734 41.806 1.00 31.49  ? 733  GLN A OE1   1 
ATOM   5995 N  NE2   . GLN A 1 733 ? 9.163   -21.789 41.592 1.00 27.33  ? 733  GLN A NE2   1 
ATOM   5996 N  N     . LYS A 1 734 ? 12.157  -19.108 37.288 1.00 28.77  ? 734  LYS A N     1 
ATOM   5997 C  CA    . LYS A 1 734 ? 12.168  -18.155 36.194 1.00 31.03  ? 734  LYS A CA    1 
ATOM   5998 C  C     . LYS A 1 734 ? 12.061  -18.891 34.873 1.00 33.18  ? 734  LYS A C     1 
ATOM   5999 O  O     . LYS A 1 734 ? 12.786  -19.881 34.630 1.00 31.75  ? 734  LYS A O     1 
ATOM   6000 C  CB    . LYS A 1 734 ? 13.483  -17.368 36.182 1.00 36.06  ? 734  LYS A CB    1 
ATOM   6001 C  CG    . LYS A 1 734 ? 13.742  -16.476 37.397 1.00 39.84  ? 734  LYS A CG    1 
ATOM   6002 C  CD    . LYS A 1 734 ? 14.825  -15.436 37.083 1.00 45.63  ? 734  LYS A CD    1 
ATOM   6003 C  CE    . LYS A 1 734 ? 14.313  -14.374 36.100 1.00 52.19  ? 734  LYS A CE    1 
ATOM   6004 N  NZ    . LYS A 1 734 ? 15.386  -13.607 35.394 1.00 52.27  ? 734  LYS A NZ    1 
ATOM   6005 N  N     . SER A 1 735 ? 11.191  -18.382 34.002 1.00 30.55  ? 735  SER A N     1 
ATOM   6006 C  CA    . SER A 1 735 ? 10.957  -19.009 32.711 1.00 30.23  ? 735  SER A CA    1 
ATOM   6007 C  C     . SER A 1 735 ? 12.142  -18.814 31.753 1.00 30.05  ? 735  SER A C     1 
ATOM   6008 O  O     . SER A 1 735 ? 12.247  -19.510 30.758 1.00 29.00  ? 735  SER A O     1 
ATOM   6009 C  CB    . SER A 1 735 ? 9.645   -18.518 32.094 1.00 29.51  ? 735  SER A CB    1 
ATOM   6010 O  OG    . SER A 1 735 ? 9.739   -17.167 31.682 1.00 36.13  ? 735  SER A OG    1 
ATOM   6011 N  N     . SER A 1 736 ? 13.040  -17.886 32.077 1.00 29.60  ? 736  SER A N     1 
ATOM   6012 C  CA    . SER A 1 736 ? 14.210  -17.633 31.249 1.00 31.42  ? 736  SER A CA    1 
ATOM   6013 C  C     . SER A 1 736 ? 15.346  -18.636 31.464 1.00 30.73  ? 736  SER A C     1 
ATOM   6014 O  O     . SER A 1 736 ? 16.208  -18.785 30.599 1.00 33.66  ? 736  SER A O     1 
ATOM   6015 C  CB    . SER A 1 736 ? 14.703  -16.198 31.420 1.00 31.58  ? 736  SER A CB    1 
ATOM   6016 O  OG    . SER A 1 736 ? 14.461  -15.740 32.730 1.00 41.64  ? 736  SER A OG    1 
ATOM   6017 N  N     . THR A 1 737 ? 15.332  -19.323 32.601 1.00 29.86  ? 737  THR A N     1 
ATOM   6018 C  CA    . THR A 1 737 ? 16.315  -20.363 32.930 1.00 30.02  ? 737  THR A CA    1 
ATOM   6019 C  C     . THR A 1 737 ? 15.997  -21.645 32.154 1.00 30.85  ? 737  THR A C     1 
ATOM   6020 O  O     . THR A 1 737 ? 14.840  -22.068 32.125 1.00 33.73  ? 737  THR A O     1 
ATOM   6021 C  CB    . THR A 1 737 ? 16.312  -20.663 34.453 1.00 29.49  ? 737  THR A CB    1 
ATOM   6022 O  OG1   . THR A 1 737 ? 16.757  -19.509 35.178 1.00 28.12  ? 737  THR A OG1   1 
ATOM   6023 C  CG2   . THR A 1 737 ? 17.218  -21.828 34.795 1.00 33.98  ? 737  THR A CG2   1 
ATOM   6024 N  N     . PRO A 1 738 ? 17.015  -22.271 31.530 1.00 21.03  ? 738  PRO A N     1 
ATOM   6025 C  CA    . PRO A 1 738 ? 16.776  -23.450 30.711 1.00 21.85  ? 738  PRO A CA    1 
ATOM   6026 C  C     . PRO A 1 738 ? 16.196  -24.612 31.517 1.00 23.95  ? 738  PRO A C     1 
ATOM   6027 O  O     . PRO A 1 738 ? 16.589  -24.829 32.669 1.00 24.77  ? 738  PRO A O     1 
ATOM   6028 C  CB    . PRO A 1 738 ? 18.177  -23.814 30.187 1.00 23.82  ? 738  PRO A CB    1 
ATOM   6029 C  CG    . PRO A 1 738 ? 19.023  -22.589 30.382 1.00 21.14  ? 738  PRO A CG    1 
ATOM   6030 C  CD    . PRO A 1 738 ? 18.449  -21.917 31.583 1.00 24.11  ? 738  PRO A CD    1 
ATOM   6031 N  N     . LYS A 1 739 ? 15.283  -25.353 30.889 1.00 25.65  ? 739  LYS A N     1 
ATOM   6032 C  CA    . LYS A 1 739 ? 14.581  -26.484 31.498 1.00 26.93  ? 739  LYS A CA    1 
ATOM   6033 C  C     . LYS A 1 739 ? 15.451  -27.417 32.310 1.00 25.90  ? 739  LYS A C     1 
ATOM   6034 O  O     . LYS A 1 739 ? 15.141  -27.701 33.453 1.00 27.03  ? 739  LYS A O     1 
ATOM   6035 C  CB    . LYS A 1 739 ? 13.828  -27.293 30.430 1.00 30.88  ? 739  LYS A CB    1 
ATOM   6036 C  CG    . LYS A 1 739 ? 12.417  -26.814 30.175 1.00 42.17  ? 739  LYS A CG    1 
ATOM   6037 C  CD    . LYS A 1 739 ? 11.381  -27.561 31.037 1.00 49.51  ? 739  LYS A CD    1 
ATOM   6038 C  CE    . LYS A 1 739 ? 10.562  -26.610 31.950 1.00 52.26  ? 739  LYS A CE    1 
ATOM   6039 N  NZ    . LYS A 1 739 ? 10.534  -25.159 31.543 1.00 51.14  ? 739  LYS A NZ    1 
ATOM   6040 N  N     . ALA A 1 740 ? 16.531  -27.905 31.709 1.00 28.59  ? 740  ALA A N     1 
ATOM   6041 C  CA    . ALA A 1 740 ? 17.401  -28.889 32.357 1.00 28.75  ? 740  ALA A CA    1 
ATOM   6042 C  C     . ALA A 1 740 ? 18.211  -28.264 33.485 1.00 28.10  ? 740  ALA A C     1 
ATOM   6043 O  O     . ALA A 1 740 ? 18.647  -28.959 34.399 1.00 33.00  ? 740  ALA A O     1 
ATOM   6044 C  CB    . ALA A 1 740 ? 18.314  -29.538 31.339 1.00 26.66  ? 740  ALA A CB    1 
ATOM   6045 N  N     . VAL A 1 741 ? 18.406  -26.952 33.420 1.00 27.01  ? 741  VAL A N     1 
ATOM   6046 C  CA    . VAL A 1 741 ? 19.109  -26.230 34.475 1.00 25.56  ? 741  VAL A CA    1 
ATOM   6047 C  C     . VAL A 1 741 ? 18.169  -25.940 35.655 1.00 26.62  ? 741  VAL A C     1 
ATOM   6048 O  O     . VAL A 1 741 ? 18.594  -25.982 36.809 1.00 23.61  ? 741  VAL A O     1 
ATOM   6049 C  CB    . VAL A 1 741 ? 19.723  -24.919 33.953 1.00 26.10  ? 741  VAL A CB    1 
ATOM   6050 C  CG1   . VAL A 1 741 ? 20.258  -24.061 35.102 1.00 25.56  ? 741  VAL A CG1   1 
ATOM   6051 C  CG2   . VAL A 1 741 ? 20.809  -25.206 32.917 1.00 26.46  ? 741  VAL A CG2   1 
ATOM   6052 N  N     . GLN A 1 742 ? 16.900  -25.645 35.372 1.00 24.55  ? 742  GLN A N     1 
ATOM   6053 C  CA    . GLN A 1 742 ? 15.929  -25.505 36.445 1.00 27.47  ? 742  GLN A CA    1 
ATOM   6054 C  C     . GLN A 1 742 ? 15.973  -26.788 37.253 1.00 27.67  ? 742  GLN A C     1 
ATOM   6055 O  O     . GLN A 1 742 ? 16.195  -26.773 38.469 1.00 27.75  ? 742  GLN A O     1 
ATOM   6056 C  CB    . GLN A 1 742 ? 14.505  -25.318 35.906 1.00 27.78  ? 742  GLN A CB    1 
ATOM   6057 C  CG    . GLN A 1 742 ? 14.244  -24.035 35.138 1.00 26.18  ? 742  GLN A CG    1 
ATOM   6058 C  CD    . GLN A 1 742 ? 12.833  -23.999 34.588 1.00 23.66  ? 742  GLN A CD    1 
ATOM   6059 O  OE1   . GLN A 1 742 ? 12.245  -25.036 34.294 1.00 28.83  ? 742  GLN A OE1   1 
ATOM   6060 N  NE2   . GLN A 1 742 ? 12.281  -22.814 34.463 1.00 17.27  ? 742  GLN A NE2   1 
ATOM   6061 N  N     . LYS A 1 743 ? 15.775  -27.895 36.545 1.00 27.69  ? 743  LYS A N     1 
ATOM   6062 C  CA    . LYS A 1 743 ? 15.772  -29.220 37.124 1.00 29.99  ? 743  LYS A CA    1 
ATOM   6063 C  C     . LYS A 1 743 ? 17.042  -29.454 37.942 1.00 27.90  ? 743  LYS A C     1 
ATOM   6064 O  O     . LYS A 1 743 ? 16.971  -29.891 39.094 1.00 30.86  ? 743  LYS A O     1 
ATOM   6065 C  CB    . LYS A 1 743 ? 15.618  -30.258 36.009 1.00 32.25  ? 743  LYS A CB    1 
ATOM   6066 C  CG    . LYS A 1 743 ? 15.257  -31.668 36.468 1.00 35.10  ? 743  LYS A CG    1 
ATOM   6067 C  CD    . LYS A 1 743 ? 14.930  -32.529 35.250 1.00 41.71  ? 743  LYS A CD    1 
ATOM   6068 C  CE    . LYS A 1 743 ? 15.334  -33.986 35.446 1.00 46.05  ? 743  LYS A CE    1 
ATOM   6069 N  NZ    . LYS A 1 743 ? 14.559  -34.662 36.529 1.00 45.00  ? 743  LYS A NZ    1 
ATOM   6070 N  N     . ALA A 1 744 ? 18.190  -29.117 37.366 1.00 26.40  ? 744  ALA A N     1 
ATOM   6071 C  CA    . ALA A 1 744 ? 19.479  -29.348 38.026 1.00 24.60  ? 744  ALA A CA    1 
ATOM   6072 C  C     . ALA A 1 744 ? 19.652  -28.504 39.276 1.00 21.27  ? 744  ALA A C     1 
ATOM   6073 O  O     . ALA A 1 744 ? 20.097  -29.001 40.325 1.00 19.87  ? 744  ALA A O     1 
ATOM   6074 C  CB    . ALA A 1 744 ? 20.605  -29.092 37.070 1.00 24.17  ? 744  ALA A CB    1 
ATOM   6075 N  N     . LEU A 1 745 ? 19.297  -27.229 39.163 1.00 21.19  ? 745  LEU A N     1 
ATOM   6076 C  CA    . LEU A 1 745 ? 19.373  -26.304 40.300 1.00 23.05  ? 745  LEU A CA    1 
ATOM   6077 C  C     . LEU A 1 745 ? 18.432  -26.734 41.423 1.00 22.77  ? 745  LEU A C     1 
ATOM   6078 O  O     . LEU A 1 745 ? 18.800  -26.693 42.604 1.00 24.23  ? 745  LEU A O     1 
ATOM   6079 C  CB    . LEU A 1 745 ? 19.077  -24.857 39.872 1.00 21.44  ? 745  LEU A CB    1 
ATOM   6080 C  CG    . LEU A 1 745 ? 20.154  -24.114 39.072 1.00 25.74  ? 745  LEU A CG    1 
ATOM   6081 C  CD1   . LEU A 1 745 ? 19.643  -22.749 38.636 1.00 21.00  ? 745  LEU A CD1   1 
ATOM   6082 C  CD2   . LEU A 1 745 ? 21.467  -23.976 39.858 1.00 24.56  ? 745  LEU A CD2   1 
ATOM   6083 N  N     . LYS A 1 746 ? 17.237  -27.176 41.051 1.00 19.64  ? 746  LYS A N     1 
ATOM   6084 C  CA    . LYS A 1 746 ? 16.272  -27.606 42.028 1.00 22.49  ? 746  LYS A CA    1 
ATOM   6085 C  C     . LYS A 1 746 ? 16.837  -28.784 42.800 1.00 25.82  ? 746  LYS A C     1 
ATOM   6086 O  O     . LYS A 1 746 ? 16.826  -28.789 44.037 1.00 30.08  ? 746  LYS A O     1 
ATOM   6087 C  CB    . LYS A 1 746 ? 14.943  -27.953 41.364 1.00 22.92  ? 746  LYS A CB    1 
ATOM   6088 C  CG    . LYS A 1 746 ? 13.885  -28.350 42.344 1.00 23.21  ? 746  LYS A CG    1 
ATOM   6089 C  CD    . LYS A 1 746 ? 12.540  -28.571 41.677 1.00 30.30  ? 746  LYS A CD    1 
ATOM   6090 C  CE    . LYS A 1 746 ? 11.436  -28.555 42.726 1.00 32.29  ? 746  LYS A CE    1 
ATOM   6091 N  NZ    . LYS A 1 746 ? 10.283  -29.408 42.347 1.00 39.48  ? 746  LYS A NZ    1 
ATOM   6092 N  N     . GLU A 1 747 ? 17.366  -29.767 42.082 1.00 26.54  ? 747  GLU A N     1 
ATOM   6093 C  CA    . GLU A 1 747 ? 17.960  -30.926 42.745 1.00 29.08  ? 747  GLU A CA    1 
ATOM   6094 C  C     . GLU A 1 747 ? 19.134  -30.543 43.656 1.00 28.66  ? 747  GLU A C     1 
ATOM   6095 O  O     . GLU A 1 747 ? 19.306  -31.126 44.734 1.00 30.26  ? 747  GLU A O     1 
ATOM   6096 C  CB    . GLU A 1 747 ? 18.364  -31.996 41.728 1.00 31.27  ? 747  GLU A CB    1 
ATOM   6097 C  CG    . GLU A 1 747 ? 19.080  -33.211 42.332 1.00 33.12  ? 747  GLU A CG    1 
ATOM   6098 C  CD    . GLU A 1 747 ? 18.213  -34.014 43.292 1.00 34.85  ? 747  GLU A CD    1 
ATOM   6099 O  OE1   . GLU A 1 747 ? 18.790  -34.798 44.087 1.00 33.84  ? 747  GLU A OE1   1 
ATOM   6100 O  OE2   . GLU A 1 747 ? 16.969  -33.861 43.250 1.00 30.60  ? 747  GLU A OE2   1 
ATOM   6101 N  N     . CYS A 1 748 ? 19.932  -29.563 43.232 1.00 26.41  ? 748  CYS A N     1 
ATOM   6102 C  CA    . CYS A 1 748 ? 20.942  -28.982 44.118 1.00 24.16  ? 748  CYS A CA    1 
ATOM   6103 C  C     . CYS A 1 748 ? 20.275  -28.438 45.381 1.00 24.35  ? 748  CYS A C     1 
ATOM   6104 O  O     . CYS A 1 748 ? 20.660  -28.796 46.489 1.00 23.33  ? 748  CYS A O     1 
ATOM   6105 C  CB    . CYS A 1 748 ? 21.722  -27.877 43.415 1.00 25.23  ? 748  CYS A CB    1 
ATOM   6106 S  SG    . CYS A 1 748 ? 22.853  -28.466 42.122 1.00 32.61  ? 748  CYS A SG    1 
ATOM   6107 N  N     . ILE A 1 749 ? 19.242  -27.610 45.216 1.00 22.48  ? 749  ILE A N     1 
ATOM   6108 C  CA    . ILE A 1 749 ? 18.567  -27.030 46.365 1.00 21.29  ? 749  ILE A CA    1 
ATOM   6109 C  C     . ILE A 1 749 ? 18.030  -28.155 47.264 1.00 24.21  ? 749  ILE A C     1 
ATOM   6110 O  O     . ILE A 1 749 ? 18.271  -28.152 48.476 1.00 25.82  ? 749  ILE A O     1 
ATOM   6111 C  CB    . ILE A 1 749 ? 17.451  -26.015 45.944 1.00 21.20  ? 749  ILE A CB    1 
ATOM   6112 C  CG1   . ILE A 1 749 ? 18.074  -24.773 45.307 1.00 16.63  ? 749  ILE A CG1   1 
ATOM   6113 C  CG2   . ILE A 1 749 ? 16.582  -25.595 47.139 1.00 13.26  ? 749  ILE A CG2   1 
ATOM   6114 C  CD1   . ILE A 1 749 ? 17.076  -23.890 44.586 1.00 17.19  ? 749  ILE A CD1   1 
ATOM   6115 N  N     . ARG A 1 750 ? 17.350  -29.134 46.664 1.00 23.04  ? 750  ARG A N     1 
ATOM   6116 C  CA    . ARG A 1 750 ? 16.814  -30.257 47.430 1.00 24.71  ? 750  ARG A CA    1 
ATOM   6117 C  C     . ARG A 1 750 ? 17.893  -30.906 48.290 1.00 24.86  ? 750  ARG A C     1 
ATOM   6118 O  O     . ARG A 1 750 ? 17.681  -31.168 49.465 1.00 29.86  ? 750  ARG A O     1 
ATOM   6119 C  CB    . ARG A 1 750 ? 16.154  -31.308 46.530 1.00 24.22  ? 750  ARG A CB    1 
ATOM   6120 C  CG    . ARG A 1 750 ? 15.205  -32.253 47.315 1.00 27.11  ? 750  ARG A CG    1 
ATOM   6121 C  CD    . ARG A 1 750 ? 14.894  -33.558 46.583 1.00 27.90  ? 750  ARG A CD    1 
ATOM   6122 N  NE    . ARG A 1 750 ? 16.115  -34.268 46.198 1.00 35.27  ? 750  ARG A NE    1 
ATOM   6123 C  CZ    . ARG A 1 750 ? 16.837  -35.027 47.020 1.00 33.94  ? 750  ARG A CZ    1 
ATOM   6124 N  NH1   . ARG A 1 750 ? 16.468  -35.197 48.282 1.00 31.98  ? 750  ARG A NH1   1 
ATOM   6125 N  NH2   . ARG A 1 750 ? 17.930  -35.625 46.575 1.00 31.20  ? 750  ARG A NH2   1 
ATOM   6126 N  N     . ARG A 1 751 ? 19.050  -31.148 47.699 1.00 26.92  ? 751  ARG A N     1 
ATOM   6127 C  CA    . ARG A 1 751 ? 20.167  -31.756 48.404 1.00 26.84  ? 751  ARG A CA    1 
ATOM   6128 C  C     . ARG A 1 751 ? 20.693  -30.891 49.546 1.00 27.40  ? 751  ARG A C     1 
ATOM   6129 O  O     . ARG A 1 751 ? 20.930  -31.388 50.651 1.00 28.77  ? 751  ARG A O     1 
ATOM   6130 C  CB    . ARG A 1 751 ? 21.271  -32.115 47.417 1.00 26.19  ? 751  ARG A CB    1 
ATOM   6131 C  CG    . ARG A 1 751 ? 20.956  -33.398 46.683 1.00 24.63  ? 751  ARG A CG    1 
ATOM   6132 C  CD    . ARG A 1 751 ? 21.802  -33.558 45.481 1.00 24.06  ? 751  ARG A CD    1 
ATOM   6133 N  NE    . ARG A 1 751 ? 21.475  -34.807 44.815 1.00 29.54  ? 751  ARG A NE    1 
ATOM   6134 C  CZ    . ARG A 1 751 ? 22.193  -35.923 44.911 1.00 26.02  ? 751  ARG A CZ    1 
ATOM   6135 N  NH1   . ARG A 1 751 ? 23.294  -35.952 45.652 1.00 24.68  ? 751  ARG A NH1   1 
ATOM   6136 N  NH2   . ARG A 1 751 ? 21.799  -37.015 44.274 1.00 19.78  ? 751  ARG A NH2   1 
ATOM   6137 N  N     . MET A 1 752 ? 20.855  -29.599 49.287 1.00 26.97  ? 752  MET A N     1 
ATOM   6138 C  CA    . MET A 1 752 ? 21.241  -28.658 50.334 1.00 27.55  ? 752  MET A CA    1 
ATOM   6139 C  C     . MET A 1 752 ? 20.249  -28.718 51.484 1.00 28.09  ? 752  MET A C     1 
ATOM   6140 O  O     . MET A 1 752 ? 20.646  -28.908 52.632 1.00 28.95  ? 752  MET A O     1 
ATOM   6141 C  CB    . MET A 1 752 ? 21.290  -27.240 49.788 1.00 28.12  ? 752  MET A CB    1 
ATOM   6142 C  CG    . MET A 1 752 ? 22.404  -27.018 48.803 1.00 31.79  ? 752  MET A CG    1 
ATOM   6143 S  SD    . MET A 1 752 ? 22.202  -25.479 47.925 1.00 36.44  ? 752  MET A SD    1 
ATOM   6144 C  CE    . MET A 1 752 ? 22.261  -24.303 49.279 1.00 32.72  ? 752  MET A CE    1 
ATOM   6145 N  N     . LEU A 1 753 ? 18.960  -28.592 51.166 1.00 25.05  ? 753  LEU A N     1 
ATOM   6146 C  CA    . LEU A 1 753 ? 17.941  -28.476 52.205 1.00 26.86  ? 753  LEU A CA    1 
ATOM   6147 C  C     . LEU A 1 753 ? 17.677  -29.762 52.973 1.00 25.61  ? 753  LEU A C     1 
ATOM   6148 O  O     . LEU A 1 753 ? 17.332  -29.707 54.153 1.00 25.62  ? 753  LEU A O     1 
ATOM   6149 C  CB    . LEU A 1 753 ? 16.630  -27.884 51.665 1.00 25.81  ? 753  LEU A CB    1 
ATOM   6150 C  CG    . LEU A 1 753 ? 16.661  -26.505 50.972 1.00 28.28  ? 753  LEU A CG    1 
ATOM   6151 C  CD1   . LEU A 1 753 ? 15.287  -25.869 50.987 1.00 25.01  ? 753  LEU A CD1   1 
ATOM   6152 C  CD2   . LEU A 1 753 ? 17.670  -25.543 51.578 1.00 22.98  ? 753  LEU A CD2   1 
ATOM   6153 N  N     . GLN A 1 754 ? 17.870  -30.910 52.324 1.00 24.90  ? 754  GLN A N     1 
ATOM   6154 C  CA    . GLN A 1 754 ? 17.469  -32.204 52.911 1.00 26.68  ? 754  GLN A CA    1 
ATOM   6155 C  C     . GLN A 1 754 ? 18.609  -33.120 53.317 1.00 27.75  ? 754  GLN A C     1 
ATOM   6156 O  O     . GLN A 1 754 ? 18.422  -33.996 54.157 1.00 27.16  ? 754  GLN A O     1 
ATOM   6157 C  CB    . GLN A 1 754 ? 16.532  -32.976 51.969 1.00 26.49  ? 754  GLN A CB    1 
ATOM   6158 C  CG    . GLN A 1 754 ? 15.234  -32.250 51.630 1.00 27.12  ? 754  GLN A CG    1 
ATOM   6159 C  CD    . GLN A 1 754 ? 14.340  -33.011 50.656 1.00 29.11  ? 754  GLN A CD    1 
ATOM   6160 O  OE1   . GLN A 1 754 ? 14.661  -34.123 50.210 1.00 26.18  ? 754  GLN A OE1   1 
ATOM   6161 N  NE2   . GLN A 1 754 ? 13.195  -32.417 50.336 1.00 25.65  ? 754  GLN A NE2   1 
ATOM   6162 N  N     . GLU A 1 755 ? 19.782  -32.930 52.715 1.00 31.04  ? 755  GLU A N     1 
ATOM   6163 C  CA    . GLU A 1 755 ? 20.840  -33.927 52.795 1.00 31.88  ? 755  GLU A CA    1 
ATOM   6164 C  C     . GLU A 1 755 ? 22.193  -33.365 53.235 1.00 34.57  ? 755  GLU A C     1 
ATOM   6165 O  O     . GLU A 1 755 ? 22.918  -34.024 53.971 1.00 39.39  ? 755  GLU A O     1 
ATOM   6166 C  CB    . GLU A 1 755 ? 20.945  -34.693 51.470 1.00 31.04  ? 755  GLU A CB    1 
ATOM   6167 C  CG    . GLU A 1 755 ? 19.847  -35.754 51.260 1.00 31.83  ? 755  GLU A CG    1 
ATOM   6168 C  CD    . GLU A 1 755 ? 19.726  -36.268 49.812 1.00 35.46  ? 755  GLU A CD    1 
ATOM   6169 O  OE1   . GLU A 1 755 ? 18.612  -36.682 49.429 1.00 36.97  ? 755  GLU A OE1   1 
ATOM   6170 O  OE2   . GLU A 1 755 ? 20.725  -36.269 49.051 1.00 33.30  ? 755  GLU A OE2   1 
ATOM   6171 N  N     . GLY A 1 756 ? 22.536  -32.161 52.792 1.00 35.68  ? 756  GLY A N     1 
ATOM   6172 C  CA    . GLY A 1 756 ? 23.756  -31.491 53.262 1.00 35.98  ? 756  GLY A CA    1 
ATOM   6173 C  C     . GLY A 1 756 ? 24.791  -31.219 52.181 1.00 37.42  ? 756  GLY A C     1 
ATOM   6174 O  O     . GLY A 1 756 ? 24.565  -31.504 51.000 1.00 36.71  ? 756  GLY A O     1 
ATOM   6175 N  N     . GLU A 1 757 ? 25.941  -30.692 52.601 1.00 38.22  ? 757  GLU A N     1 
ATOM   6176 C  CA    . GLU A 1 757 ? 27.008  -30.273 51.690 1.00 37.99  ? 757  GLU A CA    1 
ATOM   6177 C  C     . GLU A 1 757 ? 27.584  -31.414 50.844 1.00 38.13  ? 757  GLU A C     1 
ATOM   6178 O  O     . GLU A 1 757 ? 27.781  -31.263 49.637 1.00 35.73  ? 757  GLU A O     1 
ATOM   6179 C  CB    . GLU A 1 757 ? 28.123  -29.564 52.468 1.00 37.42  ? 757  GLU A CB    1 
ATOM   6180 C  CG    . GLU A 1 757 ? 29.104  -28.773 51.590 1.00 41.90  ? 757  GLU A CG    1 
ATOM   6181 C  CD    . GLU A 1 757 ? 30.168  -28.053 52.402 1.00 44.72  ? 757  GLU A CD    1 
ATOM   6182 O  OE1   . GLU A 1 757 ? 30.782  -28.696 53.273 1.00 48.70  ? 757  GLU A OE1   1 
ATOM   6183 O  OE2   . GLU A 1 757 ? 30.394  -26.848 52.175 1.00 44.70  ? 757  GLU A OE2   1 
ATOM   6184 N  N     . GLU A 1 758 ? 27.857  -32.545 51.482 1.00 40.21  ? 758  GLU A N     1 
ATOM   6185 C  CA    . GLU A 1 758 ? 28.463  -33.674 50.798 1.00 42.07  ? 758  GLU A CA    1 
ATOM   6186 C  C     . GLU A 1 758 ? 27.573  -34.184 49.657 1.00 41.25  ? 758  GLU A C     1 
ATOM   6187 O  O     . GLU A 1 758 ? 28.069  -34.496 48.572 1.00 40.42  ? 758  GLU A O     1 
ATOM   6188 C  CB    . GLU A 1 758 ? 28.777  -34.794 51.796 1.00 45.75  ? 758  GLU A CB    1 
ATOM   6189 C  CG    . GLU A 1 758 ? 29.723  -35.869 51.251 1.00 55.25  ? 758  GLU A CG    1 
ATOM   6190 C  CD    . GLU A 1 758 ? 30.013  -36.964 52.268 1.00 61.76  ? 758  GLU A CD    1 
ATOM   6191 O  OE1   . GLU A 1 758 ? 29.357  -38.029 52.201 1.00 63.43  ? 758  GLU A OE1   1 
ATOM   6192 O  OE2   . GLU A 1 758 ? 30.887  -36.755 53.139 1.00 62.22  ? 758  GLU A OE2   1 
ATOM   6193 N  N     . SER A 1 759 ? 26.262  -34.253 49.895 1.00 39.25  ? 759  SER A N     1 
ATOM   6194 C  CA    . SER A 1 759 ? 25.336  -34.719 48.871 1.00 36.96  ? 759  SER A CA    1 
ATOM   6195 C  C     . SER A 1 759 ? 25.309  -33.765 47.690 1.00 35.87  ? 759  SER A C     1 
ATOM   6196 O  O     . SER A 1 759 ? 25.382  -34.187 46.534 1.00 36.68  ? 759  SER A O     1 
ATOM   6197 C  CB    . SER A 1 759 ? 23.936  -34.882 49.436 1.00 38.90  ? 759  SER A CB    1 
ATOM   6198 O  OG    . SER A 1 759 ? 23.036  -35.282 48.418 1.00 41.58  ? 759  SER A OG    1 
ATOM   6199 N  N     . LEU A 1 760 ? 25.208  -32.478 47.996 1.00 34.36  ? 760  LEU A N     1 
ATOM   6200 C  CA    . LEU A 1 760 ? 25.288  -31.416 47.001 1.00 33.45  ? 760  LEU A CA    1 
ATOM   6201 C  C     . LEU A 1 760 ? 26.561  -31.533 46.157 1.00 33.79  ? 760  LEU A C     1 
ATOM   6202 O  O     . LEU A 1 760 ? 26.494  -31.519 44.927 1.00 34.88  ? 760  LEU A O     1 
ATOM   6203 C  CB    . LEU A 1 760 ? 25.214  -30.057 47.702 1.00 31.32  ? 760  LEU A CB    1 
ATOM   6204 C  CG    . LEU A 1 760 ? 25.037  -28.690 47.013 1.00 33.27  ? 760  LEU A CG    1 
ATOM   6205 C  CD1   . LEU A 1 760 ? 26.255  -27.813 47.229 1.00 28.61  ? 760  LEU A CD1   1 
ATOM   6206 C  CD2   . LEU A 1 760 ? 24.576  -28.695 45.537 1.00 23.54  ? 760  LEU A CD2   1 
ATOM   6207 N  N     . GLN A 1 761 ? 27.709  -31.672 46.811 1.00 33.41  ? 761  GLN A N     1 
ATOM   6208 C  CA    . GLN A 1 761 ? 28.979  -31.750 46.092 1.00 35.42  ? 761  GLN A CA    1 
ATOM   6209 C  C     . GLN A 1 761 ? 28.980  -32.909 45.103 1.00 36.62  ? 761  GLN A C     1 
ATOM   6210 O  O     . GLN A 1 761 ? 29.353  -32.739 43.949 1.00 37.22  ? 761  GLN A O     1 
ATOM   6211 C  CB    . GLN A 1 761 ? 30.161  -31.842 47.066 1.00 34.98  ? 761  GLN A CB    1 
ATOM   6212 C  CG    . GLN A 1 761 ? 30.506  -30.497 47.685 1.00 33.95  ? 761  GLN A CG    1 
ATOM   6213 C  CD    . GLN A 1 761 ? 31.551  -30.553 48.783 1.00 32.77  ? 761  GLN A CD    1 
ATOM   6214 O  OE1   . GLN A 1 761 ? 31.900  -29.518 49.347 1.00 38.79  ? 761  GLN A OE1   1 
ATOM   6215 N  NE2   . GLN A 1 761 ? 32.048  -31.743 49.100 1.00 32.41  ? 761  GLN A NE2   1 
ATOM   6216 N  N     . GLU A 1 762 ? 28.536  -34.072 45.568 1.00 39.35  ? 762  GLU A N     1 
ATOM   6217 C  CA    . GLU A 1 762 ? 28.377  -35.260 44.736 1.00 40.95  ? 762  GLU A CA    1 
ATOM   6218 C  C     . GLU A 1 762 ? 27.552  -34.969 43.475 1.00 39.21  ? 762  GLU A C     1 
ATOM   6219 O  O     . GLU A 1 762 ? 28.002  -35.257 42.369 1.00 42.85  ? 762  GLU A O     1 
ATOM   6220 C  CB    . GLU A 1 762 ? 27.749  -36.394 45.560 1.00 44.04  ? 762  GLU A CB    1 
ATOM   6221 C  CG    . GLU A 1 762 ? 27.455  -37.685 44.792 1.00 51.18  ? 762  GLU A CG    1 
ATOM   6222 C  CD    . GLU A 1 762 ? 26.593  -38.660 45.589 1.00 55.94  ? 762  GLU A CD    1 
ATOM   6223 O  OE1   . GLU A 1 762 ? 25.360  -38.704 45.353 1.00 54.45  ? 762  GLU A OE1   1 
ATOM   6224 O  OE2   . GLU A 1 762 ? 27.151  -39.379 46.452 1.00 58.65  ? 762  GLU A OE2   1 
ATOM   6225 N  N     . TYR A 1 763 ? 26.368  -34.382 43.630 1.00 35.59  ? 763  TYR A N     1 
ATOM   6226 C  CA    . TYR A 1 763 ? 25.505  -34.112 42.476 1.00 32.70  ? 763  TYR A CA    1 
ATOM   6227 C  C     . TYR A 1 763 ? 26.107  -33.123 41.492 1.00 33.48  ? 763  TYR A C     1 
ATOM   6228 O  O     . TYR A 1 763 ? 25.966  -33.296 40.274 1.00 31.50  ? 763  TYR A O     1 
ATOM   6229 C  CB    . TYR A 1 763 ? 24.139  -33.590 42.905 1.00 31.35  ? 763  TYR A CB    1 
ATOM   6230 C  CG    . TYR A 1 763 ? 23.145  -33.526 41.763 1.00 31.02  ? 763  TYR A CG    1 
ATOM   6231 C  CD1   . TYR A 1 763 ? 22.823  -32.314 41.145 1.00 27.30  ? 763  TYR A CD1   1 
ATOM   6232 C  CD2   . TYR A 1 763 ? 22.537  -34.689 41.288 1.00 31.53  ? 763  TYR A CD2   1 
ATOM   6233 C  CE1   . TYR A 1 763 ? 21.915  -32.269 40.090 1.00 30.77  ? 763  TYR A CE1   1 
ATOM   6234 C  CE2   . TYR A 1 763 ? 21.625  -34.654 40.244 1.00 34.48  ? 763  TYR A CE2   1 
ATOM   6235 C  CZ    . TYR A 1 763 ? 21.315  -33.448 39.648 1.00 35.43  ? 763  TYR A CZ    1 
ATOM   6236 O  OH    . TYR A 1 763 ? 20.396  -33.439 38.612 1.00 43.40  ? 763  TYR A OH    1 
ATOM   6237 N  N     . PHE A 1 764 ? 26.757  -32.083 42.023 1.00 33.35  ? 764  PHE A N     1 
ATOM   6238 C  CA    . PHE A 1 764 ? 27.366  -31.058 41.190 1.00 31.80  ? 764  PHE A CA    1 
ATOM   6239 C  C     . PHE A 1 764 ? 28.396  -31.684 40.285 1.00 33.87  ? 764  PHE A C     1 
ATOM   6240 O  O     . PHE A 1 764 ? 28.429  -31.400 39.088 1.00 36.42  ? 764  PHE A O     1 
ATOM   6241 C  CB    . PHE A 1 764 ? 28.027  -29.951 42.015 1.00 30.32  ? 764  PHE A CB    1 
ATOM   6242 C  CG    . PHE A 1 764 ? 28.791  -28.968 41.169 1.00 29.84  ? 764  PHE A CG    1 
ATOM   6243 C  CD1   . PHE A 1 764 ? 28.134  -27.901 40.554 1.00 28.34  ? 764  PHE A CD1   1 
ATOM   6244 C  CD2   . PHE A 1 764 ? 30.154  -29.139 40.931 1.00 24.43  ? 764  PHE A CD2   1 
ATOM   6245 C  CE1   . PHE A 1 764 ? 28.826  -27.003 39.738 1.00 27.91  ? 764  PHE A CE1   1 
ATOM   6246 C  CE2   . PHE A 1 764 ? 30.854  -28.246 40.118 1.00 25.86  ? 764  PHE A CE2   1 
ATOM   6247 C  CZ    . PHE A 1 764 ? 30.191  -27.173 39.521 1.00 23.33  ? 764  PHE A CZ    1 
ATOM   6248 N  N     . LYS A 1 765 ? 29.230  -32.541 40.863 1.00 35.86  ? 765  LYS A N     1 
ATOM   6249 C  CA    . LYS A 1 765 ? 30.293  -33.202 40.113 1.00 38.32  ? 765  LYS A CA    1 
ATOM   6250 C  C     . LYS A 1 765 ? 29.688  -33.974 38.939 1.00 37.15  ? 765  LYS A C     1 
ATOM   6251 O  O     . LYS A 1 765 ? 30.177  -33.889 37.815 1.00 34.98  ? 765  LYS A O     1 
ATOM   6252 C  CB    . LYS A 1 765 ? 31.130  -34.111 41.028 1.00 39.61  ? 765  LYS A CB    1 
ATOM   6253 C  CG    . LYS A 1 765 ? 32.391  -34.668 40.356 1.00 50.17  ? 765  LYS A CG    1 
ATOM   6254 C  CD    . LYS A 1 765 ? 33.315  -35.430 41.331 1.00 53.84  ? 765  LYS A CD    1 
ATOM   6255 C  CE    . LYS A 1 765 ? 34.541  -34.607 41.750 1.00 55.25  ? 765  LYS A CE    1 
ATOM   6256 N  NZ    . LYS A 1 765 ? 35.629  -35.468 42.324 1.00 52.39  ? 765  LYS A NZ    1 
ATOM   6257 N  N     . GLU A 1 766 ? 28.592  -34.685 39.202 1.00 37.78  ? 766  GLU A N     1 
ATOM   6258 C  CA    . GLU A 1 766 ? 27.946  -35.480 38.170 1.00 38.96  ? 766  GLU A CA    1 
ATOM   6259 C  C     . GLU A 1 766 ? 27.387  -34.601 37.055 1.00 37.69  ? 766  GLU A C     1 
ATOM   6260 O  O     . GLU A 1 766 ? 27.573  -34.900 35.871 1.00 39.96  ? 766  GLU A O     1 
ATOM   6261 C  CB    . GLU A 1 766 ? 26.845  -36.361 38.762 1.00 40.61  ? 766  GLU A CB    1 
ATOM   6262 C  CG    . GLU A 1 766 ? 26.483  -37.543 37.882 1.00 44.19  ? 766  GLU A CG    1 
ATOM   6263 C  CD    . GLU A 1 766 ? 27.646  -38.503 37.692 1.00 48.80  ? 766  GLU A CD    1 
ATOM   6264 O  OE1   . GLU A 1 766 ? 28.141  -39.048 38.703 1.00 51.52  ? 766  GLU A OE1   1 
ATOM   6265 O  OE2   . GLU A 1 766 ? 28.068  -38.716 36.532 1.00 53.71  ? 766  GLU A OE2   1 
ATOM   6266 N  N     . PHE A 1 767 ? 26.732  -33.508 37.435 1.00 32.76  ? 767  PHE A N     1 
ATOM   6267 C  CA    . PHE A 1 767 ? 26.057  -32.679 36.463 1.00 30.75  ? 767  PHE A CA    1 
ATOM   6268 C  C     . PHE A 1 767 ? 27.052  -32.076 35.494 1.00 33.23  ? 767  PHE A C     1 
ATOM   6269 O  O     . PHE A 1 767 ? 26.875  -32.173 34.289 1.00 36.08  ? 767  PHE A O     1 
ATOM   6270 C  CB    . PHE A 1 767 ? 25.215  -31.598 37.134 1.00 26.88  ? 767  PHE A CB    1 
ATOM   6271 C  CG    . PHE A 1 767 ? 24.358  -30.835 36.175 1.00 25.14  ? 767  PHE A CG    1 
ATOM   6272 C  CD1   . PHE A 1 767 ? 24.698  -29.544 35.800 1.00 25.68  ? 767  PHE A CD1   1 
ATOM   6273 C  CD2   . PHE A 1 767 ? 23.216  -31.417 35.627 1.00 24.83  ? 767  PHE A CD2   1 
ATOM   6274 C  CE1   . PHE A 1 767 ? 23.906  -28.833 34.900 1.00 26.57  ? 767  PHE A CE1   1 
ATOM   6275 C  CE2   . PHE A 1 767 ? 22.417  -30.717 34.723 1.00 26.07  ? 767  PHE A CE2   1 
ATOM   6276 C  CZ    . PHE A 1 767 ? 22.759  -29.418 34.361 1.00 22.34  ? 767  PHE A CZ    1 
ATOM   6277 N  N     . GLU A 1 768 ? 28.105  -31.468 36.031 1.00 36.01  ? 768  GLU A N     1 
ATOM   6278 C  CA    . GLU A 1 768 ? 29.199  -30.908 35.236 1.00 37.61  ? 768  GLU A CA    1 
ATOM   6279 C  C     . GLU A 1 768 ? 29.829  -31.959 34.311 1.00 38.74  ? 768  GLU A C     1 
ATOM   6280 O  O     . GLU A 1 768 ? 30.284  -31.645 33.218 1.00 38.46  ? 768  GLU A O     1 
ATOM   6281 C  CB    . GLU A 1 768 ? 30.252  -30.316 36.184 1.00 40.47  ? 768  GLU A CB    1 
ATOM   6282 C  CG    . GLU A 1 768 ? 31.488  -29.701 35.523 1.00 45.40  ? 768  GLU A CG    1 
ATOM   6283 C  CD    . GLU A 1 768 ? 32.401  -29.005 36.522 1.00 50.83  ? 768  GLU A CD    1 
ATOM   6284 O  OE1   . GLU A 1 768 ? 32.940  -27.931 36.179 1.00 54.79  ? 768  GLU A OE1   1 
ATOM   6285 O  OE2   . GLU A 1 768 ? 32.585  -29.529 37.648 1.00 54.67  ? 768  GLU A OE2   1 
ATOM   6286 N  N     . LYS A 1 769 ? 29.835  -33.207 34.758 1.00 40.77  ? 769  LYS A N     1 
ATOM   6287 C  CA    . LYS A 1 769 ? 30.430  -34.303 34.008 1.00 44.09  ? 769  LYS A CA    1 
ATOM   6288 C  C     . LYS A 1 769 ? 29.585  -34.699 32.790 1.00 45.71  ? 769  LYS A C     1 
ATOM   6289 O  O     . LYS A 1 769 ? 30.133  -35.037 31.736 1.00 44.34  ? 769  LYS A O     1 
ATOM   6290 C  CB    . LYS A 1 769 ? 30.611  -35.502 34.942 1.00 45.73  ? 769  LYS A CB    1 
ATOM   6291 C  CG    . LYS A 1 769 ? 31.832  -36.346 34.670 1.00 51.27  ? 769  LYS A CG    1 
ATOM   6292 C  CD    . LYS A 1 769 ? 32.636  -36.576 35.957 1.00 54.56  ? 769  LYS A CD    1 
ATOM   6293 C  CE    . LYS A 1 769 ? 32.100  -37.730 36.817 1.00 54.89  ? 769  LYS A CE    1 
ATOM   6294 N  NZ    . LYS A 1 769 ? 33.085  -38.147 37.876 1.00 46.98  ? 769  LYS A NZ    1 
ATOM   6295 N  N     . GLU A 1 770 ? 28.258  -34.637 32.933 1.00 45.00  ? 770  GLU A N     1 
ATOM   6296 C  CA    . GLU A 1 770 ? 27.347  -35.202 31.928 1.00 46.59  ? 770  GLU A CA    1 
ATOM   6297 C  C     . GLU A 1 770 ? 26.567  -34.171 31.116 1.00 48.15  ? 770  GLU A C     1 
ATOM   6298 O  O     . GLU A 1 770 ? 25.924  -34.523 30.119 1.00 50.25  ? 770  GLU A O     1 
ATOM   6299 C  CB    . GLU A 1 770 ? 26.336  -36.163 32.575 1.00 45.01  ? 770  GLU A CB    1 
ATOM   6300 C  CG    . GLU A 1 770 ? 26.918  -37.289 33.413 1.00 46.63  ? 770  GLU A CG    1 
ATOM   6301 C  CD    . GLU A 1 770 ? 27.736  -38.294 32.612 1.00 50.56  ? 770  GLU A CD    1 
ATOM   6302 O  OE1   . GLU A 1 770 ? 28.485  -39.072 33.252 1.00 51.66  ? 770  GLU A OE1   1 
ATOM   6303 O  OE2   . GLU A 1 770 ? 27.636  -38.310 31.361 1.00 47.74  ? 770  GLU A OE2   1 
ATOM   6304 N  N     . PHE A 1 771 ? 26.610  -32.909 31.527 1.00 46.16  ? 771  PHE A N     1 
ATOM   6305 C  CA    . PHE A 1 771 ? 25.661  -31.941 30.985 1.00 46.64  ? 771  PHE A CA    1 
ATOM   6306 C  C     . PHE A 1 771 ? 25.773  -31.689 29.476 1.00 47.44  ? 771  PHE A C     1 
ATOM   6307 O  O     . PHE A 1 771 ? 24.778  -31.358 28.824 1.00 45.23  ? 771  PHE A O     1 
ATOM   6308 C  CB    . PHE A 1 771 ? 25.667  -30.645 31.803 1.00 46.78  ? 771  PHE A CB    1 
ATOM   6309 C  CG    . PHE A 1 771 ? 26.436  -29.529 31.187 1.00 44.47  ? 771  PHE A CG    1 
ATOM   6310 C  CD1   . PHE A 1 771 ? 27.817  -29.495 31.267 1.00 47.37  ? 771  PHE A CD1   1 
ATOM   6311 C  CD2   . PHE A 1 771 ? 25.767  -28.480 30.569 1.00 46.38  ? 771  PHE A CD2   1 
ATOM   6312 C  CE1   . PHE A 1 771 ? 28.527  -28.442 30.711 1.00 47.84  ? 771  PHE A CE1   1 
ATOM   6313 C  CE2   . PHE A 1 771 ? 26.460  -27.428 30.007 1.00 45.75  ? 771  PHE A CE2   1 
ATOM   6314 C  CZ    . PHE A 1 771 ? 27.842  -27.408 30.074 1.00 46.31  ? 771  PHE A CZ    1 
ATOM   6315 N  N     . ARG A 1 772 ? 26.970  -31.871 28.926 1.00 48.32  ? 772  ARG A N     1 
ATOM   6316 C  CA    . ARG A 1 772 ? 27.187  -31.689 27.494 1.00 49.92  ? 772  ARG A CA    1 
ATOM   6317 C  C     . ARG A 1 772 ? 26.349  -32.646 26.652 1.00 51.39  ? 772  ARG A C     1 
ATOM   6318 O  O     . ARG A 1 772 ? 26.170  -32.431 25.452 1.00 54.01  ? 772  ARG A O     1 
ATOM   6319 C  CB    . ARG A 1 772 ? 28.670  -31.804 27.145 1.00 53.41  ? 772  ARG A CB    1 
ATOM   6320 C  CG    . ARG A 1 772 ? 29.495  -30.610 27.612 1.00 56.17  ? 772  ARG A CG    1 
ATOM   6321 C  CD    . ARG A 1 772 ? 30.984  -30.900 27.599 1.00 60.08  ? 772  ARG A CD    1 
ATOM   6322 N  NE    . ARG A 1 772 ? 31.771  -29.725 27.983 1.00 66.25  ? 772  ARG A NE    1 
ATOM   6323 C  CZ    . ARG A 1 772 ? 32.208  -28.784 27.141 1.00 69.42  ? 772  ARG A CZ    1 
ATOM   6324 N  NH1   . ARG A 1 772 ? 31.941  -28.847 25.836 1.00 68.36  ? 772  ARG A NH1   1 
ATOM   6325 N  NH2   . ARG A 1 772 ? 32.916  -27.763 27.610 1.00 70.15  ? 772  ARG A NH2   1 
ATOM   6326 N  N     . GLN A 1 773 ? 25.811  -33.682 27.287 1.00 49.04  ? 773  GLN A N     1 
ATOM   6327 C  CA    . GLN A 1 773 ? 25.003  -34.660 26.576 1.00 49.96  ? 773  GLN A CA    1 
ATOM   6328 C  C     . GLN A 1 773 ? 23.511  -34.336 26.585 1.00 47.44  ? 773  GLN A C     1 
ATOM   6329 O  O     . GLN A 1 773 ? 22.691  -35.099 26.065 1.00 47.66  ? 773  GLN A O     1 
ATOM   6330 C  CB    . GLN A 1 773 ? 25.261  -36.062 27.122 1.00 53.16  ? 773  GLN A CB    1 
ATOM   6331 C  CG    . GLN A 1 773 ? 25.540  -37.061 26.014 1.00 60.68  ? 773  GLN A CG    1 
ATOM   6332 C  CD    . GLN A 1 773 ? 26.733  -36.649 25.153 1.00 62.93  ? 773  GLN A CD    1 
ATOM   6333 O  OE1   . GLN A 1 773 ? 27.838  -36.411 25.662 1.00 62.28  ? 773  GLN A OE1   1 
ATOM   6334 N  NE2   . GLN A 1 773 ? 26.511  -36.554 23.844 1.00 63.87  ? 773  GLN A NE2   1 
ATOM   6335 N  N     . LEU A 1 774 ? 23.162  -33.196 27.165 1.00 44.48  ? 774  LEU A N     1 
ATOM   6336 C  CA    . LEU A 1 774 ? 21.773  -32.777 27.216 1.00 42.26  ? 774  LEU A CA    1 
ATOM   6337 C  C     . LEU A 1 774 ? 21.311  -32.215 25.883 1.00 41.78  ? 774  LEU A C     1 
ATOM   6338 O  O     . LEU A 1 774 ? 22.073  -31.577 25.159 1.00 40.69  ? 774  LEU A O     1 
ATOM   6339 C  CB    . LEU A 1 774 ? 21.552  -31.758 28.329 1.00 40.76  ? 774  LEU A CB    1 
ATOM   6340 C  CG    . LEU A 1 774 ? 21.684  -32.303 29.754 1.00 43.78  ? 774  LEU A CG    1 
ATOM   6341 C  CD1   . LEU A 1 774 ? 22.095  -31.206 30.712 1.00 44.08  ? 774  LEU A CD1   1 
ATOM   6342 C  CD2   . LEU A 1 774 ? 20.386  -32.959 30.213 1.00 46.28  ? 774  LEU A CD2   1 
ATOM   6343 N  N     . ASN A 1 775 ? 20.050  -32.475 25.568 1.00 41.87  ? 775  ASN A N     1 
ATOM   6344 C  CA    . ASN A 1 775 ? 19.427  -31.930 24.384 1.00 43.04  ? 775  ASN A CA    1 
ATOM   6345 C  C     . ASN A 1 775 ? 19.518  -30.412 24.386 1.00 40.10  ? 775  ASN A C     1 
ATOM   6346 O  O     . ASN A 1 775 ? 19.170  -29.772 25.372 1.00 39.87  ? 775  ASN A O     1 
ATOM   6347 C  CB    . ASN A 1 775 ? 17.968  -32.373 24.321 1.00 45.08  ? 775  ASN A CB    1 
ATOM   6348 C  CG    . ASN A 1 775 ? 17.216  -31.705 23.208 1.00 46.75  ? 775  ASN A CG    1 
ATOM   6349 O  OD1   . ASN A 1 775 ? 16.766  -30.563 23.342 1.00 53.26  ? 775  ASN A OD1   1 
ATOM   6350 N  ND2   . ASN A 1 775 ? 17.071  -32.406 22.096 1.00 43.76  ? 775  ASN A ND2   1 
ATOM   6351 N  N     . TYR A 1 776 ? 19.966  -29.849 23.271 1.00 40.37  ? 776  TYR A N     1 
ATOM   6352 C  CA    . TYR A 1 776 ? 20.237  -28.419 23.171 1.00 39.40  ? 776  TYR A CA    1 
ATOM   6353 C  C     . TYR A 1 776 ? 19.056  -27.547 23.605 1.00 39.24  ? 776  TYR A C     1 
ATOM   6354 O  O     . TYR A 1 776 ? 19.252  -26.521 24.251 1.00 41.15  ? 776  TYR A O     1 
ATOM   6355 C  CB    . TYR A 1 776 ? 20.726  -28.053 21.764 1.00 40.84  ? 776  TYR A CB    1 
ATOM   6356 C  CG    . TYR A 1 776 ? 19.648  -28.001 20.701 1.00 44.90  ? 776  TYR A CG    1 
ATOM   6357 C  CD1   . TYR A 1 776 ? 19.272  -26.787 20.127 1.00 46.51  ? 776  TYR A CD1   1 
ATOM   6358 C  CD2   . TYR A 1 776 ? 19.005  -29.161 20.265 1.00 46.86  ? 776  TYR A CD2   1 
ATOM   6359 C  CE1   . TYR A 1 776 ? 18.278  -26.728 19.145 1.00 46.79  ? 776  TYR A CE1   1 
ATOM   6360 C  CE2   . TYR A 1 776 ? 18.013  -29.113 19.292 1.00 48.71  ? 776  TYR A CE2   1 
ATOM   6361 C  CZ    . TYR A 1 776 ? 17.653  -27.893 18.736 1.00 48.91  ? 776  TYR A CZ    1 
ATOM   6362 O  OH    . TYR A 1 776 ? 16.673  -27.841 17.767 1.00 49.91  ? 776  TYR A OH    1 
ATOM   6363 N  N     . ILE A 1 777 ? 17.833  -27.965 23.292 1.00 38.52  ? 777  ILE A N     1 
ATOM   6364 C  CA    . ILE A 1 777 ? 16.660  -27.181 23.666 1.00 36.37  ? 777  ILE A CA    1 
ATOM   6365 C  C     . ILE A 1 777 ? 16.531  -27.108 25.187 1.00 36.84  ? 777  ILE A C     1 
ATOM   6366 O  O     . ILE A 1 777 ? 16.109  -26.084 25.735 1.00 36.72  ? 777  ILE A O     1 
ATOM   6367 C  CB    . ILE A 1 777 ? 15.381  -27.736 23.010 1.00 38.72  ? 777  ILE A CB    1 
ATOM   6368 C  CG1   . ILE A 1 777 ? 15.377  -27.398 21.516 1.00 40.97  ? 777  ILE A CG1   1 
ATOM   6369 C  CG2   . ILE A 1 777 ? 14.102  -27.202 23.682 1.00 35.90  ? 777  ILE A CG2   1 
ATOM   6370 C  CD1   . ILE A 1 777 ? 14.357  -28.193 20.721 1.00 44.78  ? 777  ILE A CD1   1 
ATOM   6371 N  N     . SER A 1 778 ? 16.927  -28.181 25.868 1.00 35.52  ? 778  SER A N     1 
ATOM   6372 C  CA    . SER A 1 778 ? 16.746  -28.259 27.311 1.00 32.63  ? 778  SER A CA    1 
ATOM   6373 C  C     . SER A 1 778 ? 17.759  -27.386 28.029 1.00 30.58  ? 778  SER A C     1 
ATOM   6374 O  O     . SER A 1 778 ? 17.612  -27.121 29.223 1.00 30.29  ? 778  SER A O     1 
ATOM   6375 C  CB    . SER A 1 778 ? 16.833  -29.705 27.808 1.00 32.82  ? 778  SER A CB    1 
ATOM   6376 O  OG    . SER A 1 778 ? 18.182  -30.143 27.888 1.00 34.38  ? 778  SER A OG    1 
ATOM   6377 N  N     . ILE A 1 779 ? 18.775  -26.936 27.299 1.00 28.43  ? 779  ILE A N     1 
ATOM   6378 C  CA    . ILE A 1 779 ? 19.824  -26.102 27.893 1.00 28.68  ? 779  ILE A CA    1 
ATOM   6379 C  C     . ILE A 1 779 ? 19.882  -24.688 27.304 1.00 29.03  ? 779  ILE A C     1 
ATOM   6380 O  O     . ILE A 1 779 ? 20.705  -23.857 27.728 1.00 29.08  ? 779  ILE A O     1 
ATOM   6381 C  CB    . ILE A 1 779 ? 21.233  -26.796 27.912 1.00 28.03  ? 779  ILE A CB    1 
ATOM   6382 C  CG1   . ILE A 1 779 ? 21.613  -27.373 26.547 1.00 28.98  ? 779  ILE A CG1   1 
ATOM   6383 C  CG2   . ILE A 1 779 ? 21.267  -27.915 28.934 1.00 27.75  ? 779  ILE A CG2   1 
ATOM   6384 C  CD1   . ILE A 1 779 ? 23.085  -27.771 26.457 1.00 24.14  ? 779  ILE A CD1   1 
ATOM   6385 N  N     . ALA A 1 780 ? 18.989  -24.411 26.355 1.00 26.75  ? 780  ALA A N     1 
ATOM   6386 C  CA    . ALA A 1 780 ? 18.854  -23.070 25.784 1.00 27.32  ? 780  ALA A CA    1 
ATOM   6387 C  C     . ALA A 1 780 ? 18.087  -22.124 26.727 1.00 26.80  ? 780  ALA A C     1 
ATOM   6388 O  O     . ALA A 1 780 ? 17.135  -22.539 27.392 1.00 28.85  ? 780  ALA A O     1 
ATOM   6389 C  CB    . ALA A 1 780 ? 18.180  -23.149 24.420 1.00 25.85  ? 780  ALA A CB    1 
ATOM   6390 N  N     . SER A 1 781 ? 18.517  -20.866 26.808 1.00 27.47  ? 781  SER A N     1 
ATOM   6391 C  CA    . SER A 1 781 ? 17.819  -19.853 27.618 1.00 27.65  ? 781  SER A CA    1 
ATOM   6392 C  C     . SER A 1 781 ? 16.582  -19.372 26.895 1.00 26.04  ? 781  SER A C     1 
ATOM   6393 O  O     . SER A 1 781 ? 16.426  -19.626 25.714 1.00 28.16  ? 781  SER A O     1 
ATOM   6394 C  CB    . SER A 1 781 ? 18.720  -18.656 27.902 1.00 27.12  ? 781  SER A CB    1 
ATOM   6395 O  OG    . SER A 1 781 ? 19.667  -18.972 28.897 1.00 32.99  ? 781  SER A OG    1 
ATOM   6396 N  N     . VAL A 1 782 ? 15.709  -18.659 27.594 1.00 27.21  ? 782  VAL A N     1 
ATOM   6397 C  CA    . VAL A 1 782 ? 14.482  -18.160 26.974 1.00 26.43  ? 782  VAL A CA    1 
ATOM   6398 C  C     . VAL A 1 782 ? 14.328  -16.669 27.223 1.00 27.38  ? 782  VAL A C     1 
ATOM   6399 O  O     . VAL A 1 782 ? 14.647  -16.187 28.300 1.00 25.88  ? 782  VAL A O     1 
ATOM   6400 C  CB    . VAL A 1 782 ? 13.246  -18.904 27.500 1.00 24.27  ? 782  VAL A CB    1 
ATOM   6401 C  CG1   . VAL A 1 782 ? 12.005  -18.454 26.776 1.00 25.72  ? 782  VAL A CG1   1 
ATOM   6402 C  CG2   . VAL A 1 782 ? 13.428  -20.398 27.347 1.00 22.48  ? 782  VAL A CG2   1 
ATOM   6403 N  N     . SER A 1 783 ? 13.856  -15.937 26.217 1.00 31.17  ? 783  SER A N     1 
ATOM   6404 C  CA    . SER A 1 783 ? 13.578  -14.514 26.395 1.00 33.24  ? 783  SER A CA    1 
ATOM   6405 C  C     . SER A 1 783 ? 12.435  -14.026 25.511 1.00 35.34  ? 783  SER A C     1 
ATOM   6406 O  O     . SER A 1 783 ? 12.206  -14.558 24.423 1.00 36.14  ? 783  SER A O     1 
ATOM   6407 C  CB    . SER A 1 783 ? 14.831  -13.681 26.148 1.00 31.54  ? 783  SER A CB    1 
ATOM   6408 O  OG    . SER A 1 783 ? 14.680  -12.406 26.737 1.00 38.04  ? 783  SER A OG    1 
ATOM   6409 N  N     . SER A 1 784 ? 11.708  -13.023 25.996 1.00 37.40  ? 784  SER A N     1 
ATOM   6410 C  CA    . SER A 1 784 ? 10.741  -12.312 25.163 1.00 39.23  ? 784  SER A CA    1 
ATOM   6411 C  C     . SER A 1 784 ? 11.499  -11.421 24.194 1.00 40.90  ? 784  SER A C     1 
ATOM   6412 O  O     . SER A 1 784 ? 12.457  -10.745 24.579 1.00 41.26  ? 784  SER A O     1 
ATOM   6413 C  CB    . SER A 1 784 ? 9.806   -11.452 26.012 1.00 38.83  ? 784  SER A CB    1 
ATOM   6414 O  OG    . SER A 1 784 ? 8.944   -12.250 26.796 1.00 39.74  ? 784  SER A OG    1 
ATOM   6415 N  N     . ALA A 1 785 ? 11.066  -11.427 22.938 1.00 43.92  ? 785  ALA A N     1 
ATOM   6416 C  CA    . ALA A 1 785 ? 11.685  -10.606 21.899 1.00 47.14  ? 785  ALA A CA    1 
ATOM   6417 C  C     . ALA A 1 785 ? 10.898  -9.313  21.670 1.00 48.99  ? 785  ALA A C     1 
ATOM   6418 O  O     . ALA A 1 785 ? 9.985   -9.274  20.844 1.00 49.46  ? 785  ALA A O     1 
ATOM   6419 C  CB    . ALA A 1 785 ? 11.795  -11.398 20.611 1.00 48.30  ? 785  ALA A CB    1 
ATOM   6420 N  N     . ASN A 1 786 ? 11.256  -8.266  22.409 1.00 48.71  ? 786  ASN A N     1 
ATOM   6421 C  CA    . ASN A 1 786 ? 10.592  -6.975  22.295 1.00 50.35  ? 786  ASN A CA    1 
ATOM   6422 C  C     . ASN A 1 786 ? 11.463  -5.926  21.618 1.00 52.35  ? 786  ASN A C     1 
ATOM   6423 O  O     . ASN A 1 786 ? 12.687  -5.921  21.784 1.00 51.20  ? 786  ASN A O     1 
ATOM   6424 C  CB    . ASN A 1 786 ? 10.155  -6.477  23.673 1.00 51.38  ? 786  ASN A CB    1 
ATOM   6425 C  CG    . ASN A 1 786 ? 9.110   -7.372  24.314 1.00 53.95  ? 786  ASN A CG    1 
ATOM   6426 O  OD1   . ASN A 1 786 ? 8.143   -7.790  23.669 1.00 56.76  ? 786  ASN A OD1   1 
ATOM   6427 N  ND2   . ASN A 1 786 ? 9.295   -7.665  25.596 1.00 52.60  ? 786  ASN A ND2   1 
ATOM   6428 N  N     . ASN A 1 787 ? 10.815  -5.039  20.860 1.00 54.04  ? 787  ASN A N     1 
ATOM   6429 C  CA    . ASN A 1 787 ? 11.480  -3.922  20.171 1.00 56.00  ? 787  ASN A CA    1 
ATOM   6430 C  C     . ASN A 1 787 ? 12.694  -4.348  19.341 1.00 53.93  ? 787  ASN A C     1 
ATOM   6431 O  O     . ASN A 1 787 ? 13.757  -3.725  19.411 1.00 52.91  ? 787  ASN A O     1 
ATOM   6432 C  CB    . ASN A 1 787 ? 11.845  -2.800  21.162 1.00 58.42  ? 787  ASN A CB    1 
ATOM   6433 C  CG    . ASN A 1 787 ? 10.620  -2.037  21.673 1.00 64.99  ? 787  ASN A CG    1 
ATOM   6434 O  OD1   . ASN A 1 787 ? 9.769   -1.596  20.892 1.00 67.25  ? 787  ASN A OD1   1 
ATOM   6435 N  ND2   . ASN A 1 787 ? 10.536  -1.869  22.993 1.00 67.04  ? 787  ASN A ND2   1 
ATOM   6436 N  N     . ILE A 1 788 ? 12.512  -5.413  18.560 1.00 51.96  ? 788  ILE A N     1 
ATOM   6437 C  CA    . ILE A 1 788 ? 13.571  -5.990  17.730 1.00 51.66  ? 788  ILE A CA    1 
ATOM   6438 C  C     . ILE A 1 788 ? 14.068  -4.992  16.672 1.00 53.01  ? 788  ILE A C     1 
ATOM   6439 O  O     . ILE A 1 788 ? 15.275  -4.751  16.560 1.00 51.60  ? 788  ILE A O     1 
ATOM   6440 C  CB    . ILE A 1 788 ? 13.104  -7.319  17.058 1.00 52.12  ? 788  ILE A CB    1 
ATOM   6441 C  CG1   . ILE A 1 788 ? 12.606  -8.314  18.112 1.00 51.75  ? 788  ILE A CG1   1 
ATOM   6442 C  CG2   . ILE A 1 788 ? 14.229  -7.945  16.217 1.00 51.23  ? 788  ILE A CG2   1 
ATOM   6443 C  CD1   . ILE A 1 788 ? 11.708  -9.411  17.565 1.00 51.59  ? 788  ILE A CD1   1 
ATOM   6444 N  N     . ALA A 1 789 ? 13.130  -4.415  15.916 1.00 53.38  ? 789  ALA A N     1 
ATOM   6445 C  CA    . ALA A 1 789 ? 13.434  -3.421  14.882 1.00 55.67  ? 789  ALA A CA    1 
ATOM   6446 C  C     . ALA A 1 789 ? 14.362  -2.303  15.376 1.00 57.43  ? 789  ALA A C     1 
ATOM   6447 O  O     . ALA A 1 789 ? 15.304  -1.916  14.679 1.00 59.45  ? 789  ALA A O     1 
ATOM   6448 C  CB    . ALA A 1 789 ? 12.146  -2.833  14.328 1.00 56.10  ? 789  ALA A CB    1 
ATOM   6449 N  N     . LYS A 1 790 ? 14.091  -1.807  16.581 1.00 57.03  ? 790  LYS A N     1 
ATOM   6450 C  CA    . LYS A 1 790 ? 14.855  -0.726  17.209 1.00 58.56  ? 790  LYS A CA    1 
ATOM   6451 C  C     . LYS A 1 790 ? 16.380  -0.942  17.210 1.00 56.78  ? 790  LYS A C     1 
ATOM   6452 O  O     . LYS A 1 790 ? 17.151  0.021   17.180 1.00 56.88  ? 790  LYS A O     1 
ATOM   6453 C  CB    . LYS A 1 790 ? 14.352  -0.517  18.646 1.00 60.16  ? 790  LYS A CB    1 
ATOM   6454 C  CG    . LYS A 1 790 ? 14.808  0.775   19.317 1.00 63.10  ? 790  LYS A CG    1 
ATOM   6455 C  CD    . LYS A 1 790 ? 14.629  0.698   20.823 1.00 65.08  ? 790  LYS A CD    1 
ATOM   6456 C  CE    . LYS A 1 790 ? 15.399  1.807   21.506 1.00 68.50  ? 790  LYS A CE    1 
ATOM   6457 N  NZ    . LYS A 1 790 ? 15.560  1.519   22.948 1.00 69.88  ? 790  LYS A NZ    1 
ATOM   6458 N  N     . TYR A 1 791 ? 16.804  -2.202  17.239 1.00 53.72  ? 791  TYR A N     1 
ATOM   6459 C  CA    . TYR A 1 791 ? 18.226  -2.534  17.329 1.00 51.81  ? 791  TYR A CA    1 
ATOM   6460 C  C     . TYR A 1 791 ? 18.772  -3.189  16.052 1.00 51.92  ? 791  TYR A C     1 
ATOM   6461 O  O     . TYR A 1 791 ? 19.916  -3.666  16.022 1.00 51.07  ? 791  TYR A O     1 
ATOM   6462 C  CB    . TYR A 1 791 ? 18.480  -3.424  18.551 1.00 50.10  ? 791  TYR A CB    1 
ATOM   6463 C  CG    . TYR A 1 791 ? 18.174  -2.759  19.880 1.00 48.52  ? 791  TYR A CG    1 
ATOM   6464 C  CD1   . TYR A 1 791 ? 16.966  -2.998  20.534 1.00 46.58  ? 791  TYR A CD1   1 
ATOM   6465 C  CD2   . TYR A 1 791 ? 19.087  -1.889  20.481 1.00 47.24  ? 791  TYR A CD2   1 
ATOM   6466 C  CE1   . TYR A 1 791 ? 16.674  -2.395  21.746 1.00 45.89  ? 791  TYR A CE1   1 
ATOM   6467 C  CE2   . TYR A 1 791 ? 18.800  -1.281  21.696 1.00 46.26  ? 791  TYR A CE2   1 
ATOM   6468 C  CZ    . TYR A 1 791 ? 17.592  -1.540  22.320 1.00 46.53  ? 791  TYR A CZ    1 
ATOM   6469 O  OH    . TYR A 1 791 ? 17.293  -0.953  23.525 1.00 49.36  ? 791  TYR A OH    1 
ATOM   6470 N  N     . ASP A 1 792 ? 17.947  -3.191  15.004 1.00 52.14  ? 792  ASP A N     1 
ATOM   6471 C  CA    . ASP A 1 792 ? 18.296  -3.769  13.704 1.00 54.27  ? 792  ASP A CA    1 
ATOM   6472 C  C     . ASP A 1 792 ? 18.907  -2.713  12.789 1.00 55.01  ? 792  ASP A C     1 
ATOM   6473 O  O     . ASP A 1 792 ? 18.191  -1.955  12.130 1.00 56.17  ? 792  ASP A O     1 
ATOM   6474 C  CB    . ASP A 1 792 ? 17.050  -4.383  13.042 1.00 54.40  ? 792  ASP A CB    1 
ATOM   6475 C  CG    . ASP A 1 792 ? 17.388  -5.318  11.876 1.00 56.25  ? 792  ASP A CG    1 
ATOM   6476 O  OD1   . ASP A 1 792 ? 18.499  -5.228  11.306 1.00 55.88  ? 792  ASP A OD1   1 
ATOM   6477 O  OD2   . ASP A 1 792 ? 16.523  -6.152  11.529 1.00 55.42  ? 792  ASP A OD2   1 
ATOM   6478 N  N     . VAL A 1 793 ? 20.232  -2.677  12.749 1.00 55.58  ? 793  VAL A N     1 
ATOM   6479 C  CA    . VAL A 1 793 ? 20.951  -1.723  11.912 1.00 57.70  ? 793  VAL A CA    1 
ATOM   6480 C  C     . VAL A 1 793 ? 21.560  -2.443  10.704 1.00 58.02  ? 793  VAL A C     1 
ATOM   6481 O  O     . VAL A 1 793 ? 22.723  -2.861  10.731 1.00 57.02  ? 793  VAL A O     1 
ATOM   6482 C  CB    . VAL A 1 793 ? 22.010  -0.941  12.735 1.00 58.16  ? 793  VAL A CB    1 
ATOM   6483 C  CG1   . VAL A 1 793 ? 22.804  0.020   11.854 1.00 62.49  ? 793  VAL A CG1   1 
ATOM   6484 C  CG2   . VAL A 1 793 ? 21.328  -0.177  13.858 1.00 57.63  ? 793  VAL A CG2   1 
ATOM   6485 N  N     . GLY A 1 794 ? 20.745  -2.595  9.658  1.00 58.47  ? 794  GLY A N     1 
ATOM   6486 C  CA    . GLY A 1 794 ? 21.144  -3.288  8.427  1.00 59.28  ? 794  GLY A CA    1 
ATOM   6487 C  C     . GLY A 1 794 ? 21.425  -4.769  8.623  1.00 58.82  ? 794  GLY A C     1 
ATOM   6488 O  O     . GLY A 1 794 ? 22.344  -5.325  8.009  1.00 57.47  ? 794  GLY A O     1 
ATOM   6489 N  N     . GLY A 1 795 ? 20.627  -5.403  9.482  1.00 57.47  ? 795  GLY A N     1 
ATOM   6490 C  CA    . GLY A 1 795 ? 20.795  -6.816  9.815  1.00 58.92  ? 795  GLY A CA    1 
ATOM   6491 C  C     . GLY A 1 795 ? 21.784  -7.081  10.944 1.00 59.86  ? 795  GLY A C     1 
ATOM   6492 O  O     . GLY A 1 795 ? 22.001  -8.233  11.328 1.00 59.96  ? 795  GLY A O     1 
ATOM   6493 N  N     . PHE A 1 796 ? 22.379  -6.015  11.478 1.00 59.29  ? 796  PHE A N     1 
ATOM   6494 C  CA    . PHE A 1 796 ? 23.406  -6.126  12.506 1.00 58.58  ? 796  PHE A CA    1 
ATOM   6495 C  C     . PHE A 1 796 ? 22.991  -5.420  13.802 1.00 57.90  ? 796  PHE A C     1 
ATOM   6496 O  O     . PHE A 1 796 ? 22.094  -4.570  13.785 1.00 56.83  ? 796  PHE A O     1 
ATOM   6497 C  CB    . PHE A 1 796 ? 24.740  -5.577  11.985 1.00 60.28  ? 796  PHE A CB    1 
ATOM   6498 C  CG    . PHE A 1 796 ? 25.414  -6.470  10.969 1.00 62.55  ? 796  PHE A CG    1 
ATOM   6499 C  CD1   . PHE A 1 796 ? 26.251  -7.509  11.379 1.00 62.54  ? 796  PHE A CD1   1 
ATOM   6500 C  CD2   . PHE A 1 796 ? 25.220  -6.267  9.602  1.00 63.64  ? 796  PHE A CD2   1 
ATOM   6501 C  CE1   . PHE A 1 796 ? 26.883  -8.337  10.440 1.00 63.28  ? 796  PHE A CE1   1 
ATOM   6502 C  CE2   . PHE A 1 796 ? 25.843  -7.090  8.655  1.00 63.98  ? 796  PHE A CE2   1 
ATOM   6503 C  CZ    . PHE A 1 796 ? 26.677  -8.125  9.074  1.00 62.58  ? 796  PHE A CZ    1 
ATOM   6504 N  N     . PRO A 1 797 ? 23.623  -5.796  14.937 1.00 57.96  ? 797  PRO A N     1 
ATOM   6505 C  CA    . PRO A 1 797 ? 23.335  -5.205  16.249 1.00 57.39  ? 797  PRO A CA    1 
ATOM   6506 C  C     . PRO A 1 797 ? 23.608  -3.706  16.342 1.00 58.97  ? 797  PRO A C     1 
ATOM   6507 O  O     . PRO A 1 797 ? 24.707  -3.249  16.020 1.00 59.45  ? 797  PRO A O     1 
ATOM   6508 C  CB    . PRO A 1 797 ? 24.273  -5.969  17.184 1.00 57.34  ? 797  PRO A CB    1 
ATOM   6509 C  CG    . PRO A 1 797 ? 24.433  -7.282  16.526 1.00 56.80  ? 797  PRO A CG    1 
ATOM   6510 C  CD    . PRO A 1 797 ? 24.486  -6.986  15.067 1.00 57.37  ? 797  PRO A CD    1 
ATOM   6511 N  N     . GLY A 1 798 ? 22.596  -2.960  16.780 1.00 59.16  ? 798  GLY A N     1 
ATOM   6512 C  CA    . GLY A 1 798 ? 22.737  -1.537  17.063 1.00 60.81  ? 798  GLY A CA    1 
ATOM   6513 C  C     . GLY A 1 798 ? 23.287  -1.299  18.461 1.00 62.06  ? 798  GLY A C     1 
ATOM   6514 O  O     . GLY A 1 798 ? 23.587  -2.255  19.182 1.00 61.09  ? 798  GLY A O     1 
ATOM   6515 N  N     . PRO A 1 799 ? 23.431  -0.019  18.856 1.00 63.43  ? 799  PRO A N     1 
ATOM   6516 C  CA    . PRO A 1 799 ? 23.943  0.307   20.191 1.00 62.73  ? 799  PRO A CA    1 
ATOM   6517 C  C     . PRO A 1 799 ? 22.946  -0.065  21.298 1.00 60.57  ? 799  PRO A C     1 
ATOM   6518 O  O     . PRO A 1 799 ? 21.732  0.040   21.096 1.00 56.28  ? 799  PRO A O     1 
ATOM   6519 C  CB    . PRO A 1 799 ? 24.155  1.829   20.131 1.00 64.35  ? 799  PRO A CB    1 
ATOM   6520 C  CG    . PRO A 1 799 ? 24.051  2.198   18.669 1.00 66.14  ? 799  PRO A CG    1 
ATOM   6521 C  CD    . PRO A 1 799 ? 23.136  1.192   18.069 1.00 64.38  ? 799  PRO A CD    1 
ATOM   6522 N  N     . LYS A 1 800 ? 23.482  -0.499  22.444 1.00 61.08  ? 800  LYS A N     1 
ATOM   6523 C  CA    . LYS A 1 800 ? 22.703  -1.002  23.595 1.00 60.12  ? 800  LYS A CA    1 
ATOM   6524 C  C     . LYS A 1 800 ? 21.848  -2.220  23.242 1.00 57.85  ? 800  LYS A C     1 
ATOM   6525 O  O     . LYS A 1 800 ? 20.834  -2.488  23.893 1.00 57.82  ? 800  LYS A O     1 
ATOM   6526 C  CB    . LYS A 1 800 ? 21.829  0.101   24.215 1.00 61.96  ? 800  LYS A CB    1 
ATOM   6527 C  CG    . LYS A 1 800 ? 22.595  1.175   24.963 1.00 67.47  ? 800  LYS A CG    1 
ATOM   6528 C  CD    . LYS A 1 800 ? 21.730  2.412   25.186 1.00 71.90  ? 800  LYS A CD    1 
ATOM   6529 C  CE    . LYS A 1 800 ? 22.567  3.568   25.726 1.00 75.14  ? 800  LYS A CE    1 
ATOM   6530 N  NZ    . LYS A 1 800 ? 21.731  4.720   26.161 1.00 77.53  ? 800  LYS A NZ    1 
ATOM   6531 N  N     . CYS A 1 801 ? 22.269  -2.958  22.217 1.00 55.62  ? 801  CYS A N     1 
ATOM   6532 C  CA    . CYS A 1 801 ? 21.516  -4.106  21.740 1.00 52.89  ? 801  CYS A CA    1 
ATOM   6533 C  C     . CYS A 1 801 ? 21.528  -5.237  22.753 1.00 49.58  ? 801  CYS A C     1 
ATOM   6534 O  O     . CYS A 1 801 ? 22.593  -5.748  23.091 1.00 48.63  ? 801  CYS A O     1 
ATOM   6535 C  CB    . CYS A 1 801 ? 22.052  -4.609  20.400 1.00 53.41  ? 801  CYS A CB    1 
ATOM   6536 S  SG    . CYS A 1 801 ? 21.121  -6.001  19.736 1.00 53.21  ? 801  CYS A SG    1 
ATOM   6537 N  N     . PRO A 1 802 ? 20.333  -5.635  23.229 1.00 47.51  ? 802  PRO A N     1 
ATOM   6538 C  CA    . PRO A 1 802 ? 20.196  -6.731  24.189 1.00 45.52  ? 802  PRO A CA    1 
ATOM   6539 C  C     . PRO A 1 802 ? 20.716  -8.047  23.614 1.00 44.49  ? 802  PRO A C     1 
ATOM   6540 O  O     . PRO A 1 802 ? 20.672  -8.251  22.392 1.00 44.94  ? 802  PRO A O     1 
ATOM   6541 C  CB    . PRO A 1 802 ? 18.681  -6.807  24.429 1.00 45.21  ? 802  PRO A CB    1 
ATOM   6542 C  CG    . PRO A 1 802 ? 18.158  -5.457  24.022 1.00 45.89  ? 802  PRO A CG    1 
ATOM   6543 C  CD    . PRO A 1 802 ? 19.025  -5.049  22.875 1.00 46.17  ? 802  PRO A CD    1 
ATOM   6544 N  N     . PHE A 1 803 ? 21.215  -8.912  24.497 1.00 41.91  ? 803  PHE A N     1 
ATOM   6545 C  CA    . PHE A 1 803 ? 21.824  -10.188 24.118 1.00 39.21  ? 803  PHE A CA    1 
ATOM   6546 C  C     . PHE A 1 803 ? 20.902  -11.033 23.242 1.00 38.91  ? 803  PHE A C     1 
ATOM   6547 O  O     . PHE A 1 803 ? 21.303  -11.492 22.173 1.00 41.96  ? 803  PHE A O     1 
ATOM   6548 C  CB    . PHE A 1 803 ? 22.213  -10.958 25.379 1.00 37.20  ? 803  PHE A CB    1 
ATOM   6549 C  CG    . PHE A 1 803 ? 23.071  -12.171 25.127 1.00 35.87  ? 803  PHE A CG    1 
ATOM   6550 C  CD1   . PHE A 1 803 ? 24.426  -12.035 24.836 1.00 35.50  ? 803  PHE A CD1   1 
ATOM   6551 C  CD2   . PHE A 1 803 ? 22.533  -13.453 25.222 1.00 31.63  ? 803  PHE A CD2   1 
ATOM   6552 C  CE1   . PHE A 1 803 ? 25.238  -13.159 24.625 1.00 32.97  ? 803  PHE A CE1   1 
ATOM   6553 C  CE2   . PHE A 1 803 ? 23.330  -14.583 25.003 1.00 32.52  ? 803  PHE A CE2   1 
ATOM   6554 C  CZ    . PHE A 1 803 ? 24.693  -14.429 24.709 1.00 30.87  ? 803  PHE A CZ    1 
ATOM   6555 N  N     . HIS A 1 804 ? 19.663  -11.213 23.688 1.00 36.36  ? 804  HIS A N     1 
ATOM   6556 C  CA    . HIS A 1 804 ? 18.704  -12.061 22.991 1.00 35.44  ? 804  HIS A CA    1 
ATOM   6557 C  C     . HIS A 1 804 ? 18.277  -11.483 21.644 1.00 36.58  ? 804  HIS A C     1 
ATOM   6558 O  O     . HIS A 1 804 ? 18.021  -12.234 20.701 1.00 38.73  ? 804  HIS A O     1 
ATOM   6559 C  CB    . HIS A 1 804 ? 17.491  -12.363 23.876 1.00 32.54  ? 804  HIS A CB    1 
ATOM   6560 C  CG    . HIS A 1 804 ? 16.713  -11.148 24.284 1.00 32.30  ? 804  HIS A CG    1 
ATOM   6561 N  ND1   . HIS A 1 804 ? 17.164  -10.254 25.233 1.00 29.21  ? 804  HIS A ND1   1 
ATOM   6562 C  CD2   . HIS A 1 804 ? 15.505  -10.689 23.878 1.00 30.79  ? 804  HIS A CD2   1 
ATOM   6563 C  CE1   . HIS A 1 804 ? 16.270  -9.293  25.389 1.00 28.80  ? 804  HIS A CE1   1 
ATOM   6564 N  NE2   . HIS A 1 804 ? 15.253  -9.536  24.580 1.00 31.85  ? 804  HIS A NE2   1 
ATOM   6565 N  N     . ILE A 1 805 ? 18.218  -10.157 21.551 1.00 36.14  ? 805  ILE A N     1 
ATOM   6566 C  CA    . ILE A 1 805 ? 17.928  -9.490  20.280 1.00 37.38  ? 805  ILE A CA    1 
ATOM   6567 C  C     . ILE A 1 805 ? 19.062  -9.733  19.280 1.00 39.82  ? 805  ILE A C     1 
ATOM   6568 O  O     . ILE A 1 805 ? 18.811  -10.005 18.104 1.00 41.82  ? 805  ILE A O     1 
ATOM   6569 C  CB    . ILE A 1 805 ? 17.669  -7.971  20.465 1.00 38.68  ? 805  ILE A CB    1 
ATOM   6570 C  CG1   . ILE A 1 805 ? 16.557  -7.722  21.499 1.00 38.83  ? 805  ILE A CG1   1 
ATOM   6571 C  CG2   . ILE A 1 805 ? 17.331  -7.302  19.139 1.00 39.30  ? 805  ILE A CG2   1 
ATOM   6572 C  CD1   . ILE A 1 805 ? 15.174  -8.277  21.122 1.00 35.35  ? 805  ILE A CD1   1 
ATOM   6573 N  N     . ARG A 1 806 ? 20.305  -9.660  19.755 1.00 38.51  ? 806  ARG A N     1 
ATOM   6574 C  CA    . ARG A 1 806 ? 21.466  -9.954  18.921 1.00 38.36  ? 806  ARG A CA    1 
ATOM   6575 C  C     . ARG A 1 806 ? 21.378  -11.355 18.311 1.00 38.97  ? 806  ARG A C     1 
ATOM   6576 O  O     . ARG A 1 806 ? 21.814  -11.580 17.175 1.00 39.69  ? 806  ARG A O     1 
ATOM   6577 C  CB    . ARG A 1 806 ? 22.757  -9.790  19.732 1.00 38.94  ? 806  ARG A CB    1 
ATOM   6578 C  CG    . ARG A 1 806 ? 24.025  -10.258 19.031 1.00 37.29  ? 806  ARG A CG    1 
ATOM   6579 C  CD    . ARG A 1 806 ? 25.203  -10.236 19.976 1.00 38.75  ? 806  ARG A CD    1 
ATOM   6580 N  NE    . ARG A 1 806 ? 25.388  -8.902  20.544 1.00 39.41  ? 806  ARG A NE    1 
ATOM   6581 C  CZ    . ARG A 1 806 ? 26.119  -7.937  19.988 1.00 37.79  ? 806  ARG A CZ    1 
ATOM   6582 N  NH1   . ARG A 1 806 ? 26.762  -8.151  18.846 1.00 34.24  ? 806  ARG A NH1   1 
ATOM   6583 N  NH2   . ARG A 1 806 ? 26.206  -6.755  20.583 1.00 36.80  ? 806  ARG A NH2   1 
ATOM   6584 N  N     . GLY A 1 807 ? 20.811  -12.291 19.067 1.00 38.13  ? 807  GLY A N     1 
ATOM   6585 C  CA    . GLY A 1 807 ? 20.625  -13.660 18.585 1.00 37.80  ? 807  GLY A CA    1 
ATOM   6586 C  C     . GLY A 1 807 ? 19.560  -13.741 17.511 1.00 38.39  ? 807  GLY A C     1 
ATOM   6587 O  O     . GLY A 1 807 ? 19.669  -14.519 16.561 1.00 39.48  ? 807  GLY A O     1 
ATOM   6588 N  N     . ILE A 1 808 ? 18.516  -12.936 17.670 1.00 38.63  ? 808  ILE A N     1 
ATOM   6589 C  CA    . ILE A 1 808 ? 17.477  -12.828 16.661 1.00 39.08  ? 808  ILE A CA    1 
ATOM   6590 C  C     . ILE A 1 808 ? 18.076  -12.300 15.359 1.00 40.72  ? 808  ILE A C     1 
ATOM   6591 O  O     . ILE A 1 808 ? 17.807  -12.837 14.285 1.00 44.64  ? 808  ILE A O     1 
ATOM   6592 C  CB    . ILE A 1 808 ? 16.296  -11.967 17.170 1.00 37.89  ? 808  ILE A CB    1 
ATOM   6593 C  CG1   . ILE A 1 808 ? 15.505  -12.758 18.212 1.00 37.61  ? 808  ILE A CG1   1 
ATOM   6594 C  CG2   . ILE A 1 808 ? 15.377  -11.579 16.038 1.00 36.48  ? 808  ILE A CG2   1 
ATOM   6595 C  CD1   . ILE A 1 808 ? 14.881  -11.914 19.294 1.00 35.72  ? 808  ILE A CD1   1 
ATOM   6596 N  N     . LEU A 1 809 ? 18.918  -11.273 15.465 1.00 40.55  ? 809  LEU A N     1 
ATOM   6597 C  CA    . LEU A 1 809 ? 19.586  -10.703 14.297 1.00 42.07  ? 809  LEU A CA    1 
ATOM   6598 C  C     . LEU A 1 809 ? 20.555  -11.697 13.659 1.00 43.78  ? 809  LEU A C     1 
ATOM   6599 O  O     . LEU A 1 809 ? 20.733  -11.706 12.437 1.00 47.48  ? 809  LEU A O     1 
ATOM   6600 C  CB    . LEU A 1 809 ? 20.297  -9.388  14.650 1.00 40.33  ? 809  LEU A CB    1 
ATOM   6601 C  CG    . LEU A 1 809 ? 19.403  -8.265  15.194 1.00 37.73  ? 809  LEU A CG    1 
ATOM   6602 C  CD1   . LEU A 1 809 ? 20.215  -7.019  15.480 1.00 33.90  ? 809  LEU A CD1   1 
ATOM   6603 C  CD2   . LEU A 1 809 ? 18.255  -7.937  14.251 1.00 36.86  ? 809  LEU A CD2   1 
ATOM   6604 N  N     . THR A 1 810 ? 21.167  -12.540 14.482 1.00 42.48  ? 810  THR A N     1 
ATOM   6605 C  CA    . THR A 1 810 ? 22.035  -13.591 13.972 1.00 44.00  ? 810  THR A CA    1 
ATOM   6606 C  C     . THR A 1 810 ? 21.188  -14.617 13.212 1.00 44.76  ? 810  THR A C     1 
ATOM   6607 O  O     . THR A 1 810 ? 21.555  -15.052 12.115 1.00 46.62  ? 810  THR A O     1 
ATOM   6608 C  CB    . THR A 1 810 ? 22.846  -14.255 15.106 1.00 43.99  ? 810  THR A CB    1 
ATOM   6609 O  OG1   . THR A 1 810 ? 23.561  -13.248 15.835 1.00 44.66  ? 810  THR A OG1   1 
ATOM   6610 C  CG2   . THR A 1 810 ? 23.848  -15.243 14.549 1.00 45.53  ? 810  THR A CG2   1 
ATOM   6611 N  N     . TYR A 1 811 ? 20.041  -14.974 13.788 1.00 43.92  ? 811  TYR A N     1 
ATOM   6612 C  CA    . TYR A 1 811 ? 19.096  -15.897 13.150 1.00 43.39  ? 811  TYR A CA    1 
ATOM   6613 C  C     . TYR A 1 811 ? 18.604  -15.376 11.799 1.00 43.72  ? 811  TYR A C     1 
ATOM   6614 O  O     . TYR A 1 811 ? 18.673  -16.089 10.798 1.00 44.71  ? 811  TYR A O     1 
ATOM   6615 C  CB    . TYR A 1 811 ? 17.914  -16.181 14.080 1.00 41.64  ? 811  TYR A CB    1 
ATOM   6616 C  CG    . TYR A 1 811 ? 16.915  -17.183 13.542 1.00 39.15  ? 811  TYR A CG    1 
ATOM   6617 C  CD1   . TYR A 1 811 ? 17.207  -18.542 13.512 1.00 37.84  ? 811  TYR A CD1   1 
ATOM   6618 C  CD2   . TYR A 1 811 ? 15.674  -16.768 13.076 1.00 39.17  ? 811  TYR A CD2   1 
ATOM   6619 C  CE1   . TYR A 1 811 ? 16.292  -19.459 13.028 1.00 38.56  ? 811  TYR A CE1   1 
ATOM   6620 C  CE2   . TYR A 1 811 ? 14.754  -17.673 12.589 1.00 38.50  ? 811  TYR A CE2   1 
ATOM   6621 C  CZ    . TYR A 1 811 ? 15.067  -19.016 12.565 1.00 39.33  ? 811  TYR A CZ    1 
ATOM   6622 O  OH    . TYR A 1 811 ? 14.152  -19.916 12.076 1.00 40.40  ? 811  TYR A OH    1 
ATOM   6623 N  N     . ASN A 1 812 ? 18.127  -14.133 11.776 1.00 43.59  ? 812  ASN A N     1 
ATOM   6624 C  CA    . ASN A 1 812 ? 17.677  -13.497 10.532 1.00 48.30  ? 812  ASN A CA    1 
ATOM   6625 C  C     . ASN A 1 812 ? 18.705  -13.552 9.383  1.00 51.92  ? 812  ASN A C     1 
ATOM   6626 O  O     . ASN A 1 812 ? 18.332  -13.791 8.233  1.00 55.40  ? 812  ASN A O     1 
ATOM   6627 C  CB    . ASN A 1 812 ? 17.200  -12.058 10.788 1.00 47.59  ? 812  ASN A CB    1 
ATOM   6628 C  CG    . ASN A 1 812 ? 15.954  -11.993 11.687 1.00 50.09  ? 812  ASN A CG    1 
ATOM   6629 O  OD1   . ASN A 1 812 ? 15.255  -12.992 11.901 1.00 47.74  ? 812  ASN A OD1   1 
ATOM   6630 N  ND2   . ASN A 1 812 ? 15.674  -10.806 12.212 1.00 48.61  ? 812  ASN A ND2   1 
ATOM   6631 N  N     . ARG A 1 813 ? 19.987  -13.348 9.696  1.00 52.36  ? 813  ARG A N     1 
ATOM   6632 C  CA    . ARG A 1 813 ? 21.042  -13.386 8.676  1.00 53.23  ? 813  ARG A CA    1 
ATOM   6633 C  C     . ARG A 1 813 ? 21.307  -14.799 8.169  1.00 53.68  ? 813  ARG A C     1 
ATOM   6634 O  O     . ARG A 1 813 ? 21.549  -15.000 6.977  1.00 55.84  ? 813  ARG A O     1 
ATOM   6635 C  CB    . ARG A 1 813 ? 22.345  -12.763 9.192  1.00 52.63  ? 813  ARG A CB    1 
ATOM   6636 C  CG    . ARG A 1 813 ? 22.294  -11.247 9.361  1.00 52.85  ? 813  ARG A CG    1 
ATOM   6637 C  CD    . ARG A 1 813 ? 23.663  -10.658 9.684  1.00 51.93  ? 813  ARG A CD    1 
ATOM   6638 N  NE    . ARG A 1 813 ? 24.339  -11.406 10.742 1.00 54.21  ? 813  ARG A NE    1 
ATOM   6639 C  CZ    . ARG A 1 813 ? 24.427  -11.038 12.021 1.00 51.77  ? 813  ARG A CZ    1 
ATOM   6640 N  NH1   . ARG A 1 813 ? 23.898  -9.899  12.452 1.00 51.60  ? 813  ARG A NH1   1 
ATOM   6641 N  NH2   . ARG A 1 813 ? 25.070  -11.819 12.874 1.00 49.78  ? 813  ARG A NH2   1 
ATOM   6642 N  N     . ALA A 1 814 ? 21.259  -15.773 9.071  1.00 51.81  ? 814  ALA A N     1 
ATOM   6643 C  CA    . ALA A 1 814 ? 21.505  -17.159 8.699  1.00 52.87  ? 814  ALA A CA    1 
ATOM   6644 C  C     . ALA A 1 814 ? 20.341  -17.792 7.928  1.00 55.06  ? 814  ALA A C     1 
ATOM   6645 O  O     . ALA A 1 814 ? 20.538  -18.787 7.232  1.00 55.96  ? 814  ALA A O     1 
ATOM   6646 C  CB    . ALA A 1 814 ? 21.843  -17.980 9.915  1.00 52.09  ? 814  ALA A CB    1 
ATOM   6647 N  N     . ILE A 1 815 ? 19.139  -17.226 8.050  1.00 55.11  ? 815  ILE A N     1 
ATOM   6648 C  CA    . ILE A 1 815 ? 17.978  -17.723 7.291  1.00 57.82  ? 815  ILE A CA    1 
ATOM   6649 C  C     . ILE A 1 815 ? 17.556  -16.807 6.134  1.00 60.80  ? 815  ILE A C     1 
ATOM   6650 O  O     . ILE A 1 815 ? 16.481  -16.984 5.555  1.00 61.15  ? 815  ILE A O     1 
ATOM   6651 C  CB    . ILE A 1 815 ? 16.738  -18.019 8.195  1.00 55.28  ? 815  ILE A CB    1 
ATOM   6652 C  CG1   . ILE A 1 815 ? 16.176  -16.727 8.811  1.00 53.59  ? 815  ILE A CG1   1 
ATOM   6653 C  CG2   . ILE A 1 815 ? 17.075  -19.078 9.246  1.00 53.48  ? 815  ILE A CG2   1 
ATOM   6654 C  CD1   . ILE A 1 815 ? 14.679  -16.756 9.088  1.00 50.19  ? 815  ILE A CD1   1 
ATOM   6655 N  N     . LYS A 1 816 ? 18.399  -15.833 5.805  1.00 63.98  ? 816  LYS A N     1 
ATOM   6656 C  CA    . LYS A 1 816 ? 18.103  -14.899 4.723  1.00 68.28  ? 816  LYS A CA    1 
ATOM   6657 C  C     . LYS A 1 816 ? 18.019  -15.644 3.389  1.00 71.57  ? 816  LYS A C     1 
ATOM   6658 O  O     . LYS A 1 816 ? 18.989  -16.270 2.956  1.00 71.52  ? 816  LYS A O     1 
ATOM   6659 C  CB    . LYS A 1 816 ? 19.156  -13.779 4.671  1.00 69.60  ? 816  LYS A CB    1 
ATOM   6660 C  CG    . LYS A 1 816 ? 18.802  -12.573 3.782  1.00 73.78  ? 816  LYS A CG    1 
ATOM   6661 C  CD    . LYS A 1 816 ? 17.448  -11.934 4.134  1.00 77.12  ? 816  LYS A CD    1 
ATOM   6662 C  CE    . LYS A 1 816 ? 17.454  -11.232 5.496  1.00 78.02  ? 816  LYS A CE    1 
ATOM   6663 N  NZ    . LYS A 1 816 ? 18.259  -9.980  5.489  1.00 79.52  ? 816  LYS A NZ    1 
ATOM   6664 N  N     . GLY A 1 817 ? 16.844  -15.593 2.764  1.00 74.09  ? 817  GLY A N     1 
ATOM   6665 C  CA    . GLY A 1 817 ? 16.619  -16.251 1.476  1.00 78.65  ? 817  GLY A CA    1 
ATOM   6666 C  C     . GLY A 1 817 ? 16.142  -17.687 1.603  1.00 80.64  ? 817  GLY A C     1 
ATOM   6667 O  O     . GLY A 1 817 ? 15.812  -18.330 0.604  1.00 82.45  ? 817  GLY A O     1 
ATOM   6668 N  N     . ASN A 1 818 ? 16.138  -18.196 2.834  1.00 80.44  ? 818  ASN A N     1 
ATOM   6669 C  CA    . ASN A 1 818 ? 15.504  -19.462 3.155  1.00 80.67  ? 818  ASN A CA    1 
ATOM   6670 C  C     . ASN A 1 818 ? 14.010  -19.180 3.160  1.00 81.95  ? 818  ASN A C     1 
ATOM   6671 O  O     . ASN A 1 818 ? 13.533  -18.344 3.931  1.00 80.69  ? 818  ASN A O     1 
ATOM   6672 C  CB    . ASN A 1 818 ? 15.978  -19.950 4.525  1.00 79.25  ? 818  ASN A CB    1 
ATOM   6673 C  CG    . ASN A 1 818 ? 15.699  -21.425 4.768  1.00 77.94  ? 818  ASN A CG    1 
ATOM   6674 O  OD1   . ASN A 1 818 ? 15.012  -22.092 3.992  1.00 78.55  ? 818  ASN A OD1   1 
ATOM   6675 N  ND2   . ASN A 1 818 ? 16.237  -21.939 5.867  1.00 73.90  ? 818  ASN A ND2   1 
ATOM   6676 N  N     . ILE A 1 819 ? 13.284  -19.863 2.279  1.00 85.34  ? 819  ILE A N     1 
ATOM   6677 C  CA    . ILE A 1 819 ? 11.892  -19.519 1.970  1.00 86.04  ? 819  ILE A CA    1 
ATOM   6678 C  C     . ILE A 1 819 ? 10.926  -19.836 3.119  1.00 83.72  ? 819  ILE A C     1 
ATOM   6679 O  O     . ILE A 1 819 ? 10.092  -19.002 3.484  1.00 82.89  ? 819  ILE A O     1 
ATOM   6680 C  CB    . ILE A 1 819 ? 11.409  -20.198 0.643  1.00 89.27  ? 819  ILE A CB    1 
ATOM   6681 C  CG1   . ILE A 1 819 ? 12.528  -20.233 -0.422 1.00 92.63  ? 819  ILE A CG1   1 
ATOM   6682 C  CG2   . ILE A 1 819 ? 10.110  -19.548 0.121  1.00 89.60  ? 819  ILE A CG2   1 
ATOM   6683 C  CD1   . ILE A 1 819 ? 12.913  -18.873 -1.047 1.00 93.93  ? 819  ILE A CD1   1 
ATOM   6684 N  N     . ASP A 1 820 ? 11.051  -21.029 3.692  1.00 82.19  ? 820  ASP A N     1 
ATOM   6685 C  CA    . ASP A 1 820 ? 10.118  -21.471 4.728  1.00 80.15  ? 820  ASP A CA    1 
ATOM   6686 C  C     . ASP A 1 820 ? 10.738  -21.613 6.126  1.00 76.70  ? 820  ASP A C     1 
ATOM   6687 O  O     . ASP A 1 820 ? 10.239  -22.364 6.967  1.00 75.58  ? 820  ASP A O     1 
ATOM   6688 C  CB    . ASP A 1 820 ? 9.389   -22.757 4.294  1.00 82.86  ? 820  ASP A CB    1 
ATOM   6689 C  CG    . ASP A 1 820 ? 10.323  -23.798 3.685  1.00 84.97  ? 820  ASP A CG    1 
ATOM   6690 O  OD1   . ASP A 1 820 ? 9.896   -24.475 2.723  1.00 84.85  ? 820  ASP A OD1   1 
ATOM   6691 O  OD2   . ASP A 1 820 ? 11.474  -23.942 4.163  1.00 85.54  ? 820  ASP A OD2   1 
ATOM   6692 N  N     . ALA A 1 821 ? 11.819  -20.880 6.374  1.00 73.75  ? 821  ALA A N     1 
ATOM   6693 C  CA    . ALA A 1 821 ? 12.379  -20.796 7.717  1.00 69.96  ? 821  ALA A CA    1 
ATOM   6694 C  C     . ALA A 1 821 ? 11.464  -19.921 8.574  1.00 67.23  ? 821  ALA A C     1 
ATOM   6695 O  O     . ALA A 1 821 ? 11.075  -18.833 8.137  1.00 66.80  ? 821  ALA A O     1 
ATOM   6696 C  CB    . ALA A 1 821 ? 13.773  -20.221 7.669  1.00 70.06  ? 821  ALA A CB    1 
ATOM   6697 N  N     . PRO A 1 822 ? 11.097  -20.400 9.785  1.00 64.47  ? 822  PRO A N     1 
ATOM   6698 C  CA    . PRO A 1 822 ? 10.183  -19.682 10.685 1.00 60.63  ? 822  PRO A CA    1 
ATOM   6699 C  C     . PRO A 1 822 ? 10.724  -18.332 11.136 1.00 58.10  ? 822  PRO A C     1 
ATOM   6700 O  O     . PRO A 1 822 ? 11.794  -18.263 11.739 1.00 57.16  ? 822  PRO A O     1 
ATOM   6701 C  CB    . PRO A 1 822 ? 10.058  -20.625 11.886 1.00 59.91  ? 822  PRO A CB    1 
ATOM   6702 C  CG    . PRO A 1 822 ? 10.368  -21.965 11.348 1.00 62.68  ? 822  PRO A CG    1 
ATOM   6703 C  CD    . PRO A 1 822 ? 11.428  -21.738 10.310 1.00 64.75  ? 822  PRO A CD    1 
ATOM   6704 N  N     . GLN A 1 823 ? 9.991   -17.266 10.828 1.00 56.61  ? 823  GLN A N     1 
ATOM   6705 C  CA    . GLN A 1 823 ? 10.372  -15.928 11.266 1.00 55.40  ? 823  GLN A CA    1 
ATOM   6706 C  C     . GLN A 1 823 ? 10.062  -15.742 12.750 1.00 53.17  ? 823  GLN A C     1 
ATOM   6707 O  O     . GLN A 1 823 ? 9.053   -16.242 13.254 1.00 51.14  ? 823  GLN A O     1 
ATOM   6708 C  CB    . GLN A 1 823 ? 9.660   -14.845 10.445 1.00 55.88  ? 823  GLN A CB    1 
ATOM   6709 C  CG    . GLN A 1 823 ? 10.089  -14.742 8.979  1.00 58.88  ? 823  GLN A CG    1 
ATOM   6710 C  CD    . GLN A 1 823 ? 11.509  -14.204 8.774  1.00 61.65  ? 823  GLN A CD    1 
ATOM   6711 O  OE1   . GLN A 1 823 ? 12.204  -14.625 7.850  1.00 64.78  ? 823  GLN A OE1   1 
ATOM   6712 N  NE2   . GLN A 1 823 ? 11.936  -13.268 9.619  1.00 59.95  ? 823  GLN A NE2   1 
ATOM   6713 N  N     . VAL A 1 824 ? 10.947  -15.030 13.441 1.00 51.59  ? 824  VAL A N     1 
ATOM   6714 C  CA    . VAL A 1 824 ? 10.727  -14.660 14.829 1.00 50.08  ? 824  VAL A CA    1 
ATOM   6715 C  C     . VAL A 1 824 ? 9.649   -13.577 14.869 1.00 50.45  ? 824  VAL A C     1 
ATOM   6716 O  O     . VAL A 1 824 ? 9.704   -12.619 14.102 1.00 50.92  ? 824  VAL A O     1 
ATOM   6717 C  CB    . VAL A 1 824 ? 12.036  -14.168 15.489 1.00 48.45  ? 824  VAL A CB    1 
ATOM   6718 C  CG1   . VAL A 1 824 ? 11.768  -13.505 16.831 1.00 46.53  ? 824  VAL A CG1   1 
ATOM   6719 C  CG2   . VAL A 1 824 ? 13.019  -15.324 15.648 1.00 50.14  ? 824  VAL A CG2   1 
ATOM   6720 N  N     . VAL A 1 825 ? 8.663   -13.751 15.744 1.00 50.47  ? 825  VAL A N     1 
ATOM   6721 C  CA    . VAL A 1 825 ? 7.575   -12.790 15.879 1.00 52.50  ? 825  VAL A CA    1 
ATOM   6722 C  C     . VAL A 1 825 ? 7.853   -11.819 17.028 1.00 53.25  ? 825  VAL A C     1 
ATOM   6723 O  O     . VAL A 1 825 ? 8.038   -12.229 18.182 1.00 53.53  ? 825  VAL A O     1 
ATOM   6724 C  CB    . VAL A 1 825 ? 6.196   -13.493 16.080 1.00 53.93  ? 825  VAL A CB    1 
ATOM   6725 C  CG1   . VAL A 1 825 ? 5.059   -12.466 16.208 1.00 54.80  ? 825  VAL A CG1   1 
ATOM   6726 C  CG2   . VAL A 1 825 ? 5.906   -14.462 14.939 1.00 52.09  ? 825  VAL A CG2   1 
ATOM   6727 N  N     . GLU A 1 826 ? 7.892   -10.533 16.693 1.00 54.30  ? 826  GLU A N     1 
ATOM   6728 C  CA    . GLU A 1 826 ? 8.018   -9.458  17.674 1.00 55.15  ? 826  GLU A CA    1 
ATOM   6729 C  C     . GLU A 1 826 ? 7.077   -9.687  18.859 1.00 54.15  ? 826  GLU A C     1 
ATOM   6730 O  O     . GLU A 1 826 ? 5.898   -9.996  18.679 1.00 56.06  ? 826  GLU A O     1 
ATOM   6731 C  CB    . GLU A 1 826 ? 7.768   -8.099  16.992 1.00 57.19  ? 826  GLU A CB    1 
ATOM   6732 C  CG    . GLU A 1 826 ? 7.423   -6.917  17.912 1.00 60.61  ? 826  GLU A CG    1 
ATOM   6733 C  CD    . GLU A 1 826 ? 8.594   -6.428  18.754 1.00 62.81  ? 826  GLU A CD    1 
ATOM   6734 O  OE1   . GLU A 1 826 ? 8.336   -5.895  19.857 1.00 64.56  ? 826  GLU A OE1   1 
ATOM   6735 O  OE2   . GLU A 1 826 ? 9.760   -6.565  18.319 1.00 63.19  ? 826  GLU A OE2   1 
ATOM   6736 N  N     . GLY A 1 827 ? 7.620   -9.567  20.067 1.00 54.17  ? 827  GLY A N     1 
ATOM   6737 C  CA    . GLY A 1 827 ? 6.844   -9.722  21.299 1.00 53.39  ? 827  GLY A CA    1 
ATOM   6738 C  C     . GLY A 1 827 ? 6.690   -11.153 21.786 1.00 51.89  ? 827  GLY A C     1 
ATOM   6739 O  O     . GLY A 1 827 ? 6.097   -11.388 22.842 1.00 51.43  ? 827  GLY A O     1 
ATOM   6740 N  N     . GLU A 1 828 ? 7.219   -12.104 21.017 1.00 50.56  ? 828  GLU A N     1 
ATOM   6741 C  CA    . GLU A 1 828 ? 7.104   -13.528 21.345 1.00 50.65  ? 828  GLU A CA    1 
ATOM   6742 C  C     . GLU A 1 828 ? 8.421   -14.116 21.858 1.00 46.70  ? 828  GLU A C     1 
ATOM   6743 O  O     . GLU A 1 828 ? 9.448   -13.441 21.855 1.00 46.54  ? 828  GLU A O     1 
ATOM   6744 C  CB    . GLU A 1 828 ? 6.538   -14.318 20.157 1.00 53.32  ? 828  GLU A CB    1 
ATOM   6745 C  CG    . GLU A 1 828 ? 5.100   -13.912 19.797 1.00 59.64  ? 828  GLU A CG    1 
ATOM   6746 C  CD    . GLU A 1 828 ? 4.215   -15.095 19.421 1.00 65.46  ? 828  GLU A CD    1 
ATOM   6747 O  OE1   . GLU A 1 828 ? 3.302   -15.417 20.212 1.00 68.38  ? 828  GLU A OE1   1 
ATOM   6748 O  OE2   . GLU A 1 828 ? 4.427   -15.705 18.347 1.00 67.95  ? 828  GLU A OE2   1 
ATOM   6749 N  N     . LYS A 1 829 ? 8.393   -15.366 22.303 1.00 43.16  ? 829  LYS A N     1 
ATOM   6750 C  CA    . LYS A 1 829 ? 9.522   -15.911 23.054 1.00 41.27  ? 829  LYS A CA    1 
ATOM   6751 C  C     . LYS A 1 829 ? 10.524  -16.696 22.214 1.00 40.72  ? 829  LYS A C     1 
ATOM   6752 O  O     . LYS A 1 829 ? 10.138  -17.429 21.296 1.00 42.19  ? 829  LYS A O     1 
ATOM   6753 C  CB    . LYS A 1 829 ? 9.026   -16.737 24.245 1.00 41.89  ? 829  LYS A CB    1 
ATOM   6754 C  CG    . LYS A 1 829 ? 8.289   -15.899 25.283 1.00 41.90  ? 829  LYS A CG    1 
ATOM   6755 C  CD    . LYS A 1 829 ? 8.565   -16.362 26.700 1.00 42.58  ? 829  LYS A CD    1 
ATOM   6756 C  CE    . LYS A 1 829 ? 7.745   -15.566 27.703 1.00 43.57  ? 829  LYS A CE    1 
ATOM   6757 N  NZ    . LYS A 1 829 ? 8.034   -16.020 29.083 1.00 48.75  ? 829  LYS A NZ    1 
ATOM   6758 N  N     . VAL A 1 830 ? 11.813  -16.517 22.512 1.00 37.29  ? 830  VAL A N     1 
ATOM   6759 C  CA    . VAL A 1 830 ? 12.866  -17.248 21.801 1.00 36.88  ? 830  VAL A CA    1 
ATOM   6760 C  C     . VAL A 1 830 ? 13.754  -18.063 22.725 1.00 34.98  ? 830  VAL A C     1 
ATOM   6761 O  O     . VAL A 1 830 ? 14.005  -17.671 23.860 1.00 35.80  ? 830  VAL A O     1 
ATOM   6762 C  CB    . VAL A 1 830 ? 13.778  -16.335 20.911 1.00 37.19  ? 830  VAL A CB    1 
ATOM   6763 C  CG1   . VAL A 1 830 ? 13.016  -15.811 19.711 1.00 42.10  ? 830  VAL A CG1   1 
ATOM   6764 C  CG2   . VAL A 1 830 ? 14.393  -15.194 21.703 1.00 37.08  ? 830  VAL A CG2   1 
ATOM   6765 N  N     . TYR A 1 831 ? 14.216  -19.200 22.222 1.00 34.01  ? 831  TYR A N     1 
ATOM   6766 C  CA    . TYR A 1 831 ? 15.386  -19.871 22.775 1.00 33.52  ? 831  TYR A CA    1 
ATOM   6767 C  C     . TYR A 1 831 ? 16.638  -19.099 22.391 1.00 34.81  ? 831  TYR A C     1 
ATOM   6768 O  O     . TYR A 1 831 ? 16.686  -18.485 21.327 1.00 36.56  ? 831  TYR A O     1 
ATOM   6769 C  CB    . TYR A 1 831 ? 15.500  -21.289 22.238 1.00 32.81  ? 831  TYR A CB    1 
ATOM   6770 C  CG    . TYR A 1 831 ? 14.431  -22.210 22.735 1.00 31.22  ? 831  TYR A CG    1 
ATOM   6771 C  CD1   . TYR A 1 831 ? 14.100  -22.264 24.093 1.00 28.99  ? 831  TYR A CD1   1 
ATOM   6772 C  CD2   . TYR A 1 831 ? 13.757  -23.045 21.859 1.00 31.29  ? 831  TYR A CD2   1 
ATOM   6773 C  CE1   . TYR A 1 831 ? 13.112  -23.125 24.555 1.00 29.37  ? 831  TYR A CE1   1 
ATOM   6774 C  CE2   . TYR A 1 831 ? 12.779  -23.913 22.308 1.00 30.11  ? 831  TYR A CE2   1 
ATOM   6775 C  CZ    . TYR A 1 831 ? 12.455  -23.951 23.649 1.00 32.20  ? 831  TYR A CZ    1 
ATOM   6776 O  OH    . TYR A 1 831 ? 11.467  -24.812 24.079 1.00 35.55  ? 831  TYR A OH    1 
ATOM   6777 N  N     . VAL A 1 832 ? 17.645  -19.134 23.260 1.00 34.58  ? 832  VAL A N     1 
ATOM   6778 C  CA    . VAL A 1 832 ? 18.882  -18.389 23.054 1.00 33.76  ? 832  VAL A CA    1 
ATOM   6779 C  C     . VAL A 1 832 ? 20.058  -19.256 23.462 1.00 36.09  ? 832  VAL A C     1 
ATOM   6780 O  O     . VAL A 1 832 ? 20.067  -19.807 24.564 1.00 36.21  ? 832  VAL A O     1 
ATOM   6781 C  CB    . VAL A 1 832 ? 18.939  -17.104 23.916 1.00 34.00  ? 832  VAL A CB    1 
ATOM   6782 C  CG1   . VAL A 1 832 ? 20.158  -16.248 23.531 1.00 32.01  ? 832  VAL A CG1   1 
ATOM   6783 C  CG2   . VAL A 1 832 ? 17.641  -16.287 23.807 1.00 31.72  ? 832  VAL A CG2   1 
ATOM   6784 N  N     . LEU A 1 833 ? 21.046  -19.367 22.578 1.00 35.69  ? 833  LEU A N     1 
ATOM   6785 C  CA    . LEU A 1 833 ? 22.270  -20.102 22.864 1.00 35.23  ? 833  LEU A CA    1 
ATOM   6786 C  C     . LEU A 1 833 ? 23.506  -19.280 22.511 1.00 36.84  ? 833  LEU A C     1 
ATOM   6787 O  O     . LEU A 1 833 ? 23.558  -18.662 21.440 1.00 34.47  ? 833  LEU A O     1 
ATOM   6788 C  CB    . LEU A 1 833 ? 22.309  -21.418 22.085 1.00 36.38  ? 833  LEU A CB    1 
ATOM   6789 C  CG    . LEU A 1 833 ? 21.464  -22.602 22.548 1.00 35.25  ? 833  LEU A CG    1 
ATOM   6790 C  CD1   . LEU A 1 833 ? 21.448  -23.668 21.474 1.00 38.23  ? 833  LEU A CD1   1 
ATOM   6791 C  CD2   . LEU A 1 833 ? 21.983  -23.181 23.848 1.00 38.13  ? 833  LEU A CD2   1 
ATOM   6792 N  N     . PRO A 1 834 ? 24.507  -19.274 23.414 1.00 38.34  ? 834  PRO A N     1 
ATOM   6793 C  CA    . PRO A 1 834 ? 25.817  -18.684 23.151 1.00 40.15  ? 834  PRO A CA    1 
ATOM   6794 C  C     . PRO A 1 834 ? 26.627  -19.498 22.146 1.00 41.60  ? 834  PRO A C     1 
ATOM   6795 O  O     . PRO A 1 834 ? 26.514  -20.726 22.090 1.00 40.64  ? 834  PRO A O     1 
ATOM   6796 C  CB    . PRO A 1 834 ? 26.500  -18.724 24.523 1.00 39.88  ? 834  PRO A CB    1 
ATOM   6797 C  CG    . PRO A 1 834 ? 25.845  -19.844 25.238 1.00 37.98  ? 834  PRO A CG    1 
ATOM   6798 C  CD    . PRO A 1 834 ? 24.411  -19.783 24.795 1.00 38.00  ? 834  PRO A CD    1 
ATOM   6799 N  N     . LEU A 1 835 ? 27.447  -18.799 21.370 1.00 45.03  ? 835  LEU A N     1 
ATOM   6800 C  CA    . LEU A 1 835 ? 28.245  -19.408 20.310 1.00 47.87  ? 835  LEU A CA    1 
ATOM   6801 C  C     . LEU A 1 835 ? 29.736  -19.214 20.565 1.00 48.84  ? 835  LEU A C     1 
ATOM   6802 O  O     . LEU A 1 835 ? 30.161  -18.137 20.994 1.00 48.58  ? 835  LEU A O     1 
ATOM   6803 C  CB    . LEU A 1 835 ? 27.851  -18.794 18.963 1.00 48.96  ? 835  LEU A CB    1 
ATOM   6804 C  CG    . LEU A 1 835 ? 26.740  -19.404 18.091 1.00 50.61  ? 835  LEU A CG    1 
ATOM   6805 C  CD1   . LEU A 1 835 ? 25.903  -20.483 18.767 1.00 50.72  ? 835  LEU A CD1   1 
ATOM   6806 C  CD2   . LEU A 1 835 ? 25.849  -18.304 17.539 1.00 50.66  ? 835  LEU A CD2   1 
ATOM   6807 N  N     . ARG A 1 836 ? 30.529  -20.255 20.311 1.00 50.74  ? 836  ARG A N     1 
ATOM   6808 C  CA    . ARG A 1 836 ? 31.988  -20.151 20.462 1.00 53.15  ? 836  ARG A CA    1 
ATOM   6809 C  C     . ARG A 1 836 ? 32.540  -19.158 19.444 1.00 54.86  ? 836  ARG A C     1 
ATOM   6810 O  O     . ARG A 1 836 ? 31.943  -18.951 18.381 1.00 52.92  ? 836  ARG A O     1 
ATOM   6811 C  CB    . ARG A 1 836 ? 32.679  -21.516 20.315 1.00 53.66  ? 836  ARG A CB    1 
ATOM   6812 C  CG    . ARG A 1 836 ? 32.222  -22.562 21.329 1.00 52.97  ? 836  ARG A CG    1 
ATOM   6813 C  CD    . ARG A 1 836 ? 33.158  -23.754 21.398 1.00 53.96  ? 836  ARG A CD    1 
ATOM   6814 N  NE    . ARG A 1 836 ? 33.441  -24.325 20.081 1.00 58.54  ? 836  ARG A NE    1 
ATOM   6815 C  CZ    . ARG A 1 836 ? 32.656  -25.192 19.447 1.00 57.96  ? 836  ARG A CZ    1 
ATOM   6816 N  NH1   . ARG A 1 836 ? 31.518  -25.596 20.000 1.00 53.10  ? 836  ARG A NH1   1 
ATOM   6817 N  NH2   . ARG A 1 836 ? 33.010  -25.651 18.253 1.00 56.50  ? 836  ARG A NH2   1 
ATOM   6818 N  N     . GLU A 1 837 ? 33.666  -18.532 19.774 1.00 57.42  ? 837  GLU A N     1 
ATOM   6819 C  CA    . GLU A 1 837 ? 34.273  -17.556 18.875 1.00 60.69  ? 837  GLU A CA    1 
ATOM   6820 C  C     . GLU A 1 837 ? 34.693  -18.198 17.545 1.00 60.17  ? 837  GLU A C     1 
ATOM   6821 O  O     . GLU A 1 837 ? 35.092  -19.364 17.508 1.00 59.08  ? 837  GLU A O     1 
ATOM   6822 C  CB    . GLU A 1 837 ? 35.453  -16.861 19.553 1.00 63.85  ? 837  GLU A CB    1 
ATOM   6823 C  CG    . GLU A 1 837 ? 35.780  -15.496 18.955 1.00 72.47  ? 837  GLU A CG    1 
ATOM   6824 C  CD    . GLU A 1 837 ? 36.345  -14.516 19.970 1.00 78.26  ? 837  GLU A CD    1 
ATOM   6825 O  OE1   . GLU A 1 837 ? 36.565  -14.910 21.139 1.00 79.76  ? 837  GLU A OE1   1 
ATOM   6826 O  OE2   . GLU A 1 837 ? 36.564  -13.343 19.593 1.00 80.77  ? 837  GLU A OE2   1 
ATOM   6827 N  N     . GLY A 1 838 ? 34.556  -17.440 16.459 1.00 59.83  ? 838  GLY A N     1 
ATOM   6828 C  CA    . GLY A 1 838 ? 34.959  -17.893 15.129 1.00 60.97  ? 838  GLY A CA    1 
ATOM   6829 C  C     . GLY A 1 838 ? 33.924  -18.728 14.400 1.00 60.41  ? 838  GLY A C     1 
ATOM   6830 O  O     . GLY A 1 838 ? 34.209  -19.278 13.334 1.00 61.94  ? 838  GLY A O     1 
ATOM   6831 N  N     . ASN A 1 839 ? 32.724  -18.822 14.978 1.00 57.60  ? 839  ASN A N     1 
ATOM   6832 C  CA    . ASN A 1 839 ? 31.583  -19.519 14.366 1.00 55.34  ? 839  ASN A CA    1 
ATOM   6833 C  C     . ASN A 1 839 ? 31.184  -18.896 13.029 1.00 55.22  ? 839  ASN A C     1 
ATOM   6834 O  O     . ASN A 1 839 ? 31.496  -17.727 12.790 1.00 56.73  ? 839  ASN A O     1 
ATOM   6835 C  CB    . ASN A 1 839 ? 30.386  -19.521 15.332 1.00 53.81  ? 839  ASN A CB    1 
ATOM   6836 C  CG    . ASN A 1 839 ? 29.774  -18.144 15.512 1.00 51.72  ? 839  ASN A CG    1 
ATOM   6837 O  OD1   . ASN A 1 839 ? 29.039  -17.668 14.652 1.00 54.83  ? 839  ASN A OD1   1 
ATOM   6838 N  ND2   . ASN A 1 839 ? 30.076  -17.498 16.634 1.00 47.45  ? 839  ASN A ND2   1 
ATOM   6839 N  N     . PRO A 1 840 ? 30.484  -19.660 12.159 1.00 55.05  ? 840  PRO A N     1 
ATOM   6840 C  CA    . PRO A 1 840 ? 30.142  -19.136 10.829 1.00 56.34  ? 840  PRO A CA    1 
ATOM   6841 C  C     . PRO A 1 840 ? 28.868  -18.271 10.807 1.00 57.03  ? 840  PRO A C     1 
ATOM   6842 O  O     . PRO A 1 840 ? 28.353  -17.951 9.725  1.00 57.57  ? 840  PRO A O     1 
ATOM   6843 C  CB    . PRO A 1 840 ? 29.968  -20.405 9.986  1.00 55.75  ? 840  PRO A CB    1 
ATOM   6844 C  CG    . PRO A 1 840 ? 29.617  -21.480 10.950 1.00 54.66  ? 840  PRO A CG    1 
ATOM   6845 C  CD    . PRO A 1 840 ? 29.956  -21.021 12.353 1.00 53.63  ? 840  PRO A CD    1 
ATOM   6846 N  N     . PHE A 1 841 ? 28.378  -17.905 11.995 1.00 55.01  ? 841  PHE A N     1 
ATOM   6847 C  CA    . PHE A 1 841 ? 27.262  -16.970 12.138 1.00 53.12  ? 841  PHE A CA    1 
ATOM   6848 C  C     . PHE A 1 841 ? 27.756  -15.547 12.372 1.00 53.19  ? 841  PHE A C     1 
ATOM   6849 O  O     . PHE A 1 841 ? 27.012  -14.585 12.174 1.00 53.12  ? 841  PHE A O     1 
ATOM   6850 C  CB    . PHE A 1 841 ? 26.347  -17.394 13.281 1.00 51.01  ? 841  PHE A CB    1 
ATOM   6851 C  CG    . PHE A 1 841 ? 25.702  -18.730 13.074 1.00 51.85  ? 841  PHE A CG    1 
ATOM   6852 C  CD1   . PHE A 1 841 ? 24.561  -18.850 12.283 1.00 51.62  ? 841  PHE A CD1   1 
ATOM   6853 C  CD2   . PHE A 1 841 ? 26.235  -19.871 13.668 1.00 51.78  ? 841  PHE A CD2   1 
ATOM   6854 C  CE1   . PHE A 1 841 ? 23.961  -20.089 12.088 1.00 52.01  ? 841  PHE A CE1   1 
ATOM   6855 C  CE2   . PHE A 1 841 ? 25.642  -21.113 13.481 1.00 51.41  ? 841  PHE A CE2   1 
ATOM   6856 C  CZ    . PHE A 1 841 ? 24.502  -21.223 12.690 1.00 52.42  ? 841  PHE A CZ    1 
ATOM   6857 N  N     . GLY A 1 842 ? 29.009  -15.420 12.801 1.00 53.20  ? 842  GLY A N     1 
ATOM   6858 C  CA    . GLY A 1 842 ? 29.650  -14.116 12.929 1.00 55.66  ? 842  GLY A CA    1 
ATOM   6859 C  C     . GLY A 1 842 ? 29.255  -13.324 14.161 1.00 55.44  ? 842  GLY A C     1 
ATOM   6860 O  O     . GLY A 1 842 ? 29.510  -12.119 14.233 1.00 55.91  ? 842  GLY A O     1 
ATOM   6861 N  N     . ASP A 1 843 ? 28.629  -13.993 15.127 1.00 53.78  ? 843  ASP A N     1 
ATOM   6862 C  CA    . ASP A 1 843 ? 28.332  -13.365 16.407 1.00 52.69  ? 843  ASP A CA    1 
ATOM   6863 C  C     . ASP A 1 843 ? 28.286  -14.345 17.569 1.00 50.14  ? 843  ASP A C     1 
ATOM   6864 O  O     . ASP A 1 843 ? 28.315  -15.561 17.377 1.00 48.87  ? 843  ASP A O     1 
ATOM   6865 C  CB    . ASP A 1 843 ? 27.047  -12.531 16.344 1.00 53.92  ? 843  ASP A CB    1 
ATOM   6866 C  CG    . ASP A 1 843 ? 27.201  -11.175 17.024 1.00 55.64  ? 843  ASP A CG    1 
ATOM   6867 O  OD1   . ASP A 1 843 ? 28.056  -11.047 17.933 1.00 53.83  ? 843  ASP A OD1   1 
ATOM   6868 O  OD2   . ASP A 1 843 ? 26.474  -10.235 16.640 1.00 56.82  ? 843  ASP A OD2   1 
ATOM   6869 N  N     . LYS A 1 844 ? 28.201  -13.790 18.775 1.00 49.49  ? 844  LYS A N     1 
ATOM   6870 C  CA    . LYS A 1 844 ? 28.374  -14.537 20.022 1.00 46.64  ? 844  LYS A CA    1 
ATOM   6871 C  C     . LYS A 1 844 ? 27.140  -15.291 20.526 1.00 45.14  ? 844  LYS A C     1 
ATOM   6872 O  O     . LYS A 1 844 ? 27.226  -16.012 21.531 1.00 43.50  ? 844  LYS A O     1 
ATOM   6873 C  CB    . LYS A 1 844 ? 28.909  -13.609 21.118 1.00 47.89  ? 844  LYS A CB    1 
ATOM   6874 C  CG    . LYS A 1 844 ? 28.112  -12.322 21.319 1.00 48.21  ? 844  LYS A CG    1 
ATOM   6875 C  CD    . LYS A 1 844 ? 28.686  -11.506 22.472 1.00 50.49  ? 844  LYS A CD    1 
ATOM   6876 C  CE    . LYS A 1 844 ? 27.876  -10.243 22.718 1.00 51.36  ? 844  LYS A CE    1 
ATOM   6877 N  NZ    . LYS A 1 844 ? 28.194  -9.626  24.037 1.00 48.94  ? 844  LYS A NZ    1 
ATOM   6878 N  N     . CYS A 1 845 ? 26.006  -15.134 19.840 1.00 41.75  ? 845  CYS A N     1 
ATOM   6879 C  CA    . CYS A 1 845 ? 24.803  -15.865 20.205 1.00 41.76  ? 845  CYS A CA    1 
ATOM   6880 C  C     . CYS A 1 845 ? 23.813  -16.018 19.053 1.00 42.59  ? 845  CYS A C     1 
ATOM   6881 O  O     . CYS A 1 845 ? 23.856  -15.251 18.094 1.00 46.74  ? 845  CYS A O     1 
ATOM   6882 C  CB    . CYS A 1 845 ? 24.115  -15.190 21.397 1.00 42.12  ? 845  CYS A CB    1 
ATOM   6883 S  SG    . CYS A 1 845 ? 23.591  -13.498 21.096 1.00 43.91  ? 845  CYS A SG    1 
ATOM   6884 N  N     . ILE A 1 846 ? 22.927  -17.013 19.158 1.00 39.06  ? 846  ILE A N     1 
ATOM   6885 C  CA    . ILE A 1 846 ? 21.822  -17.197 18.217 1.00 35.25  ? 846  ILE A CA    1 
ATOM   6886 C  C     . ILE A 1 846 ? 20.503  -17.382 18.964 1.00 34.30  ? 846  ILE A C     1 
ATOM   6887 O  O     . ILE A 1 846 ? 20.481  -17.869 20.088 1.00 35.16  ? 846  ILE A O     1 
ATOM   6888 C  CB    . ILE A 1 846 ? 22.072  -18.391 17.243 1.00 36.81  ? 846  ILE A CB    1 
ATOM   6889 C  CG1   . ILE A 1 846 ? 21.172  -18.290 16.005 1.00 33.53  ? 846  ILE A CG1   1 
ATOM   6890 C  CG2   . ILE A 1 846 ? 21.887  -19.734 17.942 1.00 36.71  ? 846  ILE A CG2   1 
ATOM   6891 C  CD1   . ILE A 1 846 ? 21.550  -19.225 14.911 1.00 34.29  ? 846  ILE A CD1   1 
ATOM   6892 N  N     . ALA A 1 847 ? 19.404  -16.992 18.331 1.00 36.07  ? 847  ALA A N     1 
ATOM   6893 C  CA    . ALA A 1 847 ? 18.077  -17.138 18.924 1.00 34.76  ? 847  ALA A CA    1 
ATOM   6894 C  C     . ALA A 1 847 ? 17.018  -17.512 17.884 1.00 35.07  ? 847  ALA A C     1 
ATOM   6895 O  O     . ALA A 1 847 ? 16.991  -16.956 16.788 1.00 32.89  ? 847  ALA A O     1 
ATOM   6896 C  CB    . ALA A 1 847 ? 17.688  -15.865 19.649 1.00 34.89  ? 847  ALA A CB    1 
ATOM   6897 N  N     . TRP A 1 848 ? 16.152  -18.461 18.239 1.00 35.70  ? 848  TRP A N     1 
ATOM   6898 C  CA    . TRP A 1 848 ? 15.069  -18.902 17.368 1.00 34.86  ? 848  TRP A CA    1 
ATOM   6899 C  C     . TRP A 1 848 ? 13.797  -19.082 18.184 1.00 38.42  ? 848  TRP A C     1 
ATOM   6900 O  O     . TRP A 1 848 ? 13.881  -19.219 19.407 1.00 38.72  ? 848  TRP A O     1 
ATOM   6901 C  CB    . TRP A 1 848 ? 15.447  -20.203 16.667 1.00 35.67  ? 848  TRP A CB    1 
ATOM   6902 C  CG    . TRP A 1 848 ? 15.433  -21.413 17.544 1.00 33.91  ? 848  TRP A CG    1 
ATOM   6903 C  CD1   . TRP A 1 848 ? 14.443  -22.354 17.626 1.00 33.91  ? 848  TRP A CD1   1 
ATOM   6904 C  CD2   . TRP A 1 848 ? 16.458  -21.827 18.459 1.00 32.66  ? 848  TRP A CD2   1 
ATOM   6905 N  NE1   . TRP A 1 848 ? 14.786  -23.323 18.544 1.00 35.47  ? 848  TRP A NE1   1 
ATOM   6906 C  CE2   . TRP A 1 848 ? 16.019  -23.025 19.064 1.00 34.59  ? 848  TRP A CE2   1 
ATOM   6907 C  CE3   . TRP A 1 848 ? 17.700  -21.298 18.830 1.00 31.17  ? 848  TRP A CE3   1 
ATOM   6908 C  CZ2   . TRP A 1 848 ? 16.782  -23.705 20.017 1.00 35.31  ? 848  TRP A CZ2   1 
ATOM   6909 C  CZ3   . TRP A 1 848 ? 18.462  -21.981 19.773 1.00 32.43  ? 848  TRP A CZ3   1 
ATOM   6910 C  CH2   . TRP A 1 848 ? 17.998  -23.168 20.356 1.00 33.79  ? 848  TRP A CH2   1 
ATOM   6911 N  N     . PRO A 1 849 ? 12.616  -19.103 17.520 1.00 40.32  ? 849  PRO A N     1 
ATOM   6912 C  CA    . PRO A 1 849 ? 11.349  -19.153 18.254 1.00 41.91  ? 849  PRO A CA    1 
ATOM   6913 C  C     . PRO A 1 849 ? 11.265  -20.336 19.209 1.00 43.86  ? 849  PRO A C     1 
ATOM   6914 O  O     . PRO A 1 849 ? 11.631  -21.456 18.846 1.00 44.42  ? 849  PRO A O     1 
ATOM   6915 C  CB    . PRO A 1 849 ? 10.295  -19.285 17.141 1.00 42.18  ? 849  PRO A CB    1 
ATOM   6916 C  CG    . PRO A 1 849 ? 10.927  -18.665 15.958 1.00 41.39  ? 849  PRO A CG    1 
ATOM   6917 C  CD    . PRO A 1 849 ? 12.386  -19.062 16.062 1.00 41.50  ? 849  PRO A CD    1 
ATOM   6918 N  N     . SER A 1 850 ? 10.800  -20.065 20.425 1.00 45.63  ? 850  SER A N     1 
ATOM   6919 C  CA    . SER A 1 850 ? 10.693  -21.075 21.466 1.00 47.99  ? 850  SER A CA    1 
ATOM   6920 C  C     . SER A 1 850 ? 9.594   -22.078 21.146 1.00 51.24  ? 850  SER A C     1 
ATOM   6921 O  O     . SER A 1 850 ? 8.655   -21.780 20.394 1.00 50.65  ? 850  SER A O     1 
ATOM   6922 C  CB    . SER A 1 850 ? 10.411  -20.417 22.812 1.00 47.45  ? 850  SER A CB    1 
ATOM   6923 O  OG    . SER A 1 850 ? 9.110   -19.847 22.833 1.00 46.44  ? 850  SER A OG    1 
ATOM   6924 N  N     . GLY A 1 851 ? 9.722   -23.267 21.729 1.00 53.72  ? 851  GLY A N     1 
ATOM   6925 C  CA    . GLY A 1 851 ? 8.774   -24.353 21.512 1.00 56.79  ? 851  GLY A CA    1 
ATOM   6926 C  C     . GLY A 1 851 ? 9.001   -25.108 20.216 1.00 59.25  ? 851  GLY A C     1 
ATOM   6927 O  O     . GLY A 1 851 ? 8.304   -26.089 19.935 1.00 61.96  ? 851  GLY A O     1 
ATOM   6928 N  N     . THR A 1 852 ? 9.970   -24.654 19.424 1.00 58.52  ? 852  THR A N     1 
ATOM   6929 C  CA    . THR A 1 852 ? 10.233  -25.247 18.114 1.00 58.75  ? 852  THR A CA    1 
ATOM   6930 C  C     . THR A 1 852 ? 11.675  -25.739 18.018 1.00 59.88  ? 852  THR A C     1 
ATOM   6931 O  O     . THR A 1 852 ? 12.584  -25.172 18.636 1.00 58.83  ? 852  THR A O     1 
ATOM   6932 C  CB    . THR A 1 852 ? 9.970   -24.248 16.955 1.00 56.92  ? 852  THR A CB    1 
ATOM   6933 O  OG1   . THR A 1 852 ? 10.980  -23.235 16.962 1.00 56.96  ? 852  THR A OG1   1 
ATOM   6934 C  CG2   . THR A 1 852 ? 8.589   -23.591 17.069 1.00 53.01  ? 852  THR A CG2   1 
ATOM   6935 N  N     . GLU A 1 853 ? 11.868  -26.810 17.252 1.00 61.44  ? 853  GLU A N     1 
ATOM   6936 C  CA    . GLU A 1 853 ? 13.196  -27.227 16.830 1.00 61.11  ? 853  GLU A CA    1 
ATOM   6937 C  C     . GLU A 1 853 ? 13.730  -26.169 15.875 1.00 59.62  ? 853  GLU A C     1 
ATOM   6938 O  O     . GLU A 1 853 ? 12.979  -25.605 15.069 1.00 59.80  ? 853  GLU A O     1 
ATOM   6939 C  CB    . GLU A 1 853 ? 13.144  -28.585 16.119 1.00 63.74  ? 853  GLU A CB    1 
ATOM   6940 C  CG    . GLU A 1 853 ? 12.759  -29.777 17.006 1.00 67.53  ? 853  GLU A CG    1 
ATOM   6941 C  CD    . GLU A 1 853 ? 13.880  -30.250 17.940 1.00 70.42  ? 853  GLU A CD    1 
ATOM   6942 O  OE1   . GLU A 1 853 ? 15.067  -29.900 17.728 1.00 69.87  ? 853  GLU A OE1   1 
ATOM   6943 O  OE2   . GLU A 1 853 ? 13.567  -30.988 18.899 1.00 72.48  ? 853  GLU A OE2   1 
ATOM   6944 N  N     . ILE A 1 854 ? 15.022  -25.885 15.973 1.00 58.58  ? 854  ILE A N     1 
ATOM   6945 C  CA    . ILE A 1 854 ? 15.643  -24.933 15.061 1.00 58.51  ? 854  ILE A CA    1 
ATOM   6946 C  C     . ILE A 1 854 ? 15.719  -25.552 13.656 1.00 60.45  ? 854  ILE A C     1 
ATOM   6947 O  O     . ILE A 1 854 ? 16.081  -26.726 13.504 1.00 61.71  ? 854  ILE A O     1 
ATOM   6948 C  CB    . ILE A 1 854 ? 17.021  -24.423 15.587 1.00 56.18  ? 854  ILE A CB    1 
ATOM   6949 C  CG1   . ILE A 1 854 ? 17.456  -23.167 14.831 1.00 58.06  ? 854  ILE A CG1   1 
ATOM   6950 C  CG2   . ILE A 1 854 ? 18.089  -25.513 15.526 1.00 56.67  ? 854  ILE A CG2   1 
ATOM   6951 C  CD1   . ILE A 1 854 ? 18.545  -22.377 15.517 1.00 59.71  ? 854  ILE A CD1   1 
ATOM   6952 N  N     . THR A 1 855 ? 15.335  -24.772 12.648 1.00 61.02  ? 855  THR A N     1 
ATOM   6953 C  CA    . THR A 1 855 ? 15.321  -25.234 11.250 1.00 63.41  ? 855  THR A CA    1 
ATOM   6954 C  C     . THR A 1 855 ? 16.577  -26.040 10.874 1.00 64.44  ? 855  THR A C     1 
ATOM   6955 O  O     . THR A 1 855 ? 17.701  -25.630 11.179 1.00 64.03  ? 855  THR A O     1 
ATOM   6956 C  CB    . THR A 1 855 ? 15.073  -24.067 10.255 1.00 63.08  ? 855  THR A CB    1 
ATOM   6957 O  OG1   . THR A 1 855 ? 15.137  -24.559 8.910  1.00 68.57  ? 855  THR A OG1   1 
ATOM   6958 C  CG2   . THR A 1 855 ? 16.091  -22.932 10.448 1.00 59.82  ? 855  THR A CG2   1 
ATOM   6959 N  N     . ASP A 1 856 ? 16.367  -27.183 10.217 1.00 66.79  ? 856  ASP A N     1 
ATOM   6960 C  CA    . ASP A 1 856 ? 17.425  -28.183 9.982  1.00 68.71  ? 856  ASP A CA    1 
ATOM   6961 C  C     . ASP A 1 856 ? 18.635  -27.652 9.211  1.00 69.10  ? 856  ASP A C     1 
ATOM   6962 O  O     . ASP A 1 856 ? 19.734  -28.205 9.309  1.00 69.35  ? 856  ASP A O     1 
ATOM   6963 C  CB    . ASP A 1 856 ? 16.854  -29.431 9.288  1.00 70.95  ? 856  ASP A CB    1 
ATOM   6964 C  CG    . ASP A 1 856 ? 15.792  -30.142 10.125 1.00 71.77  ? 856  ASP A CG    1 
ATOM   6965 O  OD1   . ASP A 1 856 ? 14.812  -30.638 9.533  1.00 75.08  ? 856  ASP A OD1   1 
ATOM   6966 O  OD2   . ASP A 1 856 ? 15.924  -30.205 11.368 1.00 71.32  ? 856  ASP A OD2   1 
ATOM   6967 N  N     . LEU A 1 857 ? 18.422  -26.567 8.472  1.00 68.94  ? 857  LEU A N     1 
ATOM   6968 C  CA    . LEU A 1 857 ? 19.448  -25.948 7.633  1.00 70.41  ? 857  LEU A CA    1 
ATOM   6969 C  C     . LEU A 1 857 ? 20.588  -25.315 8.417  1.00 68.22  ? 857  LEU A C     1 
ATOM   6970 O  O     . LEU A 1 857 ? 21.705  -25.209 7.912  1.00 70.86  ? 857  LEU A O     1 
ATOM   6971 C  CB    . LEU A 1 857 ? 18.802  -24.914 6.715  1.00 71.89  ? 857  LEU A CB    1 
ATOM   6972 C  CG    . LEU A 1 857 ? 17.820  -25.592 5.756  1.00 76.82  ? 857  LEU A CG    1 
ATOM   6973 C  CD1   . LEU A 1 857 ? 16.484  -24.847 5.682  1.00 76.87  ? 857  LEU A CD1   1 
ATOM   6974 C  CD2   . LEU A 1 857 ? 18.444  -25.852 4.369  1.00 76.61  ? 857  LEU A CD2   1 
ATOM   6975 N  N     . ILE A 1 858 ? 20.302  -24.892 9.644  1.00 64.84  ? 858  ILE A N     1 
ATOM   6976 C  CA    . ILE A 1 858 ? 21.310  -24.259 10.500 1.00 61.70  ? 858  ILE A CA    1 
ATOM   6977 C  C     . ILE A 1 858 ? 21.482  -24.972 11.842 1.00 60.05  ? 858  ILE A C     1 
ATOM   6978 O  O     . ILE A 1 858 ? 22.351  -24.607 12.640 1.00 58.59  ? 858  ILE A O     1 
ATOM   6979 C  CB    . ILE A 1 858 ? 21.011  -22.757 10.727 1.00 59.76  ? 858  ILE A CB    1 
ATOM   6980 C  CG1   . ILE A 1 858 ? 19.672  -22.573 11.450 1.00 55.51  ? 858  ILE A CG1   1 
ATOM   6981 C  CG2   . ILE A 1 858 ? 21.052  -22.005 9.392  1.00 59.96  ? 858  ILE A CG2   1 
ATOM   6982 C  CD1   . ILE A 1 858 ? 19.437  -21.173 11.959 1.00 55.25  ? 858  ILE A CD1   1 
ATOM   6983 N  N     . LYS A 1 859 ? 20.652  -25.989 12.079 1.00 59.81  ? 859  LYS A N     1 
ATOM   6984 C  CA    . LYS A 1 859 ? 20.746  -26.814 13.286 1.00 58.33  ? 859  LYS A CA    1 
ATOM   6985 C  C     . LYS A 1 859 ? 22.148  -27.399 13.434 1.00 58.43  ? 859  LYS A C     1 
ATOM   6986 O  O     . LYS A 1 859 ? 22.818  -27.165 14.443 1.00 57.31  ? 859  LYS A O     1 
ATOM   6987 C  CB    . LYS A 1 859 ? 19.688  -27.924 13.268 1.00 58.65  ? 859  LYS A CB    1 
ATOM   6988 C  CG    . LYS A 1 859 ? 19.661  -28.790 14.523 1.00 58.26  ? 859  LYS A CG    1 
ATOM   6989 C  CD    . LYS A 1 859 ? 18.437  -29.682 14.561 1.00 58.66  ? 859  LYS A CD    1 
ATOM   6990 C  CE    . LYS A 1 859 ? 18.536  -30.692 15.692 1.00 60.98  ? 859  LYS A CE    1 
ATOM   6991 N  NZ    . LYS A 1 859 ? 17.259  -31.445 15.867 1.00 61.97  ? 859  LYS A NZ    1 
ATOM   6992 N  N     . ASP A 1 860 ? 22.576  -28.145 12.417 1.00 60.25  ? 860  ASP A N     1 
ATOM   6993 C  CA    . ASP A 1 860 ? 23.936  -28.684 12.312 1.00 62.27  ? 860  ASP A CA    1 
ATOM   6994 C  C     . ASP A 1 860 ? 24.989  -27.757 12.914 1.00 59.50  ? 860  ASP A C     1 
ATOM   6995 O  O     . ASP A 1 860 ? 25.722  -28.143 13.825 1.00 57.74  ? 860  ASP A O     1 
ATOM   6996 C  CB    . ASP A 1 860 ? 24.283  -28.971 10.837 1.00 66.74  ? 860  ASP A CB    1 
ATOM   6997 C  CG    . ASP A 1 860 ? 23.982  -27.781 9.907  1.00 70.72  ? 860  ASP A CG    1 
ATOM   6998 O  OD1   . ASP A 1 860 ? 24.912  -27.297 9.220  1.00 73.96  ? 860  ASP A OD1   1 
ATOM   6999 O  OD2   . ASP A 1 860 ? 22.815  -27.329 9.860  1.00 71.19  ? 860  ASP A OD2   1 
ATOM   7000 N  N     . ASP A 1 861 ? 25.031  -26.531 12.401 1.00 58.52  ? 861  ASP A N     1 
ATOM   7001 C  CA    . ASP A 1 861 ? 26.028  -25.540 12.782 1.00 59.04  ? 861  ASP A CA    1 
ATOM   7002 C  C     . ASP A 1 861 ? 25.834  -25.051 14.212 1.00 56.34  ? 861  ASP A C     1 
ATOM   7003 O  O     . ASP A 1 861 ? 26.809  -24.851 14.941 1.00 55.93  ? 861  ASP A O     1 
ATOM   7004 C  CB    . ASP A 1 861 ? 26.025  -24.374 11.780 1.00 60.39  ? 861  ASP A CB    1 
ATOM   7005 C  CG    . ASP A 1 861 ? 26.623  -24.761 10.422 1.00 62.07  ? 861  ASP A CG    1 
ATOM   7006 O  OD1   . ASP A 1 861 ? 25.962  -24.521 9.385  1.00 62.05  ? 861  ASP A OD1   1 
ATOM   7007 O  OD2   . ASP A 1 861 ? 27.752  -25.310 10.396 1.00 61.73  ? 861  ASP A OD2   1 
ATOM   7008 N  N     . VAL A 1 862 ? 24.576  -24.879 14.616 1.00 54.31  ? 862  VAL A N     1 
ATOM   7009 C  CA    . VAL A 1 862 ? 24.269  -24.522 15.998 1.00 51.98  ? 862  VAL A CA    1 
ATOM   7010 C  C     . VAL A 1 862 ? 24.807  -25.584 16.969 1.00 51.92  ? 862  VAL A C     1 
ATOM   7011 O  O     . VAL A 1 862 ? 25.555  -25.252 17.888 1.00 51.27  ? 862  VAL A O     1 
ATOM   7012 C  CB    . VAL A 1 862 ? 22.760  -24.241 16.220 1.00 51.95  ? 862  VAL A CB    1 
ATOM   7013 C  CG1   . VAL A 1 862 ? 22.442  -24.120 17.700 1.00 50.73  ? 862  VAL A CG1   1 
ATOM   7014 C  CG2   . VAL A 1 862 ? 22.340  -22.964 15.502 1.00 50.81  ? 862  VAL A CG2   1 
ATOM   7015 N  N     . LEU A 1 863 ? 24.463  -26.852 16.745 1.00 51.59  ? 863  LEU A N     1 
ATOM   7016 C  CA    . LEU A 1 863 ? 24.968  -27.941 17.590 1.00 51.62  ? 863  LEU A CA    1 
ATOM   7017 C  C     . LEU A 1 863 ? 26.500  -27.979 17.650 1.00 53.05  ? 863  LEU A C     1 
ATOM   7018 O  O     . LEU A 1 863 ? 27.073  -28.244 18.711 1.00 52.74  ? 863  LEU A O     1 
ATOM   7019 C  CB    . LEU A 1 863 ? 24.447  -29.306 17.130 1.00 51.74  ? 863  LEU A CB    1 
ATOM   7020 C  CG    . LEU A 1 863 ? 22.961  -29.592 16.909 1.00 52.29  ? 863  LEU A CG    1 
ATOM   7021 C  CD1   . LEU A 1 863 ? 22.784  -31.071 16.600 1.00 52.60  ? 863  LEU A CD1   1 
ATOM   7022 C  CD2   . LEU A 1 863 ? 22.100  -29.194 18.101 1.00 53.40  ? 863  LEU A CD2   1 
ATOM   7023 N  N     . HIS A 1 864 ? 27.153  -27.712 16.518 1.00 54.59  ? 864  HIS A N     1 
ATOM   7024 C  CA    . HIS A 1 864 ? 28.614  -27.745 16.438 1.00 56.33  ? 864  HIS A CA    1 
ATOM   7025 C  C     . HIS A 1 864 ? 29.272  -26.579 17.186 1.00 54.33  ? 864  HIS A C     1 
ATOM   7026 O  O     . HIS A 1 864 ? 30.355  -26.741 17.760 1.00 55.63  ? 864  HIS A O     1 
ATOM   7027 C  CB    . HIS A 1 864 ? 29.078  -27.784 14.973 1.00 59.98  ? 864  HIS A CB    1 
ATOM   7028 C  CG    . HIS A 1 864 ? 30.534  -28.098 14.800 1.00 66.97  ? 864  HIS A CG    1 
ATOM   7029 N  ND1   . HIS A 1 864 ? 31.468  -27.142 14.454 1.00 70.43  ? 864  HIS A ND1   1 
ATOM   7030 C  CD2   . HIS A 1 864 ? 31.217  -29.262 14.920 1.00 70.72  ? 864  HIS A CD2   1 
ATOM   7031 C  CE1   . HIS A 1 864 ? 32.661  -27.703 14.369 1.00 71.97  ? 864  HIS A CE1   1 
ATOM   7032 N  NE2   . HIS A 1 864 ? 32.537  -28.989 14.646 1.00 73.43  ? 864  HIS A NE2   1 
ATOM   7033 N  N     . TRP A 1 865 ? 28.617  -25.417 17.200 1.00 50.82  ? 865  TRP A N     1 
ATOM   7034 C  CA    . TRP A 1 865 ? 29.231  -24.202 17.756 1.00 47.44  ? 865  TRP A CA    1 
ATOM   7035 C  C     . TRP A 1 865 ? 28.705  -23.732 19.122 1.00 44.16  ? 865  TRP A C     1 
ATOM   7036 O  O     . TRP A 1 865 ? 29.247  -22.784 19.703 1.00 43.68  ? 865  TRP A O     1 
ATOM   7037 C  CB    . TRP A 1 865 ? 29.202  -23.061 16.727 1.00 47.91  ? 865  TRP A CB    1 
ATOM   7038 C  CG    . TRP A 1 865 ? 30.105  -23.315 15.564 1.00 46.09  ? 865  TRP A CG    1 
ATOM   7039 C  CD1   . TRP A 1 865 ? 29.780  -23.951 14.406 1.00 46.97  ? 865  TRP A CD1   1 
ATOM   7040 C  CD2   . TRP A 1 865 ? 31.493  -22.970 15.457 1.00 49.62  ? 865  TRP A CD2   1 
ATOM   7041 N  NE1   . TRP A 1 865 ? 30.870  -24.014 13.572 1.00 51.91  ? 865  TRP A NE1   1 
ATOM   7042 C  CE2   . TRP A 1 865 ? 31.938  -23.421 14.193 1.00 52.25  ? 865  TRP A CE2   1 
ATOM   7043 C  CE3   . TRP A 1 865 ? 32.404  -22.322 16.304 1.00 50.12  ? 865  TRP A CE3   1 
ATOM   7044 C  CZ2   . TRP A 1 865 ? 33.253  -23.240 13.751 1.00 51.46  ? 865  TRP A CZ2   1 
ATOM   7045 C  CZ3   . TRP A 1 865 ? 33.714  -22.138 15.860 1.00 50.10  ? 865  TRP A CZ3   1 
ATOM   7046 C  CH2   . TRP A 1 865 ? 34.122  -22.598 14.596 1.00 50.91  ? 865  TRP A CH2   1 
ATOM   7047 N  N     . MET A 1 866 ? 27.671  -24.397 19.631 1.00 42.07  ? 866  MET A N     1 
ATOM   7048 C  CA    . MET A 1 866 ? 27.159  -24.141 20.979 1.00 43.45  ? 866  MET A CA    1 
ATOM   7049 C  C     . MET A 1 866 ? 28.313  -23.994 21.950 1.00 43.74  ? 866  MET A C     1 
ATOM   7050 O  O     . MET A 1 866 ? 29.259  -24.786 21.914 1.00 45.78  ? 866  MET A O     1 
ATOM   7051 C  CB    . MET A 1 866 ? 26.339  -25.318 21.483 1.00 42.59  ? 866  MET A CB    1 
ATOM   7052 C  CG    . MET A 1 866 ? 25.025  -25.537 20.834 1.00 46.32  ? 866  MET A CG    1 
ATOM   7053 S  SD    . MET A 1 866 ? 24.355  -27.082 21.457 1.00 51.33  ? 866  MET A SD    1 
ATOM   7054 C  CE    . MET A 1 866 ? 23.946  -26.578 23.127 1.00 46.96  ? 866  MET A CE    1 
ATOM   7055 N  N     . ASP A 1 867 ? 28.234  -23.008 22.833 1.00 40.89  ? 867  ASP A N     1 
ATOM   7056 C  CA    . ASP A 1 867 ? 29.300  -22.826 23.790 1.00 39.83  ? 867  ASP A CA    1 
ATOM   7057 C  C     . ASP A 1 867 ? 28.891  -23.378 25.144 1.00 38.99  ? 867  ASP A C     1 
ATOM   7058 O  O     . ASP A 1 867 ? 28.288  -22.677 25.956 1.00 37.56  ? 867  ASP A O     1 
ATOM   7059 C  CB    . ASP A 1 867 ? 29.725  -21.366 23.884 1.00 37.55  ? 867  ASP A CB    1 
ATOM   7060 C  CG    . ASP A 1 867 ? 31.025  -21.203 24.630 1.00 40.86  ? 867  ASP A CG    1 
ATOM   7061 O  OD1   . ASP A 1 867 ? 31.308  -22.049 25.508 1.00 37.72  ? 867  ASP A OD1   1 
ATOM   7062 O  OD2   . ASP A 1 867 ? 31.769  -20.241 24.338 1.00 43.68  ? 867  ASP A OD2   1 
ATOM   7063 N  N     . TYR A 1 868 ? 29.236  -24.641 25.377 1.00 38.90  ? 868  TYR A N     1 
ATOM   7064 C  CA    . TYR A 1 868 ? 28.845  -25.333 26.599 1.00 38.70  ? 868  TYR A CA    1 
ATOM   7065 C  C     . TYR A 1 868 ? 29.450  -24.690 27.837 1.00 39.56  ? 868  TYR A C     1 
ATOM   7066 O  O     . TYR A 1 868 ? 28.761  -24.527 28.845 1.00 41.60  ? 868  TYR A O     1 
ATOM   7067 C  CB    . TYR A 1 868 ? 29.186  -26.825 26.537 1.00 38.28  ? 868  TYR A CB    1 
ATOM   7068 C  CG    . TYR A 1 868 ? 28.310  -27.625 25.592 1.00 40.37  ? 868  TYR A CG    1 
ATOM   7069 C  CD1   . TYR A 1 868 ? 27.046  -28.065 25.989 1.00 38.69  ? 868  TYR A CD1   1 
ATOM   7070 C  CD2   . TYR A 1 868 ? 28.746  -27.951 24.304 1.00 40.34  ? 868  TYR A CD2   1 
ATOM   7071 C  CE1   . TYR A 1 868 ? 26.231  -28.808 25.130 1.00 38.27  ? 868  TYR A CE1   1 
ATOM   7072 C  CE2   . TYR A 1 868 ? 27.935  -28.692 23.433 1.00 44.15  ? 868  TYR A CE2   1 
ATOM   7073 C  CZ    . TYR A 1 868 ? 26.675  -29.115 23.859 1.00 43.46  ? 868  TYR A CZ    1 
ATOM   7074 O  OH    . TYR A 1 868 ? 25.861  -29.848 23.020 1.00 44.11  ? 868  TYR A OH    1 
ATOM   7075 N  N     . THR A 1 869 ? 30.715  -24.294 27.751 1.00 40.64  ? 869  THR A N     1 
ATOM   7076 C  CA    . THR A 1 869 ? 31.392  -23.636 28.865 1.00 41.06  ? 869  THR A CA    1 
ATOM   7077 C  C     . THR A 1 869 ? 30.629  -22.403 29.347 1.00 39.77  ? 869  THR A C     1 
ATOM   7078 O  O     . THR A 1 869 ? 30.300  -22.295 30.531 1.00 40.36  ? 869  THR A O     1 
ATOM   7079 C  CB    . THR A 1 869 ? 32.845  -23.267 28.490 1.00 43.16  ? 869  THR A CB    1 
ATOM   7080 O  OG1   . THR A 1 869 ? 33.578  -24.470 28.237 1.00 45.76  ? 869  THR A OG1   1 
ATOM   7081 C  CG2   . THR A 1 869 ? 33.537  -22.477 29.615 1.00 41.45  ? 869  THR A CG2   1 
ATOM   7082 N  N     . VAL A 1 870 ? 30.351  -21.484 28.426 1.00 40.22  ? 870  VAL A N     1 
ATOM   7083 C  CA    . VAL A 1 870 ? 29.611  -20.256 28.732 1.00 39.65  ? 870  VAL A CA    1 
ATOM   7084 C  C     . VAL A 1 870 ? 28.195  -20.572 29.246 1.00 38.60  ? 870  VAL A C     1 
ATOM   7085 O  O     . VAL A 1 870 ? 27.729  -19.978 30.214 1.00 38.95  ? 870  VAL A O     1 
ATOM   7086 C  CB    . VAL A 1 870 ? 29.568  -19.298 27.502 1.00 40.20  ? 870  VAL A CB    1 
ATOM   7087 C  CG1   . VAL A 1 870 ? 28.634  -18.138 27.747 1.00 38.24  ? 870  VAL A CG1   1 
ATOM   7088 C  CG2   . VAL A 1 870 ? 30.956  -18.764 27.197 1.00 42.54  ? 870  VAL A CG2   1 
ATOM   7089 N  N     . LEU A 1 871 ? 27.539  -21.534 28.615 1.00 38.05  ? 871  LEU A N     1 
ATOM   7090 C  CA    . LEU A 1 871 ? 26.182  -21.914 28.972 1.00 39.36  ? 871  LEU A CA    1 
ATOM   7091 C  C     . LEU A 1 871 ? 26.059  -22.426 30.414 1.00 39.73  ? 871  LEU A C     1 
ATOM   7092 O  O     . LEU A 1 871 ? 25.078  -22.118 31.107 1.00 38.32  ? 871  LEU A O     1 
ATOM   7093 C  CB    . LEU A 1 871 ? 25.676  -22.950 27.969 1.00 41.25  ? 871  LEU A CB    1 
ATOM   7094 C  CG    . LEU A 1 871 ? 24.237  -23.443 27.977 1.00 38.14  ? 871  LEU A CG    1 
ATOM   7095 C  CD1   . LEU A 1 871 ? 23.982  -24.091 26.650 1.00 39.36  ? 871  LEU A CD1   1 
ATOM   7096 C  CD2   . LEU A 1 871 ? 24.005  -24.448 29.108 1.00 41.97  ? 871  LEU A CD2   1 
ATOM   7097 N  N     . LEU A 1 872 ? 27.048  -23.209 30.851 1.00 41.43  ? 872  LEU A N     1 
ATOM   7098 C  CA    . LEU A 1 872 ? 27.101  -23.719 32.229 1.00 39.81  ? 872  LEU A CA    1 
ATOM   7099 C  C     . LEU A 1 872 ? 27.438  -22.620 33.235 1.00 39.83  ? 872  LEU A C     1 
ATOM   7100 O  O     . LEU A 1 872 ? 26.774  -22.494 34.268 1.00 40.43  ? 872  LEU A O     1 
ATOM   7101 C  CB    . LEU A 1 872 ? 28.109  -24.864 32.361 1.00 39.91  ? 872  LEU A CB    1 
ATOM   7102 C  CG    . LEU A 1 872 ? 28.150  -25.628 33.699 1.00 41.35  ? 872  LEU A CG    1 
ATOM   7103 C  CD1   . LEU A 1 872 ? 26.916  -26.514 33.873 1.00 40.35  ? 872  LEU A CD1   1 
ATOM   7104 C  CD2   . LEU A 1 872 ? 29.433  -26.458 33.847 1.00 36.01  ? 872  LEU A CD2   1 
ATOM   7105 N  N     . GLU A 1 873 ? 28.467  -21.827 32.934 1.00 40.14  ? 873  GLU A N     1 
ATOM   7106 C  CA    . GLU A 1 873 ? 28.874  -20.739 33.819 1.00 40.55  ? 873  GLU A CA    1 
ATOM   7107 C  C     . GLU A 1 873 ? 27.709  -19.780 34.062 1.00 38.48  ? 873  GLU A C     1 
ATOM   7108 O  O     . GLU A 1 873 ? 27.443  -19.379 35.186 1.00 35.37  ? 873  GLU A O     1 
ATOM   7109 C  CB    . GLU A 1 873 ? 30.041  -19.968 33.210 1.00 42.51  ? 873  GLU A CB    1 
ATOM   7110 C  CG    . GLU A 1 873 ? 31.263  -19.823 34.125 1.00 52.23  ? 873  GLU A CG    1 
ATOM   7111 C  CD    . GLU A 1 873 ? 31.030  -18.954 35.367 1.00 57.18  ? 873  GLU A CD    1 
ATOM   7112 O  OE1   . GLU A 1 873 ? 31.667  -19.252 36.407 1.00 53.42  ? 873  GLU A OE1   1 
ATOM   7113 O  OE2   . GLU A 1 873 ? 30.234  -17.980 35.306 1.00 59.02  ? 873  GLU A OE2   1 
ATOM   7114 N  N     . LYS A 1 874 ? 27.016  -19.435 32.985 1.00 39.31  ? 874  LYS A N     1 
ATOM   7115 C  CA    . LYS A 1 874 ? 26.039  -18.372 33.002 1.00 39.66  ? 874  LYS A CA    1 
ATOM   7116 C  C     . LYS A 1 874 ? 24.765  -18.817 33.700 1.00 37.58  ? 874  LYS A C     1 
ATOM   7117 O  O     . LYS A 1 874 ? 24.292  -18.133 34.600 1.00 39.99  ? 874  LYS A O     1 
ATOM   7118 C  CB    . LYS A 1 874 ? 25.749  -17.909 31.567 1.00 42.36  ? 874  LYS A CB    1 
ATOM   7119 C  CG    . LYS A 1 874 ? 25.801  -16.398 31.372 1.00 47.34  ? 874  LYS A CG    1 
ATOM   7120 C  CD    . LYS A 1 874 ? 26.518  -15.990 30.075 1.00 48.67  ? 874  LYS A CD    1 
ATOM   7121 C  CE    . LYS A 1 874 ? 25.656  -16.191 28.834 1.00 49.72  ? 874  LYS A CE    1 
ATOM   7122 N  NZ    . LYS A 1 874 ? 26.140  -15.338 27.715 1.00 50.71  ? 874  LYS A NZ    1 
ATOM   7123 N  N     . THR A 1 875 ? 24.228  -19.971 33.315 1.00 34.70  ? 875  THR A N     1 
ATOM   7124 C  CA    . THR A 1 875 ? 22.905  -20.373 33.787 1.00 32.85  ? 875  THR A CA    1 
ATOM   7125 C  C     . THR A 1 875 ? 22.936  -21.241 35.034 1.00 32.62  ? 875  THR A C     1 
ATOM   7126 O  O     . THR A 1 875 ? 21.967  -21.262 35.795 1.00 34.15  ? 875  THR A O     1 
ATOM   7127 C  CB    . THR A 1 875 ? 22.082  -21.093 32.687 1.00 32.38  ? 875  THR A CB    1 
ATOM   7128 O  OG1   . THR A 1 875 ? 22.690  -22.350 32.367 1.00 35.21  ? 875  THR A OG1   1 
ATOM   7129 C  CG2   . THR A 1 875 ? 22.002  -20.241 31.424 1.00 28.74  ? 875  THR A CG2   1 
ATOM   7130 N  N     . PHE A 1 876 ? 24.039  -21.949 35.256 1.00 31.67  ? 876  PHE A N     1 
ATOM   7131 C  CA    . PHE A 1 876 ? 24.086  -22.930 36.339 1.00 30.59  ? 876  PHE A CA    1 
ATOM   7132 C  C     . PHE A 1 876 ? 25.028  -22.554 37.479 1.00 32.75  ? 876  PHE A C     1 
ATOM   7133 O  O     . PHE A 1 876 ? 24.585  -22.367 38.624 1.00 31.52  ? 876  PHE A O     1 
ATOM   7134 C  CB    . PHE A 1 876 ? 24.433  -24.315 35.791 1.00 28.87  ? 876  PHE A CB    1 
ATOM   7135 C  CG    . PHE A 1 876 ? 24.406  -25.396 36.822 1.00 27.79  ? 876  PHE A CG    1 
ATOM   7136 C  CD1   . PHE A 1 876 ? 23.206  -25.890 37.294 1.00 28.30  ? 876  PHE A CD1   1 
ATOM   7137 C  CD2   . PHE A 1 876 ? 25.590  -25.930 37.317 1.00 30.90  ? 876  PHE A CD2   1 
ATOM   7138 C  CE1   . PHE A 1 876 ? 23.182  -26.897 38.258 1.00 31.32  ? 876  PHE A CE1   1 
ATOM   7139 C  CE2   . PHE A 1 876 ? 25.571  -26.938 38.266 1.00 31.61  ? 876  PHE A CE2   1 
ATOM   7140 C  CZ    . PHE A 1 876 ? 24.364  -27.423 38.739 1.00 25.50  ? 876  PHE A CZ    1 
ATOM   7141 N  N     . ILE A 1 877 ? 26.320  -22.442 37.172 1.00 32.24  ? 877  ILE A N     1 
ATOM   7142 C  CA    . ILE A 1 877 ? 27.313  -22.191 38.211 1.00 32.07  ? 877  ILE A CA    1 
ATOM   7143 C  C     . ILE A 1 877 ? 27.048  -20.889 38.957 1.00 30.96  ? 877  ILE A C     1 
ATOM   7144 O  O     . ILE A 1 877 ? 26.985  -20.889 40.181 1.00 33.23  ? 877  ILE A O     1 
ATOM   7145 C  CB    . ILE A 1 877 ? 28.770  -22.251 37.680 1.00 33.24  ? 877  ILE A CB    1 
ATOM   7146 C  CG1   . ILE A 1 877 ? 29.185  -23.709 37.450 1.00 31.21  ? 877  ILE A CG1   1 
ATOM   7147 C  CG2   . ILE A 1 877 ? 29.750  -21.571 38.676 1.00 31.92  ? 877  ILE A CG2   1 
ATOM   7148 C  CD1   . ILE A 1 877 ? 30.384  -23.863 36.517 1.00 35.09  ? 877  ILE A CD1   1 
ATOM   7149 N  N     . LYS A 1 878 ? 26.873  -19.796 38.223 1.00 30.13  ? 878  LYS A N     1 
ATOM   7150 C  CA    . LYS A 1 878 ? 26.739  -18.491 38.849 1.00 32.44  ? 878  LYS A CA    1 
ATOM   7151 C  C     . LYS A 1 878 ? 25.502  -18.379 39.763 1.00 31.79  ? 878  LYS A C     1 
ATOM   7152 O  O     . LYS A 1 878 ? 25.605  -17.834 40.863 1.00 34.04  ? 878  LYS A O     1 
ATOM   7153 C  CB    . LYS A 1 878 ? 26.801  -17.359 37.818 1.00 33.44  ? 878  LYS A CB    1 
ATOM   7154 C  CG    . LYS A 1 878 ? 27.109  -16.002 38.435 1.00 41.62  ? 878  LYS A CG    1 
ATOM   7155 C  CD    . LYS A 1 878 ? 27.346  -14.914 37.392 1.00 51.87  ? 878  LYS A CD    1 
ATOM   7156 C  CE    . LYS A 1 878 ? 27.261  -13.523 38.032 1.00 56.82  ? 878  LYS A CE    1 
ATOM   7157 N  NZ    . LYS A 1 878 ? 27.613  -12.436 37.060 1.00 62.08  ? 878  LYS A NZ    1 
ATOM   7158 N  N     . PRO A 1 879 ? 24.341  -18.911 39.332 1.00 29.48  ? 879  PRO A N     1 
ATOM   7159 C  CA    . PRO A 1 879 ? 23.242  -18.925 40.301 1.00 29.24  ? 879  PRO A CA    1 
ATOM   7160 C  C     . PRO A 1 879 ? 23.530  -19.831 41.491 1.00 28.57  ? 879  PRO A C     1 
ATOM   7161 O  O     . PRO A 1 879 ? 23.263  -19.441 42.633 1.00 29.31  ? 879  PRO A O     1 
ATOM   7162 C  CB    . PRO A 1 879 ? 22.049  -19.446 39.481 1.00 26.41  ? 879  PRO A CB    1 
ATOM   7163 C  CG    . PRO A 1 879 ? 22.374  -19.049 38.101 1.00 27.57  ? 879  PRO A CG    1 
ATOM   7164 C  CD    . PRO A 1 879 ? 23.867  -19.265 37.982 1.00 28.34  ? 879  PRO A CD    1 
ATOM   7165 N  N     . LEU A 1 880 ? 24.092  -21.012 41.230 1.00 28.63  ? 880  LEU A N     1 
ATOM   7166 C  CA    . LEU A 1 880 ? 24.423  -21.953 42.302 1.00 27.92  ? 880  LEU A CA    1 
ATOM   7167 C  C     . LEU A 1 880 ? 25.404  -21.339 43.301 1.00 29.93  ? 880  LEU A C     1 
ATOM   7168 O  O     . LEU A 1 880 ? 25.305  -21.596 44.509 1.00 30.71  ? 880  LEU A O     1 
ATOM   7169 C  CB    . LEU A 1 880 ? 24.971  -23.272 41.740 1.00 25.17  ? 880  LEU A CB    1 
ATOM   7170 C  CG    . LEU A 1 880 ? 25.224  -24.398 42.760 1.00 29.28  ? 880  LEU A CG    1 
ATOM   7171 C  CD1   . LEU A 1 880 ? 23.965  -24.803 43.595 1.00 20.57  ? 880  LEU A CD1   1 
ATOM   7172 C  CD2   . LEU A 1 880 ? 25.823  -25.611 42.085 1.00 25.24  ? 880  LEU A CD2   1 
ATOM   7173 N  N     . GLU A 1 881 ? 26.339  -20.532 42.788 1.00 29.79  ? 881  GLU A N     1 
ATOM   7174 C  CA    . GLU A 1 881 ? 27.306  -19.795 43.606 1.00 33.06  ? 881  GLU A CA    1 
ATOM   7175 C  C     . GLU A 1 881 ? 26.598  -18.863 44.590 1.00 32.01  ? 881  GLU A C     1 
ATOM   7176 O  O     . GLU A 1 881 ? 27.017  -18.726 45.746 1.00 33.04  ? 881  GLU A O     1 
ATOM   7177 C  CB    . GLU A 1 881 ? 28.225  -18.957 42.703 1.00 37.14  ? 881  GLU A CB    1 
ATOM   7178 C  CG    . GLU A 1 881 ? 29.237  -18.097 43.447 1.00 41.46  ? 881  GLU A CG    1 
ATOM   7179 C  CD    . GLU A 1 881 ? 30.411  -18.915 43.952 1.00 51.88  ? 881  GLU A CD    1 
ATOM   7180 O  OE1   . GLU A 1 881 ? 30.455  -19.199 45.173 1.00 52.29  ? 881  GLU A OE1   1 
ATOM   7181 O  OE2   . GLU A 1 881 ? 31.280  -19.292 43.121 1.00 58.96  ? 881  GLU A OE2   1 
ATOM   7182 N  N     . GLY A 1 882 ? 25.540  -18.213 44.107 1.00 27.10  ? 882  GLY A N     1 
ATOM   7183 C  CA    . GLY A 1 882 ? 24.728  -17.325 44.917 1.00 27.30  ? 882  GLY A CA    1 
ATOM   7184 C  C     . GLY A 1 882 ? 24.030  -18.081 46.030 1.00 27.76  ? 882  GLY A C     1 
ATOM   7185 O  O     . GLY A 1 882 ? 24.007  -17.616 47.156 1.00 31.83  ? 882  GLY A O     1 
ATOM   7186 N  N     . PHE A 1 883 ? 23.488  -19.255 45.715 1.00 25.36  ? 883  PHE A N     1 
ATOM   7187 C  CA    . PHE A 1 883 ? 22.734  -20.046 46.682 1.00 24.05  ? 883  PHE A CA    1 
ATOM   7188 C  C     . PHE A 1 883 ? 23.688  -20.506 47.767 1.00 25.77  ? 883  PHE A C     1 
ATOM   7189 O  O     . PHE A 1 883 ? 23.418  -20.327 48.953 1.00 26.95  ? 883  PHE A O     1 
ATOM   7190 C  CB    . PHE A 1 883 ? 22.073  -21.296 46.046 1.00 21.27  ? 883  PHE A CB    1 
ATOM   7191 C  CG    . PHE A 1 883 ? 21.202  -21.020 44.839 1.00 23.44  ? 883  PHE A CG    1 
ATOM   7192 C  CD1   . PHE A 1 883 ? 20.786  -19.730 44.506 1.00 25.05  ? 883  PHE A CD1   1 
ATOM   7193 C  CD2   . PHE A 1 883 ? 20.754  -22.074 44.060 1.00 23.85  ? 883  PHE A CD2   1 
ATOM   7194 C  CE1   . PHE A 1 883 ? 19.974  -19.498 43.404 1.00 23.30  ? 883  PHE A CE1   1 
ATOM   7195 C  CE2   . PHE A 1 883 ? 19.931  -21.849 42.952 1.00 24.38  ? 883  PHE A CE2   1 
ATOM   7196 C  CZ    . PHE A 1 883 ? 19.547  -20.559 42.623 1.00 23.88  ? 883  PHE A CZ    1 
ATOM   7197 N  N     . THR A 1 884 ? 24.806  -21.095 47.349 1.00 24.93  ? 884  THR A N     1 
ATOM   7198 C  CA    . THR A 1 884 ? 25.710  -21.777 48.271 1.00 27.65  ? 884  THR A CA    1 
ATOM   7199 C  C     . THR A 1 884 ? 26.477  -20.834 49.178 1.00 28.04  ? 884  THR A C     1 
ATOM   7200 O  O     . THR A 1 884 ? 26.659  -21.141 50.369 1.00 29.79  ? 884  THR A O     1 
ATOM   7201 C  CB    . THR A 1 884 ? 26.726  -22.659 47.539 1.00 28.15  ? 884  THR A CB    1 
ATOM   7202 O  OG1   . THR A 1 884 ? 27.387  -21.883 46.531 1.00 33.30  ? 884  THR A OG1   1 
ATOM   7203 C  CG2   . THR A 1 884 ? 26.035  -23.852 46.903 1.00 27.40  ? 884  THR A CG2   1 
ATOM   7204 N  N     . SER A 1 885 ? 26.928  -19.700 48.633 1.00 24.71  ? 885  SER A N     1 
ATOM   7205 C  CA    . SER A 1 885 ? 27.657  -18.716 49.444 1.00 27.31  ? 885  SER A CA    1 
ATOM   7206 C  C     . SER A 1 885 ? 26.755  -18.095 50.496 1.00 28.43  ? 885  SER A C     1 
ATOM   7207 O  O     . SER A 1 885 ? 27.177  -17.850 51.623 1.00 30.73  ? 885  SER A O     1 
ATOM   7208 C  CB    . SER A 1 885 ? 28.263  -17.615 48.581 1.00 28.58  ? 885  SER A CB    1 
ATOM   7209 O  OG    . SER A 1 885 ? 27.295  -17.040 47.727 1.00 33.55  ? 885  SER A OG    1 
ATOM   7210 N  N     . ALA A 1 886 ? 25.509  -17.839 50.114 1.00 28.37  ? 886  ALA A N     1 
ATOM   7211 C  CA    . ALA A 1 886 ? 24.532  -17.291 51.030 1.00 29.01  ? 886  ALA A CA    1 
ATOM   7212 C  C     . ALA A 1 886 ? 24.308  -18.298 52.138 1.00 26.94  ? 886  ALA A C     1 
ATOM   7213 O  O     . ALA A 1 886 ? 24.159  -17.935 53.289 1.00 28.75  ? 886  ALA A O     1 
ATOM   7214 C  CB    . ALA A 1 886 ? 23.215  -16.989 50.297 1.00 29.16  ? 886  ALA A CB    1 
ATOM   7215 N  N     . ALA A 1 887 ? 24.311  -19.574 51.778 1.00 26.65  ? 887  ALA A N     1 
ATOM   7216 C  CA    . ALA A 1 887 ? 24.027  -20.645 52.728 1.00 24.78  ? 887  ALA A CA    1 
ATOM   7217 C  C     . ALA A 1 887 ? 25.272  -21.068 53.490 1.00 25.03  ? 887  ALA A C     1 
ATOM   7218 O  O     . ALA A 1 887 ? 25.202  -21.952 54.349 1.00 26.63  ? 887  ALA A O     1 
ATOM   7219 C  CB    . ALA A 1 887 ? 23.422  -21.844 51.997 1.00 22.70  ? 887  ALA A CB    1 
ATOM   7220 N  N     . LYS A 1 888 ? 26.400  -20.446 53.150 1.00 25.06  ? 888  LYS A N     1 
ATOM   7221 C  CA    . LYS A 1 888 ? 27.694  -20.686 53.797 1.00 29.73  ? 888  LYS A CA    1 
ATOM   7222 C  C     . LYS A 1 888 ? 28.117  -22.145 53.629 1.00 29.67  ? 888  LYS A C     1 
ATOM   7223 O  O     . LYS A 1 888 ? 28.456  -22.844 54.579 1.00 29.74  ? 888  LYS A O     1 
ATOM   7224 C  CB    . LYS A 1 888 ? 27.681  -20.228 55.260 1.00 30.29  ? 888  LYS A CB    1 
ATOM   7225 C  CG    . LYS A 1 888 ? 27.306  -18.759 55.445 1.00 31.66  ? 888  LYS A CG    1 
ATOM   7226 C  CD    . LYS A 1 888 ? 27.568  -18.333 56.889 1.00 39.86  ? 888  LYS A CD    1 
ATOM   7227 C  CE    . LYS A 1 888 ? 26.922  -16.989 57.222 1.00 43.11  ? 888  LYS A CE    1 
ATOM   7228 N  NZ    . LYS A 1 888 ? 27.389  -15.864 56.357 1.00 44.45  ? 888  LYS A NZ    1 
ATOM   7229 N  N     . LEU A 1 889 ? 28.101  -22.561 52.370 1.00 30.81  ? 889  LEU A N     1 
ATOM   7230 C  CA    . LEU A 1 889 ? 28.251  -23.936 51.953 1.00 31.51  ? 889  LEU A CA    1 
ATOM   7231 C  C     . LEU A 1 889 ? 29.050  -23.925 50.658 1.00 31.17  ? 889  LEU A C     1 
ATOM   7232 O  O     . LEU A 1 889 ? 29.090  -22.907 49.960 1.00 29.32  ? 889  LEU A O     1 
ATOM   7233 C  CB    . LEU A 1 889 ? 26.850  -24.479 51.663 1.00 34.71  ? 889  LEU A CB    1 
ATOM   7234 C  CG    . LEU A 1 889 ? 26.505  -25.929 51.926 1.00 36.55  ? 889  LEU A CG    1 
ATOM   7235 C  CD1   . LEU A 1 889 ? 27.074  -26.367 53.267 1.00 42.56  ? 889  LEU A CD1   1 
ATOM   7236 C  CD2   . LEU A 1 889 ? 24.997  -26.080 51.898 1.00 36.15  ? 889  LEU A CD2   1 
ATOM   7237 N  N     . ASP A 1 890 ? 29.671  -25.052 50.322 1.00 33.16  ? 890  ASP A N     1 
ATOM   7238 C  CA    . ASP A 1 890 ? 30.453  -25.158 49.090 1.00 33.97  ? 890  ASP A CA    1 
ATOM   7239 C  C     . ASP A 1 890 ? 29.870  -26.202 48.142 1.00 33.27  ? 890  ASP A C     1 
ATOM   7240 O  O     . ASP A 1 890 ? 29.474  -27.285 48.573 1.00 33.33  ? 890  ASP A O     1 
ATOM   7241 C  CB    . ASP A 1 890 ? 31.911  -25.497 49.412 1.00 38.01  ? 890  ASP A CB    1 
ATOM   7242 C  CG    . ASP A 1 890 ? 32.677  -24.321 50.021 1.00 45.67  ? 890  ASP A CG    1 
ATOM   7243 O  OD1   . ASP A 1 890 ? 32.769  -23.253 49.366 1.00 47.44  ? 890  ASP A OD1   1 
ATOM   7244 O  OD2   . ASP A 1 890 ? 33.209  -24.478 51.149 1.00 50.37  ? 890  ASP A OD2   1 
ATOM   7245 N  N     . TYR A 1 891 ? 29.810  -25.880 46.853 1.00 33.61  ? 891  TYR A N     1 
ATOM   7246 C  CA    . TYR A 1 891 ? 29.391  -26.868 45.854 1.00 32.42  ? 891  TYR A CA    1 
ATOM   7247 C  C     . TYR A 1 891 ? 30.543  -27.754 45.371 1.00 34.19  ? 891  TYR A C     1 
ATOM   7248 O  O     . TYR A 1 891 ? 30.313  -28.867 44.923 1.00 34.85  ? 891  TYR A O     1 
ATOM   7249 C  CB    . TYR A 1 891 ? 28.636  -26.225 44.687 1.00 31.36  ? 891  TYR A CB    1 
ATOM   7250 C  CG    . TYR A 1 891 ? 29.431  -25.254 43.853 1.00 29.62  ? 891  TYR A CG    1 
ATOM   7251 C  CD1   . TYR A 1 891 ? 29.454  -23.894 44.161 1.00 28.75  ? 891  TYR A CD1   1 
ATOM   7252 C  CD2   . TYR A 1 891 ? 30.145  -25.691 42.743 1.00 32.29  ? 891  TYR A CD2   1 
ATOM   7253 C  CE1   . TYR A 1 891 ? 30.189  -22.997 43.395 1.00 31.95  ? 891  TYR A CE1   1 
ATOM   7254 C  CE2   . TYR A 1 891 ? 30.885  -24.799 41.962 1.00 32.40  ? 891  TYR A CE2   1 
ATOM   7255 C  CZ    . TYR A 1 891 ? 30.902  -23.456 42.295 1.00 32.03  ? 891  TYR A CZ    1 
ATOM   7256 O  OH    . TYR A 1 891 ? 31.636  -22.581 41.528 1.00 36.89  ? 891  TYR A OH    1 
ATOM   7257 N  N     . GLU A 1 892 ? 31.770  -27.244 45.462 1.00 36.72  ? 892  GLU A N     1 
ATOM   7258 C  CA    . GLU A 1 892 ? 32.985  -28.019 45.198 1.00 39.46  ? 892  GLU A CA    1 
ATOM   7259 C  C     . GLU A 1 892 ? 33.794  -28.092 46.472 1.00 40.72  ? 892  GLU A C     1 
ATOM   7260 O  O     . GLU A 1 892 ? 33.899  -27.097 47.195 1.00 40.34  ? 892  GLU A O     1 
ATOM   7261 C  CB    . GLU A 1 892 ? 33.865  -27.325 44.175 1.00 40.08  ? 892  GLU A CB    1 
ATOM   7262 C  CG    . GLU A 1 892 ? 33.445  -27.487 42.746 1.00 44.85  ? 892  GLU A CG    1 
ATOM   7263 C  CD    . GLU A 1 892 ? 34.307  -26.662 41.801 1.00 46.23  ? 892  GLU A CD    1 
ATOM   7264 O  OE1   . GLU A 1 892 ? 34.692  -27.208 40.747 1.00 50.91  ? 892  GLU A OE1   1 
ATOM   7265 O  OE2   . GLU A 1 892 ? 34.601  -25.478 42.115 1.00 42.45  ? 892  GLU A OE2   1 
ATOM   7266 N  N     . LYS A 1 893 ? 34.389  -29.252 46.732 1.00 41.79  ? 893  LYS A N     1 
ATOM   7267 C  CA    . LYS A 1 893 ? 35.308  -29.408 47.860 1.00 44.95  ? 893  LYS A CA    1 
ATOM   7268 C  C     . LYS A 1 893 ? 36.438  -28.377 47.786 1.00 44.37  ? 893  LYS A C     1 
ATOM   7269 O  O     . LYS A 1 893 ? 37.183  -28.335 46.801 1.00 41.96  ? 893  LYS A O     1 
ATOM   7270 C  CB    . LYS A 1 893 ? 35.885  -30.826 47.875 1.00 48.85  ? 893  LYS A CB    1 
ATOM   7271 C  CG    . LYS A 1 893 ? 36.734  -31.142 49.096 1.00 57.83  ? 893  LYS A CG    1 
ATOM   7272 C  CD    . LYS A 1 893 ? 36.332  -32.472 49.703 1.00 63.38  ? 893  LYS A CD    1 
ATOM   7273 C  CE    . LYS A 1 893 ? 36.487  -32.427 51.211 1.00 68.92  ? 893  LYS A CE    1 
ATOM   7274 N  NZ    . LYS A 1 893 ? 35.286  -33.020 51.867 1.00 73.41  ? 893  LYS A NZ    1 
ATOM   7275 N  N     . LYS A 1 894 ? 36.542  -27.538 48.812 1.00 45.10  ? 894  LYS A N     1 
ATOM   7276 C  CA    . LYS A 1 894 ? 37.633  -26.569 48.900 1.00 48.71  ? 894  LYS A CA    1 
ATOM   7277 C  C     . LYS A 1 894 ? 38.993  -27.238 49.156 1.00 47.78  ? 894  LYS A C     1 
ATOM   7278 O  O     . LYS A 1 894 ? 39.062  -28.307 49.767 1.00 47.20  ? 894  LYS A O     1 
ATOM   7279 C  CB    . LYS A 1 894 ? 37.345  -25.537 49.988 1.00 51.61  ? 894  LYS A CB    1 
ATOM   7280 C  CG    . LYS A 1 894 ? 36.717  -24.262 49.465 1.00 58.09  ? 894  LYS A CG    1 
ATOM   7281 C  CD    . LYS A 1 894 ? 36.518  -23.246 50.588 1.00 66.41  ? 894  LYS A CD    1 
ATOM   7282 C  CE    . LYS A 1 894 ? 35.867  -21.963 50.070 1.00 69.72  ? 894  LYS A CE    1 
ATOM   7283 N  NZ    . LYS A 1 894 ? 35.157  -21.219 51.153 1.00 70.84  ? 894  LYS A NZ    1 
ATOM   7284 N  N     . ALA A 1 895 ? 40.066  -26.613 48.680 1.00 46.49  ? 895  ALA A N     1 
ATOM   7285 C  CA    . ALA A 1 895 ? 41.413  -27.095 48.991 1.00 48.42  ? 895  ALA A CA    1 
ATOM   7286 C  C     . ALA A 1 895 ? 41.670  -26.989 50.490 1.00 47.61  ? 895  ALA A C     1 
ATOM   7287 O  O     . ALA A 1 895 ? 41.231  -26.031 51.135 1.00 47.25  ? 895  ALA A O     1 
ATOM   7288 C  CB    . ALA A 1 895 ? 42.463  -26.326 48.214 1.00 48.28  ? 895  ALA A CB    1 
ATOM   7289 N  N     . SER A 1 896 ? 42.360  -27.987 51.039 1.00 47.36  ? 896  SER A N     1 
ATOM   7290 C  CA    . SER A 1 896 ? 42.655  -28.037 52.475 1.00 47.21  ? 896  SER A CA    1 
ATOM   7291 C  C     . SER A 1 896 ? 43.954  -28.771 52.733 1.00 47.51  ? 896  SER A C     1 
ATOM   7292 O  O     . SER A 1 896 ? 44.490  -29.411 51.837 1.00 48.15  ? 896  SER A O     1 
ATOM   7293 C  CB    . SER A 1 896 ? 41.506  -28.702 53.258 1.00 46.19  ? 896  SER A CB    1 
ATOM   7294 O  OG    . SER A 1 896 ? 41.418  -30.094 52.992 1.00 44.47  ? 896  SER A OG    1 
ATOM   7295 N  N     . LEU A 1 897 ? 44.450  -28.675 53.965 1.00 49.70  ? 897  LEU A N     1 
ATOM   7296 C  CA    . LEU A 1 897 ? 45.667  -29.374 54.402 1.00 49.63  ? 897  LEU A CA    1 
ATOM   7297 C  C     . LEU A 1 897 ? 45.589  -30.890 54.210 1.00 49.63  ? 897  LEU A C     1 
ATOM   7298 O  O     . LEU A 1 897 ? 46.604  -31.548 53.995 1.00 46.55  ? 897  LEU A O     1 
ATOM   7299 C  CB    . LEU A 1 897 ? 45.946  -29.054 55.875 1.00 51.94  ? 897  LEU A CB    1 
ATOM   7300 C  CG    . LEU A 1 897 ? 47.035  -28.059 56.314 1.00 52.75  ? 897  LEU A CG    1 
ATOM   7301 C  CD1   . LEU A 1 897 ? 47.329  -26.951 55.300 1.00 55.08  ? 897  LEU A CD1   1 
ATOM   7302 C  CD2   . LEU A 1 897 ? 46.673  -27.465 57.674 1.00 51.80  ? 897  LEU A CD2   1 
ATOM   7303 N  N     . PHE A 1 898 ? 44.371  -31.430 54.277 1.00 50.98  ? 898  PHE A N     1 
ATOM   7304 C  CA    . PHE A 1 898 ? 44.119  -32.862 54.091 1.00 51.77  ? 898  PHE A CA    1 
ATOM   7305 C  C     . PHE A 1 898 ? 44.446  -33.363 52.683 1.00 51.03  ? 898  PHE A C     1 
ATOM   7306 O  O     . PHE A 1 898 ? 44.557  -34.570 52.464 1.00 51.47  ? 898  PHE A O     1 
ATOM   7307 C  CB    . PHE A 1 898 ? 42.661  -33.189 54.413 1.00 51.29  ? 898  PHE A CB    1 
ATOM   7308 C  CG    . PHE A 1 898 ? 42.279  -32.930 55.839 1.00 54.70  ? 898  PHE A CG    1 
ATOM   7309 C  CD1   . PHE A 1 898 ? 42.577  -33.857 56.833 1.00 57.83  ? 898  PHE A CD1   1 
ATOM   7310 C  CD2   . PHE A 1 898 ? 41.603  -31.765 56.190 1.00 56.26  ? 898  PHE A CD2   1 
ATOM   7311 C  CE1   . PHE A 1 898 ? 42.215  -33.626 58.157 1.00 58.39  ? 898  PHE A CE1   1 
ATOM   7312 C  CE2   . PHE A 1 898 ? 41.237  -31.526 57.512 1.00 58.02  ? 898  PHE A CE2   1 
ATOM   7313 C  CZ    . PHE A 1 898 ? 41.543  -32.462 58.497 1.00 58.27  ? 898  PHE A CZ    1 
ATOM   7314 N  N     . ASP A 1 899 ? 44.596  -32.435 51.739 1.00 50.27  ? 899  ASP A N     1 
ATOM   7315 C  CA    . ASP A 1 899 ? 44.947  -32.775 50.356 1.00 50.66  ? 899  ASP A CA    1 
ATOM   7316 C  C     . ASP A 1 899 ? 46.311  -33.446 50.264 1.00 51.57  ? 899  ASP A C     1 
ATOM   7317 O  O     . ASP A 1 899 ? 46.641  -34.049 49.247 1.00 53.95  ? 899  ASP A O     1 
ATOM   7318 C  CB    . ASP A 1 899 ? 44.891  -31.536 49.447 1.00 49.18  ? 899  ASP A CB    1 
ATOM   7319 C  CG    . ASP A 1 899 ? 43.476  -30.984 49.291 1.00 47.25  ? 899  ASP A CG    1 
ATOM   7320 O  OD1   . ASP A 1 899 ? 42.501  -31.754 49.430 1.00 41.31  ? 899  ASP A OD1   1 
ATOM   7321 O  OD2   . ASP A 1 899 ? 43.335  -29.771 49.038 1.00 50.32  ? 899  ASP A OD2   1 
ATOM   7322 N  N     . MET A 1 900 ? 47.085  -33.349 51.340 1.00 52.23  ? 900  MET A N     1 
ATOM   7323 C  CA    . MET A 1 900 ? 48.424  -33.914 51.395 1.00 52.48  ? 900  MET A CA    1 
ATOM   7324 C  C     . MET A 1 900 ? 48.422  -35.427 51.613 1.00 52.98  ? 900  MET A C     1 
ATOM   7325 O  O     . MET A 1 900 ? 49.452  -36.074 51.452 1.00 54.46  ? 900  MET A O     1 
ATOM   7326 C  CB    . MET A 1 900 ? 49.250  -33.222 52.486 1.00 53.73  ? 900  MET A CB    1 
ATOM   7327 C  CG    . MET A 1 900 ? 49.416  -31.706 52.315 1.00 55.46  ? 900  MET A CG    1 
ATOM   7328 S  SD    . MET A 1 900 ? 50.606  -31.205 51.052 1.00 60.82  ? 900  MET A SD    1 
ATOM   7329 C  CE    . MET A 1 900 ? 49.565  -31.080 49.585 1.00 60.23  ? 900  MET A CE    1 
ATOM   7330 N  N     . PHE A 1 901 ? 47.270  -35.988 51.972 1.00 53.38  ? 901  PHE A N     1 
ATOM   7331 C  CA    . PHE A 1 901 ? 47.168  -37.420 52.262 1.00 55.54  ? 901  PHE A CA    1 
ATOM   7332 C  C     . PHE A 1 901 ? 46.463  -38.186 51.149 1.00 59.35  ? 901  PHE A C     1 
ATOM   7333 O  O     . PHE A 1 901 ? 45.860  -37.591 50.252 1.00 58.41  ? 901  PHE A O     1 
ATOM   7334 C  CB    . PHE A 1 901 ? 46.426  -37.651 53.580 1.00 53.54  ? 901  PHE A CB    1 
ATOM   7335 C  CG    . PHE A 1 901 ? 47.040  -36.957 54.762 1.00 48.98  ? 901  PHE A CG    1 
ATOM   7336 C  CD1   . PHE A 1 901 ? 47.987  -37.597 55.542 1.00 48.92  ? 901  PHE A CD1   1 
ATOM   7337 C  CD2   . PHE A 1 901 ? 46.650  -35.670 55.105 1.00 47.28  ? 901  PHE A CD2   1 
ATOM   7338 C  CE1   . PHE A 1 901 ? 48.550  -36.959 56.639 1.00 48.79  ? 901  PHE A CE1   1 
ATOM   7339 C  CE2   . PHE A 1 901 ? 47.205  -35.029 56.198 1.00 45.23  ? 901  PHE A CE2   1 
ATOM   7340 C  CZ    . PHE A 1 901 ? 48.156  -35.672 56.967 1.00 44.63  ? 901  PHE A CZ    1 
ATOM   7341 N  N     . ASP A 1 902 ? 46.527  -39.511 51.230 1.00 37.68  ? 902  ASP A N     1 
ATOM   7342 C  CA    . ASP A 1 902 ? 45.896  -40.392 50.242 1.00 45.02  ? 902  ASP A CA    1 
ATOM   7343 C  C     . ASP A 1 902 ? 44.647  -41.092 50.810 1.00 46.80  ? 902  ASP A C     1 
ATOM   7344 O  O     . ASP A 1 902 ? 44.761  -42.085 51.528 1.00 46.93  ? 902  ASP A O     1 
ATOM   7345 C  CB    . ASP A 1 902 ? 46.925  -41.413 49.732 1.00 47.08  ? 902  ASP A CB    1 
ATOM   7346 C  CG    . ASP A 1 902 ? 46.395  -42.292 48.600 1.00 54.05  ? 902  ASP A CG    1 
ATOM   7347 O  OD1   . ASP A 1 902 ? 47.185  -43.127 48.106 1.00 56.61  ? 902  ASP A OD1   1 
ATOM   7348 O  OD2   . ASP A 1 902 ? 45.209  -42.166 48.206 1.00 56.83  ? 902  ASP A OD2   1 
ATOM   7349 N  N     . PHE A 1 903 ? 43.465  -40.572 50.469 1.00 49.56  ? 903  PHE A N     1 
ATOM   7350 C  CA    . PHE A 1 903 ? 42.190  -41.132 50.947 1.00 52.01  ? 903  PHE A CA    1 
ATOM   7351 C  C     . PHE A 1 903 ? 41.388  -41.853 49.850 1.00 53.91  ? 903  PHE A C     1 
ATOM   7352 O  O     . PHE A 1 903 ? 41.942  -42.536 48.978 1.00 56.19  ? 903  PHE A O     1 
ATOM   7353 C  CB    . PHE A 1 903 ? 41.305  -40.040 51.580 1.00 51.54  ? 903  PHE A CB    1 
ATOM   7354 C  CG    . PHE A 1 903 ? 41.954  -39.287 52.729 1.00 50.68  ? 903  PHE A CG    1 
ATOM   7355 C  CD1   . PHE A 1 903 ? 42.322  -39.945 53.906 1.00 50.50  ? 903  PHE A CD1   1 
ATOM   7356 C  CD2   . PHE A 1 903 ? 42.149  -37.904 52.648 1.00 49.82  ? 903  PHE A CD2   1 
ATOM   7357 C  CE1   . PHE A 1 903 ? 42.906  -39.235 54.977 1.00 50.58  ? 903  PHE A CE1   1 
ATOM   7358 C  CE2   . PHE A 1 903 ? 42.728  -37.183 53.712 1.00 50.29  ? 903  PHE A CE2   1 
ATOM   7359 C  CZ    . PHE A 1 903 ? 43.106  -37.849 54.876 1.00 49.93  ? 903  PHE A CZ    1 
ATOM   7360 P  P     . DG  B 2 1   ? -9.919  -1.986  27.356 1.00 75.74  ? 3    DG  T P     1 
ATOM   7361 O  OP1   . DG  B 2 1   ? -10.368 -0.696  26.767 1.00 75.87  ? 3    DG  T OP1   1 
ATOM   7362 O  OP2   . DG  B 2 1   ? -8.704  -2.654  26.834 1.00 73.19  ? 3    DG  T OP2   1 
ATOM   7363 O  "O5'" . DG  B 2 1   ? -9.702  -1.843  28.939 1.00 75.44  ? 3    DG  T "O5'" 1 
ATOM   7364 C  "C5'" . DG  B 2 1   ? -8.918  -0.767  29.476 1.00 70.14  ? 3    DG  T "C5'" 1 
ATOM   7365 C  "C4'" . DG  B 2 1   ? -7.649  -1.213  30.194 1.00 64.77  ? 3    DG  T "C4'" 1 
ATOM   7366 O  "O4'" . DG  B 2 1   ? -6.483  -0.644  29.549 1.00 67.73  ? 3    DG  T "O4'" 1 
ATOM   7367 C  "C3'" . DG  B 2 1   ? -7.517  -0.774  31.651 1.00 59.62  ? 3    DG  T "C3'" 1 
ATOM   7368 O  "O3'" . DG  B 2 1   ? -6.753  -1.708  32.408 1.00 45.74  ? 3    DG  T "O3'" 1 
ATOM   7369 C  "C2'" . DG  B 2 1   ? -6.764  0.559   31.580 1.00 64.30  ? 3    DG  T "C2'" 1 
ATOM   7370 C  "C1'" . DG  B 2 1   ? -6.004  0.492   30.255 1.00 67.95  ? 3    DG  T "C1'" 1 
ATOM   7371 N  N9    . DG  B 2 1   ? -6.160  1.662   29.379 1.00 71.44  ? 3    DG  T N9    1 
ATOM   7372 C  C8    . DG  B 2 1   ? -5.155  2.257   28.644 1.00 73.62  ? 3    DG  T C8    1 
ATOM   7373 N  N7    . DG  B 2 1   ? -5.557  3.281   27.936 1.00 74.39  ? 3    DG  T N7    1 
ATOM   7374 C  C5    . DG  B 2 1   ? -6.917  3.374   28.211 1.00 73.71  ? 3    DG  T C5    1 
ATOM   7375 C  C6    . DG  B 2 1   ? -7.886  4.292   27.730 1.00 75.03  ? 3    DG  T C6    1 
ATOM   7376 O  O6    . DG  B 2 1   ? -7.716  5.229   26.942 1.00 78.44  ? 3    DG  T O6    1 
ATOM   7377 N  N1    . DG  B 2 1   ? -9.161  4.053   28.249 1.00 73.08  ? 3    DG  T N1    1 
ATOM   7378 C  C2    . DG  B 2 1   ? -9.458  3.038   29.132 1.00 72.26  ? 3    DG  T C2    1 
ATOM   7379 N  N2    . DG  B 2 1   ? -10.735 2.951   29.532 1.00 71.73  ? 3    DG  T N2    1 
ATOM   7380 N  N3    . DG  B 2 1   ? -8.561  2.168   29.592 1.00 70.08  ? 3    DG  T N3    1 
ATOM   7381 C  C4    . DG  B 2 1   ? -7.311  2.385   29.095 1.00 71.98  ? 3    DG  T C4    1 
ATOM   7382 P  P     . DA  B 2 2   ? -7.337  -3.074  33.002 1.00 35.94  ? 4    DA  T P     1 
ATOM   7383 O  OP1   . DA  B 2 2   ? -6.577  -4.187  32.389 1.00 41.42  ? 4    DA  T OP1   1 
ATOM   7384 O  OP2   . DA  B 2 2   ? -8.804  -3.095  32.961 1.00 39.40  ? 4    DA  T OP2   1 
ATOM   7385 O  "O5'" . DA  B 2 2   ? -6.900  -3.010  34.529 1.00 36.99  ? 4    DA  T "O5'" 1 
ATOM   7386 C  "C5'" . DA  B 2 2   ? -5.529  -2.932  34.925 1.00 27.66  ? 4    DA  T "C5'" 1 
ATOM   7387 C  "C4'" . DA  B 2 2   ? -5.516  -2.419  36.352 1.00 26.35  ? 4    DA  T "C4'" 1 
ATOM   7388 O  "O4'" . DA  B 2 2   ? -6.130  -3.428  37.187 1.00 24.11  ? 4    DA  T "O4'" 1 
ATOM   7389 C  "C3'" . DA  B 2 2   ? -4.158  -2.186  36.974 1.00 24.56  ? 4    DA  T "C3'" 1 
ATOM   7390 O  "O3'" . DA  B 2 2   ? -3.654  -0.908  36.599 1.00 24.43  ? 4    DA  T "O3'" 1 
ATOM   7391 C  "C2'" . DA  B 2 2   ? -4.546  -2.264  38.437 1.00 22.72  ? 4    DA  T "C2'" 1 
ATOM   7392 C  "C1'" . DA  B 2 2   ? -5.470  -3.480  38.419 1.00 23.58  ? 4    DA  T "C1'" 1 
ATOM   7393 N  N9    . DA  B 2 2   ? -4.781  -4.764  38.468 1.00 27.65  ? 4    DA  T N9    1 
ATOM   7394 C  C8    . DA  B 2 2   ? -4.729  -5.728  37.492 1.00 28.41  ? 4    DA  T C8    1 
ATOM   7395 N  N7    . DA  B 2 2   ? -4.017  -6.783  37.818 1.00 26.93  ? 4    DA  T N7    1 
ATOM   7396 C  C5    . DA  B 2 2   ? -3.578  -6.494  39.097 1.00 27.59  ? 4    DA  T C5    1 
ATOM   7397 C  C6    . DA  B 2 2   ? -2.776  -7.205  40.014 1.00 27.98  ? 4    DA  T C6    1 
ATOM   7398 N  N6    . DA  B 2 2   ? -2.260  -8.412  39.756 1.00 27.06  ? 4    DA  T N6    1 
ATOM   7399 N  N1    . DA  B 2 2   ? -2.531  -6.624  41.218 1.00 23.34  ? 4    DA  T N1    1 
ATOM   7400 C  C2    . DA  B 2 2   ? -3.051  -5.420  41.483 1.00 23.61  ? 4    DA  T C2    1 
ATOM   7401 N  N3    . DA  B 2 2   ? -3.811  -4.653  40.697 1.00 25.04  ? 4    DA  T N3    1 
ATOM   7402 C  C4    . DA  B 2 2   ? -4.038  -5.252  39.513 1.00 28.09  ? 4    DA  T C4    1 
ATOM   7403 P  P     . DG  B 2 3   ? -2.081  -0.722  36.398 1.00 25.86  ? 5    DG  T P     1 
ATOM   7404 O  OP1   . DG  B 2 3   ? -1.831  0.579   35.716 1.00 25.21  ? 5    DG  T OP1   1 
ATOM   7405 O  OP2   . DG  B 2 3   ? -1.534  -1.965  35.827 1.00 27.79  ? 5    DG  T OP2   1 
ATOM   7406 O  "O5'" . DG  B 2 3   ? -1.562  -0.674  37.907 1.00 24.68  ? 5    DG  T "O5'" 1 
ATOM   7407 C  "C5'" . DG  B 2 3   ? -1.915  0.407   38.745 1.00 23.32  ? 5    DG  T "C5'" 1 
ATOM   7408 C  "C4'" . DG  B 2 3   ? -1.456  0.105   40.151 1.00 25.48  ? 5    DG  T "C4'" 1 
ATOM   7409 O  "O4'" . DG  B 2 3   ? -1.896  -1.218  40.516 1.00 26.56  ? 5    DG  T "O4'" 1 
ATOM   7410 C  "C3'" . DG  B 2 3   ? 0.045   0.019   40.323 1.00 24.23  ? 5    DG  T "C3'" 1 
ATOM   7411 O  "O3'" . DG  B 2 3   ? 0.570   1.335   40.389 1.00 22.55  ? 5    DG  T "O3'" 1 
ATOM   7412 C  "C2'" . DG  B 2 3   ? 0.124   -0.757  41.635 1.00 24.04  ? 5    DG  T "C2'" 1 
ATOM   7413 C  "C1'" . DG  B 2 3   ? -0.989  -1.775  41.453 1.00 25.64  ? 5    DG  T "C1'" 1 
ATOM   7414 N  N9    . DG  B 2 3   ? -0.554  -3.071  40.928 1.00 32.08  ? 5    DG  T N9    1 
ATOM   7415 C  C8    . DG  B 2 3   ? -0.771  -3.532  39.647 1.00 33.56  ? 5    DG  T C8    1 
ATOM   7416 N  N7    . DG  B 2 3   ? -0.280  -4.716  39.423 1.00 30.38  ? 5    DG  T N7    1 
ATOM   7417 C  C5    . DG  B 2 3   ? 0.296   -5.073  40.631 1.00 31.28  ? 5    DG  T C5    1 
ATOM   7418 C  C6    . DG  B 2 3   ? 0.973   -6.263  40.985 1.00 33.14  ? 5    DG  T C6    1 
ATOM   7419 O  O6    . DG  B 2 3   ? 1.198   -7.252  40.276 1.00 32.39  ? 5    DG  T O6    1 
ATOM   7420 N  N1    . DG  B 2 3   ? 1.416   -6.241  42.306 1.00 34.07  ? 5    DG  T N1    1 
ATOM   7421 C  C2    . DG  B 2 3   ? 1.215   -5.196  43.175 1.00 31.67  ? 5    DG  T C2    1 
ATOM   7422 N  N2    . DG  B 2 3   ? 1.710   -5.362  44.411 1.00 27.48  ? 5    DG  T N2    1 
ATOM   7423 N  N3    . DG  B 2 3   ? 0.578   -4.072  42.851 1.00 31.17  ? 5    DG  T N3    1 
ATOM   7424 C  C4    . DG  B 2 3   ? 0.141   -4.077  41.569 1.00 30.70  ? 5    DG  T C4    1 
ATOM   7425 P  P     . DT  B 2 4   ? 2.143   1.556   40.313 1.00 26.14  ? 6    DT  T P     1 
ATOM   7426 O  OP1   . DT  B 2 4   ? 2.430   2.986   40.498 1.00 24.38  ? 6    DT  T OP1   1 
ATOM   7427 O  OP2   . DT  B 2 4   ? 2.624   0.831   39.118 1.00 30.53  ? 6    DT  T OP2   1 
ATOM   7428 O  "O5'" . DT  B 2 4   ? 2.705   0.798   41.600 1.00 28.29  ? 6    DT  T "O5'" 1 
ATOM   7429 C  "C5'" . DT  B 2 4   ? 2.593   1.418   42.857 1.00 28.23  ? 6    DT  T "C5'" 1 
ATOM   7430 C  "C4'" . DT  B 2 4   ? 3.444   0.697   43.881 1.00 25.78  ? 6    DT  T "C4'" 1 
ATOM   7431 O  "O4'" . DT  B 2 4   ? 3.275   -0.728  43.739 1.00 24.10  ? 6    DT  T "O4'" 1 
ATOM   7432 C  "C3'" . DT  B 2 4   ? 4.933   0.949   43.793 1.00 24.45  ? 6    DT  T "C3'" 1 
ATOM   7433 O  "O3'" . DT  B 2 4   ? 5.407   0.943   45.116 1.00 23.39  ? 6    DT  T "O3'" 1 
ATOM   7434 C  "C2'" . DT  B 2 4   ? 5.431   -0.239  42.976 1.00 24.38  ? 6    DT  T "C2'" 1 
ATOM   7435 C  "C1'" . DT  B 2 4   ? 4.507   -1.342  43.463 1.00 25.59  ? 6    DT  T "C1'" 1 
ATOM   7436 N  N1    . DT  B 2 4   ? 4.298   -2.450  42.483 1.00 24.86  ? 6    DT  T N1    1 
ATOM   7437 C  C2    . DT  B 2 4   ? 4.737   -3.712  42.831 1.00 25.01  ? 6    DT  T C2    1 
ATOM   7438 O  O2    . DT  B 2 4   ? 5.285   -3.966  43.886 1.00 25.26  ? 6    DT  T O2    1 
ATOM   7439 N  N3    . DT  B 2 4   ? 4.513   -4.677  41.879 1.00 26.30  ? 6    DT  T N3    1 
ATOM   7440 C  C4    . DT  B 2 4   ? 3.911   -4.505  40.647 1.00 24.31  ? 6    DT  T C4    1 
ATOM   7441 O  O4    . DT  B 2 4   ? 3.755   -5.441  39.877 1.00 32.08  ? 6    DT  T O4    1 
ATOM   7442 C  C5    . DT  B 2 4   ? 3.473   -3.165  40.344 1.00 24.57  ? 6    DT  T C5    1 
ATOM   7443 C  C7    . DT  B 2 4   ? 2.797   -2.866  39.033 1.00 26.52  ? 6    DT  T C7    1 
ATOM   7444 C  C6    . DT  B 2 4   ? 3.687   -2.210  41.262 1.00 22.63  ? 6    DT  T C6    1 
ATOM   7445 P  P     . DA  B 2 5   ? 6.953   1.056   45.508 1.00 27.58  ? 7    DA  T P     1 
ATOM   7446 O  OP1   . DA  B 2 5   ? 7.019   1.639   46.863 1.00 33.19  ? 7    DA  T OP1   1 
ATOM   7447 O  OP2   . DA  B 2 5   ? 7.724   1.712   44.435 1.00 30.57  ? 7    DA  T OP2   1 
ATOM   7448 O  "O5'" . DA  B 2 5   ? 7.397   -0.470  45.559 1.00 26.67  ? 7    DA  T "O5'" 1 
ATOM   7449 C  "C5'" . DA  B 2 5   ? 7.138   -1.235  46.714 1.00 22.93  ? 7    DA  T "C5'" 1 
ATOM   7450 C  "C4'" . DA  B 2 5   ? 8.137   -2.371  46.880 1.00 22.28  ? 7    DA  T "C4'" 1 
ATOM   7451 O  "O4'" . DA  B 2 5   ? 7.923   -3.456  45.928 1.00 24.34  ? 7    DA  T "O4'" 1 
ATOM   7452 C  "C3'" . DA  B 2 5   ? 9.599   -1.981  46.748 1.00 22.50  ? 7    DA  T "C3'" 1 
ATOM   7453 O  "O3'" . DA  B 2 5   ? 10.251  -2.716  47.752 1.00 23.39  ? 7    DA  T "O3'" 1 
ATOM   7454 C  "C2'" . DA  B 2 5   ? 9.984   -2.437  45.336 1.00 22.10  ? 7    DA  T "C2'" 1 
ATOM   7455 C  "C1'" . DA  B 2 5   ? 9.073   -3.646  45.106 1.00 24.57  ? 7    DA  T "C1'" 1 
ATOM   7456 N  N9    . DA  B 2 5   ? 8.603   -3.760  43.723 1.00 27.05  ? 7    DA  T N9    1 
ATOM   7457 C  C8    . DA  B 2 5   ? 8.041   -2.758  42.974 1.00 26.12  ? 7    DA  T C8    1 
ATOM   7458 N  N7    . DA  B 2 5   ? 7.688   -3.128  41.767 1.00 26.71  ? 7    DA  T N7    1 
ATOM   7459 C  C5    . DA  B 2 5   ? 8.038   -4.463  41.721 1.00 25.49  ? 7    DA  T C5    1 
ATOM   7460 C  C6    . DA  B 2 5   ? 7.927   -5.429  40.705 1.00 26.22  ? 7    DA  T C6    1 
ATOM   7461 N  N6    . DA  B 2 5   ? 7.412   -5.145  39.513 1.00 23.15  ? 7    DA  T N6    1 
ATOM   7462 N  N1    . DA  B 2 5   ? 8.364   -6.687  40.966 1.00 28.33  ? 7    DA  T N1    1 
ATOM   7463 C  C2    . DA  B 2 5   ? 8.889   -6.948  42.168 1.00 24.33  ? 7    DA  T C2    1 
ATOM   7464 N  N3    . DA  B 2 5   ? 9.043   -6.113  43.200 1.00 26.56  ? 7    DA  T N3    1 
ATOM   7465 C  C4    . DA  B 2 5   ? 8.597   -4.878  42.915 1.00 24.74  ? 7    DA  T C4    1 
ATOM   7466 P  P     . DA  B 2 6   ? 11.812  -2.632  47.952 1.00 28.04  ? 8    DA  T P     1 
ATOM   7467 O  OP1   . DA  B 2 6   ? 12.172  -3.145  49.295 1.00 26.83  ? 8    DA  T OP1   1 
ATOM   7468 O  OP2   . DA  B 2 6   ? 12.211  -1.262  47.530 1.00 32.50  ? 8    DA  T OP2   1 
ATOM   7469 O  "O5'" . DA  B 2 6   ? 12.337  -3.678  46.873 1.00 28.10  ? 8    DA  T "O5'" 1 
ATOM   7470 C  "C5'" . DA  B 2 6   ? 12.274  -5.076  47.131 1.00 28.84  ? 8    DA  T "C5'" 1 
ATOM   7471 C  "C4'" . DA  B 2 6   ? 12.962  -5.802  45.992 1.00 26.48  ? 8    DA  T "C4'" 1 
ATOM   7472 O  "O4'" . DA  B 2 6   ? 12.131  -5.689  44.814 1.00 29.12  ? 8    DA  T "O4'" 1 
ATOM   7473 C  "C3'" . DA  B 2 6   ? 14.324  -5.208  45.605 1.00 29.11  ? 8    DA  T "C3'" 1 
ATOM   7474 O  "O3'" . DA  B 2 6   ? 15.256  -6.247  45.375 1.00 25.30  ? 8    DA  T "O3'" 1 
ATOM   7475 C  "C2'" . DA  B 2 6   ? 14.041  -4.481  44.301 1.00 26.00  ? 8    DA  T "C2'" 1 
ATOM   7476 C  "C1'" . DA  B 2 6   ? 13.021  -5.457  43.745 1.00 28.03  ? 8    DA  T "C1'" 1 
ATOM   7477 N  N9    . DA  B 2 6   ? 12.374  -4.955  42.547 1.00 28.03  ? 8    DA  T N9    1 
ATOM   7478 C  C8    . DA  B 2 6   ? 12.030  -3.660  42.249 1.00 28.91  ? 8    DA  T C8    1 
ATOM   7479 N  N7    . DA  B 2 6   ? 11.484  -3.527  41.061 1.00 28.88  ? 8    DA  T N7    1 
ATOM   7480 C  C5    . DA  B 2 6   ? 11.493  -4.818  40.554 1.00 27.77  ? 8    DA  T C5    1 
ATOM   7481 C  C6    . DA  B 2 6   ? 11.054  -5.360  39.330 1.00 28.95  ? 8    DA  T C6    1 
ATOM   7482 N  N6    . DA  B 2 6   ? 10.511  -4.605  38.364 1.00 27.18  ? 8    DA  T N6    1 
ATOM   7483 N  N1    . DA  B 2 6   ? 11.212  -6.699  39.144 1.00 30.85  ? 8    DA  T N1    1 
ATOM   7484 C  C2    . DA  B 2 6   ? 11.764  -7.457  40.116 1.00 28.63  ? 8    DA  T C2    1 
ATOM   7485 N  N3    . DA  B 2 6   ? 12.213  -7.052  41.306 1.00 27.79  ? 8    DA  T N3    1 
ATOM   7486 C  C4    . DA  B 2 6   ? 12.045  -5.716  41.456 1.00 28.39  ? 8    DA  T C4    1 
ATOM   7487 P  P     . DG  B 2 7   ? 16.798  -6.054  45.700 1.00 25.49  ? 9    DG  T P     1 
ATOM   7488 O  OP1   . DG  B 2 7   ? 17.019  -6.081  47.156 1.00 24.29  ? 9    DG  T OP1   1 
ATOM   7489 O  OP2   . DG  B 2 7   ? 17.333  -4.925  44.921 1.00 25.84  ? 9    DG  T OP2   1 
ATOM   7490 O  "O5'" . DG  B 2 7   ? 17.354  -7.416  45.082 1.00 31.25  ? 9    DG  T "O5'" 1 
ATOM   7491 C  "C5'" . DG  B 2 7   ? 16.674  -8.649  45.341 1.00 30.36  ? 9    DG  T "C5'" 1 
ATOM   7492 C  "C4'" . DG  B 2 7   ? 16.766  -9.571  44.141 1.00 32.88  ? 9    DG  T "C4'" 1 
ATOM   7493 O  "O4'" . DG  B 2 7   ? 15.825  -9.092  43.151 1.00 32.81  ? 9    DG  T "O4'" 1 
ATOM   7494 C  "C3'" . DG  B 2 7   ? 18.147  -9.589  43.501 1.00 35.25  ? 9    DG  T "C3'" 1 
ATOM   7495 O  "O3'" . DG  B 2 7   ? 18.714  -10.882 43.310 1.00 39.49  ? 9    DG  T "O3'" 1 
ATOM   7496 C  "C2'" . DG  B 2 7   ? 17.958  -8.861  42.173 1.00 38.60  ? 9    DG  T "C2'" 1 
ATOM   7497 C  "C1'" . DG  B 2 7   ? 16.464  -8.963  41.907 1.00 36.55  ? 9    DG  T "C1'" 1 
ATOM   7498 N  N9    . DG  B 2 7   ? 15.959  -7.778  41.227 1.00 35.65  ? 9    DG  T N9    1 
ATOM   7499 C  C8    . DG  B 2 7   ? 15.875  -6.498  41.715 1.00 35.56  ? 9    DG  T C8    1 
ATOM   7500 N  N7    . DG  B 2 7   ? 15.388  -5.648  40.856 1.00 36.86  ? 9    DG  T N7    1 
ATOM   7501 C  C5    . DG  B 2 7   ? 15.140  -6.412  39.724 1.00 36.88  ? 9    DG  T C5    1 
ATOM   7502 C  C6    . DG  B 2 7   ? 14.608  -6.047  38.460 1.00 35.73  ? 9    DG  T C6    1 
ATOM   7503 O  O6    . DG  B 2 7   ? 14.249  -4.930  38.080 1.00 32.93  ? 9    DG  T O6    1 
ATOM   7504 N  N1    . DG  B 2 7   ? 14.526  -7.135  37.589 1.00 36.74  ? 9    DG  T N1    1 
ATOM   7505 C  C2    . DG  B 2 7   ? 14.915  -8.421  37.905 1.00 37.53  ? 9    DG  T C2    1 
ATOM   7506 N  N2    . DG  B 2 7   ? 14.770  -9.350  36.953 1.00 40.76  ? 9    DG  T N2    1 
ATOM   7507 N  N3    . DG  B 2 7   ? 15.414  -8.778  39.082 1.00 36.53  ? 9    DG  T N3    1 
ATOM   7508 C  C4    . DG  B 2 7   ? 15.497  -7.727  39.938 1.00 36.27  ? 9    DG  T C4    1 
ATOM   7509 P  P     . DC  B 2 8   ? 20.313  -10.971 43.059 1.00 44.56  ? 10   DC  T P     1 
ATOM   7510 O  OP1   . DC  B 2 8   ? 20.873  -12.151 43.744 1.00 39.11  ? 10   DC  T OP1   1 
ATOM   7511 O  OP2   . DC  B 2 8   ? 20.941  -9.634  43.262 1.00 41.48  ? 10   DC  T OP2   1 
ATOM   7512 O  "O5'" . DC  B 2 8   ? 20.358  -11.222 41.485 1.00 45.42  ? 10   DC  T "O5'" 1 
ATOM   7513 C  "C5'" . DC  B 2 8   ? 19.420  -12.069 40.850 1.00 42.06  ? 10   DC  T "C5'" 1 
ATOM   7514 C  "C4'" . DC  B 2 8   ? 19.789  -12.162 39.378 1.00 39.37  ? 10   DC  T "C4'" 1 
ATOM   7515 O  "O4'" . DC  B 2 8   ? 19.017  -11.205 38.611 1.00 34.86  ? 10   DC  T "O4'" 1 
ATOM   7516 C  "C3'" . DC  B 2 8   ? 21.255  -11.932 39.013 1.00 37.99  ? 10   DC  T "C3'" 1 
ATOM   7517 O  "O3'" . DC  B 2 8   ? 21.548  -12.897 38.011 1.00 40.90  ? 10   DC  T "O3'" 1 
ATOM   7518 C  "C2'" . DC  B 2 8   ? 21.279  -10.499 38.481 1.00 36.64  ? 10   DC  T "C2'" 1 
ATOM   7519 C  "C1'" . DC  B 2 8   ? 19.872  -10.347 37.901 1.00 33.98  ? 10   DC  T "C1'" 1 
ATOM   7520 N  N1    . DC  B 2 8   ? 19.322  -8.966  37.997 1.00 32.74  ? 10   DC  T N1    1 
ATOM   7521 C  C2    . DC  B 2 8   ? 18.573  -8.475  36.923 1.00 34.54  ? 10   DC  T C2    1 
ATOM   7522 O  O2    . DC  B 2 8   ? 18.382  -9.206  35.943 1.00 37.66  ? 10   DC  T O2    1 
ATOM   7523 N  N3    . DC  B 2 8   ? 18.084  -7.208  36.995 1.00 35.39  ? 10   DC  T N3    1 
ATOM   7524 C  C4    . DC  B 2 8   ? 18.322  -6.451  38.075 1.00 33.35  ? 10   DC  T C4    1 
ATOM   7525 N  N4    . DC  B 2 8   ? 17.807  -5.220  38.085 1.00 31.12  ? 10   DC  T N4    1 
ATOM   7526 C  C5    . DC  B 2 8   ? 19.089  -6.928  39.189 1.00 32.93  ? 10   DC  T C5    1 
ATOM   7527 C  C6    . DC  B 2 8   ? 19.561  -8.180  39.100 1.00 33.38  ? 10   DC  T C6    1 
ATOM   7528 P  P     . DA  B 2 9   ? 22.859  -12.919 37.097 1.00 44.86  ? 11   DA  T P     1 
ATOM   7529 O  OP1   . DA  B 2 9   ? 23.160  -14.353 36.879 1.00 43.56  ? 11   DA  T OP1   1 
ATOM   7530 O  OP2   . DA  B 2 9   ? 23.895  -12.014 37.674 1.00 42.26  ? 11   DA  T OP2   1 
ATOM   7531 O  "O5'" . DA  B 2 9   ? 22.353  -12.286 35.716 1.00 44.20  ? 11   DA  T "O5'" 1 
ATOM   7532 C  "C5'" . DA  B 2 9   ? 21.439  -12.985 34.848 1.00 46.04  ? 11   DA  T "C5'" 1 
ATOM   7533 C  "C4'" . DA  B 2 9   ? 21.518  -12.458 33.415 1.00 49.42  ? 11   DA  T "C4'" 1 
ATOM   7534 O  "O4'" . DA  B 2 9   ? 20.909  -11.142 33.327 1.00 47.99  ? 11   DA  T "O4'" 1 
ATOM   7535 C  "C3'" . DA  B 2 9   ? 22.925  -12.304 32.819 1.00 51.06  ? 11   DA  T "C3'" 1 
ATOM   7536 O  "O3'" . DA  B 2 9   ? 22.893  -12.603 31.430 1.00 56.05  ? 11   DA  T "O3'" 1 
ATOM   7537 C  "C2'" . DA  B 2 9   ? 23.268  -10.840 33.060 1.00 47.80  ? 11   DA  T "C2'" 1 
ATOM   7538 C  "C1'" . DA  B 2 9   ? 21.895  -10.169 33.014 1.00 47.84  ? 11   DA  T "C1'" 1 
ATOM   7539 N  N9    . DA  B 2 9   ? 21.754  -9.038  33.935 1.00 43.88  ? 11   DA  T N9    1 
ATOM   7540 C  C8    . DA  B 2 9   ? 22.232  -8.933  35.213 1.00 44.07  ? 11   DA  T C8    1 
ATOM   7541 N  N7    . DA  B 2 9   ? 21.954  -7.787  35.793 1.00 44.16  ? 11   DA  T N7    1 
ATOM   7542 C  C5    . DA  B 2 9   ? 21.234  -7.092  34.827 1.00 43.61  ? 11   DA  T C5    1 
ATOM   7543 C  C6    . DA  B 2 9   ? 20.637  -5.803  34.807 1.00 41.29  ? 11   DA  T C6    1 
ATOM   7544 N  N6    . DA  B 2 9   ? 20.659  -4.946  35.832 1.00 38.67  ? 11   DA  T N6    1 
ATOM   7545 N  N1    . DA  B 2 9   ? 20.005  -5.421  33.677 1.00 42.49  ? 11   DA  T N1    1 
ATOM   7546 C  C2    . DA  B 2 9   ? 19.964  -6.267  32.630 1.00 44.24  ? 11   DA  T C2    1 
ATOM   7547 N  N3    . DA  B 2 9   ? 20.473  -7.496  32.530 1.00 42.74  ? 11   DA  T N3    1 
ATOM   7548 C  C4    . DA  B 2 9   ? 21.105  -7.853  33.673 1.00 42.47  ? 11   DA  T C4    1 
ATOM   7549 P  P     . DG  B 2 10  ? 24.211  -12.657 30.512 1.00 61.97  ? 12   DG  T P     1 
ATOM   7550 O  OP1   . DG  B 2 10  ? 23.911  -13.711 29.514 1.00 60.58  ? 12   DG  T OP1   1 
ATOM   7551 O  OP2   . DG  B 2 10  ? 25.447  -12.679 31.340 1.00 55.07  ? 12   DG  T OP2   1 
ATOM   7552 O  "O5'" . DG  B 2 10  ? 24.191  -11.252 29.743 1.00 59.55  ? 12   DG  T "O5'" 1 
ATOM   7553 C  "C5'" . DG  B 2 10  ? 22.996  -10.823 29.074 1.00 56.03  ? 12   DG  T "C5'" 1 
ATOM   7554 C  "C4'" . DG  B 2 10  ? 23.117  -9.369  28.674 1.00 52.11  ? 12   DG  T "C4'" 1 
ATOM   7555 O  "O4'" . DG  B 2 10  ? 22.776  -8.581  29.836 1.00 50.15  ? 12   DG  T "O4'" 1 
ATOM   7556 C  "C3'" . DG  B 2 10  ? 24.524  -8.952  28.256 1.00 52.48  ? 12   DG  T "C3'" 1 
ATOM   7557 O  "O3'" . DG  B 2 10  ? 24.547  -8.363  26.963 1.00 52.64  ? 12   DG  T "O3'" 1 
ATOM   7558 C  "C2'" . DG  B 2 10  ? 24.939  -7.928  29.303 1.00 53.68  ? 12   DG  T "C2'" 1 
ATOM   7559 C  "C1'" . DG  B 2 10  ? 23.609  -7.451  29.856 1.00 52.26  ? 12   DG  T "C1'" 1 
ATOM   7560 N  N9    . DG  B 2 10  ? 23.749  -6.945  31.220 1.00 52.01  ? 12   DG  T N9    1 
ATOM   7561 C  C8    . DG  B 2 10  ? 24.285  -7.584  32.314 1.00 49.37  ? 12   DG  T C8    1 
ATOM   7562 N  N7    . DG  B 2 10  ? 24.279  -6.849  33.390 1.00 50.37  ? 12   DG  T N7    1 
ATOM   7563 C  C5    . DG  B 2 10  ? 23.717  -5.643  32.981 1.00 49.57  ? 12   DG  T C5    1 
ATOM   7564 C  C6    . DG  B 2 10  ? 23.450  -4.448  33.699 1.00 47.94  ? 12   DG  T C6    1 
ATOM   7565 O  O6    . DG  B 2 10  ? 23.661  -4.207  34.890 1.00 50.14  ? 12   DG  T O6    1 
ATOM   7566 N  N1    . DG  B 2 10  ? 22.873  -3.461  32.902 1.00 48.69  ? 12   DG  T N1    1 
ATOM   7567 C  C2    . DG  B 2 10  ? 22.585  -3.614  31.563 1.00 51.16  ? 12   DG  T C2    1 
ATOM   7568 N  N2    . DG  B 2 10  ? 22.032  -2.571  30.938 1.00 49.48  ? 12   DG  T N2    1 
ATOM   7569 N  N3    . DG  B 2 10  ? 22.824  -4.722  30.875 1.00 52.64  ? 12   DG  T N3    1 
ATOM   7570 C  C4    . DG  B 2 10  ? 23.389  -5.690  31.645 1.00 51.64  ? 12   DG  T C4    1 
ATOM   7571 P  P     . DT  B 2 11  ? 25.938  -7.913  26.294 1.00 53.39  ? 13   DT  T P     1 
ATOM   7572 O  OP1   . DT  B 2 11  ? 25.941  -8.475  24.930 1.00 56.72  ? 13   DT  T OP1   1 
ATOM   7573 O  OP2   . DT  B 2 11  ? 27.077  -8.168  27.210 1.00 50.79  ? 13   DT  T OP2   1 
ATOM   7574 O  "O5'" . DT  B 2 11  ? 25.765  -6.334  26.186 1.00 52.76  ? 13   DT  T "O5'" 1 
ATOM   7575 C  "C5'" . DT  B 2 11  ? 24.556  -5.760  25.697 1.00 48.58  ? 13   DT  T "C5'" 1 
ATOM   7576 C  "C4'" . DT  B 2 11  ? 24.725  -4.254  25.641 1.00 51.64  ? 13   DT  T "C4'" 1 
ATOM   7577 O  "O4'" . DT  B 2 11  ? 24.657  -3.712  26.983 1.00 51.35  ? 13   DT  T "O4'" 1 
ATOM   7578 C  "C3'" . DT  B 2 11  ? 26.060  -3.771  25.079 1.00 53.45  ? 13   DT  T "C3'" 1 
ATOM   7579 O  "O3'" . DT  B 2 11  ? 25.828  -2.602  24.267 1.00 52.70  ? 13   DT  T "O3'" 1 
ATOM   7580 C  "C2'" . DT  B 2 11  ? 26.920  -3.526  26.327 1.00 50.05  ? 13   DT  T "C2'" 1 
ATOM   7581 C  "C1'" . DT  B 2 11  ? 25.869  -3.073  27.335 1.00 50.22  ? 13   DT  T "C1'" 1 
ATOM   7582 N  N1    . DT  B 2 11  ? 26.100  -3.383  28.792 1.00 51.42  ? 13   DT  T N1    1 
ATOM   7583 C  C2    . DT  B 2 11  ? 25.765  -2.414  29.723 1.00 51.60  ? 13   DT  T C2    1 
ATOM   7584 O  O2    . DT  B 2 11  ? 25.311  -1.317  29.430 1.00 49.92  ? 13   DT  T O2    1 
ATOM   7585 N  N3    . DT  B 2 11  ? 25.986  -2.773  31.032 1.00 51.35  ? 13   DT  T N3    1 
ATOM   7586 C  C4    . DT  B 2 11  ? 26.489  -3.973  31.503 1.00 53.73  ? 13   DT  T C4    1 
ATOM   7587 O  O4    . DT  B 2 11  ? 26.648  -4.189  32.707 1.00 55.26  ? 13   DT  T O4    1 
ATOM   7588 C  C5    . DT  B 2 11  ? 26.817  -4.943  30.481 1.00 53.62  ? 13   DT  T C5    1 
ATOM   7589 C  C7    . DT  B 2 11  ? 27.383  -6.275  30.881 1.00 54.49  ? 13   DT  T C7    1 
ATOM   7590 C  C6    . DT  B 2 11  ? 26.606  -4.612  29.195 1.00 52.46  ? 13   DT  T C6    1 
ATOM   7591 P  P     . DC  B 2 12  ? 27.021  -1.816  23.525 1.00 51.36  ? 14   DC  T P     1 
ATOM   7592 O  OP1   . DC  B 2 12  ? 26.410  -1.116  22.374 1.00 54.85  ? 14   DC  T OP1   1 
ATOM   7593 O  OP2   . DC  B 2 12  ? 28.151  -2.746  23.319 1.00 47.28  ? 14   DC  T OP2   1 
ATOM   7594 O  "O5'" . DC  B 2 12  ? 27.457  -0.728  24.607 1.00 51.73  ? 14   DC  T "O5'" 1 
ATOM   7595 C  "C5'" . DC  B 2 12  ? 26.523  0.273   25.024 1.00 55.50  ? 14   DC  T "C5'" 1 
ATOM   7596 C  "C4'" . DC  B 2 12  ? 27.172  1.287   25.956 1.00 60.14  ? 14   DC  T "C4'" 1 
ATOM   7597 O  "O4'" . DC  B 2 12  ? 27.295  0.742   27.296 1.00 58.64  ? 14   DC  T "O4'" 1 
ATOM   7598 C  "C3'" . DC  B 2 12  ? 28.573  1.769   25.567 1.00 61.74  ? 14   DC  T "C3'" 1 
ATOM   7599 O  "O3'" . DC  B 2 12  ? 28.602  3.170   25.784 1.00 67.34  ? 14   DC  T "O3'" 1 
ATOM   7600 C  "C2'" . DC  B 2 12  ? 29.508  1.015   26.516 1.00 59.52  ? 14   DC  T "C2'" 1 
ATOM   7601 C  "C1'" . DC  B 2 12  ? 28.626  0.908   27.761 1.00 57.92  ? 14   DC  T "C1'" 1 
ATOM   7602 N  N1    . DC  B 2 12  ? 28.930  -0.226  28.697 1.00 54.73  ? 14   DC  T N1    1 
ATOM   7603 C  C2    . DC  B 2 12  ? 28.793  -0.028  30.082 1.00 52.63  ? 14   DC  T C2    1 
ATOM   7604 O  O2    . DC  B 2 12  ? 28.437  1.078   30.516 1.00 52.28  ? 14   DC  T O2    1 
ATOM   7605 N  N3    . DC  B 2 12  ? 29.065  -1.060  30.919 1.00 51.50  ? 14   DC  T N3    1 
ATOM   7606 C  C4    . DC  B 2 12  ? 29.441  -2.244  30.422 1.00 53.20  ? 14   DC  T C4    1 
ATOM   7607 N  N4    . DC  B 2 12  ? 29.694  -3.232  31.286 1.00 50.49  ? 14   DC  T N4    1 
ATOM   7608 C  C5    . DC  B 2 12  ? 29.576  -2.472  29.016 1.00 54.82  ? 14   DC  T C5    1 
ATOM   7609 C  C6    . DC  B 2 12  ? 29.312  -1.444  28.199 1.00 54.83  ? 14   DC  T C6    1 
ATOM   7610 P  P     . DC  B 2 13  ? 29.745  4.139   25.214 1.00 75.36  ? 15   DC  T P     1 
ATOM   7611 O  OP1   . DC  B 2 13  ? 29.023  5.350   24.752 1.00 74.77  ? 15   DC  T OP1   1 
ATOM   7612 O  OP2   . DC  B 2 13  ? 30.648  3.391   24.302 1.00 74.16  ? 15   DC  T OP2   1 
ATOM   7613 O  "O5'" . DC  B 2 13  ? 30.611  4.503   26.509 1.00 73.13  ? 15   DC  T "O5'" 1 
ATOM   7614 C  "C5'" . DC  B 2 13  ? 29.988  4.818   27.754 1.00 73.74  ? 15   DC  T "C5'" 1 
ATOM   7615 C  "C4'" . DC  B 2 13  ? 30.982  4.631   28.882 1.00 75.07  ? 15   DC  T "C4'" 1 
ATOM   7616 O  "O4'" . DC  B 2 13  ? 30.932  3.266   29.371 1.00 74.06  ? 15   DC  T "O4'" 1 
ATOM   7617 C  "C3'" . DC  B 2 13  ? 32.436  4.880   28.477 1.00 77.02  ? 15   DC  T "C3'" 1 
ATOM   7618 O  "O3'" . DC  B 2 13  ? 32.990  5.860   29.337 1.00 77.04  ? 15   DC  T "O3'" 1 
ATOM   7619 C  "C2'" . DC  B 2 13  ? 33.110  3.516   28.634 1.00 75.94  ? 15   DC  T "C2'" 1 
ATOM   7620 C  "C1'" . DC  B 2 13  ? 32.248  2.924   29.743 1.00 72.99  ? 15   DC  T "C1'" 1 
ATOM   7621 N  N1    . DC  B 2 13  ? 32.363  1.446   29.962 1.00 70.95  ? 15   DC  T N1    1 
ATOM   7622 C  C2    . DC  B 2 13  ? 32.316  0.950   31.280 1.00 69.70  ? 15   DC  T C2    1 
ATOM   7623 O  O2    . DC  B 2 13  ? 32.181  1.735   32.230 1.00 66.75  ? 15   DC  T O2    1 
ATOM   7624 N  N3    . DC  B 2 13  ? 32.422  -0.389  31.483 1.00 70.43  ? 15   DC  T N3    1 
ATOM   7625 C  C4    . DC  B 2 13  ? 32.568  -1.215  30.441 1.00 71.42  ? 15   DC  T C4    1 
ATOM   7626 N  N4    . DC  B 2 13  ? 32.667  -2.523  30.701 1.00 71.59  ? 15   DC  T N4    1 
ATOM   7627 C  C5    . DC  B 2 13  ? 32.622  -0.733  29.095 1.00 72.30  ? 15   DC  T C5    1 
ATOM   7628 C  C6    . DC  B 2 13  ? 32.513  0.590   28.902 1.00 71.36  ? 15   DC  T C6    1 
ATOM   7629 P  P     . DG  B 2 14  ? 34.303  6.693   28.932 1.00 79.24  ? 16   DG  T P     1 
ATOM   7630 O  OP1   . DG  B 2 14  ? 33.851  7.917   28.233 1.00 79.18  ? 16   DG  T OP1   1 
ATOM   7631 O  OP2   . DG  B 2 14  ? 35.305  5.807   28.283 1.00 75.78  ? 16   DG  T OP2   1 
ATOM   7632 O  "O5'" . DG  B 2 14  ? 34.861  7.104   30.379 1.00 76.87  ? 16   DG  T "O5'" 1 
ATOM   7633 C  "C5'" . DG  B 2 14  ? 34.056  7.012   31.564 1.00 71.05  ? 16   DG  T "C5'" 1 
ATOM   7634 C  "C4'" . DG  B 2 14  ? 34.786  6.285   32.689 1.00 67.04  ? 16   DG  T "C4'" 1 
ATOM   7635 O  "O4'" . DG  B 2 14  ? 34.629  4.846   32.558 1.00 66.00  ? 16   DG  T "O4'" 1 
ATOM   7636 C  "C3'" . DG  B 2 14  ? 36.292  6.535   32.790 1.00 64.62  ? 16   DG  T "C3'" 1 
ATOM   7637 O  "O3'" . DG  B 2 14  ? 36.622  6.853   34.145 1.00 59.25  ? 16   DG  T "O3'" 1 
ATOM   7638 C  "C2'" . DG  B 2 14  ? 36.918  5.220   32.317 1.00 64.46  ? 16   DG  T "C2'" 1 
ATOM   7639 C  "C1'" . DG  B 2 14  ? 35.876  4.215   32.802 1.00 65.39  ? 16   DG  T "C1'" 1 
ATOM   7640 N  N9    . DG  B 2 14  ? 35.858  2.910   32.133 1.00 63.47  ? 16   DG  T N9    1 
ATOM   7641 C  C8    . DG  B 2 14  ? 35.849  2.675   30.776 1.00 66.25  ? 16   DG  T C8    1 
ATOM   7642 N  N7    . DG  B 2 14  ? 35.816  1.411   30.454 1.00 66.36  ? 16   DG  T N7    1 
ATOM   7643 C  C5    . DG  B 2 14  ? 35.801  0.764   31.682 1.00 64.18  ? 16   DG  T C5    1 
ATOM   7644 C  C6    . DG  B 2 14  ? 35.763  -0.622  31.964 1.00 65.00  ? 16   DG  T C6    1 
ATOM   7645 O  O6    . DG  B 2 14  ? 35.732  -1.552  31.150 1.00 66.68  ? 16   DG  T O6    1 
ATOM   7646 N  N1    . DG  B 2 14  ? 35.756  -0.882  33.336 1.00 64.32  ? 16   DG  T N1    1 
ATOM   7647 C  C2    . DG  B 2 14  ? 35.784  0.089   34.318 1.00 62.04  ? 16   DG  T C2    1 
ATOM   7648 N  N2    . DG  B 2 14  ? 35.767  -0.355  35.588 1.00 57.07  ? 16   DG  T N2    1 
ATOM   7649 N  N3    . DG  B 2 14  ? 35.819  1.400   34.062 1.00 59.60  ? 16   DG  T N3    1 
ATOM   7650 C  C4    . DG  B 2 14  ? 35.824  1.665   32.727 1.00 61.16  ? 16   DG  T C4    1 
ATOM   7651 P  P     . DC  B 2 15  ? 38.000  7.581   34.512 1.00 61.16  ? 17   DC  T P     1 
ATOM   7652 O  OP1   . DC  B 2 15  ? 37.811  8.278   35.801 1.00 59.76  ? 17   DC  T OP1   1 
ATOM   7653 O  OP2   . DC  B 2 15  ? 38.500  8.327   33.332 1.00 56.63  ? 17   DC  T OP2   1 
ATOM   7654 O  "O5'" . DC  B 2 15  ? 38.957  6.338   34.784 1.00 60.08  ? 17   DC  T "O5'" 1 
ATOM   7655 C  "C5'" . DC  B 2 15  ? 38.761  5.625   35.987 1.00 59.84  ? 17   DC  T "C5'" 1 
ATOM   7656 C  "C4'" . DC  B 2 15  ? 39.654  4.413   36.011 1.00 60.23  ? 17   DC  T "C4'" 1 
ATOM   7657 O  "O4'" . DC  B 2 15  ? 39.197  3.460   35.038 1.00 62.54  ? 17   DC  T "O4'" 1 
ATOM   7658 C  "C3'" . DC  B 2 15  ? 41.112  4.692   35.672 1.00 62.07  ? 17   DC  T "C3'" 1 
ATOM   7659 O  "O3'" . DC  B 2 15  ? 41.778  4.485   36.901 1.00 59.21  ? 17   DC  T "O3'" 1 
ATOM   7660 C  "C2'" . DC  B 2 15  ? 41.470  3.688   34.576 1.00 61.67  ? 17   DC  T "C2'" 1 
ATOM   7661 C  "C1'" . DC  B 2 15  ? 40.314  2.703   34.658 1.00 62.82  ? 17   DC  T "C1'" 1 
ATOM   7662 N  N1    . DC  B 2 15  ? 39.967  2.019   33.387 1.00 65.14  ? 17   DC  T N1    1 
ATOM   7663 C  C2    . DC  B 2 15  ? 39.620  0.661   33.432 1.00 65.78  ? 17   DC  T C2    1 
ATOM   7664 O  O2    . DC  B 2 15  ? 39.615  0.071   34.525 1.00 63.30  ? 17   DC  T O2    1 
ATOM   7665 N  N3    . DC  B 2 15  ? 39.302  0.036   32.265 1.00 66.99  ? 17   DC  T N3    1 
ATOM   7666 C  C4    . DC  B 2 15  ? 39.322  0.713   31.111 1.00 67.27  ? 17   DC  T C4    1 
ATOM   7667 N  N4    . DC  B 2 15  ? 39.004  0.051   29.997 1.00 68.50  ? 17   DC  T N4    1 
ATOM   7668 C  C5    . DC  B 2 15  ? 39.669  2.096   31.046 1.00 68.00  ? 17   DC  T C5    1 
ATOM   7669 C  C6    . DC  B 2 15  ? 39.979  2.703   32.199 1.00 67.11  ? 17   DC  T C6    1 
ATOM   7670 P  P     . DG  B 2 16  ? 43.339  4.381   37.118 1.00 51.04  ? 18   DG  T P     1 
ATOM   7671 O  OP1   . DG  B 2 16  ? 43.749  2.969   36.941 1.00 56.25  ? 18   DG  T OP1   1 
ATOM   7672 O  OP2   . DG  B 2 16  ? 43.578  5.035   38.419 1.00 57.95  ? 18   DG  T OP2   1 
ATOM   7673 O  "O5'" . DG  B 2 16  ? 44.005  5.268   35.972 1.00 52.78  ? 18   DG  T "O5'" 1 
ATOM   7674 C  "C5'" . DG  B 2 16  ? 45.425  5.456   35.958 1.00 46.10  ? 18   DG  T "C5'" 1 
ATOM   7675 C  "C4'" . DG  B 2 16  ? 45.966  5.229   34.556 1.00 42.40  ? 18   DG  T "C4'" 1 
ATOM   7676 O  "O4'" . DG  B 2 16  ? 47.282  5.815   34.420 1.00 41.88  ? 18   DG  T "O4'" 1 
ATOM   7677 C  "C3'" . DG  B 2 16  ? 46.137  3.772   34.162 1.00 40.72  ? 18   DG  T "C3'" 1 
ATOM   7678 O  "O3'" . DG  B 2 16  ? 45.780  3.622   32.799 1.00 39.99  ? 18   DG  T "O3'" 1 
ATOM   7679 C  "C2'" . DG  B 2 16  ? 47.627  3.506   34.393 1.00 41.83  ? 18   DG  T "C2'" 1 
ATOM   7680 C  "C1'" . DG  B 2 16  ? 48.227  4.848   34.005 1.00 41.17  ? 18   DG  T "C1'" 1 
ATOM   7681 N  N9    . DG  B 2 16  ? 49.501  5.186   34.635 1.00 41.70  ? 18   DG  T N9    1 
ATOM   7682 C  C8    . DG  B 2 16  ? 50.676  5.459   33.979 1.00 42.95  ? 18   DG  T C8    1 
ATOM   7683 N  N7    . DG  B 2 16  ? 51.664  5.750   34.773 1.00 43.20  ? 18   DG  T N7    1 
ATOM   7684 C  C5    . DG  B 2 16  ? 51.101  5.673   36.043 1.00 42.08  ? 18   DG  T C5    1 
ATOM   7685 C  C6    . DG  B 2 16  ? 51.699  5.892   37.307 1.00 41.88  ? 18   DG  T C6    1 
ATOM   7686 O  O6    . DG  B 2 16  ? 52.878  6.206   37.547 1.00 42.63  ? 18   DG  T O6    1 
ATOM   7687 N  N1    . DG  B 2 16  ? 50.791  5.713   38.350 1.00 40.76  ? 18   DG  T N1    1 
ATOM   7688 C  C2    . DG  B 2 16  ? 49.466  5.382   38.197 1.00 40.05  ? 18   DG  T C2    1 
ATOM   7689 N  N2    . DG  B 2 16  ? 48.751  5.264   39.325 1.00 38.97  ? 18   DG  T N2    1 
ATOM   7690 N  N3    . DG  B 2 16  ? 48.892  5.168   37.012 1.00 41.59  ? 18   DG  T N3    1 
ATOM   7691 C  C4    . DG  B 2 16  ? 49.769  5.333   35.979 1.00 41.15  ? 18   DG  T C4    1 
ATOM   7692 O  "O5'" . DG  C 3 1   ? 39.175  -10.250 32.144 1.00 113.50 ? 103  DG  P "O5'" 1 
ATOM   7693 C  "C5'" . DG  C 3 1   ? 39.876  -10.805 33.256 1.00 113.78 ? 103  DG  P "C5'" 1 
ATOM   7694 C  "C4'" . DG  C 3 1   ? 39.746  -9.954  34.516 1.00 112.79 ? 103  DG  P "C4'" 1 
ATOM   7695 O  "O4'" . DG  C 3 1   ? 39.973  -8.549  34.221 1.00 111.17 ? 103  DG  P "O4'" 1 
ATOM   7696 C  "C3'" . DG  C 3 1   ? 38.406  -10.008 35.247 1.00 112.18 ? 103  DG  P "C3'" 1 
ATOM   7697 O  "O3'" . DG  C 3 1   ? 38.658  -9.971  36.657 1.00 114.02 ? 103  DG  P "O3'" 1 
ATOM   7698 C  "C2'" . DG  C 3 1   ? 37.677  -8.757  34.752 1.00 109.99 ? 103  DG  P "C2'" 1 
ATOM   7699 C  "C1'" . DG  C 3 1   ? 38.830  -7.778  34.555 1.00 108.42 ? 103  DG  P "C1'" 1 
ATOM   7700 N  N9    . DG  C 3 1   ? 38.641  -6.803  33.480 1.00 105.21 ? 103  DG  P N9    1 
ATOM   7701 C  C8    . DG  C 3 1   ? 38.527  -7.062  32.133 1.00 104.90 ? 103  DG  P C8    1 
ATOM   7702 N  N7    . DG  C 3 1   ? 38.382  -5.992  31.402 1.00 103.96 ? 103  DG  P N7    1 
ATOM   7703 C  C5    . DG  C 3 1   ? 38.406  -4.950  32.320 1.00 101.57 ? 103  DG  P C5    1 
ATOM   7704 C  C6    . DG  C 3 1   ? 38.294  -3.550  32.116 1.00 99.26  ? 103  DG  P C6    1 
ATOM   7705 O  O6    . DG  C 3 1   ? 38.148  -2.943  31.045 1.00 97.68  ? 103  DG  P O6    1 
ATOM   7706 N  N1    . DG  C 3 1   ? 38.367  -2.843  33.319 1.00 97.14  ? 103  DG  P N1    1 
ATOM   7707 C  C2    . DG  C 3 1   ? 38.532  -3.422  34.560 1.00 96.51  ? 103  DG  P C2    1 
ATOM   7708 N  N2    . DG  C 3 1   ? 38.586  -2.594  35.612 1.00 95.25  ? 103  DG  P N2    1 
ATOM   7709 N  N3    . DG  C 3 1   ? 38.638  -4.729  34.762 1.00 98.40  ? 103  DG  P N3    1 
ATOM   7710 C  C4    . DG  C 3 1   ? 38.567  -5.433  33.604 1.00 101.78 ? 103  DG  P C4    1 
ATOM   7711 P  P     . DC  C 3 2   ? 37.507  -10.139 37.766 1.00 115.06 ? 104  DC  P P     1 
ATOM   7712 O  OP1   . DC  C 3 2   ? 38.128  -10.813 38.931 1.00 114.72 ? 104  DC  P OP1   1 
ATOM   7713 O  OP2   . DC  C 3 2   ? 36.303  -10.731 37.137 1.00 114.59 ? 104  DC  P OP2   1 
ATOM   7714 O  "O5'" . DC  C 3 2   ? 37.164  -8.619  38.155 1.00 113.41 ? 104  DC  P "O5'" 1 
ATOM   7715 C  "C5'" . DC  C 3 2   ? 36.454  -8.309  39.359 1.00 109.72 ? 104  DC  P "C5'" 1 
ATOM   7716 C  "C4'" . DC  C 3 2   ? 35.726  -6.976  39.270 1.00 107.04 ? 104  DC  P "C4'" 1 
ATOM   7717 O  "O4'" . DC  C 3 2   ? 36.035  -6.314  38.013 1.00 106.05 ? 104  DC  P "O4'" 1 
ATOM   7718 C  "C3'" . DC  C 3 2   ? 34.197  -7.077  39.340 1.00 105.88 ? 104  DC  P "C3'" 1 
ATOM   7719 O  "O3'" . DC  C 3 2   ? 33.607  -6.507  40.536 1.00 105.35 ? 104  DC  P "O3'" 1 
ATOM   7720 C  "C2'" . DC  C 3 2   ? 33.685  -6.401  38.067 1.00 104.62 ? 104  DC  P "C2'" 1 
ATOM   7721 C  "C1'" . DC  C 3 2   ? 34.892  -5.599  37.588 1.00 103.61 ? 104  DC  P "C1'" 1 
ATOM   7722 N  N1    . DC  C 3 2   ? 34.924  -5.357  36.103 1.00 100.36 ? 104  DC  P N1    1 
ATOM   7723 C  C2    . DC  C 3 2   ? 35.134  -4.057  35.604 1.00 98.19  ? 104  DC  P C2    1 
ATOM   7724 O  O2    . DC  C 3 2   ? 35.296  -3.108  36.382 1.00 95.08  ? 104  DC  P O2    1 
ATOM   7725 N  N3    . DC  C 3 2   ? 35.151  -3.867  34.259 1.00 98.13  ? 104  DC  P N3    1 
ATOM   7726 C  C4    . DC  C 3 2   ? 34.970  -4.902  33.431 1.00 98.63  ? 104  DC  P C4    1 
ATOM   7727 N  N4    . DC  C 3 2   ? 34.994  -4.663  32.117 1.00 98.55  ? 104  DC  P N4    1 
ATOM   7728 C  C5    . DC  C 3 2   ? 34.754  -6.229  33.914 1.00 98.97  ? 104  DC  P C5    1 
ATOM   7729 C  C6    . DC  C 3 2   ? 34.739  -6.406  35.241 1.00 99.46  ? 104  DC  P C6    1 
ATOM   7730 P  P     . DG  C 3 3   ? 34.091  -5.176  41.302 1.00 106.88 ? 105  DG  P P     1 
ATOM   7731 O  OP1   . DG  C 3 3   ? 34.739  -4.234  40.359 1.00 106.71 ? 105  DG  P OP1   1 
ATOM   7732 O  OP2   . DG  C 3 3   ? 34.829  -5.626  42.504 1.00 106.63 ? 105  DG  P OP2   1 
ATOM   7733 O  "O5'" . DG  C 3 3   ? 32.705  -4.532  41.787 1.00 103.38 ? 105  DG  P "O5'" 1 
ATOM   7734 C  "C5'" . DG  C 3 3   ? 32.705  -3.323  42.545 1.00 99.05  ? 105  DG  P "C5'" 1 
ATOM   7735 C  "C4'" . DG  C 3 3   ? 32.288  -2.131  41.701 1.00 95.69  ? 105  DG  P "C4'" 1 
ATOM   7736 O  "O4'" . DG  C 3 3   ? 32.930  -2.176  40.401 1.00 93.53  ? 105  DG  P "O4'" 1 
ATOM   7737 C  "C3'" . DG  C 3 3   ? 30.800  -2.067  41.385 1.00 94.82  ? 105  DG  P "C3'" 1 
ATOM   7738 O  "O3'" . DG  C 3 3   ? 30.029  -1.477  42.460 1.00 96.80  ? 105  DG  P "O3'" 1 
ATOM   7739 C  "C2'" . DG  C 3 3   ? 30.768  -1.259  40.089 1.00 93.10  ? 105  DG  P "C2'" 1 
ATOM   7740 C  "C1'" . DG  C 3 3   ? 32.139  -1.473  39.457 1.00 91.39  ? 105  DG  P "C1'" 1 
ATOM   7741 N  N9    . DG  C 3 3   ? 32.085  -2.180  38.168 1.00 87.26  ? 105  DG  P N9    1 
ATOM   7742 C  C8    . DG  C 3 3   ? 31.904  -3.528  37.947 1.00 85.28  ? 105  DG  P C8    1 
ATOM   7743 N  N7    . DG  C 3 3   ? 31.895  -3.865  36.685 1.00 82.58  ? 105  DG  P N7    1 
ATOM   7744 C  C5    . DG  C 3 3   ? 32.077  -2.662  36.015 1.00 81.39  ? 105  DG  P C5    1 
ATOM   7745 C  C6    . DG  C 3 3   ? 32.161  -2.388  34.622 1.00 79.72  ? 105  DG  P C6    1 
ATOM   7746 O  O6    . DG  C 3 3   ? 32.079  -3.185  33.672 1.00 76.58  ? 105  DG  P O6    1 
ATOM   7747 N  N1    . DG  C 3 3   ? 32.351  -1.026  34.371 1.00 78.81  ? 105  DG  P N1    1 
ATOM   7748 C  C2    . DG  C 3 3   ? 32.450  -0.055  35.346 1.00 79.19  ? 105  DG  P C2    1 
ATOM   7749 N  N2    . DG  C 3 3   ? 32.630  1.203   34.927 1.00 77.73  ? 105  DG  P N2    1 
ATOM   7750 N  N3    . DG  C 3 3   ? 32.378  -0.299  36.649 1.00 80.54  ? 105  DG  P N3    1 
ATOM   7751 C  C4    . DG  C 3 3   ? 32.192  -1.618  36.914 1.00 82.96  ? 105  DG  P C4    1 
ATOM   7752 P  P     . DG  C 3 4   ? 30.021  0.085   42.866 1.00 99.66  ? 106  DG  P P     1 
ATOM   7753 O  OP1   . DG  C 3 4   ? 31.236  0.349   43.671 1.00 98.99  ? 106  DG  P OP1   1 
ATOM   7754 O  OP2   . DG  C 3 4   ? 28.678  0.394   43.412 1.00 98.87  ? 106  DG  P OP2   1 
ATOM   7755 O  "O5'" . DG  C 3 4   ? 30.153  0.879   41.484 1.00 97.44  ? 106  DG  P "O5'" 1 
ATOM   7756 C  "C5'" . DG  C 3 4   ? 30.198  2.292   41.440 1.00 92.88  ? 106  DG  P "C5'" 1 
ATOM   7757 C  "C4'" . DG  C 3 4   ? 29.505  2.761   40.178 1.00 89.56  ? 106  DG  P "C4'" 1 
ATOM   7758 O  "O4'" . DG  C 3 4   ? 29.729  1.828   39.087 1.00 86.75  ? 106  DG  P "O4'" 1 
ATOM   7759 C  "C3'" . DG  C 3 4   ? 27.997  2.860   40.322 1.00 89.14  ? 106  DG  P "C3'" 1 
ATOM   7760 O  "O3'" . DG  C 3 4   ? 27.585  4.121   39.826 1.00 90.91  ? 106  DG  P "O3'" 1 
ATOM   7761 C  "C2'" . DG  C 3 4   ? 27.464  1.694   39.481 1.00 87.39  ? 106  DG  P "C2'" 1 
ATOM   7762 C  "C1'" . DG  C 3 4   ? 28.515  1.639   38.380 1.00 84.83  ? 106  DG  P "C1'" 1 
ATOM   7763 N  N9    . DG  C 3 4   ? 28.621  0.398   37.602 1.00 79.39  ? 106  DG  P N9    1 
ATOM   7764 C  C8    . DG  C 3 4   ? 28.618  -0.886  38.085 1.00 78.73  ? 106  DG  P C8    1 
ATOM   7765 N  N7    . DG  C 3 4   ? 28.758  -1.805  37.171 1.00 77.45  ? 106  DG  P N7    1 
ATOM   7766 C  C5    . DG  C 3 4   ? 28.858  -1.087  35.990 1.00 75.31  ? 106  DG  P C5    1 
ATOM   7767 C  C6    . DG  C 3 4   ? 29.020  -1.549  34.657 1.00 73.71  ? 106  DG  P C6    1 
ATOM   7768 O  O6    . DG  C 3 4   ? 29.108  -2.716  34.255 1.00 70.83  ? 106  DG  P O6    1 
ATOM   7769 N  N1    . DG  C 3 4   ? 29.076  -0.501  33.740 1.00 74.58  ? 106  DG  P N1    1 
ATOM   7770 C  C2    . DG  C 3 4   ? 28.989  0.832   34.079 1.00 75.98  ? 106  DG  P C2    1 
ATOM   7771 N  N2    . DG  C 3 4   ? 29.066  1.705   33.066 1.00 76.83  ? 106  DG  P N2    1 
ATOM   7772 N  N3    . DG  C 3 4   ? 28.838  1.277   35.327 1.00 76.39  ? 106  DG  P N3    1 
ATOM   7773 C  C4    . DG  C 3 4   ? 28.779  0.268   36.236 1.00 76.52  ? 106  DG  P C4    1 
ATOM   7774 P  P     . DA  C 3 5   ? 26.242  4.802   40.374 1.00 95.35  ? 107  DA  P P     1 
ATOM   7775 O  OP1   . DA  C 3 5   ? 26.630  6.065   41.043 1.00 96.09  ? 107  DA  P OP1   1 
ATOM   7776 O  OP2   . DA  C 3 5   ? 25.454  3.792   41.123 1.00 93.97  ? 107  DA  P OP2   1 
ATOM   7777 O  "O5'" . DA  C 3 5   ? 25.435  5.124   39.027 1.00 93.61  ? 107  DA  P "O5'" 1 
ATOM   7778 C  "C5'" . DA  C 3 5   ? 25.955  6.032   38.061 1.00 90.79  ? 107  DA  P "C5'" 1 
ATOM   7779 C  "C4'" . DA  C 3 5   ? 25.422  5.713   36.677 1.00 87.26  ? 107  DA  P "C4'" 1 
ATOM   7780 O  "O4'" . DA  C 3 5   ? 25.855  4.391   36.281 1.00 83.54  ? 107  DA  P "O4'" 1 
ATOM   7781 C  "C3'" . DA  C 3 5   ? 23.906  5.711   36.545 1.00 85.52  ? 107  DA  P "C3'" 1 
ATOM   7782 O  "O3'" . DA  C 3 5   ? 23.571  6.476   35.402 1.00 88.40  ? 107  DA  P "O3'" 1 
ATOM   7783 C  "C2'" . DA  C 3 5   ? 23.542  4.239   36.366 1.00 81.50  ? 107  DA  P "C2'" 1 
ATOM   7784 C  "C1'" . DA  C 3 5   ? 24.783  3.735   35.641 1.00 80.13  ? 107  DA  P "C1'" 1 
ATOM   7785 N  N9    . DA  C 3 5   ? 25.052  2.303   35.741 1.00 75.52  ? 107  DA  P N9    1 
ATOM   7786 C  C8    . DA  C 3 5   ? 25.194  1.568   36.890 1.00 74.43  ? 107  DA  P C8    1 
ATOM   7787 N  N7    . DA  C 3 5   ? 25.449  0.295   36.689 1.00 71.15  ? 107  DA  P N7    1 
ATOM   7788 C  C5    . DA  C 3 5   ? 25.484  0.190   35.306 1.00 69.28  ? 107  DA  P C5    1 
ATOM   7789 C  C6    . DA  C 3 5   ? 25.708  -0.904  34.446 1.00 65.56  ? 107  DA  P C6    1 
ATOM   7790 N  N6    . DA  C 3 5   ? 25.948  -2.139  34.894 1.00 62.23  ? 107  DA  P N6    1 
ATOM   7791 N  N1    . DA  C 3 5   ? 25.679  -0.675  33.113 1.00 65.53  ? 107  DA  P N1    1 
ATOM   7792 C  C2    . DA  C 3 5   ? 25.439  0.568   32.667 1.00 66.69  ? 107  DA  P C2    1 
ATOM   7793 N  N3    . DA  C 3 5   ? 25.208  1.673   33.379 1.00 68.39  ? 107  DA  P N3    1 
ATOM   7794 C  C4    . DA  C 3 5   ? 25.246  1.418   34.702 1.00 71.09  ? 107  DA  P C4    1 
ATOM   7795 P  P     . DC  C 3 6   ? 22.067  6.975   35.200 1.00 91.87  ? 108  DC  P P     1 
ATOM   7796 O  OP1   . DC  C 3 6   ? 22.121  8.268   34.477 1.00 91.73  ? 108  DC  P OP1   1 
ATOM   7797 O  OP2   . DC  C 3 6   ? 21.372  6.863   36.507 1.00 90.19  ? 108  DC  P OP2   1 
ATOM   7798 O  "O5'" . DC  C 3 6   ? 21.430  5.854   34.252 1.00 90.60  ? 108  DC  P "O5'" 1 
ATOM   7799 C  "C5'" . DC  C 3 6   ? 21.545  5.933   32.832 1.00 88.32  ? 108  DC  P "C5'" 1 
ATOM   7800 C  "C4'" . DC  C 3 6   ? 21.340  4.562   32.213 1.00 84.54  ? 108  DC  P "C4'" 1 
ATOM   7801 O  "O4'" . DC  C 3 6   ? 22.191  3.578   32.854 1.00 79.57  ? 108  DC  P "O4'" 1 
ATOM   7802 C  "C3'" . DC  C 3 6   ? 19.948  3.974   32.384 1.00 83.14  ? 108  DC  P "C3'" 1 
ATOM   7803 O  "O3'" . DC  C 3 6   ? 19.057  4.537   31.424 1.00 87.17  ? 108  DC  P "O3'" 1 
ATOM   7804 C  "C2'" . DC  C 3 6   ? 20.217  2.496   32.113 1.00 79.11  ? 108  DC  P "C2'" 1 
ATOM   7805 C  "C1'" . DC  C 3 6   ? 21.682  2.306   32.501 1.00 74.46  ? 108  DC  P "C1'" 1 
ATOM   7806 N  N1    . DC  C 3 6   ? 21.873  1.305   33.606 1.00 66.26  ? 108  DC  P N1    1 
ATOM   7807 C  C2    . DC  C 3 6   ? 22.209  -0.018  33.268 1.00 61.89  ? 108  DC  P C2    1 
ATOM   7808 O  O2    . DC  C 3 6   ? 22.350  -0.330  32.085 1.00 61.06  ? 108  DC  P O2    1 
ATOM   7809 N  N3    . DC  C 3 6   ? 22.387  -0.935  34.248 1.00 58.51  ? 108  DC  P N3    1 
ATOM   7810 C  C4    . DC  C 3 6   ? 22.234  -0.573  35.518 1.00 56.32  ? 108  DC  P C4    1 
ATOM   7811 N  N4    . DC  C 3 6   ? 22.425  -1.521  36.429 1.00 54.30  ? 108  DC  P N4    1 
ATOM   7812 C  C5    . DC  C 3 6   ? 21.888  0.762   35.899 1.00 59.06  ? 108  DC  P C5    1 
ATOM   7813 C  C6    . DC  C 3 6   ? 21.713  1.661   34.919 1.00 61.78  ? 108  DC  P C6    1 
ATOM   7814 P  P     . DT  C 3 7   ? 17.499  4.139   31.352 1.00 91.37  ? 109  DT  P P     1 
ATOM   7815 O  OP1   . DT  C 3 7   ? 16.830  5.188   30.551 1.00 92.90  ? 109  DT  P OP1   1 
ATOM   7816 O  OP2   . DT  C 3 7   ? 17.008  3.819   32.715 1.00 89.49  ? 109  DT  P OP2   1 
ATOM   7817 O  "O5'" . DT  C 3 7   ? 17.465  2.772   30.513 1.00 89.70  ? 109  DT  P "O5'" 1 
ATOM   7818 C  "C5'" . DT  C 3 7   ? 18.132  2.624   29.247 1.00 86.95  ? 109  DT  P "C5'" 1 
ATOM   7819 C  "C4'" . DT  C 3 7   ? 18.027  1.189   28.741 1.00 82.23  ? 109  DT  P "C4'" 1 
ATOM   7820 O  "O4'" . DT  C 3 7   ? 18.743  0.274   29.616 1.00 78.87  ? 109  DT  P "O4'" 1 
ATOM   7821 C  "C3'" . DT  C 3 7   ? 16.606  0.646   28.637 1.00 80.34  ? 109  DT  P "C3'" 1 
ATOM   7822 O  "O3'" . DT  C 3 7   ? 16.469  -0.016  27.380 1.00 81.41  ? 109  DT  P "O3'" 1 
ATOM   7823 C  "C2'" . DT  C 3 7   ? 16.470  -0.290  29.844 1.00 75.98  ? 109  DT  P "C2'" 1 
ATOM   7824 C  "C1'" . DT  C 3 7   ? 17.904  -0.788  30.034 1.00 72.42  ? 109  DT  P "C1'" 1 
ATOM   7825 N  N1    . DT  C 3 7   ? 18.272  -1.225  31.453 1.00 67.07  ? 109  DT  P N1    1 
ATOM   7826 C  C2    . DT  C 3 7   ? 18.704  -2.526  31.685 1.00 62.99  ? 109  DT  P C2    1 
ATOM   7827 O  O2    . DT  C 3 7   ? 18.818  -3.370  30.808 1.00 58.78  ? 109  DT  P O2    1 
ATOM   7828 N  N3    . DT  C 3 7   ? 19.007  -2.809  33.003 1.00 58.31  ? 109  DT  P N3    1 
ATOM   7829 C  C4    . DT  C 3 7   ? 18.926  -1.955  34.091 1.00 55.44  ? 109  DT  P C4    1 
ATOM   7830 O  O4    . DT  C 3 7   ? 19.224  -2.311  35.229 1.00 52.59  ? 109  DT  P O4    1 
ATOM   7831 C  C5    . DT  C 3 7   ? 18.469  -0.620  33.786 1.00 55.99  ? 109  DT  P C5    1 
ATOM   7832 C  C7    . DT  C 3 7   ? 18.333  0.403   34.873 1.00 54.99  ? 109  DT  P C7    1 
ATOM   7833 C  C6    . DT  C 3 7   ? 18.172  -0.328  32.510 1.00 61.95  ? 109  DT  P C6    1 
ATOM   7834 P  P     . DG  C 3 8   ? 15.050  -0.585  26.899 1.00 83.50  ? 110  DG  P P     1 
ATOM   7835 O  OP1   . DG  C 3 8   ? 15.035  -0.616  25.416 1.00 82.70  ? 110  DG  P OP1   1 
ATOM   7836 O  OP2   . DG  C 3 8   ? 13.994  0.128   27.662 1.00 83.08  ? 110  DG  P OP2   1 
ATOM   7837 O  "O5'" . DG  C 3 8   ? 15.071  -2.091  27.431 1.00 80.77  ? 110  DG  P "O5'" 1 
ATOM   7838 C  "C5'" . DG  C 3 8   ? 16.063  -3.015  26.976 1.00 74.86  ? 110  DG  P "C5'" 1 
ATOM   7839 C  "C4'" . DG  C 3 8   ? 15.796  -4.383  27.572 1.00 67.69  ? 110  DG  P "C4'" 1 
ATOM   7840 O  "O4'" . DG  C 3 8   ? 16.240  -4.391  28.950 1.00 62.39  ? 110  DG  P "O4'" 1 
ATOM   7841 C  "C3'" . DG  C 3 8   ? 14.323  -4.787  27.560 1.00 64.27  ? 110  DG  P "C3'" 1 
ATOM   7842 O  "O3'" . DG  C 3 8   ? 14.225  -5.966  26.765 1.00 62.65  ? 110  DG  P "O3'" 1 
ATOM   7843 C  "C2'" . DG  C 3 8   ? 13.955  -4.974  29.037 1.00 62.17  ? 110  DG  P "C2'" 1 
ATOM   7844 C  "C1'" . DG  C 3 8   ? 15.313  -5.097  29.745 1.00 61.16  ? 110  DG  P "C1'" 1 
ATOM   7845 N  N9    . DG  C 3 8   ? 15.395  -4.563  31.115 1.00 56.73  ? 110  DG  P N9    1 
ATOM   7846 C  C8    . DG  C 3 8   ? 14.986  -3.325  31.562 1.00 56.89  ? 110  DG  P C8    1 
ATOM   7847 N  N7    . DG  C 3 8   ? 15.190  -3.124  32.839 1.00 55.73  ? 110  DG  P N7    1 
ATOM   7848 C  C5    . DG  C 3 8   ? 15.777  -4.306  33.274 1.00 53.11  ? 110  DG  P C5    1 
ATOM   7849 C  C6    . DG  C 3 8   ? 16.222  -4.680  34.569 1.00 51.30  ? 110  DG  P C6    1 
ATOM   7850 O  O6    . DG  C 3 8   ? 16.188  -4.005  35.612 1.00 48.23  ? 110  DG  P O6    1 
ATOM   7851 N  N1    . DG  C 3 8   ? 16.760  -5.971  34.584 1.00 47.61  ? 110  DG  P N1    1 
ATOM   7852 C  C2    . DG  C 3 8   ? 16.853  -6.788  33.480 1.00 47.78  ? 110  DG  P C2    1 
ATOM   7853 N  N2    . DG  C 3 8   ? 17.393  -7.997  33.671 1.00 44.42  ? 110  DG  P N2    1 
ATOM   7854 N  N3    . DG  C 3 8   ? 16.445  -6.450  32.264 1.00 50.57  ? 110  DG  P N3    1 
ATOM   7855 C  C4    . DG  C 3 8   ? 15.913  -5.200  32.228 1.00 54.04  ? 110  DG  P C4    1 
ATOM   7856 P  P     . DC  C 3 9   ? 12.833  -6.684  26.458 1.00 62.03  ? 111  DC  P P     1 
ATOM   7857 O  OP1   . DC  C 3 9   ? 13.000  -7.426  25.188 1.00 62.73  ? 111  DC  P OP1   1 
ATOM   7858 O  OP2   . DC  C 3 9   ? 11.756  -5.676  26.611 1.00 62.58  ? 111  DC  P OP2   1 
ATOM   7859 O  "O5'" . DC  C 3 9   ? 12.681  -7.733  27.661 1.00 58.42  ? 111  DC  P "O5'" 1 
ATOM   7860 C  "C5'" . DC  C 3 9   ? 13.774  -8.590  28.013 1.00 56.13  ? 111  DC  P "C5'" 1 
ATOM   7861 C  "C4'" . DC  C 3 9   ? 13.620  -9.248  29.378 1.00 49.65  ? 111  DC  P "C4'" 1 
ATOM   7862 O  "O4'" . DC  C 3 9   ? 13.884  -8.310  30.450 1.00 46.66  ? 111  DC  P "O4'" 1 
ATOM   7863 C  "C3'" . DC  C 3 9   ? 12.247  -9.838  29.678 1.00 47.24  ? 111  DC  P "C3'" 1 
ATOM   7864 O  "O3'" . DC  C 3 9   ? 12.400  -11.226 29.854 1.00 48.10  ? 111  DC  P "O3'" 1 
ATOM   7865 C  "C2'" . DC  C 3 9   ? 11.804  -9.173  30.975 1.00 44.94  ? 111  DC  P "C2'" 1 
ATOM   7866 C  "C1'" . DC  C 3 9   ? 13.149  -8.769  31.561 1.00 44.92  ? 111  DC  P "C1'" 1 
ATOM   7867 N  N1    . DC  C 3 9   ? 13.066  -7.696  32.583 1.00 42.54  ? 111  DC  P N1    1 
ATOM   7868 C  C2    . DC  C 3 9   ? 13.584  -7.913  33.874 1.00 42.49  ? 111  DC  P C2    1 
ATOM   7869 O  O2    . DC  C 3 9   ? 14.105  -8.997  34.159 1.00 41.08  ? 111  DC  P O2    1 
ATOM   7870 N  N3    . DC  C 3 9   ? 13.496  -6.911  34.789 1.00 43.28  ? 111  DC  P N3    1 
ATOM   7871 C  C4    . DC  C 3 9   ? 12.925  -5.741  34.455 1.00 43.22  ? 111  DC  P C4    1 
ATOM   7872 N  N4    . DC  C 3 9   ? 12.853  -4.780  35.381 1.00 40.96  ? 111  DC  P N4    1 
ATOM   7873 C  C5    . DC  C 3 9   ? 12.398  -5.502  33.146 1.00 42.51  ? 111  DC  P C5    1 
ATOM   7874 C  C6    . DC  C 3 9   ? 12.489  -6.499  32.254 1.00 42.66  ? 111  DC  P C6    1 
ATOM   7875 P  P     . DT  C 3 10  ? 11.111  -12.172 29.883 1.00 51.74  ? 112  DT  P P     1 
ATOM   7876 O  OP1   . DT  C 3 10  ? 11.510  -13.433 29.218 1.00 53.37  ? 112  DT  P OP1   1 
ATOM   7877 O  OP2   . DT  C 3 10  ? 9.895   -11.433 29.443 1.00 43.35  ? 112  DT  P OP2   1 
ATOM   7878 O  "O5'" . DT  C 3 10  ? 10.995  -12.434 31.455 1.00 49.03  ? 112  DT  P "O5'" 1 
ATOM   7879 C  "C5'" . DT  C 3 10  ? 12.097  -12.968 32.186 1.00 44.47  ? 112  DT  P "C5'" 1 
ATOM   7880 C  "C4'" . DT  C 3 10  ? 11.812  -12.788 33.660 1.00 42.27  ? 112  DT  P "C4'" 1 
ATOM   7881 O  "O4'" . DT  C 3 10  ? 11.900  -11.385 33.979 1.00 42.74  ? 112  DT  P "O4'" 1 
ATOM   7882 C  "C3'" . DT  C 3 10  ? 10.394  -13.151 34.088 1.00 40.81  ? 112  DT  P "C3'" 1 
ATOM   7883 O  "O3'" . DT  C 3 10  ? 10.363  -14.513 34.497 1.00 36.73  ? 112  DT  P "O3'" 1 
ATOM   7884 C  "C2'" . DT  C 3 10  ? 10.073  -12.177 35.227 1.00 39.07  ? 112  DT  P "C2'" 1 
ATOM   7885 C  "C1'" . DT  C 3 10  ? 11.241  -11.199 35.214 1.00 41.09  ? 112  DT  P "C1'" 1 
ATOM   7886 N  N1    . DT  C 3 10  ? 10.832  -9.762  35.372 1.00 40.29  ? 112  DT  P N1    1 
ATOM   7887 C  C2    . DT  C 3 10  ? 11.119  -9.093  36.552 1.00 38.16  ? 112  DT  P C2    1 
ATOM   7888 O  O2    . DT  C 3 10  ? 11.697  -9.610  37.491 1.00 36.16  ? 112  DT  P O2    1 
ATOM   7889 N  N3    . DT  C 3 10  ? 10.692  -7.781  36.583 1.00 36.16  ? 112  DT  P N3    1 
ATOM   7890 C  C4    . DT  C 3 10  ? 10.019  -7.092  35.580 1.00 34.03  ? 112  DT  P C4    1 
ATOM   7891 O  O4    . DT  C 3 10  ? 9.680   -5.917  35.697 1.00 29.90  ? 112  DT  P O4    1 
ATOM   7892 C  C5    . DT  C 3 10  ? 9.752   -7.853  34.377 1.00 35.90  ? 112  DT  P C5    1 
ATOM   7893 C  C7    . DT  C 3 10  ? 9.030   -7.236  33.212 1.00 34.47  ? 112  DT  P C7    1 
ATOM   7894 C  C6    . DT  C 3 10  ? 10.169  -9.128  34.332 1.00 38.16  ? 112  DT  P C6    1 
ATOM   7895 P  P     . DT  C 3 11  ? 9.064   -15.139 35.173 1.00 35.11  ? 113  DT  P P     1 
ATOM   7896 O  OP1   . DT  C 3 11  ? 9.215   -16.609 35.136 1.00 34.38  ? 113  DT  P OP1   1 
ATOM   7897 O  OP2   . DT  C 3 11  ? 7.846   -14.480 34.634 1.00 37.51  ? 113  DT  P OP2   1 
ATOM   7898 O  "O5'" . DT  C 3 11  ? 9.170   -14.669 36.683 1.00 36.93  ? 113  DT  P "O5'" 1 
ATOM   7899 C  "C5'" . DT  C 3 11  ? 10.046  -15.304 37.559 1.00 34.30  ? 113  DT  P "C5'" 1 
ATOM   7900 C  "C4'" . DT  C 3 11  ? 10.050  -14.542 38.862 1.00 34.72  ? 113  DT  P "C4'" 1 
ATOM   7901 O  "O4'" . DT  C 3 11  ? 10.057  -13.120 38.596 1.00 34.30  ? 113  DT  P "O4'" 1 
ATOM   7902 C  "C3'" . DT  C 3 11  ? 8.831   -14.817 39.730 1.00 32.58  ? 113  DT  P "C3'" 1 
ATOM   7903 O  "O3'" . DT  C 3 11  ? 9.251   -15.545 40.858 1.00 27.86  ? 113  DT  P "O3'" 1 
ATOM   7904 C  "C2'" . DT  C 3 11  ? 8.346   -13.433 40.132 1.00 36.07  ? 113  DT  P "C2'" 1 
ATOM   7905 C  "C1'" . DT  C 3 11  ? 9.467   -12.495 39.705 1.00 32.08  ? 113  DT  P "C1'" 1 
ATOM   7906 N  N1    . DT  C 3 11  ? 8.896   -11.210 39.254 1.00 33.03  ? 113  DT  P N1    1 
ATOM   7907 C  C2    . DT  C 3 11  ? 9.095   -10.090 40.024 1.00 30.30  ? 113  DT  P C2    1 
ATOM   7908 O  O2    . DT  C 3 11  ? 9.734   -10.091 41.060 1.00 34.90  ? 113  DT  P O2    1 
ATOM   7909 N  N3    . DT  C 3 11  ? 8.508   -8.961  39.518 1.00 29.72  ? 113  DT  P N3    1 
ATOM   7910 C  C4    . DT  C 3 11  ? 7.765   -8.845  38.349 1.00 29.61  ? 113  DT  P C4    1 
ATOM   7911 O  O4    . DT  C 3 11  ? 7.294   -7.771  37.989 1.00 30.77  ? 113  DT  P O4    1 
ATOM   7912 C  C5    . DT  C 3 11  ? 7.592   -10.060 37.589 1.00 28.65  ? 113  DT  P C5    1 
ATOM   7913 C  C7    . DT  C 3 11  ? 6.809   -10.075 36.302 1.00 25.76  ? 113  DT  P C7    1 
ATOM   7914 C  C6    . DT  C 3 11  ? 8.153   -11.173 38.081 1.00 29.91  ? 113  DT  P C6    1 
ATOM   7915 P  P     . DA  C 3 12  ? 8.243   -16.008 41.993 1.00 27.03  ? 114  DA  P P     1 
ATOM   7916 O  OP1   . DA  C 3 12  ? 8.904   -17.126 42.693 1.00 28.95  ? 114  DA  P OP1   1 
ATOM   7917 O  OP2   . DA  C 3 12  ? 6.872   -16.141 41.439 1.00 31.68  ? 114  DA  P OP2   1 
ATOM   7918 O  "O5'" . DA  C 3 12  ? 8.198   -14.731 42.948 1.00 28.85  ? 114  DA  P "O5'" 1 
ATOM   7919 C  "C5'" . DA  C 3 12  ? 9.305   -14.319 43.735 1.00 27.86  ? 114  DA  P "C5'" 1 
ATOM   7920 C  "C4'" . DA  C 3 12  ? 8.809   -13.480 44.908 1.00 28.97  ? 114  DA  P "C4'" 1 
ATOM   7921 O  "O4'" . DA  C 3 12  ? 8.530   -12.126 44.456 1.00 28.54  ? 114  DA  P "O4'" 1 
ATOM   7922 C  "C3'" . DA  C 3 12  ? 7.533   -13.956 45.616 1.00 21.78  ? 114  DA  P "C3'" 1 
ATOM   7923 O  "O3'" . DA  C 3 12  ? 7.619   -13.655 46.991 1.00 22.10  ? 114  DA  P "O3'" 1 
ATOM   7924 C  "C2'" . DA  C 3 12  ? 6.431   -13.127 44.971 1.00 20.37  ? 114  DA  P "C2'" 1 
ATOM   7925 C  "C1'" . DA  C 3 12  ? 7.158   -11.823 44.694 1.00 27.29  ? 114  DA  P "C1'" 1 
ATOM   7926 N  N9    . DA  C 3 12  ? 6.602   -11.133 43.536 1.00 28.59  ? 114  DA  P N9    1 
ATOM   7927 C  C8    . DA  C 3 12  ? 6.245   -11.704 42.344 1.00 28.43  ? 114  DA  P C8    1 
ATOM   7928 N  N7    . DA  C 3 12  ? 5.768   -10.840 41.481 1.00 31.50  ? 114  DA  P N7    1 
ATOM   7929 C  C5    . DA  C 3 12  ? 5.820   -9.630  42.161 1.00 27.36  ? 114  DA  P C5    1 
ATOM   7930 C  C6    . DA  C 3 12  ? 5.444   -8.330  41.794 1.00 26.25  ? 114  DA  P C6    1 
ATOM   7931 N  N6    . DA  C 3 12  ? 4.941   -8.070  40.590 1.00 25.92  ? 114  DA  P N6    1 
ATOM   7932 N  N1    . DA  C 3 12  ? 5.607   -7.332  42.697 1.00 24.38  ? 114  DA  P N1    1 
ATOM   7933 C  C2    . DA  C 3 12  ? 6.115   -7.634  43.899 1.00 24.73  ? 114  DA  P C2    1 
ATOM   7934 N  N3    . DA  C 3 12  ? 6.505   -8.824  44.359 1.00 23.90  ? 114  DA  P N3    1 
ATOM   7935 C  C4    . DA  C 3 12  ? 6.331   -9.786  43.432 1.00 25.66  ? 114  DA  P C4    1 
ATOM   7936 P  P     . DC  C 3 13  ? 6.672   -14.327 48.089 1.00 25.87  ? 115  DC  P P     1 
ATOM   7937 O  OP1   . DC  C 3 13  ? 7.409   -14.352 49.381 1.00 23.03  ? 115  DC  P OP1   1 
ATOM   7938 O  OP2   . DC  C 3 13  ? 6.126   -15.596 47.593 1.00 22.99  ? 115  DC  P OP2   1 
ATOM   7939 O  "O5'" . DC  C 3 13  ? 5.474   -13.269 48.141 1.00 26.18  ? 115  DC  P "O5'" 1 
ATOM   7940 C  "C5'" . DC  C 3 13  ? 5.722   -11.991 48.726 1.00 24.20  ? 115  DC  P "C5'" 1 
ATOM   7941 C  "C4'" . DC  C 3 13  ? 4.691   -10.950 48.333 1.00 22.18  ? 115  DC  P "C4'" 1 
ATOM   7942 O  "O4'" . DC  C 3 13  ? 4.731   -10.737 46.912 1.00 23.79  ? 115  DC  P "O4'" 1 
ATOM   7943 C  "C3'" . DC  C 3 13  ? 3.218   -11.269 48.554 1.00 23.41  ? 115  DC  P "C3'" 1 
ATOM   7944 O  "O3'" . DC  C 3 13  ? 2.854   -11.102 49.941 1.00 23.70  ? 115  DC  P "O3'" 1 
ATOM   7945 C  "C2'" . DC  C 3 13  ? 2.546   -10.227 47.653 1.00 23.71  ? 115  DC  P "C2'" 1 
ATOM   7946 C  "C1'" . DC  C 3 13  ? 3.640   -9.881  46.639 1.00 25.57  ? 115  DC  P "C1'" 1 
ATOM   7947 N  N1    . DC  C 3 13  ? 3.239   -9.951  45.187 1.00 21.17  ? 115  DC  P N1    1 
ATOM   7948 C  C2    . DC  C 3 13  ? 2.899   -8.760  44.531 1.00 23.44  ? 115  DC  P C2    1 
ATOM   7949 O  O2    . DC  C 3 13  ? 2.937   -7.702  45.158 1.00 25.30  ? 115  DC  P O2    1 
ATOM   7950 N  N3    . DC  C 3 13  ? 2.535   -8.791  43.222 1.00 26.09  ? 115  DC  P N3    1 
ATOM   7951 C  C4    . DC  C 3 13  ? 2.501   -9.953  42.559 1.00 25.03  ? 115  DC  P C4    1 
ATOM   7952 N  N4    . DC  C 3 13  ? 2.136   -9.919  41.270 1.00 20.45  ? 115  DC  P N4    1 
ATOM   7953 C  C5    . DC  C 3 13  ? 2.838   -11.187 43.206 1.00 22.81  ? 115  DC  P C5    1 
ATOM   7954 C  C6    . DC  C 3 13  ? 3.198   -11.139 44.504 1.00 23.93  ? 115  DC  P C6    1 
HETATM 7955 N  N1    . UPC D 4 .   ? -0.833  -8.389  45.560 1.00 24.61  ? 904  UPC A N1    1 
HETATM 7956 C  C2    . UPC D 4 .   ? -1.271  -7.724  44.387 1.00 24.20  ? 904  UPC A C2    1 
HETATM 7957 O  O2    . UPC D 4 .   ? -1.724  -6.440  44.445 1.00 23.33  ? 904  UPC A O2    1 
HETATM 7958 N  N3    . UPC D 4 .   ? -1.238  -8.355  43.188 1.00 27.64  ? 904  UPC A N3    1 
HETATM 7959 C  C4    . UPC D 4 .   ? -0.802  -9.629  43.082 1.00 30.86  ? 904  UPC A C4    1 
HETATM 7960 O  O4    . UPC D 4 .   ? -0.780  -10.235 41.861 1.00 30.49  ? 904  UPC A O4    1 
HETATM 7961 C  C5    . UPC D 4 .   ? -0.383  -10.308 44.230 1.00 30.67  ? 904  UPC A C5    1 
HETATM 7962 C  C6    . UPC D 4 .   ? -0.408  -9.663  45.470 1.00 25.83  ? 904  UPC A C6    1 
HETATM 7963 P  PA    . UPC D 4 .   ? -0.490  -12.733 48.734 1.00 24.49  ? 904  UPC A PA    1 
HETATM 7964 P  PB    . UPC D 4 .   ? -3.649  -12.461 49.401 1.00 27.28  ? 904  UPC A PB    1 
HETATM 7965 P  PG    . UPC D 4 .   ? -4.259  -14.949 50.602 1.00 24.54  ? 904  UPC A PG    1 
HETATM 7966 C  "C1'" . UPC D 4 .   ? -0.910  -7.698  46.858 1.00 23.32  ? 904  UPC A "C1'" 1 
HETATM 7967 O  O1A   . UPC D 4 .   ? 0.007   -13.551 47.574 1.00 30.68  ? 904  UPC A O1A   1 
HETATM 7968 O  O1B   . UPC D 4 .   ? -4.328  -11.607 48.357 1.00 25.22  ? 904  UPC A O1B   1 
HETATM 7969 O  O1G   . UPC D 4 .   ? -2.878  -14.790 51.193 1.00 29.99  ? 904  UPC A O1G   1 
HETATM 7970 C  "C2'" . UPC D 4 .   ? -2.366  -7.736  47.332 1.00 20.92  ? 904  UPC A "C2'" 1 
HETATM 7971 O  O2A   . UPC D 4 .   ? 0.007   -13.064 50.127 1.00 27.19  ? 904  UPC A O2A   1 
HETATM 7972 O  O2B   . UPC D 4 .   ? -3.438  -11.912 50.783 1.00 26.92  ? 904  UPC A O2B   1 
HETATM 7973 O  O2G   . UPC D 4 .   ? -5.471  -14.893 51.479 1.00 28.49  ? 904  UPC A O2G   1 
HETATM 7974 C  "C3'" . UPC D 4 .   ? -2.409  -8.983  48.187 1.00 20.86  ? 904  UPC A "C3'" 1 
HETATM 7975 O  "O3'" . UPC D 4 .   ? -3.526  -8.980  49.088 1.00 21.25  ? 904  UPC A "O3'" 1 
HETATM 7976 C  C3A   . UPC D 4 .   ? -2.093  -12.619 48.960 1.00 26.82  ? 904  UPC A C3A   1 
HETATM 7977 O  O3B   . UPC D 4 .   ? -4.471  -13.840 49.476 1.00 28.20  ? 904  UPC A O3B   1 
HETATM 7978 O  O3G   . UPC D 4 .   ? -4.278  -16.403 49.236 1.00 21.35  ? 904  UPC A O3G   1 
HETATM 7979 C  "C4'" . UPC D 4 .   ? -1.060  -8.902  48.882 1.00 21.31  ? 904  UPC A "C4'" 1 
HETATM 7980 O  "O4'" . UPC D 4 .   ? -0.192  -8.406  47.863 1.00 25.88  ? 904  UPC A "O4'" 1 
HETATM 7981 C  "C5'" . UPC D 4 .   ? -0.540  -10.208 49.490 1.00 21.26  ? 904  UPC A "C5'" 1 
HETATM 7982 O  "O5'" . UPC D 4 .   ? -0.204  -11.166 48.472 1.00 25.84  ? 904  UPC A "O5'" 1 
HETATM 7983 CA CA    . CA  E 5 .   ? -1.736  -13.123 52.034 1.00 22.24  ? 905  CA  A CA    1 
HETATM 7984 CA CA    . CA  F 5 .   ? 2.532   -13.772 51.183 1.00 70.84  ? 906  CA  A CA    1 
HETATM 7985 CA CA    . CA  G 5 .   ? -3.823  -50.567 51.542 1.00 56.33  ? 907  CA  A CA    1 
HETATM 7986 CA CA    . CA  H 5 .   ? -2.320  -26.139 12.774 1.00 69.49  ? 908  CA  A CA    1 
HETATM 7987 O  O     . HOH I 6 .   ? 14.869  -3.998  56.221 1.00 14.46  ? 909  HOH A O     1 
HETATM 7988 O  O     . HOH I 6 .   ? 21.618  -16.435 70.746 1.00 14.19  ? 910  HOH A O     1 
HETATM 7989 O  O     . HOH I 6 .   ? -3.361  -18.294 54.556 1.00 2.00   ? 911  HOH A O     1 
HETATM 7990 O  O     . HOH I 6 .   ? 25.585  -34.220 52.626 1.00 17.37  ? 912  HOH A O     1 
HETATM 7991 O  O     . HOH I 6 .   ? -38.420 -18.083 19.740 1.00 8.85   ? 913  HOH A O     1 
HETATM 7992 O  O     . HOH I 6 .   ? -0.197  -7.361  71.635 1.00 17.83  ? 914  HOH A O     1 
HETATM 7993 O  O     . HOH I 6 .   ? 11.411  -7.956  70.826 1.00 18.68  ? 915  HOH A O     1 
HETATM 7994 O  O     . HOH I 6 .   ? 30.319  -17.135 46.347 1.00 36.36  ? 916  HOH A O     1 
HETATM 7995 O  O     . HOH I 6 .   ? -19.412 -7.693  44.134 1.00 16.72  ? 917  HOH A O     1 
HETATM 7996 O  O     . HOH I 6 .   ? -14.842 -24.106 31.392 1.00 10.40  ? 918  HOH A O     1 
HETATM 7997 O  O     . HOH I 6 .   ? -21.353 9.931   42.250 1.00 18.40  ? 919  HOH A O     1 
HETATM 7998 O  O     . HOH I 6 .   ? -5.027  -49.640 49.808 1.00 22.81  ? 920  HOH A O     1 
HETATM 7999 O  O     . HOH I 6 .   ? 1.140   -44.891 21.418 1.00 25.37  ? 921  HOH A O     1 
HETATM 8000 O  O     . HOH I 6 .   ? -2.630  -51.306 52.973 1.00 23.92  ? 922  HOH A O     1 
HETATM 8001 O  O     . HOH I 6 .   ? -11.043 -9.893  52.681 1.00 13.83  ? 923  HOH A O     1 
HETATM 8002 O  O     . HOH I 6 .   ? -14.879 -24.714 22.746 1.00 25.55  ? 924  HOH A O     1 
HETATM 8003 O  O     . HOH I 6 .   ? -26.488 18.505  43.253 1.00 18.51  ? 925  HOH A O     1 
HETATM 8004 O  O     . HOH I 6 .   ? -20.451 -18.631 40.878 1.00 24.67  ? 926  HOH A O     1 
HETATM 8005 O  O     . HOH I 6 .   ? -6.674  -5.347  63.204 1.00 17.72  ? 927  HOH A O     1 
HETATM 8006 O  O     . HOH I 6 .   ? -20.751 -23.182 16.392 1.00 13.33  ? 928  HOH A O     1 
HETATM 8007 O  O     . HOH I 6 .   ? 5.665   -35.684 27.573 1.00 40.68  ? 929  HOH A O     1 
HETATM 8008 O  O     . HOH I 6 .   ? -6.136  -6.989  9.255  1.00 23.97  ? 930  HOH A O     1 
HETATM 8009 O  O     . HOH I 6 .   ? -7.251  6.435   65.323 1.00 16.01  ? 931  HOH A O     1 
HETATM 8010 O  O     . HOH I 6 .   ? -26.436 -19.681 22.420 1.00 12.73  ? 932  HOH A O     1 
HETATM 8011 O  O     . HOH I 6 .   ? 2.370   6.451   52.170 1.00 24.50  ? 933  HOH A O     1 
HETATM 8012 O  O     . HOH I 6 .   ? -4.672  -35.365 22.422 1.00 26.40  ? 934  HOH A O     1 
HETATM 8013 O  O     . HOH I 6 .   ? 0.873   -17.485 75.312 1.00 13.93  ? 935  HOH A O     1 
HETATM 8014 O  O     . HOH I 6 .   ? -9.469  -13.088 23.449 1.00 42.02  ? 936  HOH A O     1 
HETATM 8015 O  O     . HOH I 6 .   ? -14.304 10.348  46.764 1.00 10.39  ? 937  HOH A O     1 
HETATM 8016 O  O     . HOH I 6 .   ? 1.438   -2.943  46.974 1.00 14.35  ? 938  HOH A O     1 
HETATM 8017 O  O     . HOH I 6 .   ? -9.924  -17.309 51.861 1.00 6.30   ? 939  HOH A O     1 
HETATM 8018 O  O     . HOH I 6 .   ? -12.147 -0.390  66.600 1.00 24.65  ? 940  HOH A O     1 
HETATM 8019 O  O     . HOH I 6 .   ? 19.706  -9.632  10.823 1.00 22.40  ? 941  HOH A O     1 
HETATM 8020 O  O     . HOH I 6 .   ? -2.011  -15.727 34.845 1.00 21.13  ? 942  HOH A O     1 
HETATM 8021 O  O     . HOH I 6 .   ? -34.777 13.875  38.101 1.00 14.42  ? 943  HOH A O     1 
HETATM 8022 O  O     . HOH I 6 .   ? -18.984 -15.465 40.654 1.00 31.21  ? 944  HOH A O     1 
HETATM 8023 O  O     . HOH I 6 .   ? -13.505 -41.102 7.019  1.00 22.27  ? 945  HOH A O     1 
HETATM 8024 O  O     . HOH I 6 .   ? 15.436  -24.685 27.785 1.00 7.44   ? 946  HOH A O     1 
HETATM 8025 O  O     . HOH I 6 .   ? 27.815  -14.437 48.218 1.00 33.94  ? 947  HOH A O     1 
HETATM 8026 O  O     . HOH I 6 .   ? -1.640  -14.592 3.347  1.00 12.38  ? 948  HOH A O     1 
HETATM 8027 O  O     . HOH I 6 .   ? 1.408   -38.505 31.559 1.00 37.26  ? 949  HOH A O     1 
HETATM 8028 O  O     . HOH I 6 .   ? 25.937  -16.062 54.170 1.00 27.45  ? 950  HOH A O     1 
HETATM 8029 O  O     . HOH I 6 .   ? -21.287 -7.008  51.087 1.00 26.01  ? 951  HOH A O     1 
HETATM 8030 O  O     . HOH I 6 .   ? 18.143  -32.331 73.042 1.00 34.41  ? 952  HOH A O     1 
HETATM 8031 O  O     . HOH I 6 .   ? 1.185   -19.043 20.415 1.00 20.37  ? 953  HOH A O     1 
HETATM 8032 O  O     . HOH I 6 .   ? 31.483  -14.051 17.267 1.00 26.70  ? 954  HOH A O     1 
HETATM 8033 O  O     . HOH I 6 .   ? -23.310 -6.510  38.424 1.00 19.05  ? 955  HOH A O     1 
HETATM 8034 O  O     . HOH I 6 .   ? 2.043   -1.761  70.954 1.00 16.84  ? 956  HOH A O     1 
HETATM 8035 O  O     . HOH I 6 .   ? 31.330  -32.651 52.825 1.00 37.11  ? 957  HOH A O     1 
HETATM 8036 O  O     . HOH I 6 .   ? -6.853  -10.999 48.086 1.00 11.13  ? 958  HOH A O     1 
HETATM 8037 O  O     . HOH I 6 .   ? 4.009   -3.521  46.514 1.00 13.05  ? 959  HOH A O     1 
HETATM 8038 O  O     . HOH I 6 .   ? -19.074 2.294   38.318 1.00 19.91  ? 960  HOH A O     1 
HETATM 8039 O  O     . HOH I 6 .   ? 5.384   -16.033 23.099 1.00 26.11  ? 961  HOH A O     1 
HETATM 8040 O  O     . HOH I 6 .   ? 1.976   11.845  66.878 1.00 21.37  ? 962  HOH A O     1 
HETATM 8041 O  O     . HOH I 6 .   ? -16.327 -41.425 19.993 1.00 34.42  ? 963  HOH A O     1 
HETATM 8042 O  O     . HOH I 6 .   ? -4.006  -33.411 34.376 1.00 25.37  ? 964  HOH A O     1 
HETATM 8043 O  O     . HOH I 6 .   ? 31.366  -30.939 43.628 1.00 26.13  ? 965  HOH A O     1 
HETATM 8044 O  O     . HOH I 6 .   ? 29.641  -7.359  22.956 1.00 23.83  ? 966  HOH A O     1 
HETATM 8045 O  O     . HOH I 6 .   ? -9.525  9.807   31.821 1.00 34.37  ? 967  HOH A O     1 
HETATM 8046 O  O     . HOH I 6 .   ? -4.823  -32.909 37.406 1.00 29.15  ? 968  HOH A O     1 
HETATM 8047 O  O     . HOH I 6 .   ? 3.532   -4.035  53.233 1.00 16.92  ? 969  HOH A O     1 
HETATM 8048 O  O     . HOH I 6 .   ? -15.766 11.464  41.727 1.00 21.26  ? 970  HOH A O     1 
HETATM 8049 O  O     . HOH I 6 .   ? -15.038 -48.003 56.272 1.00 38.91  ? 971  HOH A O     1 
HETATM 8050 O  O     . HOH I 6 .   ? -23.081 -17.041 8.420  1.00 40.12  ? 972  HOH A O     1 
HETATM 8051 O  O     . HOH I 6 .   ? -23.033 -14.574 12.072 1.00 31.58  ? 973  HOH A O     1 
HETATM 8052 O  O     . HOH I 6 .   ? -11.352 -9.812  67.852 1.00 26.23  ? 974  HOH A O     1 
HETATM 8053 O  O     . HOH I 6 .   ? -10.124 -49.252 39.938 1.00 37.44  ? 975  HOH A O     1 
HETATM 8054 O  O     . HOH I 6 .   ? -23.535 -6.218  42.257 1.00 23.43  ? 976  HOH A O     1 
HETATM 8055 O  O     . HOH I 6 .   ? -23.345 -8.818  42.193 1.00 19.03  ? 977  HOH A O     1 
HETATM 8056 O  O     . HOH I 6 .   ? -23.964 -0.811  54.860 1.00 31.83  ? 978  HOH A O     1 
HETATM 8057 O  O     . HOH I 6 .   ? 0.857   -28.767 3.942  1.00 26.35  ? 979  HOH A O     1 
HETATM 8058 O  O     . HOH I 6 .   ? 35.133  -23.896 46.689 1.00 34.39  ? 980  HOH A O     1 
HETATM 8059 O  O     . HOH I 6 .   ? -1.966  -13.972 44.670 1.00 22.76  ? 981  HOH A O     1 
HETATM 8060 O  O     . HOH I 6 .   ? 11.928  -39.121 60.654 1.00 15.18  ? 982  HOH A O     1 
HETATM 8061 O  O     . HOH I 6 .   ? 13.873  -2.808  53.352 1.00 18.22  ? 983  HOH A O     1 
HETATM 8062 O  O     . HOH I 6 .   ? 15.288  -31.822 61.544 1.00 20.64  ? 984  HOH A O     1 
HETATM 8063 O  O     . HOH I 6 .   ? -26.914 5.782   30.497 1.00 18.56  ? 985  HOH A O     1 
HETATM 8064 O  O     . HOH I 6 .   ? 24.938  -4.767  22.127 1.00 20.37  ? 986  HOH A O     1 
HETATM 8065 O  O     . HOH I 6 .   ? -5.401  -0.916  72.685 1.00 30.29  ? 987  HOH A O     1 
HETATM 8066 O  O     . HOH I 6 .   ? -22.034 19.989  38.665 1.00 14.80  ? 988  HOH A O     1 
HETATM 8067 O  O     . HOH I 6 .   ? 15.111  -31.457 40.062 1.00 13.66  ? 989  HOH A O     1 
HETATM 8068 O  O     . HOH I 6 .   ? -30.476 8.237   45.693 1.00 26.77  ? 990  HOH A O     1 
HETATM 8069 O  O     . HOH I 6 .   ? 0.783   -18.371 31.064 1.00 21.23  ? 991  HOH A O     1 
HETATM 8070 O  O     . HOH I 6 .   ? -2.055  -6.519  11.125 1.00 27.51  ? 992  HOH A O     1 
HETATM 8071 O  O     . HOH I 6 .   ? 1.642   -2.892  51.950 1.00 9.72   ? 993  HOH A O     1 
HETATM 8072 O  O     . HOH I 6 .   ? 19.924  -9.067  52.090 1.00 18.04  ? 994  HOH A O     1 
HETATM 8073 O  O     . HOH I 6 .   ? -18.822 -5.016  28.742 1.00 21.03  ? 995  HOH A O     1 
HETATM 8074 O  O     . HOH I 6 .   ? 15.861  -20.576 61.501 1.00 10.75  ? 996  HOH A O     1 
HETATM 8075 O  O     . HOH I 6 .   ? -1.437  7.313   38.950 1.00 7.41   ? 997  HOH A O     1 
HETATM 8076 O  O     . HOH I 6 .   ? 9.456   -30.174 45.937 1.00 6.11   ? 998  HOH A O     1 
HETATM 8077 O  O     . HOH I 6 .   ? 0.627   -23.563 18.502 1.00 12.60  ? 999  HOH A O     1 
HETATM 8078 O  O     . HOH I 6 .   ? 14.078  -23.861 56.973 1.00 28.65  ? 1000 HOH A O     1 
HETATM 8079 O  O     . HOH I 6 .   ? -35.120 -13.714 17.566 1.00 15.85  ? 1001 HOH A O     1 
HETATM 8080 O  O     . HOH I 6 .   ? -13.364 -5.187  6.422  1.00 32.27  ? 1002 HOH A O     1 
HETATM 8081 O  O     . HOH I 6 .   ? -11.293 -26.588 53.462 1.00 19.50  ? 1003 HOH A O     1 
HETATM 8082 O  O     . HOH I 6 .   ? 14.129  -5.742  12.410 1.00 24.02  ? 1004 HOH A O     1 
HETATM 8083 O  O     . HOH I 6 .   ? -5.472  -6.879  71.990 1.00 19.87  ? 1005 HOH A O     1 
HETATM 8084 O  O     . HOH I 6 .   ? -18.188 -37.570 49.787 1.00 23.33  ? 1006 HOH A O     1 
HETATM 8085 O  O     . HOH I 6 .   ? -6.107  -13.654 71.131 1.00 26.63  ? 1007 HOH A O     1 
HETATM 8086 O  O     . HOH I 6 .   ? 24.023  -10.365 15.544 1.00 21.34  ? 1008 HOH A O     1 
HETATM 8087 O  O     . HOH I 6 .   ? 31.700  -24.246 46.280 1.00 31.81  ? 1009 HOH A O     1 
HETATM 8088 O  O     . HOH I 6 .   ? -6.740  -13.212 36.816 1.00 28.01  ? 1010 HOH A O     1 
HETATM 8089 O  O     . HOH I 6 .   ? -13.016 8.949   42.451 1.00 19.35  ? 1011 HOH A O     1 
HETATM 8090 O  O     . HOH I 6 .   ? 9.027   6.338   59.283 1.00 14.81  ? 1012 HOH A O     1 
HETATM 8091 O  O     . HOH I 6 .   ? -5.821  -17.927 62.993 1.00 31.77  ? 1013 HOH A O     1 
HETATM 8092 O  O     . HOH I 6 .   ? -0.499  -9.751  74.059 1.00 27.56  ? 1014 HOH A O     1 
HETATM 8093 O  O     . HOH I 6 .   ? 2.842   2.043   51.307 1.00 24.47  ? 1015 HOH A O     1 
HETATM 8094 O  O     . HOH I 6 .   ? -7.771  -18.180 53.026 1.00 20.73  ? 1016 HOH A O     1 
HETATM 8095 O  O     . HOH I 6 .   ? -6.088  -21.856 13.654 1.00 32.34  ? 1017 HOH A O     1 
HETATM 8096 O  O     . HOH I 6 .   ? -8.698  -9.121  2.354  1.00 41.29  ? 1018 HOH A O     1 
HETATM 8097 O  O     . HOH I 6 .   ? 13.631  -27.812 9.598  1.00 22.65  ? 1019 HOH A O     1 
HETATM 8098 O  O     . HOH I 6 .   ? 4.824   -38.655 64.119 1.00 25.11  ? 1020 HOH A O     1 
HETATM 8099 O  O     . HOH I 6 .   ? 33.341  -17.621 42.357 1.00 28.23  ? 1021 HOH A O     1 
HETATM 8100 O  O     . HOH I 6 .   ? -16.344 -31.667 -7.133 1.00 28.17  ? 1022 HOH A O     1 
HETATM 8101 O  O     . HOH I 6 .   ? -2.959  -52.744 43.265 1.00 32.57  ? 1023 HOH A O     1 
HETATM 8102 O  O     . HOH I 6 .   ? 19.795  -19.474 35.049 1.00 12.81  ? 1024 HOH A O     1 
HETATM 8103 O  O     . HOH I 6 .   ? 15.010  -32.107 42.622 1.00 14.89  ? 1025 HOH A O     1 
HETATM 8104 O  O     . HOH I 6 .   ? -11.257 -51.355 38.422 1.00 41.31  ? 1026 HOH A O     1 
HETATM 8105 O  O     . HOH I 6 .   ? 31.161  -24.925 54.303 1.00 30.02  ? 1027 HOH A O     1 
HETATM 8106 O  O     . HOH I 6 .   ? 25.135  -19.629 59.369 1.00 24.96  ? 1028 HOH A O     1 
HETATM 8107 O  O     . HOH I 6 .   ? 5.815   -14.304 51.673 1.00 17.87  ? 1029 HOH A O     1 
HETATM 8108 O  O     . HOH I 6 .   ? -11.677 -37.724 59.019 1.00 18.95  ? 1030 HOH A O     1 
HETATM 8109 O  O     . HOH I 6 .   ? 21.044  -15.018 59.990 1.00 26.71  ? 1031 HOH A O     1 
HETATM 8110 O  O     . HOH I 6 .   ? -15.503 -24.248 51.319 1.00 20.90  ? 1032 HOH A O     1 
HETATM 8111 O  O     . HOH I 6 .   ? -9.613  12.242  67.799 1.00 16.56  ? 1033 HOH A O     1 
HETATM 8112 O  O     . HOH I 6 .   ? -21.547 -8.914  24.114 1.00 15.32  ? 1034 HOH A O     1 
HETATM 8113 O  O     . HOH I 6 .   ? -11.626 5.990   45.342 1.00 16.58  ? 1035 HOH A O     1 
HETATM 8114 O  O     . HOH I 6 .   ? 17.261  -11.733 58.435 1.00 18.24  ? 1036 HOH A O     1 
HETATM 8115 O  O     . HOH I 6 .   ? -13.455 -1.751  9.670  1.00 24.16  ? 1037 HOH A O     1 
HETATM 8116 O  O     . HOH I 6 .   ? -6.417  -10.229 57.019 1.00 17.01  ? 1038 HOH A O     1 
HETATM 8117 O  O     . HOH I 6 .   ? 22.479  -31.526 11.527 1.00 21.50  ? 1039 HOH A O     1 
HETATM 8118 O  O     . HOH I 6 .   ? -9.257  -52.712 41.239 1.00 31.05  ? 1040 HOH A O     1 
HETATM 8119 O  O     . HOH I 6 .   ? -0.438  15.168  57.548 1.00 14.63  ? 1041 HOH A O     1 
HETATM 8120 O  O     . HOH I 6 .   ? -15.637 8.698   70.050 1.00 15.92  ? 1042 HOH A O     1 
HETATM 8121 O  O     . HOH I 6 .   ? -19.101 20.014  37.543 1.00 30.50  ? 1043 HOH A O     1 
HETATM 8122 O  O     . HOH I 6 .   ? -20.677 -22.046 33.522 1.00 24.71  ? 1044 HOH A O     1 
HETATM 8123 O  O     . HOH I 6 .   ? -9.065  1.734   71.713 1.00 44.72  ? 1045 HOH A O     1 
HETATM 8124 O  O     . HOH I 6 .   ? 19.518  -24.524 65.102 1.00 27.07  ? 1046 HOH A O     1 
HETATM 8125 O  O     . HOH I 6 .   ? -14.064 2.844   35.509 1.00 25.80  ? 1047 HOH A O     1 
HETATM 8126 O  O     . HOH I 6 .   ? -3.492  -11.230 43.016 1.00 15.00  ? 1048 HOH A O     1 
HETATM 8127 O  O     . HOH I 6 .   ? -19.840 -3.079  8.955  1.00 31.73  ? 1049 HOH A O     1 
HETATM 8128 O  O     . HOH I 6 .   ? -5.142  13.748  39.276 1.00 22.83  ? 1050 HOH A O     1 
HETATM 8129 O  O     . HOH I 6 .   ? 22.053  -35.763 55.535 1.00 23.78  ? 1051 HOH A O     1 
HETATM 8130 O  O     . HOH I 6 .   ? -15.368 19.962  31.125 1.00 22.28  ? 1052 HOH A O     1 
HETATM 8131 O  O     . HOH I 6 .   ? 43.673  -36.238 49.963 1.00 18.03  ? 1053 HOH A O     1 
HETATM 8132 O  O     . HOH I 6 .   ? -35.270 2.139   26.437 1.00 11.62  ? 1054 HOH A O     1 
HETATM 8133 O  O     . HOH I 6 .   ? -3.072  -1.647  12.451 1.00 18.33  ? 1055 HOH A O     1 
HETATM 8134 O  O     . HOH I 6 .   ? -8.890  -34.776 54.111 1.00 22.95  ? 1056 HOH A O     1 
HETATM 8135 O  O     . HOH I 6 .   ? -4.016  -38.095 -0.338 1.00 8.25   ? 1057 HOH A O     1 
HETATM 8136 O  O     . HOH I 6 .   ? -14.117 -21.911 36.644 1.00 16.16  ? 1058 HOH A O     1 
HETATM 8137 O  O     . HOH I 6 .   ? 12.549  -28.170 37.337 1.00 21.30  ? 1059 HOH A O     1 
HETATM 8138 O  O     . HOH I 6 .   ? 0.795   -32.671 32.846 1.00 38.45  ? 1060 HOH A O     1 
HETATM 8139 O  O     . HOH I 6 .   ? 24.155  -15.546 34.753 1.00 19.42  ? 1061 HOH A O     1 
HETATM 8140 O  O     . HOH I 6 .   ? -40.048 -15.257 16.666 1.00 25.67  ? 1062 HOH A O     1 
HETATM 8141 O  O     . HOH I 6 .   ? 5.216   -19.034 22.190 1.00 21.27  ? 1063 HOH A O     1 
HETATM 8142 O  O     . HOH I 6 .   ? -0.914  4.622   37.988 1.00 12.00  ? 1064 HOH A O     1 
HETATM 8143 O  O     . HOH I 6 .   ? -11.475 5.907   72.764 1.00 9.49   ? 1065 HOH A O     1 
HETATM 8144 O  O     . HOH I 6 .   ? 4.939   -33.756 55.826 1.00 10.97  ? 1066 HOH A O     1 
HETATM 8145 O  O     . HOH I 6 .   ? -1.534  -25.704 51.005 1.00 25.22  ? 1067 HOH A O     1 
HETATM 8146 O  O     . HOH I 6 .   ? -19.772 -10.064 -0.978 1.00 17.01  ? 1068 HOH A O     1 
HETATM 8147 O  O     . HOH I 6 .   ? -9.976  -6.684  6.503  1.00 20.32  ? 1069 HOH A O     1 
HETATM 8148 O  O     . HOH I 6 .   ? 24.161  -7.994  22.860 1.00 23.37  ? 1070 HOH A O     1 
HETATM 8149 O  O     . HOH I 6 .   ? -0.242  -23.837 62.516 1.00 16.69  ? 1071 HOH A O     1 
HETATM 8150 O  O     . HOH I 6 .   ? -9.908  -11.064 15.281 1.00 15.79  ? 1072 HOH A O     1 
HETATM 8151 O  O     . HOH I 6 .   ? 20.444  -38.829 47.384 1.00 23.21  ? 1073 HOH A O     1 
HETATM 8152 O  O     . HOH I 6 .   ? -29.462 4.587   30.613 1.00 16.03  ? 1074 HOH A O     1 
HETATM 8153 O  O     . HOH I 6 .   ? -4.655  0.384   70.584 1.00 27.99  ? 1075 HOH A O     1 
HETATM 8154 O  O     . HOH I 6 .   ? 18.030  -36.727 54.504 1.00 18.21  ? 1076 HOH A O     1 
HETATM 8155 O  O     . HOH I 6 .   ? -6.817  -30.766 2.959  1.00 19.64  ? 1077 HOH A O     1 
HETATM 8156 O  O     . HOH I 6 .   ? 3.621   -4.073  72.197 1.00 15.30  ? 1078 HOH A O     1 
HETATM 8157 O  O     . HOH I 6 .   ? -8.099  -7.144  0.976  1.00 27.97  ? 1079 HOH A O     1 
HETATM 8158 O  O     . HOH I 6 .   ? 7.296   -25.008 5.906  1.00 30.41  ? 1080 HOH A O     1 
HETATM 8159 O  O     . HOH I 6 .   ? 30.889  -20.430 49.644 1.00 43.50  ? 1081 HOH A O     1 
HETATM 8160 O  O     . HOH I 6 .   ? 14.977  -16.893 72.731 1.00 25.93  ? 1082 HOH A O     1 
HETATM 8161 O  O     . HOH I 6 .   ? -5.695  11.020  43.674 1.00 22.41  ? 1083 HOH A O     1 
HETATM 8162 O  O     . HOH I 6 .   ? 29.624  -27.397 20.592 1.00 20.43  ? 1084 HOH A O     1 
HETATM 8163 O  O     . HOH I 6 .   ? -8.866  -25.209 55.210 1.00 21.67  ? 1085 HOH A O     1 
HETATM 8164 O  O     . HOH I 6 .   ? 15.594  -21.359 73.050 1.00 29.94  ? 1086 HOH A O     1 
HETATM 8165 O  O     . HOH I 6 .   ? -3.946  -13.106 76.788 1.00 27.61  ? 1087 HOH A O     1 
HETATM 8166 O  O     . HOH I 6 .   ? 12.885  -23.598 28.203 1.00 7.95   ? 1088 HOH A O     1 
HETATM 8167 O  O     . HOH I 6 .   ? 13.526  -8.509  69.481 1.00 17.56  ? 1089 HOH A O     1 
HETATM 8168 O  O     . HOH I 6 .   ? 34.023  -28.099 51.502 1.00 25.57  ? 1090 HOH A O     1 
HETATM 8169 O  O     . HOH I 6 .   ? 15.863  -36.537 43.063 1.00 27.50  ? 1091 HOH A O     1 
HETATM 8170 O  O     . HOH I 6 .   ? 42.140  -46.461 49.126 1.00 41.89  ? 1092 HOH A O     1 
HETATM 8171 O  O     . HOH I 6 .   ? 39.655  -47.800 48.940 1.00 36.47  ? 1093 HOH A O     1 
HETATM 8172 O  O     . HOH I 6 .   ? 43.329  -26.319 55.141 1.00 35.41  ? 1094 HOH A O     1 
HETATM 8173 O  O     . HOH I 6 .   ? -12.786 13.156  43.800 1.00 29.16  ? 1095 HOH A O     1 
HETATM 8174 O  O     . HOH I 6 .   ? -8.224  13.976  41.620 1.00 26.15  ? 1096 HOH A O     1 
HETATM 8175 O  O     . HOH I 6 .   ? -9.551  15.330  39.545 1.00 20.26  ? 1097 HOH A O     1 
HETATM 8176 O  O     . HOH I 6 .   ? -11.092 15.637  31.960 1.00 29.18  ? 1098 HOH A O     1 
HETATM 8177 O  O     . HOH I 6 .   ? -12.909 7.071   33.500 1.00 24.20  ? 1099 HOH A O     1 
HETATM 8178 O  O     . HOH I 6 .   ? -14.313 2.715   27.741 1.00 33.13  ? 1100 HOH A O     1 
HETATM 8179 O  O     . HOH I 6 .   ? 0.364   6.198   72.163 1.00 20.27  ? 1101 HOH A O     1 
HETATM 8180 O  O     . HOH I 6 .   ? 6.719   6.422   45.239 1.00 11.26  ? 1102 HOH A O     1 
HETATM 8181 O  O     . HOH I 6 .   ? 30.294  -31.117 17.191 1.00 17.78  ? 1103 HOH A O     1 
HETATM 8182 O  O     . HOH I 6 .   ? 12.735  -22.492 30.619 1.00 12.82  ? 1104 HOH A O     1 
HETATM 8183 O  O     . HOH I 6 .   ? 4.275   -6.175  47.181 1.00 16.19  ? 1105 HOH A O     1 
HETATM 8184 O  O     . HOH I 6 .   ? 13.476  -4.149  62.733 1.00 17.17  ? 1106 HOH A O     1 
HETATM 8185 O  O     . HOH I 6 .   ? 10.731  -5.425  66.481 1.00 26.21  ? 1107 HOH A O     1 
HETATM 8186 O  O     . HOH I 6 .   ? 3.382   -9.480  71.467 1.00 7.95   ? 1108 HOH A O     1 
HETATM 8187 O  O     . HOH I 6 .   ? -33.449 2.164   11.571 1.00 31.14  ? 1109 HOH A O     1 
HETATM 8188 O  O     . HOH I 6 .   ? -15.606 -33.106 24.478 1.00 33.92  ? 1110 HOH A O     1 
HETATM 8189 O  O     . HOH I 6 .   ? -14.096 -28.774 27.298 1.00 17.45  ? 1111 HOH A O     1 
HETATM 8190 O  O     . HOH I 6 .   ? -35.091 -0.370  15.552 1.00 18.13  ? 1112 HOH A O     1 
HETATM 8191 O  O     . HOH I 6 .   ? -28.401 24.330  46.105 1.00 12.32  ? 1113 HOH A O     1 
HETATM 8192 O  O     . HOH I 6 .   ? -9.701  -10.808 56.488 1.00 11.44  ? 1114 HOH A O     1 
HETATM 8193 O  O     . HOH I 6 .   ? 21.715  -22.986 60.527 1.00 14.15  ? 1115 HOH A O     1 
HETATM 8194 O  O     . HOH I 6 .   ? 32.136  -25.672 24.429 1.00 13.24  ? 1116 HOH A O     1 
HETATM 8195 O  O     . HOH I 6 .   ? 35.777  -26.817 22.260 1.00 40.86  ? 1117 HOH A O     1 
HETATM 8196 O  O     . HOH I 6 .   ? 4.099   -30.164 34.077 1.00 25.52  ? 1118 HOH A O     1 
HETATM 8197 O  O     . HOH I 6 .   ? -0.842  3.665   71.359 1.00 27.55  ? 1119 HOH A O     1 
HETATM 8198 O  O     . HOH I 6 .   ? 47.278  -37.314 47.353 1.00 16.48  ? 1120 HOH A O     1 
HETATM 8199 O  O     . HOH I 6 .   ? 41.552  -34.544 50.455 1.00 14.47  ? 1121 HOH A O     1 
HETATM 8200 O  O     . HOH I 6 .   ? 35.676  -44.238 49.249 1.00 34.81  ? 1122 HOH A O     1 
HETATM 8201 O  O     . HOH J 6 .   ? 6.864   -5.688  46.861 1.00 9.21   ? 19   HOH T O     1 
HETATM 8202 O  O     . HOH J 6 .   ? 10.635  -2.183  51.316 1.00 10.56  ? 51   HOH T O     1 
HETATM 8203 O  O     . HOH J 6 .   ? 17.956  -8.143  48.477 1.00 17.78  ? 56   HOH T O     1 
HETATM 8204 O  O     . HOH J 6 .   ? 14.434  -12.216 42.386 1.00 26.05  ? 58   HOH T O     1 
HETATM 8205 O  O     . HOH J 6 .   ? 26.018  -7.309  36.046 1.00 17.50  ? 68   HOH T O     1 
HETATM 8206 O  O     . HOH J 6 .   ? 36.197  -2.181  28.625 1.00 8.55   ? 84   HOH T O     1 
HETATM 8207 O  O     . HOH J 6 .   ? 14.338  -2.699  40.455 1.00 20.47  ? 88   HOH T O     1 
HETATM 8208 O  O     . HOH J 6 .   ? -5.453  -6.181  34.078 1.00 22.12  ? 132  HOH T O     1 
HETATM 8209 O  O     . HOH J 6 .   ? 4.732   3.892   41.056 1.00 14.95  ? 133  HOH T O     1 
HETATM 8210 O  O     . HOH J 6 .   ? 0.295   2.236   35.956 1.00 2.00   ? 142  HOH T O     1 
HETATM 8211 O  O     . HOH J 6 .   ? 2.264   0.676   36.129 1.00 4.98   ? 193  HOH T O     1 
HETATM 8212 O  O     . HOH J 6 .   ? -8.723  1.511   25.148 1.00 23.05  ? 213  HOH T O     1 
HETATM 8213 O  O     . HOH J 6 .   ? 3.838   5.095   37.238 1.00 11.26  ? 216  HOH T O     1 
HETATM 8214 O  O     . HOH K 6 .   ? 9.230   -12.566 49.095 1.00 17.76  ? 16   HOH P O     1 
HETATM 8215 O  O     . HOH K 6 .   ? 7.924   -19.340 42.374 1.00 8.49   ? 195  HOH P O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.5784 0.8240 1.0577 -0.0213 0.0304  -0.0697 1   MET A N     
2    C CA    . MET A 1   ? 0.5738 0.8090 1.0141 -0.0189 0.0339  -0.0581 1   MET A CA    
3    C C     . MET A 1   ? 0.5432 0.7826 0.9698 -0.0150 0.0244  -0.0545 1   MET A C     
4    O O     . MET A 1   ? 0.5481 0.7981 0.9919 -0.0136 0.0134  -0.0604 1   MET A O     
5    C CB    . MET A 1   ? 0.5979 0.8308 1.0170 -0.0186 0.0274  -0.0558 1   MET A CB    
6    C CG    . MET A 1   ? 0.6725 0.9147 1.0843 -0.0162 0.0076  -0.0595 1   MET A CG    
7    S SD    . MET A 1   ? 0.7767 1.0147 1.1662 -0.0163 0.0021  -0.0579 1   MET A SD    
8    C CE    . MET A 1   ? 0.7791 1.0052 1.1361 -0.0144 0.0118  -0.0445 1   MET A CE    
9    N N     . LYS A 2   ? 0.5106 0.7412 0.9068 -0.0131 0.0284  -0.0450 2   LYS A N     
10   C CA    . LYS A 2   ? 0.4753 0.7087 0.8564 -0.0096 0.0202  -0.0412 2   LYS A CA    
11   C C     . LYS A 2   ? 0.4303 0.6692 0.7949 -0.0070 0.0036  -0.0412 2   LYS A C     
12   O O     . LYS A 2   ? 0.4280 0.6635 0.7785 -0.0075 0.0021  -0.0393 2   LYS A O     
13   C CB    . LYS A 2   ? 0.5051 0.7266 0.8613 -0.0089 0.0307  -0.0321 2   LYS A CB    
14   C CG    . LYS A 2   ? 0.5599 0.7772 0.9268 -0.0095 0.0424  -0.0319 2   LYS A CG    
15   C CD    . LYS A 2   ? 0.6359 0.8633 1.0131 -0.0071 0.0326  -0.0348 2   LYS A CD    
16   C CE    . LYS A 2   ? 0.6621 0.8865 1.0573 -0.0081 0.0450  -0.0362 2   LYS A CE    
17   N NZ    . LYS A 2   ? 0.6939 0.9049 1.0629 -0.0077 0.0557  -0.0286 2   LYS A NZ    
18   N N     . GLU A 3   ? 0.3788 0.6252 0.7454 -0.0040 -0.0080 -0.0431 3   GLU A N     
19   C CA    . GLU A 3   ? 0.3374 0.5869 0.6870 -0.0010 -0.0228 -0.0430 3   GLU A CA    
20   C C     . GLU A 3   ? 0.2953 0.5377 0.6136 0.0007  -0.0215 -0.0343 3   GLU A C     
21   O O     . GLU A 3   ? 0.3033 0.5411 0.6136 0.0009  -0.0135 -0.0290 3   GLU A O     
22   C CB    . GLU A 3   ? 0.3462 0.6035 0.7056 0.0024  -0.0348 -0.0468 3   GLU A CB    
23   C CG    . GLU A 3   ? 0.4159 0.6821 0.8067 0.0018  -0.0416 -0.0565 3   GLU A CG    
24   C CD    . GLU A 3   ? 0.4757 0.7489 0.8745 0.0062  -0.0543 -0.0591 3   GLU A CD    
25   O OE1   . GLU A 3   ? 0.5250 0.7985 0.9287 0.0074  -0.0489 -0.0560 3   GLU A OE1   
26   O OE2   . GLU A 3   ? 0.5588 0.8359 0.9575 0.0087  -0.0698 -0.0642 3   GLU A OE2   
27   N N     . PHE A 4   ? 0.2407 0.4819 0.5422 0.0019  -0.0293 -0.0335 4   PHE A N     
28   C CA    . PHE A 4   ? 0.2272 0.4631 0.5025 0.0038  -0.0296 -0.0264 4   PHE A CA    
29   C C     . PHE A 4   ? 0.2060 0.4426 0.4682 0.0065  -0.0414 -0.0278 4   PHE A C     
30   O O     . PHE A 4   ? 0.1942 0.4327 0.4621 0.0063  -0.0481 -0.0334 4   PHE A O     
31   C CB    . PHE A 4   ? 0.2329 0.4616 0.4978 0.0017  -0.0205 -0.0216 4   PHE A CB    
32   C CG    . PHE A 4   ? 0.2421 0.4701 0.5119 -0.0003 -0.0209 -0.0251 4   PHE A CG    
33   C CD1   . PHE A 4   ? 0.1893 0.4186 0.4801 -0.0032 -0.0153 -0.0299 4   PHE A CD1   
34   C CD2   . PHE A 4   ? 0.2119 0.4374 0.4667 0.0006  -0.0256 -0.0238 4   PHE A CD2   
35   C CE1   . PHE A 4   ? 0.1999 0.4282 0.4958 -0.0053 -0.0151 -0.0336 4   PHE A CE1   
36   C CE2   . PHE A 4   ? 0.2485 0.4724 0.5076 -0.0014 -0.0251 -0.0273 4   PHE A CE2   
37   C CZ    . PHE A 4   ? 0.2194 0.4450 0.4989 -0.0044 -0.0201 -0.0322 4   PHE A CZ    
38   N N     . TYR A 5   ? 0.2093 0.4430 0.4534 0.0091  -0.0433 -0.0228 5   TYR A N     
39   C CA    . TYR A 5   ? 0.2235 0.4549 0.4520 0.0119  -0.0520 -0.0231 5   TYR A CA    
40   C C     . TYR A 5   ? 0.2173 0.4431 0.4334 0.0106  -0.0504 -0.0219 5   TYR A C     
41   O O     . TYR A 5   ? 0.1993 0.4227 0.4145 0.0083  -0.0425 -0.0185 5   TYR A O     
42   C CB    . TYR A 5   ? 0.2311 0.4603 0.4457 0.0148  -0.0528 -0.0183 5   TYR A CB    
43   C CG    . TYR A 5   ? 0.2002 0.4251 0.4027 0.0136  -0.0451 -0.0120 5   TYR A CG    
44   C CD1   . TYR A 5   ? 0.1749 0.4001 0.3818 0.0121  -0.0377 -0.0091 5   TYR A CD1   
45   C CD2   . TYR A 5   ? 0.2114 0.4311 0.3980 0.0143  -0.0453 -0.0092 5   TYR A CD2   
46   C CE1   . TYR A 5   ? 0.1496 0.3705 0.3447 0.0114  -0.0327 -0.0040 5   TYR A CE1   
47   C CE2   . TYR A 5   ? 0.1567 0.3734 0.3351 0.0134  -0.0397 -0.0041 5   TYR A CE2   
48   C CZ    . TYR A 5   ? 0.1304 0.3480 0.3128 0.0121  -0.0344 -0.0017 5   TYR A CZ    
49   O OH    . TYR A 5   ? 0.1482 0.3625 0.3218 0.0116  -0.0307 0.0028  5   TYR A OH    
50   N N     . LEU A 6   ? 0.2092 0.4319 0.4153 0.0125  -0.0580 -0.0248 6   LEU A N     
51   C CA    . LEU A 6   ? 0.1957 0.4116 0.3882 0.0119  -0.0563 -0.0238 6   LEU A CA    
52   C C     . LEU A 6   ? 0.2049 0.4149 0.3782 0.0147  -0.0567 -0.0193 6   LEU A C     
53   O O     . LEU A 6   ? 0.1919 0.3988 0.3587 0.0139  -0.0503 -0.0147 6   LEU A O     
54   C CB    . LEU A 6   ? 0.1949 0.4088 0.3879 0.0116  -0.0629 -0.0307 6   LEU A CB    
55   C CG    . LEU A 6   ? 0.1809 0.4004 0.3954 0.0081  -0.0612 -0.0358 6   LEU A CG    
56   C CD1   . LEU A 6   ? 0.1244 0.3431 0.3412 0.0081  -0.0704 -0.0442 6   LEU A CD1   
57   C CD2   . LEU A 6   ? 0.1128 0.3301 0.3299 0.0048  -0.0503 -0.0323 6   LEU A CD2   
58   N N     . THR A 7   ? 0.2267 0.4347 0.3920 0.0183  -0.0641 -0.0208 7   THR A N     
59   C CA    . THR A 7   ? 0.2822 0.4833 0.4295 0.0213  -0.0636 -0.0167 7   THR A CA    
60   C C     . THR A 7   ? 0.3269 0.5299 0.4738 0.0249  -0.0691 -0.0163 7   THR A C     
61   O O     . THR A 7   ? 0.3595 0.5675 0.5172 0.0261  -0.0764 -0.0205 7   THR A O     
62   C CB    . THR A 7   ? 0.2837 0.4736 0.4122 0.0230  -0.0658 -0.0183 7   THR A CB    
63   O OG1   . THR A 7   ? 0.3133 0.5015 0.4387 0.0256  -0.0763 -0.0237 7   THR A OG1   
64   C CG2   . THR A 7   ? 0.2835 0.4703 0.4122 0.0196  -0.0599 -0.0189 7   THR A CG2   
65   N N     . VAL A 8   ? 0.3249 0.5236 0.4606 0.0269  -0.0658 -0.0117 8   VAL A N     
66   C CA    . VAL A 8   ? 0.3191 0.5171 0.4513 0.0310  -0.0703 -0.0107 8   VAL A CA    
67   C C     . VAL A 8   ? 0.3384 0.5249 0.4493 0.0341  -0.0682 -0.0074 8   VAL A C     
68   O O     . VAL A 8   ? 0.3123 0.4949 0.4173 0.0322  -0.0604 -0.0045 8   VAL A O     
69   C CB    . VAL A 8   ? 0.3233 0.5295 0.4697 0.0297  -0.0662 -0.0084 8   VAL A CB    
70   C CG1   . VAL A 8   ? 0.2655 0.4700 0.4067 0.0276  -0.0572 -0.0037 8   VAL A CG1   
71   C CG2   . VAL A 8   ? 0.2884 0.4955 0.4363 0.0340  -0.0718 -0.0085 8   VAL A CG2   
72   N N     . GLU A 9   ? 0.3460 0.5264 0.4461 0.0391  -0.0750 -0.0079 9   GLU A N     
73   C CA    . GLU A 9   ? 0.3440 0.5113 0.4229 0.0427  -0.0720 -0.0044 9   GLU A CA    
74   C C     . GLU A 9   ? 0.3789 0.5448 0.4552 0.0478  -0.0766 -0.0027 9   GLU A C     
75   O O     . GLU A 9   ? 0.3983 0.5708 0.4851 0.0499  -0.0857 -0.0053 9   GLU A O     
76   C CB    . GLU A 9   ? 0.3661 0.5197 0.4244 0.0449  -0.0750 -0.0066 9   GLU A CB    
77   C CG    . GLU A 9   ? 0.3384 0.4912 0.3977 0.0404  -0.0701 -0.0086 9   GLU A CG    
78   C CD    . GLU A 9   ? 0.3464 0.4966 0.4051 0.0375  -0.0577 -0.0047 9   GLU A CD    
79   O OE1   . GLU A 9   ? 0.3174 0.4665 0.3748 0.0385  -0.0527 -0.0009 9   GLU A OE1   
80   O OE2   . GLU A 9   ? 0.3751 0.5244 0.4360 0.0341  -0.0531 -0.0058 9   GLU A OE2   
81   N N     . GLN A 10  ? 0.4143 0.5717 0.4783 0.0498  -0.0700 0.0016  10  GLN A N     
82   C CA    . GLN A 10  ? 0.4429 0.5947 0.4993 0.0556  -0.0735 0.0040  10  GLN A CA    
83   C C     . GLN A 10  ? 0.4876 0.6206 0.5161 0.0610  -0.0754 0.0050  10  GLN A C     
84   O O     . GLN A 10  ? 0.4513 0.5731 0.4656 0.0600  -0.0662 0.0069  10  GLN A O     
85   C CB    . GLN A 10  ? 0.4533 0.6068 0.5146 0.0545  -0.0641 0.0080  10  GLN A CB    
86   C CG    . GLN A 10  ? 0.4457 0.5966 0.5052 0.0602  -0.0679 0.0101  10  GLN A CG    
87   C CD    . GLN A 10  ? 0.4891 0.6347 0.5446 0.0604  -0.0576 0.0142  10  GLN A CD    
88   O OE1   . GLN A 10  ? 0.4685 0.6188 0.5318 0.0552  -0.0488 0.0147  10  GLN A OE1   
89   N NE2   . GLN A 10  ? 0.4684 0.6039 0.5119 0.0667  -0.0592 0.0170  10  GLN A NE2   
90   N N     . ILE A 11  ? 0.5532 0.6819 0.5740 0.0669  -0.0873 0.0037  11  ILE A N     
91   C CA    . ILE A 11  ? 0.6023 0.7106 0.5927 0.0731  -0.0908 0.0048  11  ILE A CA    
92   C C     . ILE A 11  ? 0.6086 0.7126 0.5938 0.0806  -0.0985 0.0074  11  ILE A C     
93   O O     . ILE A 11  ? 0.6298 0.7408 0.6242 0.0838  -0.1124 0.0044  11  ILE A O     
94   C CB    . ILE A 11  ? 0.6192 0.7228 0.5996 0.0734  -0.1006 -0.0005 11  ILE A CB    
95   C CG1   . ILE A 11  ? 0.6157 0.7198 0.5978 0.0666  -0.0907 -0.0022 11  ILE A CG1   
96   C CG2   . ILE A 11  ? 0.6669 0.7476 0.6128 0.0812  -0.1069 0.0004  11  ILE A CG2   
97   C CD1   . ILE A 11  ? 0.6407 0.7448 0.6209 0.0650  -0.0989 -0.0083 11  ILE A CD1   
98   N N     . GLY A 12  ? 0.6123 0.7051 0.5849 0.0834  -0.0892 0.0128  12  GLY A N     
99   C CA    . GLY A 12  ? 0.6312 0.7201 0.6010 0.0903  -0.0939 0.0163  12  GLY A CA    
100  C C     . GLY A 12  ? 0.6168 0.7270 0.6193 0.0879  -0.0968 0.0152  12  GLY A C     
101  O O     . GLY A 12  ? 0.5885 0.7099 0.6087 0.0814  -0.0866 0.0154  12  GLY A O     
102  N N     . ASP A 13  ? 0.6079 0.7224 0.6178 0.0934  -0.1109 0.0137  13  ASP A N     
103  C CA    . ASP A 13  ? 0.5810 0.7144 0.6231 0.0919  -0.1142 0.0121  13  ASP A CA    
104  C C     . ASP A 13  ? 0.5517 0.7012 0.6167 0.0870  -0.1214 0.0056  13  ASP A C     
105  O O     . ASP A 13  ? 0.5276 0.6916 0.6199 0.0864  -0.1260 0.0031  13  ASP A O     
106  C CB    . ASP A 13  ? 0.5965 0.7261 0.6384 0.1010  -0.1252 0.0141  13  ASP A CB    
107  C CG    . ASP A 13  ? 0.6373 0.7545 0.6651 0.1051  -0.1157 0.0208  13  ASP A CG    
108  O OD1   . ASP A 13  ? 0.6758 0.7806 0.6883 0.1142  -0.1237 0.0239  13  ASP A OD1   
109  O OD2   . ASP A 13  ? 0.6454 0.7648 0.6776 0.0994  -0.1004 0.0229  13  ASP A OD2   
110  N N     . SER A 14  ? 0.5410 0.6872 0.5957 0.0835  -0.1213 0.0027  14  SER A N     
111  C CA    . SER A 14  ? 0.5275 0.6868 0.6017 0.0789  -0.1274 -0.0037 14  SER A CA    
112  C C     . SER A 14  ? 0.4806 0.6470 0.5637 0.0702  -0.1150 -0.0043 14  SER A C     
113  O O     . SER A 14  ? 0.4497 0.6071 0.5160 0.0680  -0.1051 -0.0014 14  SER A O     
114  C CB    . SER A 14  ? 0.5688 0.7190 0.6262 0.0825  -0.1409 -0.0080 14  SER A CB    
115  O OG    . SER A 14  ? 0.6308 0.7823 0.6937 0.0895  -0.1571 -0.0102 14  SER A OG    
116  N N     . ILE A 15  ? 0.4543 0.6365 0.5650 0.0655  -0.1155 -0.0081 15  ILE A N     
117  C CA    . ILE A 15  ? 0.4210 0.6097 0.5405 0.0580  -0.1070 -0.0097 15  ILE A CA    
118  C C     . ILE A 15  ? 0.4185 0.6076 0.5385 0.0572  -0.1159 -0.0157 15  ILE A C     
119  O O     . ILE A 15  ? 0.4035 0.5979 0.5359 0.0597  -0.1279 -0.0204 15  ILE A O     
120  C CB    . ILE A 15  ? 0.3793 0.5821 0.5262 0.0534  -0.1003 -0.0100 15  ILE A CB    
121  C CG1   . ILE A 15  ? 0.3564 0.5573 0.4997 0.0528  -0.0896 -0.0044 15  ILE A CG1   
122  C CG2   . ILE A 15  ? 0.3499 0.5592 0.5076 0.0467  -0.0950 -0.0127 15  ILE A CG2   
123  C CD1   . ILE A 15  ? 0.2774 0.4693 0.4011 0.0507  -0.0804 -0.0007 15  ILE A CD1   
124  N N     . PHE A 16  ? 0.4395 0.6225 0.5465 0.0537  -0.1103 -0.0158 16  PHE A N     
125  C CA    . PHE A 16  ? 0.4470 0.6299 0.5545 0.0517  -0.1162 -0.0216 16  PHE A CA    
126  C C     . PHE A 16  ? 0.4275 0.6196 0.5518 0.0444  -0.1066 -0.0224 16  PHE A C     
127  O O     . PHE A 16  ? 0.4231 0.6118 0.5398 0.0415  -0.0957 -0.0185 16  PHE A O     
128  C CB    . PHE A 16  ? 0.4751 0.6406 0.5516 0.0541  -0.1172 -0.0213 16  PHE A CB    
129  C CG    . PHE A 16  ? 0.5574 0.7121 0.6158 0.0615  -0.1309 -0.0230 16  PHE A CG    
130  C CD1   . PHE A 16  ? 0.5871 0.7438 0.6500 0.0628  -0.1452 -0.0303 16  PHE A CD1   
131  C CD2   . PHE A 16  ? 0.5795 0.7210 0.6155 0.0673  -0.1297 -0.0175 16  PHE A CD2   
132  C CE1   . PHE A 16  ? 0.6052 0.7507 0.6493 0.0703  -0.1597 -0.0320 16  PHE A CE1   
133  C CE2   . PHE A 16  ? 0.6410 0.7701 0.6569 0.0750  -0.1428 -0.0185 16  PHE A CE2   
134  C CZ    . PHE A 16  ? 0.6286 0.7597 0.6479 0.0767  -0.1586 -0.0257 16  PHE A CZ    
135  N N     . GLU A 17  ? 0.3969 0.6002 0.5449 0.0419  -0.1108 -0.0277 17  GLU A N     
136  C CA    . GLU A 17  ? 0.3656 0.5770 0.5308 0.0356  -0.1017 -0.0284 17  GLU A CA    
137  C C     . GLU A 17  ? 0.3507 0.5640 0.5241 0.0330  -0.1066 -0.0353 17  GLU A C     
138  O O     . GLU A 17  ? 0.3467 0.5639 0.5309 0.0348  -0.1179 -0.0414 17  GLU A O     
139  C CB    . GLU A 17  ? 0.3587 0.5813 0.5485 0.0340  -0.0978 -0.0278 17  GLU A CB    
140  C CG    . GLU A 17  ? 0.3678 0.5957 0.5713 0.0280  -0.0868 -0.0273 17  GLU A CG    
141  C CD    . GLU A 17  ? 0.3745 0.6120 0.6048 0.0261  -0.0838 -0.0294 17  GLU A CD    
142  O OE1   . GLU A 17  ? 0.3606 0.6004 0.6005 0.0217  -0.0742 -0.0288 17  GLU A OE1   
143  O OE2   . GLU A 17  ? 0.3688 0.6107 0.6106 0.0293  -0.0903 -0.0315 17  GLU A OE2   
144  N N     . ARG A 18  ? 0.3206 0.5312 0.4899 0.0288  -0.0983 -0.0344 18  ARG A N     
145  C CA    . ARG A 18  ? 0.2821 0.4958 0.4635 0.0249  -0.0989 -0.0404 18  ARG A CA    
146  C C     . ARG A 18  ? 0.2675 0.4906 0.4718 0.0205  -0.0892 -0.0390 18  ARG A C     
147  O O     . ARG A 18  ? 0.2439 0.4666 0.4444 0.0195  -0.0797 -0.0326 18  ARG A O     
148  C CB    . ARG A 18  ? 0.2748 0.4783 0.4375 0.0233  -0.0946 -0.0399 18  ARG A CB    
149  C CG    . ARG A 18  ? 0.2573 0.4483 0.3945 0.0275  -0.1030 -0.0417 18  ARG A CG    
150  C CD    . ARG A 18  ? 0.2966 0.4756 0.4141 0.0260  -0.0951 -0.0398 18  ARG A CD    
151  N NE    . ARG A 18  ? 0.2769 0.4561 0.4015 0.0219  -0.0942 -0.0453 18  ARG A NE    
152  C CZ    . ARG A 18  ? 0.2787 0.4498 0.3934 0.0195  -0.0859 -0.0444 18  ARG A CZ    
153  N NH1   . ARG A 18  ? 0.2545 0.4172 0.3534 0.0206  -0.0777 -0.0382 18  ARG A NH1   
154  N NH2   . ARG A 18  ? 0.3270 0.4984 0.4497 0.0158  -0.0851 -0.0498 18  ARG A NH2   
155  N N     . TYR A 19  ? 0.2398 0.4706 0.4676 0.0182  -0.0916 -0.0453 19  TYR A N     
156  C CA    . TYR A 19  ? 0.2235 0.4609 0.4723 0.0142  -0.0810 -0.0442 19  TYR A CA    
157  C C     . TYR A 19  ? 0.2375 0.4788 0.5065 0.0102  -0.0799 -0.0512 19  TYR A C     
158  O O     . TYR A 19  ? 0.2518 0.4925 0.5219 0.0104  -0.0894 -0.0581 19  TYR A O     
159  C CB    . TYR A 19  ? 0.2069 0.4508 0.4703 0.0159  -0.0809 -0.0431 19  TYR A CB    
160  C CG    . TYR A 19  ? 0.2947 0.5456 0.5782 0.0179  -0.0924 -0.0506 19  TYR A CG    
161  C CD1   . TYR A 19  ? 0.2701 0.5188 0.5420 0.0232  -0.1064 -0.0524 19  TYR A CD1   
162  C CD2   . TYR A 19  ? 0.2836 0.5427 0.5982 0.0148  -0.0894 -0.0561 19  TYR A CD2   
163  C CE1   . TYR A 19  ? 0.3028 0.5582 0.5938 0.0257  -0.1189 -0.0594 19  TYR A CE1   
164  C CE2   . TYR A 19  ? 0.3025 0.5692 0.6395 0.0167  -0.1007 -0.0637 19  TYR A CE2   
165  C CZ    . TYR A 19  ? 0.3208 0.5860 0.6460 0.0223  -0.1164 -0.0653 19  TYR A CZ    
166  O OH    . TYR A 19  ? 0.3708 0.6436 0.7186 0.0249  -0.1297 -0.0730 19  TYR A OH    
167  N N     . ILE A 20  ? 0.2464 0.4900 0.5300 0.0065  -0.0680 -0.0493 20  ILE A N     
168  C CA    . ILE A 20  ? 0.2519 0.4993 0.5591 0.0025  -0.0643 -0.0557 20  ILE A CA    
169  C C     . ILE A 20  ? 0.2824 0.5377 0.6172 0.0020  -0.0627 -0.0589 20  ILE A C     
170  O O     . ILE A 20  ? 0.2779 0.5328 0.6132 0.0023  -0.0544 -0.0534 20  ILE A O     
171  C CB    . ILE A 20  ? 0.2154 0.4574 0.5192 -0.0011 -0.0506 -0.0513 20  ILE A CB    
172  C CG1   . ILE A 20  ? 0.2715 0.5063 0.5529 -0.0009 -0.0521 -0.0493 20  ILE A CG1   
173  C CG2   . ILE A 20  ? 0.1923 0.4371 0.5220 -0.0053 -0.0439 -0.0571 20  ILE A CG2   
174  C CD1   . ILE A 20  ? 0.2556 0.4896 0.5378 -0.0015 -0.0613 -0.0577 20  ILE A CD1   
175  N N     . ASP A 21  ? 0.2851 0.5471 0.6434 0.0013  -0.0707 -0.0684 21  ASP A N     
176  C CA    . ASP A 21  ? 0.3348 0.6050 0.7245 0.0008  -0.0693 -0.0727 21  ASP A CA    
177  C C     . ASP A 21  ? 0.3536 0.6237 0.7660 -0.0043 -0.0532 -0.0740 21  ASP A C     
178  O O     . ASP A 21  ? 0.3419 0.6054 0.7441 -0.0072 -0.0436 -0.0710 21  ASP A O     
179  C CB    . ASP A 21  ? 0.3343 0.6127 0.7421 0.0032  -0.0868 -0.0824 21  ASP A CB    
180  C CG    . ASP A 21  ? 0.3960 0.6763 0.8177 -0.0001 -0.0921 -0.0922 21  ASP A CG    
181  O OD1   . ASP A 21  ? 0.4257 0.7040 0.8572 -0.0050 -0.0794 -0.0931 21  ASP A OD1   
182  O OD2   . ASP A 21  ? 0.4438 0.7269 0.8663 0.0025  -0.1094 -0.0993 21  ASP A OD2   
183  N N     . SER A 22  ? 0.3603 0.6369 0.8036 -0.0053 -0.0497 -0.0784 22  SER A N     
184  C CA    . SER A 22  ? 0.3755 0.6502 0.8413 -0.0099 -0.0322 -0.0795 22  SER A CA    
185  C C     . SER A 22  ? 0.3771 0.6519 0.8583 -0.0142 -0.0297 -0.0866 22  SER A C     
186  O O     . SER A 22  ? 0.3897 0.6586 0.8795 -0.0180 -0.0131 -0.0854 22  SER A O     
187  C CB    . SER A 22  ? 0.3837 0.6653 0.8823 -0.0098 -0.0291 -0.0836 22  SER A CB    
188  O OG    . SER A 22  ? 0.3985 0.6913 0.9259 -0.0092 -0.0436 -0.0946 22  SER A OG    
189  N N     . ASN A 23  ? 0.3619 0.6419 0.8451 -0.0135 -0.0458 -0.0942 23  ASN A N     
190  C CA    . ASN A 23  ? 0.3605 0.6399 0.8551 -0.0176 -0.0450 -0.1015 23  ASN A CA    
191  C C     . ASN A 23  ? 0.3742 0.6440 0.8351 -0.0178 -0.0430 -0.0956 23  ASN A C     
192  O O     . ASN A 23  ? 0.3837 0.6513 0.8484 -0.0209 -0.0421 -0.1007 23  ASN A O     
193  C CB    . ASN A 23  ? 0.3775 0.6666 0.8923 -0.0169 -0.0640 -0.1140 23  ASN A CB    
194  C CG    . ASN A 23  ? 0.3720 0.6719 0.9286 -0.0173 -0.0653 -0.1215 23  ASN A CG    
195  O OD1   . ASN A 23  ? 0.3593 0.6602 0.9458 -0.0218 -0.0510 -0.1253 23  ASN A OD1   
196  N ND2   . ASN A 23  ? 0.2742 0.5812 0.8336 -0.0125 -0.0817 -0.1236 23  ASN A ND2   
197  N N     . GLY A 24  ? 0.3532 0.6174 0.7830 -0.0145 -0.0420 -0.0852 24  GLY A N     
198  C CA    . GLY A 24  ? 0.3270 0.5825 0.7265 -0.0141 -0.0401 -0.0791 24  GLY A CA    
199  C C     . GLY A 24  ? 0.3253 0.5805 0.7103 -0.0125 -0.0556 -0.0841 24  GLY A C     
200  O O     . GLY A 24  ? 0.3505 0.5991 0.7211 -0.0139 -0.0533 -0.0834 24  GLY A O     
201  N N     . ARG A 25  ? 0.3382 0.5991 0.7261 -0.0093 -0.0710 -0.0890 25  ARG A N     
202  C CA    . ARG A 25  ? 0.3509 0.6090 0.7205 -0.0068 -0.0867 -0.0935 25  ARG A CA    
203  C C     . ARG A 25  ? 0.3173 0.5701 0.6555 -0.0016 -0.0919 -0.0854 25  ARG A C     
204  O O     . ARG A 25  ? 0.3229 0.5788 0.6622 0.0008  -0.0900 -0.0800 25  ARG A O     
205  C CB    . ARG A 25  ? 0.3855 0.6518 0.7783 -0.0062 -0.1023 -0.1055 25  ARG A CB    
206  C CG    . ARG A 25  ? 0.5236 0.7911 0.9351 -0.0111 -0.1035 -0.1164 25  ARG A CG    
207  C CD    . ARG A 25  ? 0.6323 0.8996 1.0632 -0.0167 -0.0836 -0.1149 25  ARG A CD    
208  N NE    . ARG A 25  ? 0.6829 0.9483 1.1250 -0.0215 -0.0818 -0.1235 25  ARG A NE    
209  C CZ    . ARG A 25  ? 0.7123 0.9851 1.1908 -0.0254 -0.0819 -0.1343 25  ARG A CZ    
210  N NH1   . ARG A 25  ? 0.6939 0.9766 1.2025 -0.0250 -0.0836 -0.1379 25  ARG A NH1   
211  N NH2   . ARG A 25  ? 0.7124 0.9823 1.1986 -0.0299 -0.0797 -0.1420 25  ARG A NH2   
212  N N     . GLU A 26  ? 0.3062 0.5499 0.6166 -0.0002 -0.0968 -0.0846 26  GLU A N     
213  C CA    . GLU A 26  ? 0.2938 0.5310 0.5744 0.0047  -0.1011 -0.0776 26  GLU A CA    
214  C C     . GLU A 26  ? 0.3032 0.5423 0.5811 0.0098  -0.1178 -0.0814 26  GLU A C     
215  O O     . GLU A 26  ? 0.2971 0.5356 0.5768 0.0106  -0.1307 -0.0902 26  GLU A O     
216  C CB    . GLU A 26  ? 0.2669 0.4919 0.5185 0.0047  -0.0989 -0.0750 26  GLU A CB    
217  C CG    . GLU A 26  ? 0.3007 0.5184 0.5242 0.0095  -0.1008 -0.0675 26  GLU A CG    
218  C CD    . GLU A 26  ? 0.3436 0.5482 0.5394 0.0098  -0.0970 -0.0647 26  GLU A CD    
219  O OE1   . GLU A 26  ? 0.3544 0.5563 0.5522 0.0060  -0.0881 -0.0647 26  GLU A OE1   
220  O OE2   . GLU A 26  ? 0.3697 0.5659 0.5418 0.0141  -0.1021 -0.0620 26  GLU A OE2   
221  N N     . ARG A 27  ? 0.3163 0.5568 0.5889 0.0136  -0.1177 -0.0749 27  ARG A N     
222  C CA    . ARG A 27  ? 0.3692 0.6103 0.6373 0.0194  -0.1327 -0.0768 27  ARG A CA    
223  C C     . ARG A 27  ? 0.3811 0.6132 0.6188 0.0240  -0.1317 -0.0680 27  ARG A C     
224  O O     . ARG A 27  ? 0.3872 0.6159 0.6143 0.0224  -0.1189 -0.0603 27  ARG A O     
225  C CB    . ARG A 27  ? 0.4095 0.6634 0.7102 0.0198  -0.1344 -0.0792 27  ARG A CB    
226  C CG    . ARG A 27  ? 0.4926 0.7563 0.8298 0.0143  -0.1291 -0.0862 27  ARG A CG    
227  C CD    . ARG A 27  ? 0.6218 0.8879 0.9715 0.0133  -0.1423 -0.0981 27  ARG A CD    
228  N NE    . ARG A 27  ? 0.7538 1.0173 1.0908 0.0194  -0.1625 -0.1020 27  ARG A NE    
229  C CZ    . ARG A 27  ? 0.8363 1.1080 1.1926 0.0235  -0.1748 -0.1058 27  ARG A CZ    
230  N NH1   . ARG A 27  ? 0.8487 1.1321 1.2403 0.0217  -0.1680 -0.1065 27  ARG A NH1   
231  N NH2   . ARG A 27  ? 0.8649 1.1317 1.2047 0.0298  -0.1938 -0.1086 27  ARG A NH2   
232  N N     . THR A 28  ? 0.4269 0.6544 0.6508 0.0300  -0.1456 -0.0693 28  THR A N     
233  C CA    . THR A 28  ? 0.4398 0.6586 0.6378 0.0351  -0.1451 -0.0614 28  THR A CA    
234  C C     . THR A 28  ? 0.4340 0.6587 0.6439 0.0403  -0.1556 -0.0619 28  THR A C     
235  O O     . THR A 28  ? 0.4468 0.6791 0.6775 0.0414  -0.1678 -0.0696 28  THR A O     
236  C CB    . THR A 28  ? 0.4777 0.6794 0.6393 0.0383  -0.1508 -0.0614 28  THR A CB    
237  O OG1   . THR A 28  ? 0.5619 0.7587 0.7167 0.0333  -0.1423 -0.0627 28  THR A OG1   
238  C CG2   . THR A 28  ? 0.4557 0.6468 0.5908 0.0426  -0.1457 -0.0524 28  THR A CG2   
239  N N     . ARG A 29  ? 0.4147 0.6365 0.6137 0.0437  -0.1510 -0.0541 29  ARG A N     
240  C CA    . ARG A 29  ? 0.4129 0.6382 0.6196 0.0496  -0.1605 -0.0534 29  ARG A CA    
241  C C     . ARG A 29  ? 0.4341 0.6484 0.6136 0.0545  -0.1571 -0.0449 29  ARG A C     
242  O O     . ARG A 29  ? 0.3995 0.6097 0.5672 0.0517  -0.1431 -0.0387 29  ARG A O     
243  C CB    . ARG A 29  ? 0.3740 0.6147 0.6182 0.0468  -0.1551 -0.0546 29  ARG A CB    
244  C CG    . ARG A 29  ? 0.3701 0.6131 0.6180 0.0416  -0.1362 -0.0484 29  ARG A CG    
245  C CD    . ARG A 29  ? 0.3492 0.6045 0.6315 0.0390  -0.1302 -0.0500 29  ARG A CD    
246  N NE    . ARG A 29  ? 0.3286 0.5843 0.6127 0.0336  -0.1126 -0.0452 29  ARG A NE    
247  C CZ    . ARG A 29  ? 0.3063 0.5692 0.6162 0.0290  -0.1035 -0.0476 29  ARG A CZ    
248  N NH1   . ARG A 29  ? 0.2803 0.5518 0.6202 0.0286  -0.1094 -0.0551 29  ARG A NH1   
249  N NH2   . ARG A 29  ? 0.2599 0.5203 0.5657 0.0249  -0.0885 -0.0426 29  ARG A NH2   
250  N N     . GLU A 30  ? 0.4486 0.6578 0.6187 0.0619  -0.1702 -0.0449 30  GLU A N     
251  C CA    . GLU A 30  ? 0.4775 0.6774 0.6273 0.0671  -0.1669 -0.0369 30  GLU A CA    
252  C C     . GLU A 30  ? 0.4619 0.6738 0.6388 0.0683  -0.1653 -0.0351 30  GLU A C     
253  O O     . GLU A 30  ? 0.4380 0.6591 0.6385 0.0708  -0.1767 -0.0402 30  GLU A O     
254  C CB    . GLU A 30  ? 0.5333 0.7175 0.6534 0.0753  -0.1810 -0.0370 30  GLU A CB    
255  C CG    . GLU A 30  ? 0.6059 0.7771 0.7013 0.0810  -0.1763 -0.0285 30  GLU A CG    
256  C CD    . GLU A 30  ? 0.6877 0.8386 0.7468 0.0891  -0.1879 -0.0278 30  GLU A CD    
257  O OE1   . GLU A 30  ? 0.7373 0.8851 0.7914 0.0914  -0.2030 -0.0344 30  GLU A OE1   
258  O OE2   . GLU A 30  ? 0.7218 0.8584 0.7559 0.0933  -0.1816 -0.0207 30  GLU A OE2   
259  N N     . VAL A 31  ? 0.4699 0.6816 0.6448 0.0664  -0.1508 -0.0284 31  VAL A N     
260  C CA    . VAL A 31  ? 0.4743 0.6953 0.6723 0.0672  -0.1471 -0.0263 31  VAL A CA    
261  C C     . VAL A 31  ? 0.4916 0.7032 0.6710 0.0723  -0.1435 -0.0190 31  VAL A C     
262  O O     . VAL A 31  ? 0.4952 0.6982 0.6538 0.0705  -0.1326 -0.0140 31  VAL A O     
263  C CB    . VAL A 31  ? 0.4532 0.6848 0.6735 0.0593  -0.1322 -0.0264 31  VAL A CB    
264  C CG1   . VAL A 31  ? 0.4555 0.6917 0.6903 0.0599  -0.1244 -0.0227 31  VAL A CG1   
265  C CG2   . VAL A 31  ? 0.4300 0.6725 0.6778 0.0555  -0.1363 -0.0341 31  VAL A CG2   
266  N N     . GLU A 32  ? 0.5184 0.7316 0.7073 0.0787  -0.1527 -0.0188 32  GLU A N     
267  C CA    . GLU A 32  ? 0.5384 0.7432 0.7136 0.0842  -0.1494 -0.0120 32  GLU A CA    
268  C C     . GLU A 32  ? 0.4857 0.6978 0.6773 0.0791  -0.1334 -0.0090 32  GLU A C     
269  O O     . GLU A 32  ? 0.4923 0.7124 0.7076 0.0806  -0.1335 -0.0094 32  GLU A O     
270  C CB    . GLU A 32  ? 0.5731 0.7778 0.7559 0.0931  -0.1653 -0.0129 32  GLU A CB    
271  C CG    . GLU A 32  ? 0.6716 0.8659 0.8328 0.0996  -0.1832 -0.0157 32  GLU A CG    
272  C CD    . GLU A 32  ? 0.7486 0.9486 0.9288 0.1071  -0.2027 -0.0198 32  GLU A CD    
273  O OE1   . GLU A 32  ? 0.7695 0.9572 0.9266 0.1149  -0.2183 -0.0200 32  GLU A OE1   
274  O OE2   . GLU A 32  ? 0.7532 0.9693 0.9715 0.1053  -0.2028 -0.0229 32  GLU A OE2   
275  N N     . TYR A 33  ? 0.4287 0.6375 0.6079 0.0732  -0.1200 -0.0063 33  TYR A N     
276  C CA    . TYR A 33  ? 0.3841 0.5996 0.5774 0.0672  -0.1055 -0.0047 33  TYR A CA    
277  C C     . TYR A 33  ? 0.3781 0.5899 0.5698 0.0701  -0.0991 0.0001  33  TYR A C     
278  O O     . TYR A 33  ? 0.3791 0.5795 0.5481 0.0737  -0.0978 0.0045  33  TYR A O     
279  C CB    . TYR A 33  ? 0.3797 0.5924 0.5601 0.0607  -0.0952 -0.0036 33  TYR A CB    
280  C CG    . TYR A 33  ? 0.3383 0.5564 0.5301 0.0547  -0.0818 -0.0023 33  TYR A CG    
281  C CD1   . TYR A 33  ? 0.2756 0.5037 0.4926 0.0511  -0.0790 -0.0057 33  TYR A CD1   
282  C CD2   . TYR A 33  ? 0.3049 0.5169 0.4816 0.0525  -0.0716 0.0019  33  TYR A CD2   
283  C CE1   . TYR A 33  ? 0.2575 0.4876 0.4807 0.0459  -0.0665 -0.0045 33  TYR A CE1   
284  C CE2   . TYR A 33  ? 0.2789 0.4944 0.4634 0.0472  -0.0608 0.0026  33  TYR A CE2   
285  C CZ    . TYR A 33  ? 0.2642 0.4878 0.4699 0.0441  -0.0583 -0.0004 33  TYR A CZ    
286  O OH    . TYR A 33  ? 0.2847 0.5088 0.4937 0.0393  -0.0473 0.0005  33  TYR A OH    
287  N N     . LYS A 34  ? 0.3462 0.5668 0.5625 0.0681  -0.0939 -0.0010 34  LYS A N     
288  C CA    . LYS A 34  ? 0.3472 0.5653 0.5662 0.0704  -0.0871 0.0028  34  LYS A CA    
289  C C     . LYS A 34  ? 0.3191 0.5370 0.5364 0.0634  -0.0712 0.0044  34  LYS A C     
290  O O     . LYS A 34  ? 0.2978 0.5228 0.5336 0.0586  -0.0644 0.0020  34  LYS A O     
291  C CB    . LYS A 34  ? 0.3615 0.5878 0.6090 0.0742  -0.0929 0.0004  34  LYS A CB    
292  C CG    . LYS A 34  ? 0.4018 0.6247 0.6457 0.0835  -0.1097 0.0004  34  LYS A CG    
293  C CD    . LYS A 34  ? 0.4685 0.7029 0.7456 0.0862  -0.1200 -0.0047 34  LYS A CD    
294  C CE    . LYS A 34  ? 0.4960 0.7364 0.7799 0.0845  -0.1311 -0.0110 34  LYS A CE    
295  N NZ    . LYS A 34  ? 0.4762 0.7291 0.7974 0.0866  -0.1408 -0.0171 34  LYS A NZ    
296  N N     . PRO A 35  ? 0.3122 0.5208 0.5066 0.0629  -0.0651 0.0083  35  PRO A N     
297  C CA    . PRO A 35  ? 0.2825 0.4902 0.4720 0.0563  -0.0524 0.0093  35  PRO A CA    
298  C C     . PRO A 35  ? 0.2704 0.4776 0.4686 0.0558  -0.0434 0.0106  35  PRO A C     
299  O O     . PRO A 35  ? 0.2894 0.4959 0.4952 0.0611  -0.0463 0.0117  35  PRO A O     
300  C CB    . PRO A 35  ? 0.2928 0.4906 0.4576 0.0571  -0.0510 0.0122  35  PRO A CB    
301  C CG    . PRO A 35  ? 0.3233 0.5138 0.4790 0.0650  -0.0586 0.0145  35  PRO A CG    
302  C CD    . PRO A 35  ? 0.3299 0.5274 0.5028 0.0690  -0.0696 0.0119  35  PRO A CD    
303  N N     . SER A 36  ? 0.2548 0.4619 0.4514 0.0495  -0.0330 0.0102  36  SER A N     
304  C CA    . SER A 36  ? 0.2557 0.4600 0.4559 0.0482  -0.0232 0.0111  36  SER A CA    
305  C C     . SER A 36  ? 0.2697 0.4678 0.4527 0.0442  -0.0159 0.0123  36  SER A C     
306  O O     . SER A 36  ? 0.2784 0.4767 0.4523 0.0406  -0.0164 0.0117  36  SER A O     
307  C CB    . SER A 36  ? 0.2512 0.4606 0.4695 0.0443  -0.0168 0.0084  36  SER A CB    
308  O OG    . SER A 36  ? 0.2549 0.4702 0.4943 0.0482  -0.0221 0.0068  36  SER A OG    
309  N N     . LEU A 37  ? 0.2659 0.4585 0.4460 0.0451  -0.0095 0.0138  37  LEU A N     
310  C CA    . LEU A 37  ? 0.2382 0.4256 0.4066 0.0406  -0.0018 0.0136  37  LEU A CA    
311  C C     . LEU A 37  ? 0.2496 0.4343 0.4247 0.0392  0.0073  0.0129  37  LEU A C     
312  O O     . LEU A 37  ? 0.2579 0.4446 0.4468 0.0422  0.0078  0.0130  37  LEU A O     
313  C CB    . LEU A 37  ? 0.2297 0.4104 0.3841 0.0433  -0.0027 0.0159  37  LEU A CB    
314  C CG    . LEU A 37  ? 0.2140 0.3944 0.3588 0.0444  -0.0096 0.0166  37  LEU A CG    
315  C CD1   . LEU A 37  ? 0.2008 0.3718 0.3330 0.0490  -0.0091 0.0195  37  LEU A CD1   
316  C CD2   . LEU A 37  ? 0.1487 0.3317 0.2894 0.0382  -0.0081 0.0146  37  LEU A CD2   
317  N N     . PHE A 38  ? 0.2273 0.4073 0.3936 0.0346  0.0143  0.0116  38  PHE A N     
318  C CA    . PHE A 38  ? 0.2385 0.4150 0.4089 0.0319  0.0236  0.0099  38  PHE A CA    
319  C C     . PHE A 38  ? 0.2857 0.4550 0.4479 0.0309  0.0297  0.0096  38  PHE A C     
320  O O     . PHE A 38  ? 0.3151 0.4824 0.4673 0.0297  0.0281  0.0096  38  PHE A O     
321  C CB    . PHE A 38  ? 0.2469 0.4237 0.4147 0.0258  0.0270  0.0070  38  PHE A CB    
322  C CG    . PHE A 38  ? 0.2022 0.3850 0.3793 0.0261  0.0232  0.0068  38  PHE A CG    
323  C CD1   . PHE A 38  ? 0.1555 0.3430 0.3292 0.0264  0.0150  0.0074  38  PHE A CD1   
324  C CD2   . PHE A 38  ? 0.1494 0.3326 0.3403 0.0258  0.0289  0.0056  38  PHE A CD2   
325  C CE1   . PHE A 38  ? 0.1313 0.3241 0.3149 0.0264  0.0120  0.0068  38  PHE A CE1   
326  C CE2   . PHE A 38  ? 0.1380 0.3266 0.3402 0.0258  0.0265  0.0048  38  PHE A CE2   
327  C CZ    . PHE A 38  ? 0.1553 0.3488 0.3537 0.0261  0.0178  0.0053  38  PHE A CZ    
328  N N     . ALA A 39  ? 0.3179 0.4832 0.4862 0.0311  0.0375  0.0090  39  ALA A N     
329  C CA    . ALA A 39  ? 0.3290 0.4871 0.4919 0.0295  0.0451  0.0080  39  ALA A CA    
330  C C     . ALA A 39  ? 0.3476 0.5017 0.5116 0.0245  0.0540  0.0043  39  ALA A C     
331  O O     . ALA A 39  ? 0.3745 0.5301 0.5485 0.0250  0.0567  0.0042  39  ALA A O     
332  C CB    . ALA A 39  ? 0.3358 0.4904 0.5044 0.0361  0.0467  0.0115  39  ALA A CB    
333  N N     . HIS A 40  ? 0.3688 0.5172 0.5229 0.0195  0.0587  0.0009  40  HIS A N     
334  C CA    . HIS A 40  ? 0.3855 0.5272 0.5374 0.0149  0.0679  -0.0030 40  HIS A CA    
335  C C     . HIS A 40  ? 0.3975 0.5359 0.5617 0.0184  0.0762  -0.0016 40  HIS A C     
336  O O     . HIS A 40  ? 0.3916 0.5294 0.5609 0.0231  0.0763  0.0013  40  HIS A O     
337  C CB    . HIS A 40  ? 0.3716 0.5073 0.5115 0.0096  0.0703  -0.0075 40  HIS A CB    
338  C CG    . HIS A 40  ? 0.3998 0.5376 0.5283 0.0056  0.0628  -0.0097 40  HIS A CG    
339  N ND1   . HIS A 40  ? 0.4267 0.5667 0.5516 0.0046  0.0572  -0.0107 40  HIS A ND1   
340  C CD2   . HIS A 40  ? 0.4343 0.5717 0.5551 0.0027  0.0603  -0.0109 40  HIS A CD2   
341  C CE1   . HIS A 40  ? 0.4185 0.5604 0.5350 0.0015  0.0506  -0.0125 40  HIS A CE1   
342  N NE2   . HIS A 40  ? 0.4229 0.5627 0.5353 0.0004  0.0522  -0.0124 40  HIS A NE2   
343  N N     . CYS A 41  ? 0.4030 0.5380 0.5719 0.0163  0.0836  -0.0033 41  CYS A N     
344  C CA    . CYS A 41  ? 0.4264 0.5578 0.6090 0.0191  0.0928  -0.0026 41  CYS A CA    
345  C C     . CYS A 41  ? 0.4754 0.5958 0.6497 0.0129  0.1047  -0.0076 41  CYS A C     
346  O O     . CYS A 41  ? 0.4882 0.6044 0.6460 0.0073  0.1039  -0.0112 41  CYS A O     
347  C CB    . CYS A 41  ? 0.4049 0.5425 0.6053 0.0229  0.0914  -0.0002 41  CYS A CB    
348  S SG    . CYS A 41  ? 0.4252 0.5607 0.6217 0.0172  0.0954  -0.0035 41  CYS A SG    
349  N N     . PRO A 42  ? 0.5345 0.6492 0.7193 0.0142  0.1155  -0.0078 42  PRO A N     
350  C CA    . PRO A 42  ? 0.5852 0.6876 0.7608 0.0081  0.1279  -0.0131 42  PRO A CA    
351  C C     . PRO A 42  ? 0.6202 0.7183 0.7938 0.0048  0.1335  -0.0150 42  PRO A C     
352  O O     . PRO A 42  ? 0.6060 0.7115 0.7929 0.0080  0.1301  -0.0121 42  PRO A O     
353  C CB    . PRO A 42  ? 0.5998 0.6980 0.7904 0.0115  0.1380  -0.0120 42  PRO A CB    
354  C CG    . PRO A 42  ? 0.5626 0.6711 0.7733 0.0198  0.1312  -0.0059 42  PRO A CG    
355  C CD    . PRO A 42  ? 0.5464 0.6639 0.7493 0.0214  0.1165  -0.0035 42  PRO A CD    
356  N N     . GLU A 43  ? 0.6808 0.7656 0.8371 -0.0015 0.1423  -0.0202 43  GLU A N     
357  C CA    . GLU A 43  ? 0.7402 0.8166 0.8893 -0.0050 0.1497  -0.0223 43  GLU A CA    
358  C C     . GLU A 43  ? 0.7617 0.8376 0.9346 -0.0021 0.1610  -0.0206 43  GLU A C     
359  O O     . GLU A 43  ? 0.7559 0.8310 0.9339 -0.0024 0.1645  -0.0202 43  GLU A O     
360  C CB    . GLU A 43  ? 0.7729 0.8322 0.8955 -0.0119 0.1572  -0.0284 43  GLU A CB    
361  C CG    . GLU A 43  ? 0.8553 0.9046 0.9590 -0.0156 0.1597  -0.0301 43  GLU A CG    
362  C CD    . GLU A 43  ? 0.9030 0.9605 0.9959 -0.0153 0.1442  -0.0282 43  GLU A CD    
363  O OE1   . GLU A 43  ? 0.8909 0.9556 0.9941 -0.0127 0.1414  -0.0245 43  GLU A OE1   
364  O OE2   . GLU A 43  ? 0.9007 0.9579 0.9768 -0.0176 0.1349  -0.0306 43  GLU A OE2   
365  N N     . SER A 44  ? 0.7867 0.8631 0.9758 0.0011  0.1668  -0.0197 44  SER A N     
366  C CA    . SER A 44  ? 0.8100 0.8879 1.0271 0.0050  0.1761  -0.0178 44  SER A CA    
367  C C     . SER A 44  ? 0.8141 0.9066 1.0536 0.0105  0.1668  -0.0137 44  SER A C     
368  O O     . SER A 44  ? 0.8165 0.9104 1.0805 0.0128  0.1742  -0.0132 44  SER A O     
369  C CB    . SER A 44  ? 0.8119 0.8901 1.0424 0.0090  0.1799  -0.0163 44  SER A CB    
370  O OG    . SER A 44  ? 0.7823 0.8715 1.0148 0.0140  0.1657  -0.0123 44  SER A OG    
371  N N     . GLN A 45  ? 0.8004 0.9034 1.0329 0.0122  0.1510  -0.0113 45  GLN A N     
372  C CA    . GLN A 45  ? 0.7873 0.9044 1.0394 0.0176  0.1400  -0.0077 45  GLN A CA    
373  C C     . GLN A 45  ? 0.7753 0.8930 1.0236 0.0143  0.1393  -0.0091 45  GLN A C     
374  O O     . GLN A 45  ? 0.7850 0.9017 1.0109 0.0110  0.1328  -0.0097 45  GLN A O     
375  C CB    . GLN A 45  ? 0.7784 0.9054 1.0258 0.0221  0.1241  -0.0041 45  GLN A CB    
376  C CG    . GLN A 45  ? 0.7999 0.9399 1.0702 0.0297  0.1130  -0.0002 45  GLN A CG    
377  C CD    . GLN A 45  ? 0.8374 0.9819 1.1027 0.0353  0.1017  0.0037  45  GLN A CD    
378  O OE1   . GLN A 45  ? 0.8423 0.9954 1.1080 0.0389  0.0884  0.0061  45  GLN A OE1   
379  N NE2   . GLN A 45  ? 0.8343 0.9715 1.0939 0.0359  0.1078  0.0042  45  GLN A NE2   
380  N N     . ALA A 46  ? 0.7429 0.8619 1.0145 0.0153  0.1467  -0.0097 46  ALA A N     
381  C CA    . ALA A 46  ? 0.7124 0.8314 0.9850 0.0127  0.1480  -0.0109 46  ALA A CA    
382  C C     . ALA A 46  ? 0.6715 0.8045 0.9445 0.0154  0.1303  -0.0084 46  ALA A C     
383  O O     . ALA A 46  ? 0.6587 0.8043 0.9502 0.0214  0.1190  -0.0060 46  ALA A O     
384  C CB    . ALA A 46  ? 0.7003 0.8191 1.0040 0.0137  0.1599  -0.0123 46  ALA A CB    
385  N N     . THR A 47  ? 0.6255 0.7547 0.8766 0.0113  0.1278  -0.0091 47  THR A N     
386  C CA    . THR A 47  ? 0.5821 0.7226 0.8301 0.0132  0.1122  -0.0071 47  THR A CA    
387  C C     . THR A 47  ? 0.5693 0.7041 0.8035 0.0088  0.1149  -0.0082 47  THR A C     
388  O O     . THR A 47  ? 0.5939 0.7140 0.8121 0.0041  0.1272  -0.0102 47  THR A O     
389  C CB    . THR A 47  ? 0.5867 0.7301 0.8158 0.0143  0.1008  -0.0053 47  THR A CB    
390  O OG1   . THR A 47  ? 0.5379 0.6917 0.7653 0.0164  0.0865  -0.0033 47  THR A OG1   
391  C CG2   . THR A 47  ? 0.6036 0.7344 0.8034 0.0088  0.1059  -0.0074 47  THR A CG2   
392  N N     . LYS A 48  ? 0.5320 0.6771 0.7714 0.0104  0.1038  -0.0069 48  LYS A N     
393  C CA    . LYS A 48  ? 0.5332 0.6731 0.7572 0.0067  0.1047  -0.0072 48  LYS A CA    
394  C C     . LYS A 48  ? 0.5095 0.6528 0.7107 0.0064  0.0913  -0.0055 48  LYS A C     
395  O O     . LYS A 48  ? 0.5221 0.6614 0.7086 0.0040  0.0900  -0.0051 48  LYS A O     
396  C CB    . LYS A 48  ? 0.5348 0.6819 0.7834 0.0079  0.1052  -0.0078 48  LYS A CB    
397  C CG    . LYS A 48  ? 0.5392 0.7039 0.8075 0.0129  0.0894  -0.0067 48  LYS A CG    
398  C CD    . LYS A 48  ? 0.6280 0.7995 0.9263 0.0137  0.0915  -0.0088 48  LYS A CD    
399  C CE    . LYS A 48  ? 0.6415 0.8249 0.9442 0.0156  0.0768  -0.0084 48  LYS A CE    
400  N NZ    . LYS A 48  ? 0.6851 0.8624 0.9607 0.0121  0.0756  -0.0071 48  LYS A NZ    
401  N N     . TYR A 49  ? 0.4551 0.6046 0.6542 0.0091  0.0825  -0.0042 49  TYR A N     
402  C CA    . TYR A 49  ? 0.4456 0.5986 0.6272 0.0090  0.0708  -0.0029 49  TYR A CA    
403  C C     . TYR A 49  ? 0.4340 0.5777 0.5939 0.0060  0.0733  -0.0041 49  TYR A C     
404  O O     . TYR A 49  ? 0.4313 0.5733 0.5942 0.0069  0.0767  -0.0047 49  TYR A O     
405  C CB    . TYR A 49  ? 0.4295 0.5948 0.6229 0.0141  0.0590  -0.0007 49  TYR A CB    
406  C CG    . TYR A 49  ? 0.4270 0.6020 0.6435 0.0176  0.0546  -0.0003 49  TYR A CG    
407  C CD1   . TYR A 49  ? 0.4192 0.5986 0.6584 0.0217  0.0560  -0.0003 49  TYR A CD1   
408  C CD2   . TYR A 49  ? 0.3965 0.5765 0.6136 0.0170  0.0486  -0.0002 49  TYR A CD2   
409  C CE1   . TYR A 49  ? 0.4256 0.6144 0.6881 0.0250  0.0504  -0.0008 49  TYR A CE1   
410  C CE2   . TYR A 49  ? 0.4370 0.6260 0.6767 0.0199  0.0440  -0.0008 49  TYR A CE2   
411  C CZ    . TYR A 49  ? 0.4301 0.6239 0.6928 0.0239  0.0444  -0.0013 49  TYR A CZ    
412  O OH    . TYR A 49  ? 0.4177 0.6209 0.7045 0.0269  0.0382  -0.0028 49  TYR A OH    
413  N N     . PHE A 50  ? 0.4246 0.5623 0.5635 0.0026  0.0710  -0.0048 50  PHE A N     
414  C CA    . PHE A 50  ? 0.4137 0.5434 0.5319 -0.0004 0.0705  -0.0068 50  PHE A CA    
415  C C     . PHE A 50  ? 0.3765 0.5124 0.4855 -0.0002 0.0579  -0.0059 50  PHE A C     
416  O O     . PHE A 50  ? 0.3784 0.5198 0.4891 0.0008  0.0518  -0.0039 50  PHE A O     
417  C CB    . PHE A 50  ? 0.4405 0.5542 0.5396 -0.0046 0.0799  -0.0092 50  PHE A CB    
418  C CG    . PHE A 50  ? 0.4631 0.5683 0.5702 -0.0054 0.0946  -0.0108 50  PHE A CG    
419  C CD1   . PHE A 50  ? 0.4915 0.5959 0.6127 -0.0046 0.1027  -0.0099 50  PHE A CD1   
420  C CD2   . PHE A 50  ? 0.4722 0.5701 0.5744 -0.0070 0.1011  -0.0135 50  PHE A CD2   
421  C CE1   . PHE A 50  ? 0.4902 0.5865 0.6216 -0.0053 0.1174  -0.0115 50  PHE A CE1   
422  C CE2   . PHE A 50  ? 0.5121 0.6016 0.6227 -0.0076 0.1156  -0.0150 50  PHE A CE2   
423  C CZ    . PHE A 50  ? 0.5236 0.6124 0.6492 -0.0068 0.1239  -0.0139 50  PHE A CZ    
424  N N     . ASP A 51  ? 0.3382 0.4733 0.4397 -0.0012 0.0545  -0.0077 51  ASP A N     
425  C CA    . ASP A 51  ? 0.3260 0.4658 0.4200 -0.0016 0.0437  -0.0075 51  ASP A CA    
426  C C     . ASP A 51  ? 0.3584 0.4890 0.4321 -0.0051 0.0419  -0.0093 51  ASP A C     
427  O O     . ASP A 51  ? 0.3906 0.5101 0.4543 -0.0071 0.0499  -0.0105 51  ASP A O     
428  C CB    . ASP A 51  ? 0.3174 0.4601 0.4142 -0.0013 0.0411  -0.0089 51  ASP A CB    
429  C CG    . ASP A 51  ? 0.3487 0.4816 0.4329 -0.0054 0.0447  -0.0137 51  ASP A CG    
430  O OD1   . ASP A 51  ? 0.3544 0.4775 0.4236 -0.0084 0.0474  -0.0160 51  ASP A OD1   
431  O OD2   . ASP A 51  ? 0.3761 0.5104 0.4647 -0.0055 0.0448  -0.0155 51  ASP A OD2   
432  N N     . ILE A 52  ? 0.3520 0.4860 0.4192 -0.0055 0.0318  -0.0094 52  ILE A N     
433  C CA    . ILE A 52  ? 0.3709 0.4964 0.4187 -0.0076 0.0278  -0.0103 52  ILE A CA    
434  C C     . ILE A 52  ? 0.3951 0.5071 0.4241 -0.0111 0.0307  -0.0148 52  ILE A C     
435  O O     . ILE A 52  ? 0.4258 0.5255 0.4350 -0.0125 0.0314  -0.0153 52  ILE A O     
436  C CB    . ILE A 52  ? 0.3380 0.4710 0.3858 -0.0067 0.0155  -0.0091 52  ILE A CB    
437  C CG1   . ILE A 52  ? 0.3216 0.4605 0.3756 -0.0074 0.0096  -0.0120 52  ILE A CG1   
438  C CG2   . ILE A 52  ? 0.2971 0.4399 0.3586 -0.0037 0.0138  -0.0048 52  ILE A CG2   
439  C CD1   . ILE A 52  ? 0.2936 0.4380 0.3478 -0.0070 -0.0017 -0.0118 52  ILE A CD1   
440  N N     . TYR A 53  ? 0.3982 0.5108 0.4322 -0.0123 0.0330  -0.0182 53  TYR A N     
441  C CA    . TYR A 53  ? 0.4422 0.5419 0.4601 -0.0159 0.0366  -0.0235 53  TYR A CA    
442  C C     . TYR A 53  ? 0.4698 0.5591 0.4852 -0.0168 0.0510  -0.0239 53  TYR A C     
443  O O     . TYR A 53  ? 0.4871 0.5641 0.4889 -0.0199 0.0563  -0.0284 53  TYR A O     
444  C CB    . TYR A 53  ? 0.4278 0.5325 0.4536 -0.0173 0.0328  -0.0276 53  TYR A CB    
445  C CG    . TYR A 53  ? 0.4610 0.5773 0.4955 -0.0161 0.0207  -0.0270 53  TYR A CG    
446  C CD1   . TYR A 53  ? 0.3908 0.5195 0.4454 -0.0132 0.0203  -0.0238 53  TYR A CD1   
447  C CD2   . TYR A 53  ? 0.4830 0.5966 0.5052 -0.0176 0.0096  -0.0297 53  TYR A CD2   
448  C CE1   . TYR A 53  ? 0.4125 0.5502 0.4751 -0.0123 0.0110  -0.0233 53  TYR A CE1   
449  C CE2   . TYR A 53  ? 0.4658 0.5901 0.4990 -0.0165 -0.0008 -0.0293 53  TYR A CE2   
450  C CZ    . TYR A 53  ? 0.4525 0.5886 0.5061 -0.0141 0.0009  -0.0262 53  TYR A CZ    
451  O OH    . TYR A 53  ? 0.4711 0.6164 0.5358 -0.0132 -0.0075 -0.0259 53  TYR A OH    
452  N N     . GLY A 54  ? 0.4843 0.5786 0.5142 -0.0141 0.0574  -0.0197 54  GLY A N     
453  C CA    . GLY A 54  ? 0.5026 0.5878 0.5344 -0.0146 0.0718  -0.0197 54  GLY A CA    
454  C C     . GLY A 54  ? 0.5013 0.5903 0.5508 -0.0137 0.0794  -0.0205 54  GLY A C     
455  O O     . GLY A 54  ? 0.5149 0.5957 0.5671 -0.0143 0.0919  -0.0212 54  GLY A O     
456  N N     . LYS A 55  ? 0.5009 0.6012 0.5625 -0.0120 0.0727  -0.0202 55  LYS A N     
457  C CA    . LYS A 55  ? 0.5065 0.6103 0.5850 -0.0101 0.0790  -0.0200 55  LYS A CA    
458  C C     . LYS A 55  ? 0.4705 0.5840 0.5703 -0.0053 0.0804  -0.0152 55  LYS A C     
459  O O     . LYS A 55  ? 0.4729 0.5958 0.5780 -0.0029 0.0719  -0.0121 55  LYS A O     
460  C CB    . LYS A 55  ? 0.5303 0.6408 0.6129 -0.0097 0.0722  -0.0211 55  LYS A CB    
461  C CG    . LYS A 55  ? 0.6021 0.7062 0.6678 -0.0143 0.0675  -0.0266 55  LYS A CG    
462  C CD    . LYS A 55  ? 0.6882 0.7819 0.7494 -0.0175 0.0767  -0.0317 55  LYS A CD    
463  C CE    . LYS A 55  ? 0.7600 0.8381 0.8023 -0.0210 0.0843  -0.0349 55  LYS A CE    
464  N NZ    . LYS A 55  ? 0.7654 0.8321 0.8002 -0.0249 0.0920  -0.0411 55  LYS A NZ    
465  N N     . PRO A 56  ? 0.4598 0.5710 0.5729 -0.0038 0.0906  -0.0149 56  PRO A N     
466  C CA    . PRO A 56  ? 0.4276 0.5479 0.5628 0.0009  0.0907  -0.0111 56  PRO A CA    
467  C C     . PRO A 56  ? 0.3840 0.5166 0.5316 0.0060  0.0809  -0.0077 56  PRO A C     
468  O O     . PRO A 56  ? 0.3680 0.5004 0.5135 0.0066  0.0798  -0.0080 56  PRO A O     
469  C CB    . PRO A 56  ? 0.4320 0.5455 0.5784 0.0011  0.1042  -0.0122 56  PRO A CB    
470  C CG    . PRO A 56  ? 0.4794 0.5840 0.6132 -0.0020 0.1089  -0.0157 56  PRO A CG    
471  C CD    . PRO A 56  ? 0.4937 0.5938 0.6034 -0.0063 0.1021  -0.0184 56  PRO A CD    
472  N N     . CYS A 57  ? 0.3545 0.4965 0.5140 0.0095  0.0744  -0.0047 57  CYS A N     
473  C CA    . CYS A 57  ? 0.3425 0.4939 0.5117 0.0148  0.0655  -0.0014 57  CYS A CA    
474  C C     . CYS A 57  ? 0.3661 0.5236 0.5573 0.0201  0.0651  0.0008  57  CYS A C     
475  O O     . CYS A 57  ? 0.3922 0.5499 0.5943 0.0194  0.0699  -0.0001 57  CYS A O     
476  C CB    . CYS A 57  ? 0.3271 0.4844 0.4881 0.0147  0.0546  -0.0003 57  CYS A CB    
477  S SG    . CYS A 57  ? 0.3455 0.4976 0.4856 0.0098  0.0525  -0.0030 57  CYS A SG    
478  N N     . THR A 58  ? 0.3585 0.5203 0.5565 0.0257  0.0594  0.0037  58  THR A N     
479  C CA    . THR A 58  ? 0.3517 0.5200 0.5699 0.0318  0.0554  0.0059  58  THR A CA    
480  C C     . THR A 58  ? 0.3158 0.4921 0.5333 0.0352  0.0420  0.0079  58  THR A C     
481  O O     . THR A 58  ? 0.3314 0.5070 0.5344 0.0355  0.0365  0.0092  58  THR A O     
482  C CB    . THR A 58  ? 0.3604 0.5251 0.5857 0.0366  0.0591  0.0079  58  THR A CB    
483  O OG1   . THR A 58  ? 0.3868 0.5565 0.6354 0.0419  0.0577  0.0091  58  THR A OG1   
484  C CG2   . THR A 58  ? 0.3940 0.5575 0.6077 0.0404  0.0524  0.0110  58  THR A CG2   
485  N N     . ARG A 59  ? 0.2986 0.4820 0.5323 0.0372  0.0374  0.0076  59  ARG A N     
486  C CA    . ARG A 59  ? 0.3053 0.4959 0.5395 0.0405  0.0245  0.0087  59  ARG A CA    
487  C C     . ARG A 59  ? 0.3068 0.4985 0.5451 0.0484  0.0161  0.0118  59  ARG A C     
488  O O     . ARG A 59  ? 0.3155 0.5081 0.5704 0.0528  0.0171  0.0125  59  ARG A O     
489  C CB    . ARG A 59  ? 0.2938 0.4914 0.5447 0.0394  0.0225  0.0064  59  ARG A CB    
490  C CG    . ARG A 59  ? 0.3349 0.5397 0.5871 0.0427  0.0088  0.0068  59  ARG A CG    
491  C CD    . ARG A 59  ? 0.3186 0.5289 0.5817 0.0395  0.0080  0.0039  59  ARG A CD    
492  N NE    . ARG A 59  ? 0.3894 0.6065 0.6807 0.0427  0.0056  0.0018  59  ARG A NE    
493  C CZ    . ARG A 59  ? 0.3791 0.6042 0.6832 0.0457  -0.0058 0.0001  59  ARG A CZ    
494  N NH1   . ARG A 59  ? 0.3501 0.5766 0.6396 0.0460  -0.0152 0.0006  59  ARG A NH1   
495  N NH2   . ARG A 59  ? 0.3965 0.6281 0.7295 0.0485  -0.0077 -0.0024 59  ARG A NH2   
496  N N     . LYS A 60  ? 0.3162 0.5067 0.5386 0.0505  0.0081  0.0138  60  LYS A N     
497  C CA    . LYS A 60  ? 0.3221 0.5110 0.5421 0.0584  -0.0008 0.0171  60  LYS A CA    
498  C C     . LYS A 60  ? 0.3082 0.5032 0.5298 0.0606  -0.0134 0.0164  60  LYS A C     
499  O O     . LYS A 60  ? 0.2864 0.4809 0.4938 0.0579  -0.0163 0.0160  60  LYS A O     
500  C CB    . LYS A 60  ? 0.3587 0.5384 0.5570 0.0588  0.0018  0.0197  60  LYS A CB    
501  C CG    . LYS A 60  ? 0.4339 0.6064 0.6310 0.0580  0.0132  0.0205  60  LYS A CG    
502  C CD    . LYS A 60  ? 0.5172 0.6840 0.7159 0.0664  0.0111  0.0246  60  LYS A CD    
503  C CE    . LYS A 60  ? 0.5521 0.7126 0.7547 0.0658  0.0232  0.0250  60  LYS A CE    
504  N NZ    . LYS A 60  ? 0.5559 0.7210 0.7793 0.0641  0.0287  0.0227  60  LYS A NZ    
505  N N     . LEU A 61  ? 0.3439 0.5448 0.5845 0.0654  -0.0210 0.0156  61  LEU A N     
506  C CA    . LEU A 61  ? 0.3459 0.5531 0.5910 0.0677  -0.0340 0.0138  61  LEU A CA    
507  C C     . LEU A 61  ? 0.3517 0.5530 0.5832 0.0760  -0.0456 0.0171  61  LEU A C     
508  O O     . LEU A 61  ? 0.3765 0.5753 0.6145 0.0827  -0.0490 0.0194  61  LEU A O     
509  C CB    . LEU A 61  ? 0.3353 0.5523 0.6111 0.0681  -0.0362 0.0102  61  LEU A CB    
510  C CG    . LEU A 61  ? 0.3601 0.5861 0.6502 0.0687  -0.0477 0.0062  61  LEU A CG    
511  C CD1   . LEU A 61  ? 0.4483 0.6761 0.7459 0.0778  -0.0636 0.0066  61  LEU A CD1   
512  C CD2   . LEU A 61  ? 0.3181 0.5439 0.5912 0.0642  -0.0499 0.0050  61  LEU A CD2   
513  N N     . PHE A 62  ? 0.3438 0.5415 0.5554 0.0757  -0.0510 0.0175  62  PHE A N     
514  C CA    . PHE A 62  ? 0.3656 0.5538 0.5580 0.0832  -0.0604 0.0208  62  PHE A CA    
515  C C     . PHE A 62  ? 0.3890 0.5812 0.5860 0.0878  -0.0765 0.0184  62  PHE A C     
516  O O     . PHE A 62  ? 0.3822 0.5832 0.5892 0.0834  -0.0797 0.0140  62  PHE A O     
517  C CB    . PHE A 62  ? 0.3472 0.5258 0.5128 0.0806  -0.0551 0.0228  62  PHE A CB    
518  C CG    . PHE A 62  ? 0.3422 0.5159 0.5025 0.0766  -0.0409 0.0246  62  PHE A CG    
519  C CD1   . PHE A 62  ? 0.2648 0.4436 0.4287 0.0681  -0.0321 0.0220  62  PHE A CD1   
520  C CD2   . PHE A 62  ? 0.3194 0.4827 0.4710 0.0816  -0.0366 0.0287  62  PHE A CD2   
521  C CE1   . PHE A 62  ? 0.2908 0.4650 0.4499 0.0643  -0.0205 0.0227  62  PHE A CE1   
522  C CE2   . PHE A 62  ? 0.3353 0.4942 0.4835 0.0775  -0.0234 0.0294  62  PHE A CE2   
523  C CZ    . PHE A 62  ? 0.3150 0.4798 0.4673 0.0687  -0.0159 0.0261  62  PHE A CZ    
524  N N     . ALA A 63  ? 0.4323 0.6171 0.6208 0.0970  -0.0869 0.0211  63  ALA A N     
525  C CA    . ALA A 63  ? 0.4722 0.6593 0.6637 0.1027  -0.1046 0.0186  63  ALA A CA    
526  C C     . ALA A 63  ? 0.4787 0.6612 0.6487 0.1006  -0.1097 0.0168  63  ALA A C     
527  O O     . ALA A 63  ? 0.4938 0.6813 0.6699 0.1019  -0.1227 0.0125  63  ALA A O     
528  C CB    . ALA A 63  ? 0.4972 0.6749 0.6812 0.1139  -0.1149 0.0226  63  ALA A CB    
529  N N     . ASN A 64  ? 0.4733 0.6460 0.6197 0.0972  -0.0992 0.0197  64  ASN A N     
530  C CA    . ASN A 64  ? 0.4920 0.6597 0.6190 0.0943  -0.1005 0.0183  64  ASN A CA    
531  C C     . ASN A 64  ? 0.4694 0.6327 0.5846 0.0878  -0.0849 0.0203  64  ASN A C     
532  O O     . ASN A 64  ? 0.4481 0.6119 0.5691 0.0857  -0.0742 0.0225  64  ASN A O     
533  C CB    . ASN A 64  ? 0.5066 0.6592 0.6069 0.1026  -0.1118 0.0202  64  ASN A CB    
534  C CG    . ASN A 64  ? 0.5773 0.7141 0.6583 0.1092  -0.1072 0.0267  64  ASN A CG    
535  O OD1   . ASN A 64  ? 0.5908 0.7192 0.6581 0.1063  -0.0933 0.0299  64  ASN A OD1   
536  N ND2   . ASN A 64  ? 0.5640 0.6963 0.6448 0.1185  -0.1188 0.0285  64  ASN A ND2   
537  N N     . MET A 65  ? 0.4931 0.6520 0.5929 0.0846  -0.0839 0.0193  65  MET A N     
538  C CA    . MET A 65  ? 0.5024 0.6588 0.5950 0.0781  -0.0705 0.0203  65  MET A CA    
539  C C     . MET A 65  ? 0.5301 0.6707 0.6014 0.0811  -0.0621 0.0250  65  MET A C     
540  O O     . MET A 65  ? 0.5247 0.6648 0.5967 0.0763  -0.0502 0.0259  65  MET A O     
541  C CB    . MET A 65  ? 0.4821 0.6410 0.5707 0.0732  -0.0716 0.0172  65  MET A CB    
542  C CG    . MET A 65  ? 0.4457 0.6206 0.5579 0.0677  -0.0738 0.0129  65  MET A CG    
543  S SD    . MET A 65  ? 0.4504 0.6279 0.5593 0.0625  -0.0753 0.0093  65  MET A SD    
544  C CE    . MET A 65  ? 0.4683 0.6389 0.5652 0.0692  -0.0906 0.0071  65  MET A CE    
545  N N     . ARG A 66  ? 0.5748 0.7017 0.6274 0.0891  -0.0684 0.0277  66  ARG A N     
546  C CA    . ARG A 66  ? 0.6319 0.7415 0.6640 0.0929  -0.0595 0.0326  66  ARG A CA    
547  C C     . ARG A 66  ? 0.6076 0.7196 0.6522 0.0936  -0.0524 0.0350  66  ARG A C     
548  O O     . ARG A 66  ? 0.5930 0.7000 0.6346 0.0905  -0.0393 0.0366  66  ARG A O     
549  C CB    . ARG A 66  ? 0.7112 0.8028 0.7170 0.1022  -0.0681 0.0353  66  ARG A CB    
550  C CG    . ARG A 66  ? 0.8272 0.9097 0.8129 0.1011  -0.0699 0.0335  66  ARG A CG    
551  C CD    . ARG A 66  ? 0.9642 1.0265 0.9202 0.1108  -0.0793 0.0360  66  ARG A CD    
552  N NE    . ARG A 66  ? 1.0288 1.0863 0.9704 0.1098  -0.0859 0.0325  66  ARG A NE    
553  C CZ    . ARG A 66  ? 1.0911 1.1321 1.0062 0.1173  -0.0967 0.0329  66  ARG A CZ    
554  N NH1   . ARG A 66  ? 1.1042 1.1315 1.0033 0.1270  -0.1031 0.0372  66  ARG A NH1   
555  N NH2   . ARG A 66  ? 1.1145 1.1517 1.0179 0.1153  -0.1015 0.0289  66  ARG A NH2   
556  N N     . ASP A 67  ? 0.5924 0.7124 0.6527 0.0974  -0.0608 0.0348  67  ASP A N     
557  C CA    . ASP A 67  ? 0.5768 0.7007 0.6525 0.0976  -0.0540 0.0364  67  ASP A CA    
558  C C     . ASP A 67  ? 0.5529 0.6847 0.6404 0.0882  -0.0406 0.0343  67  ASP A C     
559  O O     . ASP A 67  ? 0.5568 0.6829 0.6428 0.0874  -0.0296 0.0364  67  ASP A O     
560  C CB    . ASP A 67  ? 0.5828 0.7187 0.6814 0.1008  -0.0645 0.0347  67  ASP A CB    
561  C CG    . ASP A 67  ? 0.6300 0.7564 0.7190 0.1119  -0.0771 0.0378  67  ASP A CG    
562  O OD1   . ASP A 67  ? 0.6493 0.7580 0.7104 0.1174  -0.0772 0.0418  67  ASP A OD1   
563  O OD2   . ASP A 67  ? 0.6485 0.7844 0.7581 0.1154  -0.0869 0.0363  67  ASP A OD2   
564  N N     . ALA A 68  ? 0.5032 0.6472 0.6014 0.0813  -0.0419 0.0301  68  ALA A N     
565  C CA    . ALA A 68  ? 0.4790 0.6300 0.5864 0.0727  -0.0317 0.0278  68  ALA A CA    
566  C C     . ALA A 68  ? 0.4903 0.6321 0.5830 0.0698  -0.0219 0.0288  68  ALA A C     
567  O O     . ALA A 68  ? 0.4533 0.5964 0.5512 0.0649  -0.0124 0.0279  68  ALA A O     
568  C CB    . ALA A 68  ? 0.4679 0.6315 0.5870 0.0673  -0.0360 0.0237  68  ALA A CB    
569  N N     . SER A 69  ? 0.5109 0.6426 0.5856 0.0726  -0.0242 0.0302  69  SER A N     
570  C CA    . SER A 69  ? 0.5195 0.6410 0.5817 0.0703  -0.0143 0.0310  69  SER A CA    
571  C C     . SER A 69  ? 0.5412 0.6499 0.5957 0.0739  -0.0051 0.0345  69  SER A C     
572  O O     . SER A 69  ? 0.5297 0.6367 0.5875 0.0694  0.0057  0.0336  69  SER A O     
573  C CB    . SER A 69  ? 0.5308 0.6434 0.5756 0.0724  -0.0180 0.0314  69  SER A CB    
574  O OG    . SER A 69  ? 0.5497 0.6729 0.6022 0.0666  -0.0210 0.0279  69  SER A OG    
575  N N     . GLN A 70  ? 0.5715 0.6709 0.6163 0.0823  -0.0099 0.0382  70  GLN A N     
576  C CA    . GLN A 70  ? 0.6008 0.6871 0.6386 0.0869  -0.0016 0.0421  70  GLN A CA    
577  C C     . GLN A 70  ? 0.5773 0.6728 0.6344 0.0822  0.0058  0.0404  70  GLN A C     
578  O O     . GLN A 70  ? 0.5865 0.6738 0.6418 0.0812  0.0176  0.0414  70  GLN A O     
579  C CB    . GLN A 70  ? 0.6524 0.7298 0.6798 0.0973  -0.0109 0.0464  70  GLN A CB    
580  C CG    . GLN A 70  ? 0.7463 0.8123 0.7510 0.1032  -0.0204 0.0480  70  GLN A CG    
581  C CD    . GLN A 70  ? 0.8494 0.8944 0.8288 0.1046  -0.0098 0.0507  70  GLN A CD    
582  O OE1   . GLN A 70  ? 0.8980 0.9341 0.8591 0.1065  -0.0142 0.0506  70  GLN A OE1   
583  N NE2   . GLN A 70  ? 0.8654 0.9017 0.8442 0.1035  0.0050  0.0527  70  GLN A NE2   
584  N N     . TRP A 71  ? 0.5196 0.6308 0.5950 0.0793  -0.0003 0.0376  71  TRP A N     
585  C CA    . TRP A 71  ? 0.4740 0.5928 0.5663 0.0750  0.0065  0.0356  71  TRP A CA    
586  C C     . TRP A 71  ? 0.4701 0.5916 0.5653 0.0663  0.0158  0.0320  71  TRP A C     
587  O O     . TRP A 71  ? 0.4680 0.5877 0.5688 0.0635  0.0250  0.0310  71  TRP A O     
588  C CB    . TRP A 71  ? 0.4429 0.5761 0.5530 0.0736  -0.0011 0.0332  71  TRP A CB    
589  C CG    . TRP A 71  ? 0.4070 0.5452 0.5321 0.0697  0.0068  0.0314  71  TRP A CG    
590  C CD1   . TRP A 71  ? 0.3768 0.5104 0.5075 0.0737  0.0114  0.0336  71  TRP A CD1   
591  C CD2   . TRP A 71  ? 0.3400 0.4871 0.4747 0.0612  0.0115  0.0269  71  TRP A CD2   
592  N NE1   . TRP A 71  ? 0.3739 0.5130 0.5174 0.0678  0.0193  0.0304  71  TRP A NE1   
593  C CE2   . TRP A 71  ? 0.3176 0.4643 0.4623 0.0602  0.0192  0.0262  71  TRP A CE2   
594  C CE3   . TRP A 71  ? 0.3484 0.5024 0.4828 0.0547  0.0099  0.0235  71  TRP A CE3   
595  C CZ2   . TRP A 71  ? 0.2459 0.3978 0.3982 0.0528  0.0252  0.0221  71  TRP A CZ2   
596  C CZ3   . TRP A 71  ? 0.3174 0.4767 0.4593 0.0479  0.0152  0.0199  71  TRP A CZ3   
597  C CH2   . TRP A 71  ? 0.2920 0.4496 0.4416 0.0469  0.0227  0.0191  71  TRP A CH2   
598  N N     . ILE A 72  ? 0.4821 0.6075 0.5739 0.0623  0.0129  0.0298  72  ILE A N     
599  C CA    . ILE A 72  ? 0.4839 0.6116 0.5786 0.0549  0.0197  0.0264  72  ILE A CA    
600  C C     . ILE A 72  ? 0.4951 0.6095 0.5823 0.0557  0.0306  0.0275  72  ILE A C     
601  O O     . ILE A 72  ? 0.4979 0.6131 0.5925 0.0507  0.0385  0.0246  72  ILE A O     
602  C CB    . ILE A 72  ? 0.4815 0.6150 0.5744 0.0516  0.0140  0.0244  72  ILE A CB    
603  C CG1   . ILE A 72  ? 0.4975 0.6443 0.6008 0.0491  0.0061  0.0224  72  ILE A CG1   
604  C CG2   . ILE A 72  ? 0.4664 0.6004 0.5621 0.0452  0.0204  0.0213  72  ILE A CG2   
605  C CD1   . ILE A 72  ? 0.5315 0.6829 0.6322 0.0482  -0.0013 0.0215  72  ILE A CD1   
606  N N     . LYS A 73  ? 0.5299 0.6311 0.6019 0.0621  0.0312  0.0316  73  LYS A N     
607  C CA    . LYS A 73  ? 0.5656 0.6512 0.6289 0.0638  0.0431  0.0334  73  LYS A CA    
608  C C     . LYS A 73  ? 0.5547 0.6362 0.6235 0.0652  0.0506  0.0344  73  LYS A C     
609  O O     . LYS A 73  ? 0.5510 0.6283 0.6251 0.0613  0.0617  0.0322  73  LYS A O     
610  C CB    . LYS A 73  ? 0.6112 0.6805 0.6531 0.0715  0.0422  0.0382  73  LYS A CB    
611  C CG    . LYS A 73  ? 0.7000 0.7704 0.7342 0.0703  0.0363  0.0371  73  LYS A CG    
612  C CD    . LYS A 73  ? 0.7943 0.8448 0.8032 0.0783  0.0364  0.0418  73  LYS A CD    
613  C CE    . LYS A 73  ? 0.8119 0.8631 0.8118 0.0777  0.0292  0.0405  73  LYS A CE    
614  N NZ    . LYS A 73  ? 0.7451 0.7945 0.7483 0.0716  0.0387  0.0377  73  LYS A NZ    
615  N N     . ARG A 74  ? 0.5455 0.6282 0.6149 0.0707  0.0446  0.0374  74  ARG A N     
616  C CA    . ARG A 74  ? 0.5486 0.6273 0.6240 0.0727  0.0516  0.0387  74  ARG A CA    
617  C C     . ARG A 74  ? 0.5455 0.6348 0.6379 0.0640  0.0572  0.0330  74  ARG A C     
618  O O     . ARG A 74  ? 0.5465 0.6293 0.6424 0.0623  0.0682  0.0320  74  ARG A O     
619  C CB    . ARG A 74  ? 0.5622 0.6421 0.6386 0.0803  0.0427  0.0426  74  ARG A CB    
620  C CG    . ARG A 74  ? 0.5813 0.6458 0.6381 0.0905  0.0385  0.0488  74  ARG A CG    
621  C CD    . ARG A 74  ? 0.6379 0.7011 0.6986 0.0987  0.0324  0.0529  74  ARG A CD    
622  N NE    . ARG A 74  ? 0.6321 0.7117 0.7076 0.0984  0.0193  0.0506  74  ARG A NE    
623  C CZ    . ARG A 74  ? 0.6283 0.7112 0.6981 0.1018  0.0056  0.0509  74  ARG A CZ    
624  N NH1   . ARG A 74  ? 0.6760 0.7461 0.7231 0.1059  0.0027  0.0534  74  ARG A NH1   
625  N NH2   . ARG A 74  ? 0.5826 0.6808 0.6698 0.1009  -0.0045 0.0481  74  ARG A NH2   
626  N N     . MET A 75  ? 0.5303 0.6342 0.6317 0.0587  0.0499  0.0292  75  MET A N     
627  C CA    . MET A 75  ? 0.5123 0.6247 0.6258 0.0504  0.0539  0.0235  75  MET A CA    
628  C C     . MET A 75  ? 0.5514 0.6602 0.6652 0.0447  0.0617  0.0196  75  MET A C     
629  O O     . MET A 75  ? 0.5797 0.6884 0.7008 0.0399  0.0687  0.0156  75  MET A O     
630  C CB    . MET A 75  ? 0.4737 0.5998 0.5933 0.0463  0.0449  0.0207  75  MET A CB    
631  C CG    . MET A 75  ? 0.4018 0.5334 0.5278 0.0500  0.0392  0.0225  75  MET A CG    
632  S SD    . MET A 75  ? 0.4037 0.5332 0.5402 0.0497  0.0478  0.0217  75  MET A SD    
633  C CE    . MET A 75  ? 0.3179 0.4557 0.4604 0.0399  0.0497  0.0152  75  MET A CE    
634  N N     . GLU A 76  ? 0.5663 0.6719 0.6733 0.0451  0.0606  0.0203  76  GLU A N     
635  C CA    . GLU A 76  ? 0.5899 0.6916 0.7002 0.0403  0.0685  0.0167  76  GLU A CA    
636  C C     . GLU A 76  ? 0.5876 0.6754 0.6968 0.0425  0.0815  0.0178  76  GLU A C     
637  O O     . GLU A 76  ? 0.5578 0.6450 0.6767 0.0370  0.0893  0.0129  76  GLU A O     
638  C CB    . GLU A 76  ? 0.6269 0.7265 0.7308 0.0410  0.0659  0.0176  76  GLU A CB    
639  C CG    . GLU A 76  ? 0.7213 0.8185 0.8333 0.0356  0.0739  0.0131  76  GLU A CG    
640  C CD    . GLU A 76  ? 0.7505 0.8440 0.8573 0.0364  0.0735  0.0142  76  GLU A CD    
641  O OE1   . GLU A 76  ? 0.7415 0.8427 0.8593 0.0308  0.0718  0.0096  76  GLU A OE1   
642  O OE2   . GLU A 76  ? 0.7656 0.8475 0.8569 0.0427  0.0748  0.0194  76  GLU A OE2   
643  N N     . ASP A 77  ? 0.5967 0.6731 0.6941 0.0507  0.0833  0.0242  77  ASP A N     
644  C CA    . ASP A 77  ? 0.6011 0.6618 0.6947 0.0544  0.0960  0.0268  77  ASP A CA    
645  C C     . ASP A 77  ? 0.5967 0.6599 0.7011 0.0523  0.1009  0.0247  77  ASP A C     
646  O O     . ASP A 77  ? 0.6268 0.6789 0.7329 0.0527  0.1133  0.0246  77  ASP A O     
647  C CB    . ASP A 77  ? 0.6459 0.6926 0.7211 0.0648  0.0945  0.0349  77  ASP A CB    
648  C CG    . ASP A 77  ? 0.6660 0.7055 0.7266 0.0673  0.0920  0.0371  77  ASP A CG    
649  O OD1   . ASP A 77  ? 0.6320 0.6712 0.6971 0.0618  0.0980  0.0332  77  ASP A OD1   
650  O OD2   . ASP A 77  ? 0.6840 0.7178 0.7292 0.0748  0.0840  0.0423  77  ASP A OD2   
651  N N     . ILE A 78  ? 0.5590 0.6352 0.6705 0.0502  0.0925  0.0229  78  ILE A N     
652  C CA    . ILE A 78  ? 0.5163 0.5947 0.6379 0.0474  0.0976  0.0201  78  ILE A CA    
653  C C     . ILE A 78  ? 0.5054 0.5912 0.6372 0.0374  0.1000  0.0116  78  ILE A C     
654  O O     . ILE A 78  ? 0.5217 0.6033 0.6602 0.0339  0.1094  0.0078  78  ILE A O     
655  C CB    . ILE A 78  ? 0.5005 0.5867 0.6251 0.0506  0.0895  0.0224  78  ILE A CB    
656  C CG1   . ILE A 78  ? 0.5099 0.5877 0.6261 0.0612  0.0866  0.0303  78  ILE A CG1   
657  C CG2   . ILE A 78  ? 0.4650 0.5531 0.6000 0.0465  0.0960  0.0186  78  ILE A CG2   
658  C CD1   . ILE A 78  ? 0.4462 0.5328 0.5686 0.0649  0.0769  0.0324  78  ILE A CD1   
659  N N     . GLY A 79  ? 0.4821 0.5783 0.6147 0.0332  0.0910  0.0086  79  GLY A N     
660  C CA    . GLY A 79  ? 0.4506 0.5541 0.5913 0.0244  0.0901  0.0008  79  GLY A CA    
661  C C     . GLY A 79  ? 0.4421 0.5558 0.5839 0.0211  0.0822  -0.0017 79  GLY A C     
662  O O     . GLY A 79  ? 0.4476 0.5638 0.5935 0.0147  0.0831  -0.0081 79  GLY A O     
663  N N     . LEU A 80  ? 0.4198 0.5381 0.5573 0.0253  0.0747  0.0029  80  LEU A N     
664  C CA    . LEU A 80  ? 0.3836 0.5102 0.5221 0.0226  0.0685  0.0011  80  LEU A CA    
665  C C     . LEU A 80  ? 0.3721 0.5067 0.5074 0.0230  0.0579  0.0026  80  LEU A C     
666  O O     . LEU A 80  ? 0.3886 0.5224 0.5204 0.0278  0.0545  0.0069  80  LEU A O     
667  C CB    . LEU A 80  ? 0.3384 0.4635 0.4796 0.0269  0.0709  0.0045  80  LEU A CB    
668  C CG    . LEU A 80  ? 0.3246 0.4418 0.4699 0.0267  0.0818  0.0033  80  LEU A CG    
669  C CD1   . LEU A 80  ? 0.3173 0.4328 0.4670 0.0335  0.0830  0.0084  80  LEU A CD1   
670  C CD2   . LEU A 80  ? 0.2514 0.3692 0.3981 0.0189  0.0854  -0.0038 80  LEU A CD2   
671  N N     . GLU A 81  ? 0.3590 0.4999 0.4941 0.0180  0.0532  -0.0009 81  GLU A N     
672  C CA    . GLU A 81  ? 0.3415 0.4897 0.4740 0.0174  0.0439  -0.0002 81  GLU A CA    
673  C C     . GLU A 81  ? 0.3588 0.5101 0.4919 0.0228  0.0396  0.0046  81  GLU A C     
674  O O     . GLU A 81  ? 0.3636 0.5141 0.5006 0.0248  0.0423  0.0058  81  GLU A O     
675  C CB    . GLU A 81  ? 0.3467 0.4982 0.4770 0.0115  0.0411  -0.0047 81  GLU A CB    
676  C CG    . GLU A 81  ? 0.3421 0.5000 0.4695 0.0103  0.0323  -0.0044 81  GLU A CG    
677  C CD    . GLU A 81  ? 0.3741 0.5324 0.4960 0.0051  0.0295  -0.0084 81  GLU A CD    
678  O OE1   . GLU A 81  ? 0.3827 0.5359 0.5018 0.0022  0.0344  -0.0118 81  GLU A OE1   
679  O OE2   . GLU A 81  ? 0.4363 0.5987 0.5552 0.0040  0.0225  -0.0082 81  GLU A OE2   
680  N N     . ALA A 82  ? 0.3493 0.5039 0.4799 0.0249  0.0330  0.0069  82  ALA A N     
681  C CA    . ALA A 82  ? 0.3149 0.4735 0.4466 0.0294  0.0268  0.0103  82  ALA A CA    
682  C C     . ALA A 82  ? 0.2920 0.4580 0.4240 0.0259  0.0206  0.0088  82  ALA A C     
683  O O     . ALA A 82  ? 0.2837 0.4518 0.4123 0.0250  0.0163  0.0087  82  ALA A O     
684  C CB    . ALA A 82  ? 0.3093 0.4638 0.4357 0.0351  0.0242  0.0141  82  ALA A CB    
685  N N     . LEU A 83  ? 0.2875 0.4562 0.4237 0.0242  0.0213  0.0076  83  LEU A N     
686  C CA    . LEU A 83  ? 0.2763 0.4496 0.4113 0.0205  0.0176  0.0061  83  LEU A CA    
687  C C     . LEU A 83  ? 0.2776 0.4565 0.4170 0.0235  0.0113  0.0082  83  LEU A C     
688  O O     . LEU A 83  ? 0.2489 0.4284 0.3935 0.0284  0.0093  0.0103  83  LEU A O     
689  C CB    . LEU A 83  ? 0.2856 0.4564 0.4206 0.0168  0.0231  0.0035  83  LEU A CB    
690  C CG    . LEU A 83  ? 0.3072 0.4721 0.4357 0.0125  0.0282  -0.0001 83  LEU A CG    
691  C CD1   . LEU A 83  ? 0.3307 0.4909 0.4630 0.0144  0.0349  0.0000  83  LEU A CD1   
692  C CD2   . LEU A 83  ? 0.2751 0.4361 0.3980 0.0084  0.0315  -0.0027 83  LEU A CD2   
693  N N     . GLY A 84  ? 0.2835 0.4657 0.4206 0.0206  0.0077  0.0073  84  GLY A N     
694  C CA    . GLY A 84  ? 0.2866 0.4741 0.4289 0.0224  0.0023  0.0084  84  GLY A CA    
695  C C     . GLY A 84  ? 0.2955 0.4850 0.4332 0.0230  -0.0037 0.0093  84  GLY A C     
696  O O     . GLY A 84  ? 0.2758 0.4626 0.4077 0.0227  -0.0035 0.0094  84  GLY A O     
697  N N     . MET A 85  ? 0.2887 0.4827 0.4305 0.0235  -0.0082 0.0095  85  MET A N     
698  C CA    . MET A 85  ? 0.2742 0.4696 0.4122 0.0242  -0.0135 0.0101  85  MET A CA    
699  C C     . MET A 85  ? 0.3002 0.4927 0.4349 0.0289  -0.0162 0.0116  85  MET A C     
700  O O     . MET A 85  ? 0.3091 0.5026 0.4483 0.0328  -0.0195 0.0121  85  MET A O     
701  C CB    . MET A 85  ? 0.2242 0.4244 0.3680 0.0235  -0.0169 0.0095  85  MET A CB    
702  C CG    . MET A 85  ? 0.1943 0.3956 0.3348 0.0240  -0.0219 0.0098  85  MET A CG    
703  S SD    . MET A 85  ? 0.2897 0.4880 0.4215 0.0215  -0.0208 0.0104  85  MET A SD    
704  C CE    . MET A 85  ? 0.2205 0.4200 0.3523 0.0170  -0.0190 0.0097  85  MET A CE    
705  N N     . ASP A 86  ? 0.3134 0.5014 0.4405 0.0289  -0.0147 0.0122  86  ASP A N     
706  C CA    . ASP A 86  ? 0.3364 0.5178 0.4564 0.0334  -0.0151 0.0140  86  ASP A CA    
707  C C     . ASP A 86  ? 0.3595 0.5399 0.4743 0.0350  -0.0200 0.0143  86  ASP A C     
708  O O     . ASP A 86  ? 0.3851 0.5586 0.4913 0.0395  -0.0216 0.0158  86  ASP A O     
709  C CB    . ASP A 86  ? 0.3104 0.4858 0.4259 0.0322  -0.0086 0.0141  86  ASP A CB    
710  C CG    . ASP A 86  ? 0.3393 0.5173 0.4566 0.0273  -0.0077 0.0123  86  ASP A CG    
711  O OD1   . ASP A 86  ? 0.4399 0.6146 0.5538 0.0275  -0.0070 0.0126  86  ASP A OD1   
712  O OD2   . ASP A 86  ? 0.2687 0.4514 0.3905 0.0236  -0.0077 0.0106  86  ASP A OD2   
713  N N     . ASP A 87  ? 0.3582 0.5439 0.4766 0.0315  -0.0221 0.0130  87  ASP A N     
714  C CA    . ASP A 87  ? 0.3504 0.5360 0.4657 0.0324  -0.0266 0.0127  87  ASP A CA    
715  C C     . ASP A 87  ? 0.3329 0.5241 0.4553 0.0338  -0.0325 0.0115  87  ASP A C     
716  O O     . ASP A 87  ? 0.3351 0.5327 0.4663 0.0306  -0.0328 0.0102  87  ASP A O     
717  C CB    . ASP A 87  ? 0.3658 0.5542 0.4833 0.0282  -0.0255 0.0119  87  ASP A CB    
718  C CG    . ASP A 87  ? 0.3619 0.5493 0.4764 0.0288  -0.0290 0.0114  87  ASP A CG    
719  O OD1   . ASP A 87  ? 0.3046 0.4902 0.4157 0.0321  -0.0335 0.0109  87  ASP A OD1   
720  O OD2   . ASP A 87  ? 0.4024 0.5906 0.5183 0.0261  -0.0275 0.0112  87  ASP A OD2   
721  N N     . PHE A 88  ? 0.3275 0.5154 0.4464 0.0387  -0.0373 0.0118  88  PHE A N     
722  C CA    . PHE A 88  ? 0.3596 0.5534 0.4892 0.0405  -0.0434 0.0101  88  PHE A CA    
723  C C     . PHE A 88  ? 0.3777 0.5774 0.5146 0.0383  -0.0478 0.0073  88  PHE A C     
724  O O     . PHE A 88  ? 0.4112 0.6180 0.5628 0.0373  -0.0494 0.0053  88  PHE A O     
725  C CB    . PHE A 88  ? 0.3726 0.5612 0.4969 0.0470  -0.0493 0.0109  88  PHE A CB    
726  C CG    . PHE A 88  ? 0.3735 0.5557 0.4918 0.0496  -0.0442 0.0139  88  PHE A CG    
727  C CD1   . PHE A 88  ? 0.3770 0.5635 0.5063 0.0479  -0.0391 0.0141  88  PHE A CD1   
728  C CD2   . PHE A 88  ? 0.3830 0.5533 0.4839 0.0535  -0.0431 0.0163  88  PHE A CD2   
729  C CE1   . PHE A 88  ? 0.4364 0.6167 0.5609 0.0499  -0.0336 0.0165  88  PHE A CE1   
730  C CE2   . PHE A 88  ? 0.4094 0.5729 0.5053 0.0557  -0.0371 0.0190  88  PHE A CE2   
731  C CZ    . PHE A 88  ? 0.4399 0.6089 0.5483 0.0539  -0.0326 0.0190  88  PHE A CZ    
732  N N     . LYS A 89  ? 0.3731 0.5696 0.5015 0.0372  -0.0486 0.0070  89  LYS A N     
733  C CA    . LYS A 89  ? 0.3857 0.5874 0.5218 0.0348  -0.0518 0.0042  89  LYS A CA    
734  C C     . LYS A 89  ? 0.3681 0.5762 0.5154 0.0299  -0.0464 0.0041  89  LYS A C     
735  O O     . LYS A 89  ? 0.3543 0.5677 0.5130 0.0282  -0.0477 0.0017  89  LYS A O     
736  C CB    . LYS A 89  ? 0.3845 0.5805 0.5093 0.0348  -0.0534 0.0036  89  LYS A CB    
737  C CG    . LYS A 89  ? 0.3913 0.5811 0.5059 0.0334  -0.0468 0.0061  89  LYS A CG    
738  C CD    . LYS A 89  ? 0.4390 0.6197 0.5399 0.0352  -0.0480 0.0055  89  LYS A CD    
739  C CE    . LYS A 89  ? 0.4313 0.6064 0.5263 0.0333  -0.0402 0.0074  89  LYS A CE    
740  N NZ    . LYS A 89  ? 0.4421 0.6127 0.5325 0.0349  -0.0354 0.0099  89  LYS A NZ    
741  N N     . LEU A 90  ? 0.3503 0.5568 0.4940 0.0279  -0.0402 0.0064  90  LEU A N     
742  C CA    . LEU A 90  ? 0.3086 0.5185 0.4588 0.0240  -0.0355 0.0066  90  LEU A CA    
743  C C     . LEU A 90  ? 0.2952 0.5084 0.4563 0.0241  -0.0337 0.0056  90  LEU A C     
744  O O     . LEU A 90  ? 0.2705 0.4861 0.4399 0.0216  -0.0308 0.0045  90  LEU A O     
745  C CB    . LEU A 90  ? 0.2882 0.4949 0.4306 0.0219  -0.0310 0.0086  90  LEU A CB    
746  C CG    . LEU A 90  ? 0.2833 0.4874 0.4193 0.0213  -0.0316 0.0093  90  LEU A CG    
747  C CD1   . LEU A 90  ? 0.3006 0.5037 0.4341 0.0187  -0.0284 0.0104  90  LEU A CD1   
748  C CD2   . LEU A 90  ? 0.2863 0.4924 0.4256 0.0203  -0.0338 0.0084  90  LEU A CD2   
749  N N     . ALA A 91  ? 0.2706 0.4827 0.4320 0.0273  -0.0346 0.0059  91  ALA A N     
750  C CA    . ALA A 91  ? 0.2423 0.4575 0.4167 0.0278  -0.0328 0.0047  91  ALA A CA    
751  C C     . ALA A 91  ? 0.2431 0.4639 0.4320 0.0288  -0.0380 0.0016  91  ALA A C     
752  O O     . ALA A 91  ? 0.2051 0.4292 0.4078 0.0265  -0.0340 -0.0002 91  ALA A O     
753  C CB    . ALA A 91  ? 0.2417 0.4544 0.4144 0.0316  -0.0332 0.0060  91  ALA A CB    
754  N N     . TYR A 92  ? 0.2329 0.4536 0.4181 0.0318  -0.0463 0.0006  92  TYR A N     
755  C CA    . TYR A 92  ? 0.2169 0.4427 0.4153 0.0328  -0.0532 -0.0033 92  TYR A CA    
756  C C     . TYR A 92  ? 0.2166 0.4457 0.4238 0.0281  -0.0488 -0.0052 92  TYR A C     
757  O O     . TYR A 92  ? 0.2381 0.4721 0.4640 0.0269  -0.0475 -0.0082 92  TYR A O     
758  C CB    . TYR A 92  ? 0.2544 0.4767 0.4412 0.0365  -0.0628 -0.0042 92  TYR A CB    
759  C CG    . TYR A 92  ? 0.2757 0.5030 0.4752 0.0370  -0.0710 -0.0092 92  TYR A CG    
760  C CD1   . TYR A 92  ? 0.2668 0.4945 0.4652 0.0338  -0.0710 -0.0114 92  TYR A CD1   
761  C CD2   . TYR A 92  ? 0.2558 0.4879 0.4707 0.0406  -0.0788 -0.0123 92  TYR A CD2   
762  C CE1   . TYR A 92  ? 0.2893 0.5215 0.5006 0.0338  -0.0783 -0.0169 92  TYR A CE1   
763  C CE2   . TYR A 92  ? 0.2728 0.5103 0.5021 0.0408  -0.0871 -0.0180 92  TYR A CE2   
764  C CZ    . TYR A 92  ? 0.2878 0.5252 0.5149 0.0372  -0.0867 -0.0205 92  TYR A CZ    
765  O OH    . TYR A 92  ? 0.3182 0.5608 0.5606 0.0370  -0.0949 -0.0269 92  TYR A OH    
766  N N     . LEU A 93  ? 0.2192 0.4448 0.4139 0.0255  -0.0461 -0.0034 93  LEU A N     
767  C CA    . LEU A 93  ? 0.2309 0.4577 0.4314 0.0215  -0.0416 -0.0044 93  LEU A CA    
768  C C     . LEU A 93  ? 0.2309 0.4578 0.4399 0.0189  -0.0328 -0.0037 93  LEU A C     
769  O O     . LEU A 93  ? 0.2410 0.4700 0.4636 0.0168  -0.0293 -0.0061 93  LEU A O     
770  C CB    . LEU A 93  ? 0.1861 0.4087 0.3720 0.0198  -0.0399 -0.0018 93  LEU A CB    
771  C CG    . LEU A 93  ? 0.2184 0.4394 0.3972 0.0213  -0.0462 -0.0032 93  LEU A CG    
772  C CD1   . LEU A 93  ? 0.2266 0.4435 0.3944 0.0194  -0.0429 -0.0006 93  LEU A CD1   
773  C CD2   . LEU A 93  ? 0.1465 0.3714 0.3378 0.0210  -0.0509 -0.0080 93  LEU A CD2   
774  N N     . SER A 94  ? 0.2202 0.4436 0.4208 0.0190  -0.0285 -0.0009 94  SER A N     
775  C CA    . SER A 94  ? 0.2201 0.4409 0.4246 0.0167  -0.0193 -0.0002 94  SER A CA    
776  C C     . SER A 94  ? 0.2539 0.4787 0.4793 0.0174  -0.0174 -0.0034 94  SER A C     
777  O O     . SER A 94  ? 0.2858 0.5087 0.5204 0.0147  -0.0092 -0.0045 94  SER A O     
778  C CB    . SER A 94  ? 0.2062 0.4222 0.3972 0.0169  -0.0163 0.0025  94  SER A CB    
779  O OG    . SER A 94  ? 0.2331 0.4442 0.4241 0.0144  -0.0072 0.0029  94  SER A OG    
780  N N     . ASP A 95  ? 0.2750 0.5043 0.5082 0.0211  -0.0245 -0.0049 95  ASP A N     
781  C CA    . ASP A 95  ? 0.2927 0.5273 0.5497 0.0226  -0.0249 -0.0084 95  ASP A CA    
782  C C     . ASP A 95  ? 0.3223 0.5628 0.5977 0.0217  -0.0285 -0.0131 95  ASP A C     
783  O O     . ASP A 95  ? 0.3024 0.5462 0.6006 0.0206  -0.0240 -0.0164 95  ASP A O     
784  C CB    . ASP A 95  ? 0.2800 0.5172 0.5390 0.0278  -0.0335 -0.0084 95  ASP A CB    
785  C CG    . ASP A 95  ? 0.2993 0.5317 0.5497 0.0286  -0.0275 -0.0051 95  ASP A CG    
786  O OD1   . ASP A 95  ? 0.2790 0.5103 0.5217 0.0329  -0.0335 -0.0034 95  ASP A OD1   
787  O OD2   . ASP A 95  ? 0.2854 0.5138 0.5355 0.0252  -0.0165 -0.0043 95  ASP A OD2   
788  N N     . THR A 96  ? 0.3458 0.5871 0.6126 0.0219  -0.0360 -0.0137 96  THR A N     
789  C CA    . THR A 96  ? 0.3675 0.6141 0.6506 0.0210  -0.0407 -0.0188 96  THR A CA    
790  C C     . THR A 96  ? 0.3655 0.6097 0.6529 0.0161  -0.0306 -0.0193 96  THR A C     
791  O O     . THR A 96  ? 0.3775 0.6258 0.6861 0.0145  -0.0297 -0.0241 96  THR A O     
792  C CB    . THR A 96  ? 0.3662 0.6131 0.6373 0.0235  -0.0528 -0.0200 96  THR A CB    
793  O OG1   . THR A 96  ? 0.4038 0.6496 0.6658 0.0285  -0.0608 -0.0184 96  THR A OG1   
794  C CG2   . THR A 96  ? 0.3583 0.6111 0.6483 0.0231  -0.0599 -0.0266 96  THR A CG2   
795  N N     . TYR A 97  ? 0.3636 0.6006 0.6314 0.0141  -0.0234 -0.0144 97  TYR A N     
796  C CA    . TYR A 97  ? 0.3619 0.5939 0.6292 0.0102  -0.0135 -0.0135 97  TYR A CA    
797  C C     . TYR A 97  ? 0.3826 0.6066 0.6392 0.0089  -0.0028 -0.0094 97  TYR A C     
798  O O     . TYR A 97  ? 0.3882 0.6059 0.6239 0.0083  -0.0012 -0.0051 97  TYR A O     
799  C CB    . TYR A 97  ? 0.3429 0.5726 0.5956 0.0095  -0.0169 -0.0118 97  TYR A CB    
800  C CG    . TYR A 97  ? 0.3383 0.5742 0.5990 0.0108  -0.0273 -0.0163 97  TYR A CG    
801  C CD1   . TYR A 97  ? 0.3213 0.5581 0.5694 0.0140  -0.0373 -0.0158 97  TYR A CD1   
802  C CD2   . TYR A 97  ? 0.3087 0.5485 0.5896 0.0090  -0.0270 -0.0217 97  TYR A CD2   
803  C CE1   . TYR A 97  ? 0.3452 0.5852 0.5972 0.0155  -0.0472 -0.0202 97  TYR A CE1   
804  C CE2   . TYR A 97  ? 0.3369 0.5817 0.6244 0.0101  -0.0376 -0.0267 97  TYR A CE2   
805  C CZ    . TYR A 97  ? 0.3419 0.5862 0.6134 0.0136  -0.0481 -0.0259 97  TYR A CZ    
806  O OH    . TYR A 97  ? 0.3036 0.5505 0.5780 0.0149  -0.0588 -0.0311 97  TYR A OH    
807  N N     . ASN A 98  ? 0.3975 0.6214 0.6692 0.0085  0.0040  -0.0112 98  ASN A N     
808  C CA    . ASN A 98  ? 0.4366 0.6510 0.6984 0.0070  0.0155  -0.0082 98  ASN A CA    
809  C C     . ASN A 98  ? 0.4445 0.6504 0.7082 0.0037  0.0280  -0.0080 98  ASN A C     
810  O O     . ASN A 98  ? 0.4626 0.6654 0.7421 0.0022  0.0385  -0.0102 98  ASN A O     
811  C CB    . ASN A 98  ? 0.4917 0.7086 0.7678 0.0083  0.0180  -0.0101 98  ASN A CB    
812  C CG    . ASN A 98  ? 0.5548 0.7609 0.8150 0.0071  0.0282  -0.0069 98  ASN A CG    
813  O OD1   . ASN A 98  ? 0.5124 0.7140 0.7491 0.0074  0.0255  -0.0033 98  ASN A OD1   
814  N ND2   . ASN A 98  ? 0.5743 0.7757 0.8482 0.0056  0.0402  -0.0086 98  ASN A ND2   
815  N N     . TYR A 99  ? 0.4315 0.6330 0.6796 0.0028  0.0271  -0.0052 99  TYR A N     
816  C CA    . TYR A 99  ? 0.4451 0.6368 0.6899 0.0005  0.0377  -0.0039 99  TYR A CA    
817  C C     . TYR A 99  ? 0.4658 0.6555 0.6921 0.0009  0.0317  -0.0003 99  TYR A C     
818  O O     . TYR A 99  ? 0.4450 0.6427 0.6681 0.0025  0.0201  -0.0004 99  TYR A O     
819  C CB    . TYR A 99  ? 0.4380 0.6339 0.7115 -0.0012 0.0428  -0.0091 99  TYR A CB    
820  C CG    . TYR A 99  ? 0.4502 0.6596 0.7406 -0.0003 0.0304  -0.0137 99  TYR A CG    
821  C CD1   . TYR A 99  ? 0.4273 0.6481 0.7396 0.0012  0.0228  -0.0188 99  TYR A CD1   
822  C CD2   . TYR A 99  ? 0.4535 0.6633 0.7376 -0.0008 0.0262  -0.0131 99  TYR A CD2   
823  C CE1   . TYR A 99  ? 0.3966 0.6277 0.7214 0.0023  0.0104  -0.0234 99  TYR A CE1   
824  C CE2   . TYR A 99  ? 0.3966 0.6167 0.6937 -0.0003 0.0153  -0.0178 99  TYR A CE2   
825  C CZ    . TYR A 99  ? 0.3851 0.6154 0.7014 0.0013  0.0070  -0.0231 99  TYR A CZ    
826  O OH    . TYR A 99  ? 0.3240 0.5628 0.6502 0.0022  -0.0047 -0.0281 99  TYR A OH    
827  N N     . GLU A 100 ? 0.4810 0.6590 0.6951 -0.0003 0.0401  0.0030  100 GLU A N     
828  C CA    . GLU A 100 ? 0.4839 0.6589 0.6823 0.0004  0.0354  0.0068  100 GLU A CA    
829  C C     . GLU A 100 ? 0.4617 0.6458 0.6770 0.0000  0.0306  0.0034  100 GLU A C     
830  O O     . GLU A 100 ? 0.4477 0.6310 0.6799 -0.0018 0.0378  0.0004  100 GLU A O     
831  C CB    . GLU A 100 ? 0.5247 0.6831 0.7061 -0.0001 0.0461  0.0113  100 GLU A CB    
832  C CG    . GLU A 100 ? 0.5780 0.7317 0.7419 0.0014  0.0412  0.0161  100 GLU A CG    
833  C CD    . GLU A 100 ? 0.6373 0.7729 0.7849 0.0016  0.0520  0.0206  100 GLU A CD    
834  O OE1   . GLU A 100 ? 0.6736 0.8056 0.8149 0.0027  0.0503  0.0238  100 GLU A OE1   
835  O OE2   . GLU A 100 ? 0.6503 0.7740 0.7908 0.0009  0.0626  0.0213  100 GLU A OE2   
836  N N     . ILE A 101 ? 0.4349 0.6265 0.6458 0.0014  0.0192  0.0035  101 ILE A N     
837  C CA    . ILE A 101 ? 0.4246 0.6240 0.6489 0.0010  0.0136  -0.0002 101 ILE A CA    
838  C C     . ILE A 101 ? 0.4318 0.6248 0.6551 -0.0002 0.0195  0.0014  101 ILE A C     
839  O O     . ILE A 101 ? 0.4389 0.6255 0.6453 0.0008  0.0194  0.0066  101 ILE A O     
840  C CB    . ILE A 101 ? 0.4265 0.6331 0.6439 0.0030  0.0013  -0.0005 101 ILE A CB    
841  C CG1   . ILE A 101 ? 0.4104 0.6238 0.6341 0.0044  -0.0044 -0.0034 101 ILE A CG1   
842  C CG2   . ILE A 101 ? 0.3825 0.5931 0.6076 0.0024  -0.0032 -0.0037 101 ILE A CG2   
843  C CD1   . ILE A 101 ? 0.3760 0.5929 0.5891 0.0067  -0.0141 -0.0028 101 ILE A CD1   
844  N N     . LYS A 102 ? 0.4472 0.6419 0.6904 -0.0023 0.0246  -0.0032 102 LYS A N     
845  C CA    . LYS A 102 ? 0.4634 0.6533 0.7100 -0.0036 0.0301  -0.0028 102 LYS A CA    
846  C C     . LYS A 102 ? 0.4403 0.6403 0.6986 -0.0041 0.0207  -0.0082 102 LYS A C     
847  O O     . LYS A 102 ? 0.4550 0.6632 0.7328 -0.0051 0.0172  -0.0150 102 LYS A O     
848  C CB    . LYS A 102 ? 0.4882 0.6719 0.7502 -0.0060 0.0437  -0.0050 102 LYS A CB    
849  C CG    . LYS A 102 ? 0.5758 0.7578 0.8513 -0.0081 0.0492  -0.0077 102 LYS A CG    
850  C CD    . LYS A 102 ? 0.6782 0.8448 0.9379 -0.0076 0.0601  -0.0009 102 LYS A CD    
851  C CE    . LYS A 102 ? 0.7111 0.8734 0.9900 -0.0104 0.0715  -0.0045 102 LYS A CE    
852  N NZ    . LYS A 102 ? 0.7447 0.8882 1.0103 -0.0099 0.0869  0.0018  102 LYS A NZ    
853  N N     . TYR A 103 ? 0.3984 0.5973 0.6447 -0.0031 0.0161  -0.0054 103 TYR A N     
854  C CA    . TYR A 103 ? 0.3527 0.5586 0.6052 -0.0034 0.0076  -0.0102 103 TYR A CA    
855  C C     . TYR A 103 ? 0.3654 0.5674 0.6243 -0.0053 0.0131  -0.0112 103 TYR A C     
856  O O     . TYR A 103 ? 0.3947 0.5878 0.6487 -0.0055 0.0224  -0.0064 103 TYR A O     
857  C CB    . TYR A 103 ? 0.3484 0.5558 0.5836 -0.0010 -0.0013 -0.0072 103 TYR A CB    
858  C CG    . TYR A 103 ? 0.2856 0.4865 0.5063 0.0001  0.0009  -0.0008 103 TYR A CG    
859  C CD1   . TYR A 103 ? 0.2515 0.4467 0.4584 0.0016  0.0034  0.0056  103 TYR A CD1   
860  C CD2   . TYR A 103 ? 0.3106 0.5106 0.5319 -0.0004 -0.0001 -0.0016 103 TYR A CD2   
861  C CE1   . TYR A 103 ? 0.3016 0.4914 0.4970 0.0031  0.0036  0.0111  103 TYR A CE1   
862  C CE2   . TYR A 103 ? 0.3233 0.5178 0.5342 0.0009  0.0015  0.0042  103 TYR A CE2   
863  C CZ    . TYR A 103 ? 0.3192 0.5091 0.5180 0.0028  0.0027  0.0105  103 TYR A CZ    
864  O OH    . TYR A 103 ? 0.3293 0.5144 0.5200 0.0046  0.0027  0.0158  103 TYR A OH    
865  N N     . ASP A 104 ? 0.3651 0.5725 0.6339 -0.0065 0.0074  -0.0175 104 ASP A N     
866  C CA    . ASP A 104 ? 0.3576 0.5616 0.6336 -0.0086 0.0121  -0.0196 104 ASP A CA    
867  C C     . ASP A 104 ? 0.3337 0.5391 0.6010 -0.0080 0.0042  -0.0210 104 ASP A C     
868  O O     . ASP A 104 ? 0.3307 0.5416 0.6015 -0.0081 -0.0047 -0.0273 104 ASP A O     
869  C CB    . ASP A 104 ? 0.3532 0.5610 0.6545 -0.0118 0.0154  -0.0280 104 ASP A CB    
870  C CG    . ASP A 104 ? 0.4027 0.6070 0.7131 -0.0145 0.0208  -0.0312 104 ASP A CG    
871  O OD1   . ASP A 104 ? 0.4357 0.6343 0.7331 -0.0136 0.0225  -0.0265 104 ASP A OD1   
872  O OD2   . ASP A 104 ? 0.4491 0.6565 0.7821 -0.0175 0.0235  -0.0388 104 ASP A OD2   
873  N N     . HIS A 105 ? 0.3176 0.5167 0.5734 -0.0070 0.0078  -0.0150 105 HIS A N     
874  C CA    . HIS A 105 ? 0.3196 0.5181 0.5657 -0.0061 0.0026  -0.0150 105 HIS A CA    
875  C C     . HIS A 105 ? 0.2942 0.4935 0.5496 -0.0086 0.0009  -0.0229 105 HIS A C     
876  O O     . HIS A 105 ? 0.2682 0.4672 0.5153 -0.0081 -0.0052 -0.0254 105 HIS A O     
877  C CB    . HIS A 105 ? 0.3488 0.5406 0.5847 -0.0043 0.0074  -0.0069 105 HIS A CB    
878  C CG    . HIS A 105 ? 0.4221 0.6081 0.6659 -0.0058 0.0161  -0.0064 105 HIS A CG    
879  N ND1   . HIS A 105 ? 0.4486 0.6326 0.6950 -0.0069 0.0168  -0.0090 105 HIS A ND1   
880  C CD2   . HIS A 105 ? 0.4579 0.6382 0.7070 -0.0063 0.0254  -0.0035 105 HIS A CD2   
881  C CE1   . HIS A 105 ? 0.4689 0.6472 0.7231 -0.0080 0.0259  -0.0077 105 HIS A CE1   
882  N NE2   . HIS A 105 ? 0.4818 0.6573 0.7373 -0.0076 0.0313  -0.0042 105 HIS A NE2   
883  N N     . THR A 106 ? 0.3094 0.5476 0.4823 0.0295  0.0185  0.0128  106 THR A N     
884  C CA    . THR A 106 ? 0.2880 0.5325 0.4765 0.0207  0.0132  0.0132  106 THR A CA    
885  C C     . THR A 106 ? 0.2712 0.5246 0.4721 0.0194  0.0060  0.0122  106 THR A C     
886  O O     . THR A 106 ? 0.2484 0.5046 0.4584 0.0121  -0.0011 0.0108  106 THR A O     
887  C CB    . THR A 106 ? 0.2942 0.5459 0.4984 0.0172  0.0203  0.0192  106 THR A CB    
888  O OG1   . THR A 106 ? 0.2912 0.5557 0.5102 0.0219  0.0265  0.0246  106 THR A OG1   
889  C CG2   . THR A 106 ? 0.3182 0.5605 0.5096 0.0191  0.0277  0.0208  106 THR A CG2   
890  N N     . LYS A 107 ? 0.2583 0.5153 0.4583 0.0269  0.0077  0.0128  107 LYS A N     
891  C CA    . LYS A 107 ? 0.2613 0.5260 0.4705 0.0276  0.0009  0.0118  107 LYS A CA    
892  C C     . LYS A 107 ? 0.2444 0.4980 0.4365 0.0291  -0.0063 0.0061  107 LYS A C     
893  O O     . LYS A 107 ? 0.2437 0.5010 0.4404 0.0288  -0.0131 0.0047  107 LYS A O     
894  C CB    . LYS A 107 ? 0.2785 0.5540 0.4973 0.0360  0.0072  0.0165  107 LYS A CB    
895  C CG    . LYS A 107 ? 0.3232 0.6113 0.5596 0.0364  0.0164  0.0237  107 LYS A CG    
896  C CD    . LYS A 107 ? 0.3946 0.6968 0.6554 0.0273  0.0117  0.0263  107 LYS A CD    
897  C CE    . LYS A 107 ? 0.4312 0.7447 0.7096 0.0263  0.0216  0.0341  107 LYS A CE    
898  N NZ    . LYS A 107 ? 0.4821 0.8024 0.7789 0.0143  0.0164  0.0352  107 LYS A NZ    
899  N N     . ILE A 108 ? 0.2456 0.4861 0.4187 0.0307  -0.0047 0.0033  108 ILE A N     
900  C CA    . ILE A 108 ? 0.2208 0.4506 0.3781 0.0316  -0.0105 -0.0013 108 ILE A CA    
901  C C     . ILE A 108 ? 0.2489 0.4743 0.4029 0.0243  -0.0173 -0.0043 108 ILE A C     
902  O O     . ILE A 108 ? 0.2733 0.4946 0.4228 0.0209  -0.0155 -0.0045 108 ILE A O     
903  C CB    . ILE A 108 ? 0.2218 0.4398 0.3604 0.0363  -0.0065 -0.0030 108 ILE A CB    
904  C CG1   . ILE A 108 ? 0.1575 0.3770 0.2955 0.0450  0.0011  -0.0003 108 ILE A CG1   
905  C CG2   . ILE A 108 ? 0.1813 0.3889 0.3060 0.0361  -0.0128 -0.0072 108 ILE A CG2   
906  C CD1   . ILE A 108 ? 0.1739 0.3799 0.2915 0.0499  0.0036  -0.0028 108 ILE A CD1   
907  N N     . ARG A 109 ? 0.2443 0.4696 0.3989 0.0228  -0.0247 -0.0063 109 ARG A N     
908  C CA    . ARG A 109 ? 0.2380 0.4586 0.3881 0.0171  -0.0310 -0.0089 109 ARG A CA    
909  C C     . ARG A 109 ? 0.2437 0.4531 0.3765 0.0174  -0.0315 -0.0113 109 ARG A C     
910  O O     . ARG A 109 ? 0.2417 0.4463 0.3667 0.0202  -0.0337 -0.0126 109 ARG A O     
911  C CB    . ARG A 109 ? 0.2539 0.4784 0.4100 0.0161  -0.0387 -0.0099 109 ARG A CB    
912  C CG    . ARG A 109 ? 0.2131 0.4349 0.3685 0.0101  -0.0447 -0.0119 109 ARG A CG    
913  C CD    . ARG A 109 ? 0.2461 0.4700 0.4041 0.0100  -0.0531 -0.0133 109 ARG A CD    
914  N NE    . ARG A 109 ? 0.2873 0.5240 0.4629 0.0104  -0.0549 -0.0113 109 ARG A NE    
915  C CZ    . ARG A 109 ? 0.2773 0.5214 0.4670 0.0050  -0.0570 -0.0104 109 ARG A CZ    
916  N NH1   . ARG A 109 ? 0.2174 0.4552 0.4040 -0.0008 -0.0573 -0.0116 109 ARG A NH1   
917  N NH2   . ARG A 109 ? 0.2797 0.5374 0.4869 0.0055  -0.0588 -0.0079 109 ARG A NH2   
918  N N     . VAL A 110 ? 0.2619 0.4674 0.3895 0.0144  -0.0297 -0.0115 110 VAL A N     
919  C CA    . VAL A 110 ? 0.2699 0.4674 0.3835 0.0141  -0.0304 -0.0131 110 VAL A CA    
920  C C     . VAL A 110 ? 0.2819 0.4765 0.3923 0.0103  -0.0351 -0.0142 110 VAL A C     
921  O O     . VAL A 110 ? 0.2948 0.4900 0.4090 0.0074  -0.0350 -0.0138 110 VAL A O     
922  C CB    . VAL A 110 ? 0.2714 0.4665 0.3791 0.0152  -0.0246 -0.0122 110 VAL A CB    
923  C CG1   . VAL A 110 ? 0.3029 0.4917 0.3979 0.0148  -0.0263 -0.0135 110 VAL A CG1   
924  C CG2   . VAL A 110 ? 0.3224 0.5188 0.4308 0.0201  -0.0196 -0.0111 110 VAL A CG2   
925  N N     . ALA A 111 ? 0.3001 0.4905 0.4027 0.0107  -0.0388 -0.0154 111 ALA A N     
926  C CA    . ALA A 111 ? 0.3048 0.4920 0.4029 0.0087  -0.0428 -0.0160 111 ALA A CA    
927  C C     . ALA A 111 ? 0.2863 0.4694 0.3744 0.0085  -0.0414 -0.0155 111 ALA A C     
928  O O     . ALA A 111 ? 0.3159 0.4974 0.3994 0.0094  -0.0409 -0.0153 111 ALA A O     
929  C CB    . ALA A 111 ? 0.2757 0.4621 0.3734 0.0098  -0.0480 -0.0167 111 ALA A CB    
930  N N     . ASN A 112 ? 0.2938 0.4751 0.3787 0.0072  -0.0411 -0.0151 112 ASN A N     
931  C CA    . ASN A 112 ? 0.3426 0.5219 0.4192 0.0075  -0.0398 -0.0139 112 ASN A CA    
932  C C     . ASN A 112 ? 0.3515 0.5273 0.4230 0.0077  -0.0427 -0.0138 112 ASN A C     
933  O O     . ASN A 112 ? 0.3726 0.5457 0.4446 0.0071  -0.0441 -0.0148 112 ASN A O     
934  C CB    . ASN A 112 ? 0.3415 0.5211 0.4172 0.0075  -0.0355 -0.0130 112 ASN A CB    
935  C CG    . ASN A 112 ? 0.4452 0.6255 0.5142 0.0086  -0.0338 -0.0113 112 ASN A CG    
936  O OD1   . ASN A 112 ? 0.5112 0.6909 0.5754 0.0091  -0.0348 -0.0101 112 ASN A OD1   
937  N ND2   . ASN A 112 ? 0.4786 0.6608 0.5473 0.0094  -0.0312 -0.0110 112 ASN A ND2   
938  N N     . PHE A 113 ? 0.3110 0.4860 0.3773 0.0086  -0.0438 -0.0125 113 PHE A N     
939  C CA    . PHE A 113 ? 0.3470 0.5181 0.4069 0.0101  -0.0457 -0.0119 113 PHE A CA    
940  C C     . PHE A 113 ? 0.3639 0.5359 0.4178 0.0114  -0.0438 -0.0086 113 PHE A C     
941  O O     . PHE A 113 ? 0.3517 0.5276 0.4077 0.0101  -0.0424 -0.0070 113 PHE A O     
942  C CB    . PHE A 113 ? 0.3715 0.5405 0.4324 0.0107  -0.0503 -0.0134 113 PHE A CB    
943  C CG    . PHE A 113 ? 0.3722 0.5410 0.4310 0.0116  -0.0511 -0.0117 113 PHE A CG    
944  C CD1   . PHE A 113 ? 0.3603 0.5313 0.4228 0.0104  -0.0497 -0.0113 113 PHE A CD1   
945  C CD2   . PHE A 113 ? 0.4010 0.5657 0.4531 0.0140  -0.0532 -0.0106 113 PHE A CD2   
946  C CE1   . PHE A 113 ? 0.3662 0.5349 0.4263 0.0107  -0.0506 -0.0097 113 PHE A CE1   
947  C CE2   . PHE A 113 ? 0.3971 0.5606 0.4471 0.0148  -0.0533 -0.0084 113 PHE A CE2   
948  C CZ    . PHE A 113 ? 0.3999 0.5651 0.4543 0.0127  -0.0521 -0.0080 113 PHE A CZ    
949  N N     . ASP A 114 ? 0.3798 0.5480 0.4263 0.0140  -0.0439 -0.0073 114 ASP A N     
950  C CA    . ASP A 114 ? 0.4242 0.5943 0.4658 0.0160  -0.0413 -0.0031 114 ASP A CA    
951  C C     . ASP A 114 ? 0.4042 0.5678 0.4366 0.0198  -0.0424 -0.0026 114 ASP A C     
952  O O     . ASP A 114 ? 0.4305 0.5877 0.4582 0.0212  -0.0444 -0.0055 114 ASP A O     
953  C CB    . ASP A 114 ? 0.4505 0.6240 0.4908 0.0171  -0.0373 -0.0012 114 ASP A CB    
954  C CG    . ASP A 114 ? 0.5386 0.7187 0.5785 0.0183  -0.0344 0.0041  114 ASP A CG    
955  O OD1   . ASP A 114 ? 0.5431 0.7297 0.5894 0.0151  -0.0345 0.0054  114 ASP A OD1   
956  O OD2   . ASP A 114 ? 0.6101 0.7889 0.6432 0.0226  -0.0319 0.0071  114 ASP A OD2   
957  N N     . ILE A 115 ? 0.3819 0.5463 0.4113 0.0215  -0.0414 0.0010  115 ILE A N     
958  C CA    . ILE A 115 ? 0.3708 0.5282 0.3895 0.0263  -0.0420 0.0020  115 ILE A CA    
959  C C     . ILE A 115 ? 0.3919 0.5514 0.4045 0.0306  -0.0366 0.0074  115 ILE A C     
960  O O     . ILE A 115 ? 0.3703 0.5386 0.3894 0.0288  -0.0331 0.0113  115 ILE A O     
961  C CB    . ILE A 115 ? 0.3368 0.4922 0.3550 0.0265  -0.0445 0.0028  115 ILE A CB    
962  C CG1   . ILE A 115 ? 0.3466 0.5078 0.3691 0.0250  -0.0409 0.0082  115 ILE A CG1   
963  C CG2   . ILE A 115 ? 0.3414 0.4967 0.3669 0.0232  -0.0491 -0.0017 115 ILE A CG2   
964  C CD1   . ILE A 115 ? 0.3337 0.4908 0.3527 0.0265  -0.0416 0.0106  115 ILE A CD1   
965  N N     . GLU A 116 ? 0.4022 0.5535 0.4019 0.0365  -0.0361 0.0078  116 GLU A N     
966  C CA    . GLU A 116 ? 0.4119 0.5648 0.4045 0.0422  -0.0302 0.0138  116 GLU A CA    
967  C C     . GLU A 116 ? 0.4166 0.5650 0.4010 0.0464  -0.0296 0.0170  116 GLU A C     
968  O O     . GLU A 116 ? 0.4293 0.5687 0.4069 0.0476  -0.0346 0.0130  116 GLU A O     
969  C CB    . GLU A 116 ? 0.4411 0.5864 0.4223 0.0475  -0.0285 0.0124  116 GLU A CB    
970  C CG    . GLU A 116 ? 0.4766 0.6249 0.4640 0.0443  -0.0282 0.0100  116 GLU A CG    
971  C CD    . GLU A 116 ? 0.5235 0.6861 0.5227 0.0418  -0.0242 0.0147  116 GLU A CD    
972  O OE1   . GLU A 116 ? 0.5805 0.7508 0.5817 0.0438  -0.0203 0.0209  116 GLU A OE1   
973  O OE2   . GLU A 116 ? 0.5996 0.7658 0.6062 0.0378  -0.0250 0.0123  116 GLU A OE2   
974  N N     . VAL A 117 ? 0.3656 0.5210 0.3515 0.0487  -0.0236 0.0245  117 VAL A N     
975  C CA    . VAL A 117 ? 0.3716 0.5234 0.3497 0.0534  -0.0212 0.0292  117 VAL A CA    
976  C C     . VAL A 117 ? 0.4016 0.5585 0.3753 0.0600  -0.0128 0.0375  117 VAL A C     
977  O O     . VAL A 117 ? 0.3886 0.5589 0.3750 0.0567  -0.0086 0.0433  117 VAL A O     
978  C CB    . VAL A 117 ? 0.3628 0.5194 0.3517 0.0474  -0.0223 0.0314  117 VAL A CB    
979  C CG1   . VAL A 117 ? 0.3321 0.4842 0.3124 0.0527  -0.0190 0.0371  117 VAL A CG1   
980  C CG2   . VAL A 117 ? 0.3139 0.4664 0.3073 0.0422  -0.0299 0.0240  117 VAL A CG2   
981  N N     . THR A 118 ? 0.4053 0.5518 0.3610 0.0694  -0.0105 0.0383  118 THR A N     
982  C CA    . THR A 118 ? 0.4431 0.5938 0.3930 0.0775  -0.0015 0.0468  118 THR A CA    
983  C C     . THR A 118 ? 0.4600 0.6174 0.4150 0.0776  0.0034  0.0553  118 THR A C     
984  O O     . THR A 118 ? 0.4744 0.6239 0.4239 0.0775  0.0005  0.0541  118 THR A O     
985  C CB    . THR A 118 ? 0.4656 0.6006 0.3916 0.0888  -0.0002 0.0450  118 THR A CB    
986  O OG1   . THR A 118 ? 0.4694 0.5984 0.3917 0.0883  -0.0037 0.0383  118 THR A OG1   
987  C CG2   . THR A 118 ? 0.4476 0.5871 0.3666 0.0988  0.0104  0.0549  118 THR A CG2   
988  N N     . SER A 119 ? 0.4859 0.6582 0.4518 0.0777  0.0109  0.0643  119 SER A N     
989  C CA    . SER A 119 ? 0.5115 0.6922 0.4859 0.0762  0.0163  0.0737  119 SER A CA    
990  C C     . SER A 119 ? 0.5451 0.7372 0.5210 0.0834  0.0269  0.0850  119 SER A C     
991  O O     . SER A 119 ? 0.5179 0.7266 0.5100 0.0794  0.0295  0.0895  119 SER A O     
992  C CB    . SER A 119 ? 0.4938 0.6854 0.4898 0.0632  0.0124  0.0734  119 SER A CB    
993  O OG    . SER A 119 ? 0.5286 0.7277 0.5336 0.0607  0.0175  0.0828  119 SER A OG    
994  N N     . PRO A 120 ? 0.5982 0.7821 0.5574 0.0943  0.0333  0.0902  120 PRO A N     
995  C CA    . PRO A 120 ? 0.6336 0.8277 0.5926 0.1030  0.0448  0.1021  120 PRO A CA    
996  C C     . PRO A 120 ? 0.6631 0.8756 0.6440 0.0962  0.0504  0.1134  120 PRO A C     
997  O O     . PRO A 120 ? 0.6711 0.8971 0.6578 0.1017  0.0601  0.1244  120 PRO A O     
998  C CB    . PRO A 120 ? 0.6584 0.8347 0.5910 0.1159  0.0485  0.1031  120 PRO A CB    
999  C CG    . PRO A 120 ? 0.6576 0.8211 0.5857 0.1104  0.0401  0.0960  120 PRO A CG    
1000 C CD    . PRO A 120 ? 0.6173 0.7817 0.5563 0.0996  0.0297  0.0854  120 PRO A CD    
1001 N N     . ASP A 121 ? 0.6900 0.9027 0.6829 0.0846  0.0445  0.1109  121 ASP A N     
1002 C CA    . ASP A 121 ? 0.7126 0.9392 0.7252 0.0769  0.0489  0.1211  121 ASP A CA    
1003 C C     . ASP A 121 ? 0.6821 0.9208 0.7182 0.0617  0.0420  0.1183  121 ASP A C     
1004 O O     . ASP A 121 ? 0.6791 0.9195 0.7270 0.0523  0.0404  0.1210  121 ASP A O     
1005 C CB    . ASP A 121 ? 0.7453 0.9594 0.7487 0.0783  0.0507  0.1240  121 ASP A CB    
1006 C CG    . ASP A 121 ? 0.8058 1.0032 0.8011 0.0735  0.0402  0.1122  121 ASP A CG    
1007 O OD1   . ASP A 121 ? 0.8410 1.0257 0.8245 0.0770  0.0409  0.1133  121 ASP A OD1   
1008 O OD2   . ASP A 121 ? 0.8113 1.0085 0.8119 0.0669  0.0316  0.1025  121 ASP A OD2   
1009 N N     . GLY A 122 ? 0.6562 0.9020 0.6977 0.0599  0.0381  0.1132  122 GLY A N     
1010 C CA    . GLY A 122 ? 0.6423 0.8987 0.7034 0.0469  0.0311  0.1100  122 GLY A CA    
1011 C C     . GLY A 122 ? 0.6228 0.8649 0.6791 0.0405  0.0211  0.0977  122 GLY A C     
1012 O O     . GLY A 122 ? 0.6340 0.8594 0.6731 0.0459  0.0189  0.0915  122 GLY A O     
1013 N N     . PHE A 123 ? 0.5946 0.8435 0.6660 0.0292  0.0147  0.0944  123 PHE A N     
1014 C CA    . PHE A 123 ? 0.5650 0.8024 0.6330 0.0238  0.0057  0.0830  123 PHE A CA    
1015 C C     . PHE A 123 ? 0.5201 0.7397 0.5759 0.0250  0.0034  0.0787  123 PHE A C     
1016 O O     . PHE A 123 ? 0.4886 0.7057 0.5471 0.0222  0.0055  0.0839  123 PHE A O     
1017 C CB    . PHE A 123 ? 0.5694 0.8152 0.6544 0.0116  0.0000  0.0816  123 PHE A CB    
1018 C CG    . PHE A 123 ? 0.6331 0.8706 0.7147 0.0081  -0.0080 0.0704  123 PHE A CG    
1019 C CD1   . PHE A 123 ? 0.6491 0.8904 0.7289 0.0109  -0.0097 0.0658  123 PHE A CD1   
1020 C CD2   . PHE A 123 ? 0.6454 0.8706 0.7250 0.0028  -0.0132 0.0649  123 PHE A CD2   
1021 C CE1   . PHE A 123 ? 0.6630 0.8969 0.7399 0.0081  -0.0160 0.0563  123 PHE A CE1   
1022 C CE2   . PHE A 123 ? 0.6478 0.8661 0.7244 0.0005  -0.0195 0.0553  123 PHE A CE2   
1023 C CZ    . PHE A 123 ? 0.6642 0.8871 0.7398 0.0030  -0.0208 0.0512  123 PHE A CZ    
1024 N N     . PRO A 124 ? 0.5000 0.7076 0.5431 0.0291  -0.0011 0.0696  124 PRO A N     
1025 C CA    . PRO A 124 ? 0.5018 0.6939 0.5339 0.0307  -0.0046 0.0648  124 PRO A CA    
1026 C C     . PRO A 124 ? 0.4903 0.6789 0.5307 0.0213  -0.0105 0.0605  124 PRO A C     
1027 O O     . PRO A 124 ? 0.5211 0.7076 0.5630 0.0182  -0.0163 0.0526  124 PRO A O     
1028 C CB    . PRO A 124 ? 0.4845 0.6683 0.5040 0.0367  -0.0082 0.0565  124 PRO A CB    
1029 C CG    . PRO A 124 ? 0.5011 0.6947 0.5284 0.0344  -0.0087 0.0545  124 PRO A CG    
1030 C CD    . PRO A 124 ? 0.4878 0.6963 0.5264 0.0328  -0.0028 0.0639  124 PRO A CD    
1031 N N     . GLU A 125 ? 0.4937 0.6808 0.5387 0.0173  -0.0087 0.0661  125 GLU A N     
1032 C CA    . GLU A 125 ? 0.4921 0.6737 0.5433 0.0088  -0.0138 0.0628  125 GLU A CA    
1033 C C     . GLU A 125 ? 0.4671 0.6349 0.5075 0.0121  -0.0189 0.0548  125 GLU A C     
1034 O O     . GLU A 125 ? 0.4512 0.6108 0.4798 0.0192  -0.0175 0.0556  125 GLU A O     
1035 C CB    . GLU A 125 ? 0.5396 0.7205 0.5967 0.0041  -0.0101 0.0712  125 GLU A CB    
1036 C CG    . GLU A 125 ? 0.6211 0.8177 0.6918 0.0002  -0.0048 0.0808  125 GLU A CG    
1037 C CD    . GLU A 125 ? 0.6793 0.8876 0.7641 -0.0082 -0.0093 0.0783  125 GLU A CD    
1038 O OE1   . GLU A 125 ? 0.6926 0.8948 0.7780 -0.0135 -0.0162 0.0702  125 GLU A OE1   
1039 O OE2   . GLU A 125 ? 0.7229 0.9471 0.8179 -0.0089 -0.0056 0.0847  125 GLU A OE2   
1040 N N     . PRO A 126 ? 0.4583 0.6240 0.5025 0.0074  -0.0249 0.0472  126 PRO A N     
1041 C CA    . PRO A 126 ? 0.4473 0.6024 0.4839 0.0103  -0.0296 0.0401  126 PRO A CA    
1042 C C     . PRO A 126 ? 0.4595 0.6034 0.4905 0.0115  -0.0294 0.0425  126 PRO A C     
1043 O O     . PRO A 126 ? 0.4461 0.5824 0.4675 0.0178  -0.0314 0.0397  126 PRO A O     
1044 C CB    . PRO A 126 ? 0.4215 0.5782 0.4656 0.0042  -0.0343 0.0339  126 PRO A CB    
1045 C CG    . PRO A 126 ? 0.4319 0.6007 0.4839 0.0010  -0.0327 0.0357  126 PRO A CG    
1046 C CD    . PRO A 126 ? 0.4490 0.6234 0.5043 0.0003  -0.0273 0.0449  126 PRO A CD    
1047 N N     . SER A 127 ? 0.4842 0.6267 0.5210 0.0055  -0.0273 0.0478  127 SER A N     
1048 C CA    . SER A 127 ? 0.5103 0.6405 0.5415 0.0063  -0.0267 0.0505  127 SER A CA    
1049 C C     . SER A 127 ? 0.5071 0.6334 0.5274 0.0148  -0.0222 0.0560  127 SER A C     
1050 O O     . SER A 127 ? 0.5256 0.6406 0.5371 0.0188  -0.0227 0.0565  127 SER A O     
1051 C CB    . SER A 127 ? 0.5366 0.6652 0.5767 -0.0032 -0.0255 0.0553  127 SER A CB    
1052 O OG    . SER A 127 ? 0.5974 0.7357 0.6443 -0.0055 -0.0198 0.0641  127 SER A OG    
1053 N N     . GLN A 128 ? 0.5055 0.6404 0.5249 0.0185  -0.0178 0.0602  128 GLN A N     
1054 C CA    . GLN A 128 ? 0.5372 0.6679 0.5438 0.0280  -0.0132 0.0652  128 GLN A CA    
1055 C C     . GLN A 128 ? 0.5328 0.6614 0.5279 0.0363  -0.0169 0.0585  128 GLN A C     
1056 O O     . GLN A 128 ? 0.5480 0.6673 0.5294 0.0442  -0.0179 0.0581  128 GLN A O     
1057 C CB    . GLN A 128 ? 0.5611 0.7011 0.5721 0.0283  -0.0049 0.0752  128 GLN A CB    
1058 C CG    . GLN A 128 ? 0.6364 0.7814 0.6621 0.0185  -0.0014 0.0826  128 GLN A CG    
1059 C CD    . GLN A 128 ? 0.7476 0.8791 0.7714 0.0147  -0.0032 0.0831  128 GLN A CD    
1060 O OE1   . GLN A 128 ? 0.7901 0.9194 0.8224 0.0060  -0.0078 0.0792  128 GLN A OE1   
1061 N NE2   . GLN A 128 ? 0.7347 0.8556 0.7458 0.0221  0.0006  0.0876  128 GLN A NE2   
1062 N N     . ALA A 129 ? 0.5065 0.6430 0.5068 0.0345  -0.0194 0.0534  129 ALA A N     
1063 C CA    . ALA A 129 ? 0.4885 0.6225 0.4794 0.0406  -0.0236 0.0465  129 ALA A CA    
1064 C C     . ALA A 129 ? 0.4886 0.6155 0.4626 0.0509  -0.0210 0.0496  129 ALA A C     
1065 O O     . ALA A 129 ? 0.4737 0.5918 0.4363 0.0564  -0.0260 0.0450  129 ALA A O     
1066 C CB    . ALA A 129 ? 0.4463 0.5752 0.4380 0.0390  -0.0313 0.0383  129 ALA A CB    
1067 N N     . LYS A 130 ? 0.4937 0.6246 0.4660 0.0538  -0.0132 0.0578  130 LYS A N     
1068 C CA    . LYS A 130 ? 0.5282 0.6514 0.4827 0.0645  -0.0093 0.0620  130 LYS A CA    
1069 C C     . LYS A 130 ? 0.5023 0.6246 0.4460 0.0714  -0.0093 0.0588  130 LYS A C     
1070 O O     . LYS A 130 ? 0.5247 0.6402 0.4518 0.0812  -0.0055 0.0624  130 LYS A O     
1071 C CB    . LYS A 130 ? 0.5430 0.6692 0.4995 0.0655  0.0005  0.0739  130 LYS A CB    
1072 C CG    . LYS A 130 ? 0.5785 0.7194 0.5488 0.0614  0.0071  0.0803  130 LYS A CG    
1073 C CD    . LYS A 130 ? 0.6795 0.8230 0.6493 0.0648  0.0174  0.0930  130 LYS A CD    
1074 C CE    . LYS A 130 ? 0.6975 0.8577 0.6810 0.0624  0.0246  0.1007  130 LYS A CE    
1075 N NZ    . LYS A 130 ? 0.7224 0.8847 0.7012 0.0696  0.0358  0.1133  130 LYS A NZ    
1076 N N     . HIS A 131 ? 0.4854 0.6130 0.4369 0.0666  -0.0136 0.0522  131 HIS A N     
1077 C CA    . HIS A 131 ? 0.4991 0.6254 0.4418 0.0719  -0.0136 0.0490  131 HIS A CA    
1078 C C     . HIS A 131 ? 0.4918 0.6123 0.4320 0.0701  -0.0231 0.0384  131 HIS A C     
1079 O O     . HIS A 131 ? 0.4982 0.6221 0.4506 0.0626  -0.0282 0.0339  131 HIS A O     
1080 C CB    . HIS A 131 ? 0.5035 0.6429 0.4587 0.0682  -0.0084 0.0526  131 HIS A CB    
1081 C CG    . HIS A 131 ? 0.5321 0.6791 0.4895 0.0713  0.0015  0.0639  131 HIS A CG    
1082 N ND1   . HIS A 131 ? 0.5310 0.6908 0.5071 0.0633  0.0051  0.0701  131 HIS A ND1   
1083 C CD2   . HIS A 131 ? 0.5519 0.6959 0.4958 0.0816  0.0088  0.0703  131 HIS A CD2   
1084 C CE1   . HIS A 131 ? 0.5661 0.7321 0.5421 0.0679  0.0142  0.0805  131 HIS A CE1   
1085 N NE2   . HIS A 131 ? 0.5646 0.7213 0.5208 0.0796  0.0172  0.0810  131 HIS A NE2   
1086 N N     . PRO A 132 ? 0.4893 0.6005 0.4134 0.0772  -0.0253 0.0345  132 PRO A N     
1087 C CA    . PRO A 132 ? 0.4756 0.5808 0.3973 0.0752  -0.0345 0.0247  132 PRO A CA    
1088 C C     . PRO A 132 ? 0.4442 0.5584 0.3821 0.0668  -0.0360 0.0209  132 PRO A C     
1089 O O     . PRO A 132 ? 0.4635 0.5842 0.4056 0.0665  -0.0303 0.0241  132 PRO A O     
1090 C CB    . PRO A 132 ? 0.4949 0.5879 0.3953 0.0844  -0.0348 0.0229  132 PRO A CB    
1091 C CG    . PRO A 132 ? 0.5200 0.6098 0.4079 0.0932  -0.0269 0.0313  132 PRO A CG    
1092 C CD    . PRO A 132 ? 0.5173 0.6219 0.4233 0.0878  -0.0192 0.0394  132 PRO A CD    
1093 N N     . ILE A 133 ? 0.4308 0.5459 0.3777 0.0609  -0.0432 0.0146  133 ILE A N     
1094 C CA    . ILE A 133 ? 0.4069 0.5276 0.3657 0.0543  -0.0453 0.0100  133 ILE A CA    
1095 C C     . ILE A 133 ? 0.4185 0.5302 0.3659 0.0575  -0.0485 0.0050  133 ILE A C     
1096 O O     . ILE A 133 ? 0.4281 0.5314 0.3681 0.0588  -0.0558 -0.0002 133 ILE A O     
1097 C CB    . ILE A 133 ? 0.3854 0.5100 0.3570 0.0478  -0.0513 0.0055  133 ILE A CB    
1098 C CG1   . ILE A 133 ? 0.3786 0.5093 0.3595 0.0448  -0.0482 0.0101  133 ILE A CG1   
1099 C CG2   . ILE A 133 ? 0.3059 0.4352 0.2880 0.0421  -0.0529 0.0011  133 ILE A CG2   
1100 C CD1   . ILE A 133 ? 0.3705 0.5032 0.3615 0.0403  -0.0533 0.0063  133 ILE A CD1   
1101 N N     . ASP A 134 ? 0.4083 0.5213 0.3540 0.0588  -0.0435 0.0067  134 ASP A N     
1102 C CA    . ASP A 134 ? 0.4172 0.5184 0.3484 0.0632  -0.0454 0.0028  134 ASP A CA    
1103 C C     . ASP A 134 ? 0.4123 0.5138 0.3512 0.0574  -0.0481 -0.0023 134 ASP A C     
1104 O O     . ASP A 134 ? 0.4578 0.5479 0.3851 0.0599  -0.0504 -0.0061 134 ASP A O     
1105 C CB    . ASP A 134 ? 0.4349 0.5319 0.3515 0.0722  -0.0377 0.0085  134 ASP A CB    
1106 C CG    . ASP A 134 ? 0.4093 0.5200 0.3376 0.0709  -0.0293 0.0150  134 ASP A CG    
1107 O OD1   . ASP A 134 ? 0.4635 0.5829 0.4067 0.0638  -0.0300 0.0134  134 ASP A OD1   
1108 O OD2   . ASP A 134 ? 0.4419 0.5553 0.3645 0.0773  -0.0219 0.0222  134 ASP A OD2   
1109 N N     . ALA A 135 ? 0.3647 0.4779 0.3219 0.0500  -0.0479 -0.0024 135 ALA A N     
1110 C CA    . ALA A 135 ? 0.3624 0.4766 0.3283 0.0443  -0.0504 -0.0069 135 ALA A CA    
1111 C C     . ALA A 135 ? 0.3560 0.4817 0.3401 0.0372  -0.0515 -0.0073 135 ALA A C     
1112 O O     . ALA A 135 ? 0.3623 0.4964 0.3530 0.0364  -0.0479 -0.0032 135 ALA A O     
1113 C CB    . ALA A 135 ? 0.3558 0.4702 0.3190 0.0462  -0.0443 -0.0046 135 ALA A CB    
1114 N N     . ILE A 136 ? 0.3759 0.5012 0.3677 0.0323  -0.0564 -0.0122 136 ILE A N     
1115 C CA    . ILE A 136 ? 0.3522 0.4875 0.3604 0.0264  -0.0567 -0.0128 136 ILE A CA    
1116 C C     . ILE A 136 ? 0.3707 0.5055 0.3850 0.0224  -0.0574 -0.0159 136 ILE A C     
1117 O O     . ILE A 136 ? 0.4237 0.5515 0.4354 0.0213  -0.0625 -0.0197 136 ILE A O     
1118 C CB    . ILE A 136 ? 0.3493 0.4862 0.3629 0.0251  -0.0625 -0.0149 136 ILE A CB    
1119 C CG1   . ILE A 136 ? 0.3454 0.4818 0.3531 0.0290  -0.0618 -0.0116 136 ILE A CG1   
1120 C CG2   . ILE A 136 ? 0.3193 0.4653 0.3486 0.0201  -0.0623 -0.0157 136 ILE A CG2   
1121 C CD1   . ILE A 136 ? 0.3866 0.5237 0.3980 0.0289  -0.0676 -0.0134 136 ILE A CD1   
1122 N N     . THR A 137 ? 0.3369 0.4784 0.3590 0.0201  -0.0526 -0.0142 137 THR A N     
1123 C CA    . THR A 137 ? 0.3200 0.4625 0.3504 0.0159  -0.0527 -0.0165 137 THR A CA    
1124 C C     . THR A 137 ? 0.3092 0.4612 0.3533 0.0124  -0.0525 -0.0165 137 THR A C     
1125 O O     . THR A 137 ? 0.3028 0.4609 0.3496 0.0128  -0.0492 -0.0141 137 THR A O     
1126 C CB    . THR A 137 ? 0.3002 0.4410 0.3273 0.0168  -0.0473 -0.0149 137 THR A CB    
1127 O OG1   . THR A 137 ? 0.3099 0.4404 0.3227 0.0211  -0.0469 -0.0148 137 THR A OG1   
1128 C CG2   . THR A 137 ? 0.3299 0.4700 0.3650 0.0124  -0.0472 -0.0169 137 THR A CG2   
1129 N N     . HIS A 138 ? 0.2869 0.4399 0.3394 0.0092  -0.0562 -0.0191 138 HIS A N     
1130 C CA    . HIS A 138 ? 0.2734 0.4349 0.3383 0.0072  -0.0561 -0.0191 138 HIS A CA    
1131 C C     . HIS A 138 ? 0.2878 0.4512 0.3617 0.0037  -0.0544 -0.0198 138 HIS A C     
1132 O O     . HIS A 138 ? 0.3178 0.4777 0.3941 0.0011  -0.0580 -0.0217 138 HIS A O     
1133 C CB    . HIS A 138 ? 0.2642 0.4266 0.3319 0.0076  -0.0623 -0.0207 138 HIS A CB    
1134 C CG    . HIS A 138 ? 0.2495 0.4200 0.3281 0.0072  -0.0621 -0.0203 138 HIS A CG    
1135 N ND1   . HIS A 138 ? 0.2220 0.3935 0.2986 0.0099  -0.0628 -0.0193 138 HIS A ND1   
1136 C CD2   . HIS A 138 ? 0.2736 0.4507 0.3646 0.0051  -0.0609 -0.0203 138 HIS A CD2   
1137 C CE1   . HIS A 138 ? 0.2786 0.4561 0.3649 0.0099  -0.0623 -0.0191 138 HIS A CE1   
1138 N NE2   . HIS A 138 ? 0.2638 0.4456 0.3593 0.0072  -0.0609 -0.0196 138 HIS A NE2   
1139 N N     . TYR A 139 ? 0.3042 0.4724 0.3824 0.0035  -0.0490 -0.0180 139 TYR A N     
1140 C CA    . TYR A 139 ? 0.3250 0.4957 0.4122 0.0009  -0.0460 -0.0177 139 TYR A CA    
1141 C C     . TYR A 139 ? 0.3163 0.4955 0.4157 0.0004  -0.0458 -0.0173 139 TYR A C     
1142 O O     . TYR A 139 ? 0.3077 0.4901 0.4062 0.0029  -0.0443 -0.0166 139 TYR A O     
1143 C CB    . TYR A 139 ? 0.3193 0.4891 0.4020 0.0021  -0.0396 -0.0156 139 TYR A CB    
1144 C CG    . TYR A 139 ? 0.3220 0.4948 0.4135 0.0003  -0.0353 -0.0144 139 TYR A CG    
1145 C CD1   . TYR A 139 ? 0.3318 0.5113 0.4293 0.0016  -0.0321 -0.0132 139 TYR A CD1   
1146 C CD2   . TYR A 139 ? 0.3004 0.4681 0.3935 -0.0024 -0.0342 -0.0142 139 TYR A CD2   
1147 C CE1   . TYR A 139 ? 0.3369 0.5192 0.4419 0.0009  -0.0271 -0.0114 139 TYR A CE1   
1148 C CE2   . TYR A 139 ? 0.3106 0.4811 0.4125 -0.0042 -0.0294 -0.0122 139 TYR A CE2   
1149 C CZ    . TYR A 139 ? 0.3222 0.5006 0.4301 -0.0022 -0.0255 -0.0105 139 TYR A CZ    
1150 O OH    . TYR A 139 ? 0.3207 0.5021 0.4366 -0.0029 -0.0198 -0.0078 139 TYR A OH    
1151 N N     . ASP A 140 ? 0.3188 0.5012 0.4293 -0.0027 -0.0472 -0.0175 140 ASP A N     
1152 C CA    . ASP A 140 ? 0.3059 0.4978 0.4297 -0.0026 -0.0466 -0.0165 140 ASP A CA    
1153 C C     . ASP A 140 ? 0.3201 0.5155 0.4520 -0.0039 -0.0399 -0.0139 140 ASP A C     
1154 O O     . ASP A 140 ? 0.3446 0.5383 0.4817 -0.0080 -0.0397 -0.0134 140 ASP A O     
1155 C CB    . ASP A 140 ? 0.3073 0.5027 0.4400 -0.0050 -0.0539 -0.0179 140 ASP A CB    
1156 C CG    . ASP A 140 ? 0.3216 0.5289 0.4703 -0.0044 -0.0532 -0.0160 140 ASP A CG    
1157 O OD1   . ASP A 140 ? 0.3282 0.5410 0.4882 -0.0067 -0.0488 -0.0136 140 ASP A OD1   
1158 O OD2   . ASP A 140 ? 0.2855 0.4966 0.4354 -0.0013 -0.0567 -0.0164 140 ASP A OD2   
1159 N N     . SER A 141 ? 0.3173 0.5163 0.4491 -0.0002 -0.0344 -0.0122 141 SER A N     
1160 C CA    . SER A 141 ? 0.3088 0.5103 0.4454 0.0002  -0.0268 -0.0093 141 SER A CA    
1161 C C     . SER A 141 ? 0.3109 0.5207 0.4650 -0.0026 -0.0254 -0.0068 141 SER A C     
1162 O O     . SER A 141 ? 0.2780 0.4886 0.4365 -0.0034 -0.0190 -0.0038 141 SER A O     
1163 C CB    . SER A 141 ? 0.2722 0.4745 0.4028 0.0056  -0.0222 -0.0085 141 SER A CB    
1164 O OG    . SER A 141 ? 0.2668 0.4753 0.4044 0.0083  -0.0231 -0.0083 141 SER A OG    
1165 N N     . ILE A 142 ? 0.3035 0.5197 0.4676 -0.0039 -0.0312 -0.0075 142 ILE A N     
1166 C CA    . ILE A 142 ? 0.3110 0.5381 0.4948 -0.0069 -0.0306 -0.0046 142 ILE A CA    
1167 C C     . ILE A 142 ? 0.3233 0.5481 0.5141 -0.0148 -0.0359 -0.0055 142 ILE A C     
1168 O O     . ILE A 142 ? 0.3480 0.5782 0.5529 -0.0191 -0.0329 -0.0022 142 ILE A O     
1169 C CB    . ILE A 142 ? 0.3131 0.5508 0.5064 -0.0035 -0.0339 -0.0042 142 ILE A CB    
1170 C CG1   . ILE A 142 ? 0.2788 0.5177 0.4665 0.0043  -0.0271 -0.0026 142 ILE A CG1   
1171 C CG2   . ILE A 142 ? 0.2663 0.5173 0.4823 -0.0075 -0.0353 -0.0010 142 ILE A CG2   
1172 C CD1   . ILE A 142 ? 0.2167 0.4646 0.4124 0.0091  -0.0288 -0.0016 142 ILE A CD1   
1173 N N     . ASP A 143 ? 0.3369 0.5531 0.5173 -0.0166 -0.0435 -0.0096 143 ASP A N     
1174 C CA    . ASP A 143 ? 0.3356 0.5447 0.5170 -0.0235 -0.0484 -0.0113 143 ASP A CA    
1175 C C     . ASP A 143 ? 0.2887 0.4854 0.4572 -0.0238 -0.0429 -0.0110 143 ASP A C     
1176 O O     . ASP A 143 ? 0.2579 0.4473 0.4274 -0.0293 -0.0442 -0.0114 143 ASP A O     
1177 C CB    . ASP A 143 ? 0.3496 0.5528 0.5229 -0.0243 -0.0590 -0.0160 143 ASP A CB    
1178 C CG    . ASP A 143 ? 0.3768 0.5913 0.5604 -0.0229 -0.0653 -0.0163 143 ASP A CG    
1179 O OD1   . ASP A 143 ? 0.4282 0.6564 0.6294 -0.0231 -0.0627 -0.0129 143 ASP A OD1   
1180 O OD2   . ASP A 143 ? 0.3635 0.5733 0.5372 -0.0209 -0.0725 -0.0196 143 ASP A OD2   
1181 N N     . ASP A 144 ? 0.2751 0.4692 0.4315 -0.0179 -0.0370 -0.0104 144 ASP A N     
1182 C CA    . ASP A 144 ? 0.2749 0.4584 0.4178 -0.0166 -0.0321 -0.0100 144 ASP A CA    
1183 C C     . ASP A 144 ? 0.2641 0.4355 0.3958 -0.0188 -0.0383 -0.0135 144 ASP A C     
1184 O O     . ASP A 144 ? 0.2683 0.4303 0.3967 -0.0220 -0.0373 -0.0133 144 ASP A O     
1185 C CB    . ASP A 144 ? 0.3173 0.5011 0.4679 -0.0190 -0.0244 -0.0059 144 ASP A CB    
1186 C CG    . ASP A 144 ? 0.3828 0.5563 0.5190 -0.0163 -0.0186 -0.0049 144 ASP A CG    
1187 O OD1   . ASP A 144 ? 0.3787 0.5493 0.5012 -0.0112 -0.0181 -0.0061 144 ASP A OD1   
1188 O OD2   . ASP A 144 ? 0.4009 0.5694 0.5404 -0.0196 -0.0143 -0.0023 144 ASP A OD2   
1189 N N     . ARG A 145 ? 0.2270 0.3978 0.3521 -0.0167 -0.0447 -0.0164 145 ARG A N     
1190 C CA    . ARG A 145 ? 0.2742 0.4332 0.3870 -0.0174 -0.0507 -0.0197 145 ARG A CA    
1191 C C     . ARG A 145 ? 0.2403 0.3965 0.3385 -0.0115 -0.0518 -0.0208 145 ARG A C     
1192 O O     . ARG A 145 ? 0.2459 0.4098 0.3465 -0.0088 -0.0524 -0.0205 145 ARG A O     
1193 C CB    . ARG A 145 ? 0.2690 0.4283 0.3898 -0.0224 -0.0599 -0.0224 145 ARG A CB    
1194 C CG    . ARG A 145 ? 0.3088 0.4700 0.4449 -0.0298 -0.0603 -0.0213 145 ARG A CG    
1195 C CD    . ARG A 145 ? 0.3255 0.4714 0.4526 -0.0327 -0.0582 -0.0217 145 ARG A CD    
1196 N NE    . ARG A 145 ? 0.3720 0.5178 0.5138 -0.0413 -0.0608 -0.0211 145 ARG A NE    
1197 C CZ    . ARG A 145 ? 0.4188 0.5685 0.5725 -0.0447 -0.0533 -0.0167 145 ARG A CZ    
1198 N NH1   . ARG A 145 ? 0.3778 0.5310 0.5288 -0.0394 -0.0431 -0.0129 145 ARG A NH1   
1199 N NH2   . ARG A 145 ? 0.4207 0.5705 0.5891 -0.0534 -0.0564 -0.0159 145 ARG A NH2   
1200 N N     . PHE A 146 ? 0.2038 0.3485 0.2870 -0.0095 -0.0515 -0.0217 146 PHE A N     
1201 C CA    . PHE A 146 ? 0.2253 0.3667 0.2948 -0.0042 -0.0526 -0.0222 146 PHE A CA    
1202 C C     . PHE A 146 ? 0.2270 0.3620 0.2906 -0.0044 -0.0609 -0.0256 146 PHE A C     
1203 O O     . PHE A 146 ? 0.2601 0.3832 0.3155 -0.0056 -0.0640 -0.0278 146 PHE A O     
1204 C CB    . PHE A 146 ? 0.2078 0.3408 0.2636 -0.0005 -0.0475 -0.0207 146 PHE A CB    
1205 C CG    . PHE A 146 ? 0.2115 0.3500 0.2708 0.0005  -0.0400 -0.0175 146 PHE A CG    
1206 C CD1   . PHE A 146 ? 0.2094 0.3458 0.2744 -0.0025 -0.0364 -0.0165 146 PHE A CD1   
1207 C CD2   . PHE A 146 ? 0.1969 0.3423 0.2534 0.0045  -0.0367 -0.0153 146 PHE A CD2   
1208 C CE1   . PHE A 146 ? 0.2462 0.3869 0.3125 -0.0006 -0.0295 -0.0134 146 PHE A CE1   
1209 C CE2   . PHE A 146 ? 0.2158 0.3658 0.2740 0.0058  -0.0309 -0.0127 146 PHE A CE2   
1210 C CZ    . PHE A 146 ? 0.2553 0.4028 0.3176 0.0038  -0.0271 -0.0118 146 PHE A CZ    
1211 N N     . TYR A 147 ? 0.2257 0.3673 0.2921 -0.0028 -0.0647 -0.0260 147 TYR A N     
1212 C CA    . TYR A 147 ? 0.2702 0.4059 0.3293 -0.0018 -0.0728 -0.0290 147 TYR A CA    
1213 C C     . TYR A 147 ? 0.3007 0.4296 0.3425 0.0046  -0.0711 -0.0281 147 TYR A C     
1214 O O     . TYR A 147 ? 0.3009 0.4361 0.3424 0.0078  -0.0670 -0.0253 147 TYR A O     
1215 C CB    . TYR A 147 ? 0.2321 0.3781 0.3027 -0.0026 -0.0777 -0.0294 147 TYR A CB    
1216 C CG    . TYR A 147 ? 0.2526 0.4070 0.3418 -0.0084 -0.0795 -0.0296 147 TYR A CG    
1217 C CD1   . TYR A 147 ? 0.2242 0.3889 0.3261 -0.0094 -0.0729 -0.0266 147 TYR A CD1   
1218 C CD2   . TYR A 147 ? 0.2445 0.3969 0.3388 -0.0128 -0.0880 -0.0325 147 TYR A CD2   
1219 C CE1   . TYR A 147 ? 0.2648 0.4383 0.3844 -0.0140 -0.0733 -0.0257 147 TYR A CE1   
1220 C CE2   . TYR A 147 ? 0.2803 0.4425 0.3941 -0.0186 -0.0895 -0.0318 147 TYR A CE2   
1221 C CZ    . TYR A 147 ? 0.2991 0.4723 0.4260 -0.0189 -0.0815 -0.0280 147 TYR A CZ    
1222 O OH    . TYR A 147 ? 0.2233 0.4073 0.3703 -0.0240 -0.0816 -0.0262 147 TYR A OH    
1223 N N     . VAL A 148 ? 0.3129 0.4283 0.3401 0.0065  -0.0742 -0.0303 148 VAL A N     
1224 C CA    . VAL A 148 ? 0.3380 0.4463 0.3479 0.0134  -0.0710 -0.0286 148 VAL A CA    
1225 C C     . VAL A 148 ? 0.3413 0.4426 0.3394 0.0172  -0.0777 -0.0308 148 VAL A C     
1226 O O     . VAL A 148 ? 0.3747 0.4659 0.3666 0.0159  -0.0849 -0.0349 148 VAL A O     
1227 C CB    . VAL A 148 ? 0.3351 0.4321 0.3336 0.0153  -0.0667 -0.0284 148 VAL A CB    
1228 C CG1   . VAL A 148 ? 0.3608 0.4534 0.3434 0.0234  -0.0619 -0.0253 148 VAL A CG1   
1229 C CG2   . VAL A 148 ? 0.3195 0.4235 0.3292 0.0120  -0.0604 -0.0261 148 VAL A CG2   
1230 N N     . PHE A 149 ? 0.3430 0.4494 0.3382 0.0217  -0.0755 -0.0278 149 PHE A N     
1231 C CA    . PHE A 149 ? 0.3560 0.4563 0.3388 0.0268  -0.0802 -0.0286 149 PHE A CA    
1232 C C     . PHE A 149 ? 0.3884 0.4808 0.3533 0.0344  -0.0746 -0.0254 149 PHE A C     
1233 O O     . PHE A 149 ? 0.3849 0.4850 0.3523 0.0366  -0.0671 -0.0203 149 PHE A O     
1234 C CB    . PHE A 149 ? 0.3401 0.4513 0.3325 0.0268  -0.0811 -0.0266 149 PHE A CB    
1235 C CG    . PHE A 149 ? 0.3708 0.4913 0.3810 0.0208  -0.0857 -0.0288 149 PHE A CG    
1236 C CD1   . PHE A 149 ? 0.3595 0.4900 0.3851 0.0163  -0.0808 -0.0273 149 PHE A CD1   
1237 C CD2   . PHE A 149 ? 0.3241 0.4439 0.3356 0.0203  -0.0948 -0.0320 149 PHE A CD2   
1238 C CE1   . PHE A 149 ? 0.3621 0.5017 0.4041 0.0119  -0.0839 -0.0285 149 PHE A CE1   
1239 C CE2   . PHE A 149 ? 0.3938 0.5242 0.4234 0.0154  -0.0985 -0.0331 149 PHE A CE2   
1240 C CZ    . PHE A 149 ? 0.3959 0.5362 0.4408 0.0114  -0.0925 -0.0311 149 PHE A CZ    
1241 N N     . ASP A 150 ? 0.4157 0.4929 0.3626 0.0386  -0.0783 -0.0283 150 ASP A N     
1242 C CA    . ASP A 150 ? 0.4450 0.5124 0.3733 0.0466  -0.0723 -0.0255 150 ASP A CA    
1243 C C     . ASP A 150 ? 0.4766 0.5333 0.3855 0.0544  -0.0757 -0.0259 150 ASP A C     
1244 O O     . ASP A 150 ? 0.5186 0.5632 0.4173 0.0545  -0.0846 -0.0315 150 ASP A O     
1245 C CB    . ASP A 150 ? 0.4475 0.5027 0.3683 0.0457  -0.0723 -0.0286 150 ASP A CB    
1246 C CG    . ASP A 150 ? 0.4854 0.5296 0.3859 0.0551  -0.0657 -0.0257 150 ASP A CG    
1247 O OD1   . ASP A 150 ? 0.5029 0.5522 0.3985 0.0617  -0.0597 -0.0203 150 ASP A OD1   
1248 O OD2   . ASP A 150 ? 0.4769 0.5067 0.3662 0.0560  -0.0663 -0.0286 150 ASP A OD2   
1249 N N     . LEU A 151 ? 0.4684 0.5295 0.3723 0.0608  -0.0687 -0.0198 151 LEU A N     
1250 C CA    . LEU A 151 ? 0.4845 0.5357 0.3690 0.0695  -0.0700 -0.0188 151 LEU A CA    
1251 C C     . LEU A 151 ? 0.5387 0.5737 0.3994 0.0784  -0.0666 -0.0186 151 LEU A C     
1252 O O     . LEU A 151 ? 0.5545 0.5927 0.4137 0.0824  -0.0570 -0.0133 151 LEU A O     
1253 C CB    . LEU A 151 ? 0.4492 0.5115 0.3388 0.0724  -0.0637 -0.0117 151 LEU A CB    
1254 C CG    . LEU A 151 ? 0.4506 0.5031 0.3207 0.0815  -0.0650 -0.0101 151 LEU A CG    
1255 C CD1   . LEU A 151 ? 0.4337 0.4786 0.2992 0.0800  -0.0773 -0.0170 151 LEU A CD1   
1256 C CD2   . LEU A 151 ? 0.3559 0.4187 0.2318 0.0838  -0.0578 -0.0021 151 LEU A CD2   
1257 N N     . LEU A 152 ? 0.5632 0.5805 0.4049 0.0820  -0.0748 -0.0244 152 LEU A N     
1258 C CA    . LEU A 152 ? 0.6020 0.5999 0.4178 0.0909  -0.0728 -0.0255 152 LEU A CA    
1259 C C     . LEU A 152 ? 0.6378 0.6300 0.4338 0.1033  -0.0675 -0.0203 152 LEU A C     
1260 O O     . LEU A 152 ? 0.6686 0.6546 0.4500 0.1124  -0.0587 -0.0160 152 LEU A O     
1261 C CB    . LEU A 152 ? 0.6229 0.6020 0.4264 0.0882  -0.0849 -0.0349 152 LEU A CB    
1262 C CG    . LEU A 152 ? 0.6272 0.6094 0.4486 0.0762  -0.0896 -0.0397 152 LEU A CG    
1263 C CD1   . LEU A 152 ? 0.6206 0.5823 0.4283 0.0734  -0.1019 -0.0486 152 LEU A CD1   
1264 C CD2   . LEU A 152 ? 0.5705 0.5568 0.3979 0.0760  -0.0791 -0.0356 152 LEU A CD2   
1265 N N     . ASN A 153 ? 0.6698 0.6650 0.4658 0.1041  -0.0721 -0.0201 153 ASN A N     
1266 C CA    . ASN A 153 ? 0.7019 0.6915 0.4791 0.1159  -0.0669 -0.0147 153 ASN A CA    
1267 C C     . ASN A 153 ? 0.6880 0.6962 0.4816 0.1149  -0.0596 -0.0063 153 ASN A C     
1268 O O     . ASN A 153 ? 0.6551 0.6732 0.4649 0.1078  -0.0647 -0.0075 153 ASN A O     
1269 C CB    . ASN A 153 ? 0.7252 0.6965 0.4796 0.1211  -0.0780 -0.0211 153 ASN A CB    
1270 C CG    . ASN A 153 ? 0.7626 0.7126 0.4979 0.1223  -0.0852 -0.0293 153 ASN A CG    
1271 O OD1   . ASN A 153 ? 0.7899 0.7307 0.5124 0.1283  -0.0779 -0.0276 153 ASN A OD1   
1272 N ND2   . ASN A 153 ? 0.7638 0.7060 0.4979 0.1165  -0.0996 -0.0380 153 ASN A ND2   
1273 N N     . SER A 154 ? 0.7093 0.7216 0.4985 0.1223  -0.0472 0.0026  154 SER A N     
1274 C CA    . SER A 154 ? 0.7129 0.7426 0.5183 0.1209  -0.0390 0.0115  154 SER A CA    
1275 C C     . SER A 154 ? 0.7306 0.7563 0.5189 0.1335  -0.0283 0.0205  154 SER A C     
1276 O O     . SER A 154 ? 0.7663 0.7812 0.5362 0.1425  -0.0240 0.0210  154 SER A O     
1277 C CB    . SER A 154 ? 0.6943 0.7417 0.5250 0.1119  -0.0339 0.0143  154 SER A CB    
1278 O OG    . SER A 154 ? 0.7114 0.7743 0.5562 0.1107  -0.0254 0.0234  154 SER A OG    
1279 N N     . PRO A 155 ? 0.7289 0.7628 0.5227 0.1348  -0.0233 0.0279  155 PRO A N     
1280 C CA    . PRO A 155 ? 0.7457 0.7795 0.5277 0.1460  -0.0112 0.0385  155 PRO A CA    
1281 C C     . PRO A 155 ? 0.7321 0.7759 0.5209 0.1482  -0.0001 0.0453  155 PRO A C     
1282 O O     . PRO A 155 ? 0.7492 0.7903 0.5240 0.1597  0.0099  0.0531  155 PRO A O     
1283 C CB    . PRO A 155 ? 0.7305 0.7766 0.5284 0.1414  -0.0081 0.0453  155 PRO A CB    
1284 C CG    . PRO A 155 ? 0.7066 0.7609 0.5263 0.1276  -0.0175 0.0384  155 PRO A CG    
1285 C CD    . PRO A 155 ? 0.7060 0.7479 0.5154 0.1267  -0.0288 0.0270  155 PRO A CD    
1286 N N     . TYR A 156 ? 0.7093 0.7650 0.5190 0.1380  -0.0018 0.0426  156 TYR A N     
1287 C CA    . TYR A 156 ? 0.7167 0.7831 0.5342 0.1397  0.0074  0.0484  156 TYR A CA    
1288 C C     . TYR A 156 ? 0.7032 0.7565 0.5063 0.1437  0.0048  0.0418  156 TYR A C     
1289 O O     . TYR A 156 ? 0.6891 0.7506 0.4999 0.1438  0.0104  0.0447  156 TYR A O     
1290 C CB    . TYR A 156 ? 0.7114 0.8000 0.5604 0.1271  0.0087  0.0514  156 TYR A CB    
1291 C CG    . TYR A 156 ? 0.7700 0.8699 0.6324 0.1230  0.0119  0.0586  156 TYR A CG    
1292 C CD1   . TYR A 156 ? 0.8279 0.9315 0.6851 0.1314  0.0225  0.0696  156 TYR A CD1   
1293 C CD2   . TYR A 156 ? 0.7803 0.8864 0.6601 0.1113  0.0049  0.0547  156 TYR A CD2   
1294 C CE1   . TYR A 156 ? 0.8391 0.9516 0.7084 0.1271  0.0257  0.0766  156 TYR A CE1   
1295 C CE2   . TYR A 156 ? 0.7883 0.9021 0.6788 0.1076  0.0079  0.0612  156 TYR A CE2   
1296 C CZ    . TYR A 156 ? 0.8038 0.9205 0.6893 0.1151  0.0181  0.0721  156 TYR A CZ    
1297 O OH    . TYR A 156 ? 0.8181 0.9413 0.7143 0.1109  0.0212  0.0789  156 TYR A OH    
1298 N N     . GLY A 157 ? 0.7261 0.7582 0.5077 0.1472  -0.0040 0.0330  157 GLY A N     
1299 C CA    . GLY A 157 ? 0.7349 0.7497 0.4978 0.1524  -0.0063 0.0268  157 GLY A CA    
1300 C C     . GLY A 157 ? 0.7145 0.7155 0.4735 0.1449  -0.0204 0.0144  157 GLY A C     
1301 O O     . GLY A 157 ? 0.6984 0.7100 0.4789 0.1325  -0.0271 0.0106  157 GLY A O     
1302 N N     . ASN A 158 ? 0.7209 0.6981 0.4522 0.1527  -0.0248 0.0084  158 ASN A N     
1303 C CA    . ASN A 158 ? 0.7094 0.6722 0.4363 0.1455  -0.0383 -0.0033 158 ASN A CA    
1304 C C     . ASN A 158 ? 0.7028 0.6594 0.4296 0.1433  -0.0371 -0.0064 158 ASN A C     
1305 O O     . ASN A 158 ? 0.7299 0.6772 0.4395 0.1540  -0.0289 -0.0029 158 ASN A O     
1306 C CB    . ASN A 158 ? 0.7416 0.6801 0.4378 0.1538  -0.0463 -0.0092 158 ASN A CB    
1307 C CG    . ASN A 158 ? 0.7594 0.7027 0.4531 0.1577  -0.0466 -0.0052 158 ASN A CG    
1308 O OD1   . ASN A 158 ? 0.7073 0.6705 0.4254 0.1499  -0.0457 -0.0016 158 ASN A OD1   
1309 N ND2   . ASN A 158 ? 0.7661 0.6897 0.4285 0.1705  -0.0476 -0.0060 158 ASN A ND2   
1310 N N     . VAL A 159 ? 0.6587 0.6211 0.4050 0.1300  -0.0445 -0.0122 159 VAL A N     
1311 C CA    . VAL A 159 ? 0.6583 0.6178 0.4091 0.1264  -0.0427 -0.0142 159 VAL A CA    
1312 C C     . VAL A 159 ? 0.6723 0.6157 0.4196 0.1180  -0.0552 -0.0249 159 VAL A C     
1313 O O     . VAL A 159 ? 0.6685 0.6102 0.4190 0.1119  -0.0660 -0.0304 159 VAL A O     
1314 C CB    . VAL A 159 ? 0.6120 0.5974 0.3940 0.1177  -0.0367 -0.0089 159 VAL A CB    
1315 C CG1   . VAL A 159 ? 0.5873 0.5889 0.3741 0.1251  -0.0241 0.0020  159 VAL A CG1   
1316 C CG2   . VAL A 159 ? 0.5923 0.5916 0.3980 0.1049  -0.0446 -0.0121 159 VAL A CG2   
1317 N N     . GLU A 160 ? 0.6866 0.6187 0.4281 0.1177  -0.0537 -0.0272 160 GLU A N     
1318 C CA    . GLU A 160 ? 0.6998 0.6169 0.4402 0.1085  -0.0646 -0.0364 160 GLU A CA    
1319 C C     . GLU A 160 ? 0.6518 0.5891 0.4251 0.0942  -0.0667 -0.0367 160 GLU A C     
1320 O O     . GLU A 160 ? 0.6207 0.5801 0.4136 0.0926  -0.0587 -0.0301 160 GLU A O     
1321 C CB    . GLU A 160 ? 0.7420 0.6364 0.4612 0.1146  -0.0613 -0.0384 160 GLU A CB    
1322 C CG    . GLU A 160 ? 0.8437 0.7146 0.5268 0.1300  -0.0593 -0.0387 160 GLU A CG    
1323 C CD    . GLU A 160 ? 0.9273 0.7816 0.5936 0.1298  -0.0723 -0.0464 160 GLU A CD    
1324 O OE1   . GLU A 160 ? 0.9812 0.8235 0.6485 0.1198  -0.0848 -0.0551 160 GLU A OE1   
1325 O OE2   . GLU A 160 ? 0.9448 0.7986 0.5972 0.1398  -0.0703 -0.0434 160 GLU A OE2   
1326 N N     . GLU A 161 ? 0.6592 0.5889 0.4382 0.0838  -0.0776 -0.0443 161 GLU A N     
1327 C CA    . GLU A 161 ? 0.6352 0.5818 0.4438 0.0707  -0.0794 -0.0447 161 GLU A CA    
1328 C C     . GLU A 161 ? 0.6090 0.5627 0.4269 0.0704  -0.0689 -0.0398 161 GLU A C     
1329 O O     . GLU A 161 ? 0.6196 0.5586 0.4195 0.0779  -0.0633 -0.0387 161 GLU A O     
1330 C CB    . GLU A 161 ? 0.6588 0.5925 0.4690 0.0606  -0.0920 -0.0531 161 GLU A CB    
1331 C CG    . GLU A 161 ? 0.6848 0.6162 0.4919 0.0587  -0.1043 -0.0581 161 GLU A CG    
1332 C CD    . GLU A 161 ? 0.7334 0.6610 0.5524 0.0460  -0.1168 -0.0650 161 GLU A CD    
1333 O OE1   . GLU A 161 ? 0.7494 0.6873 0.5903 0.0365  -0.1147 -0.0639 161 GLU A OE1   
1334 O OE2   . GLU A 161 ? 0.7965 0.7112 0.6033 0.0454  -0.1288 -0.0711 161 GLU A OE2   
1335 N N     . TRP A 162 ? 0.5754 0.5513 0.4202 0.0624  -0.0664 -0.0368 162 TRP A N     
1336 C CA    . TRP A 162 ? 0.5371 0.5214 0.3932 0.0607  -0.0579 -0.0327 162 TRP A CA    
1337 C C     . TRP A 162 ? 0.5546 0.5248 0.4111 0.0534  -0.0619 -0.0375 162 TRP A C     
1338 O O     . TRP A 162 ? 0.5289 0.4953 0.3923 0.0446  -0.0716 -0.0430 162 TRP A O     
1339 C CB    . TRP A 162 ? 0.4955 0.5061 0.3782 0.0547  -0.0552 -0.0287 162 TRP A CB    
1340 C CG    . TRP A 162 ? 0.5035 0.5238 0.4008 0.0506  -0.0490 -0.0258 162 TRP A CG    
1341 C CD1   . TRP A 162 ? 0.4903 0.5190 0.3880 0.0563  -0.0395 -0.0196 162 TRP A CD1   
1342 C CD2   . TRP A 162 ? 0.4910 0.5151 0.4050 0.0404  -0.0519 -0.0282 162 TRP A CD2   
1343 N NE1   . TRP A 162 ? 0.4556 0.4916 0.3675 0.0506  -0.0367 -0.0186 162 TRP A NE1   
1344 C CE2   . TRP A 162 ? 0.4751 0.5081 0.3969 0.0410  -0.0436 -0.0236 162 TRP A CE2   
1345 C CE3   . TRP A 162 ? 0.4965 0.5180 0.4202 0.0310  -0.0606 -0.0334 162 TRP A CE3   
1346 C CZ2   . TRP A 162 ? 0.4499 0.4879 0.3870 0.0332  -0.0430 -0.0239 162 TRP A CZ2   
1347 C CZ3   . TRP A 162 ? 0.5074 0.5352 0.4483 0.0228  -0.0596 -0.0332 162 TRP A CZ3   
1348 C CH2   . TRP A 162 ? 0.4602 0.4955 0.4068 0.0243  -0.0505 -0.0285 162 TRP A CH2   
1349 N N     . SER A 163 ? 0.5663 0.5295 0.4160 0.0573  -0.0543 -0.0349 163 SER A N     
1350 C CA    . SER A 163 ? 0.6017 0.5478 0.4480 0.0519  -0.0565 -0.0386 163 SER A CA    
1351 C C     . SER A 163 ? 0.5998 0.5604 0.4679 0.0449  -0.0514 -0.0353 163 SER A C     
1352 O O     . SER A 163 ? 0.5755 0.5449 0.4453 0.0505  -0.0419 -0.0295 163 SER A O     
1353 C CB    . SER A 163 ? 0.6292 0.5514 0.4474 0.0624  -0.0519 -0.0386 163 SER A CB    
1354 O OG    . SER A 163 ? 0.7095 0.6159 0.5251 0.0578  -0.0517 -0.0407 163 SER A OG    
1355 N N     . ILE A 164 ? 0.6012 0.5644 0.4859 0.0330  -0.0578 -0.0387 164 ILE A N     
1356 C CA    . ILE A 164 ? 0.5873 0.5628 0.4922 0.0262  -0.0532 -0.0357 164 ILE A CA    
1357 C C     . ILE A 164 ? 0.5937 0.5531 0.4876 0.0288  -0.0468 -0.0342 164 ILE A C     
1358 O O     . ILE A 164 ? 0.5741 0.5437 0.4780 0.0287  -0.0393 -0.0296 164 ILE A O     
1359 C CB    . ILE A 164 ? 0.5943 0.5766 0.5200 0.0133  -0.0611 -0.0391 164 ILE A CB    
1360 C CG1   . ILE A 164 ? 0.5259 0.5255 0.4737 0.0080  -0.0549 -0.0348 164 ILE A CG1   
1361 C CG2   . ILE A 164 ? 0.5881 0.5472 0.5050 0.0070  -0.0695 -0.0450 164 ILE A CG2   
1362 C CD1   . ILE A 164 ? 0.4973 0.5120 0.4685 -0.0018 -0.0606 -0.0360 164 ILE A CD1   
1363 N N     . GLU A 165 ? 0.6123 0.5455 0.4840 0.0317  -0.0499 -0.0381 165 GLU A N     
1364 C CA    . GLU A 165 ? 0.6502 0.5645 0.5083 0.0351  -0.0440 -0.0368 165 GLU A CA    
1365 C C     . GLU A 165 ? 0.6425 0.5629 0.4908 0.0483  -0.0330 -0.0304 165 GLU A C     
1366 O O     . GLU A 165 ? 0.6576 0.5792 0.5082 0.0503  -0.0252 -0.0261 165 GLU A O     
1367 C CB    . GLU A 165 ? 0.7101 0.5920 0.5444 0.0354  -0.0506 -0.0431 165 GLU A CB    
1368 C CG    . GLU A 165 ? 0.7720 0.6458 0.6168 0.0210  -0.0619 -0.0492 165 GLU A CG    
1369 C CD    . GLU A 165 ? 0.8302 0.7125 0.6805 0.0173  -0.0727 -0.0537 165 GLU A CD    
1370 O OE1   . GLU A 165 ? 0.8419 0.7285 0.6809 0.0268  -0.0721 -0.0531 165 GLU A OE1   
1371 O OE2   . GLU A 165 ? 0.8533 0.7384 0.7196 0.0050  -0.0818 -0.0573 165 GLU A OE2   
1372 N N     . ILE A 166 ? 0.6072 0.5325 0.4456 0.0573  -0.0323 -0.0293 166 ILE A N     
1373 C CA    . ILE A 166 ? 0.5675 0.5009 0.3980 0.0701  -0.0223 -0.0226 166 ILE A CA    
1374 C C     . ILE A 166 ? 0.5251 0.4888 0.3792 0.0680  -0.0173 -0.0168 166 ILE A C     
1375 O O     . ILE A 166 ? 0.4977 0.4689 0.3519 0.0746  -0.0091 -0.0110 166 ILE A O     
1376 C CB    . ILE A 166 ? 0.5821 0.5107 0.3944 0.0805  -0.0226 -0.0225 166 ILE A CB    
1377 C CG1   . ILE A 166 ? 0.6164 0.5114 0.3991 0.0864  -0.0251 -0.0272 166 ILE A CG1   
1378 C CG2   . ILE A 166 ? 0.5418 0.4882 0.3547 0.0917  -0.0126 -0.0142 166 ILE A CG2   
1379 C CD1   . ILE A 166 ? 0.6782 0.5638 0.4412 0.0947  -0.0282 -0.0292 166 ILE A CD1   
1380 N N     . ALA A 167 ? 0.5218 0.5020 0.3953 0.0592  -0.0228 -0.0184 167 ALA A N     
1381 C CA    . ALA A 167 ? 0.4968 0.5034 0.3918 0.0563  -0.0194 -0.0140 167 ALA A CA    
1382 C C     . ALA A 167 ? 0.5166 0.5259 0.4206 0.0530  -0.0147 -0.0118 167 ALA A C     
1383 O O     . ALA A 167 ? 0.5352 0.5614 0.4482 0.0555  -0.0092 -0.0068 167 ALA A O     
1384 C CB    . ALA A 167 ? 0.4642 0.4832 0.3758 0.0474  -0.0265 -0.0170 167 ALA A CB    
1385 N N     . ALA A 168 ? 0.5333 0.5253 0.4345 0.0471  -0.0171 -0.0153 168 ALA A N     
1386 C CA    . ALA A 168 ? 0.5234 0.5148 0.4319 0.0437  -0.0124 -0.0130 168 ALA A CA    
1387 C C     . ALA A 168 ? 0.5307 0.5113 0.4232 0.0536  -0.0042 -0.0089 168 ALA A C     
1388 O O     . ALA A 168 ? 0.4983 0.4824 0.3962 0.0534  0.0013  -0.0054 168 ALA A O     
1389 C CB    . ALA A 168 ? 0.5353 0.5128 0.4487 0.0328  -0.0178 -0.0176 168 ALA A CB    
1390 N N     . LYS A 169 ? 0.5566 0.5240 0.4286 0.0631  -0.0030 -0.0090 169 LYS A N     
1391 C CA    . LYS A 169 ? 0.5884 0.5448 0.4433 0.0744  0.0051  -0.0047 169 LYS A CA    
1392 C C     . LYS A 169 ? 0.5505 0.5307 0.4132 0.0819  0.0120  0.0025  169 LYS A C     
1393 O O     . LYS A 169 ? 0.5206 0.5225 0.3959 0.0810  0.0104  0.0039  169 LYS A O     
1394 C CB    . LYS A 169 ? 0.6100 0.5458 0.4398 0.0838  0.0048  -0.0065 169 LYS A CB    
1395 C CG    . LYS A 169 ? 0.6870 0.5940 0.5037 0.0779  -0.0022 -0.0138 169 LYS A CG    
1396 C CD    . LYS A 169 ? 0.8060 0.6874 0.5923 0.0900  0.0001  -0.0147 169 LYS A CD    
1397 C CE    . LYS A 169 ? 0.8627 0.7120 0.6340 0.0837  -0.0075 -0.0223 169 LYS A CE    
1398 N NZ    . LYS A 169 ? 0.9207 0.7409 0.6654 0.0933  -0.0019 -0.0217 169 LYS A NZ    
1399 N N     . LEU A 170 ? 0.5353 0.5107 0.3903 0.0891  0.0193  0.0069  170 LEU A N     
1400 C CA    . LEU A 170 ? 0.5211 0.5181 0.3818 0.0973  0.0253  0.0140  170 LEU A CA    
1401 C C     . LEU A 170 ? 0.5239 0.5306 0.3791 0.1064  0.0266  0.0169  170 LEU A C     
1402 O O     . LEU A 170 ? 0.5505 0.5402 0.3890 0.1112  0.0258  0.0146  170 LEU A O     
1403 C CB    . LEU A 170 ? 0.5452 0.5313 0.3937 0.1058  0.0329  0.0183  170 LEU A CB    
1404 C CG    . LEU A 170 ? 0.5404 0.5158 0.3919 0.0994  0.0343  0.0176  170 LEU A CG    
1405 C CD1   . LEU A 170 ? 0.5349 0.4965 0.3694 0.1107  0.0423  0.0223  170 LEU A CD1   
1406 C CD2   . LEU A 170 ? 0.4843 0.4832 0.3577 0.0923  0.0334  0.0191  170 LEU A CD2   
1407 N N     . GLN A 171 ? 0.5336 0.5672 0.4027 0.1087  0.0284  0.0220  171 GLN A N     
1408 C CA    . GLN A 171 ? 0.5668 0.6128 0.4337 0.1171  0.0306  0.0264  171 GLN A CA    
1409 C C     . GLN A 171 ? 0.6165 0.6500 0.4627 0.1318  0.0378  0.0307  171 GLN A C     
1410 O O     . GLN A 171 ? 0.6478 0.6732 0.4808 0.1389  0.0391  0.0311  171 GLN A O     
1411 C CB    . GLN A 171 ? 0.5547 0.6319 0.4416 0.1158  0.0309  0.0315  171 GLN A CB    
1412 C CG    . GLN A 171 ? 0.5960 0.6852 0.5012 0.1030  0.0240  0.0275  171 GLN A CG    
1413 C CD    . GLN A 171 ? 0.6320 0.7448 0.5502 0.1029  0.0231  0.0314  171 GLN A CD    
1414 O OE1   . GLN A 171 ? 0.7253 0.8379 0.6375 0.1078  0.0242  0.0332  171 GLN A OE1   
1415 N NE2   . GLN A 171 ? 0.5926 0.7249 0.5279 0.0972  0.0210  0.0328  171 GLN A NE2   
1416 N N     . GLU A 172 ? 0.6590 0.6896 0.5011 0.1371  0.0429  0.0341  172 GLU A N     
1417 C CA    . GLU A 172 ? 0.7019 0.7188 0.5233 0.1519  0.0504  0.0385  172 GLU A CA    
1418 C C     . GLU A 172 ? 0.7186 0.7000 0.5153 0.1544  0.0500  0.0330  172 GLU A C     
1419 O O     . GLU A 172 ? 0.7479 0.7122 0.5237 0.1669  0.0561  0.0357  172 GLU A O     
1420 C CB    . GLU A 172 ? 0.7254 0.7453 0.5481 0.1557  0.0551  0.0427  172 GLU A CB    
1421 C CG    . GLU A 172 ? 0.7390 0.7925 0.5838 0.1540  0.0548  0.0480  172 GLU A CG    
1422 C CD    . GLU A 172 ? 0.7294 0.7918 0.5927 0.1390  0.0484  0.0434  172 GLU A CD    
1423 O OE1   . GLU A 172 ? 0.7635 0.8497 0.6425 0.1372  0.0475  0.0467  172 GLU A OE1   
1424 O OE2   . GLU A 172 ? 0.7307 0.7767 0.5929 0.1293  0.0441  0.0366  172 GLU A OE2   
1425 N N     . GLN A 173 ? 0.6766 0.6473 0.4758 0.1425  0.0422  0.0253  173 GLN A N     
1426 C CA    . GLN A 173 ? 0.6951 0.6327 0.4731 0.1417  0.0390  0.0186  173 GLN A CA    
1427 C C     . GLN A 173 ? 0.6551 0.5932 0.4315 0.1394  0.0331  0.0146  173 GLN A C     
1428 O O     . GLN A 173 ? 0.6377 0.5511 0.3996 0.1362  0.0276  0.0078  173 GLN A O     
1429 C CB    . GLN A 173 ? 0.7369 0.6606 0.5206 0.1285  0.0343  0.0131  173 GLN A CB    
1430 C CG    . GLN A 173 ? 0.8612 0.7507 0.6268 0.1242  0.0290  0.0054  173 GLN A CG    
1431 C CD    . GLN A 173 ? 0.9473 0.8290 0.7249 0.1090  0.0241  0.0010  173 GLN A CD    
1432 O OE1   . GLN A 173 ? 0.9295 0.8325 0.7296 0.1015  0.0243  0.0031  173 GLN A OE1   
1433 N NE2   . GLN A 173 ? 1.0067 0.8575 0.7692 0.1045  0.0196  -0.0051 173 GLN A NE2   
1434 N N     . GLY A 174 ? 0.6047 0.5703 0.3954 0.1411  0.0342  0.0192  174 GLY A N     
1435 C CA    . GLY A 174 ? 0.6041 0.5725 0.3937 0.1404  0.0300  0.0171  174 GLY A CA    
1436 C C     . GLY A 174 ? 0.5907 0.5670 0.3982 0.1250  0.0207  0.0112  174 GLY A C     
1437 O O     . GLY A 174 ? 0.6134 0.5921 0.4206 0.1237  0.0166  0.0092  174 GLY A O     
1438 N N     . GLY A 175 ? 0.5603 0.5402 0.3827 0.1143  0.0178  0.0089  175 GLY A N     
1439 C CA    . GLY A 175 ? 0.5221 0.5107 0.3629 0.1002  0.0099  0.0040  175 GLY A CA    
1440 C C     . GLY A 175 ? 0.5019 0.5213 0.3660 0.0965  0.0106  0.0082  175 GLY A C     
1441 O O     . GLY A 175 ? 0.5133 0.5485 0.3802 0.1040  0.0165  0.0149  175 GLY A O     
1442 N N     . ASP A 176 ? 0.4839 0.5118 0.3648 0.0847  0.0043  0.0045  176 ASP A N     
1443 C CA    . ASP A 176 ? 0.4775 0.5318 0.3787 0.0805  0.0038  0.0074  176 ASP A CA    
1444 C C     . ASP A 176 ? 0.4684 0.5335 0.3851 0.0742  0.0046  0.0081  176 ASP A C     
1445 O O     . ASP A 176 ? 0.4593 0.5447 0.3916 0.0708  0.0040  0.0103  176 ASP A O     
1446 C CB    . ASP A 176 ? 0.4730 0.5307 0.3812 0.0737  -0.0032 0.0034  176 ASP A CB    
1447 C CG    . ASP A 176 ? 0.4759 0.5224 0.3674 0.0806  -0.0041 0.0027  176 ASP A CG    
1448 O OD1   . ASP A 176 ? 0.4783 0.5292 0.3619 0.0906  0.0018  0.0082  176 ASP A OD1   
1449 O OD2   . ASP A 176 ? 0.4970 0.5307 0.3833 0.0762  -0.0108 -0.0032 176 ASP A OD2   
1450 N N     . GLU A 177 ? 0.4925 0.5427 0.4037 0.0728  0.0060  0.0065  177 GLU A N     
1451 C CA    . GLU A 177 ? 0.5084 0.5657 0.4312 0.0680  0.0078  0.0076  177 GLU A CA    
1452 C C     . GLU A 177 ? 0.4598 0.5308 0.4015 0.0578  0.0028  0.0050  177 GLU A C     
1453 O O     . GLU A 177 ? 0.4428 0.5291 0.3960 0.0562  0.0043  0.0074  177 GLU A O     
1454 C CB    . GLU A 177 ? 0.5452 0.6157 0.4682 0.0762  0.0141  0.0141  177 GLU A CB    
1455 C CG    . GLU A 177 ? 0.6574 0.7216 0.5784 0.0771  0.0186  0.0159  177 GLU A CG    
1456 C CD    . GLU A 177 ? 0.7574 0.8300 0.6729 0.0880  0.0248  0.0225  177 GLU A CD    
1457 O OE1   . GLU A 177 ? 0.7763 0.8561 0.6970 0.0882  0.0273  0.0250  177 GLU A OE1   
1458 O OE2   . GLU A 177 ? 0.7892 0.8615 0.6948 0.0969  0.0273  0.0254  177 GLU A OE2   
1459 N N     . VAL A 178 ? 0.4416 0.5067 0.3854 0.0516  -0.0034 0.0001  178 VAL A N     
1460 C CA    . VAL A 178 ? 0.4217 0.4963 0.3824 0.0421  -0.0080 -0.0027 178 VAL A CA    
1461 C C     . VAL A 178 ? 0.4071 0.4780 0.3742 0.0373  -0.0055 -0.0025 178 VAL A C     
1462 O O     . VAL A 178 ? 0.4180 0.4716 0.3777 0.0360  -0.0051 -0.0041 178 VAL A O     
1463 C CB    . VAL A 178 ? 0.4073 0.4744 0.3679 0.0370  -0.0154 -0.0078 178 VAL A CB    
1464 C CG1   . VAL A 178 ? 0.3669 0.4440 0.3456 0.0278  -0.0197 -0.0102 178 VAL A CG1   
1465 C CG2   . VAL A 178 ? 0.3691 0.4403 0.3232 0.0423  -0.0169 -0.0072 178 VAL A CG2   
1466 N N     . PRO A 179 ? 0.4020 0.4881 0.3819 0.0351  -0.0036 -0.0005 179 PRO A N     
1467 C CA    . PRO A 179 ? 0.3932 0.4772 0.3782 0.0323  0.0003  0.0009  179 PRO A CA    
1468 C C     . PRO A 179 ? 0.4032 0.4745 0.3921 0.0245  -0.0021 -0.0022 179 PRO A C     
1469 O O     . PRO A 179 ? 0.4174 0.4909 0.4143 0.0185  -0.0082 -0.0058 179 PRO A O     
1470 C CB    . PRO A 179 ? 0.3680 0.4704 0.3666 0.0301  0.0002  0.0019  179 PRO A CB    
1471 C CG    . PRO A 179 ? 0.3646 0.4782 0.3608 0.0349  -0.0010 0.0033  179 PRO A CG    
1472 C CD    . PRO A 179 ? 0.3854 0.4905 0.3740 0.0358  -0.0047 0.0010  179 PRO A CD    
1473 N N     . SER A 180 ? 0.4191 0.4774 0.4028 0.0245  0.0024  -0.0006 180 SER A N     
1474 C CA    . SER A 180 ? 0.4404 0.4849 0.4277 0.0165  0.0002  -0.0030 180 SER A CA    
1475 C C     . SER A 180 ? 0.4264 0.4826 0.4339 0.0077  -0.0022 -0.0038 180 SER A C     
1476 O O     . SER A 180 ? 0.4721 0.5234 0.4865 0.0001  -0.0079 -0.0070 180 SER A O     
1477 C CB    . SER A 180 ? 0.4551 0.4832 0.4331 0.0183  0.0067  -0.0001 180 SER A CB    
1478 O OG    . SER A 180 ? 0.4866 0.5242 0.4670 0.0227  0.0140  0.0049  180 SER A OG    
1479 N N     . GLU A 181 ? 0.3874 0.4593 0.4039 0.0092  0.0018  -0.0008 181 GLU A N     
1480 C CA    . GLU A 181 ? 0.3806 0.4640 0.4153 0.0028  0.0012  -0.0006 181 GLU A CA    
1481 C C     . GLU A 181 ? 0.3632 0.4568 0.4079 -0.0013 -0.0066 -0.0043 181 GLU A C     
1482 O O     . GLU A 181 ? 0.3821 0.4858 0.4423 -0.0060 -0.0072 -0.0040 181 GLU A O     
1483 C CB    . GLU A 181 ? 0.3547 0.4495 0.3927 0.0070  0.0080  0.0036  181 GLU A CB    
1484 C CG    . GLU A 181 ? 0.4253 0.5332 0.4605 0.0127  0.0067  0.0034  181 GLU A CG    
1485 C CD    . GLU A 181 ? 0.4547 0.5596 0.4746 0.0209  0.0093  0.0053  181 GLU A CD    
1486 O OE1   . GLU A 181 ? 0.4432 0.5344 0.4524 0.0233  0.0115  0.0061  181 GLU A OE1   
1487 O OE2   . GLU A 181 ? 0.4267 0.5432 0.4458 0.0251  0.0088  0.0061  181 GLU A OE2   
1488 N N     . ILE A 182 ? 0.3496 0.4405 0.3853 0.0013  -0.0119 -0.0073 182 ILE A N     
1489 C CA    . ILE A 182 ? 0.3334 0.4322 0.3762 -0.0016 -0.0193 -0.0107 182 ILE A CA    
1490 C C     . ILE A 182 ? 0.3575 0.4433 0.3924 -0.0037 -0.0264 -0.0148 182 ILE A C     
1491 O O     . ILE A 182 ? 0.3596 0.4498 0.3995 -0.0063 -0.0332 -0.0178 182 ILE A O     
1492 C CB    . ILE A 182 ? 0.2976 0.4085 0.3381 0.0038  -0.0197 -0.0102 182 ILE A CB    
1493 C CG1   . ILE A 182 ? 0.3151 0.4193 0.3393 0.0105  -0.0191 -0.0098 182 ILE A CG1   
1494 C CG2   . ILE A 182 ? 0.2290 0.3521 0.2760 0.0058  -0.0144 -0.0071 182 ILE A CG2   
1495 C CD1   . ILE A 182 ? 0.2927 0.4063 0.3158 0.0135  -0.0219 -0.0102 182 ILE A CD1   
1496 N N     . ILE A 183 ? 0.4016 0.4703 0.4227 -0.0019 -0.0249 -0.0151 183 ILE A N     
1497 C CA    . ILE A 183 ? 0.4190 0.4715 0.4288 -0.0032 -0.0317 -0.0195 183 ILE A CA    
1498 C C     . ILE A 183 ? 0.4368 0.4894 0.4601 -0.0129 -0.0395 -0.0228 183 ILE A C     
1499 O O     . ILE A 183 ? 0.4809 0.5316 0.5015 -0.0140 -0.0477 -0.0268 183 ILE A O     
1500 C CB    . ILE A 183 ? 0.4266 0.4582 0.4186 0.0004  -0.0278 -0.0189 183 ILE A CB    
1501 C CG1   . ILE A 183 ? 0.4289 0.4601 0.4047 0.0116  -0.0231 -0.0167 183 ILE A CG1   
1502 C CG2   . ILE A 183 ? 0.4618 0.4729 0.4444 -0.0039 -0.0353 -0.0240 183 ILE A CG2   
1503 C CD1   . ILE A 183 ? 0.4255 0.4556 0.3911 0.0160  -0.0284 -0.0194 183 ILE A CD1   
1504 N N     . ASP A 184 ? 0.4561 0.5125 0.4946 -0.0197 -0.0370 -0.0207 184 ASP A N     
1505 C CA    . ASP A 184 ? 0.4674 0.5270 0.5224 -0.0295 -0.0440 -0.0228 184 ASP A CA    
1506 C C     . ASP A 184 ? 0.4350 0.5151 0.5054 -0.0303 -0.0478 -0.0231 184 ASP A C     
1507 O O     . ASP A 184 ? 0.4389 0.5240 0.5230 -0.0373 -0.0547 -0.0249 184 ASP A O     
1508 C CB    . ASP A 184 ? 0.4993 0.5574 0.5673 -0.0364 -0.0389 -0.0193 184 ASP A CB    
1509 C CG    . ASP A 184 ? 0.5683 0.6022 0.6226 -0.0384 -0.0381 -0.0201 184 ASP A CG    
1510 O OD1   . ASP A 184 ? 0.6046 0.6218 0.6415 -0.0367 -0.0441 -0.0246 184 ASP A OD1   
1511 O OD2   . ASP A 184 ? 0.5858 0.6161 0.6457 -0.0414 -0.0310 -0.0159 184 ASP A OD2   
1512 N N     . LYS A 185 ? 0.4262 0.5175 0.4940 -0.0233 -0.0437 -0.0213 185 LYS A N     
1513 C CA    . LYS A 185 ? 0.3798 0.4889 0.4606 -0.0233 -0.0463 -0.0212 185 LYS A CA    
1514 C C     . LYS A 185 ? 0.3764 0.4858 0.4480 -0.0192 -0.0527 -0.0244 185 LYS A C     
1515 O O     . LYS A 185 ? 0.3494 0.4712 0.4300 -0.0190 -0.0557 -0.0247 185 LYS A O     
1516 C CB    . LYS A 185 ? 0.3660 0.4877 0.4528 -0.0195 -0.0378 -0.0170 185 LYS A CB    
1517 C CG    . LYS A 185 ? 0.4220 0.5469 0.5216 -0.0236 -0.0316 -0.0133 185 LYS A CG    
1518 C CD    . LYS A 185 ? 0.4258 0.5589 0.5251 -0.0181 -0.0229 -0.0094 185 LYS A CD    
1519 C CE    . LYS A 185 ? 0.4177 0.5514 0.5262 -0.0208 -0.0156 -0.0052 185 LYS A CE    
1520 N NZ    . LYS A 185 ? 0.4166 0.5594 0.5252 -0.0151 -0.0082 -0.0018 185 LYS A NZ    
1521 N N     . ILE A 186 ? 0.3686 0.4636 0.4214 -0.0154 -0.0544 -0.0265 186 ILE A N     
1522 C CA    . ILE A 186 ? 0.3513 0.4442 0.3927 -0.0107 -0.0596 -0.0289 186 ILE A CA    
1523 C C     . ILE A 186 ? 0.3580 0.4460 0.4012 -0.0153 -0.0704 -0.0335 186 ILE A C     
1524 O O     . ILE A 186 ? 0.3612 0.4363 0.4013 -0.0200 -0.0746 -0.0362 186 ILE A O     
1525 C CB    . ILE A 186 ? 0.3227 0.4024 0.3425 -0.0033 -0.0561 -0.0286 186 ILE A CB    
1526 C CG1   . ILE A 186 ? 0.3164 0.4047 0.3358 0.0018  -0.0469 -0.0239 186 ILE A CG1   
1527 C CG2   . ILE A 186 ? 0.3420 0.4174 0.3488 0.0017  -0.0612 -0.0308 186 ILE A CG2   
1528 C CD1   . ILE A 186 ? 0.3312 0.4076 0.3332 0.0083  -0.0415 -0.0221 186 ILE A CD1   
1529 N N     . ILE A 187 ? 0.3634 0.4614 0.4114 -0.0141 -0.0752 -0.0344 187 ILE A N     
1530 C CA    . ILE A 187 ? 0.3790 0.4727 0.4256 -0.0165 -0.0862 -0.0387 187 ILE A CA    
1531 C C     . ILE A 187 ? 0.3979 0.4854 0.4257 -0.0085 -0.0883 -0.0399 187 ILE A C     
1532 O O     . ILE A 187 ? 0.3752 0.4732 0.4049 -0.0042 -0.0859 -0.0377 187 ILE A O     
1533 C CB    . ILE A 187 ? 0.3723 0.4830 0.4406 -0.0212 -0.0908 -0.0384 187 ILE A CB    
1534 C CG1   . ILE A 187 ? 0.3751 0.4908 0.4620 -0.0296 -0.0894 -0.0370 187 ILE A CG1   
1535 C CG2   . ILE A 187 ? 0.3382 0.4462 0.4028 -0.0215 -0.1027 -0.0426 187 ILE A CG2   
1536 C CD1   . ILE A 187 ? 0.3854 0.5212 0.4955 -0.0323 -0.0890 -0.0342 187 ILE A CD1   
1537 N N     . TYR A 188 ? 0.4237 0.4927 0.4324 -0.0063 -0.0924 -0.0433 188 TYR A N     
1538 C CA    . TYR A 188 ? 0.4416 0.5023 0.4294 0.0027  -0.0918 -0.0434 188 TYR A CA    
1539 C C     . TYR A 188 ? 0.4670 0.5240 0.4484 0.0038  -0.1023 -0.0473 188 TYR A C     
1540 O O     . TYR A 188 ? 0.4801 0.5275 0.4596 -0.0009 -0.1118 -0.0521 188 TYR A O     
1541 C CB    . TYR A 188 ? 0.4392 0.4808 0.4065 0.0071  -0.0879 -0.0439 188 TYR A CB    
1542 C CG    . TYR A 188 ? 0.4651 0.4961 0.4090 0.0172  -0.0872 -0.0439 188 TYR A CG    
1543 C CD1   . TYR A 188 ? 0.4284 0.4681 0.3692 0.0245  -0.0785 -0.0386 188 TYR A CD1   
1544 C CD2   . TYR A 188 ? 0.4864 0.4986 0.4112 0.0195  -0.0953 -0.0489 188 TYR A CD2   
1545 C CE1   . TYR A 188 ? 0.4399 0.4710 0.3605 0.0340  -0.0768 -0.0374 188 TYR A CE1   
1546 C CE2   . TYR A 188 ? 0.5128 0.5147 0.4148 0.0300  -0.0937 -0.0483 188 TYR A CE2   
1547 C CZ    . TYR A 188 ? 0.4761 0.4884 0.3769 0.0373  -0.0839 -0.0421 188 TYR A CZ    
1548 O OH    . TYR A 188 ? 0.5183 0.5216 0.3979 0.0478  -0.0813 -0.0405 188 TYR A OH    
1549 N N     . MET A 189 ? 0.4651 0.5294 0.4430 0.0099  -0.1010 -0.0451 189 MET A N     
1550 C CA    . MET A 189 ? 0.4722 0.5335 0.4426 0.0126  -0.1103 -0.0480 189 MET A CA    
1551 C C     . MET A 189 ? 0.5014 0.5544 0.4500 0.0230  -0.1065 -0.0461 189 MET A C     
1552 O O     . MET A 189 ? 0.4775 0.5411 0.4294 0.0270  -0.0996 -0.0412 189 MET A O     
1553 C CB    . MET A 189 ? 0.4481 0.5280 0.4381 0.0099  -0.1128 -0.0465 189 MET A CB    
1554 C CG    . MET A 189 ? 0.4877 0.5777 0.5004 0.0004  -0.1172 -0.0479 189 MET A CG    
1555 S SD    . MET A 189 ? 0.5734 0.6866 0.6091 -0.0004 -0.1137 -0.0437 189 MET A SD    
1556 C CE    . MET A 189 ? 0.5304 0.6478 0.5679 0.0012  -0.0995 -0.0388 189 MET A CE    
1557 N N     . PRO A 190 ? 0.5323 0.5655 0.4579 0.0275  -0.1107 -0.0496 190 PRO A N     
1558 C CA    . PRO A 190 ? 0.5615 0.5854 0.4643 0.0385  -0.1076 -0.0478 190 PRO A CA    
1559 C C     . PRO A 190 ? 0.5642 0.5897 0.4628 0.0416  -0.1154 -0.0491 190 PRO A C     
1560 O O     . PRO A 190 ? 0.5594 0.5865 0.4659 0.0359  -0.1261 -0.0536 190 PRO A O     
1561 C CB    . PRO A 190 ? 0.5839 0.5842 0.4635 0.0416  -0.1104 -0.0520 190 PRO A CB    
1562 C CG    . PRO A 190 ? 0.6056 0.6014 0.4942 0.0316  -0.1215 -0.0583 190 PRO A CG    
1563 C CD    . PRO A 190 ? 0.5699 0.5873 0.4892 0.0225  -0.1186 -0.0556 190 PRO A CD    
1564 N N     . PHE A 191 ? 0.5730 0.5990 0.4600 0.0506  -0.1097 -0.0446 191 PHE A N     
1565 C CA    . PHE A 191 ? 0.5674 0.5935 0.4471 0.0555  -0.1154 -0.0447 191 PHE A CA    
1566 C C     . PHE A 191 ? 0.5875 0.6001 0.4403 0.0676  -0.1107 -0.0421 191 PHE A C     
1567 O O     . PHE A 191 ? 0.5857 0.5991 0.4343 0.0722  -0.0994 -0.0367 191 PHE A O     
1568 C CB    . PHE A 191 ? 0.5412 0.5870 0.4408 0.0534  -0.1116 -0.0399 191 PHE A CB    
1569 C CG    . PHE A 191 ? 0.5167 0.5766 0.4421 0.0433  -0.1156 -0.0418 191 PHE A CG    
1570 C CD1   . PHE A 191 ? 0.4703 0.5403 0.4126 0.0375  -0.1081 -0.0395 191 PHE A CD1   
1571 C CD2   . PHE A 191 ? 0.4967 0.5606 0.4295 0.0403  -0.1265 -0.0455 191 PHE A CD2   
1572 C CE1   . PHE A 191 ? 0.4442 0.5270 0.4093 0.0292  -0.1108 -0.0406 191 PHE A CE1   
1573 C CE2   . PHE A 191 ? 0.4801 0.5584 0.4376 0.0317  -0.1293 -0.0463 191 PHE A CE2   
1574 C CZ    . PHE A 191 ? 0.4791 0.5664 0.4524 0.0264  -0.1209 -0.0438 191 PHE A CZ    
1575 N N     . ASP A 192 ? 0.6198 0.6209 0.4549 0.0731  -0.1192 -0.0454 192 ASP A N     
1576 C CA    . ASP A 192 ? 0.6623 0.6483 0.4688 0.0857  -0.1154 -0.0432 192 ASP A CA    
1577 C C     . ASP A 192 ? 0.6455 0.6405 0.4515 0.0924  -0.1090 -0.0360 192 ASP A C     
1578 O O     . ASP A 192 ? 0.6714 0.6566 0.4559 0.1034  -0.1032 -0.0321 192 ASP A O     
1579 C CB    . ASP A 192 ? 0.7218 0.6867 0.5044 0.0894  -0.1281 -0.0510 192 ASP A CB    
1580 C CG    . ASP A 192 ? 0.8081 0.7564 0.5806 0.0867  -0.1311 -0.0567 192 ASP A CG    
1581 O OD1   . ASP A 192 ? 0.8378 0.7936 0.6274 0.0792  -0.1259 -0.0557 192 ASP A OD1   
1582 O OD2   . ASP A 192 ? 0.9067 0.8327 0.6525 0.0923  -0.1388 -0.0622 192 ASP A OD2   
1583 N N     . ASN A 193 ? 0.6083 0.6209 0.4371 0.0863  -0.1095 -0.0339 193 ASN A N     
1584 C CA    . ASN A 193 ? 0.6173 0.6387 0.4486 0.0910  -0.1023 -0.0265 193 ASN A CA    
1585 C C     . ASN A 193 ? 0.5933 0.6347 0.4534 0.0823  -0.0986 -0.0233 193 ASN A C     
1586 O O     . ASN A 193 ? 0.5690 0.6181 0.4468 0.0735  -0.1045 -0.0276 193 ASN A O     
1587 C CB    . ASN A 193 ? 0.6438 0.6573 0.4590 0.0984  -0.1096 -0.0274 193 ASN A CB    
1588 C CG    . ASN A 193 ? 0.6797 0.6993 0.5077 0.0921  -0.1227 -0.0332 193 ASN A CG    
1589 O OD1   . ASN A 193 ? 0.6693 0.7039 0.5177 0.0873  -0.1218 -0.0308 193 ASN A OD1   
1590 N ND2   . ASN A 193 ? 0.7242 0.7319 0.5400 0.0923  -0.1350 -0.0408 193 ASN A ND2   
1591 N N     . GLU A 194 ? 0.5692 0.6180 0.4332 0.0849  -0.0887 -0.0156 194 GLU A N     
1592 C CA    . GLU A 194 ? 0.5413 0.6065 0.4294 0.0775  -0.0844 -0.0124 194 GLU A CA    
1593 C C     . GLU A 194 ? 0.5238 0.5952 0.4240 0.0733  -0.0931 -0.0158 194 GLU A C     
1594 O O     . GLU A 194 ? 0.5113 0.5933 0.4313 0.0653  -0.0944 -0.0177 194 GLU A O     
1595 C CB    . GLU A 194 ? 0.5206 0.5902 0.4083 0.0812  -0.0737 -0.0036 194 GLU A CB    
1596 C CG    . GLU A 194 ? 0.4996 0.5838 0.4098 0.0732  -0.0681 -0.0002 194 GLU A CG    
1597 C CD    . GLU A 194 ? 0.5474 0.6358 0.4585 0.0756  -0.0584 0.0086  194 GLU A CD    
1598 O OE1   . GLU A 194 ? 0.5363 0.6351 0.4642 0.0690  -0.0547 0.0112  194 GLU A OE1   
1599 O OE2   . GLU A 194 ? 0.5257 0.6065 0.4204 0.0839  -0.0546 0.0131  194 GLU A OE2   
1600 N N     . LYS A 195 ? 0.5360 0.6008 0.4235 0.0797  -0.0988 -0.0162 195 LYS A N     
1601 C CA    . LYS A 195 ? 0.5494 0.6208 0.4472 0.0778  -0.1062 -0.0180 195 LYS A CA    
1602 C C     . LYS A 195 ? 0.5298 0.6076 0.4428 0.0700  -0.1156 -0.0248 195 LYS A C     
1603 O O     . LYS A 195 ? 0.5076 0.5974 0.4398 0.0649  -0.1166 -0.0247 195 LYS A O     
1604 C CB    . LYS A 195 ? 0.6055 0.6673 0.4841 0.0873  -0.1112 -0.0174 195 LYS A CB    
1605 C CG    . LYS A 195 ? 0.6662 0.7259 0.5368 0.0937  -0.1012 -0.0090 195 LYS A CG    
1606 C CD    . LYS A 195 ? 0.7564 0.8036 0.6031 0.1048  -0.1048 -0.0078 195 LYS A CD    
1607 C CE    . LYS A 195 ? 0.8079 0.8511 0.6443 0.1115  -0.0925 0.0016  195 LYS A CE    
1608 N NZ    . LYS A 195 ? 0.8228 0.8515 0.6318 0.1239  -0.0939 0.0035  195 LYS A NZ    
1609 N N     . GLU A 196 ? 0.5319 0.6012 0.4365 0.0689  -0.1218 -0.0303 196 GLU A N     
1610 C CA    . GLU A 196 ? 0.5403 0.6156 0.4606 0.0605  -0.1301 -0.0361 196 GLU A CA    
1611 C C     . GLU A 196 ? 0.4938 0.5791 0.4334 0.0523  -0.1228 -0.0349 196 GLU A C     
1612 O O     . GLU A 196 ? 0.4667 0.5632 0.4262 0.0454  -0.1262 -0.0367 196 GLU A O     
1613 C CB    . GLU A 196 ? 0.6007 0.6623 0.5061 0.0609  -0.1404 -0.0427 196 GLU A CB    
1614 C CG    . GLU A 196 ? 0.7491 0.7959 0.6361 0.0639  -0.1349 -0.0431 196 GLU A CG    
1615 C CD    . GLU A 196 ? 0.8786 0.9121 0.7561 0.0609  -0.1451 -0.0506 196 GLU A CD    
1616 O OE1   . GLU A 196 ? 0.9080 0.9275 0.7692 0.0638  -0.1410 -0.0513 196 GLU A OE1   
1617 O OE2   . GLU A 196 ? 0.9242 0.9612 0.8107 0.0557  -0.1572 -0.0555 196 GLU A OE2   
1618 N N     . LEU A 197 ? 0.4553 0.5372 0.3892 0.0536  -0.1126 -0.0314 197 LEU A N     
1619 C CA    . LEU A 197 ? 0.4119 0.5033 0.3626 0.0470  -0.1052 -0.0297 197 LEU A CA    
1620 C C     . LEU A 197 ? 0.4080 0.5137 0.3774 0.0438  -0.1020 -0.0265 197 LEU A C     
1621 O O     . LEU A 197 ? 0.3822 0.4974 0.3693 0.0373  -0.1025 -0.0280 197 LEU A O     
1622 C CB    . LEU A 197 ? 0.4158 0.5024 0.3567 0.0502  -0.0951 -0.0257 197 LEU A CB    
1623 C CG    . LEU A 197 ? 0.3701 0.4642 0.3238 0.0447  -0.0877 -0.0240 197 LEU A CG    
1624 C CD1   . LEU A 197 ? 0.3392 0.4258 0.2792 0.0494  -0.0804 -0.0213 197 LEU A CD1   
1625 C CD2   . LEU A 197 ? 0.2845 0.3921 0.2544 0.0416  -0.0821 -0.0199 197 LEU A CD2   
1626 N N     . LEU A 198 ? 0.3995 0.5057 0.3640 0.0488  -0.0983 -0.0221 198 LEU A N     
1627 C CA    . LEU A 198 ? 0.3826 0.4990 0.3614 0.0467  -0.0954 -0.0192 198 LEU A CA    
1628 C C     . LEU A 198 ? 0.4181 0.5409 0.4077 0.0451  -0.1037 -0.0224 198 LEU A C     
1629 O O     . LEU A 198 ? 0.3971 0.5299 0.4036 0.0406  -0.1023 -0.0223 198 LEU A O     
1630 C CB    . LEU A 198 ? 0.3758 0.4888 0.3453 0.0521  -0.0898 -0.0135 198 LEU A CB    
1631 C CG    . LEU A 198 ? 0.3692 0.4792 0.3314 0.0535  -0.0806 -0.0089 198 LEU A CG    
1632 C CD1   . LEU A 198 ? 0.3693 0.4759 0.3232 0.0586  -0.0756 -0.0027 198 LEU A CD1   
1633 C CD2   . LEU A 198 ? 0.3331 0.4516 0.3096 0.0469  -0.0747 -0.0078 198 LEU A CD2   
1634 N N     . MET A 199 ? 0.4667 0.5841 0.4465 0.0494  -0.1123 -0.0249 199 MET A N     
1635 C CA    . MET A 199 ? 0.4898 0.6148 0.4805 0.0484  -0.1213 -0.0276 199 MET A CA    
1636 C C     . MET A 199 ? 0.4536 0.5870 0.4619 0.0402  -0.1240 -0.0310 199 MET A C     
1637 O O     . MET A 199 ? 0.4368 0.5823 0.4629 0.0373  -0.1249 -0.0307 199 MET A O     
1638 C CB    . MET A 199 ? 0.5578 0.6748 0.5335 0.0539  -0.1316 -0.0305 199 MET A CB    
1639 C CG    . MET A 199 ? 0.6739 0.7867 0.6375 0.0626  -0.1316 -0.0270 199 MET A CG    
1640 S SD    . MET A 199 ? 0.9243 1.0295 0.8717 0.0691  -0.1459 -0.0312 199 MET A SD    
1641 C CE    . MET A 199 ? 0.8811 0.9671 0.8008 0.0738  -0.1444 -0.0324 199 MET A CE    
1642 N N     . GLU A 200 ? 0.4537 0.5802 0.4564 0.0370  -0.1245 -0.0338 200 GLU A N     
1643 C CA    . GLU A 200 ? 0.4401 0.5726 0.4582 0.0290  -0.1263 -0.0366 200 GLU A CA    
1644 C C     . GLU A 200 ? 0.4000 0.5416 0.4323 0.0253  -0.1162 -0.0333 200 GLU A C     
1645 O O     . GLU A 200 ? 0.3683 0.5198 0.4184 0.0199  -0.1166 -0.0339 200 GLU A O     
1646 C CB    . GLU A 200 ? 0.4904 0.6102 0.4964 0.0271  -0.1294 -0.0404 200 GLU A CB    
1647 C CG    . GLU A 200 ? 0.5927 0.7162 0.6131 0.0184  -0.1340 -0.0438 200 GLU A CG    
1648 C CD    . GLU A 200 ? 0.6761 0.8115 0.7134 0.0150  -0.1436 -0.0455 200 GLU A CD    
1649 O OE1   . GLU A 200 ? 0.7169 0.8489 0.7459 0.0185  -0.1534 -0.0479 200 GLU A OE1   
1650 O OE2   . GLU A 200 ? 0.7069 0.8557 0.7659 0.0093  -0.1411 -0.0440 200 GLU A OE2   
1651 N N     . TYR A 201 ? 0.3766 0.5150 0.4013 0.0284  -0.1074 -0.0296 201 TYR A N     
1652 C CA    . TYR A 201 ? 0.3634 0.5095 0.3998 0.0252  -0.0989 -0.0269 201 TYR A CA    
1653 C C     . TYR A 201 ? 0.3643 0.5205 0.4139 0.0255  -0.0990 -0.0254 201 TYR A C     
1654 O O     . TYR A 201 ? 0.3956 0.5603 0.4596 0.0218  -0.0962 -0.0252 201 TYR A O     
1655 C CB    . TYR A 201 ? 0.3346 0.4758 0.3608 0.0276  -0.0904 -0.0232 201 TYR A CB    
1656 C CG    . TYR A 201 ? 0.3263 0.4744 0.3633 0.0239  -0.0830 -0.0211 201 TYR A CG    
1657 C CD1   . TYR A 201 ? 0.3115 0.4621 0.3555 0.0194  -0.0809 -0.0226 201 TYR A CD1   
1658 C CD2   . TYR A 201 ? 0.3322 0.4831 0.3712 0.0250  -0.0783 -0.0178 201 TYR A CD2   
1659 C CE1   . TYR A 201 ? 0.2354 0.3916 0.2874 0.0168  -0.0745 -0.0208 201 TYR A CE1   
1660 C CE2   . TYR A 201 ? 0.2289 0.3849 0.2759 0.0218  -0.0725 -0.0165 201 TYR A CE2   
1661 C CZ    . TYR A 201 ? 0.2511 0.4100 0.3042 0.0181  -0.0707 -0.0180 201 TYR A CZ    
1662 O OH    . TYR A 201 ? 0.2421 0.4055 0.3015 0.0157  -0.0654 -0.0168 201 TYR A OH    
1663 N N     . LEU A 202 ? 0.3549 0.5095 0.3984 0.0308  -0.1018 -0.0242 202 LEU A N     
1664 C CA    . LEU A 202 ? 0.3326 0.4952 0.3865 0.0327  -0.1024 -0.0227 202 LEU A CA    
1665 C C     . LEU A 202 ? 0.3605 0.5337 0.4302 0.0301  -0.1086 -0.0249 202 LEU A C     
1666 O O     . LEU A 202 ? 0.3682 0.5507 0.4518 0.0292  -0.1057 -0.0236 202 LEU A O     
1667 C CB    . LEU A 202 ? 0.3417 0.4988 0.3841 0.0395  -0.1050 -0.0209 202 LEU A CB    
1668 C CG    . LEU A 202 ? 0.3704 0.5208 0.4037 0.0419  -0.0972 -0.0168 202 LEU A CG    
1669 C CD1   . LEU A 202 ? 0.3776 0.5204 0.3970 0.0488  -0.1000 -0.0149 202 LEU A CD1   
1670 C CD2   . LEU A 202 ? 0.3525 0.5082 0.3967 0.0405  -0.0920 -0.0151 202 LEU A CD2   
1671 N N     . ASN A 203 ? 0.4052 0.5769 0.4726 0.0291  -0.1173 -0.0281 203 ASN A N     
1672 C CA    . ASN A 203 ? 0.4208 0.6038 0.5049 0.0257  -0.1244 -0.0299 203 ASN A CA    
1673 C C     . ASN A 203 ? 0.3997 0.5900 0.4995 0.0188  -0.1194 -0.0297 203 ASN A C     
1674 O O     . ASN A 203 ? 0.3776 0.5810 0.4956 0.0172  -0.1191 -0.0283 203 ASN A O     
1675 C CB    . ASN A 203 ? 0.4799 0.6578 0.5568 0.0251  -0.1357 -0.0339 203 ASN A CB    
1676 C CG    . ASN A 203 ? 0.5632 0.7395 0.6308 0.0325  -0.1429 -0.0337 203 ASN A CG    
1677 O OD1   . ASN A 203 ? 0.6177 0.7976 0.6884 0.0322  -0.1539 -0.0364 203 ASN A OD1   
1678 N ND2   . ASN A 203 ? 0.5946 0.7653 0.6507 0.0390  -0.1370 -0.0305 203 ASN A ND2   
1679 N N     . PHE A 204 ? 0.3867 0.5684 0.4788 0.0156  -0.1146 -0.0305 204 PHE A N     
1680 C CA    . PHE A 204 ? 0.3416 0.5274 0.4446 0.0099  -0.1083 -0.0299 204 PHE A CA    
1681 C C     . PHE A 204 ? 0.3214 0.5137 0.4314 0.0117  -0.0993 -0.0264 204 PHE A C     
1682 O O     . PHE A 204 ? 0.2826 0.4842 0.4076 0.0089  -0.0958 -0.0251 204 PHE A O     
1683 C CB    . PHE A 204 ? 0.3150 0.4883 0.4046 0.0079  -0.1057 -0.0314 204 PHE A CB    
1684 C CG    . PHE A 204 ? 0.2569 0.4313 0.3508 0.0050  -0.0964 -0.0295 204 PHE A CG    
1685 C CD1   . PHE A 204 ? 0.2784 0.4558 0.3834 -0.0010 -0.0957 -0.0301 204 PHE A CD1   
1686 C CD2   . PHE A 204 ? 0.2376 0.4094 0.3237 0.0081  -0.0887 -0.0271 204 PHE A CD2   
1687 C CE1   . PHE A 204 ? 0.2983 0.4758 0.4054 -0.0028 -0.0870 -0.0282 204 PHE A CE1   
1688 C CE2   . PHE A 204 ? 0.2609 0.4337 0.3498 0.0059  -0.0810 -0.0256 204 PHE A CE2   
1689 C CZ    . PHE A 204 ? 0.2996 0.4750 0.3983 0.0010  -0.0799 -0.0261 204 PHE A CZ    
1690 N N     . TRP A 205 ? 0.3050 0.4918 0.4036 0.0166  -0.0956 -0.0248 205 TRP A N     
1691 C CA    . TRP A 205 ? 0.3296 0.5200 0.4321 0.0188  -0.0886 -0.0221 205 TRP A CA    
1692 C C     . TRP A 205 ? 0.3393 0.5409 0.4560 0.0211  -0.0900 -0.0209 205 TRP A C     
1693 O O     . TRP A 205 ? 0.3206 0.5278 0.4461 0.0209  -0.0842 -0.0193 205 TRP A O     
1694 C CB    . TRP A 205 ? 0.3144 0.4958 0.4022 0.0229  -0.0861 -0.0206 205 TRP A CB    
1695 C CG    . TRP A 205 ? 0.3068 0.4882 0.3953 0.0244  -0.0795 -0.0184 205 TRP A CG    
1696 C CD1   . TRP A 205 ? 0.3093 0.4940 0.4027 0.0281  -0.0790 -0.0172 205 TRP A CD1   
1697 C CD2   . TRP A 205 ? 0.3183 0.4947 0.4008 0.0226  -0.0733 -0.0173 205 TRP A CD2   
1698 N NE1   . TRP A 205 ? 0.3010 0.4813 0.3906 0.0285  -0.0729 -0.0159 205 TRP A NE1   
1699 C CE2   . TRP A 205 ? 0.2936 0.4695 0.3772 0.0247  -0.0698 -0.0160 205 TRP A CE2   
1700 C CE3   . TRP A 205 ? 0.3164 0.4888 0.3926 0.0198  -0.0705 -0.0173 205 TRP A CE3   
1701 C CZ2   . TRP A 205 ? 0.2664 0.4378 0.3453 0.0231  -0.0647 -0.0151 205 TRP A CZ2   
1702 C CZ3   . TRP A 205 ? 0.3207 0.4908 0.3937 0.0186  -0.0651 -0.0157 205 TRP A CZ3   
1703 C CH2   . TRP A 205 ? 0.2882 0.4577 0.3626 0.0198  -0.0628 -0.0149 205 TRP A CH2   
1704 N N     . GLN A 206 ? 0.3509 0.5557 0.4691 0.0241  -0.0975 -0.0214 206 GLN A N     
1705 C CA    . GLN A 206 ? 0.3943 0.6114 0.5270 0.0271  -0.0992 -0.0197 206 GLN A CA    
1706 C C     . GLN A 206 ? 0.3572 0.5869 0.5094 0.0221  -0.0987 -0.0192 206 GLN A C     
1707 O O     . GLN A 206 ? 0.3351 0.5742 0.4992 0.0241  -0.0937 -0.0166 206 GLN A O     
1708 C CB    . GLN A 206 ? 0.4536 0.6726 0.5842 0.0315  -0.1084 -0.0201 206 GLN A CB    
1709 C CG    . GLN A 206 ? 0.5565 0.7697 0.6763 0.0395  -0.1069 -0.0181 206 GLN A CG    
1710 C CD    . GLN A 206 ? 0.6738 0.8905 0.7927 0.0449  -0.1162 -0.0180 206 GLN A CD    
1711 O OE1   . GLN A 206 ? 0.6892 0.8955 0.7919 0.0492  -0.1186 -0.0181 206 GLN A OE1   
1712 N NE2   . GLN A 206 ? 0.6342 0.8664 0.7709 0.0450  -0.1212 -0.0175 206 GLN A NE2   
1713 N N     . GLN A 207 ? 0.3368 0.5657 0.4913 0.0158  -0.1034 -0.0216 207 GLN A N     
1714 C CA    . GLN A 207 ? 0.3381 0.5771 0.5106 0.0095  -0.1027 -0.0209 207 GLN A CA    
1715 C C     . GLN A 207 ? 0.3164 0.5552 0.4916 0.0080  -0.0918 -0.0189 207 GLN A C     
1716 O O     . GLN A 207 ? 0.3267 0.5769 0.5182 0.0070  -0.0877 -0.0160 207 GLN A O     
1717 C CB    . GLN A 207 ? 0.3562 0.5902 0.5273 0.0027  -0.1104 -0.0243 207 GLN A CB    
1718 C CG    . GLN A 207 ? 0.4325 0.6705 0.6066 0.0027  -0.1230 -0.0265 207 GLN A CG    
1719 C CD    . GLN A 207 ? 0.5319 0.7898 0.7302 0.0023  -0.1263 -0.0236 207 GLN A CD    
1720 O OE1   . GLN A 207 ? 0.5711 0.8391 0.7878 -0.0036 -0.1241 -0.0217 207 GLN A OE1   
1721 N NE2   . GLN A 207 ? 0.5341 0.7979 0.7325 0.0090  -0.1313 -0.0228 207 GLN A NE2   
1722 N N     . LYS A 208 ? 0.3192 0.5454 0.4782 0.0084  -0.0870 -0.0199 208 LYS A N     
1723 C CA    . LYS A 208 ? 0.3231 0.5476 0.4819 0.0071  -0.0776 -0.0184 208 LYS A CA    
1724 C C     . LYS A 208 ? 0.3371 0.5550 0.4835 0.0123  -0.0722 -0.0177 208 LYS A C     
1725 O O     . LYS A 208 ? 0.3254 0.5338 0.4591 0.0116  -0.0694 -0.0185 208 LYS A O     
1726 C CB    . LYS A 208 ? 0.3090 0.5249 0.4610 0.0019  -0.0771 -0.0202 208 LYS A CB    
1727 C CG    . LYS A 208 ? 0.3203 0.5400 0.4837 -0.0044 -0.0820 -0.0210 208 LYS A CG    
1728 C CD    . LYS A 208 ? 0.3175 0.5244 0.4689 -0.0083 -0.0831 -0.0235 208 LYS A CD    
1729 C CE    . LYS A 208 ? 0.3064 0.5132 0.4652 -0.0145 -0.0913 -0.0257 208 LYS A CE    
1730 N NZ    . LYS A 208 ? 0.2665 0.4853 0.4468 -0.0195 -0.0889 -0.0228 208 LYS A NZ    
1731 N N     . THR A 209 ? 0.3176 0.5405 0.4680 0.0176  -0.0711 -0.0160 209 THR A N     
1732 C CA    . THR A 209 ? 0.3097 0.5247 0.4479 0.0223  -0.0676 -0.0156 209 THR A CA    
1733 C C     . THR A 209 ? 0.2962 0.5080 0.4313 0.0219  -0.0596 -0.0150 209 THR A C     
1734 O O     . THR A 209 ? 0.3263 0.5450 0.4708 0.0231  -0.0549 -0.0133 209 THR A O     
1735 C CB    . THR A 209 ? 0.2948 0.5137 0.4363 0.0287  -0.0687 -0.0141 209 THR A CB    
1736 O OG1   . THR A 209 ? 0.3781 0.6038 0.5266 0.0291  -0.0766 -0.0144 209 THR A OG1   
1737 C CG2   . THR A 209 ? 0.3024 0.5094 0.4283 0.0325  -0.0677 -0.0143 209 THR A CG2   
1738 N N     . PRO A 210 ? 0.2789 0.4807 0.4007 0.0206  -0.0581 -0.0159 210 PRO A N     
1739 C CA    . PRO A 210 ? 0.2360 0.4342 0.3530 0.0202  -0.0518 -0.0157 210 PRO A CA    
1740 C C     . PRO A 210 ? 0.2295 0.4268 0.3458 0.0252  -0.0480 -0.0148 210 PRO A C     
1741 O O     . PRO A 210 ? 0.2285 0.4229 0.3416 0.0290  -0.0501 -0.0147 210 PRO A O     
1742 C CB    . PRO A 210 ? 0.2275 0.4165 0.3314 0.0184  -0.0528 -0.0165 210 PRO A CB    
1743 C CG    . PRO A 210 ? 0.2358 0.4246 0.3389 0.0167  -0.0581 -0.0171 210 PRO A CG    
1744 C CD    . PRO A 210 ? 0.2780 0.4726 0.3892 0.0194  -0.0623 -0.0170 210 PRO A CD    
1745 N N     . VAL A 211 ? 0.2241 0.4231 0.3424 0.0260  -0.0423 -0.0142 211 VAL A N     
1746 C CA    . VAL A 211 ? 0.2048 0.3994 0.3177 0.0312  -0.0380 -0.0139 211 VAL A CA    
1747 C C     . VAL A 211 ? 0.2532 0.4372 0.3521 0.0294  -0.0369 -0.0156 211 VAL A C     
1748 O O     . VAL A 211 ? 0.2462 0.4210 0.3353 0.0311  -0.0381 -0.0166 211 VAL A O     
1749 C CB    . VAL A 211 ? 0.2229 0.4255 0.3451 0.0343  -0.0319 -0.0117 211 VAL A CB    
1750 C CG1   . VAL A 211 ? 0.1824 0.3774 0.2948 0.0406  -0.0270 -0.0119 211 VAL A CG1   
1751 C CG2   . VAL A 211 ? 0.1840 0.3991 0.3224 0.0360  -0.0334 -0.0094 211 VAL A CG2   
1752 N N     . ILE A 212 ? 0.2510 0.4362 0.3494 0.0259  -0.0349 -0.0157 212 ILE A N     
1753 C CA    . ILE A 212 ? 0.2851 0.4630 0.3723 0.0233  -0.0352 -0.0169 212 ILE A CA    
1754 C C     . ILE A 212 ? 0.2790 0.4578 0.3662 0.0186  -0.0389 -0.0168 212 ILE A C     
1755 O O     . ILE A 212 ? 0.2871 0.4712 0.3807 0.0166  -0.0389 -0.0162 212 ILE A O     
1756 C CB    . ILE A 212 ? 0.2998 0.4783 0.3847 0.0237  -0.0304 -0.0167 212 ILE A CB    
1757 C CG1   . ILE A 212 ? 0.3099 0.4885 0.3954 0.0295  -0.0253 -0.0160 212 ILE A CG1   
1758 C CG2   . ILE A 212 ? 0.2667 0.4389 0.3407 0.0213  -0.0318 -0.0179 212 ILE A CG2   
1759 C CD1   . ILE A 212 ? 0.2857 0.4545 0.3605 0.0338  -0.0257 -0.0177 212 ILE A CD1   
1760 N N     . LEU A 213 ? 0.2491 0.4220 0.3288 0.0171  -0.0419 -0.0172 213 LEU A N     
1761 C CA    . LEU A 213 ? 0.2594 0.4329 0.3377 0.0138  -0.0444 -0.0164 213 LEU A CA    
1762 C C     . LEU A 213 ? 0.2560 0.4277 0.3282 0.0113  -0.0434 -0.0160 213 LEU A C     
1763 O O     . LEU A 213 ? 0.2663 0.4331 0.3331 0.0107  -0.0441 -0.0163 213 LEU A O     
1764 C CB    . LEU A 213 ? 0.2257 0.3955 0.3015 0.0144  -0.0480 -0.0159 213 LEU A CB    
1765 C CG    . LEU A 213 ? 0.2871 0.4568 0.3602 0.0126  -0.0501 -0.0147 213 LEU A CG    
1766 C CD1   . LEU A 213 ? 0.2812 0.4555 0.3588 0.0122  -0.0508 -0.0152 213 LEU A CD1   
1767 C CD2   . LEU A 213 ? 0.2348 0.4000 0.3042 0.0142  -0.0530 -0.0136 213 LEU A CD2   
1768 N N     . THR A 214 ? 0.2552 0.4306 0.3283 0.0098  -0.0421 -0.0153 214 THR A N     
1769 C CA    . THR A 214 ? 0.2767 0.4524 0.3450 0.0081  -0.0412 -0.0144 214 THR A CA    
1770 C C     . THR A 214 ? 0.2818 0.4600 0.3490 0.0070  -0.0413 -0.0124 214 THR A C     
1771 O O     . THR A 214 ? 0.3245 0.5024 0.3930 0.0075  -0.0425 -0.0123 214 THR A O     
1772 C CB    . THR A 214 ? 0.3003 0.4771 0.3675 0.0094  -0.0380 -0.0150 214 THR A CB    
1773 O OG1   . THR A 214 ? 0.3291 0.5063 0.3912 0.0079  -0.0386 -0.0143 214 THR A OG1   
1774 C CG2   . THR A 214 ? 0.2407 0.4208 0.3122 0.0102  -0.0349 -0.0144 214 THR A CG2   
1775 N N     . GLY A 215 ? 0.2830 0.4635 0.3473 0.0061  -0.0403 -0.0110 215 GLY A N     
1776 C CA    . GLY A 215 ? 0.2907 0.4740 0.3531 0.0062  -0.0396 -0.0084 215 GLY A CA    
1777 C C     . GLY A 215 ? 0.2895 0.4761 0.3506 0.0043  -0.0406 -0.0061 215 GLY A C     
1778 O O     . GLY A 215 ? 0.3260 0.5113 0.3870 0.0023  -0.0425 -0.0071 215 GLY A O     
1779 N N     . TRP A 216 ? 0.2841 0.4748 0.3443 0.0050  -0.0395 -0.0028 216 TRP A N     
1780 C CA    . TRP A 216 ? 0.2851 0.4819 0.3465 0.0030  -0.0401 0.0004  216 TRP A CA    
1781 C C     . TRP A 216 ? 0.3052 0.5020 0.3682 0.0008  -0.0414 0.0033  216 TRP A C     
1782 O O     . TRP A 216 ? 0.2851 0.4823 0.3467 0.0030  -0.0396 0.0060  216 TRP A O     
1783 C CB    . TRP A 216 ? 0.2714 0.4745 0.3318 0.0058  -0.0373 0.0035  216 TRP A CB    
1784 C CG    . TRP A 216 ? 0.2667 0.4781 0.3298 0.0040  -0.0385 0.0061  216 TRP A CG    
1785 C CD1   . TRP A 216 ? 0.2623 0.4818 0.3293 0.0028  -0.0386 0.0110  216 TRP A CD1   
1786 C CD2   . TRP A 216 ? 0.2500 0.4632 0.3124 0.0033  -0.0401 0.0042  216 TRP A CD2   
1787 N NE1   . TRP A 216 ? 0.2755 0.5029 0.3459 0.0006  -0.0410 0.0121  216 TRP A NE1   
1788 C CE2   . TRP A 216 ? 0.2721 0.4950 0.3385 0.0012  -0.0423 0.0077  216 TRP A CE2   
1789 C CE3   . TRP A 216 ? 0.2505 0.4586 0.3094 0.0047  -0.0398 0.0003  216 TRP A CE3   
1790 C CZ2   . TRP A 216 ? 0.2820 0.5087 0.3477 0.0002  -0.0452 0.0066  216 TRP A CZ2   
1791 C CZ3   . TRP A 216 ? 0.3187 0.5294 0.3755 0.0045  -0.0417 -0.0006 216 TRP A CZ3   
1792 C CH2   . TRP A 216 ? 0.3383 0.5580 0.3980 0.0023  -0.0449 0.0023  216 TRP A CH2   
1793 N N     . ASN A 217 ? 0.3273 0.5225 0.3923 -0.0034 -0.0444 0.0027  217 ASN A N     
1794 C CA    . ASN A 217 ? 0.3525 0.5460 0.4191 -0.0061 -0.0454 0.0056  217 ASN A CA    
1795 C C     . ASN A 217 ? 0.3441 0.5293 0.4076 -0.0040 -0.0453 0.0043  217 ASN A C     
1796 O O     . ASN A 217 ? 0.3427 0.5262 0.4060 -0.0045 -0.0449 0.0076  217 ASN A O     
1797 C CB    . ASN A 217 ? 0.3994 0.6015 0.4689 -0.0057 -0.0429 0.0118  217 ASN A CB    
1798 C CG    . ASN A 217 ? 0.4744 0.6837 0.5502 -0.0110 -0.0448 0.0151  217 ASN A CG    
1799 O OD1   . ASN A 217 ? 0.5427 0.7482 0.6194 -0.0157 -0.0488 0.0125  217 ASN A OD1   
1800 N ND2   . ASN A 217 ? 0.5544 0.7741 0.6347 -0.0102 -0.0422 0.0212  217 ASN A ND2   
1801 N N     . VAL A 218 ? 0.3388 0.5195 0.4003 -0.0014 -0.0456 0.0000  218 VAL A N     
1802 C CA    . VAL A 218 ? 0.3369 0.5114 0.3964 0.0010  -0.0463 -0.0014 218 VAL A CA    
1803 C C     . VAL A 218 ? 0.3767 0.5449 0.4352 -0.0009 -0.0481 -0.0006 218 VAL A C     
1804 O O     . VAL A 218 ? 0.3882 0.5530 0.4444 0.0008  -0.0481 0.0012  218 VAL A O     
1805 C CB    . VAL A 218 ? 0.3251 0.4978 0.3853 0.0034  -0.0467 -0.0057 218 VAL A CB    
1806 C CG1   . VAL A 218 ? 0.3039 0.4804 0.3644 0.0053  -0.0449 -0.0060 218 VAL A CG1   
1807 C CG2   . VAL A 218 ? 0.2247 0.3957 0.2857 0.0022  -0.0471 -0.0084 218 VAL A CG2   
1808 N N     . GLU A 219 ? 0.4232 0.5887 0.4822 -0.0043 -0.0497 -0.0019 219 GLU A N     
1809 C CA    . GLU A 219 ? 0.4552 0.6119 0.5120 -0.0063 -0.0515 -0.0018 219 GLU A CA    
1810 C C     . GLU A 219 ? 0.4244 0.5812 0.4822 -0.0094 -0.0510 0.0036  219 GLU A C     
1811 O O     . GLU A 219 ? 0.4317 0.5813 0.4868 -0.0088 -0.0510 0.0051  219 GLU A O     
1812 C CB    . GLU A 219 ? 0.4823 0.6337 0.5372 -0.0092 -0.0538 -0.0049 219 GLU A CB    
1813 C CG    . GLU A 219 ? 0.5462 0.6848 0.5963 -0.0095 -0.0555 -0.0061 219 GLU A CG    
1814 C CD    . GLU A 219 ? 0.6259 0.7564 0.6711 -0.0115 -0.0580 -0.0099 219 GLU A CD    
1815 O OE1   . GLU A 219 ? 0.6192 0.7425 0.6597 -0.0069 -0.0576 -0.0133 219 GLU A OE1   
1816 O OE2   . GLU A 219 ? 0.5942 0.7256 0.6401 -0.0171 -0.0605 -0.0095 219 GLU A OE2   
1817 N N     . SER A 220 ? 0.4083 0.5740 0.4704 -0.0124 -0.0501 0.0070  220 SER A N     
1818 C CA    . SER A 220 ? 0.4019 0.5698 0.4670 -0.0156 -0.0487 0.0132  220 SER A CA    
1819 C C     . SER A 220 ? 0.3714 0.5434 0.4350 -0.0106 -0.0448 0.0173  220 SER A C     
1820 O O     . SER A 220 ? 0.4098 0.5798 0.4729 -0.0109 -0.0428 0.0223  220 SER A O     
1821 C CB    . SER A 220 ? 0.3924 0.5688 0.4645 -0.0218 -0.0500 0.0159  220 SER A CB    
1822 O OG    . SER A 220 ? 0.3831 0.5706 0.4576 -0.0194 -0.0486 0.0161  220 SER A OG    
1823 N N     . PHE A 221 ? 0.3360 0.5124 0.3977 -0.0059 -0.0435 0.0154  221 PHE A N     
1824 C CA    . PHE A 221 ? 0.3423 0.5204 0.3998 -0.0004 -0.0403 0.0186  221 PHE A CA    
1825 C C     . PHE A 221 ? 0.3078 0.4790 0.3585 0.0049  -0.0415 0.0145  221 PHE A C     
1826 O O     . PHE A 221 ? 0.3363 0.5011 0.3822 0.0074  -0.0417 0.0156  221 PHE A O     
1827 C CB    . PHE A 221 ? 0.3247 0.5130 0.3843 0.0011  -0.0372 0.0216  221 PHE A CB    
1828 C CG    . PHE A 221 ? 0.3737 0.5612 0.4261 0.0079  -0.0338 0.0241  221 PHE A CG    
1829 C CD1   . PHE A 221 ? 0.3908 0.5768 0.4379 0.0123  -0.0338 0.0205  221 PHE A CD1   
1830 C CD2   . PHE A 221 ? 0.3562 0.5431 0.4060 0.0100  -0.0305 0.0302  221 PHE A CD2   
1831 C CE1   . PHE A 221 ? 0.3916 0.5743 0.4298 0.0188  -0.0313 0.0221  221 PHE A CE1   
1832 C CE2   . PHE A 221 ? 0.3730 0.5574 0.4136 0.0174  -0.0273 0.0323  221 PHE A CE2   
1833 C CZ    . PHE A 221 ? 0.3822 0.5639 0.4162 0.0218  -0.0281 0.0278  221 PHE A CZ    
1834 N N     . ALA A 222 ? 0.2808 0.4533 0.3313 0.0065  -0.0425 0.0100  222 ALA A N     
1835 C CA    . ALA A 222 ? 0.3067 0.4746 0.3525 0.0108  -0.0442 0.0065  222 ALA A CA    
1836 C C     . ALA A 222 ? 0.3130 0.4742 0.3575 0.0118  -0.0473 0.0043  222 ALA A C     
1837 O O     . ALA A 222 ? 0.3176 0.4746 0.3563 0.0158  -0.0485 0.0045  222 ALA A O     
1838 C CB    . ALA A 222 ? 0.3079 0.4783 0.3559 0.0108  -0.0447 0.0024  222 ALA A CB    
1839 N N     . ILE A 223 ? 0.2936 0.4533 0.3421 0.0090  -0.0487 0.0022  223 ILE A N     
1840 C CA    . ILE A 223 ? 0.3059 0.4595 0.3533 0.0109  -0.0512 0.0003  223 ILE A CA    
1841 C C     . ILE A 223 ? 0.3266 0.4740 0.3686 0.0124  -0.0508 0.0043  223 ILE A C     
1842 O O     . ILE A 223 ? 0.3551 0.4990 0.3925 0.0169  -0.0526 0.0040  223 ILE A O     
1843 C CB    . ILE A 223 ? 0.3025 0.4544 0.3536 0.0089  -0.0520 -0.0027 223 ILE A CB    
1844 C CG1   . ILE A 223 ? 0.2996 0.4573 0.3551 0.0085  -0.0516 -0.0059 223 ILE A CG1   
1845 C CG2   . ILE A 223 ? 0.2692 0.4150 0.3187 0.0122  -0.0540 -0.0040 223 ILE A CG2   
1846 C CD1   . ILE A 223 ? 0.3343 0.4905 0.3917 0.0072  -0.0514 -0.0084 223 ILE A CD1   
1847 N N     . PRO A 224 ? 0.3311 0.4773 0.3738 0.0086  -0.0488 0.0082  224 PRO A N     
1848 C CA    . PRO A 224 ? 0.3495 0.4893 0.3872 0.0100  -0.0475 0.0128  224 PRO A CA    
1849 C C     . PRO A 224 ? 0.3755 0.5168 0.4074 0.0146  -0.0455 0.0163  224 PRO A C     
1850 O O     . PRO A 224 ? 0.4129 0.5478 0.4380 0.0185  -0.0452 0.0188  224 PRO A O     
1851 C CB    . PRO A 224 ? 0.3506 0.4900 0.3924 0.0035  -0.0458 0.0165  224 PRO A CB    
1852 C CG    . PRO A 224 ? 0.3212 0.4691 0.3692 -0.0004 -0.0460 0.0147  224 PRO A CG    
1853 C CD    . PRO A 224 ? 0.3237 0.4736 0.3718 0.0027  -0.0480 0.0087  224 PRO A CD    
1854 N N     . TYR A 225 ? 0.3657 0.5142 0.3985 0.0150  -0.0438 0.0167  225 TYR A N     
1855 C CA    . TYR A 225 ? 0.3666 0.5142 0.3911 0.0208  -0.0418 0.0195  225 TYR A CA    
1856 C C     . TYR A 225 ? 0.3679 0.5099 0.3854 0.0260  -0.0462 0.0150  225 TYR A C     
1857 O O     . TYR A 225 ? 0.4034 0.5397 0.4114 0.0314  -0.0462 0.0171  225 TYR A O     
1858 C CB    . TYR A 225 ? 0.3548 0.5096 0.3798 0.0214  -0.0389 0.0208  225 TYR A CB    
1859 C CG    . TYR A 225 ? 0.3381 0.4911 0.3538 0.0274  -0.0349 0.0261  225 TYR A CG    
1860 C CD1   . TYR A 225 ? 0.3651 0.5114 0.3690 0.0341  -0.0368 0.0236  225 TYR A CD1   
1861 C CD2   . TYR A 225 ? 0.3680 0.5258 0.3864 0.0264  -0.0292 0.0339  225 TYR A CD2   
1862 C CE1   . TYR A 225 ? 0.3701 0.5128 0.3625 0.0409  -0.0328 0.0284  225 TYR A CE1   
1863 C CE2   . TYR A 225 ? 0.3774 0.5337 0.3867 0.0330  -0.0244 0.0396  225 TYR A CE2   
1864 C CZ    . TYR A 225 ? 0.3981 0.5461 0.3932 0.0408  -0.0260 0.0367  225 TYR A CZ    
1865 O OH    . TYR A 225 ? 0.4144 0.5593 0.3980 0.0484  -0.0210 0.0422  225 TYR A OH    
1866 N N     . VAL A 226 ? 0.3416 0.4858 0.3641 0.0246  -0.0499 0.0092  226 VAL A N     
1867 C CA    . VAL A 226 ? 0.3387 0.4797 0.3573 0.0286  -0.0549 0.0049  226 VAL A CA    
1868 C C     . VAL A 226 ? 0.3316 0.4670 0.3473 0.0314  -0.0574 0.0056  226 VAL A C     
1869 O O     . VAL A 226 ? 0.3413 0.4724 0.3489 0.0366  -0.0604 0.0052  226 VAL A O     
1870 C CB    . VAL A 226 ? 0.3179 0.4638 0.3446 0.0259  -0.0577 -0.0005 226 VAL A CB    
1871 C CG1   . VAL A 226 ? 0.2955 0.4398 0.3213 0.0289  -0.0637 -0.0043 226 VAL A CG1   
1872 C CG2   . VAL A 226 ? 0.3349 0.4840 0.3611 0.0248  -0.0555 -0.0008 226 VAL A CG2   
1873 N N     . TYR A 227 ? 0.3549 0.4893 0.3758 0.0284  -0.0561 0.0065  227 TYR A N     
1874 C CA    . TYR A 227 ? 0.3659 0.4938 0.3837 0.0313  -0.0577 0.0074  227 TYR A CA    
1875 C C     . TYR A 227 ? 0.3871 0.5082 0.3946 0.0352  -0.0555 0.0129  227 TYR A C     
1876 O O     . TYR A 227 ? 0.4254 0.5417 0.4253 0.0412  -0.0584 0.0129  227 TYR A O     
1877 C CB    . TYR A 227 ? 0.3640 0.4899 0.3876 0.0271  -0.0563 0.0073  227 TYR A CB    
1878 C CG    . TYR A 227 ? 0.3598 0.4776 0.3798 0.0306  -0.0577 0.0079  227 TYR A CG    
1879 C CD1   . TYR A 227 ? 0.3424 0.4617 0.3644 0.0350  -0.0616 0.0043  227 TYR A CD1   
1880 C CD2   . TYR A 227 ? 0.3527 0.4615 0.3680 0.0296  -0.0548 0.0125  227 TYR A CD2   
1881 C CE1   . TYR A 227 ? 0.3163 0.4285 0.3347 0.0394  -0.0626 0.0053  227 TYR A CE1   
1882 C CE2   . TYR A 227 ? 0.3529 0.4525 0.3636 0.0334  -0.0556 0.0132  227 TYR A CE2   
1883 C CZ    . TYR A 227 ? 0.3455 0.4468 0.3571 0.0389  -0.0595 0.0095  227 TYR A CZ    
1884 O OH    . TYR A 227 ? 0.3346 0.4271 0.3413 0.0438  -0.0601 0.0106  227 TYR A OH    
1885 N N     . ASN A 228 ? 0.3626 0.4839 0.3700 0.0322  -0.0503 0.0179  228 ASN A N     
1886 C CA    . ASN A 228 ? 0.3747 0.4898 0.3732 0.0357  -0.0467 0.0243  228 ASN A CA    
1887 C C     . ASN A 228 ? 0.4001 0.5140 0.3876 0.0428  -0.0473 0.0248  228 ASN A C     
1888 O O     . ASN A 228 ? 0.4229 0.5294 0.3996 0.0490  -0.0472 0.0277  228 ASN A O     
1889 C CB    . ASN A 228 ? 0.3906 0.5083 0.3941 0.0301  -0.0407 0.0304  228 ASN A CB    
1890 C CG    . ASN A 228 ? 0.3720 0.4859 0.3822 0.0237  -0.0405 0.0310  228 ASN A CG    
1891 O OD1   . ASN A 228 ? 0.4323 0.5367 0.4380 0.0256  -0.0412 0.0320  228 ASN A OD1   
1892 N ND2   . ASN A 228 ? 0.3575 0.4778 0.3773 0.0164  -0.0398 0.0305  228 ASN A ND2   
1893 N N     . ARG A 229 ? 0.3743 0.4939 0.3628 0.0425  -0.0481 0.0218  229 ARG A N     
1894 C CA    . ARG A 229 ? 0.3587 0.4750 0.3349 0.0493  -0.0496 0.0210  229 ARG A CA    
1895 C C     . ARG A 229 ? 0.3586 0.4698 0.3284 0.0543  -0.0571 0.0163  229 ARG A C     
1896 O O     . ARG A 229 ? 0.3563 0.4603 0.3125 0.0613  -0.0581 0.0181  229 ARG A O     
1897 C CB    . ARG A 229 ? 0.3433 0.4650 0.3217 0.0477  -0.0493 0.0181  229 ARG A CB    
1898 C CG    . ARG A 229 ? 0.3833 0.4993 0.3467 0.0548  -0.0497 0.0178  229 ARG A CG    
1899 C CD    . ARG A 229 ? 0.3935 0.5068 0.3474 0.0599  -0.0422 0.0258  229 ARG A CD    
1900 N NE    . ARG A 229 ? 0.4044 0.5098 0.3406 0.0683  -0.0426 0.0253  229 ARG A NE    
1901 C CZ    . ARG A 229 ? 0.4043 0.5045 0.3273 0.0757  -0.0368 0.0317  229 ARG A CZ    
1902 N NH1   . ARG A 229 ? 0.3568 0.4597 0.2838 0.0750  -0.0299 0.0398  229 ARG A NH1   
1903 N NH2   . ARG A 229 ? 0.4768 0.5682 0.3818 0.0839  -0.0378 0.0302  229 ARG A NH2   
1904 N N     . ILE A 230 ? 0.3457 0.4612 0.3253 0.0509  -0.0624 0.0107  230 ILE A N     
1905 C CA    . ILE A 230 ? 0.3742 0.4876 0.3512 0.0550  -0.0699 0.0068  230 ILE A CA    
1906 C C     . ILE A 230 ? 0.4165 0.5233 0.3871 0.0597  -0.0694 0.0107  230 ILE A C     
1907 O O     . ILE A 230 ? 0.4554 0.5572 0.4155 0.0665  -0.0740 0.0103  230 ILE A O     
1908 C CB    . ILE A 230 ? 0.3569 0.4781 0.3481 0.0505  -0.0743 0.0014  230 ILE A CB    
1909 C CG1   . ILE A 230 ? 0.3578 0.4840 0.3537 0.0466  -0.0753 -0.0025 230 ILE A CG1   
1910 C CG2   . ILE A 230 ? 0.3457 0.4670 0.3365 0.0549  -0.0818 -0.0014 230 ILE A CG2   
1911 C CD1   . ILE A 230 ? 0.2887 0.4230 0.2990 0.0423  -0.0790 -0.0072 230 ILE A CD1   
1912 N N     . LYS A 231 ? 0.4539 0.5596 0.4298 0.0562  -0.0640 0.0147  231 LYS A N     
1913 C CA    . LYS A 231 ? 0.4903 0.5876 0.4594 0.0602  -0.0621 0.0193  231 LYS A CA    
1914 C C     . LYS A 231 ? 0.5009 0.5907 0.4544 0.0670  -0.0595 0.0245  231 LYS A C     
1915 O O     . LYS A 231 ? 0.5247 0.6078 0.4679 0.0742  -0.0623 0.0256  231 LYS A O     
1916 C CB    . LYS A 231 ? 0.4679 0.5632 0.4444 0.0541  -0.0566 0.0228  231 LYS A CB    
1917 C CG    . LYS A 231 ? 0.5195 0.6038 0.4879 0.0577  -0.0538 0.0285  231 LYS A CG    
1918 C CD    . LYS A 231 ? 0.5500 0.6298 0.5253 0.0525  -0.0518 0.0291  231 LYS A CD    
1919 C CE    . LYS A 231 ? 0.6281 0.7074 0.6085 0.0444  -0.0457 0.0337  231 LYS A CE    
1920 N NZ    . LYS A 231 ? 0.6901 0.7608 0.6627 0.0460  -0.0401 0.0420  231 LYS A NZ    
1921 N N     . ASN A 232 ? 0.5118 0.6029 0.4629 0.0655  -0.0539 0.0280  232 ASN A N     
1922 C CA    . ASN A 232 ? 0.5467 0.6307 0.4826 0.0725  -0.0496 0.0340  232 ASN A CA    
1923 C C     . ASN A 232 ? 0.5515 0.6310 0.4724 0.0811  -0.0556 0.0305  232 ASN A C     
1924 O O     . ASN A 232 ? 0.5795 0.6504 0.4846 0.0893  -0.0540 0.0347  232 ASN A O     
1925 C CB    . ASN A 232 ? 0.5610 0.6494 0.4993 0.0695  -0.0416 0.0391  232 ASN A CB    
1926 C CG    . ASN A 232 ? 0.5883 0.6800 0.5396 0.0613  -0.0357 0.0441  232 ASN A CG    
1927 O OD1   . ASN A 232 ? 0.5859 0.6724 0.5395 0.0595  -0.0358 0.0458  232 ASN A OD1   
1928 N ND2   . ASN A 232 ? 0.5649 0.6649 0.5243 0.0563  -0.0310 0.0466  232 ASN A ND2   
1929 N N     . ILE A 233 ? 0.5289 0.6135 0.4542 0.0792  -0.0626 0.0229  233 ILE A N     
1930 C CA    . ILE A 233 ? 0.5204 0.6002 0.4320 0.0858  -0.0697 0.0184  233 ILE A CA    
1931 C C     . ILE A 233 ? 0.5170 0.5956 0.4275 0.0894  -0.0790 0.0145  233 ILE A C     
1932 O O     . ILE A 233 ? 0.5038 0.5747 0.3980 0.0977  -0.0836 0.0142  233 ILE A O     
1933 C CB    . ILE A 233 ? 0.5138 0.5981 0.4296 0.0817  -0.0727 0.0126  233 ILE A CB    
1934 C CG1   . ILE A 233 ? 0.5128 0.5969 0.4248 0.0816  -0.0638 0.0172  233 ILE A CG1   
1935 C CG2   . ILE A 233 ? 0.5260 0.6046 0.4293 0.0870  -0.0826 0.0064  233 ILE A CG2   
1936 C CD1   . ILE A 233 ? 0.5120 0.6013 0.4310 0.0765  -0.0645 0.0127  233 ILE A CD1   
1937 N N     . PHE A 234 ? 0.4872 0.5735 0.4142 0.0838  -0.0815 0.0118  234 PHE A N     
1938 C CA    . PHE A 234 ? 0.4834 0.5719 0.4130 0.0868  -0.0904 0.0081  234 PHE A CA    
1939 C C     . PHE A 234 ? 0.4860 0.5728 0.4188 0.0888  -0.0881 0.0119  234 PHE A C     
1940 O O     . PHE A 234 ? 0.4831 0.5697 0.4135 0.0944  -0.0945 0.0107  234 PHE A O     
1941 C CB    . PHE A 234 ? 0.4775 0.5771 0.4238 0.0802  -0.0962 0.0015  234 PHE A CB    
1942 C CG    . PHE A 234 ? 0.4883 0.5885 0.4320 0.0779  -0.0999 -0.0031 234 PHE A CG    
1943 C CD1   . PHE A 234 ? 0.4842 0.5881 0.4358 0.0711  -0.0945 -0.0036 234 PHE A CD1   
1944 C CD2   . PHE A 234 ? 0.5056 0.6018 0.4383 0.0827  -0.1091 -0.0070 234 PHE A CD2   
1945 C CE1   . PHE A 234 ? 0.4947 0.5975 0.4430 0.0693  -0.0976 -0.0078 234 PHE A CE1   
1946 C CE2   . PHE A 234 ? 0.5028 0.5969 0.4317 0.0802  -0.1128 -0.0116 234 PHE A CE2   
1947 C CZ    . PHE A 234 ? 0.5082 0.6052 0.4447 0.0737  -0.1066 -0.0118 234 PHE A CZ    
1948 N N     . GLY A 235 ? 0.5064 0.5917 0.4447 0.0842  -0.0795 0.0163  235 GLY A N     
1949 C CA    . GLY A 235 ? 0.5226 0.6042 0.4641 0.0851  -0.0770 0.0195  235 GLY A CA    
1950 C C     . GLY A 235 ? 0.5273 0.6158 0.4857 0.0775  -0.0758 0.0168  235 GLY A C     
1951 O O     . GLY A 235 ? 0.5447 0.6426 0.5136 0.0726  -0.0786 0.0119  235 GLY A O     
1952 N N     . GLU A 236 ? 0.5581 0.6405 0.5179 0.0768  -0.0715 0.0201  236 GLU A N     
1953 C CA    . GLU A 236 ? 0.5818 0.6674 0.5543 0.0701  -0.0694 0.0181  236 GLU A CA    
1954 C C     . GLU A 236 ? 0.5763 0.6718 0.5595 0.0708  -0.0752 0.0124  236 GLU A C     
1955 O O     . GLU A 236 ? 0.5893 0.6922 0.5838 0.0647  -0.0746 0.0091  236 GLU A O     
1956 C CB    . GLU A 236 ? 0.6246 0.6982 0.5931 0.0706  -0.0647 0.0226  236 GLU A CB    
1957 C CG    . GLU A 236 ? 0.7216 0.7944 0.6993 0.0626  -0.0612 0.0214  236 GLU A CG    
1958 C CD    . GLU A 236 ? 0.8355 0.8934 0.8072 0.0630  -0.0574 0.0255  236 GLU A CD    
1959 O OE1   . GLU A 236 ? 0.8428 0.8958 0.8121 0.0689  -0.0593 0.0246  236 GLU A OE1   
1960 O OE2   . GLU A 236 ? 0.8586 0.9098 0.8284 0.0574  -0.0524 0.0299  236 GLU A OE2   
1961 N N     . SER A 237 ? 0.5420 0.6386 0.5222 0.0785  -0.0808 0.0117  237 SER A N     
1962 C CA    . SER A 237 ? 0.5195 0.6268 0.5117 0.0797  -0.0859 0.0076  237 SER A CA    
1963 C C     . SER A 237 ? 0.4866 0.6064 0.4883 0.0754  -0.0905 0.0028  237 SER A C     
1964 O O     . SER A 237 ? 0.4409 0.5710 0.4562 0.0731  -0.0923 -0.0002 237 SER A O     
1965 C CB    . SER A 237 ? 0.5155 0.6221 0.5032 0.0895  -0.0908 0.0088  237 SER A CB    
1966 O OG    . SER A 237 ? 0.5543 0.6544 0.5276 0.0949  -0.0933 0.0111  237 SER A OG    
1967 N N     . THR A 238 ? 0.4774 0.5954 0.4713 0.0745  -0.0920 0.0024  238 THR A N     
1968 C CA    . THR A 238 ? 0.4331 0.5593 0.4337 0.0695  -0.0954 -0.0019 238 THR A CA    
1969 C C     . THR A 238 ? 0.4377 0.5665 0.4467 0.0614  -0.0890 -0.0025 238 THR A C     
1970 O O     . THR A 238 ? 0.4350 0.5729 0.4563 0.0570  -0.0904 -0.0059 238 THR A O     
1971 C CB    . THR A 238 ? 0.4196 0.5403 0.4063 0.0720  -0.0983 -0.0021 238 THR A CB    
1972 O OG1   . THR A 238 ? 0.4400 0.5583 0.4181 0.0799  -0.1053 -0.0021 238 THR A OG1   
1973 C CG2   . THR A 238 ? 0.3102 0.4368 0.3024 0.0668  -0.1019 -0.0069 238 THR A CG2   
1974 N N     . ALA A 239 ? 0.4363 0.5574 0.4391 0.0594  -0.0821 0.0012  239 ALA A N     
1975 C CA    . ALA A 239 ? 0.4388 0.5620 0.4488 0.0522  -0.0764 0.0012  239 ALA A CA    
1976 C C     . ALA A 239 ? 0.4545 0.5821 0.4758 0.0502  -0.0758 -0.0008 239 ALA A C     
1977 O O     . ALA A 239 ? 0.4860 0.6191 0.5158 0.0450  -0.0739 -0.0030 239 ALA A O     
1978 C CB    . ALA A 239 ? 0.4151 0.5299 0.4178 0.0506  -0.0700 0.0063  239 ALA A CB    
1979 N N     . LYS A 240 ? 0.4534 0.5780 0.4736 0.0555  -0.0772 0.0002  240 LYS A N     
1980 C CA    . LYS A 240 ? 0.4481 0.5756 0.4768 0.0560  -0.0763 -0.0012 240 LYS A CA    
1981 C C     . LYS A 240 ? 0.4207 0.5618 0.4627 0.0553  -0.0798 -0.0049 240 LYS A C     
1982 O O     . LYS A 240 ? 0.4168 0.5617 0.4669 0.0548  -0.0775 -0.0059 240 LYS A O     
1983 C CB    . LYS A 240 ? 0.4566 0.5764 0.4792 0.0631  -0.0765 0.0013  240 LYS A CB    
1984 C CG    . LYS A 240 ? 0.4953 0.6002 0.5077 0.0619  -0.0713 0.0050  240 LYS A CG    
1985 C CD    . LYS A 240 ? 0.5592 0.6548 0.5659 0.0689  -0.0708 0.0071  240 LYS A CD    
1986 C CE    . LYS A 240 ? 0.5909 0.6701 0.5853 0.0686  -0.0667 0.0117  240 LYS A CE    
1987 N NZ    . LYS A 240 ? 0.6359 0.7068 0.6307 0.0615  -0.0622 0.0117  240 LYS A NZ    
1988 N N     . ARG A 241 ? 0.3946 0.5422 0.4384 0.0553  -0.0852 -0.0066 241 ARG A N     
1989 C CA    . ARG A 241 ? 0.3746 0.5351 0.4322 0.0530  -0.0887 -0.0097 241 ARG A CA    
1990 C C     . ARG A 241 ? 0.3580 0.5219 0.4227 0.0461  -0.0840 -0.0112 241 ARG A C     
1991 O O     . ARG A 241 ? 0.3134 0.4873 0.3906 0.0441  -0.0847 -0.0129 241 ARG A O     
1992 C CB    . ARG A 241 ? 0.3917 0.5555 0.4476 0.0534  -0.0963 -0.0116 241 ARG A CB    
1993 C CG    . ARG A 241 ? 0.4413 0.6072 0.4954 0.0606  -0.1032 -0.0110 241 ARG A CG    
1994 C CD    . ARG A 241 ? 0.4931 0.6596 0.5421 0.0611  -0.1117 -0.0134 241 ARG A CD    
1995 N NE    . ARG A 241 ? 0.5632 0.7402 0.6258 0.0552  -0.1161 -0.0169 241 ARG A NE    
1996 C CZ    . ARG A 241 ? 0.5715 0.7465 0.6298 0.0522  -0.1219 -0.0200 241 ARG A CZ    
1997 N NH1   . ARG A 241 ? 0.6253 0.7886 0.6651 0.0555  -0.1238 -0.0201 241 ARG A NH1   
1998 N NH2   . ARG A 241 ? 0.5809 0.7646 0.6525 0.0461  -0.1254 -0.0228 241 ARG A NH2   
1999 N N     . LEU A 242 ? 0.3409 0.4971 0.3981 0.0427  -0.0790 -0.0102 242 LEU A N     
2000 C CA    . LEU A 242 ? 0.3356 0.4943 0.3981 0.0371  -0.0744 -0.0113 242 LEU A CA    
2001 C C     . LEU A 242 ? 0.3376 0.4976 0.4060 0.0380  -0.0709 -0.0114 242 LEU A C     
2002 O O     . LEU A 242 ? 0.3123 0.4755 0.3857 0.0346  -0.0675 -0.0125 242 LEU A O     
2003 C CB    . LEU A 242 ? 0.3353 0.4869 0.3891 0.0336  -0.0705 -0.0096 242 LEU A CB    
2004 C CG    . LEU A 242 ? 0.3567 0.5065 0.4035 0.0327  -0.0717 -0.0090 242 LEU A CG    
2005 C CD1   . LEU A 242 ? 0.3791 0.5230 0.4189 0.0306  -0.0670 -0.0058 242 LEU A CD1   
2006 C CD2   . LEU A 242 ? 0.3401 0.4959 0.3922 0.0294  -0.0727 -0.0117 242 LEU A CD2   
2007 N N     . SER A 243 ? 0.3484 0.5049 0.4145 0.0435  -0.0715 -0.0101 243 SER A N     
2008 C CA    . SER A 243 ? 0.3428 0.4993 0.4127 0.0465  -0.0682 -0.0101 243 SER A CA    
2009 C C     . SER A 243 ? 0.3263 0.4945 0.4076 0.0512  -0.0710 -0.0101 243 SER A C     
2010 O O     . SER A 243 ? 0.3251 0.4950 0.4058 0.0556  -0.0756 -0.0091 243 SER A O     
2011 C CB    . SER A 243 ? 0.3800 0.5232 0.4390 0.0501  -0.0665 -0.0082 243 SER A CB    
2012 O OG    . SER A 243 ? 0.4031 0.5453 0.4641 0.0551  -0.0640 -0.0083 243 SER A OG    
2013 N N     . PRO A 244 ? 0.3183 0.4951 0.4102 0.0505  -0.0681 -0.0108 244 PRO A N     
2014 C CA    . PRO A 244 ? 0.3138 0.5039 0.4193 0.0548  -0.0698 -0.0099 244 PRO A CA    
2015 C C     . PRO A 244 ? 0.3266 0.5143 0.4293 0.0637  -0.0704 -0.0078 244 PRO A C     
2016 O O     . PRO A 244 ? 0.2960 0.4957 0.4093 0.0680  -0.0739 -0.0064 244 PRO A O     
2017 C CB    . PRO A 244 ? 0.3056 0.5012 0.4191 0.0535  -0.0638 -0.0100 244 PRO A CB    
2018 C CG    . PRO A 244 ? 0.3263 0.5108 0.4292 0.0486  -0.0600 -0.0116 244 PRO A CG    
2019 C CD    . PRO A 244 ? 0.3230 0.4995 0.4160 0.0451  -0.0636 -0.0121 244 PRO A CD    
2020 N N     . HIS A 245 ? 0.3334 0.5057 0.4220 0.0664  -0.0672 -0.0073 245 HIS A N     
2021 C CA    . HIS A 245 ? 0.3430 0.5095 0.4261 0.0753  -0.0670 -0.0052 245 HIS A CA    
2022 C C     . HIS A 245 ? 0.3652 0.5197 0.4350 0.0763  -0.0702 -0.0041 245 HIS A C     
2023 O O     . HIS A 245 ? 0.3324 0.4772 0.3935 0.0831  -0.0694 -0.0022 245 HIS A O     
2024 C CB    . HIS A 245 ? 0.3429 0.4986 0.4189 0.0788  -0.0604 -0.0052 245 HIS A CB    
2025 C CG    . HIS A 245 ? 0.3514 0.5162 0.4371 0.0779  -0.0560 -0.0060 245 HIS A CG    
2026 N ND1   . HIS A 245 ? 0.3855 0.5679 0.4872 0.0818  -0.0558 -0.0042 245 HIS A ND1   
2027 C CD2   . HIS A 245 ? 0.3403 0.4991 0.4217 0.0738  -0.0515 -0.0079 245 HIS A CD2   
2028 C CE1   . HIS A 245 ? 0.3515 0.5379 0.4582 0.0803  -0.0505 -0.0047 245 HIS A CE1   
2029 N NE2   . HIS A 245 ? 0.3618 0.5337 0.4556 0.0758  -0.0480 -0.0071 245 HIS A NE2   
2030 N N     . ARG A 246 ? 0.4074 0.5622 0.4752 0.0701  -0.0733 -0.0051 246 ARG A N     
2031 C CA    . ARG A 246 ? 0.4444 0.5889 0.4997 0.0707  -0.0757 -0.0036 246 ARG A CA    
2032 C C     . ARG A 246 ? 0.4676 0.5939 0.5092 0.0713  -0.0712 -0.0018 246 ARG A C     
2033 O O     . ARG A 246 ? 0.4882 0.6052 0.5198 0.0754  -0.0722 0.0008  246 ARG A O     
2034 C CB    . ARG A 246 ? 0.4654 0.6159 0.5217 0.0778  -0.0819 -0.0022 246 ARG A CB    
2035 C CG    . ARG A 246 ? 0.4726 0.6412 0.5437 0.0767  -0.0878 -0.0040 246 ARG A CG    
2036 C CD    . ARG A 246 ? 0.4877 0.6576 0.5577 0.0693  -0.0908 -0.0062 246 ARG A CD    
2037 N NE    . ARG A 246 ? 0.5182 0.7031 0.6016 0.0673  -0.0972 -0.0082 246 ARG A NE    
2038 C CZ    . ARG A 246 ? 0.4902 0.6855 0.5874 0.0619  -0.0959 -0.0098 246 ARG A CZ    
2039 N NH1   . ARG A 246 ? 0.4113 0.6041 0.5101 0.0587  -0.0884 -0.0098 246 ARG A NH1   
2040 N NH2   . ARG A 246 ? 0.4262 0.6341 0.5355 0.0595  -0.1024 -0.0113 246 ARG A NH2   
2041 N N     . LYS A 247 ? 0.4710 0.5919 0.5120 0.0672  -0.0665 -0.0031 247 LYS A N     
2042 C CA    . LYS A 247 ? 0.5009 0.6039 0.5296 0.0655  -0.0630 -0.0020 247 LYS A CA    
2043 C C     . LYS A 247 ? 0.4933 0.5938 0.5212 0.0559  -0.0612 -0.0031 247 LYS A C     
2044 O O     . LYS A 247 ? 0.4641 0.5730 0.4994 0.0519  -0.0603 -0.0056 247 LYS A O     
2045 C CB    . LYS A 247 ? 0.5401 0.6346 0.5652 0.0709  -0.0598 -0.0025 247 LYS A CB    
2046 C CG    . LYS A 247 ? 0.5859 0.6586 0.5964 0.0698  -0.0574 -0.0012 247 LYS A CG    
2047 C CD    . LYS A 247 ? 0.6397 0.7006 0.6436 0.0753  -0.0543 -0.0024 247 LYS A CD    
2048 C CE    . LYS A 247 ? 0.6516 0.6890 0.6409 0.0720  -0.0527 -0.0018 247 LYS A CE    
2049 N NZ    . LYS A 247 ? 0.6527 0.6791 0.6333 0.0761  -0.0531 0.0023  247 LYS A NZ    
2050 N N     . THR A 248 ? 0.5038 0.5933 0.5231 0.0524  -0.0603 -0.0006 248 THR A N     
2051 C CA    . THR A 248 ? 0.5211 0.6084 0.5401 0.0434  -0.0586 -0.0008 248 THR A CA    
2052 C C     . THR A 248 ? 0.5771 0.6470 0.5865 0.0404  -0.0566 0.0014  248 THR A C     
2053 O O     . THR A 248 ? 0.5942 0.6528 0.5959 0.0453  -0.0562 0.0037  248 THR A O     
2054 C CB    . THR A 248 ? 0.4954 0.5907 0.5166 0.0401  -0.0596 0.0010  248 THR A CB    
2055 O OG1   . THR A 248 ? 0.4666 0.5546 0.4799 0.0434  -0.0598 0.0051  248 THR A OG1   
2056 C CG2   . THR A 248 ? 0.4414 0.5515 0.4710 0.0420  -0.0623 -0.0015 248 THR A CG2   
2057 N N     . ARG A 249 ? 0.6144 0.6825 0.6248 0.0321  -0.0556 0.0008  249 ARG A N     
2058 C CA    . ARG A 249 ? 0.6823 0.7355 0.6860 0.0266  -0.0545 0.0031  249 ARG A CA    
2059 C C     . ARG A 249 ? 0.7001 0.7600 0.7087 0.0183  -0.0539 0.0058  249 ARG A C     
2060 O O     . ARG A 249 ? 0.6632 0.7347 0.6787 0.0146  -0.0544 0.0036  249 ARG A O     
2061 C CB    . ARG A 249 ? 0.7080 0.7502 0.7073 0.0249  -0.0547 -0.0007 249 ARG A CB    
2062 C CG    . ARG A 249 ? 0.7882 0.8126 0.7800 0.0183  -0.0547 0.0010  249 ARG A CG    
2063 C CD    . ARG A 249 ? 0.8776 0.8848 0.8594 0.0212  -0.0551 -0.0027 249 ARG A CD    
2064 N NE    . ARG A 249 ? 0.9641 0.9634 0.9390 0.0317  -0.0537 -0.0016 249 ARG A NE    
2065 C CZ    . ARG A 249 ? 1.0127 1.0020 0.9799 0.0391  -0.0530 -0.0046 249 ARG A CZ    
2066 N NH1   . ARG A 249 ? 1.0217 1.0062 0.9855 0.0374  -0.0535 -0.0093 249 ARG A NH1   
2067 N NH2   . ARG A 249 ? 1.0387 1.0229 1.0008 0.0491  -0.0516 -0.0028 249 ARG A NH2   
2068 N N     . VAL A 250 ? 0.7719 0.8248 0.7770 0.0158  -0.0523 0.0111  250 VAL A N     
2069 C CA    . VAL A 250 ? 0.8456 0.9045 0.8559 0.0080  -0.0509 0.0148  250 VAL A CA    
2070 C C     . VAL A 250 ? 0.9219 0.9717 0.9324 -0.0008 -0.0518 0.0143  250 VAL A C     
2071 O O     . VAL A 250 ? 0.9232 0.9599 0.9296 -0.0045 -0.0509 0.0180  250 VAL A O     
2072 C CB    . VAL A 250 ? 0.8528 0.9102 0.8600 0.0099  -0.0481 0.0216  250 VAL A CB    
2073 C CG1   . VAL A 250 ? 0.8545 0.9211 0.8686 0.0029  -0.0458 0.0262  250 VAL A CG1   
2074 C CG2   . VAL A 250 ? 0.8329 0.8970 0.8375 0.0193  -0.0488 0.0210  250 VAL A CG2   
2075 N N     . LYS A 251 ? 1.0248 1.0812 1.0398 -0.0042 -0.0539 0.0097  251 LYS A N     
2076 C CA    . LYS A 251 ? 1.1429 1.1892 1.1556 -0.0106 -0.0565 0.0066  251 LYS A CA    
2077 C C     . LYS A 251 ? 1.2080 1.2548 1.2261 -0.0215 -0.0573 0.0105  251 LYS A C     
2078 O O     . LYS A 251 ? 1.2051 1.2628 1.2303 -0.0237 -0.0549 0.0160  251 LYS A O     
2079 C CB    . LYS A 251 ? 1.1366 1.1903 1.1509 -0.0090 -0.0583 0.0004  251 LYS A CB    
2080 C CG    . LYS A 251 ? 1.1722 1.2103 1.1777 -0.0095 -0.0608 -0.0047 251 LYS A CG    
2081 C CD    . LYS A 251 ? 1.1629 1.2092 1.1700 -0.0089 -0.0621 -0.0098 251 LYS A CD    
2082 C CE    . LYS A 251 ? 1.1788 1.2078 1.1745 -0.0084 -0.0645 -0.0149 251 LYS A CE    
2083 N NZ    . LYS A 251 ? 1.1455 1.1813 1.1411 -0.0071 -0.0654 -0.0195 251 LYS A NZ    
2084 N N     . VAL A 252 ? 1.2996 1.3344 1.3142 -0.0280 -0.0608 0.0078  252 VAL A N     
2085 C CA    . VAL A 252 ? 1.3892 1.4250 1.4105 -0.0397 -0.0632 0.0107  252 VAL A CA    
2086 C C     . VAL A 252 ? 1.4473 1.4784 1.4658 -0.0445 -0.0689 0.0042  252 VAL A C     
2087 O O     . VAL A 252 ? 1.4702 1.4844 1.4769 -0.0414 -0.0709 -0.0012 252 VAL A O     
2088 C CB    . VAL A 252 ? 1.4122 1.4331 1.4314 -0.0451 -0.0620 0.0166  252 VAL A CB    
2089 C CG1   . VAL A 252 ? 1.4412 1.4367 1.4458 -0.0421 -0.0634 0.0129  252 VAL A CG1   
2090 C CG2   . VAL A 252 ? 1.4128 1.4377 1.4423 -0.0583 -0.0647 0.0205  252 VAL A CG2   
2091 N N     . ILE A 253 ? 1.4965 1.5425 1.5249 -0.0511 -0.0713 0.0048  253 ILE A N     
2092 C CA    . ILE A 253 ? 1.5541 1.5977 1.5798 -0.0555 -0.0773 -0.0011 253 ILE A CA    
2093 C C     . ILE A 253 ? 1.6055 1.6380 1.6323 -0.0678 -0.0830 0.0000  253 ILE A C     
2094 O O     . ILE A 253 ? 1.6089 1.6504 1.6478 -0.0756 -0.0824 0.0069  253 ILE A O     
2095 C CB    . ILE A 253 ? 1.5350 1.6010 1.5700 -0.0549 -0.0775 -0.0016 253 ILE A CB    
2096 C CG1   . ILE A 253 ? 1.5157 1.5928 1.5514 -0.0443 -0.0719 -0.0018 253 ILE A CG1   
2097 C CG2   . ILE A 253 ? 1.5406 1.6032 1.5702 -0.0574 -0.0836 -0.0081 253 ILE A CG2   
2098 C CD1   . ILE A 253 ? 1.5163 1.5844 1.5411 -0.0354 -0.0713 -0.0081 253 ILE A CD1   
2099 N N     . GLU A 254 ? 1.6593 1.6722 1.6734 -0.0694 -0.0883 -0.0066 254 GLU A N     
2100 C CA    . GLU A 254 ? 1.7127 1.7116 1.7256 -0.0817 -0.0953 -0.0069 254 GLU A CA    
2101 C C     . GLU A 254 ? 1.7311 1.7334 1.7434 -0.0872 -0.1034 -0.0124 254 GLU A C     
2102 O O     . GLU A 254 ? 1.7397 1.7308 1.7375 -0.0814 -0.1060 -0.0201 254 GLU A O     
2103 C CB    . GLU A 254 ? 1.7411 1.7096 1.7372 -0.0802 -0.0960 -0.0099 254 GLU A CB    
2104 C CG    . GLU A 254 ? 1.7536 1.7157 1.7510 -0.0785 -0.0897 -0.0031 254 GLU A CG    
2105 C CD    . GLU A 254 ? 1.7891 1.7196 1.7710 -0.0799 -0.0915 -0.0050 254 GLU A CD    
2106 O OE1   . GLU A 254 ? 1.8067 1.7201 1.7799 -0.0867 -0.0988 -0.0104 254 GLU A OE1   
2107 O OE2   . GLU A 254 ? 1.7965 1.7181 1.7738 -0.0740 -0.0857 -0.0012 254 GLU A OE2   
2108 N N     . ASN A 255 ? 1.7411 1.7593 1.7690 -0.0978 -0.1072 -0.0080 255 ASN A N     
2109 C CA    . ASN A 255 ? 1.7492 1.7754 1.7790 -0.1029 -0.1154 -0.0123 255 ASN A CA    
2110 C C     . ASN A 255 ? 1.7620 1.7914 1.8036 -0.1187 -0.1238 -0.0092 255 ASN A C     
2111 O O     . ASN A 255 ? 1.7893 1.7968 1.8212 -0.1261 -0.1316 -0.0137 255 ASN A O     
2112 C CB    . ASN A 255 ? 1.7269 1.7784 1.7642 -0.0953 -0.1116 -0.0116 255 ASN A CB    
2113 C CG    . ASN A 255 ? 1.7068 1.7827 1.7634 -0.0967 -0.1056 -0.0021 255 ASN A CG    
2114 O OD1   . ASN A 255 ? 1.6953 1.7906 1.7654 -0.1020 -0.1083 0.0014  255 ASN A OD1   
2115 N ND2   . ASN A 255 ? 1.6995 1.7740 1.7566 -0.0911 -0.0975 0.0022  255 ASN A ND2   
2116 N N     . MET A 256 ? 1.7431 1.7990 1.8054 -0.1236 -0.1224 -0.0016 256 MET A N     
2117 C CA    . MET A 256 ? 1.7435 1.8089 1.8202 -0.1380 -0.1311 0.0015  256 MET A CA    
2118 C C     . MET A 256 ? 1.7195 1.8114 1.8211 -0.1435 -0.1261 0.0133  256 MET A C     
2119 O O     . MET A 256 ? 1.7296 1.8271 1.8454 -0.1569 -0.1319 0.0180  256 MET A O     
2120 C CB    . MET A 256 ? 1.7447 1.8173 1.8176 -0.1377 -0.1397 -0.0053 256 MET A CB    
2121 C CG    . MET A 256 ? 1.7648 1.8351 1.8431 -0.1525 -0.1529 -0.0068 256 MET A CG    
2122 S SD    . MET A 256 ? 1.7726 1.8339 1.8325 -0.1497 -0.1645 -0.0188 256 MET A SD    
2123 C CE    . MET A 256 ? 1.7365 1.8304 1.8056 -0.1386 -0.1587 -0.0161 256 MET A CE    
2124 N N     . TYR A 257 ? 1.6820 1.7895 1.7884 -0.1333 -0.1157 0.0183  257 TYR A N     
2125 C CA    . TYR A 257 ? 1.6477 1.7818 1.7756 -0.1358 -0.1101 0.0294  257 TYR A CA    
2126 C C     . TYR A 257 ? 1.6201 1.7543 1.7510 -0.1311 -0.0989 0.0374  257 TYR A C     
2127 O O     . TYR A 257 ? 1.6151 1.7540 1.7595 -0.1394 -0.0968 0.0463  257 TYR A O     
2128 C CB    . TYR A 257 ? 1.6377 1.7967 1.7720 -0.1289 -0.1090 0.0295  257 TYR A CB    
2129 C CG    . TYR A 257 ? 1.6531 1.8157 1.7863 -0.1334 -0.1200 0.0232  257 TYR A CG    
2130 C CD1   . TYR A 257 ? 1.6556 1.8103 1.7720 -0.1244 -0.1221 0.0138  257 TYR A CD1   
2131 C CD2   . TYR A 257 ? 1.6575 1.8318 1.8066 -0.1464 -0.1283 0.0270  257 TYR A CD2   
2132 C CE1   . TYR A 257 ? 1.6534 1.8104 1.7666 -0.1275 -0.1320 0.0081  257 TYR A CE1   
2133 C CE2   . TYR A 257 ? 1.6600 1.8374 1.8069 -0.1501 -0.1394 0.0209  257 TYR A CE2   
2134 C CZ    . TYR A 257 ? 1.6582 1.8262 1.7861 -0.1401 -0.1411 0.0113  257 TYR A CZ    
2135 O OH    . TYR A 257 ? 1.6554 1.8255 1.7791 -0.1427 -0.1519 0.0054  257 TYR A OH    
2136 N N     . GLY A 258 ? 1.5894 1.7190 1.7081 -0.1179 -0.0918 0.0347  258 GLY A N     
2137 C CA    . GLY A 258 ? 1.5537 1.6860 1.6740 -0.1114 -0.0814 0.0420  258 GLY A CA    
2138 C C     . GLY A 258 ? 1.5372 1.6482 1.6403 -0.1028 -0.0774 0.0382  258 GLY A C     
2139 O O     . GLY A 258 ? 1.5457 1.6379 1.6348 -0.1014 -0.0820 0.0297  258 GLY A O     
2140 N N     . SER A 259 ? 1.5087 1.6232 1.6124 -0.0961 -0.0687 0.0446  259 SER A N     
2141 C CA    . SER A 259 ? 1.4841 1.5806 1.5731 -0.0877 -0.0646 0.0426  259 SER A CA    
2142 C C     . SER A 259 ? 1.4386 1.5451 1.5241 -0.0749 -0.0576 0.0438  259 SER A C     
2143 O O     . SER A 259 ? 1.4337 1.5468 1.5233 -0.0723 -0.0510 0.0519  259 SER A O     
2144 C CB    . SER A 259 ? 1.5075 1.5902 1.5971 -0.0936 -0.0619 0.0495  259 SER A CB    
2145 O OG    . SER A 259 ? 1.4884 1.5871 1.5914 -0.0956 -0.0555 0.0605  259 SER A OG    
2146 N N     . ARG A 260 ? 1.3853 1.4919 1.4627 -0.0671 -0.0592 0.0359  260 ARG A N     
2147 C CA    . ARG A 260 ? 1.3302 1.4455 1.4041 -0.0559 -0.0543 0.0358  260 ARG A CA    
2148 C C     . ARG A 260 ? 1.2859 1.3862 1.3464 -0.0472 -0.0532 0.0314  260 ARG A C     
2149 O O     . ARG A 260 ? 1.3062 1.3887 1.3593 -0.0490 -0.0554 0.0290  260 ARG A O     
2150 C CB    . ARG A 260 ? 1.3299 1.4604 1.4075 -0.0535 -0.0560 0.0316  260 ARG A CB    
2151 C CG    . ARG A 260 ? 1.3507 1.4737 1.4212 -0.0528 -0.0615 0.0223  260 ARG A CG    
2152 C CD    . ARG A 260 ? 1.3696 1.5083 1.4458 -0.0529 -0.0634 0.0202  260 ARG A CD    
2153 N NE    . ARG A 260 ? 1.3935 1.5272 1.4615 -0.0483 -0.0659 0.0120  260 ARG A NE    
2154 C CZ    . ARG A 260 ? 1.3996 1.5402 1.4655 -0.0405 -0.0632 0.0096  260 ARG A CZ    
2155 N NH1   . ARG A 260 ? 1.3943 1.5457 1.4642 -0.0362 -0.0585 0.0138  260 ARG A NH1   
2156 N NH2   . ARG A 260 ? 1.3935 1.5293 1.4528 -0.0368 -0.0650 0.0030  260 ARG A NH2   
2157 N N     . GLU A 261 ? 1.1965 1.3037 1.2537 -0.0377 -0.0501 0.0305  261 GLU A N     
2158 C CA    . GLU A 261 ? 1.0998 1.1966 1.1464 -0.0289 -0.0498 0.0263  261 GLU A CA    
2159 C C     . GLU A 261 ? 1.0021 1.1087 1.0477 -0.0214 -0.0499 0.0215  261 GLU A C     
2160 O O     . GLU A 261 ? 0.9676 1.0844 1.0149 -0.0173 -0.0470 0.0242  261 GLU A O     
2161 C CB    . GLU A 261 ? 1.1255 1.2143 1.1667 -0.0249 -0.0459 0.0320  261 GLU A CB    
2162 C CG    . GLU A 261 ? 1.1274 1.1970 1.1625 -0.0281 -0.0468 0.0328  261 GLU A CG    
2163 C CD    . GLU A 261 ? 1.1203 1.1828 1.1516 -0.0257 -0.0421 0.0405  261 GLU A CD    
2164 O OE1   . GLU A 261 ? 1.1213 1.1828 1.1453 -0.0162 -0.0401 0.0408  261 GLU A OE1   
2165 O OE2   . GLU A 261 ? 1.0897 1.1473 1.1250 -0.0335 -0.0405 0.0464  261 GLU A OE2   
2166 N N     . ILE A 262 ? 0.8928 0.9951 0.9350 -0.0197 -0.0530 0.0146  262 ILE A N     
2167 C CA    . ILE A 262 ? 0.7842 0.8940 0.8261 -0.0133 -0.0531 0.0101  262 ILE A CA    
2168 C C     . ILE A 262 ? 0.7110 0.8124 0.7462 -0.0058 -0.0532 0.0076  262 ILE A C     
2169 O O     . ILE A 262 ? 0.7058 0.7942 0.7353 -0.0053 -0.0535 0.0084  262 ILE A O     
2170 C CB    . ILE A 262 ? 0.7834 0.8965 0.8271 -0.0156 -0.0556 0.0048  262 ILE A CB    
2171 C CG1   . ILE A 262 ? 0.8110 0.9097 0.8476 -0.0151 -0.0580 0.0002  262 ILE A CG1   
2172 C CG2   . ILE A 262 ? 0.7885 0.9100 0.8389 -0.0231 -0.0566 0.0072  262 ILE A CG2   
2173 C CD1   . ILE A 262 ? 0.8119 0.9129 0.8469 -0.0111 -0.0587 -0.0055 262 ILE A CD1   
2174 N N     . ILE A 263 ? 0.6200 0.7291 0.6563 -0.0001 -0.0532 0.0047  263 ILE A N     
2175 C CA    . ILE A 263 ? 0.5543 0.6591 0.5868 0.0072  -0.0539 0.0028  263 ILE A CA    
2176 C C     . ILE A 263 ? 0.5167 0.6217 0.5501 0.0096  -0.0549 -0.0025 263 ILE A C     
2177 O O     . ILE A 263 ? 0.5078 0.6220 0.5461 0.0086  -0.0548 -0.0049 263 ILE A O     
2178 C CB    . ILE A 263 ? 0.5471 0.6601 0.5805 0.0122  -0.0537 0.0038  263 ILE A CB    
2179 C CG1   . ILE A 263 ? 0.5351 0.6490 0.5666 0.0109  -0.0516 0.0094  263 ILE A CG1   
2180 C CG2   . ILE A 263 ? 0.5156 0.6250 0.5459 0.0195  -0.0554 0.0024  263 ILE A CG2   
2181 C CD1   . ILE A 263 ? 0.5293 0.6316 0.5549 0.0111  -0.0504 0.0138  263 ILE A CD1   
2182 N N     . THR A 264 ? 0.4959 0.5902 0.5239 0.0133  -0.0553 -0.0038 264 THR A N     
2183 C CA    . THR A 264 ? 0.4890 0.5837 0.5174 0.0178  -0.0553 -0.0079 264 THR A CA    
2184 C C     . THR A 264 ? 0.4639 0.5663 0.4962 0.0247  -0.0557 -0.0079 264 THR A C     
2185 O O     . THR A 264 ? 0.4835 0.5807 0.5121 0.0292  -0.0563 -0.0059 264 THR A O     
2186 C CB    . THR A 264 ? 0.5121 0.5905 0.5316 0.0195  -0.0553 -0.0093 264 THR A CB    
2187 O OG1   . THR A 264 ? 0.5666 0.6368 0.5825 0.0118  -0.0563 -0.0093 264 THR A OG1   
2188 C CG2   . THR A 264 ? 0.4936 0.5727 0.5127 0.0251  -0.0543 -0.0131 264 THR A CG2   
2189 N N     . LEU A 265 ? 0.4398 0.5544 0.4796 0.0254  -0.0556 -0.0098 265 LEU A N     
2190 C CA    . LEU A 265 ? 0.3974 0.5207 0.4431 0.0310  -0.0567 -0.0101 265 LEU A CA    
2191 C C     . LEU A 265 ? 0.3857 0.5088 0.4332 0.0360  -0.0552 -0.0120 265 LEU A C     
2192 O O     . LEU A 265 ? 0.3901 0.5180 0.4415 0.0350  -0.0533 -0.0139 265 LEU A O     
2193 C CB    . LEU A 265 ? 0.3779 0.5138 0.4313 0.0283  -0.0573 -0.0109 265 LEU A CB    
2194 C CG    . LEU A 265 ? 0.3633 0.5010 0.4149 0.0246  -0.0581 -0.0091 265 LEU A CG    
2195 C CD1   . LEU A 265 ? 0.3713 0.5194 0.4295 0.0232  -0.0586 -0.0106 265 LEU A CD1   
2196 C CD2   . LEU A 265 ? 0.3439 0.4773 0.3902 0.0278  -0.0601 -0.0066 265 LEU A CD2   
2197 N N     . PHE A 266 ? 0.3963 0.5133 0.4402 0.0423  -0.0556 -0.0110 266 PHE A N     
2198 C CA    . PHE A 266 ? 0.4099 0.5259 0.4544 0.0487  -0.0534 -0.0121 266 PHE A CA    
2199 C C     . PHE A 266 ? 0.3912 0.5241 0.4490 0.0510  -0.0531 -0.0124 266 PHE A C     
2200 O O     . PHE A 266 ? 0.3665 0.5096 0.4318 0.0508  -0.0563 -0.0115 266 PHE A O     
2201 C CB    . PHE A 266 ? 0.4383 0.5446 0.4759 0.0559  -0.0537 -0.0103 266 PHE A CB    
2202 C CG    . PHE A 266 ? 0.5000 0.5866 0.5239 0.0546  -0.0526 -0.0104 266 PHE A CG    
2203 C CD1   . PHE A 266 ? 0.5181 0.5975 0.5371 0.0472  -0.0539 -0.0093 266 PHE A CD1   
2204 C CD2   . PHE A 266 ? 0.5763 0.6507 0.5919 0.0607  -0.0502 -0.0114 266 PHE A CD2   
2205 C CE1   . PHE A 266 ? 0.5186 0.5796 0.5262 0.0446  -0.0534 -0.0091 266 PHE A CE1   
2206 C CE2   . PHE A 266 ? 0.5952 0.6489 0.5970 0.0586  -0.0499 -0.0119 266 PHE A CE2   
2207 C CZ    . PHE A 266 ? 0.5936 0.6408 0.5922 0.0499  -0.0519 -0.0107 266 PHE A CZ    
2208 N N     . GLY A 267 ? 0.3785 0.5136 0.4387 0.0531  -0.0494 -0.0135 267 GLY A N     
2209 C CA    . GLY A 267 ? 0.3436 0.4948 0.4177 0.0548  -0.0480 -0.0131 267 GLY A CA    
2210 C C     . GLY A 267 ? 0.3502 0.5088 0.4298 0.0475  -0.0479 -0.0141 267 GLY A C     
2211 O O     . GLY A 267 ? 0.3264 0.4980 0.4182 0.0472  -0.0472 -0.0135 267 GLY A O     
2212 N N     . ILE A 268 ? 0.3286 0.4792 0.4000 0.0416  -0.0485 -0.0153 268 ILE A N     
2213 C CA    . ILE A 268 ? 0.3231 0.4789 0.3974 0.0357  -0.0477 -0.0162 268 ILE A CA    
2214 C C     . ILE A 268 ? 0.3285 0.4753 0.3934 0.0332  -0.0455 -0.0177 268 ILE A C     
2215 O O     . ILE A 268 ? 0.3647 0.4997 0.4198 0.0324  -0.0467 -0.0182 268 ILE A O     
2216 C CB    . ILE A 268 ? 0.2967 0.4553 0.3720 0.0307  -0.0513 -0.0156 268 ILE A CB    
2217 C CG1   . ILE A 268 ? 0.3222 0.4902 0.4066 0.0327  -0.0544 -0.0149 268 ILE A CG1   
2218 C CG2   . ILE A 268 ? 0.2957 0.4577 0.3719 0.0255  -0.0498 -0.0162 268 ILE A CG2   
2219 C CD1   . ILE A 268 ? 0.3261 0.4945 0.4086 0.0295  -0.0582 -0.0146 268 ILE A CD1   
2220 N N     . SER A 269 ? 0.2934 0.4452 0.3611 0.0319  -0.0427 -0.0184 269 SER A N     
2221 C CA    . SER A 269 ? 0.3006 0.4449 0.3592 0.0298  -0.0415 -0.0200 269 SER A CA    
2222 C C     . SER A 269 ? 0.2970 0.4453 0.3566 0.0234  -0.0430 -0.0198 269 SER A C     
2223 O O     . SER A 269 ? 0.2864 0.4434 0.3524 0.0223  -0.0413 -0.0192 269 SER A O     
2224 C CB    . SER A 269 ? 0.2962 0.4413 0.3541 0.0345  -0.0368 -0.0207 269 SER A CB    
2225 O OG    . SER A 269 ? 0.2895 0.4276 0.3427 0.0412  -0.0352 -0.0210 269 SER A OG    
2226 N N     . VAL A 270 ? 0.2951 0.4370 0.3487 0.0193  -0.0459 -0.0196 270 VAL A N     
2227 C CA    . VAL A 270 ? 0.2891 0.4354 0.3438 0.0139  -0.0472 -0.0185 270 VAL A CA    
2228 C C     . VAL A 270 ? 0.2928 0.4366 0.3422 0.0115  -0.0471 -0.0198 270 VAL A C     
2229 O O     . VAL A 270 ? 0.3159 0.4501 0.3577 0.0106  -0.0488 -0.0213 270 VAL A O     
2230 C CB    . VAL A 270 ? 0.3102 0.4532 0.3632 0.0108  -0.0499 -0.0165 270 VAL A CB    
2231 C CG1   . VAL A 270 ? 0.2878 0.4353 0.3414 0.0058  -0.0505 -0.0147 270 VAL A CG1   
2232 C CG2   . VAL A 270 ? 0.2331 0.3797 0.2905 0.0136  -0.0506 -0.0152 270 VAL A CG2   
2233 N N     . LEU A 271 ? 0.3147 0.4663 0.3672 0.0106  -0.0454 -0.0194 271 LEU A N     
2234 C CA    . LEU A 271 ? 0.3158 0.4673 0.3637 0.0087  -0.0457 -0.0202 271 LEU A CA    
2235 C C     . LEU A 271 ? 0.3266 0.4862 0.3784 0.0052  -0.0462 -0.0178 271 LEU A C     
2236 O O     . LEU A 271 ? 0.3202 0.4862 0.3750 0.0065  -0.0435 -0.0170 271 LEU A O     
2237 C CB    . LEU A 271 ? 0.3081 0.4606 0.3544 0.0130  -0.0419 -0.0215 271 LEU A CB    
2238 C CG    . LEU A 271 ? 0.3419 0.4888 0.3855 0.0185  -0.0394 -0.0230 271 LEU A CG    
2239 C CD1   . LEU A 271 ? 0.3301 0.4814 0.3750 0.0227  -0.0342 -0.0226 271 LEU A CD1   
2240 C CD2   . LEU A 271 ? 0.3240 0.4582 0.3562 0.0190  -0.0421 -0.0256 271 LEU A CD2   
2241 N N     . ASP A 272 ? 0.3098 0.4687 0.3613 0.0011  -0.0491 -0.0161 272 ASP A N     
2242 C CA    . ASP A 272 ? 0.2854 0.4523 0.3402 -0.0016 -0.0492 -0.0131 272 ASP A CA    
2243 C C     . ASP A 272 ? 0.2781 0.4496 0.3313 -0.0013 -0.0486 -0.0135 272 ASP A C     
2244 O O     . ASP A 272 ? 0.2793 0.4470 0.3277 -0.0026 -0.0510 -0.0154 272 ASP A O     
2245 C CB    . ASP A 272 ? 0.2989 0.4641 0.3540 -0.0062 -0.0521 -0.0108 272 ASP A CB    
2246 C CG    . ASP A 272 ? 0.3680 0.5423 0.4276 -0.0078 -0.0511 -0.0064 272 ASP A CG    
2247 O OD1   . ASP A 272 ? 0.3583 0.5395 0.4192 -0.0056 -0.0489 -0.0056 272 ASP A OD1   
2248 O OD2   . ASP A 272 ? 0.4407 0.6147 0.5021 -0.0109 -0.0521 -0.0033 272 ASP A OD2   
2249 N N     . TYR A 273 ? 0.2497 0.4278 0.3053 0.0007  -0.0457 -0.0120 273 TYR A N     
2250 C CA    . TYR A 273 ? 0.2448 0.4265 0.2979 0.0021  -0.0445 -0.0122 273 TYR A CA    
2251 C C     . TYR A 273 ? 0.2631 0.4491 0.3152 -0.0010 -0.0480 -0.0108 273 TYR A C     
2252 O O     . TYR A 273 ? 0.3023 0.4883 0.3499 0.0000  -0.0490 -0.0122 273 TYR A O     
2253 C CB    . TYR A 273 ? 0.2539 0.4402 0.3090 0.0050  -0.0403 -0.0106 273 TYR A CB    
2254 C CG    . TYR A 273 ? 0.2531 0.4390 0.3046 0.0082  -0.0376 -0.0116 273 TYR A CG    
2255 C CD1   . TYR A 273 ? 0.2685 0.4586 0.3165 0.0091  -0.0378 -0.0104 273 TYR A CD1   
2256 C CD2   . TYR A 273 ? 0.2829 0.4646 0.3345 0.0108  -0.0347 -0.0134 273 TYR A CD2   
2257 C CE1   . TYR A 273 ? 0.3437 0.5324 0.3868 0.0128  -0.0350 -0.0111 273 TYR A CE1   
2258 C CE2   . TYR A 273 ? 0.3159 0.4968 0.3638 0.0142  -0.0312 -0.0137 273 TYR A CE2   
2259 C CZ    . TYR A 273 ? 0.3453 0.5289 0.3880 0.0153  -0.0314 -0.0126 273 TYR A CZ    
2260 O OH    . TYR A 273 ? 0.4176 0.5994 0.4550 0.0195  -0.0276 -0.0125 273 TYR A OH    
2261 N N     . ILE A 274 ? 0.2455 0.4354 0.3019 -0.0046 -0.0499 -0.0079 274 ILE A N     
2262 C CA    . ILE A 274 ? 0.2543 0.4497 0.3123 -0.0087 -0.0539 -0.0060 274 ILE A CA    
2263 C C     . ILE A 274 ? 0.2501 0.4371 0.3028 -0.0116 -0.0588 -0.0099 274 ILE A C     
2264 O O     . ILE A 274 ? 0.2897 0.4794 0.3402 -0.0133 -0.0626 -0.0105 274 ILE A O     
2265 C CB    . ILE A 274 ? 0.2770 0.4790 0.3421 -0.0121 -0.0542 -0.0010 274 ILE A CB    
2266 C CG1   . ILE A 274 ? 0.2579 0.4686 0.3276 -0.0168 -0.0584 0.0018  274 ILE A CG1   
2267 C CG2   . ILE A 274 ? 0.2553 0.4488 0.3206 -0.0144 -0.0548 -0.0014 274 ILE A CG2   
2268 C CD1   . ILE A 274 ? 0.3638 0.5833 0.4421 -0.0197 -0.0573 0.0080  274 ILE A CD1   
2269 N N     . ASP A 275 ? 0.2838 0.4600 0.3332 -0.0116 -0.0590 -0.0126 275 ASP A N     
2270 C CA    . ASP A 275 ? 0.2870 0.4519 0.3288 -0.0134 -0.0633 -0.0167 275 ASP A CA    
2271 C C     . ASP A 275 ? 0.2963 0.4572 0.3294 -0.0083 -0.0623 -0.0203 275 ASP A C     
2272 O O     . ASP A 275 ? 0.3095 0.4660 0.3356 -0.0097 -0.0670 -0.0229 275 ASP A O     
2273 C CB    . ASP A 275 ? 0.3268 0.4806 0.3666 -0.0134 -0.0629 -0.0180 275 ASP A CB    
2274 C CG    . ASP A 275 ? 0.3896 0.5442 0.4353 -0.0190 -0.0648 -0.0145 275 ASP A CG    
2275 O OD1   . ASP A 275 ? 0.4533 0.6122 0.5023 -0.0249 -0.0688 -0.0127 275 ASP A OD1   
2276 O OD2   . ASP A 275 ? 0.4312 0.5828 0.4787 -0.0174 -0.0622 -0.0132 275 ASP A OD2   
2277 N N     . LEU A 276 ? 0.2813 0.4436 0.3148 -0.0026 -0.0565 -0.0203 276 LEU A N     
2278 C CA    . LEU A 276 ? 0.2752 0.4355 0.3018 0.0029  -0.0538 -0.0224 276 LEU A CA    
2279 C C     . LEU A 276 ? 0.3060 0.4732 0.3304 0.0025  -0.0559 -0.0214 276 LEU A C     
2280 O O     . LEU A 276 ? 0.3651 0.5274 0.3799 0.0047  -0.0581 -0.0240 276 LEU A O     
2281 C CB    . LEU A 276 ? 0.2595 0.4234 0.2906 0.0076  -0.0469 -0.0210 276 LEU A CB    
2282 C CG    . LEU A 276 ? 0.2713 0.4298 0.3046 0.0098  -0.0443 -0.0219 276 LEU A CG    
2283 C CD1   . LEU A 276 ? 0.1898 0.3546 0.2302 0.0126  -0.0388 -0.0199 276 LEU A CD1   
2284 C CD2   . LEU A 276 ? 0.2736 0.4214 0.2973 0.0136  -0.0441 -0.0252 276 LEU A CD2   
2285 N N     . TYR A 277 ? 0.2802 0.4586 0.3128 0.0006  -0.0553 -0.0175 277 TYR A N     
2286 C CA    . TYR A 277 ? 0.2642 0.4511 0.2960 0.0010  -0.0571 -0.0157 277 TYR A CA    
2287 C C     . TYR A 277 ? 0.2691 0.4547 0.2973 -0.0035 -0.0653 -0.0175 277 TYR A C     
2288 O O     . TYR A 277 ? 0.2834 0.4691 0.3041 -0.0012 -0.0679 -0.0190 277 TYR A O     
2289 C CB    . TYR A 277 ? 0.2254 0.4242 0.2665 0.0002  -0.0549 -0.0107 277 TYR A CB    
2290 C CG    . TYR A 277 ? 0.1982 0.4064 0.2385 0.0028  -0.0552 -0.0082 277 TYR A CG    
2291 C CD1   . TYR A 277 ? 0.2174 0.4258 0.2536 0.0090  -0.0496 -0.0074 277 TYR A CD1   
2292 C CD2   . TYR A 277 ? 0.1632 0.3804 0.2072 -0.0010 -0.0610 -0.0062 277 TYR A CD2   
2293 C CE1   . TYR A 277 ? 0.2323 0.4485 0.2665 0.0124  -0.0495 -0.0049 277 TYR A CE1   
2294 C CE2   . TYR A 277 ? 0.1989 0.4261 0.2425 0.0022  -0.0614 -0.0034 277 TYR A CE2   
2295 C CZ    . TYR A 277 ? 0.2081 0.4342 0.2460 0.0094  -0.0555 -0.0029 277 TYR A CZ    
2296 O OH    . TYR A 277 ? 0.2377 0.4727 0.2739 0.0135  -0.0556 0.0001  277 TYR A OH    
2297 N N     . LYS A 278 ? 0.2540 0.4377 0.2869 -0.0100 -0.0695 -0.0173 278 LYS A N     
2298 C CA    . LYS A 278 ? 0.2535 0.4356 0.2846 -0.0162 -0.0782 -0.0189 278 LYS A CA    
2299 C C     . LYS A 278 ? 0.2677 0.4343 0.2839 -0.0143 -0.0819 -0.0250 278 LYS A C     
2300 O O     . LYS A 278 ? 0.2890 0.4548 0.2991 -0.0160 -0.0887 -0.0272 278 LYS A O     
2301 C CB    . LYS A 278 ? 0.2624 0.4445 0.3023 -0.0239 -0.0809 -0.0166 278 LYS A CB    
2302 C CG    . LYS A 278 ? 0.3141 0.5117 0.3673 -0.0253 -0.0776 -0.0100 278 LYS A CG    
2303 C CD    . LYS A 278 ? 0.3374 0.5364 0.3995 -0.0332 -0.0807 -0.0068 278 LYS A CD    
2304 C CE    . LYS A 278 ? 0.3242 0.5399 0.3988 -0.0337 -0.0773 0.0005  278 LYS A CE    
2305 N NZ    . LYS A 278 ? 0.3069 0.5220 0.3892 -0.0392 -0.0768 0.0044  278 LYS A NZ    
2306 N N     . LYS A 279 ? 0.2546 0.4092 0.2645 -0.0102 -0.0775 -0.0277 279 LYS A N     
2307 C CA    . LYS A 279 ? 0.2842 0.4230 0.2786 -0.0066 -0.0795 -0.0332 279 LYS A CA    
2308 C C     . LYS A 279 ? 0.2787 0.4181 0.2634 0.0011  -0.0767 -0.0344 279 LYS A C     
2309 O O     . LYS A 279 ? 0.2616 0.3928 0.2332 0.0023  -0.0820 -0.0383 279 LYS A O     
2310 C CB    . LYS A 279 ? 0.2860 0.4131 0.2773 -0.0033 -0.0746 -0.0349 279 LYS A CB    
2311 C CG    . LYS A 279 ? 0.3115 0.4201 0.2856 0.0004  -0.0769 -0.0404 279 LYS A CG    
2312 C CD    . LYS A 279 ? 0.3041 0.4031 0.2759 0.0052  -0.0713 -0.0412 279 LYS A CD    
2313 C CE    . LYS A 279 ? 0.3001 0.3816 0.2531 0.0121  -0.0712 -0.0460 279 LYS A CE    
2314 N NZ    . LYS A 279 ? 0.3578 0.4242 0.2979 0.0074  -0.0806 -0.0507 279 LYS A NZ    
2315 N N     . PHE A 280 ? 0.2804 0.4282 0.2705 0.0062  -0.0687 -0.0312 280 PHE A N     
2316 C CA    . PHE A 280 ? 0.3074 0.4529 0.2878 0.0146  -0.0637 -0.0319 280 PHE A CA    
2317 C C     . PHE A 280 ? 0.3036 0.4598 0.2839 0.0166  -0.0640 -0.0293 280 PHE A C     
2318 O O     . PHE A 280 ? 0.3216 0.4742 0.2909 0.0235  -0.0612 -0.0301 280 PHE A O     
2319 C CB    . PHE A 280 ? 0.3164 0.4618 0.3013 0.0197  -0.0540 -0.0300 280 PHE A CB    
2320 C CG    . PHE A 280 ? 0.3094 0.4441 0.2921 0.0207  -0.0526 -0.0324 280 PHE A CG    
2321 C CD1   . PHE A 280 ? 0.2932 0.4315 0.2868 0.0208  -0.0473 -0.0301 280 PHE A CD1   
2322 C CD2   . PHE A 280 ? 0.4029 0.5231 0.3715 0.0221  -0.0567 -0.0369 280 PHE A CD2   
2323 C CE1   . PHE A 280 ? 0.3166 0.4461 0.3085 0.0226  -0.0459 -0.0318 280 PHE A CE1   
2324 C CE2   . PHE A 280 ? 0.4375 0.5471 0.4031 0.0242  -0.0548 -0.0387 280 PHE A CE2   
2325 C CZ    . PHE A 280 ? 0.3679 0.4831 0.3459 0.0246  -0.0492 -0.0359 280 PHE A CZ    
2326 N N     . SER A 281 ? 0.2668 0.4358 0.2585 0.0115  -0.0668 -0.0259 281 SER A N     
2327 C CA    . SER A 281 ? 0.2567 0.4371 0.2497 0.0145  -0.0658 -0.0224 281 SER A CA    
2328 C C     . SER A 281 ? 0.2746 0.4572 0.2601 0.0138  -0.0744 -0.0240 281 SER A C     
2329 O O     . SER A 281 ? 0.3173 0.5051 0.2980 0.0191  -0.0733 -0.0223 281 SER A O     
2330 C CB    . SER A 281 ? 0.2478 0.4417 0.2558 0.0113  -0.0636 -0.0173 281 SER A CB    
2331 O OG    . SER A 281 ? 0.2558 0.4574 0.2712 0.0043  -0.0712 -0.0161 281 SER A OG    
2332 N N     . PHE A 282 ? 0.3091 0.4871 0.2934 0.0071  -0.0835 -0.0272 282 PHE A N     
2333 C CA    . PHE A 282 ? 0.3293 0.5098 0.3082 0.0044  -0.0940 -0.0291 282 PHE A CA    
2334 C C     . PHE A 282 ? 0.3533 0.5534 0.3430 0.0036  -0.0958 -0.0237 282 PHE A C     
2335 O O     . PHE A 282 ? 0.3546 0.5594 0.3373 0.0078  -0.0993 -0.0236 282 PHE A O     
2336 C CB    . PHE A 282 ? 0.3528 0.5200 0.3108 0.0115  -0.0957 -0.0340 282 PHE A CB    
2337 C CG    . PHE A 282 ? 0.4192 0.5668 0.3655 0.0115  -0.0966 -0.0396 282 PHE A CG    
2338 C CD1   . PHE A 282 ? 0.4359 0.5734 0.3748 0.0053  -0.1078 -0.0446 282 PHE A CD1   
2339 C CD2   . PHE A 282 ? 0.3617 0.5008 0.3053 0.0173  -0.0864 -0.0397 282 PHE A CD2   
2340 C CE1   . PHE A 282 ? 0.4676 0.5849 0.3939 0.0061  -0.1082 -0.0498 282 PHE A CE1   
2341 C CE2   . PHE A 282 ? 0.3815 0.5030 0.3143 0.0183  -0.0866 -0.0443 282 PHE A CE2   
2342 C CZ    . PHE A 282 ? 0.4189 0.5286 0.3422 0.0132  -0.0972 -0.0494 282 PHE A CZ    
2343 N N     . THR A 283 ? 0.3552 0.5664 0.3614 -0.0007 -0.0928 -0.0189 283 THR A N     
2344 C CA    . THR A 283 ? 0.3902 0.6208 0.4094 -0.0028 -0.0949 -0.0131 283 THR A CA    
2345 C C     . THR A 283 ? 0.4088 0.6442 0.4415 -0.0132 -0.1001 -0.0115 283 THR A C     
2346 O O     . THR A 283 ? 0.4203 0.6451 0.4538 -0.0168 -0.0980 -0.0134 283 THR A O     
2347 C CB    . THR A 283 ? 0.3818 0.6203 0.4076 0.0028  -0.0843 -0.0077 283 THR A CB    
2348 O OG1   . THR A 283 ? 0.3795 0.6142 0.4129 -0.0006 -0.0794 -0.0069 283 THR A OG1   
2349 C CG2   . THR A 283 ? 0.3709 0.6019 0.3843 0.0124  -0.0772 -0.0088 283 THR A CG2   
2350 N N     . ASN A 284 ? 0.4061 0.6578 0.4499 -0.0179 -0.1066 -0.0076 284 ASN A N     
2351 C CA    . ASN A 284 ? 0.4072 0.6683 0.4679 -0.0265 -0.1079 -0.0030 284 ASN A CA    
2352 C C     . ASN A 284 ? 0.3949 0.6767 0.4689 -0.0232 -0.1028 0.0052  284 ASN A C     
2353 O O     . ASN A 284 ? 0.4159 0.7129 0.4945 -0.0218 -0.1070 0.0084  284 ASN A O     
2354 C CB    . ASN A 284 ? 0.4338 0.6951 0.4991 -0.0373 -0.1201 -0.0049 284 ASN A CB    
2355 C CG    . ASN A 284 ? 0.4893 0.7581 0.5723 -0.0466 -0.1200 0.0004  284 ASN A CG    
2356 O OD1   . ASN A 284 ? 0.4409 0.7102 0.5291 -0.0444 -0.1107 0.0040  284 ASN A OD1   
2357 N ND2   . ASN A 284 ? 0.4720 0.7462 0.5638 -0.0570 -0.1304 0.0011  284 ASN A ND2   
2358 N N     . GLN A 285 ? 0.3859 0.6673 0.4648 -0.0211 -0.0936 0.0084  285 GLN A N     
2359 C CA    . GLN A 285 ? 0.3395 0.6361 0.4274 -0.0161 -0.0867 0.0158  285 GLN A CA    
2360 C C     . GLN A 285 ? 0.3038 0.6151 0.4092 -0.0229 -0.0882 0.0224  285 GLN A C     
2361 O O     . GLN A 285 ? 0.3251 0.6301 0.4347 -0.0311 -0.0911 0.0213  285 GLN A O     
2362 C CB    . GLN A 285 ? 0.3094 0.5955 0.3912 -0.0099 -0.0763 0.0152  285 GLN A CB    
2363 C CG    . GLN A 285 ? 0.3596 0.6320 0.4263 -0.0036 -0.0738 0.0097  285 GLN A CG    
2364 C CD    . GLN A 285 ? 0.3786 0.6582 0.4405 0.0049  -0.0710 0.0121  285 GLN A CD    
2365 O OE1   . GLN A 285 ? 0.4036 0.6990 0.4722 0.0059  -0.0736 0.0168  285 GLN A OE1   
2366 N NE2   . GLN A 285 ? 0.3776 0.6457 0.4282 0.0113  -0.0652 0.0093  285 GLN A NE2   
2367 N N     . PRO A 286 ? 0.2905 0.6211 0.4059 -0.0191 -0.0855 0.0300  286 PRO A N     
2368 C CA    . PRO A 286 ? 0.2851 0.6317 0.4183 -0.0245 -0.0852 0.0378  286 PRO A CA    
2369 C C     . PRO A 286 ? 0.2753 0.6149 0.4093 -0.0233 -0.0763 0.0402  286 PRO A C     
2370 O O     . PRO A 286 ? 0.3010 0.6480 0.4475 -0.0291 -0.0758 0.0455  286 PRO A O     
2371 C CB    . PRO A 286 ? 0.2903 0.6582 0.4308 -0.0176 -0.0832 0.0450  286 PRO A CB    
2372 C CG    . PRO A 286 ? 0.2741 0.6330 0.3989 -0.0068 -0.0779 0.0417  286 PRO A CG    
2373 C CD    . PRO A 286 ? 0.2847 0.6237 0.3953 -0.0092 -0.0825 0.0322  286 PRO A CD    
2374 N N     . SER A 287 ? 0.2544 0.5796 0.3752 -0.0161 -0.0696 0.0363  287 SER A N     
2375 C CA    . SER A 287 ? 0.2330 0.5497 0.3520 -0.0142 -0.0621 0.0374  287 SER A CA    
2376 C C     . SER A 287 ? 0.2547 0.5507 0.3595 -0.0119 -0.0603 0.0296  287 SER A C     
2377 O O     . SER A 287 ? 0.2545 0.5446 0.3502 -0.0086 -0.0616 0.0249  287 SER A O     
2378 C CB    . SER A 287 ? 0.2111 0.5371 0.3311 -0.0051 -0.0537 0.0438  287 SER A CB    
2379 O OG    . SER A 287 ? 0.2656 0.5788 0.3782 -0.0013 -0.0469 0.0427  287 SER A OG    
2380 N N     . TYR A 288 ? 0.2468 0.5327 0.3503 -0.0133 -0.0569 0.0288  288 TYR A N     
2381 C CA    . TYR A 288 ? 0.2804 0.5491 0.3728 -0.0107 -0.0547 0.0224  288 TYR A CA    
2382 C C     . TYR A 288 ? 0.2892 0.5533 0.3783 -0.0052 -0.0474 0.0241  288 TYR A C     
2383 O O     . TYR A 288 ? 0.3210 0.5723 0.4045 -0.0050 -0.0462 0.0200  288 TYR A O     
2384 C CB    . TYR A 288 ? 0.3074 0.5642 0.3981 -0.0176 -0.0598 0.0175  288 TYR A CB    
2385 C CG    . TYR A 288 ? 0.2670 0.5223 0.3546 -0.0209 -0.0670 0.0133  288 TYR A CG    
2386 C CD1   . TYR A 288 ? 0.2822 0.5432 0.3770 -0.0288 -0.0742 0.0146  288 TYR A CD1   
2387 C CD2   . TYR A 288 ? 0.2704 0.5182 0.3473 -0.0159 -0.0666 0.0082  288 TYR A CD2   
2388 C CE1   . TYR A 288 ? 0.3325 0.5907 0.4224 -0.0316 -0.0818 0.0101  288 TYR A CE1   
2389 C CE2   . TYR A 288 ? 0.3123 0.5576 0.3838 -0.0176 -0.0731 0.0043  288 TYR A CE2   
2390 C CZ    . TYR A 288 ? 0.3425 0.5925 0.4197 -0.0253 -0.0811 0.0048  288 TYR A CZ    
2391 O OH    . TYR A 288 ? 0.4112 0.6571 0.4811 -0.0268 -0.0885 0.0003  288 TYR A OH    
2392 N N     . SER A 289 ? 0.2823 0.5567 0.3744 -0.0003 -0.0428 0.0301  289 SER A N     
2393 C CA    . SER A 289 ? 0.2935 0.5613 0.3788 0.0063  -0.0363 0.0308  289 SER A CA    
2394 C C     . SER A 289 ? 0.2928 0.5514 0.3685 0.0109  -0.0348 0.0257  289 SER A C     
2395 O O     . SER A 289 ? 0.3029 0.5648 0.3773 0.0118  -0.0367 0.0245  289 SER A O     
2396 C CB    . SER A 289 ? 0.3059 0.5855 0.3944 0.0118  -0.0312 0.0385  289 SER A CB    
2397 O OG    . SER A 289 ? 0.3667 0.6512 0.4516 0.0182  -0.